1YZXA

Crystal structure of human kappa class glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
218
structure length
218
Chain Sequence
LPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase kappa 1
publication title Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yzxA01
3D5JA 2OJLA 3LYPA 3DMLA 1LJRA 3ISOA 4K0NA 1QMVA 5C04A 2X64A 2C0EA 3LG6A 1GTBA 3ZIVA 4J2FA 1PL2A 3M9JA 2PVOC 4OD7A 3FZ9A 1PGTA 1WPIA 2B3SA 3FR9A 4YQUA 4GQCA 1A23A 1EP7A 1ERTA 4I8BA 4XTSA 3NOFA 1J9BA 1NM3A 2YANA 1FVJA 3E9JB 1TI3A 3GA4A 2D2ZA 1FAAA 2C3QA 2MMOA 3QDNA 1VGLA 4OWYA 3O6TA 3UOMA 2PN8A 4IBPA 5KN0A 2FLSA 5H5RA 3MWHA 4F82A 1WMJA 4DSQA 1F3AA 2B7KA 3L9SA 3RPPA 22GSA 4LMVA 4QL7A 2NBSA 2CV4A 1U3IA 1W89A 2CZ3A 2TRCP 1QFNA 5KN3A 1XFLA 3CMIA 3DIEA 1XOAA 1RQMA 5CYYA 3VPTA 5G31A 3ME7A 1AQXA 3N5OA 2H30A 4ECJA 4PUFC 3ZMLA 3Q6OA 2YWOA 4YQMA 2I3YA 2VOCA 4EKZA 5CO3A 2O7KA 3VK9A 3V1WA 5JWOB 3LEFA 4ZB9A 1BYEA 1SYXA 4IN0A 3ZYWA 1UA5A 2DBCA 2OADA 3VI7A 3GYKA 3C73A 3KJYA 4EUYA 2C1YA 1R26A 3HDCA 4NV2A 1ZZYA 2HLSA 2XBQA 1GWCA 5IMDA 1E6BA 3APQA 2LS5A 3HCZA 3I69A 1TK8B 4QQ7A 4KDXA 2KOKA 2H1BA 2GZYA 5IMCA 5HR1A 3O76A 3A2WA 4XS4B 2YJ7A 2GGTA 4HUAA 1SKRB 2NPBA 5E59A 2FWEA 1AW9A 4IELA 1YJ6A 3HJOA 3M9KA 3O3TA 3GH9A 4YQVA 4HOJA 4XS4A 4ZL8A 3IHQA 2A2SA 1ILOA 1OAZA 1U87A 2CX3A 2V2GA 1QUWA 4IQ1A 2YWNA 2DSAA 2DMMA 4MJEA 1SKWB 4N0ZA 3G7IA 11GSA 3HVSA 13GSA 3I6AA 1FOVA 3J7Yb 4K7IA 4YAVA 2JL4A 5FT3A 4ZL9A 2XPDA 1SK1A 2TIRA 5DALB 1SJZA 1Z7RA 3LFLA 1GP1A 4MA9A 2M72A 3IE3A 3KH7A 4IP1A 4KH7A 3ZMKA 1UC7A 2M46A 5EL8A 1V58A 4ZXGA 4EVMA 4G2EA 2H1GA 1JLWA 1ZCPA 5C00A 4ZILA 1PN9A 4MDCA 5DALA 4I5QA 3GX8A 4HZ2A 3GKXA 1T8EB 3JCML 1YEPA 2GSQA 5IO0A 2LTKA 1Y25A 2CVKA 1M9BA 1XZOA 2GT6A 1F6MC 3RBTA 5L71A 3EC3A 4ZBBA 3PGTA 2LRNA 4QL9A 2N5FA 4F9ZA 2YP6A 5JWRB 3GHAA 2R4VA 2FY6A 4PNGA 4ECCA 3UIWA 1DE1A 4AF2A 2V41A 2XPEA 4ECIA 2AUVA 4PURA 5DJLA 3H93A 1XPVA 5ABRA 3C8EA 5ECKB 4PQ1A 1X5CA 1SKSB 1K0BA 3H79A 1GTAA 2LJRA 5F8BA 3F4TA 1XCCA 2C3TA 2PVQA 4EL1A 2CZ2A 2GTUA 1TU7A 3HYPA 3VWVA 3GX0A 5DCHA 1PD21 1TW9A 1SK0A 4KB3A 1O6JA 1OE8A 2K8VA 1AAZA 4KCAA 5ID2B 2JZRA 3CXGA 3I9V2 3BOAA 6GSYA 4FYCA 1WIKA 4K9ZA 4MF5A 2V1MA 1MDJA 4BPYA 3VWWA 3AY8A 1Z6MA 3SWLA 1VF1A 2VO4A 1UN2A 4POMA 2I9HA 5A4WA 1G6WA 2H73A 4OO4A 1AIUA 1G7EA 2IJYA 5ID2A 5GSTA 1Y6EA 3Q19A 2NVLA 2B5EA 3WGDA 5ENUA 3VLNA 3ZIJA 3KXOA 4IVFA 2DJ3A 2WGRA 2B5XA 1YEXA 2WJUA 1XW9A 2OE0A 5IMVA 3GIXA 1NSWA 3M1GA 3J7Yk 3IPZA 5ECMB 4MH2A 2AJQB 4CDOA 1OC3A 4HI7A 2WRTA 3DEXA 3IAS2 4F0BA 2YCDA 3FYGA 12GSA 5DBQA 1MD4A 4DSRA 4MJBA 3I43A 3UJ1A 4BVXA 1GUKA 3DVXA 3UL3A 4K7OA 4WXTA 2K18A 4KAEA 1I9DA 1RW1A 4IP6A 4LMWA 4PXOA 5ECQB 1YF1A 2XC2A 3GMFA 2CAIA 4ZB8A 1ZYQB 2VCVA 3KEBA 3W8SA 3KIJA 3GTUB 1FB0A 2H1AA 2IMDA 3D22A 3ERGA 2DJ1A 1SENA 2I4AA 4MMMA 4O5RA 1BG5A 2PERA 4NPBA 4ML1A 3RDWA 3E0UA 1WE0A 2YV9A 2WB9A 3QCPA 5ECPB 3EINA 3IR4A 5B8AA 3GTUA 4KE3A 5D8IA 3D6IA 3KH9A 2BJXA 1CQGA 2DIZA 6GSTA 1K3LA 4GRFA 3FR3A 3A3TA 1OKDA 2LRTA 4J57E 2VCXA 1GRXA 2WDUA 1VF4A 4XCSA 6GSUA 5IOXA 4F03A 3ME8A 1B4PA 3ZVJD 3MSZA 3QAVA 2WFCA 2C0GA 3OR5A 4KCEA 2PBJA 3GKKA 3H8QA 3TJKA 2BMXA 5EY6A 4KX4A 2FWFA 2H19A 5CRHA 5ELAA 4D73B 3TRXA 3CSJA 4HZ4A 2LQQA 1CQHA 1SL2B 2F8FA 5IPHA 3IV4A 3BBYA 4N30A 1Z5YE 2VD0A 3K8NA 2XHFA 3DYRA 3TJFA 1FB6A 5GSSA 3TOTA 4LL1B 3TKSA 6GSXA 4D73A 2IWTA 4O92A 4K0GA 3FHKA 3EYTA 2X8HA 3GRXA 4ACSA 1GL8A 1TRUA 3G7YA 4JE1A 2V6KA 2YV7A 4MLYA 2YOIA 1MEKA 4G10A 14GSA 2F3MA 1T00A 4YH2A 19GSA 4BWQA 7GSSA 2E2MA 3RAZA 5HR3A 4Q5QA 1M2DA 2K8SA 4IGJA 2A2RA 1THXA 2PU9C 1PKZA 4TR3A 2F51A 3LSZA 4I97A 4BVYA 1TK0B 1KEBA 2H0GA 3F3RA 3P7XA 4NXIA 2QC7A 1PL1A 4MJAA 1WP0A 2C0FA 2HFDA 4ID0A 4RQXA 2A4VA 3TOUA 1TRWA 3IRAA 1GSQA 4PX1A 1HNCA 5G30A 3ZITA 2C3NA 2JADA 1EOHA 2E2GA 5DDLA 3GH6A 2HSHA 2VAFA 3CTGA 1THOA 2MBTA 3FEUA 1R5AA 3TJGA 3TDGA 4ZB6A 1KBNA 4MCUA 1X9MB 5KN1A 1AQWA 3HZ8A 5J41A 1ERWA 3GL5A 2C0DA 1XXUA 2ZUPA 5B7CA 2ES7A 3LWAA 3F4RA 1XVWA 2JU5A 2DMLA 3GN3A 3F6DA 5HR0A 5G1LA 3TKSE 1HNBA 1GSSA 3H4KA 2YNXA 4DEJA 1UVZA 1T4ZA 3WYWA 6GSVA 1T1VA 2GZPA 2DJ2A 2YPMA 5DVBA 3DVWA 5JWQB 1GTUA 3ZLPA 1G6YA 1K3YA 4IQAA 1GUMA 1OC8A 1XIYA 1M2BA 5IQYA 2DJKA 1M9AA 1OC9B 1LBKA 3IA1A 4F0CA 1E2YA 4I2TA 1USBA 4FYBA 3UBLA 1XVQA 3GNJA 4MF7A 3VPQA 1T4YA 1VRSD 4Z7XA 2EIRA 1OC9A 2WS2A 3F8UA 3P2AA 1ST9A 3VURA 1GSDA 1JZOA 3HJMA 1R5PA 1Z6NA 5B6MA 4L5OA 2L5OA 3G9BA 2RIIA 17GSA 1MTCA 3H1NA 3BCKA 3APOA 3CBUA 3GL3A 5A4UA 2R6KA 4JZQA 6GSWA 1HNAA 3ZTLA 1EOGA 2DJJA 1U6TA 1BQ7A 2C8UA 4FO5A 3C1RA 4TXOB 4PGTA 2H75A 3DGQA 1AC1A 3CSHA 5J9CA 2AB6A 4AJ7A 3D4MA 4HDEA 3PH9A 2H1DA 1K0NA 1WJKA 5A5KA 4TXOA 5CRDA 1Q4JA 10GSA 3F6FA 1XOBA 2H0IA 3KGKA 1TKDB 3UVHA 4MF6A 1T3BA 2FA8A 2HRFA 1JLVA 4RI7A 4ZBDA 4BL7A 2R3XA 2KHPA 2LSTA 4XRDA 3KM6A 1V98A 2REMA 3QOUA 2I81A 5LNKe 2AAWA 2X8CA 3GKNA 5IMAA 1SJIA 4K1FA 4POLA 2L59A 2PGTA 1S3DA 5FHIA 1RK4A 4TR4A 5H5SA 4JEDA 4MK3A 1YF0A 1A8YA 3SBCA 4I2UA 3FZ5A 2IMKA 3W6GA 4RUVA 4K7NA 2IMIA 4GSNA 3RHBA 2H0HA 4MPFA 5G2ZA 3ZL5A 4EDZA 4MZWA 1A0RP 2PPTA 1FHEA 1XWGA 2H6XA 1OYJA 4LLRA 2GT5A 2DLXA 1V57A 1TI1A 2LQOA 4IS0A 1GSFA 1IYHA 3L4NA 3NIVA 1SD9A 4EO3A 2VCWA 3M3MA 1ZYEA 2MZCA 1GNEA 2VIMA 3A2XA 1BX9A 4MJCA 4GLTA 4MPGA 1GLPA 1LU4A 2K6VA 3KCMA 2HZFA 1BAYA 5F0GA 4MH3A 5G1KA 2X99A 5AIVA 5IIZA 5J3RA 2VUPA 1XWCA 5CREA 4EC0A 5LCZA 1O81A 1JZDA 1V9WA 18GSA 1C72A 1F9MA 3HVXA 2JACA 1TJDA 3U5RE 1B8XA 4CW9A 2O85A 3C71A 2B6MA 2N5BA 3G7JA 2WZ9A 5D96A 4N11A 3IBHA 4K2DA 3QPMA 4GXZA 1JFUA 1Z9HA 2DJ0A 3FZAA 5IMZA 1OVNA 4TKYA 4KNDA 1M2AA 1ZOFA 1EV9A 4F2IA 4HS1A 5INYA 1O8WA 2HE3A 4IKHA 3LXTA 1DBYA 4H86A 5KEJA 3KMOA 5D9VA 1R4WA 4N10A 4TN8A 3DKSA 2LJAA 2RUFA 3BD2A 4FH8A 2MMZA 5ECIB 1FW1A 2OACA 1O7UA 2NTOA 2VLUA 3GUSA 4KUNA 5D9TA 3HY2A 3TJBA 3F0IA 5JCUA 4RI6A 5JCGA 3L0HA 5B6NA 2V32A 3WD6A 5ECRB 4V1Ap 3VWUA 1X0RA 4PUAA 3FKFA 2MMAA 4WR5A 1FO5A 1TRVA 4HU7A 3TUEA 4AGSA 3HXSA 3ZFLA 2J23A 5AISA 5GAPD 2C80A 3TRQA 2ZNMA 2VCQA 1U88A 4YAPA 4MP4A 3ZZXA 2Z9SA 4TVEA 1O8XA 1JZWA 1O85A 2H72A 1X5DA 2CA8A 2OBIA 4N0VA 2CVBA 2P5RA 2YWIA 1EZKA 5IOWA 2CVDA 2KUCA 5ECNB 4ZIJA 2H6ZA 1F2EA 1YKCA 4O7HA 1U3AA 2R37A 3GSSA 3NZNA 4FIWA 2WULA 3MAKA 2OBKA 1HD2A 1SU9A 4PQHA 4EDYA 4Q5RA 1IYIA 5F06A 1GULA 3A5WA 5IM9A 3CSIA 4ULXA 4WBJA 3UMAA 1NHYA 2JSZA 2FHEA 2L4QA 4KW6A 2B1KA 5EVOA 2K9FA 3CYNA 3LJRA 1F3BA 4GTUA 3EMPA 1ZMAA 2VCZA 1MDIA 4KDYA 4JRRA 1QQ2A 3FR6A 4EE0A 4KGIA 2IFQB 2L5LA 4ZBAA 2CX4A 2OE1A 1YKAA 2HSYA 2IL3A 2B1LA 1OKTA 3IXRA 20GSA 1B9XC 3UEMA 2LNTA 2QKEA 4OCFA 1WWJA 2IIYA 4XS1A 3PINA 5DCGA 4KSMA 1W4VA 1SL1B 8GSSA 2IFQA 2HXKA 4GF0A 4K8MA 1PMTA 1NHOA 5AGYA 1FVKA 3D4TA 1J08A 3IAM2 3Q74A 2QGVA 5CNWA 3RHCA 3FRCA 1XW6A 1S3AA 4IHUA 1V2AA 2FCHA 3DXBA 3MDKA 3UVTA 2H01A 1SYRA 4OFNA 1A2JA 1TP9A 2GQLA 4L5LA 1YDKA 1AUCA 2L4CA 4NHWA 5J5NA 4V2NA 1T7PB 3KP8A 1EEMA 2YZHA 5CP1A 2VLVA 4JR6A 5EPFA 1SK2A 1Z3EA 2G2QA 1X5EA 3S9FA 3LORA 1PA3A 3C1SA 4O32A 1YY7A 1URMA 5A4VA 2LEGA 1FG4A 4HJ2A 1K0MA 2RLIA 2J9HA 3WGEA 4BA7A 2GVPA 1XWKA 4NMUA 2FWGA 3EU3A 3QFAC 2C4JA 4TRXA 5HFGA 4DSSB 2AYTA 1TTZA 2LNSA 1WRYA 1K0OA 1VF3A 1DE2A 3HA9A 1EV4A 2H70A 5FWGA 1EEJA 2O8VB 1K0AA 4L8EA 4TR0A 3KTBA 2HI7A 3HZ4A 1PQNA 4DSSA 2KP2A 1A0FA 3HKRA 5HFKA 4ECBA 4WR4A 3IK7A 5IO2A 1S3CA 2FGXA 1PKWA 2H71A 1NW2A 3EWLA 3KMNA 3ZFBA 1G0TA 4WETA 3ZREA 3APSA 1PX6A 5D9WA 2GQMA 4E8HA 1XWAA 2L6CA 3F9UA 5GAND 1ZL9A 2EC4A 3CTFA 2JZTA 3QMXA 2E7PA 2GSTA 3WGXA 2HYXA 2H66A 2O89A 5HQPA 1GSEA 3M0FA 2L6DA 1F37A 1YQ1A 3ED3A 1OE7A 3VWXA 4WBRD 3IK9A 1R7HA 2VCTA 3UBKA 2VLTA 2HT9A 5DAKB 2HNLA 1WOUA 1M0UA 1ERUA 3GKMA 2KP1A 1XWBA 3LQ7A 1KTEA 5ECOB 2HZEB 1HYUA 1M99A 3TKSC 4V2LA 1BEDA 2OKAA 2E0QA 4PNFA 4JR4A 2OA7A 5J4UA 1BJXA 2FA4A 5LD0A 4WF4A 5DAKA 3QAGA 4MZCA 3TCOA 3P8WA 5DQYA 3GFKA 2GS3A 3E3EA 4HQZA 4LA1A 2HZEA 4GWRA 3LXZA 4X0XA 3GSTA 2FUG2 2H76A 3KP9A 4KDUA 2FD3A 4EF0A 4X1UA 3D21A 2KLXA 1M7TA 3KTLA 9GSSA 3F4SA 3PR8A 1QK8A 2TRXA 1QXHA 2AV4A 3CRTA 4Q5FA 3TJJA 2GSRA 3Q18A 2LUSA 1AXDA 1EGOA 1ABAA 5GZZB 1A8LA 3M8NA 4X43A 4JBBA 4I6XA 5CAXA 1SL0B 1GSYA 4AJ8A 2LRCA 3FW2A 4POBA 5DQSA 1ON4A 2H8LA 3HJPA 1J0FA 3L9UA 3L78A 2ON5A 1XBSA 4JU5A 4OO5A 5IPGA 2BTOT 4ZL7A 3U6VA 3TKQA 1JHBA 4AJ6A 1ACVA 2G0FA 2DC5A 4G9HA 2IN3A 2LKUA 2N5AA 2MBSA 2MMNA 2F9SA 5KN2A 1A24A 2V6OA 1A2LA 2IPAA 3TKPA 1YZXA 5AIXA 3EMXA 3FY7A 4XS6A 3BCIA 3DWVA 4FYUA 5IMFA 3BJ5A 4DVCA 3FZ4A 3VI5A 4J56E 3EU4A 1MDKA 5D93A 1TDIA 2VD1A 3LGCA 1SD8A 1MD3A 2EIQA 5G5FA 3ZRDA 2VL2A 5HFIA 5CRGA 2GDRA 2RUEA 3ERFA 5ECLB 3US3A 2HRNA 3F63A 4L0WA 3A2VA 3N9JA 4K6XA 5HR2A 3R2QA 3TKRA 2JSYA 2P0GA 2DIYA 2LJKA 1B48A 1HQOA 2X8GA 5AN1A 4WKWA 1Z7PA 4RQRA 3EE2A 1GNWA 1TU8A 3ZVJA 2P5QA 1PRXA 4HQSA 1SJ6A 2YWMA 2GLRA 4ML6A 3RPNA 3DD3A 1VF2A 4OCEA 4XHMA 2IMFA 3HHVA 4P3YB 2M80A 2GSSA 5ECHB 4IW9A 2EIOA 5JCWA 2VL9A 2ZCTA 16GSA 2H6YA 3TB2A 4WEYA 3LYKA 1ML6A 1XW5A 2CQ9A 2ON7A 1A2MA 1EWXA 3TRPA 2PUKC 4G19A 4L0UA 4TOPA 5D9XA 5D73A 4BWSA 2RM6A 5J9BA 2YJHA 1GSUA 4POKA 4Q5NA 3KZQA 5CRWA 3TGZA 1AQVA 1TK5B 1GTIA 4HEA2 4XRAA 4XIHA 2O87A 3MNGA 1G7OA 1O73A 4GCIA 1TRSA 2F8AA 3UAPA 5ELGA 2GZZA 4CHSA 1DUGA 5COHA 2GQKA 4GSTA 4NV5A 1H75A 2IMEA 1DSBA 1B9YC 2WCIA 4MABA 2VL3A 3FK8A 5DJMA 4IJIA 3QR6A 1JZRA 4OFMA 5B8BA 1KNGA 2FWHA 3CRUA 3GURA 4IJ3A 4V2MA 5E4WA 4V1Ag 3WT1A 2B7JA 3QD9A 3P90A 1QGVA 3C7MA 2RM5A 1EGRA 4GQFA 2AHEA 3ERWA 1GUHA 5H5QA 2CT6A 3W8JA 1K0CA 5F07A 4HU9A 4TR1B 3VFIA 1ERVA 1Q98A 2P31A 1GLQA 3EVIA 1I5GA 3HVVA 4NAXA 2CAQA 4OFTA 2B5YA 4HJMA 2R5GA 2YN1A 4TXVA 3EURA 4NHZA 3UARA 1N2AA 3IC4A 4WF5A 4ILFA 2VM1A 4E8EA 4TR1A 3D0ZA 2L57A 1EP8A 1GH2A 4TW5A 4KA0A 4ISDA 3HD5A 3IOSA 2YZUA 3DRNA 3L9VA 2I1UA 2VM2A 3F3QA 2XBIA 4MZBA 4OMVA 2QSIA 2FNOA 5G5EA 2H74A 6GSSA 1B4QA 2R2JA 2VL2C 3GV1A 4EXJA 3QAWA 1N8JA 5F05A 2OE3A 4NWYA 4GSSA 3WT2A 3IDVA 4KSOA 4LL4B 2LV3A 2MYGA 2NDOA 1PSQA 5ECSA 1X9SB 2JZSA 3QFBC 1K0DA 1PX7A 2PWJA 1ZGNA 1K3OA 2PMTA 2ALBA 1TOFA 4PQIA 1TXXA 3KD0A 1H4OA 1V40A 1X9WB
