1YZXA

Crystal structure of human kappa class glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
218
structure length
218
Chain Sequence
LPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase kappa 1
publication title Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yzxA01
11GSA 1BYEA 1E2YA 1AQWA 2IFQA 3F63A 1QXHA 3DD3A 3I6AA 1SKWB 3GIXA 3LG6A 2LS5A 2WJUA 2OKAA 2J23A 3ZTLA 3CMIA 1JLWA 1YF1A 2PVOC 2E0QA 4PQHA 3HVVA 4JBBA 1WWJA 2NPBA 3LEFA 1XW6A 3GSTA 4N30A 2H1DA 1TK0B 1NSWA 2LJAA 1TK5B 1XFLA 2OBIA 5F06A 1G0TA 1A2LA 2HT9A 3TKSC 2L4CA 2B1KA 4LLRA 1HD2A 1BQ7A 1OE8A 4O32A 5B7CA 5HFIA 3LJRA 4HZ4A 3IK9A 5ID2B 4ZB6A 4XHMA 1IYIA 1GSEA 4J57E 4F9ZA 4EKZA 1F9MA 5CP1A 4KAEA 4WBRD 3D4MA 4MH3A 5CRGA 4X43A 3E0UA 3TDGA 2PU9C 4IQ1A 4BVXA 5ECIB 4FYBA 3FYGA 4OD7A 1SD9A 1NM3A 2CV4A 1J08A 2VCVA 1AAZA 5ECLB 5H5RA 1AQXA 3P7XA 4GWRA 1DUGA 2FA8A 3CXGA 1PX6A 1MD3A 4RQRA 2LKUA 2GLRA 5IQYA 1U88A 4HQSA 3EU4A 4YQVA 3KP9A 4TOPA 5G1LA 2N5AA 1ZZYA 3VWUA 2VAFA 1DE1A 2LNTA 1C72A 4I8BA 1DE2A 2H73A 3IPZA 5EY6A 5F05A 1M7TA 3GFKA 1SD8A 4FIWA 3D21A 2ZUPA 2YP6A 1PGTA 5DAKB 4K0GA 3C7MA 1B8XA 1PL1A 2FD3A 2XPDA 5A4VA 1A2JA 22GSA 1OE7A 2FCHA 5D96A 5IOWA 1PKWA 3I69A 3O76A 4PQ1A 4V1Ag 4MCUA 2M72A 4F03A 3WGDA 3PGTA 3HJMA 1GH2A 3CTGA 3O6TA 5J4UA 1AIUA 2VL2C 2C80A 1Z6MA 2HE3A 1Z5YE 3CRTA 1ERTA 4GF0A 2KOKA 2OJLA 4ZILA 2HNLA 3FZAA 5DQSA 1YF0A 4RI6A 2EIRA 3IXRA 4X1UA 5LCZA 4TW5A 2B3SA 4HEA2 4XS4B 2XC2A 4K9ZA 2CZ2A 2JU5A 5B8BA 4ML6A 3HDCA 4EUYA 4HI7A 4XS4A 3FW2A 2K8SA 1EGRA 2H72A 4BL7A 3ME8A 1T7PB 5ECRB 2L6DA 4MLYA 3CSHA 3QCPA 2C0FA 2OE1A 1XVWA 2IPAA 1UN2A 1PN9A 2GSSA 2VL3A 1KTEA 3KTBA 3HD5A 1TI1A 4HJMA 4IVFA 1M2BA 2CAQA 3KXOA 4MDCA 2E7PA 2HFDA 1M0UA 3DYRA 2JSYA 4HQZA 1FW1A 1EOHA 1CQHA 4IHUA 1GRXA 2DJ2A 2DJ3A 4MABA 2DJ1A 5JCUA 4NV5A 4KSOA 3BCKA 1WPIA 1OC8A 4MF6A 2H75A 3FZ5A 2MZCA 2A4VA 1ZYQB 4MF7A 2E2GA 1B9XC 1V9WA 2FA4A 2ON7A 3DGQA 4WETA 5J41A 2P31A 1PX7A 2PN8A 1NHOA 3LQ7A 3KCMA 2NTOA 2QGVA 3QR6A 2HYXA 2VCQA 3ZLPA 5ECQB 3U6VA 4E8HA 2LNSA 4CHSA 2C3TA 6GSSA 1AQVA 2LQOA 1PA3A 1G6YA 3K8NA 5IO2A 2GZZA 3IE3A 2LRNA 3HJPA 1B4QA 4G9HA 5KN0A 3ZREA 5CREA 1K3LA 2H0IA 4Q5FA 2VLVA 1TKDB 1GWCA 5B8AA 5COHA 5DJLA 1GSYA 1J0FA 1MD4A 1S3AA 1M2AA 3GKKA 1SJZA 1V98A 3KGKA 5G5FA 2F9SA 3LYPA 2F51A 2GS3A 1SKRB 2DBCA 4OFTA 3UAPA 2CAIA 1A0FA 1WJKA 3RHBA 1EV9A 4N11A 3C73A 3DVWA 2NVLA 3DXBA 4OMVA 1WRYA 1ST9A 2VOCA 2L5OA 1BEDA 4CW9A 3LWAA 2OA7A 1GTAA 1XW9A 1SK2A 3I43A 5INYA 5J3RA 1JFUA 3TKSA 5DCGA 1XWGA 4D73B 2FWFA 1EP7A 3A2XA 2B6MA 4XS6A 3EURA 3VLNA 2YNXA 4O5RA 1SL0B 3G7JA 1SJIA 2KLXA 3IV4A 4IJIA 3ISOA 3CSIA 1M9AA 2O89A 4V2LA 3HHVA 14GSA 3IC4A 4HZ2A 5IO0A 2H71A 1G6WA 2PWJA 5J9BA 3GURA 5GZZB 1TU8A 2LRTA 1F37A 2G2QA 2YWMA 3ZVJD 4EO3A 5ECNB 2RIIA 2X8HA 2EIQA 1SK0A 1GNEA 1XVQA 1FO5A 3US3A 4EDZA 2ES7A 1N2AA 1F3AA 2FHEA 7GSSA 2CX3A 3EE2A 4GCIA 3AY8A 6GSYA 3EVIA 4WR4A 3E9JB 1WIKA 5DVBA 2O87A 3VI5A 1TU7A 1TOFA 1XIYA 3KM6A 3VWXA 3GHAA 2LEGA 4OO5A 3GMFA 3J7Yb 1VF2A 5ECHB 3BJ5A 2WFCA 2VO4A 4JR4A 5J5NA 1SYXA 5ECKB 2IMDA 3NOFA 3M3MA 4I6XA 2H6ZA 2FLSA 1XW5A 4ECCA 1ON4A 3QAGA 1MDJA 2WCIA 4TR1A 4TRXA 3KH9A 1U3AA 4LMWA 4ECBA 2BTOT 2DLXA 2L6CA 1O6JA 4KB3A 1R5AA 2LSTA 5IMDA 3TCOA 4G2EA 2CZ3A 4V2NA 2CQ9A 3C71A 1G7OA 1OKTA 1GSUA 1YDKA 2H6YA 3PINA 3VK9A 1X0RA 3KJYA 5FWGA 4TXVA 4DSSB 4ZBDA 4ZL8A 1TRUA 1VRSD 1U6TA 3VFIA 5JWOB 1AXDA 2O85A 4AJ7A 4GSNA 1ERWA 1BJXA 1XOAA 4QL7A 4ACSA 1K3YA 2B1LA 2IFQB 1K0BA 4MPFA 1FB6A 3PR8A 3Q18A 2YWNA 4JR6A 3SWLA 6GSUA 3DKSA 3LXZA 3CBUA 2YZHA 4FO5A 4PNGA 3TB2A 1R7HA 4HU9A 1YKCA 3N5OA 3ZIVA 1E6BA 1GUMA 4MZBA 1THXA 2YWIA 3M9KA 3UIWA 1TRWA 4IKHA 2WGRA 1PSQA 3ZRDA 4GSTA 5CO3A 2B7KA 2NBSA 4MPGA 3GN3A 2PVQA 1ABAA 1V57A 1ACVA 4TR0A 2H1GA 2HLSA 1X9WB 2RUFA 3KD0A 1I9DA 4EDYA 4LMVA 1XWAA 3CYNA 2HRNA 1X9SB 1M2DA 3VPQA 4OCEA 1SYRA 3GRXA 1JZRA 3GH6A 4ECJA 1QGVA 3F3QA 5EPFA 2P5RA 2YJ7A 2GQKA 2I9HA 1UA5A 3WGEA 4J2FA 1PQNA 3A3TA 2BMXA 2PERA 2WZ9A 3KIJA 5E59A 1EWXA 4KW6A 3R2QA 2DMLA 3VURA 1EEJA 4PQIA 4IGJA 4RQXA 1Z7PA 5AISA 3TJFA 1EP8A 2LV3A 3W8SA 2VCXA 5HR0A 1MTCA 2KUCA 4YQMA 3QMXA 3IHQA 3P90A 1V40A 4JRRA 2PBJA 2CX4A 2V6KA 3HYPA 3EMXA 3F0IA 3F8UA 4O92A 4WEYA 1ILOA 2I3YA 4NHWA 1OC9A 1GSSA 2V41A 5D73A 4HUAA 4QQ7A 1SK1A 3M0FA 4IQAA 3C1SA 5CRHA 1K0NA 3DRNA 4KGIA 1SL1B 2B5YA 4L8EA 2VM1A 5AIVA 4N0ZA 3KH7A 2HSYA 1HNBA 5H5SA 1T4ZA 4LA1A 1S3CA 1EEMA 1Z7RA 5EVOA 3TRXA 4AJ6A 4F0CA 2H6XA 2YCDA 3EMPA 1AW9A 2MBTA 2DJJA 4YQUA 2IMIA 2AV4A 2WS2A 2V6OA 3DEXA 2FWEA 5ECOB 5KN2A 2GGTA 4TKYA 1NW2A 4G19A 1YQ1A 4OCFA 3TKPA 1T4YA 4HS1A 3Q6OA 5GSSA 2PUKC 5DBQA 1PKZA 2C3NA 1XZOA 1JZWA 1THOA 1XWCA 2TRCP 1XPVA 4NWYA 2X64A 4K2DA 3GL3A 3RDWA 4XIHA 2MMAA 3UARA 5AIXA 5IPGA 1FG4A 5HFGA 3I9V2 2DJKA 3L9UA 3QOUA 4ZBAA 3KZQA 4MJBA 2E2MA 3G7IA 2IMKA 2GT5A 1K3OA 2B5EA 5HQPA 4WXTA 2O8VB 1HQOA 3KEBA 5JWQB 1XWKA 4J56E 2H76A 3P8WA 2CVKA 1LBKA 3GV1A 4K1FA 4O7HA 5AGYA 4DVCA 3FR6A 2XHFA 4H86A 5DALB 4IP1A 1O8XA 5H5QA 6GSWA 3IBHA 5DQYA 5IMVA 3APQA 5DALA 2R6KA 5A5KA 10GSA 3GTUA 3U5RE 1GLPA 4ZB8A 2A2SA 2HZEB 5KN1A 3TKRA 3APOA 5ELGA 1Q98A 3HY2A 2HZEA 4PUAA 2IMFA 3TRPA 3GKNA 4F0BA 2IN3A 4POKA 2K9FA 4K7NA 2DMMA 5CYYA 4MH2A 1VGLA 3IAM2 20GSA 3D4TA 5EL8A 2H0HA 2Z9SA 2JZSA 1QFNA 3GKMA 3E3EA 3APSA 2GDRA 1JLVA 3UL3A 4WKWA 5CRDA 2AAWA 5G31A 5ECSA 3ERWA 1SENA 1ZOFA 3DVXA 1EV4A 2LTKA 4BVYA 2IJYA 1DBYA 1GUKA 3W8JA 3IR4A 1X9MB 3DMLA 5D9VA 6GSXA 2QSIA 3QAWA 2JACA 1TK8B 2OE3A 4L0WA 3QPMA 2RM6A 9GSSA 2WRTA 2BJXA 3VWWA 5A4UA 3L4NA 4I2TA 4JZQA 3D0ZA 1XOBA 2B5XA 3ERGA 1Y25A 2K18A 2YV9A 4TXOA 4DEJA 2FWHA 4KE3A 4EVMA 2C1YA 2GQLA 2RM5A 3IAS2 4YH2A 4ZBBA 5C00A 1UC7A 2VLTA 5ENUA 3CRUA 1EGOA 5IMAA 3IOSA 3L9SA 4ILFA 3N9JA 2GZPA 2VIMA 4POLA 3H4KA 4NPBA 3ZL5A 2L59A 3LORA 5G2ZA 1HYUA 3UVTA 3TGZA 1NHYA 2L57A 3GL5A 4EC0A 2HZFA 3HVSA 2H0GA 2R37A 2LRCA 1SKSB 4ZL7A 2VUPA 2FUG2 4OFNA 5JCWA 2D2ZA 2MBSA 3BOAA 3QAVA 4EE0A 3HZ4A 1B4PA 5HR1A 3ME7A 1MEKA 5F0GA 3EINA 2GTUA 5CAXA 4ULXA 4K7OA 2JADA 1HNCA 4I5QA 1KNGA 5KN3A 1TW9A 1R4WA 4FYUA 3ZFLA 1F2EA 5G5EA 4ECIA 5DJMA 3UBLA 4BA7A 5KEJA 2VCWA 4POBA 2DSAA 4HJ2A 4WR5A 1A8YA 3F4RA 2GZYA 3LSZA 2F8AA 5IM9A 5ABRA 2LJKA 5JCGA 4TR3A 4POMA 2YANA 4RUVA 3EYTA 2I4AA 3C1RA 3ZZXA 1FAAA 5A4WA 1N8JA 1A23A 1WOUA 3H93A 1RQMA 5GSTA 2KP1A 17GSA 2LQQA 3UVHA 1TDIA 2X8CA 4P3YB 5GAND 1K0OA 4L5OA 2MMNA 2C0DA 2N5FA 3EU3A 4WF4A 5HFKA 4V1Ap 1GP1A 3H79A 2PPTA 2CVDA 2DC5A 2H70A 1G7EA 4TR1B 3FR3A 5HR2A 3TOUA 3WYWA 2EIOA 5DDLA 1FVJA 2M46A 1KEBA 1YY7A 2F8FA 3IA1A 2OBKA 3UOMA 3Q74A 3RPPA 1IYHA 2H30A 2NDOA 4Q5RA 3UEMA 4V2MA 3OR5A 5E4WA 5FT3A 2I81A 3WGXA 1TJDA 4Q5QA 4XCSA 2IMEA 4AJ8A 4GSSA 4MJAA 4EL1A 1TI3A 2DIYA 1W89A 2V2GA 2HXKA 2VL9A 4L5LA 1YJ6A 3FZ4A 1A0RP 1F6MC 2RUEA 3GYKA 5IOXA 2GT6A 3TKQA 3VI7A 1LJRA 1YZXA 2X99A 3ED3A 2YZUA 4QL9A 2H19A 2GSQA 4F82A 4RI7A 3H1NA 4BPYA 3EWLA 4TN8A 1U87A 1MDIA 3QFBC 5B6MA 1OC3A 1S3DA 2QC7A 2J9HA 1OAZA 3UMAA 5IIZA 1GSDA 4GRFA 2XBQA 4N10A 3QD9A 5L71A 3FRCA 3LXTA 4EXJA 3HZ8A 3LFLA 1GSQA 1SL2B 3F6FA 4KH7A 5ECPB 1RK4A 5IMZA 2YWOA 2FY6A 3BD2A 1O73A 5B6NA 2GSTA 1Z6NA 2R4VA 1ZL9A 4XRAA 3WT2A 1F3BA 1M9BA 4MJCA 1B9YC 2K8VA 19GSA 4XTSA 3FEUA 3GH9A 3TJJA 3HA9A 1HNAA 4ZXGA 3ZITA 1OKDA 3TJGA 4EF0A 4MJEA 1GL8A 2L5LA 2FNOA 3ERFA 4PUFC 4NMUA 1K0MA 2P0GA 1FHEA 4ZB9A 5ELAA 4MA9A 4PURA 5D9TA 5ID2A 4FYCA 4YAPA 5C04A 4F2IA 4BWQA 3M1GA 2H1AA 1X5EA 5F8BA 3J7Yk 2VCZA 3KP8A 4KCEA 2IWTA 3WT1A 2FGXA 4KDXA 2JZRA 4GQFA 1FVKA 2TRXA 3RBTA 1OC9B 1TRSA 2L4QA 1YEPA 4Q5NA 3NZNA 3O3TA 4MP4A 3QDNA 4PNFA 3FK8A 4JEDA 4KDUA 2WDUA 1XBSA 2HI7A 1BG5A 3GNJA 3M8NA 2G0FA 2QKEA 4GLTA 1VF3A 1SU9A 3KTLA 4XS1A 3FR9A 1I5GA 4MZWA 1R26A 2C3QA 3NIVA 1RW1A 3HVXA 2GSRA 2AJQB 5LNKe 1FB0A 5F07A 2ON5A 2YN1A 4MF5A 2R2JA 3PH9A 4OWYA 3FKFA 2B7JA 3FY7A 3HJOA 4K6XA 2OADA 1PRXA 5DAKA 1GNWA 3LYKA 3RPNA 3HXSA 3TKSE 2R3XA 2XPEA 2YOIA 4G10A 4Z7XA 3L78A 1W4VA 1H75A 3LGCA 3W6GA 4IS0A 5CRWA 1V2AA 2K6VA 1Q4JA 4IP6A 1O8WA 4AGSA 6GSVA 2FWGA 3IK7A 3MAKA 2MMOA 3A2WA 1A24A 3FZ9A 2OACA 2AYTA 1GTUA 1ZYEA 2IL3A 4BWSA 1ZCPA 3D5JA 2H74A 2KP2A 1JHBA 3CSJA 2ALBA 2VCTA 4KX4A 3KMOA 4DSRA 4NAXA 1K0DA 2H66A 4KA0A 1ERUA 2DJ0A 4I2UA 1U3IA 3GTUB 5GAPD 3TJBA 1ERVA 1O81A 3SBCA 3Q19A 3HCZA 2HRFA 5D9XA 3BCIA 1VF1A 3ZMKA 1MDKA 2C0GA 1FOVA 3F9UA 2N5BA 1OVNA 2MMZA 2YV7A 2F3MA 4IW9A 1YKAA 1QMVA 3H8QA 4ML1A 1EOGA 1Z3EA 2CT6A 3MDKA 2DIZA 4KUNA 1GSFA 3VWVA 1O85A 4WF5A 1GULA 1JZDA 3S9FA 3MSZA 1K0AA 2LUSA 4L0UA 1UVZA 1EZKA 3DWVA 2KHPA 4TR4A 2ZCTA 2AB6A 2HSHA 2P5QA 3RHCA 2WB9A 2GQMA 3RAZA 2M80A 5AN1A 3QFAC 4TXOB 4X0XA 3FHKA 2MYGA 3MWHA 2H1BA 1VF4A 1OYJA 4N0VA 5ECMB 1H4OA 1Z9HA 1TXXA 3IRAA 4HU7A 3L9VA 2O7KA 1T8EB 4KSMA 1XCCA 4IJ3A 1AUCA 4IELA 4LL1B 4KDYA 2JZTA 1TTZA 3GX0A 1V58A 2PGTA 2H01A 3GUSA 4KCAA 2OE0A 1XXUA 4YAVA 1T3BA 5G30A 8GSSA 1ZMAA 1GUHA 1AC1A 4E8EA 3MNGA 3G7YA 1X5DA 1BX9A 4JE1A 4ZIJA 3GSSA 1QK8A 5D9WA 3ZVJA 3JCML 1T00A 4K8MA 4PX1A 4ZL9A 1URMA 3F6DA 5LD0A 4CDOA 2C0EA 1PD21 2TIRA 2I1UA 4D73A 4NXIA 2CA8A 3EC3A 5J9CA 3IDVA 3UBKA 3A2VA 1LU4A 3P2AA 5HR3A 3M9JA 3HKRA 1A2MA 3TUEA 5IMCA 2X8GA 4KNDA 4HDEA 3F4TA 2V1MA 1BAYA 2A2RA 3BBYA 3DIEA 3ZYWA 4MMMA 2REMA 1PMTA 3ZFBA 2YJHA 2RLIA 4OO4A 3TRQA 1CQGA 3G9BA 4GQCA 3V1WA 5JWRB 3TOTA 4K7IA 3GKXA 1USBA 3D22A 1PL2A 4MZCA 3D6IA 2VLUA 2GVPA 4IN0A 3CTFA 4MK3A 3F3RA 18GSA 2VD1A 5DCHA 4NV2A 13GSA 4XRDA 3UJ1A 2JL4A 2VM2A 3VPTA 3A5WA 4TVEA 4WBJA 1WP0A 4K0NA 1GTBA 3F4SA 4JU5A 1GLQA 2AUVA 2ZNMA 2IIYA 3TJKA 4PXOA 5D93A 4DSQA 1X5CA 6GSTA 1KBNA 1A8LA 3ZMLA 5FHIA 2C4JA 3C8EA 5G1KA 4HOJA 2CVBA 2XBIA 3GX8A 1T1VA 2R5GA 1O7UA 4LL4B 1ML6A 1QUWA 2V32A 3KMNA 4I97A 2LJRA 4GXZA 4GTUA 1K0CA 4ISDA 4NHZA 4AF2A 3ZIJA 1WE0A 2H8LA 2PMTA 1GTIA 1M99A 1DSBA 1YEXA 5D8IA 2C8UA 5IPHA 5CNWA 1TRVA 1JZOA 2JSZA 2VL2A 1WMJA 5IMFA 1ZGNA 4IBPA 3L0HA 2VD0A 3GA4A 16GSA 1QQ2A 1Y6EA 1R5PA 1SJ6A 4OFMA 2WULA 1TP9A 1J9BA 4DSSA 4FH8A 12GSA 4ID0A 2YPMA 1B48A 4PGTA 3WD6A 2EC4A 1XWBA 2AHEA
chains in the Genus database with same CATH superfamily