chains in the Genus database with same CATH superfamily
3D5JA 2OJLA 3LYPA 3DMLA 1LJRA 3ISOA 4K0NA 1QMVA 5C04A 2X64A 2C0EA 4ICYA 3LG6A 1GTBA 3ZIVA 4J2FA 1PL2A 3M9JA 2PVOC 4OD7A 3FZ9A 1PGTA 1WPIA 2B3SA 3FR9A 4YQUA 4GQCA 1A23A 1EP7A 4K5SA 1ERTA 4I8BA 4XTSA 3NOFA 1J9BA 1NM3A 2YANA 1FVJA 3E9JB 1TI3A 3GA4A 2D2ZA 1FAAA 2C3QA 2MMOA 3QDNA 1VGLA 4OWYA 3O6TA 3UOMA 2PN8A 4IBPA 5KN0A 2FLSA 5H5RA 2R0PA 3MWHA 4F82A 1WMJA 4A5PA 4DSQA 1F3AA 2B7KA 3L9SA 3RPPA 22GSA 4LMVA 4QL7A 2NBSA 2CV4A 1U3IA 1W89A 2DKHA 2CZ3A 2TRCP 1QFNA 5KN3A 1XFLA 3CMIA 3MYDA 4EIPA 3DIEA 1XOAA 1RQMA 5CYYA 3VPTA 5G31A 3ME7A 1AQXA 3N5OA 2H30A 4ECJA 4PUFC 3ZMLA 3Q6OA 2YWOA 4YQMA 2I3YA 2VOCA 4EKZA 5CO3A 2O7KA 3VK9A 3V1WA 5JWOB 3LEFA 4ZB9A 1BYEA 1SYXA 3CQFA 4IN0A 3ZYWA 1UA5A 2DBCA 2OADA 3VI7A 3GYKA 3C73A 3KJYA 4EUYA 2C1YA 1R26A 4NV2A 3HDCA 1ZZYA 2HLSA 2X49A 2XBQA 3MIXA 1GWCA 5IMDA 1E6BA 3APQA 2LS5A 3HCZA 3I69A 1TK8B 4QQ7A 4KDXA 2KOKA 2H1BA 2GZYA 5IMCA 5HR1A 3O76A 3A2WA 4XS4B 2YJ7A 2GGTA 4HUAA 1SKRB 2NPBA 5E59A 2FWEA 1AW9A 4IELA 1YJ6A 3HJOA 3M9KA 2DKIA 3O3TA 3GH9A 4YQVA 4HOJA 4XS4A 4ZL8A 3IHQA 2A2SA 1ILOA 1OAZA 1U87A 2CX3A 2V2GA 1QUWA 4IQ1A 2YWNA 2DSAA 2DMMA 4MJEA 1SKWB 4N0ZA 3G7IA 11GSA 4CY8A 3HVSA 13GSA 3I6AA 1FOVA 3J7Yb 4K7IA 4YAVA 2JL4A 5FT3A 4ZL9A 2XPDA 1SK1A 2TIRA 4KF9A 5DALB 1SJZA 1Z7RA 3LFLA 1GP1A 4MA9A 2M72A 3IE3A 3KH7A 4IP1A 4KH7A 3ZMKA 1UC7A 2M46A 5EL8A 1V58A 4ZXGA 4EVMA 4G2EA 2H1GA 1JLWA 1ZCPA 5C00A 4ZILA 1PN9A 4MDCA 5DALA 4I5QA 3GX8A 4HZ2A 3GKXA 5BMUA 1T8EB 3JCML 1YEPA 2GSQA 5IO0A 2LTKA 1Y25A 2CVKA 1M9BA 1XZOA 2GT6A 1F6MC 3RBTA 3R3EA 5L71A 3EC3A 4ZBBA 3PGTA 2LRNA 4QL9A 2N5FA 4F9ZA 2YP6A 5JWRB 3GHAA 2R4VA 1XG8A 2FY6A 4PNGA 4ECCA 3UIWA 1DE1A 4AF2A 4MNNA 2V41A 2XPEA 4ECIA 2AUVA 4PURA 2HRKA 5DJLA 3H93A 1XPVA 5ABRA 3C8EA 5ECKB 4PQ1A 1X5CA 1SKSB 1K0BA 3H79A 1GTAA 2LJRA 5F8BA 3F4TA 1XCCA 2C3TA 2PVQA 4EL1A 2CZ2A 2GTUA 1TU7A 3HYPA 3VWVA 3GX0A 5DCHA 1PD21 1TW9A 1SK0A 4KB3A 1O6JA 1OE8A 2K8VA 1AAZA 4KCAA 5ID2B 2JZRA 3CXGA 3I9V2 3BOAA 6GSYA 4FYCA 1WIKA 2UZ8A 4K9ZA 4MF5A 2V1MA 1MDJA 4BIKA 4BPYA 3VWWA 3AY8A 1Z6MA 3SWLA 1VF1A 2VO4A 2HRAA 1UN2A 4POMA 2I9HA 5A4WA 2A4HA 1G6WA 2H73A 4OO4A 1AIUA 1G7EA 2IJYA 5ID2A 4CY6A 5GSTA 1Y6EA 3Q19A 2NVLA 2B5EA 3WGDA 5ENUA 3VLNA 3ZIJA 3KXOA 4IVFA 2DJ3A 2WGRA 2B5XA 1YEXA 2WJUA 1XW9A 2OE0A 5IMVA 3GIXA 1NSWA 3M1GA 3J7Yk 3IPZA 5ECMB 4MH2A 2AJQB 4CDOA 1OC3A 4HI7A 2WRTA 3DEXA 3IAS2 4F0BA 2YCDA 3FYGA 12GSA 5DBQA 1MD4A 4DSRA 4MJBA 3I43A 3UJ1A 4BVXA 1GUKA 3DVXA 4G0LA 3UL3A 4K7OA 4WXTA 2K18A 4KAEA 1I9DA 1RW1A 4IP6A 4LMWA 4PXOA 5ECQB 1YF1A 2XC2A 3GMFA 2CAIA 1ZYPA 4ZB8A 2VCVA 1ZYQB 3KEBA 3W8SA 3KIJA 3GTUB 1FB0A 2H1AA 2IMDA 3D22A 3ERGA 2DJ1A 1SENA 2I4AA 4MMMA 4O5RA 1BG5A 2PERA 4NPBA 4ML1A 3RDWA 3E0UA 1WE0A 2YV9A 2WB9A 3QCPA 5ECPB 3EINA 3IR4A 5B8AA 3GTUA 4KE3A 5D8IA 3D6IA 3KH9A 2BJXA 1CQGA 4EIQA 2DIZA 6GSTA 1K3LA 4GRFA 3FR3A 3A3TA 1OKDA 2LRTA 4J57E 2VCXA 1GRXA 2WDUA 1VF4A 4XCSA 6GSUA 5IOXA 4F03A 3ME8A 1B4PA 3ZVJD 3MSZA 3QAVA 2WFCA 2C0GA 3OR5A 4KCEA 2PBJA 3GKKA 3H8QA 3TJKA 2BMXA 5EY6A 4KX4A 2FWFA 2H19A 5CRHA 5ELAA 4D73B 3TRXA 3CSJA 4HZ4A 2LQQA 1CQHA 1SL2B 2F8FA 5IPHA 3IV4A 3BBYA 4N30A 1Z5YE 2VD0A 3K8NA 2XHFA 3DYRA 3TJFA 1FB6A 5GSSA 3TOTA 4LL1B 3TKSA 6GSXA 4D73A 2IWTA 4O92A 4K0GA 3FHKA 3EYTA 2X8HA 3GRXA 4ACSA 1GL8A 1TRUA 3G7YA 4JE1A 2V6KA 2YV7A 4MLYA 2YOIA 1MEKA 4BVYB 4G10A 14GSA 2F3MA 1T00A 4YH2A 19GSA 4BWQA 7GSSA 2E2MA 3RAZA 5HR3A 4Q5QA 1M2DA 2K8SA 4IGJA 2A2RA 1THXA 2PU9C 1PKZA 4TR3A 2F51A 3LSZA 4I97A 4BVYA 1TK0B 1KEBA 2H0GA 3F3RA 3P7XA 4NXIA 2QC7A 1PL1A 4MJAA 1WP0A 2C0FA 2HFDA 4ID0A 4RQXA 2A4VA 3TOUA 1TRWA 3IRAA 1GSQA 4PX1A 1HNCA 5G30A 3ZITA 2C3NA 2JADA 1EOHA 2E2GA 5DDLA 3GH6A 2HSHA 2VAFA 3CTGA 1THOA 2MBTA 3FEUA 1R5AA 3TJGA 3TDGA 4ZB6A 1KBNA 4MCUA 1X9MB 5KN1A 1AQWA 3HZ8A 5J41A 1ERWA 3GL5A 2C0DA 4USSA 1XXUA 2ZUPA 5B7CA 2ES7A 3LWAA 3F4RA 1XVWA 2JU5A 2DMLA 3GN3A 3F6DA 5HR0A 5G1LA 3TKSE 1HNBA 1GSSA 3H4KA 2YNXA 4DEJA 1UVZA 1T4ZA 3WYWA 6GSVA 1T1VA 1PN0A 2GZPA 2DJ2A 2YPMA 4X4JA 5DVBA 3DVWA 5JWQB 1GTUA 3ZLPA 1G6YA 1K3YA 4IQAA 1GUMA 1OC8A 1XIYA 1M2BA 5IQYA 2DJKA 1M9AA 1OC9B 1LBKA 3IA1A 4F0CA 1E2YA 4G0IA 4I2TA 1USBA 4YKGA 4FYBA 3UBLA 1XVQA 3GNJA 4MF7A 3IHGA 3VPQA 1T4YA 1VRSD 4Z7XA 2EIRA 1OC9A 2WS2A 3F8UA 3P2AA 1ST9A 3VURA 1GSDA 1JZOA 3HJMA 1R5PA 1Z6NA 5B6MA 4L5OA 2L5OA 3G9BA 2RIIA 17GSA 1MTCA 3H1NA 3BCKA 3APOA 3CBUA 3GL3A 5A4UA 2R6KA 4JZQA 6GSWA 1HNAA 3ZTLA 1EOGA 2DJJA 1U6TA 1BQ7A 2C8UA 4FO5A 3C1RA 4TXOB 4PGTA 2H75A 3DGQA 1AC1A 3CSHA 5J9CA 2AB6A 4AJ7A 3D4MA 4BL7B 4HDEA 3PH9A 2H1DA 1K0NA 1WJKA 5A5KA 4TXOA 5CRDA 1Q4JA 10GSA 3F6FA 3IC8A 1XOBA 2H0IA 3KGKA 1TKDB 3UVHA 4MF6A 1T3BA 2FA8A 2HRFA 1JLVA 4RI7A 4ZBDA 4BL7A 2R3XA 2KHPA 2LSTA 4XRDA 3KM6A 1V98A 2REMA 3FMWA 3QOUA 4Z2UA 4Z2TA 2I81A 5LNKe 2AAWA 2X8CA 3GKNA 5IMAA 1SJIA 4K1FA 4POLA 2L59A 2PGTA 1S3DA 5FHIA 1RK4A 4TR4A 5H5SA 4JEDA 4MK3A 1YF0A 1A8YA 3SBCA 4I2UA 3FZ5A 2IMKA 3W6GA 4RUVA 4K7NA 2IMIA 4GSNA 3RHBA 2H0HA 4MPFA 5G2ZA 3ZL5A 4EDZA 4MZWA 1A0RP 2PPTA 1FHEA 1XWGA 2H6XA 1OYJA 4LLRA 2GT5A 2DLXA 1V57A 1TI1A 2LQOA 4IS0A 1GSFA 1IYHA 3L4NA 3NIVA 1SD9A 4EO3A 2VCWA 3M3MA 1ZYEA 2MZCA 1GNEA 2VIMA 3A2XA 1BX9A 4Z2RA 4MJCA 4GLTA 4MPGA 1GLPA 1LU4A 2K6VA 3KCMA 5BRTA 2HZFA 1BAYA 5F0GA 4MH3A 5G1KA 2X99A 5AIVA 5IIZA 5KOXA 5J3RA 2VUPA 1XWCA 5CREA 4EC0A 5LCZA 1O81A 1JZDA 1V9WA 18GSA 1C72A 1F9MA 3HVXA 2JACA 1TJDA 3U5RE 1B8XA 4CW9A 2O85A 3C71A 2B6MA 2N5BA 3G7JA 2WZ9A 5D96A 4N11A 3IBHA 4K2DA 3QPMA 4GXZA 1JFUA 1Z9HA 2DJ0A 3EPTA 3FZAA 5IMZA 1OVNA 4TKYA 4KNDA 1M2AA 1ZOFA 1EV9A 4F2IA 4HS1A 5INYA 1O8WA 2HE3A 4IKHA 3LXTA 1DBYA 4H86A 5KEJA 3KMOA 5D9VA 1R4WA 4N10A 4TN8A 3DKSA 2LJAA 2RUFA 3BD2A 4FH8A 2MMZA 5ECIB 1FW1A 2OACA 1O7UA 2NTOA 2VLUA 3GUSA 4KUNA 5D9TA 3HY2A 3TJBA 3F0IA 5JCUA 4RI6A 5JCGA 3L0HA 5B6NA 2V32A 3WD6A 5ECRB 4V1Ap 3VWUA 1X0RA 4PUAA 2QA1A 3FKFA 2MMAA 4WR5A 1FO5A 1TRVA 4HU7A 3TUEA 4AGSA 3HXSA 3ZFLA 2J23A 5AISA 5GAPD 2C80A 3TRQA 2ZNMA 2VCQA 1U88A 4YAPA 4MP4A 3ZZXA 2Z9SA 4TVEA 1O8XA 1JZWA 1O85A 2H72A 1X5DA 2CA8A 2OBIA 4N0VA 2CVBA 2P5RA 2YWIA 1EZKA 5IOWA 2CVDA 2KUCA 5ECNB 4ZIJA 2H6ZA 1F2EA 1YKCA 4O7HA 1U3AA 2R37A 3GSSA 3NZNA 4FIWA 2WULA 3MAKA 2OBKA 1HD2A 1SU9A 4PQHA 4EDYA 4Q5RA 1IYIA 5F06A 1GULA 1ZYNA 3A5WA 5IM9A 3CSIA 4ULXA 4WBJA 3UMAA 1NHYA 2JSZA 4HSCX 2FHEA 2L4QA 4KW6A 2B1KA 5EVOA 2K9FA 3CYNA 3LJRA 1F3BA 4GTUA 3EMPA 1ZMAA 2VCZA 1MDIA 4KDYA 4JRRA 1QQ2A 3FR6A 4EE0A 4KGIA 3LW9A 2IFQB 2L5LA 4ZBAA 2CX4A 2OE1A 1YKAA 2HSYA 2IL3A 2B1LA 1OKTA 3IXRA 20GSA 1B9XC 3UEMA 2LNTA 2QKEA 4OCFA 2HSMA 1WWJA 2IIYA 4XS1A 3PINA 5DCGA 4KSMA 1W4VA 1SL1B 8GSSA 2IFQA 2HXKA 4GF0A 4K8MA 1PMTA 1NHOA 5AGYA 1FVKA 3D4TA 1J08A 3IAM2 3Q74A 2QGVA 5CNWA 3RHCA 3FRCA 1XW6A 1S3AA 4IHUA 1V2AA 2FCHA 3DXBA 3MDKA 4FQUA 3UVTA 2H01A 1SYRA 4OFNA 1A2JA 1TP9A 2GQLA 4L5LA 1YDKA 1AUCA 2L4CA 1M3JA 4NHWA 5J5NA 4V2NA 1T7PB 3KP8A 1EEMA 4YKFA 2YZHA 5CP1A 2VLVA 4JR6A 5EPFA 1SK2A 1Z3EA 1PFOA 2G2QA 1M3IA 1X5EA 3S9FA 3LORA 1PA3A 3C1SA 4O32A 1YY7A 1URMA 5A4VA 2LEGA 1FG4A 4HJ2A 1K0MA 2RLIA 2J9HA 3WGEA 4BA7A 2GVPA 1XWKA 4NMUA 2FWGA 3EU3A 3QFAC 2C4JA 4TRXA 5HFGA 4DSSB 2AYTA 1TTZA 2LNSA 1WRYA 1K0OA 1VF3A 1DE2A 3HA9A 1EV4A 2H70A 5FWGA 1EEJA 2O8VB 1K0AA 4L8EA 4TR0A 3KTBA 2HI7A 3HZ4A 1PQNA 4DSSA 2KP2A 1A0FA 3HKRA 5HFKA 4ECBA 4O5UA 4WR4A 3IK7A 5IO2A 1S3CA 1S3RA 2FGXA 1PKWA 2H71A 1NW2A 3EWLA 3KMNA 3ZFBA 1G0TA 2A2PA 4WETA 3ZREA 3APSA 1PX6A 5D9WA 2GQMA 4E8HA 1XWAA 2L6CA 3F9UA 5GAND 3PPUA 1ZL9A 2EC4A 3CTFA 2JZTA 3QMXA 2E7PA 2GSTA 3WGXA 2HYXA 2H66A 2O89A 5HQPA 1GSEA 3A5IA 3M0FA 2L6DA 1F37A 1YQ1A 3ED3A 1OE7A 3VWXA 4WBRD 3IK9A 1R7HA 2VCTA 3UBKA 2VLTA 2HT9A 5DAKB 2HNLA 1WOUA 1M0UA 1ERUA 3GKMA 2KP1A 1XWBA 3LQ7A 1KTEA 5ECOB 2HZEB 1HYUA 1M99A 3TKSC 4V2LA 1BEDA 2OKAA 2E0QA 4PNFA 4JR4A 2OA7A 5J4UA 1BJXA 2FA4A 5LD0A 4WF4A 5DAKA 3QAGA 4MZCA 3TCOA 3P8WA 5DQYA 3GFKA 2GS3A 3E3EA 4HQZA 4LA1A 2HZEA 4GWRA 3LXZA 4X0XA 3GSTA 2FUG2 2H76A 3KP9A 4KDUA 2FD3A 4EF0A 4X1UA 3D21A 2KLXA 1M7TA 3KTLA 9GSSA 3F4SA 3PR8A 1QK8A 2TRXA 5KOWA 1QXHA 2AV4A 3CRTA 4Q5FA 3TJJA 2GSRA 3Q18A 2LUSA 1AXDA 1EGOA 1ABAA 5GZZB 1A8LA 3M8NA 4X43A 4JBBA 4I6XA 5CAXA 1SL0B 1GSYA 4AJ8A 2LRCA 3FW2A 4POBA 5DQSA 1ON4A 2H8LA 3HJPA 2QA2A 1J0FA 3L9UA 4K5RA 3L78A 2ON5A 1XBSA 4JU5A 4OO5A 5IPGA 2BTOT 4ZL7A 2X4AA 3U6VA 3TKQA 1JHBA 4AJ6A 1ACVA 2G0FA 2DC5A 4G9HA 2IN3A 2LKUA 2N5AA 2MBSA 2MMNA 2F9SA 5KN2A 1A24A 2V6OA 1A2LA 2IPAA 3TKPA 1YZXA 5AIXA 2R0GA 3EMXA 3FY7A 4XS6A 3BCIA 3DWVA 4FYUA 5IMFA 3BJ5A 4DVCA 3FZ4A 3VI5A 4J56E 3EU4A 1MDKA 5D93A 1TDIA 2VD1A 3LGCA 1SD8A 1MD3A 2EIQA 5G5FA 3ZRDA 2VL2A 5HFIA 5CRGA 2GDRA 2RUEA 3ERFA 5ECLB 3US3A 2HRNA 3F63A 4L0WA 3A2VA 3N9JA 4K6XA 5HR2A 3R2QA 3TKRA 2JSYA 2P0GA 2DIYA 2LJKA 4G0KA 1B48A 1HQOA 2X8GA 5AN1A 4WKWA 1Z7PA 4PTSA 4RQRA 3EE2A 1GNWA 1TU8A 3ZVJA 2P5QA 1PRXA 4HQSA 1SJ6A 2YWMA 2GLRA 4ML6A 3RPNA 3DD3A 1VF2A 4OCEA 4XHMA 2IMFA 3HHVA 4P3YB 1FOHA 2M80A 2GSSA 5ECHB 4IW9A 2EIOA 5JCWA 2VL9A 2ZCTA 16GSA 2H6YA 3TB2A 4WEYA 3LYKA 1ML6A 1XW5A 2CQ9A 2ON7A 1A2MA 1EWXA 3TRPA 2PUKC 4G19A 4L0UA 4TOPA 5D9XA 5D73A 4BWSA 2RM6A 5J9BA 2YJHA 1GSUA 4POKA 4Q5NA 3KZQA 5CRWA 3TGZA 1AQVA 1TK5B 1GTIA 4HEA2 4XRAA 4XIHA 4BVXB 2O87A 3MNGA 1G7OA 1O73A 4GCIA 1TRSA 2F8AA 3UAPA 5ELGA 2GZZA 4CHSA 1DUGA 5COHA 2GQKA 4GSTA 4NV5A 1H75A 2IMEA 1DSBA 1B9YC 2WCIA 4MABA 2VL3A 3FK8A 5DJMA 4IJIA 3QR6A 1JZRA 4OFMA 5B8BA 1KNGA 2FWHA 3CRUA 3GURA 4IJ3A 4V2MA 5E4WA 4V1Ag 3WT1A 2B7JA 2R0CA 3QD9A 3P90A 1QGVA 3C7MA 2RM5A 1EGRA 4GQFA 2AHEA 3ERWA 1GUHA 5H5QA 2CT6A 3W8JA 1K0CA 5F07A 4HU9A 4TR1B 3VFIA 1ERVA 1Q98A 2P31A 1GLQA 3EVIA 1I5GA 3HVVA 4NAXA 2CAQA 4OFTA 2B5YA 4HJMA 2R5GA 2YN1A 4TXVA 3EURA 4NHZA 3UARA 1N2AA 4K2XA 3IC4A 4WF5A 4ILFA 2VM1A 4E8EA 4TR1A 3D0ZA 2L57A 1EP8A 1GH2A 4TW5A 4KA0A 4ISDA 3HD5A 3IOSA 2YZUA 3DRNA 3L9VA 2I1UA 2VM2A 3F3QA 2XBIA 4MZBA 4OMVA 2QSIA 2FNOA 5G5EA 3HVNA 2H74A 6GSSA 1B4QA 2R2JA 2VL2C 3GV1A 4EXJA 3QAWA 1N8JA 5F05A 2OE3A 4NWYA 4GSSA 3WT2A 3IDVA 4KSOA 4LL4B 2LV3A 2MYGA 4O5QA 2NDOA 1PSQA 5ECSA 1X9SB 2JZSA 3QFBC 1K0DA 1PX7A 2PWJA 1ZGNA 1K3OA 2PMTA 2ALBA 1TOFA 4PQIA 1TXXA 3KD0A 1H4OA 1V40A 1X9WB