11GSA 1BYEA 1E2YA 1AQWA 2IFQA 3F63A 1QXHA 3DD3A 3I6AA 1SKWB 3GIXA 3LG6A 2LS5A 2WJUA 2OKAA 2J23A 3ZTLA 3CMIA 1JLWA 1YF1A 1PN0A 2PVOC 2E0QA 4PQHA 3HVVA 4JBBA 1WWJA 2NPBA 3LEFA 1XW6A 3GSTA 4N30A 2H1DA 1TK0B 1NSWA 2LJAA 1TK5B 1XFLA 2OBIA 5F06A 1G0TA 2A2PA 1A2LA 2HT9A 3TKSC 2L4CA 2B1KA 4LLRA 1HD2A 1BQ7A 1OE8A 4O32A 5B7CA 5HFIA 3LJRA 4HZ4A 3IK9A 5ID2B 4ZB6A 3EPTA 2A4HA 4XHMA 1IYIA 1GSEA 4J57E 4F9ZA 4EKZA 1F9MA 5CP1A 4KAEA 4WBRD 3D4MA 4MH3A 5CRGA 4X43A 3E0UA 3TDGA 2PU9C 4IQ1A 4BVXA 5ECIB 2UZ8A 4FYBA 3FYGA 4OD7A 1SD9A 1NM3A 1M3JA 2CV4A 1J08A 2VCVA 1AAZA 5ECLB 5BMUA 5H5RA 1AQXA 2R0CA 3P7XA 4GWRA 1DUGA 2FA8A 3CXGA 1PX6A 1MD3A 4RQRA 2LKUA 2GLRA 5IQYA 1U88A 4HQSA 3EU4A 4YQVA 3KP9A 4TOPA 5G1LA 2N5AA 1ZZYA 3VWUA 2VAFA 1DE1A 2LNTA 1C72A 4I8BA 1DE2A 5KOXA 2H73A 3IPZA 5EY6A 5F05A 1M7TA 3GFKA 1SD8A 4FIWA 3D21A 2ZUPA 2YP6A 1PGTA 5DAKB 4K0GA 3C7MA 1B8XA 1PL1A 2FD3A 2XPDA 5A4VA 1A2JA 22GSA 1OE7A 2FCHA 5D96A 5IOWA 1PKWA 3I69A 3O76A 4PQ1A 4V1Ag 4X4JA 4MCUA 2M72A 4F03A 3WGDA 3PGTA 3HJMA 1GH2A 3CTGA 3O6TA 5J4UA 1AIUA 1FOHA 2VL2C 2C80A 1Z6MA 2HE3A 1Z5YE 3CRTA 1ERTA 4G0KA 4GF0A 2KOKA 2OJLA 4ZILA 2HNLA 3FZAA 5DQSA 1YF0A 4RI6A 2EIRA 3IXRA 4X1UA 5LCZA 4TW5A 2B3SA 4HEA2 4XS4B 2XC2A 4K9ZA 2CZ2A 2JU5A 5B8BA 4ML6A 3HDCA 4EUYA 4HI7A 4XS4A 3FW2A 2K8SA 1EGRA 2H72A 4BL7A 3ME8A 1T7PB 5ECRB 2L6DA 4MLYA 3CSHA 3QCPA 2C0FA 4K2XA 2OE1A 1XG8A 3PPUA 1XVWA 2IPAA 1UN2A 1PN9A 2GSSA 2VL3A 1KTEA 3KTBA 3HD5A 1TI1A 4CY6A 4HJMA 4IVFA 1M2BA 2CAQA 3KXOA 4MDCA 2E7PA 2HFDA 1M0UA 3DYRA 2JSYA 4HQZA 1FW1A 1EOHA 1CQHA 4IHUA 1GRXA 2DJ2A 2DJ3A 4MABA 2DJ1A 5JCUA 4NV5A 4KSOA 3BCKA 1WPIA 1OC8A 4MF6A 2H75A 3FZ5A 2MZCA 2A4VA 1ZYQB 2HRKA 4MF7A 2E2GA 1B9XC 1V9WA 2FA4A 2ON7A 3DGQA 4WETA 5J41A 2P31A 1PX7A 2PN8A 1NHOA 3LQ7A 3KCMA 2HRAA 2NTOA 2QGVA 3QR6A 2HYXA 2VCQA 4YKFA 3ZLPA 5ECQB 3U6VA 4E8HA 2LNSA 4CHSA 2C3TA 6GSSA 1AQVA 2LQOA 1PA3A 1G6YA 3K8NA 5IO2A 2GZZA 3IE3A 2LRNA 3HJPA 1B4QA 4G9HA 5KN0A 3ZREA 5CREA 1K3LA 2H0IA 4Q5FA 2VLVA 1TKDB 1GWCA 5B8AA 5COHA 5DJLA 1GSYA 1J0FA 1MD4A 1S3AA 1M2AA 3GKKA 1SJZA 1V98A 3KGKA 5G5FA 2F9SA 3LYPA 2F51A 2GS3A 1SKRB 2DBCA 4OFTA 2R0GA 3UAPA 2CAIA 1A0FA 1WJKA 3RHBA 1EV9A 4N11A 3C73A 3DVWA 2NVLA 3DXBA 4OMVA 1WRYA 1ST9A 2VOCA 2L5OA 1BEDA 4CW9A 3LWAA 4Z2RA 2OA7A 1GTAA 1XW9A 1SK2A 3I43A 5INYA 5J3RA 1JFUA 3TKSA 5DCGA 1XWGA 4D73B 2FWFA 3FMWA 1EP7A 3A2XA 2B6MA 4XS6A 3EURA 3VLNA 2YNXA 4O5RA 1SL0B 3G7JA 1SJIA 2KLXA 3IV4A 4IJIA 3ISOA 3CSIA 1M9AA 2O89A 4V2LA 3HHVA 14GSA 3IC4A 4HZ2A 5IO0A 2H71A 1G6WA 2PWJA 5J9BA 3GURA 5GZZB 1TU8A 2LRTA 1F37A 2G2QA 2YWMA 3ZVJD 4EO3A 5ECNB 2RIIA 2X8HA 2EIQA 1SK0A 1GNEA 1XVQA 1FO5A 3US3A 4EDZA 2ES7A 1N2AA 1F3AA 2FHEA 7GSSA 2CX3A 3EE2A 4GCIA 3AY8A 6GSYA 3EVIA 4WR4A 2DKHA 3E9JB 1WIKA 5DVBA 2O87A 3VI5A 1TU7A 1TOFA 1XIYA 3KM6A 3VWXA 3GHAA 2LEGA 4OO5A 3GMFA 3J7Yb 1VF2A 5ECHB 3BJ5A 2WFCA 2VO4A 4JR4A 5J5NA 1SYXA 5ECKB 2IMDA 3NOFA 3M3MA 4I6XA 2H6ZA 2FLSA 1XW5A 4ECCA 1ON4A 2R0PA 3QAGA 1MDJA 2WCIA 4TR1A 4TRXA 3KH9A 1U3AA 4LMWA 4ECBA 2BTOT 2DLXA 2L6CA 1O6JA 4KB3A 1R5AA 2LSTA 5IMDA 3TCOA 4G2EA 2CZ3A 4V2NA 2CQ9A 3C71A 1G7OA 1OKTA 1GSUA 1YDKA 2H6YA 3PINA 3VK9A 1X0RA 3KJYA 5FWGA 4TXVA 4DSSB 4ZBDA 1ZYNA 4ZL8A 1TRUA 5BRTA 1VRSD 1U6TA 3VFIA 5JWOB 1AXDA 2O85A 4AJ7A 4GSNA 1ERWA 1BJXA 1XOAA 4QL7A 4ACSA 1K3YA 2B1LA 2IFQB 1K0BA 4MPFA 1FB6A 3PR8A 3Q18A 2YWNA 4JR6A 3SWLA 6GSUA 3DKSA 3LXZA 3CBUA 2YZHA 4FO5A 4PNGA 4K5SA 3TB2A 1R7HA 3MYDA 4HU9A 1YKCA 3N5OA 3ZIVA 1E6BA 1GUMA 4MZBA 3LW9A 1THXA 4EIPA 2YWIA 3CQFA 3M9KA 3UIWA 1TRWA 4IKHA 2WGRA 1PSQA 3ZRDA 4GSTA 5CO3A 2B7KA 2NBSA 4MPGA 3GN3A 2PVQA 1ABAA 1V57A 1ACVA 4K5RA 4TR0A 2H1GA 2HLSA 1X9WB 2RUFA 3KD0A 1I9DA 4EDYA 4LMVA 1XWAA 3CYNA 2HRNA 1X9SB 1M2DA 3VPQA 4OCEA 1SYRA 3GRXA 1JZRA 3GH6A 4ECJA 1QGVA 3F3QA 5EPFA 2P5RA 2YJ7A 2GQKA 2I9HA 1UA5A 3WGEA 4J2FA 4BVXB 1PQNA 3A3TA 2BMXA 2PERA 2WZ9A 3KIJA 5E59A 1EWXA 4KW6A 3R2QA 2DMLA 3VURA 1EEJA 4PQIA 4IGJA 4RQXA 1Z7PA 5AISA 3TJFA 1EP8A 2LV3A 3W8SA 2VCXA 5HR0A 1MTCA 2KUCA 4YQMA 3QMXA 3IHQA 3P90A 1V40A 4JRRA 2PBJA 2CX4A 2V6KA 3HYPA 3EMXA 3F0IA 3F8UA 4O92A 4WEYA 1ILOA 2I3YA 4NHWA 1OC9A 1GSSA 2V41A 5D73A 4HUAA 4QQ7A 1SK1A 3M0FA 4IQAA 3C1SA 5CRHA 1K0NA 3DRNA 4KGIA 1SL1B 2B5YA 4L8EA 2VM1A 5AIVA 4N0ZA 3KH7A 2HSYA 1HNBA 5H5SA 1T4ZA 4LA1A 1S3CA 1EEMA 1Z7RA 5EVOA 3TRXA 4AJ6A 4F0CA 2H6XA 2YCDA 3EMPA 1AW9A 2MBTA 2DJJA 4YQUA 2IMIA 4EIQA 2AV4A 1M3IA 2WS2A 2V6OA 3DEXA 2FWEA 5ECOB 5KN2A 2GGTA 4TKYA 1NW2A 4G19A 1YQ1A 4OCFA 3TKPA 1T4YA 4HS1A 3Q6OA 5GSSA 2PUKC 5DBQA 1PKZA 2C3NA 1XZOA 1JZWA 1THOA 1XWCA 2TRCP 1XPVA 4NWYA 2X64A 4BL7B 4K2DA 3GL3A 3RDWA 4XIHA 2MMAA 3UARA 5AIXA 5IPGA 1FG4A 5HFGA 3I9V2 2DJKA 3L9UA 3QOUA 4ZBAA 3KZQA 4MJBA 2E2MA 3G7IA 2IMKA 2GT5A 1K3OA 2B5EA 5HQPA 4WXTA 2O8VB 1HQOA 3KEBA 5JWQB 1XWKA 4J56E 2H76A 3P8WA 2CVKA 1LBKA 3GV1A 4K1FA 4O7HA 5AGYA 4DVCA 3FR6A 2XHFA 4H86A 5DALB 4IP1A 1O8XA 5H5QA 6GSWA 3IBHA 5DQYA 5IMVA 3APQA 5DALA 2R6KA 5A5KA 10GSA 3GTUA 3U5RE 1GLPA 4ZB8A 2A2SA 2HZEB 4Z2TA 5KN1A 3TKRA 3APOA 5ELGA 1Q98A 3HY2A 2HZEA 4PUAA 2IMFA 3TRPA 3GKNA 4F0BA 2IN3A 4POKA 2K9FA 4K7NA 2DMMA 5CYYA 4MH2A 1VGLA 3IAM2 20GSA 3D4TA 4USSA 5EL8A 2H0HA 2Z9SA 2JZSA 1QFNA 3GKMA 3E3EA 3APSA 2GDRA 1JLVA 3UL3A 4WKWA 5CRDA 2AAWA 5G31A 5ECSA 3ERWA 1SENA 1ZOFA 3DVXA 1EV4A 2LTKA 4BVYA 2IJYA 1DBYA 