chains in the Genus database with same CATH topology
3D5JA 2OJLA 3LYPA 3DMLA 1LJRA 3ISOA 4K0NA 1QMVA 5C04A 2X64A 2C0EA 4ICYA 3LG6A 1GTBA 3ZIVA 4J2FA 1PL2A 3M9JA 2PVOC 4OD7A 3FZ9A 1PGTA 1WPIA 2B3SA 3FR9A 4YQUA 4GQCA 1A23A 1EP7A 4K5SA 1ERTA 4I8BA 4XTSA 3NOFA 1J9BA 1NM3A 2YANA 1FVJA 3E9JB 1TI3A 3GA4A 2D2ZA 1FAAA 2C3QA 2MMOA 3QDNA 1VGLA 4OWYA 3O6TA 3UOMA 2PN8A 4IBPA 5KN0A 2FLSA 5H5RA 2R0PA 3MWHA 4F82A 1WMJA 4A5PA 4DSQA 1F3AA 2B7KA 3L9SA 3RPPA 22GSA 4LMVA 4QL7A 2NBSA 2CV4A 1U3IA 1W89A 2DKHA 2CZ3A 2TRCP 1QFNA 5KN3A 1XFLA 3CMIA 3MYDA 4EIPA 3DIEA 1XOAA 1RQMA 5CYYA 3VPTA 5G31A 3ME7A 1AQXA 3N5OA 2H30A 4ECJA 4PUFC 3ZMLA 3Q6OA 2YWOA 4YQMA 2I3YA 2VOCA 4EKZA 5CO3A 2O7KA 3VK9A 3V1WA 5JWOB 3LEFA 4ZB9A 1BYEA 1SYXA 4IN0A 3ZYWA 1UA5A 2DBCA 2OADA 3VI7A 3GYKA 3C73A 3KJYA 4EUYA 2C1YA 1R26A 4NV2A 3HDCA 1ZZYA 2HLSA 2X49A 2XBQA 3MIXA 1GWCA 5IMDA 1E6BA 3APQA 2LS5A 3HCZA 3I69A 1TK8B 4QQ7A 4KDXA 2KOKA 2H1BA 2GZYA 5IMCA 5HR1A 3O76A 3A2WA 4XS4B 2YJ7A 2GGTA 4HUAA 1SKRB 2NPBA 5E59A 2FWEA 1AW9A 4IELA 1YJ6A 3HJOA 3M9KA 2DKIA 3O3TA 3GH9A 4YQVA 4HOJA 4XS4A 4ZL8A 3IHQA 2A2SA 1ILOA 1OAZA 1U87A 2CX3A 2V2GA 1QUWA 4IQ1A 2YWNA 2DSAA 2DMMA 4MJEA 1SKWB 4N0ZA 3G7IA 11GSA 4CY8A 3HVSA 13GSA 3I6AA 1FOVA 3J7Yb 4K7IA 4YAVA 2JL4A 5FT3A 4ZL9A 2XPDA 1SK1A 2TIRA 4KF9A 5DALB 1SJZA 1Z7RA 3LFLA 1GP1A 4MA9A 2M72A 3IE3A 3KH7A 4IP1A 4KH7A 3ZMKA 1UC7A 2M46A 5EL8A 1V58A 4ZXGA 4EVMA 4G2EA 2H1GA 1JLWA 1ZCPA 5C00A 4ZILA 1PN9A 4MDCA 5DALA 4I5QA 3GX8A 4HZ2A 3GKXA 5BMUA 1T8EB 3JCML 1YEPA 2GSQA 5IO0A 2LTKA 1Y25A 2CVKA 1M9BA 1XZOA 2GT6A 1F6MC 3RBTA 3R3EA 5L71A 3EC3A 4ZBBA 3PGTA 2LRNA 4QL9A 2N5FA 4F9ZA 2YP6A 5JWRB 3GHAA 2R4VA 2FY6A 4PNGA 4ECCA 3UIWA 1DE1A 4AF2A 4MNNA 2V41A 2XPEA 4ECIA 2AUVA 4PURA 2HRKA 5DJLA 3H93A 1XPVA 5ABRA 3C8EA 5ECKB 4PQ1A 1X5CA 1SKSB 1K0BA 3H79A 1GTAA 2LJRA 5F8BA 3F4TA 1XCCA 2C3TA 2PVQA 4EL1A 2CZ2A 2GTUA 1TU7A 3HYPA 3VWVA 3GX0A 5DCHA 1PD21 1TW9A 1SK0A 4KB3A 1O6JA 1OE8A 2K8VA 1AAZA 4KCAA 5ID2B 2JZRA 3CXGA 3I9V2 3BOAA 6GSYA 4FYCA 1WIKA 2UZ8A 4K9ZA 4MF5A 2V1MA 1MDJA 4BPYA 3VWWA 3AY8A 1Z6MA 3SWLA 1VF1A 2VO4A 2HRAA 1UN2A 4POMA 2I9HA 5A4WA 2A4HA 1G6WA 2H73A 4OO4A 1AIUA 1G7EA 2IJYA 5ID2A 4CY6A 5GSTA 1Y6EA 3Q19A 2NVLA 2B5EA 3WGDA 5ENUA 3VLNA 3ZIJA 3KXOA 4IVFA 2DJ3A 2WGRA 2B5XA 1YEXA 2WJUA 1XW9A 2OE0A 5IMVA 3GIXA 1NSWA 3M1GA 3J7Yk 3IPZA 5ECMB 4MH2A 2AJQB 4CDOA 1OC3A 4HI7A 2WRTA 3DEXA 3IAS2 4F0BA 2YCDA 3FYGA 12GSA 5DBQA 1MD4A 4DSRA 4MJBA 3I43A 3UJ1A 4BVXA 1GUKA 3DVXA 4G0LA 3UL3A 4K7OA 4WXTA 2K18A 4KAEA 1I9DA 1RW1A 4IP6A 4LMWA 4PXOA 5ECQB 1YF1A 2XC2A 3GMFA 2CAIA 1ZYPA 4ZB8A 2VCVA 1ZYQB 3KEBA 3W8SA 3KIJA 3GTUB 1FB0A 2H1AA 2IMDA 3D22A 3ERGA 2DJ1A 1SENA 2I4AA 4MMMA 4O5RA 1BG5A 2PERA 4NPBA 4ML1A 3RDWA 3E0UA 1WE0A 2YV9A 2WB9A 3QCPA 5ECPB 3EINA 3IR4A 5B8AA 3GTUA 4KE3A 5D8IA 3D6IA 3KH9A 2BJXA 1CQGA 4EIQA 2DIZA 6GSTA 1K3LA 4GRFA 3FR3A 3A3TA 1OKDA 2LRTA 4J57E 2VCXA 1GRXA 2WDUA 1VF4A 4XCSA 6GSUA 5IOXA 4F03A 3ME8A 1B4PA 3ZVJD 3MSZA 3QAVA 2WFCA 2C0GA 3OR5A 4KCEA 2PBJA 3GKKA 3H8QA 3TJKA 2BMXA 5EY6A 4KX4A 2FWFA 2H19A 5CRHA 5ELAA 4D73B 3TRXA 3CSJA 4HZ4A 2LQQA 1CQHA 1SL2B 2F8FA 5IPHA 3IV4A 3BBYA 4N30A 1Z5YE 2VD0A 3K8NA 2XHFA 3DYRA 3TJFA 1FB6A 5GSSA 3TOTA 4LL1B 3TKSA 6GSXA 4D73A 2IWTA 4O92A 4K0GA 3FHKA 3EYTA 2X8HA 3GRXA 4ACSA 1GL8A 1TRUA 3G7YA 4JE1A 2V6KA 2YV7A 4MLYA 2YOIA 1MEKA 4BVYB 4G10A 14GSA 2F3MA 1T00A 4YH2A 19GSA 4BWQA 7GSSA 2E2MA 3RAZA 5HR3A 4Q5QA 1M2DA 2K8SA 4IGJA 2A2RA 1THXA 2PU9C 1PKZA 4TR3A 2F51A 3LSZA 4I97A 4BVYA 1TK0B 1KEBA 2H0GA 3F3RA 3P7XA 4NXIA 2QC7A 1PL1A 4MJAA 1WP0A 2C0FA 2HFDA 4ID0A 4RQXA 2A4VA 3TOUA 1TRWA 3IRAA 1GSQA 4PX1A 1HNCA 5G30A 3ZITA 2C3NA 2JADA 1EOHA 2E2GA 5DDLA 3GH6A 2HSHA 2VAFA 3CTGA 1THOA 2MBTA 3FEUA 1R5AA 3TJGA 3TDGA 4ZB6A 1KBNA 4MCUA 1X9MB 5KN1A 1AQWA 3HZ8A 5J41A 1ERWA 3GL5A 2C0DA 4USSA 1XXUA 2ZUPA 5B7CA 2ES7A 3LWAA 3F4RA 1XVWA 2JU5A 2DMLA 3GN3A 3F6DA 5HR0A 5G1LA 3TKSE 1HNBA 1GSSA 3H4KA 2YNXA 4DEJA 1UVZA 1T4ZA 3WYWA 6GSVA 1T1VA 1PN0A 2GZPA 2DJ2A 2YPMA 4X4JA 5DVBA 3DVWA 5JWQB 1GTUA 3ZLPA 1G6YA 1K3YA 4IQAA 1GUMA 1OC8A 1XIYA 1M2BA 5IQYA 2DJKA 1M9AA 1OC9B 1LBKA 3IA1A 4F0CA 1E2YA 4G0IA 4I2TA 1USBA 4YKGA 4FYBA 3UBLA 1XVQA 3GNJA 4MF7A 3IHGA 3VPQA 1T4YA 1VRSD 4Z7XA 2EIRA 1OC9A 2WS2A 3F8UA 3P2AA 1ST9A 3VURA 1GSDA 1JZOA 3HJMA 1R5PA 1Z6NA 5B6MA 4L5OA 2L5OA 3G9BA 2RIIA 17GSA 1MTCA 3H1NA 3BCKA 3APOA 3CBUA 3GL3A 5A4UA 2R6KA 4JZQA 6GSWA 1HNAA 3ZTLA 1EOGA 2DJJA 1U6TA 1BQ7A 2C8UA 4FO5A 3C1RA 4TXOB 4PGTA 2H75A 3DGQA 1AC1A 3CSHA 5J9CA 2AB6A 4AJ7A 3D4MA 4BL7B 4HDEA 3PH9A 2H1DA 1K0NA 1WJKA 5A5KA 4TXOA 5CRDA 1Q4JA 10GSA 3F6FA 3IC8A 1XOBA 2H0IA 3KGKA 1TKDB 3UVHA 4MF6A 1T3BA 2FA8A 2HRFA 1JLVA 4RI7A 4ZBDA 4BL7A 2R3XA 2KHPA 2LSTA 4XRDA 3KM6A 1V98A 2REMA 3FMWA 3QOUA 4Z2UA 4Z2TA 2I81A 5LNKe 2AAWA 2X8CA 3GKNA 5IMAA 1SJIA 4K1FA 4POLA 2L59A 2PGTA 1S3DA 5FHIA 1RK4A 4TR4A 5H5SA 4JEDA 4MK3A 1YF0A 1A8YA 3SBCA 4I2UA 3FZ5A 2IMKA 3W6GA 4RUVA 4K7NA 2IMIA 4GSNA 3RHBA 2H0HA 4MPFA 5G2ZA 3ZL5A 4EDZA 4MZWA 1A0RP 2PPTA 1FHEA 1XWGA 2H6XA 1OYJA 4LLRA 2GT5A 2DLXA 1V57A 1TI1A 2LQOA 4IS0A 1GSFA 1IYHA 3L4NA 3NIVA 1SD9A 4EO3A 2VCWA 3M3MA 1ZYEA 2MZCA 1GNEA 2VIMA 3A2XA 1BX9A 4Z2RA 4MJCA 4GLTA 4MPGA 1GLPA 1LU4A 2K6VA 3KCMA 5BRTA 2HZFA 1BAYA 5F0GA 4MH3A 5G1KA 2X99A 5AIVA 5IIZA 5KOXA 5J3RA 2VUPA 1XWCA 5CREA 4EC0A 5LCZA 1O81A 1JZDA 1V9WA 18GSA 1C72A 1F9MA 3HVXA 2JACA 1TJDA 3U5RE 1B8XA 4CW9A 2O85A 3C71A 2B6MA 2N5BA 3G7JA 2WZ9A 5D96A 4N11A 3IBHA 4K2DA 3QPMA 4GXZA 1JFUA 1Z9HA 2DJ0A 3EPTA 3FZAA 5IMZA 1OVNA 4TKYA 4KNDA 1M2AA 1ZOFA 1EV9A 4F2IA 4HS1A 5INYA 1O8WA 2HE3A 4IKHA 3LXTA 1DBYA 4H86A 5KEJA 3KMOA 5D9VA 1R4WA 4N10A 4TN8A 3DKSA 2LJAA 2RUFA 3BD2A 4FH8A 2MMZA 5ECIB 1FW1A 2OACA 1O7UA 2NTOA 2VLUA 3GUSA 4KUNA 5D9TA 3HY2A 3TJBA 3F0IA 5JCUA 4RI6A 5JCGA 3L0HA 5B6NA 2V32A 3WD6A 5ECRB 4V1Ap 3VWUA 1X0RA 4PUAA 2QA1A 3FKFA 2MMAA 4WR5A 1FO5A 1TRVA 4HU7A 3TUEA 4AGSA 3HXSA 3ZFLA 2J23A 5AISA 5GAPD 2C80A 3TRQA 2ZNMA 2VCQA 1U88A 4YAPA 4MP4A 3ZZXA 2Z9SA 4TVEA 1O8XA 1JZWA 1O85A 2H72A 1X5DA 2CA8A 2OBIA 4N0VA 2CVBA 2P5RA 2YWIA 1EZKA 5IOWA 2CVDA 2KUCA 5ECNB 4ZIJA 2H6ZA 1F2EA 1YKCA 4O7HA 1U3AA 2R37A 3GSSA 3NZNA 4FIWA 2WULA 3MAKA 2OBKA 1HD2A 1SU9A 4PQHA 4EDYA 4Q5RA 1IYIA 5F06A 1GULA 1ZYNA 3A5WA 5IM9A 3CSIA 4ULXA 4WBJA 3UMAA 1NHYA 2JSZA 2FHEA 2L4QA 4KW6A 2B1KA 5EVOA 2K9FA 3CYNA 3LJRA 1F3BA 4GTUA 3EMPA 1ZMAA 2VCZA 1MDIA 4KDYA 4JRRA 1QQ2A 3FR6A 4EE0A 4KGIA 3LW9A 2IFQB 2L5LA 4ZBAA 2CX4A 2OE1A 1YKAA 2HSYA 2IL3A 2B1LA 1OKTA 3IXRA 20GSA 1B9XC 3UEMA 2LNTA 2QKEA 4OCFA 2HSMA 1WWJA 2IIYA 4XS1A 3PINA 5DCGA 4KSMA 1W4VA 1SL1B 8GSSA 2IFQA 2HXKA 4GF0A 4K8MA 1PMTA 1NHOA 5AGYA 1FVKA 3D4TA 1J08A 3IAM2 3Q74A 2QGVA 5CNWA 3RHCA 3FRCA 1XW6A 1S3AA 4IHUA 1V2AA 2FCHA 3DXBA 3MDKA 4FQUA 3UVTA 2H01A 1SYRA 4OFNA 1A2JA 1TP9A 2GQLA 4L5LA 1YDKA 1AUCA 2L4CA 4NHWA 5J5NA 4V2NA 1T7PB 3KP8A 1EEMA 4YKFA 2YZHA 5CP1A 2VLVA 4JR6A 5EPFA 1SK2A 1Z3EA 2G2QA 1X5EA 3S9FA 3LORA 1PA3A 3C1SA 4O32A 1YY7A 1URMA 5A4VA 2LEGA 1FG4A 4HJ2A 1K0MA 2RLIA 2J9HA 3WGEA 4BA7A 2GVPA 1XWKA 4NMUA 2FWGA 3EU3A 3QFAC 2C4JA 4TRXA 5HFGA 4DSSB 2AYTA 1TTZA 2LNSA 1WRYA 1K0OA 1VF3A 1DE2A 3HA9A 1EV4A 2H70A 5FWGA 1EEJA 2O8VB 1K0AA 4L8EA 4TR0A 3KTBA 2HI7A 3HZ4A 1PQNA 4DSSA 2KP2A 1A0FA 3HKRA 5HFKA 4ECBA 4O5UA 4WR4A 3IK7A 5IO2A 1S3CA 2FGXA 1PKWA 2H71A 1NW2A 3EWLA 3KMNA 3ZFBA 1G0TA 2A2PA 4WETA 3ZREA 3APSA 1PX6A 5D9WA 2GQMA 4E8HA 1XWAA 2L6CA 3F9UA 5GAND 3PPUA 1ZL9A 2EC4A 3CTFA 2JZTA 3QMXA 2E7PA 2GSTA 3WGXA 2HYXA 2H66A 2O89A 5HQPA 1GSEA 3A5IA 3M0FA 2L6DA 1F37A 1YQ1A 3ED3A 1OE7A 3VWXA 4WBRD 3IK9A 1R7HA 2VCTA 3UBKA 2VLTA 2HT9A 5DAKB 2HNLA 1WOUA 1M0UA 1ERUA 3GKMA 2KP1A 1XWBA 3LQ7A 1KTEA 5ECOB 2HZEB 1HYUA 1M99A 3TKSC 4V2LA 1BEDA 2OKAA 2E0QA 4PNFA 4JR4A 2OA7A 5J4UA 1BJXA 2FA4A 5LD0A 4WF4A 5DAKA 3QAGA 4MZCA 3TCOA 3P8WA 5DQYA 3GFKA 2GS3A 3E3EA 4HQZA 4LA1A 2HZEA 4GWRA 3LXZA 4X0XA 3GSTA 2FUG2 2H76A 3KP9A 4KDUA 2FD3A 4EF0A 4X1UA 3D21A 2KLXA 1M7TA 3KTLA 9GSSA 3F4SA 3PR8A 1QK8A 2TRXA 5KOWA 1QXHA 2AV4A 3CRTA 4Q5FA 3TJJA 2GSRA 3Q18A 