1GUKA 3W8JA 3IR4A 1X9MB 3DMLA 5D9VA 6GSXA 2QSIA 3QAWA 2JACA 1TK8B 2OE3A 4L0WA 3QPMA 2RM6A 9GSSA 2WRTA 4O5QA 2BJXA 3VWWA 5A4UA 3L4NA 4I2TA 4JZQA 3D0ZA 1XOBA 2B5XA 3ERGA 1Y25A 2K18A 2YV9A 4TXOA 4DEJA 2FWHA 4KE3A 4EVMA 2C1YA 2GQLA 2RM5A 3IAS2 4YH2A 4ZBBA 5C00A 1UC7A 2VLTA 5ENUA 3CRUA 1EGOA 5IMAA 3IOSA 3L9SA 4ILFA 3N9JA 2GZPA 2VIMA 4POLA 3H4KA 4NPBA 3ZL5A 2L59A 3LORA 5G2ZA 1HYUA 3UVTA 3TGZA 1NHYA 2L57A 3GL5A 4EC0A 2HZFA 3HVSA 2H0GA 2R37A 2LRCA 1SKSB 4ZL7A 2VUPA 2FUG2 4OFNA 5JCWA 2D2ZA 2MBSA 3BOAA 3QAVA 4EE0A 3HZ4A 1B4PA 5HR1A 3ME7A 1MEKA 5F0GA 4HSCX 3EINA 2GTUA 5CAXA 4ULXA 4K7OA 2JADA 1HNCA 4I5QA 1KNGA 5KN3A 1TW9A 1R4WA 4FYUA 3ZFLA 1F2EA 5G5EA 4ECIA 5DJMA 3UBLA 4BA7A 5KEJA 2VCWA 4POBA 2DSAA 4HJ2A 4WR5A 1A8YA 3F4RA 2GZYA 3LSZA 2F8AA 5IM9A 5ABRA 2LJKA 5JCGA 4TR3A 4POMA 2YANA 4RUVA 3EYTA 2I4AA 3C1RA 3ZZXA 1FAAA 5A4WA 1N8JA 1A23A 1WOUA 3H93A 1RQMA 5GSTA 2KP1A 17GSA 2LQQA 3UVHA 1TDIA 2X8CA 4P3YB 5GAND 1K0OA 4L5OA 2MMNA 2C0DA 2N5FA 3EU3A 4WF4A 5HFKA 4V1Ap 1GP1A 3H79A 2PPTA 2CVDA 2DC5A 1PFOA 2H70A 1G7EA 4TR1B 3FR3A 5HR2A 3TOUA 3WYWA 2EIOA 5DDLA 1FVJA 2M46A 1KEBA 1YY7A 2F8FA 3IA1A 2OBKA 3UOMA 3Q74A 3RPPA 1IYHA 2H30A 2NDOA 4Q5RA 3UEMA 4V2MA 3OR5A 5E4WA 5FT3A 2I81A 3WGXA 1TJDA 4Q5QA 4XCSA 2IMEA 4AJ8A 4GSSA 4MJAA 4EL1A 1TI3A 2DIYA 1W89A 2V2GA 2HXKA 2VL9A 4L5LA 4PTSA 1YJ6A 3FZ4A 1A0RP 1F6MC 2RUEA 3GYKA 5IOXA 2GT6A 3TKQA 3VI7A 1LJRA 1YZXA 2X99A 3ED3A 2YZUA 4G0LA 4QL9A 2H19A 2GSQA 4F82A 4RI7A 3H1NA 4BPYA 3EWLA 4TN8A 1U87A 1MDIA 3QFBC 5B6MA 1OC3A 1S3DA 2QC7A 2J9HA 1OAZA 3UMAA 5IIZA 1GSDA 4GRFA 2XBQA 4N10A 3QD9A 5L71A 2X49A 3FRCA 3LXTA 4EXJA 3HZ8A 3LFLA 1GSQA 1SL2B 3R3EA 3F6FA 4KH7A 5ECPB 1RK4A 5IMZA 2YWOA 2FY6A 3BD2A 1O73A 5B6NA 2GSTA 1Z6NA 2QA2A 2R4VA 1ZL9A 4XRAA 3WT2A 1F3BA 1M9BA 3HVNA 4MJCA 1B9YC 2K8VA 19GSA 4XTSA 3FEUA 3GH9A 3TJJA 3HA9A 1HNAA 4ZXGA 3ZITA 1OKDA 3TJGA 4EF0A 4MJEA 1GL8A 2L5LA 2FNOA 3ERFA 4PUFC 4NMUA 1K0MA 2P0GA 1FHEA 4ZB9A 5ELAA 4MA9A 4PURA 5D9TA 5ID2A 4FYCA 4YAPA 5C04A 4F2IA 4BWQA 3M1GA 2H1AA 1X5EA 5F8BA 4YKGA 3J7Yk 2VCZA 3IC8A 3KP8A 4KCEA 2IWTA 3WT1A 2FGXA 4KDXA 2JZRA 4GQFA 1FVKA 2TRXA 3RBTA 1OC9B 1TRSA 2L4QA 1YEPA 4Q5NA 3NZNA 3O3TA 4MP4A 3QDNA 4PNFA 3FK8A 4JEDA 4KDUA 2WDUA 1XBSA 2HI7A 1BG5A 3GNJA 3M8NA 4O5UA 2G0FA 2QKEA 4GLTA 1VF3A 1SU9A 3KTLA 4XS1A 3FR9A 1I5GA 4MZWA 1R26A 2C3QA 3NIVA 1ZYPA 1RW1A 3HVXA 2GSRA 2AJQB 5LNKe 1FB0A 5F07A 2ON5A 2YN1A 4MF5A 2R2JA 3PH9A 4OWYA 3FKFA 2B7JA 3FY7A 3HJOA 4K6XA 2OADA 1PRXA 5DAKA 1GNWA 3LYKA 3MIXA 3RPNA 3HXSA 3TKSE 2R3XA 2XPEA 2YOIA 4G10A 4Z7XA 3L78A 1W4VA 1H75A 3LGCA 3W6GA 4IS0A 5CRWA 1V2AA 2K6VA 1Q4JA 4IP6A 1O8WA 4AGSA 6GSVA 2FWGA 3IK7A 3MAKA 2MMOA 3A2WA 1A24A 3FZ9A 2OACA 2AYTA 1GTUA 1ZYEA 2IL3A 4BWSA 1ZCPA 3D5JA 2H74A 2KP2A 1JHBA 3CSJA 2ALBA 2VCTA 4KX4A 3KMOA 4DSRA 4NAXA 1K0DA 2H66A 4KA0A 1ERUA 2DJ0A 4I2UA 1S3RA 1U3IA 3GTUB 5GAPD 3TJBA 1ERVA 1O81A 3SBCA 3Q19A 3HCZA 2HRFA 5D9XA 3BCIA 1VF1A 3ZMKA 1MDKA 2C0GA 1FOVA 3F9UA 2N5BA 2DKIA 1OVNA 2MMZA 2YV7A 2F3MA 4IW9A 1YKAA 1QMVA 3H8QA 4ML1A 1EOGA 1Z3EA 2CT6A 3MDKA 2DIZA 4KUNA 1GSFA 3VWVA 1O85A 4WF5A 1GULA 1JZDA 3S9FA 2QA1A 3MSZA 1K0AA 2LUSA 4L0UA 4BVYB 4Z2UA 1UVZA 1EZKA 3DWVA 2KHPA 4KF9A 4TR4A 2ZCTA 2AB6A 2HSHA 2P5QA 3RHCA 2WB9A 2GQMA 3RAZA 2M80A 5AN1A 3QFAC 4TXOB 4X0XA 3FHKA 2MYGA 3MWHA 2H1BA 1VF4A 1OYJA 4N0VA 5ECMB 1H4OA 1Z9HA 1TXXA 3IRAA 4HU7A 3L9VA 2O7KA 1T8EB 4KSMA 1XCCA 4IJ3A 1AUCA 4IELA 4LL1B 4KDYA 2JZTA 1TTZA 3GX0A 4BIKA 1V58A 2PGTA 2H01A 3GUSA 4KCAA 2OE0A 1XXUA 4YAVA 1T3BA 5G30A 8GSSA 1ZMAA 1GUHA 1AC1A 4E8EA 3MNGA 3G7YA 1X5DA 1BX9A 4JE1A 4ZIJA 3GSSA 1QK8A 5D9WA 3ZVJA 3JCML 2X4AA 1T00A 4K8MA 4PX1A 3IHGA 4ZL9A 1URMA 3F6DA 5LD0A 4CDOA 2C0EA 1PD21 2TIRA 2I1UA 4D73A 4NXIA 2CA8A 3EC3A 5J9CA 3IDVA 3UBKA 3A2VA 1LU4A 3P2AA 5HR3A 3M9JA 3HKRA 1A2MA 3TUEA 5IMCA 2X8GA 4KNDA 4HDEA 3F4TA 2V1MA 1BAYA 2A2RA 3BBYA 3DIEA 3ZYWA 4MMMA 2REMA 1PMTA 3ZFBA 2YJHA 2RLIA 4OO4A 3TRQA 1CQGA 3G9BA 4GQCA 3V1WA 5JWRB 3TOTA 4K7IA 3GKXA 1USBA 3D22A 1PL2A 4MZCA 3D6IA 2VLUA 2GVPA 4IN0A 3CTFA 4MK3A 3F3RA 4ICYA 18GSA 2VD1A 5DCHA 4NV2A 13GSA 4XRDA 3UJ1A 3A5IA 2JL4A 2VM2A 3VPTA 3A5WA 4TVEA 4WBJA 1WP0A 4K0NA 1GTBA 3F4SA 4JU5A 1GLQA 2AUVA 2ZNMA 2IIYA 3TJKA 4PXOA 5D93A 4DSQA 5KOWA 1X5CA 6GSTA 1KBNA 1A8LA 3ZMLA 5FHIA 2C4JA 3C8EA 5G1KA 4HOJA 2CVBA 2XBIA 3GX8A 1T1VA 2R5GA 1O7UA 4LL4B 1ML6A 4A5PA 1QUWA 2V32A 3KMNA 4I97A 2LJRA 4GXZA 4GTUA 1K0CA 4ISDA 4NHZA 4AF2A 3ZIJA 1WE0A 2H8LA 2PMTA 1GTIA 4CY8A 1M99A 1DSBA 1YEXA 5D8IA 2C8UA 2HSMA 5IPHA 5CNWA 1TRVA 4FQUA 1JZOA 2JSZA 2VL2A 4G0IA 1WMJA 5IMFA 1ZGNA 4IBPA 3L0HA 2VD0A 3GA4A 16GSA 1QQ2A 1Y6EA 1R5PA 4MNNA 1SJ6A 4OFMA 2WULA 1TP9A 1J9BA 4DSSA 4FH8A 12GSA 4ID0A 2YPMA 1B48A 4PGTA 3WD6A 2EC4A 1XWBA 2AHEA
chains in the Genus database with same CATH topology