2LUSA 1AXDA 1EGOA 1ABAA 5GZZB 1A8LA 3M8NA 4X43A 4JBBA 4I6XA 5CAXA 1SL0B 1GSYA 4AJ8A 2LRCA 3FW2A 4POBA 5DQSA 1ON4A 2H8LA 3HJPA 2QA2A 1J0FA 3L9UA 4K5RA 3L78A 2ON5A 1XBSA 4JU5A 4OO5A 5IPGA 2BTOT 4ZL7A 2X4AA 3U6VA 3TKQA 1JHBA 4AJ6A 1ACVA 2G0FA 2DC5A 4G9HA 2IN3A 2LKUA 2N5AA 2MBSA 2MMNA 2F9SA 5KN2A 1A24A 2V6OA 1A2LA 2IPAA 3TKPA 1YZXA 5AIXA 2R0GA 3EMXA 3FY7A 4XS6A 3BCIA 3DWVA 4FYUA 5IMFA 3BJ5A 4DVCA 3FZ4A 3VI5A 4J56E 3EU4A 1MDKA 5D93A 1TDIA 2VD1A 3LGCA 1SD8A 1MD3A 2EIQA 5G5FA 3ZRDA 2VL2A 5HFIA 5CRGA 2GDRA 2RUEA 3ERFA 5ECLB 3US3A 2HRNA 3F63A 4L0WA 3A2VA 3N9JA 4K6XA 5HR2A 3R2QA 3TKRA 2JSYA 2P0GA 2DIYA 2LJKA 4G0KA 1B48A 1HQOA 2X8GA 5AN1A 4WKWA 1Z7PA 4PTSA 4RQRA 3EE2A 1GNWA 1TU8A 3ZVJA 2P5QA 1PRXA 4HQSA 1SJ6A 2YWMA 2GLRA 4ML6A 3RPNA 3DD3A 1VF2A 4OCEA 4XHMA 2IMFA 3HHVA 4P3YB 1FOHA 2M80A 2GSSA 5ECHB 4IW9A 2EIOA 5JCWA 2VL9A 2ZCTA 16GSA 2H6YA 3TB2A 4WEYA 3LYKA 1ML6A 1XW5A 2CQ9A 2ON7A 1A2MA 1EWXA 3TRPA 2PUKC 4G19A 4L0UA 4TOPA 5D9XA 5D73A 4BWSA 2RM6A 5J9BA 2YJHA 1GSUA 4POKA 4Q5NA 3KZQA 5CRWA 3TGZA 1AQVA 1TK5B 1GTIA 4HEA2 4XRAA 4XIHA 4BVXB 2O87A 3MNGA 1G7OA 1O73A 4GCIA 1TRSA 2F8AA 3UAPA 5ELGA 2GZZA 4CHSA 1DUGA 5COHA 2GQKA 4GSTA 4NV5A 1H75A 2IMEA 1DSBA 1B9YC 2WCIA 4MABA 2VL3A 3FK8A 5DJMA 4IJIA 3QR6A 1JZRA 4OFMA 5B8BA 1KNGA 2FWHA 3CRUA 3GURA 4IJ3A 4V2MA 5E4WA 4V1Ag 3WT1A 2B7JA 2R0CA 3QD9A 3P90A 1QGVA 3C7MA 2RM5A 1EGRA 4GQFA 2AHEA 3ERWA 1GUHA 5H5QA 2CT6A 3W8JA 1K0CA 5F07A 4HU9A 4TR1B 3VFIA 1ERVA 1Q98A 2P31A 1GLQA 3EVIA 1I5GA 3HVVA 4NAXA 2CAQA 4OFTA 2B5YA 4HJMA 2R5GA 2YN1A 4TXVA 3EURA 4NHZA 3UARA 1N2AA 4K2XA 3IC4A 4WF5A 4ILFA 2VM1A 4E8EA 4TR1A 3D0ZA 2L57A 1EP8A 1GH2A 4TW5A 4KA0A 4ISDA 3HD5A 3IOSA 2YZUA 3DRNA 3L9VA 2I1UA 2VM2A 3F3QA 2XBIA 4MZBA 4OMVA 2QSIA 2FNOA 5G5EA 2H74A 6GSSA 1B4QA 2R2JA 2VL2C 3GV1A 4EXJA 3QAWA 1N8JA 5F05A 2OE3A 4NWYA 4GSSA 3WT2A 3IDVA 4KSOA 4LL4B 2LV3A 2MYGA 4O5QA 2NDOA 1PSQA 5ECSA 1X9SB 2JZSA 3QFBC 1K0DA 1PX7A 2PWJA 1ZGNA 1K3OA 2PMTA 2ALBA 1TOFA 4PQIA 1TXXA 3KD0A 1H4OA 1V40A 1X9WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5J A;  2OJL A;  3LYP A;  3DML A;  1LJR A;  3ISO A;  4K0N A;  1QMV A;  5C04 A;  2X64 A;  2C0E A;  3LG6 A;  1GTB A;  3ZIV A;  4J2F A;  1PL2 A;  3M9J A;  2PVO C;  4OD7 A;  3FZ9 A;  1PGT A;  1WPI A;  2B3S A;  3FR9 A;  4YQU A;  4GQC A;  1A23 A;  1EP7 A;  1ERT A;  4I8B A;  4XTS A;  3NOF A;  1J9B A;  1NM3 A;  2YAN A;  1FVJ A;  3E9J B;  1TI3 A;  3GA4 A;  2D2Z A;  1FAA A;  2C3Q A;  2MMO A;  3QDN A;  1VGL A;  4OWY A;  3O6T A;  3UOM A;  2PN8 A;  4IBP A;  5KN0 A;  2FLS A;  5H5R A;  3MWH A;  4F82 A;  1WMJ A;  4DSQ A;  1F3A A;  2B7K A;  3L9S A;  3RPP A;  22GS A;  4LMV A;  4QL7 A;  2NBS A;  2CV4 A;  1U3I A;  1W89 A;  2CZ3 A;  2TRC P;  1QFN A;  5KN3 A;  1XFL A;  3CMI A;  3DIE A;  1XOA A;  1RQM A;  5CYY A;  3VPT A;  5G31 A;  3ME7 A;  1AQX A;  3N5O A;  2H30 A;  4ECJ A;  4PUF C;  3ZML A;  3Q6O A;  2YWO A;  4YQM A;  2I3Y A;  2VOC A;  4EKZ A;  5CO3 A;  2O7K A;  3VK9 A;  3V1W A;  5JWO B;  3LEF A;  4ZB9 A;  1BYE A;  1SYX A;  4IN0 A;  3ZYW A;  1UA5 A;  2DBC A;  2OAD A;  3VI7 A;  3GYK A;  3C73 A;  3KJY A;  4EUY A;  2C1Y A;  1R26 A;  3HDC A;  4NV2 A;  1ZZY A;  2HLS A;  2XBQ A;  1GWC A;  5IMD A;  1E6B A;  3APQ A;  2LS5 A;  3HCZ A;  3I69 A;  1TK8 B;  4QQ7 A;  4KDX A;  2KOK A;  2H1B A;  2GZY A;  5IMC A;  5HR1 A;  3O76 A;  3A2W A;  4XS4 B;  2YJ7 A;  2GGT A;  4HUA A;  1SKR B;  2NPB A;  5E59 A;  2FWE A;  1AW9 A;  4IEL A;  1YJ6 A;  3HJO A;  3M9K A;  3O3T A;  3GH9 A;  4YQV A;  4HOJ A;  4XS4 A;  4ZL8 A;  3IHQ A;  2A2S A;  1ILO A;  1OAZ A;  1U87 A;  2CX3 A;  2V2G A;  1QUW A;  4IQ1 A;  2YWN A;  2DSA A;  2DMM A;  4MJE A;  1SKW B;  4N0Z A;  3G7I A;  11GS A;  3HVS A;  13GS A;  3I6A A;  1FOV A;  3J7Y b;  4K7I A;  4YAV A;  2JL4 A;  5FT3 A;  4ZL9 A;  2XPD A;  1SK1 A;  2TIR A;  5DAL B;  1SJZ A;  1Z7R A;  3LFL A;  1GP1 A;  4MA9 A;  2M72 A;  3IE3 A;  3KH7 A;  4IP1 A;  4KH7 A;  3ZMK A;  1UC7 A;  2M46 A;  5EL8 A;  1V58 A;  4ZXG A;  4EVM A;  4G2E A;  2H1G A;  1JLW A;  1ZCP A;  5C00 A;  4ZIL A;  1PN9 A;  4MDC A;  5DAL A;  4I5Q A;  3GX8 A;  4HZ2 A;  3GKX A;  1T8E B;  3JCM L;  1YEP A;  2GSQ A;  5IO0 A;  2LTK A;  1Y25 A;  2CVK A;  1M9B A;  1XZO A;  2GT6 A;  1F6M C;  3RBT A;  5L71 A;  3EC3 A;  4ZBB A;  3PGT A;  2LRN A;  4QL9 A;  2N5F A;  4F9Z A;  2YP6 A;  5JWR B;  3GHA A;  2R4V A;  2FY6 A;  4PNG A;  4ECC A;  3UIW A;  1DE1 A;  4AF2 A;  2V41 A;  2XPE A;  4ECI A;  2AUV A;  4PUR A;  5DJL A;  3H93 A;  1XPV A;  5ABR A;  3C8E A;  5ECK B;  4PQ1 A;  1X5C A;  1SKS B;  1K0B A;  3H79 A;  1GTA A;  2LJR A;  5F8B A;  3F4T A;  1XCC A;  2C3T A;  2PVQ A;  4EL1 A;  2CZ2 A;  2GTU A;  1TU7 A;  3HYP A;  3VWV A;  3GX0 A;  5DCH A;  1PD2 1;  1TW9 A;  1SK0 A;  4KB3 A;  1O6J A;  1OE8 A;  2K8V A;  1AAZ A;  4KCA A;  5ID2 B;  2JZR A;  3CXG A;  3I9V 2;  3BOA A;  6GSY A;  4FYC A;  1WIK A;  4K9Z A;  4MF5 A;  2V1M A;  1MDJ A;  4BPY A;  3VWW A;  3AY8 A;  1Z6M A;  3SWL A;  1VF1 A;  2VO4 A;  1UN2 A;  4POM A;  2I9H A;  5A4W A;  1G6W A;  2H73 A;  4OO4 A;  1AIU A;  1G7E A;  2IJY A;  5ID2 A;  5GST A;  1Y6E A;  3Q19 A;  2NVL A;  2B5E A;  3WGD A;  5ENU A;  3VLN A;  3ZIJ A;  3KXO A;  4IVF A;  2DJ3 A;  2WGR A;  2B5X A;  1YEX A;  2WJU A;  1XW9 A;  2OE0 A;  5IMV A;  3GIX A;  1NSW A;  3M1G A;  3J7Y k;  3IPZ A;  5ECM B;  4MH2 A;  2AJQ B;  4CDO A;  1OC3 A;  4HI7 A;  2WRT A;  3DEX A;  3IAS 2;  4F0B A;  2YCD A;  3FYG A;  12GS A;  5DBQ A;  1MD4 A;  4DSR A;  4MJB A;  3I43 A;  3UJ1 A;  4BVX A;  1GUK A;  3DVX A;  3UL3 A;  4K7O A;  4WXT A;  2K18 A;  4KAE A;  1I9D A;  1RW1 A;  4IP6 A;  4LMW A;  4PXO A;  5ECQ B;  1YF1 A;  2XC2 A;  3GMF A;  2CAI A;  4ZB8 A;  1ZYQ B;  2VCV A;  3KEB A;  3W8S A;  3KIJ A;  3GTU B;  1FB0 A;  2H1A A;  2IMD A;  3D22 A;  3ERG A;  2DJ1 A;  1SEN A;  2I4A A;  4MMM A;  4O5R A;  1BG5 A;  2PER A;  4NPB A;  4ML1 A;  3RDW A;  3E0U A;  1WE0 A;  2YV9 A;  2WB9 A;  3QCP A;  5ECP B;  3EIN A;  3IR4 A;  5B8A A;  3GTU A;  4KE3 A;  5D8I A;  3D6I A;  3KH9 A;  2BJX A;  1CQG A;  2DIZ A;  6GST A;  1K3L A;  4GRF A;  3FR3 A;  3A3T A;  1OKD A;  2LRT A;  4J57 E;  2VCX A;  1GRX A;  2WDU A;  1VF4 A;  4XCS A;  6GSU A;  5IOX A;  4F03 A;  3ME8 A;  1B4P A;  3ZVJ D;  3MSZ A;  3QAV A;  2WFC A;  2C0G A;  3OR5 A;  4KCE A;  2PBJ A;  3GKK A;  3H8Q A;  3TJK A;  2BMX A;  5EY6 A;  4KX4 A;  2FWF A;  2H19 A;  5CRH A;  5ELA A;  4D73 B;  3TRX A;  3CSJ A;  4HZ4 A;  2LQQ A;  1CQH A;  1SL2 B;  2F8F A;  5IPH A;  3IV4 A;  3BBY A;  4N30 A;  1Z5Y E;  2VD0 A;  3K8N A;  2XHF A;  3DYR A;  3TJF A;  1FB6 A;  5GSS A;  3TOT A;  4LL1 B;  3TKS A;  6GSX A;  4D73 A;  2IWT A;  4O92 A;  4K0G A;  3FHK A;  3EYT A;  2X8H A;  3GRX A;  4ACS A;  1GL8 A;  1TRU A;  3G7Y A;  4JE1 A;  2V6K A;  2YV7 A;  4MLY A;  2YOI A;  1MEK A;  4G10 A;  14GS A;  2F3M A;  1T00 A;  4YH2 A;  19GS A;  4BWQ A;  7GSS A;  2E2M A;  3RAZ A;  5HR3 A;  4Q5Q A;  1M2D A;  2K8S A;  4IGJ A;  2A2R A;  1THX A;  2PU9 C;  1PKZ A;  4TR3 A;  2F51 A;  3LSZ A;  4I97 A;  4BVY A;  1TK0 B;  1KEB A;  2H0G A;  3F3R A;  3P7X A;  4NXI A;  2QC7 A;  1PL1 A;  4MJA A;  1WP0 A;  2C0F A;  2HFD A;  4ID0 A;  4RQX A;  2A4V A;  3TOU A;  1TRW A;  3IRA A;  1GSQ A;  4PX1 A;  1HNC A;  5G30 A;  3ZIT A;  2C3N A;  2JAD A;  1EOH A;  2E2G A;  5DDL A;  3GH6 A;  2HSH A;  2VAF A;  3CTG A;  1THO A;  2MBT A;  3FEU A;  1R5A A;  3TJG A;  3TDG A;  4ZB6 A;  1KBN A;  4MCU A;  1X9M B;  5KN1 A;  1AQW A;  3HZ8 A;  5J41 A;  1ERW A;  3GL5 A;  2C0D A;  1XXU A;  2ZUP A;  5B7C A;  2ES7 A;  3LWA A;  3F4R A;  1XVW A;  2JU5 A;  2DML A;  3GN3 A;  3F6D A;  5HR0 A;  5G1L A;  3TKS E;  1HNB A;  1GSS A;  3H4K A;  2YNX A;  4DEJ A;  1UVZ A;  1T4Z A;  3WYW A;  6GSV A;  1T1V A;  2GZP A;  2DJ2 A;  2YPM A;  5DVB A;  3DVW A;  5JWQ B;  1GTU A;  3ZLP A;  1G6Y A;  1K3Y A;  4IQA A;  1GUM A;  1OC8 A;  1XIY A;  1M2B A;  5IQY A;  2DJK A;  1M9A A;  1OC9 B;  1LBK A;  3IA1 A;  4F0C A;  1E2Y A;  4I2T A;  1USB A;  4FYB A;  3UBL A;  1XVQ A;  3GNJ A;  4MF7 A;  3VPQ A;  1T4Y A;  1VRS D;  4Z7X A;  2EIR A;  1OC9 A;  2WS2 A;  3F8U A;  3P2A A;  1ST9 A;  3VUR A;  1GSD A;  1JZO A;  3HJM A;  1R5P A;  1Z6N A;  5B6M A;  4L5O A;  2L5O A;  3G9B A;  2RII A;  17GS A;  1MTC A;  3H1N A;  3BCK A;  3APO A;  3CBU A;  3GL3 A;  5A4U A;  2R6K A;  4JZQ A;  6GSW A;  1HNA A;  3ZTL A;  1EOG A;  2DJJ A;  1U6T A;  1BQ7 A;  2C8U A;  4FO5 A;  3C1R A;  4TXO B;  4PGT A;  2H75 A;  3DGQ A;  1AC1 A;  3CSH A;  5J9C A;  2AB6 A;  4AJ7 A;  3D4M A;  4HDE A;  3PH9 A;  2H1D A;  1K0N A;  1WJK A;  5A5K A;  4TXO A;  5CRD A;  1Q4J A;  10GS A;  3F6F A;  1XOB A;  2H0I A;  3KGK A;  1TKD B;  3UVH A;  4MF6 A;  1T3B A;  2FA8 A;  2HRF A;  1JLV A;  4RI7 A;  4ZBD A;  4BL7 A;  2R3X A;  2KHP A;  2LST A;  4XRD A;  3KM6 A;  1V98 A;  2REM A;  3QOU A;  2I81 A;  5LNK e;  2AAW A;  2X8C A;  3GKN A;  5IMA A;  1SJI A;  4K1F A;  4POL A;  2L59 A;  2PGT A;  1S3D A;  5FHI A;  1RK4 A;  4TR4 A;  5H5S A;  4JED A;  4MK3 A;  1YF0 A;  1A8Y A;  3SBC A;  4I2U A;  3FZ5 A;  2IMK A;  3W6G A;  4RUV A;  4K7N A;  2IMI A;  4GSN A;  3RHB A;  2H0H A;  4MPF A;  5G2Z A;  3ZL5 A;  4EDZ A;  4MZW A;  1A0R P;  2PPT A;  1FHE A;  1XWG A;  2H6X A;  1OYJ A;  4LLR A;  2GT5 A;  2DLX A;  1V57 A;  1TI1 A;  2LQO A;  4IS0 A;  1GSF A;  1IYH A;  3L4N A;  3NIV A;  1SD9 A;  4EO3 A;  2VCW A;  3M3M A;  1ZYE A;  2MZC A;  1GNE A;  2VIM A;  3A2X A;  1BX9 A;  4MJC A;  4GLT A;  4MPG A;  1GLP A;  1LU4 A;  2K6V A;  3KCM A;  2HZF A;  1BAY A;  5F0G A;  4MH3 A;  5G1K A;  2X99 A;  5AIV A;  5IIZ A;  5J3R A;  2VUP A;  1XWC A;  5CRE A;  4EC0 A;  5LCZ A;  1O81 A;  1JZD A;  1V9W A;  18GS A;  1C72 A;  1F9M A;  3HVX A;  2JAC A;  1TJD A;  3U5R E;  1B8X A;  4CW9 A;  2O85 A;  3C71 A;  2B6M A;  2N5B A;  3G7J A;  2WZ9 A;  5D96 A;  4N11 A;  3IBH A;  4K2D A;  3QPM A;  4GXZ A;  1JFU A;  1Z9H A;  2DJ0 A;  3FZA A;  5IMZ A;  1OVN A;  4TKY A;  4KND A;  1M2A A;  1ZOF A;  1EV9 A;  4F2I A;  4HS1 A;  5INY A;  1O8W A;  2HE3 A;  4IKH A;  3LXT A;  1DBY A;  4H86 A;  5KEJ A;  3KMO A;  5D9V A;  1R4W A;  4N10 A;  4TN8 A;  3DKS A;  2LJA A;  2RUF A;  3BD2 A;  4FH8 A;  2MMZ A;  5ECI B;  1FW1 A;  2OAC A;  1O7U A;  2NTO A;  2VLU A;  3GUS A;  4KUN A;  5D9T A;  3HY2 A;  3TJB A;  3F0I A;  5JCU A;  4RI6 A;  5JCG A;  3L0H A;  5B6N A;  2V32 A;  3WD6 A;  5ECR B;  4V1A p;  3VWU A;  1X0R A;  4PUA A;  3FKF A;  2MMA A;  4WR5 A;  1FO5 A;  1TRV A;  4HU7 A;  3TUE A;  4AGS A;  3HXS A;  3ZFL A;  2J23 A;  5AIS A;  5GAP D;  2C80 A;  3TRQ A;  2ZNM A;  2VCQ A;  1U88 A;  4YAP A;  4MP4 A;  3ZZX A;  2Z9S A;  4TVE A;  1O8X A;  1JZW A;  1O85 A;  2H72 A;  1X5D A;  2CA8 A;  2OBI A;  4N0V A;  2CVB A;  2P5R A;  2YWI A;  1EZK A;  5IOW A;  2CVD A;  2KUC A;  5ECN B;  4ZIJ A;  2H6Z A;  1F2E A;  1YKC A;  4O7H A;  1U3A A;  2R37 A;  3GSS A;  3NZN A;  4FIW A;  2WUL A;  3MAK A;  2OBK A;  1HD2 A;  1SU9 A;  4PQH A;  4EDY A;  4Q5R A;  1IYI A;  5F06 A;  1GUL A;  3A5W A;  5IM9 A;  3CSI A;  4ULX A;  4WBJ A;  3UMA A;  1NHY A;  2JSZ A;  2FHE A;  2L4Q A;  4KW6 A;  2B1K A;  5EVO A;  2K9F A;  3CYN A;  3LJR A;  1F3B A;  4GTU A;  3EMP A;  1ZMA A;  2VCZ A;  1MDI A;  4KDY A;  4JRR A;  1QQ2 A;  3FR6 A;  4EE0 A;  4KGI A;  2IFQ B;  2L5L A;  4ZBA A;  2CX4 A;  2OE1 A;  1YKA A;  2HSY A;  2IL3 A;  2B1L A;  1OKT A;  3IXR A;  20GS A;  1B9X C;  3UEM A;  2LNT A;  2QKE A;  4OCF A;  1WWJ A;  2IIY A;  4XS1 A;  3PIN A;  5DCG A;  4KSM A;  1W4V A;  1SL1 B;  8GSS A;  2IFQ A;  2HXK A;  4GF0 A;  4K8M A;  1PMT A;  1NHO A;  5AGY A;  1FVK A;  3D4T A;  1J08 A;  3IAM 2;  3Q74 A;  2QGV A;  5CNW A;  3RHC A;  3FRC A;  1XW6 A;  1S3A A;  4IHU A;  1V2A A;  2FCH A;  3DXB A;  3MDK A;  3UVT A;  2H01 A;  1SYR A;  4OFN A;  1A2J A;  1TP9 A;  2GQL A;  4L5L A;  1YDK A;  1AUC A;  2L4C A;  4NHW A;  5J5N A;  4V2N A;  1T7P B;  3KP8 A;  1EEM A;  2YZH A;  5CP1 A;  2VLV A;  4JR6 A;  5EPF A;  1SK2 A;  1Z3E A;  2G2Q A;  1X5E A;  3S9F A;  3LOR A;  1PA3 A;  3C1S A;  4O32 A;  1YY7 A;  1URM A;  5A4V A;  2LEG A;  1FG4 A;  4HJ2 A;  1K0M A;  2RLI A;  2J9H A;  3WGE A;  4BA7 A;  2GVP A;  1XWK A;  4NMU A;  2FWG A;  3EU3 A;  3QFA C;  2C4J A;  4TRX A;  5HFG A;  4DSS B;  2AYT A;  1TTZ A;  2LNS A;  1WRY A;  1K0O A;  1VF3 A;  1DE2 A;  3HA9 A;  1EV4 A;  2H70 A;  5FWG A;  1EEJ A;  2O8V B;  1K0A A;  4L8E A;  4TR0 A;  3KTB A;  2HI7 A;  3HZ4 A;  1PQN A;  4DSS A;  2KP2 A;  1A0F A;  3HKR A;  5HFK A;  4ECB A;  4WR4 A;  3IK7 A;  5IO2 A;  1S3C A;  2FGX A;  1PKW A;  2H71 A;  1NW2 A;  3EWL A;  3KMN A;  3ZFB A;  1G0T A;  4WET A;  3ZRE A;  3APS A;  1PX6 A;  5D9W A;  2GQM A;  4E8H A;  1XWA A;  2L6C A;  3F9U A;  5GAN D;  1ZL9 A;  2EC4 A;  3CTF A;  2JZT A;  3QMX A;  2E7P A;  2GST A;  3WGX A;  2HYX A;  2H66 A;  2O89 A;  5HQP A;  1GSE A;  3M0F A;  2L6D A;  1F37 A;  1YQ1 A;  3ED3 A;  1OE7 A;  3VWX A;  4WBR D;  3IK9 A;  1R7H A;  2VCT A;  3UBK A;  2VLT A;  2HT9 A;  5DAK B;  2HNL A;  1WOU A;  1M0U A;  1ERU A;  3GKM A;  2KP1 A;  1XWB A;  3LQ7 A;  1KTE A;  5ECO B;  2HZE B;  1HYU A;  1M99 A;  3TKS C;  4V2L A;  1BED A;  2OKA A;  2E0Q A;  4PNF A;  4JR4 A;  2OA7 A;  5J4U A;  1BJX A;  2FA4 A;  5LD0 A;  4WF4 A;  5DAK A;  3QAG A;  4MZC A;  3TCO A;  3P8W A;  5DQY A;  3GFK A;  2GS3 A;  3E3E A;  4HQZ A;  4LA1 A;  2HZE A;  4GWR A;  3LXZ A;  4X0X A;  3GST A;  2FUG 2;  2H76 A;  3KP9 A;  4KDU A;  2FD3 A;  4EF0 A;  4X1U A;  3D21 A;  2KLX A;  1M7T A;  3KTL A;  9GSS A;  3F4S A;  3PR8 A;  1QK8 A;  2TRX A;  1QXH A;  2AV4 A;  3CRT A;  4Q5F A;  3TJJ A;  2GSR A;  3Q18 A;  2LUS A;  1AXD A;  1EGO A;  1ABA A;  5GZZ B;  1A8L A;  3M8N A;  4X43 A;  4JBB A;  4I6X A;  5CAX A;  1SL0 B;  1GSY A;  4AJ8 A;  2LRC A;  3FW2 A;  4POB A;  5DQS A;  1ON4 A;  2H8L A;  3HJP A;  1J0F A;  3L9U A;  3L78 A;  2ON5 A;  1XBS A;  4JU5 A;  4OO5 A;  5IPG A;  2BTO T;  4ZL7 A;  3U6V A;  3TKQ A;  1JHB A;  4AJ6 A;  1ACV A;  2G0F A;  2DC5 A;  4G9H A;  2IN3 A;  2LKU A;  2N5A A;  2MBS A;  2MMN A;  2F9S A;  5KN2 A;  1A24 A;  2V6O A;  1A2L A;  2IPA A;  3TKP A;  1YZX A;  5AIX A;  3EMX A;  3FY7 A;  4XS6 A;  3BCI A;  3DWV A;  4FYU A;  5IMF A;  3BJ5 A;  4DVC A;  3FZ4 A;  3VI5 A;  4J56 E;  3EU4 A;  1MDK A;  5D93 A;  1TDI A;  2VD1 A;  3LGC A;  1SD8 A;  1MD3 A;  2EIQ A;  5G5F A;  3ZRD A;  2VL2 A;  5HFI A;  5CRG A;  2GDR A;  2RUE A;  3ERF A;  5ECL B;  3US3 A;  2HRN A;  3F63 A;  4L0W A;  3A2V A;  3N9J A;  4K6X A;  5HR2 A;  3R2Q A;  3TKR A;  2JSY A;  2P0G A;  2DIY A;  2LJK A;  1B48 A;  1HQO A;  2X8G A;  5AN1 A;  4WKW A;  1Z7P A;  4RQR A;  3EE2 A;  1GNW A;  1TU8 A;  3ZVJ A;  2P5Q A;  1PRX A;  4HQS A;  1SJ6 A;  2YWM A;  2GLR A;  4ML6 A;  3RPN A;  3DD3 A;  1VF2 A;  4OCE A;  4XHM A;  2IMF A;  3HHV A;  4P3Y B;  2M80 A;  2GSS A;  5ECH B;  4IW9 A;  2EIO A;  5JCW A;  2VL9 A;  2ZCT A;  16GS A;  2H6Y A;  3TB2 A;  4WEY A;  3LYK A;  1ML6 A;  1XW5 A;  2CQ9 A;  2ON7 A;  1A2M A;  1EWX A;  3TRP A;  2PUK C;  4G19 A;  4L0U A;  4TOP A;  5D9X A;  5D73 A;  4BWS A;  2RM6 A;  5J9B A;  2YJH A;  1GSU A;  4POK A;  4Q5N A;  3KZQ A;  5CRW A;  3TGZ A;  1AQV A;  1TK5 B;  1GTI A;  4HEA 2;  4XRA A;  4XIH A;  2O87 A;  3MNG A;  1G7O A;  1O73 A;  4GCI A;  1TRS A;  2F8A A;  3UAP A;  5ELG A;  2GZZ A;  4CHS A;  1DUG A;  5COH A;  2GQK A;  4GST A;  4NV5 A;  1H75 A;  2IME A;  1DSB A;  1B9Y C;  2WCI A;  4MAB A;  2VL3 A;  3FK8 A;  5DJM A;  4IJI A;  3QR6 A;  1JZR A;  4OFM A;  5B8B A;  1KNG A;  2FWH A;  3CRU A;  3GUR A;  4IJ3 A;  4V2M A;  5E4W A;  4V1A g;  3WT1 A;  2B7J A;  3QD9 A;  3P90 A;  1QGV A;  3C7M A;  2RM5 A;  1EGR A;  4GQF A;  2AHE A;  3ERW A;  1GUH A;  5H5Q A;  2CT6 A;  3W8J A;  1K0C A;  5F07 A;  4HU9 A;  4TR1 B;  3VFI A;  1ERV A;  1Q98 A;  2P31 A;  1GLQ A;  3EVI A;  1I5G A;  3HVV A;  4NAX A;  2CAQ A;  4OFT A;  2B5Y A;  4HJM A;  2R5G A;  2YN1 A;  4TXV A;  3EUR A;  4NHZ A;  3UAR A;  1N2A A;  3IC4 A;  4WF5 A;  4ILF A;  2VM1 A;  4E8E A;  4TR1 A;  3D0Z A;  2L57 A;  1EP8 A;  1GH2 A;  4TW5 A;  4KA0 A;  4ISD A;  3HD5 A;  3IOS A;  2YZU A;  3DRN A;  3L9V A;  2I1U A;  2VM2 A;  3F3Q A;  2XBI A;  4MZB A;  4OMV A;  2QSI A;  2FNO A;  5G5E A;  2H74 A;  6GSS A;  1B4Q A;  2R2J A;  2VL2 C;  3GV1 A;  4EXJ A;  3QAW A;  1N8J A;  5F05 A;  2OE3 A;  4NWY A;  4GSS A;  3WT2 A;  3IDV A;  4KSO A;  4LL4 B;  2LV3 A;  2MYG A;  2NDO A;  1PSQ A;  5ECS A;  1X9S B;  2JZS A;  3QFB C;  1K0D A;  1PX7 A;  2PWJ A;  1ZGN A;  1K3O A;  2PMT A;  2ALB A;  1TOF A;  4PQI A;  1TXX A;  3KD0 A;  1H4O A;  1V40 A;  1X9W B; 
#chains in the Genus database with same CATH topology
 3D5J A;  2OJL A;  3LYP A;  3DML A;  1LJR A;  3ISO A;  4K0N A;  1QMV A;  5C04 A;  2X64 A;  2C0E A;  4ICY A;  3LG6 A;  1GTB A;  3ZIV A;  4J2F A;  1PL2 A;  3M9J A;  2PVO C;  4OD7 A;  3FZ9 A;  1PGT A;  1WPI A;  2B3S A;  3FR9 A;  4YQU A;  4GQC A;  1A23 A;  1EP7 A;  4K5S A;  1ERT A;  4I8B A;  4XTS A;  3NOF A;  1J9B A;  1NM3 A;  2YAN A;  1FVJ A;  3E9J B;  1TI3 A;  3GA4 A;  2D2Z A;  1FAA A;  2C3Q A;  2MMO A;  3QDN A;  1VGL A;  4OWY A;  3O6T A;  3UOM A;  2PN8 A;  4IBP A;  5KN0 A;  2FLS A;  5H5R A;  2R0P A;  3MWH A;  4F82 A;  1WMJ A;  4A5P A;  4DSQ A;  1F3A A;  2B7K A;  3L9S A;  3RPP A;  22GS A;  4LMV A;  4QL7 A;  2NBS A;  2CV4 A;  1U3I A;  1W89 A;  2DKH A;  2CZ3 A;  2TRC P;  1QFN A;  5KN3 A;  1XFL A;  3CMI A;  3MYD A;  4EIP A;  3DIE A;  1XOA A;  1RQM A;  5CYY A;  3VPT A;  5G31 A;  3ME7 A;  1AQX A;  3N5O A;  2H30 A;  4ECJ A;  4PUF C;  3ZML A;  3Q6O A;  2YWO A;  4YQM A;  2I3Y A;  2VOC A;  4EKZ A;  5CO3 A;  2O7K A;  3VK9 A;  3V1W A;  5JWO B;  3LEF A;  4ZB9 A;  1BYE A;  1SYX A;  3CQF A;  4IN0 A;  3ZYW A;  1UA5 A;  2DBC A;  2OAD A;  3VI7 A;  3GYK A;  3C73 A;  3KJY A;  4EUY A;  2C1Y A;  1R26 A;  4NV2 A;  3HDC A;  1ZZY A;  2HLS A;  2X49 A;  2XBQ A;  3MIX A;  1GWC A;  5IMD A;  1E6B A;  3APQ A;  2LS5 A;  3HCZ A;  3I69 A;  1TK8 B;  4QQ7 A;  4KDX A;  2KOK A;  2H1B A;  2GZY A;  5IMC A;  5HR1 A;  3O76 A;  3A2W A;  4XS4 B;  2YJ7 A;  2GGT A;  4HUA A;  1SKR B;  2NPB A;  5E59 A;  2FWE A;  1AW9 A;  4IEL A;  1YJ6 A;  3HJO A;  3M9K A;  2DKI A;  3O3T A;  3GH9 A;  4YQV A;  4HOJ A;  4XS4 A;  4ZL8 A;  3IHQ A;  2A2S A;  1ILO A;  1OAZ A;  1U87 A;  2CX3 A;  2V2G A;  1QUW A;  4IQ1 A;  2YWN A;  2DSA A;  2DMM A;  4MJE A;  1SKW B;  4N0Z A;  3G7I A;  11GS A;  4CY8 A;  3HVS A;  13GS A;  3I6A A;  1FOV A;  3J7Y b;  4K7I A;  4YAV A;  2JL4 A;  5FT3 A;  4ZL9 A;  2XPD A;  1SK1 A;  2TIR A;  4KF9 A;  5DAL B;  1SJZ A;  1Z7R A;  3LFL A;  1GP1 A;  4MA9 A;  2M72 A;  3IE3 A;  3KH7 A;  4IP1 A;  4KH7 A;  3ZMK A;  1UC7 A;  2M46 A;  5EL8 A;  1V58 A;  4ZXG A;  4EVM A;  4G2E A;  2H1G A;  1JLW A;  1ZCP A;  5C00 A;  4ZIL A;  1PN9 A;  4MDC A;  