11GSA 1BYEA 1E2YA 1AQWA 2IFQA 3F63A 1QXHA 3DD3A 3I6AA 1SKWB 3GIXA 3LG6A 2LS5A 2WJUA 2OKAA 2J23A 3ZTLA 3CMIA 1JLWA 1YF1A 1PN0A 2PVOC 2E0QA 4PQHA 3HVVA 4JBBA 1WWJA 2NPBA 3LEFA 1XW6A 3GSTA 4N30A 2H1DA 1TK0B 1NSWA 2LJAA 1TK5B 1XFLA 2OBIA 5F06A 1G0TA 2A2PA 1A2LA 2HT9A 3TKSC 2L4CA 2B1KA 4LLRA 1HD2A 1BQ7A 1OE8A 4O32A 5B7CA 5HFIA 3LJRA 4HZ4A 3IK9A 5ID2B 4ZB6A 3EPTA 2A4HA 4XHMA 1IYIA 1GSEA 4J57E 4F9ZA 4EKZA 1F9MA 5CP1A 4KAEA 4WBRD 3D4MA 4MH3A 5CRGA 4X43A 3E0UA 3TDGA 2PU9C 4IQ1A 4BVXA 5ECIB 2UZ8A 4FYBA 3FYGA 4OD7A 1SD9A 1NM3A 2CV4A 1J08A 2VCVA 1AAZA 5ECLB 5BMUA 5H5RA 1AQXA 2R0CA 3P7XA 4GWRA 1DUGA 2FA8A 3CXGA 1PX6A 1MD3A 4RQRA 2LKUA 2GLRA 5IQYA 1U88A 4HQSA 3EU4A 4YQVA 3KP9A 4TOPA 5G1LA 2N5AA 1ZZYA 3VWUA 2VAFA 1DE1A 2LNTA 1C72A 4I8BA 1DE2A 5KOXA 2H73A 3IPZA 5EY6A 5F05A 1M7TA 3GFKA 1SD8A 4FIWA 3D21A 2ZUPA 2YP6A 1PGTA 5DAKB 4K0GA 3C7MA 1B8XA 1PL1A 2FD3A 2XPDA 5A4VA 1A2JA 22GSA 1OE7A 2FCHA 5D96A 5IOWA 1PKWA 3I69A 3O76A 4PQ1A 4V1Ag 4X4JA 4MCUA 2M72A 4F03A 3WGDA 3PGTA 3HJMA 1GH2A 3CTGA 3O6TA 5J4UA 1AIUA 1FOHA 2VL2C 2C80A 1Z6MA 2HE3A 1Z5YE 3CRTA 1ERTA 4G0KA 4GF0A 2KOKA 2OJLA 4ZILA 2HNLA 3FZAA 5DQSA 1YF0A 4RI6A 2EIRA 3IXRA 4X1UA 5LCZA 4TW5A 2B3SA 4HEA2 4XS4B 2XC2A 4K9ZA 2CZ2A 2JU5A 5B8BA 4ML6A 3HDCA 4EUYA 4HI7A 4XS4A 3FW2A 2K8SA 1EGRA 2H72A 4BL7A 3ME8A 1T7PB 5ECRB 2L6DA 4MLYA 3CSHA 3QCPA 2C0FA 4K2XA 2OE1A 3PPUA 1XVWA 2IPAA 1UN2A 1PN9A 2GSSA 2VL3A 1KTEA 3KTBA 3HD5A 1TI1A 4CY6A 4HJMA 4IVFA 1M2BA 2CAQA 3KXOA 4MDCA 2E7PA 2HFDA 1M0UA 3DYRA 2JSYA 4HQZA 1FW1A 1EOHA 1CQHA 4IHUA 1GRXA 2DJ2A 2DJ3A 4MABA 2DJ1A 5JCUA 4NV5A 4KSOA 3BCKA 1WPIA 1OC8A 4MF6A 2H75A 3FZ5A 2MZCA 2A4VA 1ZYQB 2HRKA 4MF7A 2E2GA 1B9XC 1V9WA 2FA4A 2ON7A 3DGQA 4WETA 5J41A 2P31A 1PX7A 2PN8A 1NHOA 3LQ7A 3KCMA 2HRAA 2NTOA 2QGVA 3QR6A 2HYXA 2VCQA 4YKFA 3ZLPA 5ECQB 3U6VA 4E8HA 2LNSA 4CHSA 2C3TA 6GSSA 1AQVA 2LQOA 1PA3A 1G6YA 3K8NA 5IO2A 2GZZA 3IE3A 2LRNA 3HJPA 1B4QA 4G9HA 5KN0A 3ZREA 5CREA 1K3LA 2H0IA 4Q5FA 2VLVA 1TKDB 1GWCA 5B8AA 5COHA 5DJLA 1GSYA 1J0FA 1MD4A 1S3AA 1M2AA 3GKKA 1SJZA 1V98A 3KGKA 5G5FA 2F9SA 3LYPA 2F51A 2GS3A 1SKRB 2DBCA 4OFTA 2R0GA 3UAPA 2CAIA 1A0FA 1WJKA 3RHBA 1EV9A 4N11A 3C73A 3DVWA 2NVLA 3DXBA 4OMVA 1WRYA 1ST9A 2VOCA 2L5OA 1BEDA 4CW9A 3LWAA 4Z2RA 2OA7A 1GTAA 1XW9A 1SK2A 3I43A 5INYA 5J3RA 1JFUA 3TKSA 5DCGA 1XWGA 4D73B 2FWFA 3FMWA 1EP7A 3A2XA 2B6MA 4XS6A 3EURA 3VLNA 2YNXA 4O5RA 1SL0B 3G7JA 1SJIA 2KLXA 3IV4A 4IJIA 3ISOA 3CSIA 1M9AA 2O89A 4V2LA 3HHVA 14GSA 3IC4A 4HZ2A 5IO0A 2H71A 1G6WA 2PWJA 5J9BA 3GURA 5GZZB 1TU8A 2LRTA 1F37A 2G2QA 2YWMA 3ZVJD 4EO3A 5ECNB 2RIIA 2X8HA 2EIQA 1SK0A 1GNEA 1XVQA 1FO5A 3US3A 4EDZA 2ES7A 1N2AA 1F3AA 2FHEA 7GSSA 2CX3A 3EE2A 4GCIA 3AY8A 6GSYA 3EVIA 4WR4A 2DKHA 3E9JB 1WIKA 5DVBA 2O87A 3VI5A 1TU7A 1TOFA 1XIYA 3KM6A 3VWXA 3GHAA 2LEGA 4OO5A 3GMFA 3J7Yb 1VF2A 5ECHB 3BJ5A 2WFCA 2VO4A 4JR4A 5J5NA 1SYXA 5ECKB 2IMDA 3NOFA 3M3MA 4I6XA 2H6ZA 2FLSA 1XW5A 4ECCA 1ON4A 2R0PA 3QAGA 1MDJA 2WCIA 4TR1A 4TRXA 3KH9A 1U3AA 4LMWA 4ECBA 2BTOT 2DLXA 2L6CA 1O6JA 4KB3A 1R5AA 2LSTA 5IMDA 3TCOA 4G2EA 2CZ3A 4V2NA 2CQ9A 3C71A 1G7OA 1OKTA 1GSUA 1YDKA 2H6YA 3PINA 3VK9A 1X0RA 3KJYA 5FWGA 4TXVA 4DSSB 4ZBDA 1ZYNA 4ZL8A 1TRUA 5BRTA 1VRSD 1U6TA 3VFIA 5JWOB 1AXDA 2O85A 4AJ7A 4GSNA 1ERWA 1BJXA 1XOAA 4QL7A 4ACSA 1K3YA 2B1LA 2IFQB 1K0BA 4MPFA 1FB6A 3PR8A 3Q18A 2YWNA 4JR6A 3SWLA 6GSUA 3DKSA 3LXZA 3CBUA 2YZHA 4FO5A 4PNGA 4K5SA 3TB2A 1R7HA 3MYDA 4HU9A 1YKCA 3N5OA 3ZIVA 1E6BA 1GUMA 4MZBA 3LW9A 1THXA 4EIPA 2YWIA 3M9KA 3UIWA 1TRWA 4IKHA 2WGRA 1PSQA 3ZRDA 4GSTA 5CO3A 2B7KA 2NBSA 4MPGA 3GN3A 2PVQA 1ABAA 1V57A 1ACVA 4K5RA 4TR0A 2H1GA 2HLSA 1X9WB 2RUFA 3KD0A 1I9DA 4EDYA 4LMVA 1XWAA 3CYNA 2HRNA 1X9SB 1M2DA 3VPQA 4OCEA 1SYRA 3GRXA 1JZRA 3GH6A 4ECJA 1QGVA 3F3QA 5EPFA 2P5RA 2YJ7A 2GQKA 2I9HA 1UA5A 3WGEA 4J2FA 4BVXB 1PQNA 3A3TA 2BMXA 2PERA 2WZ9A 3KIJA 5E59A 1EWXA 4KW6A 3R2QA 2DMLA 3VURA 1EEJA 4PQIA 4IGJA 4RQXA 1Z7PA 5AISA 3TJFA 1EP8A 2LV3A 3W8SA 2VCXA 5HR0A 1MTCA 2KUCA 4YQMA 3QMXA 3IHQA 3P90A 1V40A 4JRRA 2PBJA 2CX4A 2V6KA 3HYPA 3EMXA 3F0IA 3F8UA 4O92A 4WEYA 1ILOA 2I3YA 4NHWA 1OC9A 1GSSA 2V41A 5D73A 4HUAA 4QQ7A 1SK1A 3M0FA 4IQAA 3C1SA 5CRHA 1K0NA 3DRNA 4KGIA 1SL1B 2B5YA 4L8EA 2VM1A 5AIVA 4N0ZA 3KH7A 2HSYA 1HNBA 5H5SA 1T4ZA 4LA1A 1S3CA 1EEMA 1Z7RA 5EVOA 3TRXA 4AJ6A 4F0CA 2H6XA 2YCDA 3EMPA 1AW9A 2MBTA 2DJJA 4YQUA 2IMIA 4EIQA 2AV4A 2WS2A 2V6OA 3DEXA 2FWEA 5ECOB 5KN2A 2GGTA 4TKYA 1NW2A 4G19A 1YQ1A 4OCFA 3TKPA 1T4YA 4HS1A 3Q6OA 5GSSA 2PUKC 5DBQA 1PKZA 2C3NA 1XZOA 1JZWA 1THOA 1XWCA 2TRCP 1XPVA 4NWYA 2X64A 4BL7B 4K2DA 3GL3A 3RDWA 4XIHA 2MMAA 3UARA 5AIXA 5IPGA 1FG4A 5HFGA 3I9V2 2DJKA 3L9UA 3QOUA 4ZBAA 3KZQA 4MJBA 2E2MA 3G7IA 2IMKA 2GT5A 1K3OA 2B5EA 5HQPA 4WXTA 2O8VB 1HQOA 3KEBA 5JWQB 1XWKA 4J56E 2H76A 3P8WA 2CVKA 1LBKA 3GV1A 4K1FA 4O7HA 5AGYA 4DVCA 3FR6A 2XHFA 4H86A 5DALB 4IP1A 1O8XA 5H5QA 6GSWA 3IBHA 5DQYA 5IMVA 3APQA 5DALA 2R6KA 5A5KA 10GSA 3GTUA 3U5RE 1GLPA 4ZB8A 2A2SA 2HZEB 4Z2TA 5KN1A 3TKRA 3APOA 5ELGA 1Q98A 3HY2A 2HZEA 4PUAA 2IMFA 3TRPA 3GKNA 4F0BA 2IN3A 4POKA 2K9FA 4K7NA 2DMMA 5CYYA 4MH2A 1VGLA 3IAM2 20GSA 3D4TA 4USSA 5EL8A 2H0HA 2Z9SA 2JZSA 1QFNA 3GKMA 3E3EA 3APSA 2GDRA 1JLVA 3UL3A 4WKWA 5CRDA 2AAWA 5G31A 5ECSA 3ERWA 1SENA 1ZOFA 3DVXA 1EV4A 2LTKA 4BVYA 2IJYA 1DBYA 1GUKA 3W8JA 3IR4A 1X9MB 3DMLA 5D9VA 6GSXA 2QSIA 3QAWA 2JACA 1TK8B 2OE3A 4L0WA 3QPMA 2RM6A 9GSSA 2WRTA 4O5QA 2BJXA 3VWWA 5A4UA 3L4NA 4I2TA 4JZQA 3D0ZA 1XOBA 2B5XA 3ERGA 1Y25A 2K18A 2YV9A 4TXOA 4DEJA 2FWHA 4KE3A 4EVMA 2C1YA 2GQLA 2RM5A 3IAS2 4YH2A 4ZBBA 5C00A 1UC7A 2VLTA 5ENUA 3CRUA 1EGOA 5IMAA 3IOSA 3L9SA 4ILFA 3N9JA 2GZPA 2VIMA 4POLA 3H4KA 4NPBA 3ZL5A 2L59A 3LORA 5G2ZA 1HYUA 3UVTA 3TGZA 1NHYA 2L57A 3GL5A 4EC0A 2HZFA 3HVSA 2H0GA 2R37A 2LRCA 1SKSB 4ZL7A 2VUPA 2FUG2 4OFNA 5JCWA 2D2ZA 2MBSA 3BOAA 3QAVA 4EE0A 3HZ4A 1B4PA 5HR1A 3ME7A 1MEKA 5F0GA 3EINA 2GTUA 5CAXA 4ULXA 4K7OA 2JADA 1HNCA 4I5QA 1KNGA 5KN3A 1TW9A 1R4WA 4FYUA 3ZFLA 1F2EA 5G5EA 4ECIA 5DJMA 3UBLA 4BA7A 5KEJA 2VCWA 4POBA 2DSAA 4HJ2A 4WR5A 1A8YA 3F4RA 2GZYA 3LSZA 2F8AA 5IM9A 5ABRA 2LJKA 5JCGA 4TR3A 4POMA 2YANA 4RUVA 3EYTA 2I4AA 3C1RA 3ZZXA 1FAAA 5A4WA 1N8JA 1A23A 1WOUA 3H93A 1RQMA 5GSTA 2KP1A 17GSA 2LQQA 3UVHA 1TDIA 2X8CA 4P3YB 5GAND 1K0OA 4L5OA 2MMNA 2C0DA 2N5FA 3EU3A 4WF4A 5HFKA 4V1Ap 1GP1A 3H79A 2PPTA 2CVDA 2DC5A 2H70A 1G7EA 4TR1B 3FR3A 5HR2A 3TOUA 3WYWA 2EIOA 5DDLA 1FVJA 2M46A 1KEBA 1YY7A 2F8FA 3IA1A 2OBKA 3UOMA 3Q74A 3RPPA 1IYHA 2H30A 2NDOA 4Q5RA 3UEMA 4V2MA 3OR5A 5E4WA 5FT3A 2I81A 3WGXA 1TJDA 4Q5QA 4XCSA 2IMEA 4AJ8A 4GSSA 4MJAA 4EL1A 1TI3A 2DIYA 1W89A 2V2GA 2HXKA 2VL9A 4L5LA 4PTSA 1YJ6A 3FZ4A 1A0RP 1F6MC 2RUEA 3GYKA 5IOXA 2GT6A 3TKQA 3VI7A 1LJRA 1YZXA 2X99A 3ED3A 2YZUA 4G0LA 4QL9A 2H19A 2GSQA 4F82A 4RI7A 3H1NA 4BPYA 3EWLA 4TN8A 1U87A 1MDIA 3QFBC 5B6MA 1OC3A 1S3DA 2QC7A 2J9HA 1OAZA 3UMAA 5IIZA 1GSDA 4GRFA 2XBQA 4N10A 3QD9A 5L71A 2X49A 3FRCA 3LXTA 4EXJA 3HZ8A 3LFLA 1GSQA 1SL2B 3R3EA 3F6FA 4KH7A 5ECPB 1RK4A 5IMZA 2YWOA 2FY6A 3BD2A 1O73A 5B6NA 2GSTA 1Z6NA 2QA2A 2R4VA 1ZL9A 4XRAA 3WT2A 1F3BA 1M9BA 4MJCA 1B9YC 2K8VA 19GSA 4XTSA 3FEUA 3GH9A 3TJJA 3HA9A 1HNAA 4ZXGA 3ZITA 1OKDA 3TJGA 4EF0A 4MJEA 1GL8A 2L5LA 2FNOA 3ERFA 4PUFC 4NMUA 1K0MA 2P0GA 1FHEA 4ZB9A 5ELAA 4MA9A 4PURA 5D9TA 5ID2A 4FYCA 4YAPA 5C04A 4F2IA 4BWQA 3M1GA 2H1AA 1X5EA 5F8BA 4YKGA 3J7Yk 2VCZA 3IC8A 3KP8A 4KCEA 2IWTA 3WT1A 2FGXA 4KDXA 2JZRA 4GQFA 1FVKA 2TRXA 3RBTA 1OC9B 1TRSA 2L4QA 1YEPA 4Q5NA 3NZNA 3O3TA 4MP4A 3QDNA 4PNFA 3FK8A 4JEDA 4KDUA 2WDUA 1XBSA 2HI7A 1BG5A 3GNJA 3M8NA 4O5UA 2G0FA 2QKEA 4GLTA 1VF3A 1SU9A 3KTLA 4XS1A 3FR9A 1I5GA 4MZWA 1R26A 2C3QA 3NIVA 1ZYPA 1RW1A 3HVXA 2GSRA 2AJQB 5LNKe 1FB0A 5F07A 2ON5A 2YN1A 4MF5A 2R2JA 3PH9A 4OWYA 3FKFA 2B7JA 3FY7A 3HJOA 4K6XA 2OADA 1PRXA 5DAKA 1GNWA 3LYKA 3MIXA 3RPNA 3HXSA 3TKSE 2R3XA 2XPEA 2YOIA 4G10A 4Z7XA 3L78A 1W4VA 1H75A 3LGCA 3W6GA 4IS0A 5CRWA 1V2AA 2K6VA 1Q4JA 4IP6A 1O8WA 4AGSA 6GSVA 2FWGA 3IK7A 3MAKA 2MMOA 3A2WA 1A24A 3FZ9A 2OACA 2AYTA 1GTUA 1ZYEA 2IL3A 4BWSA 1ZCPA 3D5JA 2H74A 2KP2A 1JHBA 3CSJA 2ALBA 2VCTA 4KX4A 3KMOA 4DSRA 4NAXA 1K0DA 2H66A 4KA0A 1ERUA 2DJ0A 4I2UA 1U3IA 3GTUB 5GAPD 3TJBA 1ERVA 1O81A 3SBCA 3Q19A 3HCZA 2HRFA 5D9XA 3BCIA 1VF1A 3ZMKA 1MDKA 2C0GA 1FOVA 3F9UA 2N5BA 2DKIA 1OVNA 2MMZA 2YV7A 2F3MA 4IW9A 1YKAA 1QMVA 3H8QA 4ML1A 1EOGA 1Z3EA 2CT6A 3MDKA 2DIZA 4KUNA 1GSFA 3VWVA 1O85A 4WF5A 1GULA 1JZDA 3S9FA 2QA1A 3MSZA 1K0AA 2LUSA 4L0UA 4BVYB 4Z2UA 1UVZA 1EZKA 3DWVA 2KHPA 4KF9A 4TR4A 2ZCTA 2AB6A 2HSHA 2P5QA 3RHCA 2WB9A 2GQMA 3RAZA 2M80A 5AN1A 3QFAC 4TXOB 4X0XA 3FHKA 2MYGA 3MWHA 2H1BA 1VF4A 1OYJA 4N0VA 5ECMB 1H4OA 1Z9HA 1TXXA 3IRAA 4HU7A 3L9VA 2O7KA 1T8EB 4KSMA 1XCCA 4IJ3A 1AUCA 4IELA 4LL1B 4KDYA 2JZTA 1TTZA 3GX0A 1V58A 2PGTA 2H01A 3GUSA 4KCAA 2OE0A 1XXUA 4YAVA 1T3BA 5G30A 8GSSA 1ZMAA 1GUHA 1AC1A 4E8EA 3MNGA 3G7YA 1X5DA 1BX9A 4JE1A 4ZIJA 3GSSA 1QK8A 5D9WA 3ZVJA 3JCML 2X4AA 1T00A 4K8MA 4PX1A 3IHGA 4ZL9A 1URMA 3F6DA 5LD0A 4CDOA 2C0EA 1PD21 2TIRA 2I1UA 4D73A 4NXIA 2CA8A 3EC3A 5J9CA 3IDVA 3UBKA 3A2VA 1LU4A 3P2AA 5HR3A 3M9JA 3HKRA 1A2MA 3TUEA 5IMCA 2X8GA 4KNDA 4HDEA 3F4TA 2V1MA 1BAYA 2A2RA 3BBYA 3DIEA 3ZYWA 4MMMA 2REMA 1PMTA 3ZFBA 2YJHA 2RLIA 4OO4A 3TRQA 1CQGA 3G9BA 4GQCA 3V1WA 5JWRB 3TOTA 4K7IA 3GKXA 1USBA 3D22A 1PL2A 4MZCA 3D6IA 2VLUA 2GVPA 4IN0A 3CTFA 4MK3A 3F3RA 4ICYA 18GSA 2VD1A 5DCHA 4NV2A 13GSA 4XRDA 3UJ1A 3A5IA 2JL4A 2VM2A 3VPTA 3A5WA 4TVEA 4WBJA 1WP0A 4K0NA 1GTBA 3F4SA 4JU5A 1GLQA 2AUVA 2ZNMA 2IIYA 3TJKA 4PXOA 5D93A 4DSQA 5KOWA 1X5CA 6GSTA 1KBNA 1A8LA 3ZMLA 5FHIA 2C4JA 3C8EA 5G1KA 4HOJA 2CVBA 2XBIA 3GX8A 1T1VA 2R5GA 1O7UA 4LL4B 1ML6A 4A5PA 1QUWA 2V32A 3KMNA 4I97A 2LJRA 4GXZA 4GTUA 1K0CA 4ISDA 4NHZA 4AF2A 3ZIJA 1WE0A 2H8LA 2PMTA 1GTIA 4CY8A 1M99A 1DSBA 1YEXA 5D8IA 2C8UA 2HSMA 5IPHA 5CNWA 1TRVA 4FQUA 1JZOA 2JSZA 2VL2A 4G0IA 1WMJA 5IMFA 1ZGNA 4IBPA 3L0HA 2VD0A 3GA4A 16GSA 1QQ2A 1Y6EA 1R5PA 4MNNA 1SJ6A 4OFMA 2WULA 1TP9A 1J9BA 4DSSA 4FH8A 12GSA 4ID0A 2YPMA 1B48A 4PGTA 3WD6A 2EC4A 1XWBA 2AHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 11GS A;  1BYE A;  1E2Y A;  1AQW A;  2IFQ A;  3F63 A;  1QXH A;  3DD3 A;  3I6A A;  1SKW B;  3GIX A;  3LG6 A;  2LS5 A;  2WJU A;  2OKA A;  2J23 A;  3ZTL A;  3CMI A;  1JLW A;  1YF1 A;  2PVO C;  2E0Q A;  4PQH A;  3HVV A;  4JBB A;  1WWJ A;  2NPB A;  3LEF A;  1XW6 A;  3GST A;  4N30 A;  2H1D A;  1TK0 B;  1NSW A;  2LJA A;  1TK5 B;  1XFL A;  2OBI A;  5F06 A;  1G0T A;  1A2L A;  2HT9 A;  3TKS C;  2L4C A;  2B1K A;  