5DAL A;  4I5Q A;  3GX8 A;  4HZ2 A;  3GKX A;  5BMU A;  1T8E B;  3JCM L;  1YEP A;  2GSQ A;  5IO0 A;  2LTK A;  1Y25 A;  2CVK A;  1M9B A;  1XZO A;  2GT6 A;  1F6M C;  3RBT A;  3R3E A;  5L71 A;  3EC3 A;  4ZBB A;  3PGT A;  2LRN A;  4QL9 A;  2N5F A;  4F9Z A;  2YP6 A;  5JWR B;  3GHA A;  2R4V A;  1XG8 A;  2FY6 A;  4PNG A;  4ECC A;  3UIW A;  1DE1 A;  4AF2 A;  4MNN A;  2V41 A;  2XPE A;  4ECI A;  2AUV A;  4PUR A;  2HRK A;  5DJL A;  3H93 A;  1XPV A;  5ABR A;  3C8E A;  5ECK B;  4PQ1 A;  1X5C A;  1SKS B;  1K0B A;  3H79 A;  1GTA A;  2LJR A;  5F8B A;  3F4T A;  1XCC A;  2C3T A;  2PVQ A;  4EL1 A;  2CZ2 A;  2GTU A;  1TU7 A;  3HYP A;  3VWV A;  3GX0 A;  5DCH A;  1PD2 1;  1TW9 A;  1SK0 A;  4KB3 A;  1O6J A;  1OE8 A;  2K8V A;  1AAZ A;  4KCA A;  5ID2 B;  2JZR A;  3CXG A;  3I9V 2;  3BOA A;  6GSY A;  4FYC A;  1WIK A;  2UZ8 A;  4K9Z A;  4MF5 A;  2V1M A;  1MDJ A;  4BIK A;  4BPY A;  3VWW A;  3AY8 A;  1Z6M A;  3SWL A;  1VF1 A;  2VO4 A;  2HRA A;  1UN2 A;  4POM A;  2I9H A;  5A4W A;  2A4H A;  1G6W A;  2H73 A;  4OO4 A;  1AIU A;  1G7E A;  2IJY A;  5ID2 A;  4CY6 A;  5GST A;  1Y6E A;  3Q19 A;  2NVL A;  2B5E A;  3WGD A;  5ENU A;  3VLN A;  3ZIJ A;  3KXO A;  4IVF A;  2DJ3 A;  2WGR A;  2B5X A;  1YEX A;  2WJU A;  1XW9 A;  2OE0 A;  5IMV A;  3GIX A;  1NSW A;  3M1G A;  3J7Y k;  3IPZ A;  5ECM B;  4MH2 A;  2AJQ B;  4CDO A;  1OC3 A;  4HI7 A;  2WRT A;  3DEX A;  3IAS 2;  4F0B A;  2YCD A;  3FYG A;  12GS A;  5DBQ A;  1MD4 A;  4DSR A;  4MJB A;  3I43 A;  3UJ1 A;  4BVX A;  1GUK A;  3DVX A;  4G0L A;  3UL3 A;  4K7O A;  4WXT A;  2K18 A;  4KAE A;  1I9D A;  1RW1 A;  4IP6 A;  4LMW A;  4PXO A;  5ECQ B;  1YF1 A;  2XC2 A;  3GMF A;  2CAI A;  1ZYP A;  4ZB8 A;  2VCV A;  1ZYQ B;  3KEB A;  3W8S A;  3KIJ A;  3GTU B;  1FB0 A;  2H1A A;  2IMD A;  3D22 A;  3ERG A;  2DJ1 A;  1SEN A;  2I4A A;  4MMM A;  4O5R A;  1BG5 A;  2PER A;  4NPB A;  4ML1 A;  3RDW A;  3E0U A;  1WE0 A;  2YV9 A;  2WB9 A;  3QCP A;  5ECP B;  3EIN A;  3IR4 A;  5B8A A;  3GTU A;  4KE3 A;  5D8I A;  3D6I A;  3KH9 A;  2BJX A;  1CQG A;  4EIQ A;  2DIZ A;  6GST A;  1K3L A;  4GRF A;  3FR3 A;  3A3T A;  1OKD A;  2LRT A;  4J57 E;  2VCX A;  1GRX A;  2WDU A;  1VF4 A;  4XCS A;  6GSU A;  5IOX A;  4F03 A;  3ME8 A;  1B4P A;  3ZVJ D;  3MSZ A;  3QAV A;  2WFC A;  2C0G A;  3OR5 A;  4KCE A;  2PBJ A;  3GKK A;  3H8Q A;  3TJK A;  2BMX A;  5EY6 A;  4KX4 A;  2FWF A;  2H19 A;  5CRH A;  5ELA A;  4D73 B;  3TRX A;  3CSJ A;  4HZ4 A;  2LQQ A;  1CQH A;  1SL2 B;  2F8F A;  5IPH A;  3IV4 A;  3BBY A;  4N30 A;  1Z5Y E;  2VD0 A;  3K8N A;  2XHF A;  3DYR A;  3TJF A;  1FB6 A;  5GSS A;  3TOT A;  4LL1 B;  3TKS A;  6GSX A;  4D73 A;  2IWT A;  4O92 A;  4K0G A;  3FHK A;  3EYT A;  2X8H A;  3GRX A;  4ACS A;  1GL8 A;  1TRU A;  3G7Y A;  4JE1 A;  2V6K A;  2YV7 A;  4MLY A;  2YOI A;  1MEK A;  4BVY B;  4G10 A;  14GS A;  2F3M A;  1T00 A;  4YH2 A;  19GS A;  4BWQ A;  7GSS A;  2E2M A;  3RAZ A;  5HR3 A;  4Q5Q A;  1M2D A;  2K8S A;  4IGJ A;  2A2R A;  1THX A;  2PU9 C;  1PKZ A;  4TR3 A;  2F51 A;  3LSZ A;  4I97 A;  4BVY A;  1TK0 B;  1KEB A;  2H0G A;  3F3R A;  3P7X A;  4NXI A;  2QC7 A;  1PL1 A;  4MJA A;  1WP0 A;  2C0F A;  2HFD A;  4ID0 A;  4RQX A;  2A4V A;  3TOU A;  1TRW A;  3IRA A;  1GSQ A;  4PX1 A;  1HNC A;  5G30 A;  3ZIT A;  2C3N A;  2JAD A;  1EOH A;  2E2G A;  5DDL A;  3GH6 A;  2HSH A;  2VAF A;  3CTG A;  1THO A;  2MBT A;  3FEU A;  1R5A A;  3TJG A;  3TDG A;  4ZB6 A;  1KBN A;  4MCU A;  1X9M B;  5KN1 A;  1AQW A;  3HZ8 A;  5J41 A;  1ERW A;  3GL5 A;  2C0D A;  4USS A;  1XXU A;  2ZUP A;  5B7C A;  2ES7 A;  3LWA A;  3F4R A;  1XVW A;  2JU5 A;  2DML A;  3GN3 A;  3F6D A;  5HR0 A;  5G1L A;  3TKS E;  1HNB A;  1GSS A;  3H4K A;  2YNX A;  4DEJ A;  1UVZ A;  1T4Z A;  3WYW A;  6GSV A;  1T1V A;  1PN0 A;  2GZP A;  2DJ2 A;  2YPM A;  4X4J A;  5DVB A;  3DVW A;  5JWQ B;  1GTU A;  3ZLP A;  1G6Y A;  1K3Y A;  4IQA A;  1GUM A;  1OC8 A;  1XIY A;  1M2B A;  5IQY A;  2DJK A;  1M9A A;  1OC9 B;  1LBK A;  3IA1 A;  4F0C A;  1E2Y A;  4G0I A;  4I2T A;  1USB A;  4YKG A;  4FYB A;  3UBL A;  1XVQ A;  3GNJ A;  4MF7 A;  3IHG A;  3VPQ A;  1T4Y A;  1VRS D;  4Z7X A;  2EIR A;  1OC9 A;  2WS2 A;  3F8U A;  3P2A A;  1ST9 A;  3VUR A;  1GSD A;  1JZO A;  3HJM A;  1R5P A;  1Z6N A;  5B6M A;  4L5O A;  2L5O A;  3G9B A;  2RII A;  17GS A;  1MTC A;  3H1N A;  3BCK A;  3APO A;  3CBU A;  3GL3 A;  5A4U A;  2R6K A;  4JZQ A;  6GSW A;  1HNA A;  3ZTL A;  1EOG A;  2DJJ A;  1U6T A;  1BQ7 A;  2C8U A;  4FO5 A;  3C1R A;  4TXO B;  4PGT A;  2H75 A;  3DGQ A;  1AC1 A;  3CSH A;  5J9C A;  2AB6 A;  4AJ7 A;  3D4M A;  4BL7 B;  4HDE A;  3PH9 A;  2H1D A;  1K0N A;  1WJK A;  5A5K A;  4TXO A;  5CRD A;  1Q4J A;  10GS A;  3F6F A;  3IC8 A;  1XOB A;  2H0I A;  3KGK A;  1TKD B;  3UVH A;  4MF6 A;  1T3B A;  2FA8 A;  2HRF A;  1JLV A;  4RI7 A;  4ZBD A;  4BL7 A;  2R3X A;  2KHP A;  2LST A;  4XRD A;  3KM6 A;  1V98 A;  2REM A;  3FMW A;  3QOU A;  4Z2U A;  4Z2T A;  2I81 A;  5LNK e;  2AAW A;  2X8C A;  3GKN A;  5IMA A;  1SJI A;  4K1F A;  4POL A;  2L59 A;  2PGT A;  1S3D A;  5FHI A;  1RK4 A;  4TR4 A;  5H5S A;  4JED A;  4MK3 A;  1YF0 A;  1A8Y A;  3SBC A;  4I2U A;  3FZ5 A;  2IMK A;  3W6G A;  4RUV A;  4K7N A;  2IMI A;  4GSN A;  3RHB A;  2H0H A;  4MPF A;  5G2Z A;  3ZL5 A;  4EDZ A;  4MZW A;  1A0R P;  2PPT A;  1FHE A;  1XWG A;  2H6X A;  1OYJ A;  4LLR A;  2GT5 A;  2DLX A;  1V57 A;  1TI1 A;  2LQO A;  4IS0 A;  1GSF A;  1IYH A;  3L4N A;  3NIV A;  1SD9 A;  4EO3 A;  2VCW A;  3M3M A;  1ZYE A;  2MZC A;  1GNE A;  2VIM A;  3A2X A;  1BX9 A;  4Z2R A;  4MJC A;  4GLT A;  4MPG A;  1GLP A;  1LU4 A;  2K6V A;  3KCM A;  5BRT A;  2HZF A;  1BAY A;  5F0G A;  4MH3 A;  5G1K A;  2X99 A;  5AIV A;  5IIZ A;  5KOX A;  5J3R A;  2VUP A;  1XWC A;  5CRE A;  4EC0 A;  5LCZ A;  1O81 A;  1JZD A;  1V9W A;  18GS A;  1C72 A;  1F9M A;  3HVX A;  2JAC A;  1TJD A;  3U5R E;  1B8X A;  4CW9 A;  2O85 A;  3C71 A;  2B6M A;  2N5B A;  3G7J A;  2WZ9 A;  5D96 A;  4N11 A;  3IBH A;  4K2D A;  3QPM A;  4GXZ A;  1JFU A;  1Z9H A;  2DJ0 A;  3EPT A;  3FZA A;  5IMZ A;  1OVN A;  4TKY A;  4KND A;  1M2A A;  1ZOF A;  1EV9 A;  4F2I A;  4HS1 A;  5INY A;  1O8W A;  2HE3 A;  4IKH A;  3LXT A;  1DBY A;  4H86 A;  5KEJ A;  3KMO A;  5D9V A;  1R4W A;  4N10 A;  4TN8 A;  3DKS A;  2LJA A;  2RUF A;  3BD2 A;  4FH8 A;  2MMZ A;  5ECI B;  1FW1 A;  2OAC A;  1O7U A;  2NTO A;  2VLU A;  3GUS A;  4KUN A;  5D9T A;  3HY2 A;  3TJB A;  3F0I A;  5JCU A;  4RI6 A;  5JCG A;  3L0H A;  5B6N A;  2V32 A;  3WD6 A;  5ECR B;  4V1A p;  3VWU A;  1X0R A;  4PUA A;  2QA1 A;  3FKF A;  2MMA A;  4WR5 A;  1FO5 A;  1TRV A;  4HU7 A;  3TUE A;  4AGS A;  3HXS A;  3ZFL A;  2J23 A;  5AIS A;  5GAP D;  2C80 A;  3TRQ A;  2ZNM A;  2VCQ A;  1U88 A;  4YAP A;  4MP4 A;  3ZZX A;  2Z9S A;  4TVE A;  1O8X A;  1JZW A;  1O85 A;  2H72 A;  1X5D A;  2CA8 A;  2OBI A;  4N0V A;  2CVB A;  2P5R A;  2YWI A;  1EZK A;  5IOW A;  2CVD A;  2KUC A;  5ECN B;  4ZIJ A;  2H6Z A;  1F2E A;  1YKC A;  4O7H A;  1U3A A;  2R37 A;  3GSS A;  3NZN A;  4FIW A;  2WUL A;  3MAK A;  2OBK A;  1HD2 A;  1SU9 A;  4PQH A;  4EDY A;  4Q5R A;  1IYI A;  5F06 A;  1GUL A;  1ZYN A;  3A5W A;  5IM9 A;  3CSI A;  4ULX A;  4WBJ A;  3UMA A;  1NHY A;  2JSZ A;  4HSC X;  2FHE A;  2L4Q A;  4KW6 A;  2B1K A;  5EVO A;  2K9F A;  3CYN A;  3LJR A;  1F3B A;  4GTU A;  3EMP A;  1ZMA A;  2VCZ A;  1MDI A;  4KDY A;  4JRR A;  1QQ2 A;  3FR6 A;  4EE0 A;  4KGI A;  3LW9 A;  2IFQ B;  2L5L A;  4ZBA A;  2CX4 A;  2OE1 A;  1YKA A;  2HSY A;  2IL3 A;  2B1L A;  1OKT A;  3IXR A;  20GS A;  1B9X C;  3UEM A;  2LNT A;  2QKE A;  4OCF A;  2HSM A;  1WWJ A;  2IIY A;  4XS1 A;  3PIN A;  5DCG A;  4KSM A;  1W4V A;  1SL1 B;  8GSS A;  2IFQ A;  2HXK A;  4GF0 A;  4K8M A;  1PMT A;  1NHO A;  5AGY A;  1FVK A;  3D4T A;  1J08 A;  3IAM 2;  3Q74 A;  2QGV A;  5CNW A;  3RHC A;  3FRC A;  1XW6 A;  1S3A A;  4IHU A;  1V2A A;  2FCH A;  3DXB A;  3MDK A;  4FQU A;  3UVT A;  2H01 A;  1SYR A;  4OFN A;  1A2J A;  1TP9 A;  2GQL A;  4L5L A;  1YDK A;  1AUC A;  2L4C A;  1M3J A;  4NHW A;  5J5N A;  4V2N A;  1T7P B;  3KP8 A;  1EEM A;  4YKF A;  2YZH A;  5CP1 A;  2VLV A;  4JR6 A;  5EPF A;  1SK2 A;  1Z3E A;  1PFO A;  2G2Q A;  1M3I A;  1X5E A;  3S9F A;  3LOR A;  1PA3 A;  3C1S A;  4O32 A;  1YY7 A;  1URM A;  5A4V A;  2LEG A;  1FG4 A;  4HJ2 A;  1K0M A;  2RLI A;  2J9H A;  3WGE A;  4BA7 A;  2GVP A;  1XWK A;  4NMU A;  2FWG A;  3EU3 A;  3QFA C;  2C4J A;  4TRX A;  5HFG A;  4DSS B;  2AYT A;  1TTZ A;  2LNS A;  1WRY A;  1K0O A;  1VF3 A;  1DE2 A;  3HA9 A;  1EV4 A;  2H70 A;  5FWG A;  1EEJ A;  2O8V B;  1K0A A;  4L8E A;  4TR0 A;  3KTB A;  2HI7 A;  3HZ4 A;  1PQN A;  4DSS A;  2KP2 A;  1A0F A;  3HKR A;  5HFK A;  4ECB A;  4O5U A;  4WR4 A;  3IK7 A;  5IO2 A;  1S3C A;  1S3R A;  2FGX A;  1PKW A;  2H71 A;  1NW2 A;  3EWL A;  3KMN A;  3ZFB A;  1G0T A;  2A2P A;  4WET A;  3ZRE A;  3APS A;  1PX6 A;  5D9W A;  2GQM A;  4E8H A;  1XWA A;  2L6C A;  3F9U A;  5GAN D;  3PPU A;  1ZL9 A;  2EC4 A;  3CTF A;  2JZT A;  3QMX A;  2E7P A;  2GST A;  3WGX A;  2HYX A;  2H66 A;  2O89 A;  5HQP A;  1GSE A;  3A5I A;  3M0F A;  2L6D A;  1F37 A;  1YQ1 A;  3ED3 A;  1OE7 A;  3VWX A;  4WBR D;  3IK9 A;  1R7H A;  2VCT A;  3UBK A;  2VLT A;  2HT9 A;  5DAK B;  2HNL A;  1WOU A;  1M0U A;  1ERU A;  3GKM A;  2KP1 A;  1XWB A;  3LQ7 A;  1KTE A;  5ECO B;  2HZE