4LLR A;  1HD2 A;  1BQ7 A;  1OE8 A;  4O32 A;  5B7C A;  5HFI A;  3LJR A;  4HZ4 A;  3IK9 A;  5ID2 B;  4ZB6 A;  4XHM A;  1IYI A;  1GSE A;  4J57 E;  4F9Z A;  4EKZ A;  1F9M A;  5CP1 A;  4KAE A;  4WBR D;  3D4M A;  4MH3 A;  5CRG A;  4X43 A;  3E0U A;  3TDG A;  2PU9 C;  4IQ1 A;  4BVX A;  5ECI B;  4FYB A;  3FYG A;  4OD7 A;  1SD9 A;  1NM3 A;  2CV4 A;  1J08 A;  2VCV A;  1AAZ A;  5ECL B;  5H5R A;  1AQX A;  3P7X A;  4GWR A;  1DUG A;  2FA8 A;  3CXG A;  1PX6 A;  1MD3 A;  4RQR A;  2LKU A;  2GLR A;  5IQY A;  1U88 A;  4HQS A;  3EU4 A;  4YQV A;  3KP9 A;  4TOP A;  5G1L A;  2N5A A;  1ZZY A;  3VWU A;  2VAF A;  1DE1 A;  2LNT A;  1C72 A;  4I8B A;  1DE2 A;  2H73 A;  3IPZ A;  5EY6 A;  5F05 A;  1M7T A;  3GFK A;  1SD8 A;  4FIW A;  3D21 A;  2ZUP A;  2YP6 A;  1PGT A;  5DAK B;  4K0G A;  3C7M A;  1B8X A;  1PL1 A;  2FD3 A;  2XPD A;  5A4V A;  1A2J A;  22GS A;  1OE7 A;  2FCH A;  5D96 A;  5IOW A;  1PKW A;  3I69 A;  3O76 A;  4PQ1 A;  4V1A g;  4MCU A;  2M72 A;  4F03 A;  3WGD A;  3PGT A;  3HJM A;  1GH2 A;  3CTG A;  3O6T A;  5J4U A;  1AIU A;  2VL2 C;  2C80 A;  1Z6M A;  2HE3 A;  1Z5Y E;  3CRT A;  1ERT A;  4GF0 A;  2KOK A;  2OJL A;  4ZIL A;  2HNL A;  3FZA A;  5DQS A;  1YF0 A;  4RI6 A;  2EIR A;  3IXR A;  4X1U A;  5LCZ A;  4TW5 A;  2B3S A;  4HEA 2;  4XS4 B;  2XC2 A;  4K9Z A;  2CZ2 A;  2JU5 A;  5B8B A;  4ML6 A;  3HDC A;  4EUY A;  4HI7 A;  4XS4 A;  3FW2 A;  2K8S A;  1EGR A;  2H72 A;  4BL7 A;  3ME8 A;  1T7P B;  5ECR B;  2L6D A;  4MLY A;  3CSH A;  3QCP A;  2C0F A;  2OE1 A;  1XVW A;  2IPA A;  1UN2 A;  1PN9 A;  2GSS A;  2VL3 A;  1KTE A;  3KTB A;  3HD5 A;  1TI1 A;  4HJM A;  4IVF A;  1M2B A;  2CAQ A;  3KXO A;  4MDC A;  2E7P A;  2HFD A;  1M0U A;  3DYR A;  2JSY A;  4HQZ A;  1FW1 A;  1EOH A;  1CQH A;  4IHU A;  1GRX A;  2DJ2 A;  2DJ3 A;  4MAB A;  2DJ1 A;  5JCU A;  4NV5 A;  4KSO A;  3BCK A;  1WPI A;  1OC8 A;  4MF6 A;  2H75 A;  3FZ5 A;  2MZC A;  2A4V A;  1ZYQ B;  4MF7 A;  2E2G A;  1B9X C;  1V9W A;  2FA4 A;  2ON7 A;  3DGQ A;  4WET A;  5J41 A;  2P31 A;  1PX7 A;  2PN8 A;  1NHO A;  3LQ7 A;  3KCM A;  2NTO A;  2QGV A;  3QR6 A;  2HYX A;  2VCQ A;  3ZLP A;  5ECQ B;  3U6V A;  4E8H A;  2LNS A;  4CHS A;  2C3T A;  6GSS A;  1AQV A;  2LQO A;  1PA3 A;  1G6Y A;  3K8N A;  5IO2 A;  2GZZ A;  3IE3 A;  2LRN A;  3HJP A;  1B4Q A;  4G9H A;  5KN0 A;  3ZRE A;  5CRE A;  1K3L A;  2H0I A;  4Q5F A;  2VLV A;  1TKD B;  1GWC A;  5B8A A;  5COH A;  5DJL A;  1GSY A;  1J0F A;  1MD4 A;  1S3A A;  1M2A A;  3GKK A;  1SJZ A;  1V98 A;  3KGK A;  5G5F A;  2F9S A;  3LYP A;  2F51 A;  2GS3 A;  1SKR B;  2DBC A;  4OFT A;  3UAP A;  2CAI A;  1A0F A;  1WJK A;  3RHB A;  1EV9 A;  4N11 A;  3C73 A;  3DVW A;  2NVL A;  3DXB A;  4OMV A;  1WRY A;  1ST9 A;  2VOC A;  2L5O A;  1BED A;  4CW9 A;  3LWA A;  2OA7 A;  1GTA A;  1XW9 A;  1SK2 A;  3I43 A;  5INY A;  5J3R A;  1JFU A;  3TKS A;  5DCG A;  1XWG A;  4D73 B;  2FWF A;  1EP7 A;  3A2X A;  2B6M A;  4XS6 A;  3EUR A;  3VLN A;  2YNX A;  4O5R A;  1SL0 B;  3G7J A;  1SJI A;  2KLX A;  3IV4 A;  4IJI A;  3ISO A;  3CSI A;  1M9A A;  2O89 A;  4V2L A;  3HHV A;  14GS A;  3IC4 A;  4HZ2 A;  5IO0 A;  2H71 A;  1G6W A;  2PWJ A;  5J9B A;  3GUR A;  5GZZ B;  1TU8 A;  2LRT A;  1F37 A;  2G2Q A;  2YWM A;  3ZVJ D;  4EO3 A;  5ECN B;  2RII A;  2X8H A;  2EIQ A;  1SK0 A;  1GNE A;  1XVQ A;  1FO5 A;  3US3 A;  4EDZ A;  2ES7 A;  1N2A A;  1F3A A;  2FHE A;  7GSS A;  2CX3 A;  3EE2 A;  4GCI A;  3AY8 A;  6GSY A;  3EVI A;  4WR4 A;  3E9J B;  1WIK A;  5DVB A;  2O87 A;  3VI5 A;  1TU7 A;  1TOF A;  1XIY A;  3KM6 A;  3VWX A;  3GHA A;  2LEG A;  4OO5 A;  3GMF A;  3J7Y b;  1VF2 A;  5ECH B;  3BJ5 A;  2WFC A;  2VO4 A;  4JR4 A;  5J5N A;  1SYX A;  5ECK B;  2IMD A;  3NOF A;  3M3M A;  4I6X A;  2H6Z A;  2FLS A;  1XW5 A;  4ECC A;  1ON4 A;  3QAG A;  1MDJ A;  2WCI A;  4TR1 A;  4TRX A;  3KH9 A;  1U3A A;  4LMW A;  4ECB A;  2BTO T;  2DLX A;  2L6C A;  1O6J A;  4KB3 A;  1R5A A;  2LST A;  5IMD A;  3TCO A;  4G2E A;  2CZ3 A;  4V2N A;  2CQ9 A;  3C71 A;  1G7O A;  1OKT A;  1GSU A;  1YDK A;  2H6Y A;  3PIN A;  3VK9 A;  1X0R A;  3KJY A;  5FWG A;  4TXV A;  4DSS B;  4ZBD A;  4ZL8 A;  1TRU A;  1VRS D;  1U6T A;  3VFI A;  5JWO B;  1AXD A;  2O85 A;  4AJ7 A;  4GSN A;  1ERW A;  1BJX A;  1XOA A;  4QL7 A;  4ACS A;  1K3Y A;  2B1L A;  2IFQ B;  1K0B A;  4MPF A;  1FB6 A;  3PR8 A;  3Q18 A;  2YWN A;  4JR6 A;  3SWL A;  6GSU A;  3DKS A;  3LXZ A;  3CBU A;  2YZH A;  4FO5 A;  4PNG A;  3TB2 A;  1R7H A;  4HU9 A;  1YKC A;  3N5O A;  3ZIV A;  1E6B A;  1GUM A;  4MZB A;  1THX A;  2YWI A;  3M9K A;  3UIW A;  1TRW A;  4IKH A;  2WGR A;  1PSQ A;  3ZRD A;  4GST A;  5CO3 A;  2B7K A;  2NBS A;  4MPG A;  3GN3 A;  2PVQ A;  1ABA A;  1V57 A;  1ACV A;  4TR0 A;  2H1G A;  2HLS A;  1X9W B;  2RUF A;  3KD0 A;  1I9D A;  4EDY A;  4LMV A;  1XWA A;  3CYN A;  2HRN A;  1X9S B;  1M2D A;  3VPQ A;  4OCE A;  1SYR A;  3GRX A;  1JZR A;  3GH6 A;  4ECJ A;  1QGV A;  3F3Q A;  5EPF A;  2P5R A;  2YJ7 A;  2GQK A;  2I9H A;  1UA5 A;  3WGE A;  4J2F A;  1PQN A;  3A3T A;  2BMX A;  2PER A;  2WZ9 A;  3KIJ A;  5E59 A;  1EWX A;  