B;  1HYU A;  1M99 A;  3TKS C;  4V2L A;  1BED A;  2OKA A;  2E0Q A;  4PNF A;  4JR4 A;  2OA7 A;  5J4U A;  1BJX A;  2FA4 A;  5LD0 A;  4WF4 A;  5DAK A;  3QAG A;  4MZC A;  3TCO A;  3P8W A;  5DQY A;  3GFK A;  2GS3 A;  3E3E A;  4HQZ A;  4LA1 A;  2HZE A;  4GWR A;  3LXZ A;  4X0X A;  3GST A;  2FUG 2;  2H76 A;  3KP9 A;  4KDU A;  2FD3 A;  4EF0 A;  4X1U A;  3D21 A;  2KLX A;  1M7T A;  3KTL A;  9GSS A;  3F4S A;  3PR8 A;  1QK8 A;  2TRX A;  5KOW A;  1QXH A;  2AV4 A;  3CRT A;  4Q5F A;  3TJJ A;  2GSR A;  3Q18 A;  2LUS A;  1AXD A;  1EGO A;  1ABA A;  5GZZ B;  1A8L A;  3M8N A;  4X43 A;  4JBB A;  4I6X A;  5CAX A;  1SL0 B;  1GSY A;  4AJ8 A;  2LRC A;  3FW2 A;  4POB A;  5DQS A;  1ON4 A;  2H8L A;  3HJP A;  2QA2 A;  1J0F A;  3L9U A;  4K5R A;  3L78 A;  2ON5 A;  1XBS A;  4JU5 A;  4OO5 A;  5IPG A;  2BTO T;  4ZL7 A;  2X4A A;  3U6V A;  3TKQ A;  1JHB A;  4AJ6 A;  1ACV A;  2G0F A;  2DC5 A;  4G9H A;  2IN3 A;  2LKU A;  2N5A A;  2MBS A;  2MMN A;  2F9S A;  5KN2 A;  1A24 A;  2V6O A;  1A2L A;  2IPA A;  3TKP A;  1YZX A;  5AIX A;  2R0G A;  3EMX A;  3FY7 A;  4XS6 A;  3BCI A;  3DWV A;  4FYU A;  5IMF A;  3BJ5 A;  4DVC A;  3FZ4 A;  3VI5 A;  4J56 E;  3EU4 A;  1MDK A;  5D93 A;  1TDI A;  2VD1 A;  3LGC A;  1SD8 A;  1MD3 A;  2EIQ A;  5G5F A;  3ZRD A;  2VL2 A;  5HFI A;  5CRG A;  2GDR A;  2RUE A;  3ERF A;  5ECL B;  3US3 A;  2HRN A;  3F63 A;  4L0W A;  3A2V A;  3N9J A;  4K6X A;  5HR2 A;  3R2Q A;  3TKR A;  2JSY A;  2P0G A;  2DIY A;  2LJK A;  4G0K A;  1B48 A;  1HQO A;  2X8G A;  5AN1 A;  4WKW A;  1Z7P A;  4PTS A;  4RQR A;  3EE2 A;  1GNW A;  1TU8 A;  3ZVJ A;  2P5Q A;  1PRX A;  4HQS A;  1SJ6 A;  2YWM A;  2GLR A;  4ML6 A;  3RPN A;  3DD3 A;  1VF2 A;  4OCE A;  4XHM A;  2IMF A;  3HHV A;  4P3Y B;  1FOH A;  2M80 A;  2GSS A;  5ECH B;  4IW9 A;  2EIO A;  5JCW A;  2VL9 A;  2ZCT A;  16GS A;  2H6Y A;  3TB2 A;  4WEY A;  3LYK A;  1ML6 A;  1XW5 A;  2CQ9 A;  2ON7 A;  1A2M A;  1EWX A;  3TRP A;  2PUK C;  4G19 A;  4L0U A;  4TOP A;  5D9X A;  5D73 A;  4BWS A;  2RM6 A;  5J9B A;  2YJH A;  1GSU A;  4POK A;  4Q5N A;  3KZQ A;  5CRW A;  3TGZ A;  1AQV A;  1TK5 B;  1GTI A;  4HEA 2;  4XRA A;  4XIH A;  4BVX B;  2O87 A;  3MNG A;  1G7O A;  1O73 A;  4GCI A;  1TRS A;  2F8A A;  3UAP A;  5ELG A;  2GZZ A;  4CHS A;  1DUG A;  5COH A;  2GQK A;  4GST A;  4NV5 A;  1H75 A;  2IME A;  1DSB A;  1B9Y C;  2WCI A;  4MAB A;  2VL3 A;  3FK8 A;  5DJM A;  4IJI A;  3QR6 A;  1JZR A;  4OFM A;  5B8B A;  1KNG A;  2FWH A;  3CRU A;  3GUR A;  4IJ3 A;  4V2M A;  5E4W A;  4V1A g;  3WT1 A;  2B7J A;  2R0C A;  3QD9 A;  3P90 A;  1QGV A;  3C7M A;  2RM5 A;  1EGR A;  4GQF A;  2AHE A;  3ERW A;  1GUH A;  5H5Q A;  2CT6 A;  3W8J A;  1K0C A;  5F07 A;  4HU9 A;  4TR1 B;  3VFI A;  1ERV A;  1Q98 A;  2P31 A;  1GLQ A;  3EVI A;  1I5G A;  3HVV A;  4NAX A;  2CAQ A;  4OFT A;  2B5Y A;  4HJM A;  2R5G A;  2YN1 A;  4TXV A;  3EUR A;  4NHZ A;  3UAR A;  1N2A A;  4K2X A;  3IC4 A;  4WF5 A;  4ILF A;  2VM1 A;  4E8E A;  4TR1 A;  3D0Z A;  2L57 A;  1EP8 A;  1GH2 A;  4TW5 A;  4KA0 A;  4ISD A;  3HD5 A;  3IOS A;  2YZU A;  3DRN A;  3L9V A;  2I1U A;  2VM2 A;  3F3Q A;  2XBI A;  4MZB A;  4OMV A;  2QSI A;  2FNO A;  5G5E A;  3HVN A;  2H74 A;  6GSS A;  1B4Q A;  2R2J A;  2VL2 C;  3GV1 A;  4EXJ A;  3QAW A;  1N8J A;  5F05 A;  2OE3 A;  4NWY A;  4GSS A;  3WT2 A;  3IDV A;  4KSO A;  4LL4 B;  2LV3 A;  2MYG A;  4O5Q A;  2NDO A;  1PSQ A;  5ECS A;  1X9S B;  2JZS A;  3QFB C;  1K0D A;  1PX7 A;  2PWJ A;  1ZGN A;  1K3O A;  2PMT A;  2ALB A;  1TOF A;  4PQI A;  1TXX A;  3KD0 A;  1H4O A;  1V40 A;  1X9W B; 
#chains in the Genus database with same CATH homology
 3D5J A;  2OJL A;  3LYP A;  3DML A;  1LJR A;  3ISO A;  4K0N A;  1QMV A;  5C04 A;  2X64 A;  2C0E A;  4ICY A;  3LG6 A;  1GTB A;  3ZIV A;  4J2F A;  1PL2 A;  3M9J A;  2PVO C;  4OD7 A;  3FZ9 A;  1PGT A;  1WPI A;  2B3S A;  3FR9 A;  4YQU A;  4GQC A;  1A23 A;  1EP7 A;  4K5S A;  1ERT A;  4I8B A;  4XTS A;  3NOF A;  1J9B A;  1NM3 A;  2YAN A;  1FVJ A;  3E9J B;  1TI3 A;  3GA4 A;  2D2Z A;  1FAA A;  2C3Q A;  2MMO A;  3QDN A;  1VGL A;  4OWY A;  3O6T A;  3UOM A;  2PN8 A;  4IBP A;  5KN0 A;  2FLS A;  5H5R A;  2R0P A;  3MWH A;  4F82 A;  1WMJ A;  4A5P A;  4DSQ A;  1F3A A;  2B7K A;  3L9S A;  3RPP A;  22GS A;  4LMV A;  4QL7 A;  2NBS A;  2CV4 A;  1U3I A;  1W89 A;  2DKH A;  2CZ3 A;  2TRC P;  1QFN A;  5KN3 A;  1XFL A;  3CMI A;  3MYD A;  4EIP A;  3DIE A;  1XOA A;  1RQM A;  5CYY A;  3VPT A;  5G31 A;  3ME7 A;  1AQX A;  3N5O A;  2H30 A;  4ECJ A;  4PUF C;  3ZML A;  3Q6O A;  2YWO A;  4YQM A;  2I3Y A;  2VOC A;  4EKZ A;  5CO3 A;  2O7K A;  3VK9 A;  3V1W A;  5JWO B;  3LEF A;  4ZB9 A;  1BYE A;  1SYX A;  4IN0 A;  3ZYW A;  1UA5 A;  2DBC A;  2OAD A;  3VI7 A;  3GYK A;  3C73 A;  3KJY A;  4EUY A;  2C1Y A;  1R26 A;  4NV2 A;  3HDC A;  1ZZY A;  2HLS A;  2X49 A;  2XBQ A;  3MIX A;  1GWC A;  5IMD A;  1E6B A;  3APQ A;  2LS5 A;  3HCZ A;  3I69 A;  1TK8 B;  4QQ7 A;  4KDX A;  2KOK A;  2H1B A;  2GZY A;  5IMC A;  5HR1 A;  3O76 A;  3A2W A;  4XS4 B;  2YJ7 A;  2GGT A;  4HUA A;  1SKR B;  2NPB A;  5E59 A;  2FWE A;  1AW9 A;  4IEL A;  1YJ6 A;  3HJO A;  3M9K A;  2DKI A;  3O3T A;  3GH9 A;  4YQV A;  4HOJ A;  4XS4 A;  4ZL8 A;  3IHQ A;  2A2S A;  1ILO A;  1OAZ A;  1U87 A;  2CX3 A;  2V2G A;  1QUW A;  4IQ1 A;  2YWN A;  2DSA A;  2DMM A;  4MJE A;  1SKW B;  4N0Z A;  3G7I A;  11GS A;  4CY8 A;  3HVS A;  13GS A;  3I6A A;  1FOV A;  3J7Y b;  4K7I A;  4YAV A;  2JL4 A;  5FT3 A;  4ZL9 A;  2XPD A;  1SK1 A;  2TIR A;  4KF9 A;  5DAL B;  1SJZ A;  1Z7R A;  3LFL A;  1GP1 A;  4MA9 A;  2M72 A;  3IE3 A;  3KH7 A;  4IP1 A;  4KH7 A;  3ZMK A;  1UC7 A;  2M46 A;  5EL8 A;  1V58 A;  4ZXG A;  4EVM A;  4G2E A;  2H1G A;  1JLW A;  1ZCP A;  5C00 A;  4ZIL A;  1PN9 A;  4MDC A;  5DAL A;  4I5Q A;  3GX8 A;  4HZ2 A;  3GKX A;  5BMU A;  1T8E B;  3JCM L;  1YEP A;  2GSQ A;  5IO0 A;  2LTK A;  1Y25 A;  2CVK A;  1M9B A;  1XZO A;  2GT6 A;  1F6M C;  3RBT A;  3R3E A;  5L71 A;  3EC3 A;  4ZBB A;  3PGT A;  2LRN A;  4QL9 A;  2N5F A;  4F9Z A;  2YP6 A;  5JWR B;  3GHA A;  2R4V A;  2FY6 A;  4PNG A;  4ECC A;  3UIW A;  1DE1 A;  4AF2 A;  4MNN A;  2V41 A;  2XPE A;  4ECI A;  2AUV A;  4PUR A;  2HRK A;  5DJL A;  3H93 A;  1XPV A;  5ABR A;  3C8E A;  5ECK B;  4PQ1 A;  1X5C A;  1SKS B;  1K0B A;  3H79 A;  1GTA A;  2LJR A;  5F8B A;  3F4T A;  1XCC A;  2C3T A;  2PVQ A;  4EL1 A;  2CZ2 A;  2GTU A;  1TU7 A;  3HYP A;  3VWV A;  3GX0 A;  5DCH A;  1PD2 1;  1TW9 A;  1SK0 A;  4KB3 A;  1O6J A;  1OE8 A;  2K8V A;  1AAZ A;  4KCA A;  5ID2 B;  2JZR A;  3CXG A;  3I9V 2;  3BOA A;  6GSY A;  4FYC A;  1WIK A;  2UZ8 A;  4K9Z A;  4MF5 A;  2V1M A;  1MDJ A;  4BPY A;  3VWW A;  3AY8 A;  1Z6M A;  3SWL A;  1VF1 A;  2VO4 A;  2HRA A;  1UN2 A;  4POM A;  2I9H A;  5A4W A;  2A4H A;  1G6W A;  2H73 A;  4OO4 A;  1AIU A;  1G7E A;  2IJY A;  5ID2 A;  4CY6 A;  5GST A;  1Y6E A;  3Q19 A;  2NVL A;  2B5E A;  3WGD A;  5ENU A;  3VLN A;  3ZIJ A;  3KXO A;  4IVF A;  2DJ3 A;  2WGR A;  2B5X A;  1YEX A;  2WJU A;  1XW9 A;  2OE0 A;  5IMV A;  3GIX A;  1NSW A;  3M1G A;  3J7Y k;  3IPZ A;  5ECM B;  4MH2 A;  2AJQ B;  4CDO A;  1OC3 A;  4HI7 A;  2WRT A;  3DEX A;  3IAS 2;  4F0B A;  2YCD A;  3FYG A;  12GS A;  5DBQ A;  1MD4 A;  4DSR A;  4MJB A;  3I43 A;  3UJ1 A;  4BVX A;  1GUK A;  3DVX A;  4G0L A;  3UL3 A;  4K7O A;  4WXT A;  2K18 A;  4KAE A;  1I9D A;  1RW1 A;  4IP6 A;  4LMW A;  4PXO A;  5ECQ B;  1YF1 A;  2XC2 A;  3GMF A;  2CAI A;  1ZYP A;  4ZB8 A;  2VCV A;  1ZYQ B;  3KEB A;  3W8S A;  3KIJ A;  3GTU B;  1FB0 A;  2H1A A;  2IMD A;  3D22 A;  3ERG A;  2DJ1 A;  1SEN A;  2I4A A;  4MMM A;  4O5R A;  1BG5 A;  2PER A;  4NPB A;  4ML1 A;  3RDW A;  3E0U A;  1WE0 A;  2YV9 A;  2WB9 A;  3QCP A;  5ECP B;  3EIN A;  3IR4 A;  5B8A A;  3GTU A;  4KE3 A;  5D8I A;  3D6I A;  3KH9 A;  2BJX A;  1CQG A;  4EIQ A;  2DIZ A;  6GST A;  1K3L A;  4GRF A;  3FR3 A;  3A3T A;  1OKD A;  2LRT A;  4J57 E;  2VCX A;  1GRX A;  2WDU A;  1VF4 A;  4XCS A;  6GSU A;  5IOX A;  4F03 A;  3ME8 A;  1B4P A;  3ZVJ D;  3MSZ A;  3QAV A;  2WFC A;  2C0G A;  3OR5 A;  4KCE A;  2PBJ A;  3GKK A;  3H8Q A;  3TJK A;  2BMX A;  5EY6 A;  4KX4 A;  2FWF A;  2H19 A;  5CRH A;  5ELA A;  4D73 B;  3TRX A;  3CSJ A;  4HZ4 A;  2LQQ A;  1CQH A;  1SL2 B;  2F8F A;  5IPH A;  3IV4 A;  3BBY A;  4N30 A;  1Z5Y E;  2VD0 A;  3K8N A;  2XHF A;  3DYR A;  3TJF A;  1FB6 A;  5GSS A;  3TOT A;  4LL1 B;  3TKS A;  6GSX A;  4D73 A;  2IWT A;  4O92 A;  4K0G A;  3FHK A;  3EYT A;  2X8H A;  3GRX A;  4ACS A;  1GL8 A;  1TRU A;  3G7Y A;  4JE1 A;  2V6K A;  2YV7 A;  4MLY A;  2YOI A;  1MEK A;  4BVY B;  4G10 A;  14GS A;  2F3M A;  1T00 A;  4YH2 A;  19GS A;  4BWQ A;  7GSS A;  2E2M A;  3RAZ A;  5HR3 A;  4Q5Q A;  1M2D A;  2K8S A;  4IGJ A;  2A2R A;  1THX A;  2PU9 C;  1PKZ A;  4TR3 A;  2F51 A;  3LSZ A;  4I97 A;  4BVY A;  1TK0 B;  1KEB A;  2H0G A;  3F3R A;  3P7X A;  4NXI A;  2QC7 A;  1PL1 A;  4MJA A;  1WP0 A;  2C0F A;  2HFD A;  4ID0 A;  4RQX A;  2A4V A;  3TOU A;  1TRW A;  3IRA A;  1GSQ A;  4PX1 A;  1HNC A;  5G30 A;  3ZIT A;  2C3N A;  2JAD A;  1EOH A;  2E2G A;  5DDL A;  3GH6 A;  2HSH A;  2VAF A;  3CTG A;  1THO A;  2MBT A;  3FEU A;  1R5A A;  3TJG A;  3TDG A;  4ZB6 A;  1KBN A;  4MCU A;  1X9M B;  5KN1 A;  1AQW A;  3HZ8 A;  5J41 A;  1ERW A;  3GL5 A;  2C0D A;  4USS A;  1XXU A;  2ZUP A;  5B7C A;  2ES7 A;  3LWA A;  3F4R A;  1XVW A;  2JU5 A;  2DML A;  3GN3 A;  3F6D A;  5HR0 A;  5G1L A;  3TKS E;  1HNB A;  1GSS A;  3H4K A;  2YNX A;  4DEJ A;  1UVZ A;  1T4Z A;  3WYW A;  6GSV A;  1T1V A;  1PN0 A;  2GZP A;  2DJ2 A;  2YPM A;  4X4J A;  5DVB A;  3DVW A;  5JWQ B;  1GTU A;  3ZLP A;  1G6Y A;  1K3Y A;  4IQA A;  1GUM A;  1OC8 A;  1XIY A;  1M2B A;  5IQY A;  2DJK A;  1M9A A;  1OC9 B;  1LBK A;  3IA1 A;  4F0C A;  1E2Y A;  4G0I A;  4I2T A;  1USB A;  4YKG A;  4FYB A;  3UBL A;  1XVQ A;  3GNJ A;  4MF7 A;  3IHG A;  3VPQ A;  1T4Y A;  1VRS D;  4Z7X A;  2EIR A;  1OC9 A;  2WS2 A;  3F8U A;  3P2A A;  1ST9 A;  3VUR A;  1GSD A;  1JZO A;  3HJM A;  1R5P A;  1Z6N A;  5B6M A;  4L5O A;  2L5O A;  3G9B A;  2RII A;  17GS A;  1MTC A;  3H1N A;  3BCK A;  3APO A;  3CBU A;  3GL3 A;  5A4U A;  2R6K A;  4JZQ A;  6GSW A;  1HNA A;  3ZTL A;  1EOG A;  2DJJ A;  1U6T A;  1BQ7 A;  2C8U A;  4FO5 A;  3C1R A;  4TXO B;  4PGT A;  2H75 A;  3DGQ A;  1AC1 A;  3CSH A;  5J9C A;  2AB6 A;  4AJ7 A;  3D4M A;  4BL7 B;  4HDE A;  3PH9 A;  2H1D A;  1K0N A;  1WJK A;  5A5K A;  4TXO A;  5CRD A;  1Q4J A;  10GS A;  3F6F A;  3IC8 A;  1XOB A;  2H0I A;  3KGK A;  1TKD B;  3UVH A;  4MF6 A;  1T3B A;  2FA8 A;  2HRF A;  1JLV A;  4RI7 A;  4ZBD A;  4BL7 A;  2R3X A;  2KHP A;  2LST A;  4XRD A;  3KM6 A;  1V98 A;  2REM A;  3FMW A;  3QOU A;  4Z2U A;  4Z2T A;  2I81 A;  5LNK e;  2AAW A;  2X8C A;  3GKN A;  5IMA A;  1SJI A;  4K1F A;  4POL A;  2L59 A;  2PGT A;  1S3D A;  5FHI A;  1RK4 A;  4TR4 A;  5H5S A;  4JED A;  4MK3 A;  1YF0 A;  1A8Y A;  3SBC A;  4I2U A;  3FZ5 A;  2IMK A;  3W6G A;  4RUV A;  4K7N A;  2IMI A;  4GSN A;  3RHB A;  2H0H A;  4MPF A;  5G2Z A;  3ZL5 A;  4EDZ A;  4MZW A;  1A0R P;  2PPT A;  1FHE A;  1XWG A;  2H6X A;  1OYJ A;  4LLR A;  2GT5 A;  2DLX A;  1V57 A;  1TI1 A;  2LQO A;  4IS0 A;  1GSF A;  1IYH A;  3L4N A;  3NIV A;  1SD9 A;  4EO3 A;  2VCW A;  3M3M A;  1ZYE A;  2MZC A;  1GNE A;  2VIM A;  3A2X A;  1BX9 A;  4Z2R A;  4MJC A;  4GLT A;  4MPG A;  1GLP A;  1LU4 A;  2K6V A;  3KCM A;  5BRT A;  2HZF A;  1BAY A;  5F0G A;  4MH3 A;  5G1K A;  2X99 A;  5AIV A;  5IIZ A;  5KOX A;  5J3R A;  2VUP A;  1XWC A;  5CRE A;  4EC0 A;  5LCZ A;  1O81 A;  1JZD A;  1V9W A;  18GS A;  1C72 A;  1F9M A;  3HVX A;  2JAC A;  1TJD A;  3U5R E;  1B8X A;  4CW9 A;  2O85 A;  3C71 A;  2B6M A;  2N5B A;  3G7J A;  2WZ9 A;  5D96 A;  4N11 A;  3IBH A;  4K2D A;  3QPM A;  4GXZ A;  1JFU A;  1Z9H A;  2DJ0 A;  3EPT A;  3FZA A;  5IMZ A;  1OVN A;  4TKY A;  4KND A;  1M2A A;  1ZOF A;  1EV9 A;  4F2I A;  4HS1 A;  5INY A;  1O8W A;  2HE3 A;  4IKH A;  3LXT A;  1DBY A;  4H86 A;  5KEJ A;  3KMO A;  5D9V A;  1R4W A;  4N10 A;  4TN8 A;  3DKS A;  2LJA A;  2RUF A;  3BD2 A;  4FH8 A;  2MMZ A;  5ECI B;  1FW1 A;  2OAC A;  1O7U A;  2NTO A;  2VLU A;  3GUS A;  4KUN A;  5D9T A;  3HY2 A;  3TJB A;  3F0I A;  5JCU A;  4RI6 A;  5JCG A;  3L0H A;  5B6N A;  2V32 A;  3WD6 A;  5ECR B;  4V1A p;  3VWU A;  1X0R A;  4PUA A;  2QA1 A;  3FKF A;  2MMA A;  4WR5 A;  1FO5 A;  1TRV A;  4HU7 A;  3TUE A;  4AGS A;  3HXS A;  3ZFL A;  2J23 A;  5AIS A;  5GAP D;  2C80 A;  3TRQ A;  2ZNM A;  2VCQ A;  1U88 A;  4YAP A;  4MP4 A;  3ZZX A;  2Z9S A;  4TVE A;  1O8X A;  1JZW A;  1O85 A;  2H72 A;  1X5D A;  2CA8 A;  2OBI A;  4N0V A;  2CVB A;  2P5R A;  2YWI A;  1EZK A;  5IOW A;  2CVD A;  2KUC A;  5ECN B;  4ZIJ A;  2H6Z A;  1F2E A;  1YKC A;  4O7H A;  1U3A A;  2R37 A;  3GSS A;  3NZN A;  4FIW A;  2WUL A;  3MAK A;  2OBK A;  1HD2 A;  1SU9 A;  4PQH A;  4EDY A;  4Q5R A;  1IYI A;  5F06 A;  1GUL A;  1ZYN A;  3A5W A;  5IM9 A;  3CSI A;  4ULX A;  4WBJ A;  3UMA A;  1NHY A;  2JSZ A;  2FHE A;  2L4Q A;  4KW6 A;  2B1K A;  5EVO A;  2K9F A;  3CYN A;  3LJR A;  1F3B A;  4GTU A;  3EMP A;  1ZMA A;  2VCZ A;  1MDI A;  4KDY A;  4JRR A;  1QQ2 A;  3FR6 A;  4EE0 A;  4KGI A;  3LW9 A;  2IFQ B;  2L5L A;  4ZBA A;  2CX4 A;  2OE1 A;  1YKA A;  2HSY A;  2IL3 A;  2B1L A;  1OKT A;  3IXR A;  20GS A;  1B9X C;  3UEM A;  2LNT A;  2QKE A;  4OCF A;  2HSM A;  1WWJ A;  2IIY A;  4XS1 A;  3PIN A;  5DCG A;  4KSM A;  1W4V A;  1SL1 B;  8GSS A;  2IFQ A;  2HXK A;  4GF0 A;  4K8M A;  1PMT A;  1NHO A;  5AGY A;  1FVK A;  3D4T A;  1J08 A;  3IAM 2;  3Q74 A;  2QGV A;  5CNW A;  3RHC A;  3FRC A;  1XW6 A;  1S3A A;  4IHU A;  1V2A A;  2FCH A;  3DXB A;  3MDK A;  4FQU A;  3UVT A;  2H01 A;  1SYR A;  4OFN A;  1A2J A;  1TP9 A;  2GQL A;  4L5L A;  1YDK A;  1AUC A;  2L4C A;  4NHW A;  5J5N A;  4V2N A;  1T7P B;  3KP8 A;  1EEM A;  4YKF A;  2YZH A;  5CP1 A;  2VLV A;  4JR6 A;  5EPF A;  1SK2 A;  1Z3E A;  2G2Q A;  1X5E A;  3S9F A;  3LOR A;  1PA3 A;  3C1S A;  4O32 A;  1YY7 A;  1URM A;  5A4V A;  2LEG A;  1FG4 A;  4HJ2 A;  1K0M A;  2RLI A;  2J9H A;  3WGE A;  4BA7 A;  2GVP A;  1XWK A;  4NMU A;  2FWG A;  3EU3 A;  3QFA C;  2C4J A;  4TRX A;  5HFG A;  4DSS B;  2AYT A;  1TTZ A;  2LNS A;  1WRY A;  1K0O A;  1VF3 A;  1DE2 A;  3HA9 A;  1EV4 A;  2H70 A;  5FWG A;  1EEJ A;  2O8V B;  1K0A A;  4L8E A;  4TR0 A;  3KTB A;  2HI7 A;  3HZ4 A;  1PQN A;  4DSS A;  2KP2 A;  1A0F A;  3HKR A;  5HFK A;  4ECB A;  4O5U A;  4WR4 A;  3IK7 A;  5IO2 A;  1S3C A;  2FGX A;  1PKW A;  2H71 A;  1NW2 A;  3EWL A;  3KMN A;  3ZFB A;  1G0T A;  2A2P A;  4WET A;  3ZRE A;  3APS A;  1PX6 A;  5D9W A;  2GQM A;  4E8H A;  1XWA A;  2L6C A;  3F9U A;  5GAN D;  3PPU A;  1ZL9 A;  2EC4 A;  3CTF A;  2JZT A;  3QMX A;  2E7P A;  2GST A;  3WGX A;  2HYX A;  2H66 A;  2O89 A;  5HQP A;  1GSE A;  3A5I A;  3M0F A;  2L6D A;  1F37 A;  1YQ1 A;  3ED3 A;  1OE7 A;  3VWX A;  4WBR D;  3IK9 A;  1R7H A;  2VCT A;  3UBK A;  2VLT A;  2HT9 A;  5DAK B;  2HNL A;  1WOU A;  1M0U A;  1ERU A;  3GKM A;  2KP1 A;  1XWB A;  3LQ7 A;  1KTE A;  5ECO B;  2HZE B;  1HYU A;  1M99 A;  3TKS C;  4V2L A;  1BED A;  2OKA A;  2E0Q A;  4PNF A;  4JR4 A;  2OA7 A;  5J4U A;  1BJX A;  2FA4 A;  5LD0 A;  4WF4 A;  5DAK A;  3QAG A;  4MZC A;  3TCO A;  3P8W A;  5DQY A;  3GFK A;  2GS3 A;  3E3E A;  4HQZ A;  4LA1 A;  2HZE A;  4GWR A;  3LXZ A;  4X0X A;  3GST A;  2FUG 2;  2H76 A;  3KP9 A;  4KDU A;  2FD3 A;  4EF0 A;  4X1U A;  3D21 A;  2KLX A;  1M7T A;  3KTL A;  9GSS A;  3F4S A;  3PR8 A;  1QK8 A;  2TRX A;  5KOW A;  1QXH A;  2AV4 A;  3CRT A;  4Q5F A;  3TJJ A;  2GSR A;  3Q18 A;  2LUS A;  1AXD A;  1EGO A;  1ABA A;  5GZZ B;  1A8L A;  3M8N A;  4X43 A;  4JBB A;  4I6X A;  5CAX A;  1SL0 B;  1GSY A;  4AJ8 A;  2LRC A;  3FW2 A;  4POB A;  5DQS A;  1ON4 A;  2H8L A;  3HJP A;  2QA2 A;  1J0F A;  3L9U A;  4K5R A;  3L78 A;  2ON5 A;  1XBS A;  4JU5 A;  4OO5 A;  5IPG A;  2BTO T;  4ZL7 A;  2X4A A;  3U6V A;  3TKQ A;  1JHB A;  4AJ6 A;  1ACV A;  2G0F A;  2DC5 A;  4G9H A;  2IN3 A;  2LKU A;  2N5A A;  2MBS A;  2MMN A;  2F9S A;  5KN2 A;  1A24 A;  2V6O A;  1A2L A;  2IPA A;  3TKP A;  1YZX A;  5AIX A;  2R0G A;  3EMX A;  3FY7 A;  4XS6 A;  3BCI A;  3DWV A;  4FYU A;  5IMF A;  3BJ5 A;  4DVC A;  3FZ4 A;  3VI5 A;  4J56 E;  3EU4 A;  1MDK A;  5D93 A;  1TDI A;  2VD1 A;  3LGC A;  1SD8 A;  1MD3 A;  2EIQ A;  5G5F A;  3ZRD A;  2VL2 A;  5HFI A;  5CRG A;  2GDR A;  2RUE A;  3ERF A;  5ECL B;  3US3 A;  2HRN A;  3F63 A;  4L0W A;  3A2V A;  3N9J A;  4K6X A;  5HR2 A;  3R2Q A;  3TKR A;  2JSY A;  2P0G A;  2DIY A;  2LJK A;  4G0K A;  1B48 A;  1HQO A;  2X8G A;  5AN1 A;  4WKW A;  1Z7P A;  4PTS A;  4RQR A;  3EE2 A;  1GNW A;  1TU8 A;  3ZVJ A;  2P5Q A;  1PRX A;  4HQS A;  1SJ6 A;  2YWM A;  2GLR A;  4ML6 A;  3RPN A;  3DD3 A;  1VF2 A;  4OCE A;  4XHM A;  2IMF A;  3HHV A;  4P3Y B;  1FOH A;  2M80 A;  2GSS A;  5ECH B;  4IW9 A;  2EIO A;  5JCW A;  2VL9 A;  2ZCT A;  16GS A;  2H6Y A;  3TB2 A;  4WEY A;  3LYK A;  1ML6 A;  1XW5 A;  2CQ9 A;  2ON7 A;  1A2M A;  1EWX A;  3TRP A;  2PUK C;  4G19 A;  4L0U A;  4TOP A;  5D9X A;  5D73 A;  4BWS A;  2RM6 A;  5J9B A;  2YJH A;  1GSU A;  4POK A;  4Q5N A;  3KZQ A;  5CRW A;  3TGZ A;  1AQV A;  1TK5 B;  1GTI A;  4HEA 2;  4XRA A;  4XIH A;  4BVX B;  2O87 A;  3MNG A;  1G7O A;  1O73 A;  4GCI A;  1TRS A;  2F8A A;  3UAP A;  5ELG A;  2GZZ A;  4CHS A;  1DUG A;  5COH A;  2GQK A;  4GST A;  4NV5 A;  1H75 A;  2IME A;  1DSB A;  1B9Y C;  2WCI A;  4MAB A;  2VL3 A;  3FK8 A;  5DJM A;  4IJI A;  3QR6 A;  1JZR A;  4OFM A;  5B8B A;  1KNG A;  2FWH A;  3CRU A;  3GUR A;  4IJ3 A;  4V2M A;  5E4W A;  4V1A g;  3WT1 A;  2B7J A;  2R0C A;  3QD9 A;  3P90 A;  1QGV A;  3C7M A;  2RM5 A;  1EGR A;  4GQF A;  2AHE A;  3ERW A;  1GUH A;  5H5Q A;  2CT6 A;  3W8J A;  1K0C A;  5F07 A;  4HU9 A;  4TR1 B;  3VFI A;  1ERV A;  1Q98 A;  2P31 A;  1GLQ A;  3EVI A;  1I5G A;  3HVV A;  4NAX A;  2CAQ A;  4OFT A;  2B5Y A;  4HJM A;  2R5G A;  2YN1 A;  4TXV A;  3EUR A;  4NHZ A;  3UAR A;  1N2A A;  4K2X A;  3IC4 A;  4WF5 A;  4ILF A;  2VM1 A;  4E8E A;  4TR1 A;  3D0Z A;  2L57 A;  1EP8 A;  1GH2 A;  4TW5 A;  4KA0 A;  4ISD A;  3HD5 A;  3IOS A;  2YZU A;  3DRN A;  3L9V A;  2I1U A;  2VM2 A;  3F3Q A;  2XBI A;  4MZB A;  4OMV A;  2QSI A;  2FNO A;  5G5E A;  2H74 A;  6GSS A;  1B4Q A;  2R2J A;  2VL2 C;  3GV1 A;  4EXJ A;  3QAW A;  1N8J A;  5F05 A;  2OE3 A;  4NWY A;  4GSS A;  3WT2 A;  3IDV A;  4KSO A;  4LL4 B;  2LV3 A;  2MYG A;  4O5Q A;  2NDO A;  1PSQ A;  5ECS A;  1X9S B;  2JZS A;  3QFB C;  1K0D A;  1PX7 A;  2PWJ A;  1ZGN A;  1K3O A;  2PMT A;  2ALB A;  1TOF A;  4PQI A;  1TXX A;  3KD0 A;  1H4O A;  1V40 A;  1X9W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...