4KW6 A;  3R2Q A;  2DML A;  3VUR A;  1EEJ A;  4PQI A;  4IGJ A;  4RQX A;  1Z7P A;  5AIS A;  3TJF A;  1EP8 A;  2LV3 A;  3W8S A;  2VCX A;  5HR0 A;  1MTC A;  2KUC A;  4YQM A;  3QMX A;  3IHQ A;  3P90 A;  1V40 A;  4JRR A;  2PBJ A;  2CX4 A;  2V6K A;  3HYP A;  3EMX A;  3F0I A;  3F8U A;  4O92 A;  4WEY A;  1ILO A;  2I3Y A;  4NHW A;  1OC9 A;  1GSS A;  2V41 A;  5D73 A;  4HUA A;  4QQ7 A;  1SK1 A;  3M0F A;  4IQA A;  3C1S A;  5CRH A;  1K0N A;  3DRN A;  4KGI A;  1SL1 B;  2B5Y A;  4L8E A;  2VM1 A;  5AIV A;  4N0Z A;  3KH7 A;  2HSY A;  1HNB A;  5H5S A;  1T4Z A;  4LA1 A;  1S3C A;  1EEM A;  1Z7R A;  5EVO A;  3TRX A;  4AJ6 A;  4F0C A;  2H6X A;  2YCD A;  3EMP A;  1AW9 A;  2MBT A;  2DJJ A;  4YQU A;  2IMI A;  2AV4 A;  2WS2 A;  2V6O A;  3DEX A;  2FWE A;  5ECO B;  5KN2 A;  2GGT A;  4TKY A;  1NW2 A;  4G19 A;  1YQ1 A;  4OCF A;  3TKP A;  1T4Y A;  4HS1 A;  3Q6O A;  5GSS A;  2PUK C;  5DBQ A;  1PKZ A;  2C3N A;  1XZO A;  1JZW A;  1THO A;  1XWC A;  2TRC P;  1XPV A;  4NWY A;  2X64 A;  4K2D A;  3GL3 A;  3RDW A;  4XIH A;  2MMA A;  3UAR A;  5AIX A;  5IPG A;  1FG4 A;  5HFG A;  3I9V 2;  2DJK A;  3L9U A;  3QOU A;  4ZBA A;  3KZQ A;  4MJB A;  2E2M A;  3G7I A;  2IMK A;  2GT5 A;  1K3O A;  2B5E A;  5HQP A;  4WXT A;  2O8V B;  1HQO A;  3KEB A;  5JWQ B;  1XWK A;  4J56 E;  2H76 A;  3P8W A;  2CVK A;  1LBK A;  3GV1 A;  4K1F A;  4O7H A;  5AGY A;  4DVC A;  3FR6 A;  2XHF A;  4H86 A;  5DAL B;  4IP1 A;  1O8X A;  5H5Q A;  6GSW A;  3IBH A;  5DQY A;  5IMV A;  3APQ A;  5DAL A;  2R6K A;  5A5K A;  10GS A;  3GTU A;  3U5R E;  1GLP A;  4ZB8 A;  2A2S A;  2HZE B;  5KN1 A;  3TKR A;  3APO A;  5ELG A;  1Q98 A;  3HY2 A;  2HZE A;  4PUA A;  2IMF A;  3TRP A;  3GKN A;  4F0B A;  2IN3 A;  4POK A;  2K9F A;  4K7N A;  2DMM A;  5CYY A;  4MH2 A;  1VGL A;  3IAM 2;  20GS A;  3D4T A;  5EL8 A;  2H0H A;  2Z9S A;  2JZS A;  1QFN A;  3GKM A;  3E3E A;  3APS A;  2GDR A;  1JLV A;  3UL3 A;  4WKW A;  5CRD A;  2AAW A;  5G31 A;  5ECS A;  3ERW A;  1SEN A;  1ZOF A;  3DVX A;  1EV4 A;  2LTK A;  4BVY A;  2IJY A;  1DBY A;  1GUK A;  3W8J A;  3IR4 A;  1X9M B;  3DML A;  5D9V A;  6GSX A;  2QSI A;  3QAW A;  2JAC A;  1TK8 B;  2OE3 A;  4L0W A;  3QPM A;  2RM6 A;  9GSS A;  2WRT A;  2BJX A;  3VWW A;  5A4U A;  3L4N A;  4I2T A;  4JZQ A;  3D0Z A;  1XOB A;  2B5X A;  3ERG A;  1Y25 A;  2K18 A;  2YV9 A;  4TXO A;  4DEJ A;  2FWH A;  4KE3 A;  4EVM A;  2C1Y A;  2GQL A;  2RM5 A;  3IAS 2;  4YH2 A;  4ZBB A;  5C00 A;  1UC7 A;  2VLT A;  5ENU A;  3CRU A;  1EGO A;  5IMA A;  3IOS A;  3L9S A;  4ILF A;  3N9J A;  2GZP A;  2VIM A;  4POL A;  3H4K A;  4NPB A;  3ZL5 A;  2L59 A;  3LOR A;  5G2Z A;  1HYU A;  3UVT A;  3TGZ A;  1NHY A;  2L57 A;  3GL5 A;  4EC0 A;  2HZF A;  3HVS A;  2H0G A;  2R37 A;  2LRC A;  1SKS B;  4ZL7 A;  2VUP A;  2FUG 2;  4OFN A;  5JCW A;  2D2Z A;  2MBS A;  3BOA A;  3QAV A;  4EE0 A;  3HZ4 A;  1B4P A;  5HR1 A;  3ME7 A;  1MEK A;  5F0G A;  3EIN A;  2GTU A;  5CAX A;  4ULX A;  4K7O A;  2JAD A;  1HNC A;  4I5Q A;  1KNG A;  5KN3 A;  1TW9 A;  1R4W A;  4FYU A;  3ZFL A;  1F2E A;  5G5E A;  4ECI A;  5DJM A;  3UBL A;  4BA7 A;  5KEJ A;  2VCW A;  4POB A;  2DSA A;  4HJ2 A;  4WR5 A;  1A8Y A;  3F4R A;  2GZY A;  3LSZ A;  2F8A A;  5IM9 A;  5ABR A;  2LJK A;  5JCG A;  4TR3 A;  4POM A;  2YAN A;  4RUV A;  3EYT A;  2I4A A;  3C1R A;  3ZZX A;  1FAA A;  5A4W A;  1N8J A;  1A23 A;  1WOU A;  3H93 A;  1RQM A;  5GST A;  2KP1 A;  17GS A;  2LQQ A;  3UVH A;  1TDI A;  2X8C A;  4P3Y B;  5GAN D;  1K0O A;  4L5O A;  2MMN A;  2C0D A;  2N5F A;  3EU3 A;  4WF4 A;  5HFK A;  4V1A p;  1GP1 A;  3H79 A;  2PPT A;  2CVD A;  2DC5 A;  2H70 A;  1G7E A;  4TR1 B;  3FR3 A;  5HR2 A;  3TOU A;  3WYW A;  2EIO A;  5DDL A;  1FVJ A;  2M46 A;  1KEB A;  1YY7 A;  2F8F A;  3IA1 A;  2OBK A;  3UOM A;  3Q74 A;  3RPP A;  1IYH A;  2H30 A;  2NDO A;  4Q5R A;  3UEM A;  4V2M A;  3OR5 A;  5E4W A;  5FT3 A;  2I81 A;  3WGX A;  1TJD A;  4Q5Q A;  4XCS A;  2IME A;  4AJ8 A;  4GSS A;  4MJA A;  4EL1 A;  1TI3 A;  2DIY A;  1W89 A;  2V2G A;  2HXK A;  2VL9 A;  4L5L A;  1YJ6 A;  3FZ4 A;  1A0R P;  1F6M C;  2RUE A;  3GYK A;  5IOX A;  2GT6 A;  3TKQ A;  3VI7 A;  1LJR A;  1YZX A;  2X99 A;  3ED3 A;  2YZU A;  4QL9 A;  2H19 A;  2GSQ A;  4F82 A;  4RI7 A;  3H1N A;  4BPY A;  3EWL A;  4TN8 A;  1U87 A;  1MDI A;  3QFB C;  5B6M A;  1OC3 A;  1S3D A;  2QC7 A;  2J9H A;  1OAZ A;  3UMA A;  5IIZ A;  1GSD A;  4GRF A;  2XBQ A;  4N10 A;  3QD9 A;  5L71 A;  3FRC A;  3LXT A;  4EXJ A;  3HZ8 A;  3LFL A;  1GSQ A;  1SL2 B;  3F6F A;  4KH7 A;  5ECP B;  1RK4 A;  5IMZ A;  2YWO A;  2FY6 A;  3BD2 A;  1O73 A;  5B6N A;  2GST A;  1Z6N A;  2R4V A;  1ZL9 A;  4XRA A;  3WT2 A;  1F3B A;  1M9B A;  4MJC A;  1B9Y C;  2K8V A;  19GS A;  4XTS A;  3FEU A;  3GH9 A;  3TJJ A;  3HA9 A;  1HNA A;  4ZXG A;  3ZIT A;  1OKD A;  3TJG A;  4EF0 A;  4MJE A;  1GL8 A;  2L5L A;  2FNO A;  3ERF A;  4PUF C;  4NMU A;  1K0M A;  2P0G A;  1FHE A;  4ZB9 A;  5ELA A;  4MA9 A;  4PUR A;  5D9T A;  5ID2 A;  4FYC A;  4YAP A;  5C04 A;  4F2I A;  4BWQ A;  3M1G A;  2H1A A;  1X5E A;  5F8B A;  3J7Y k;  2VCZ A;  3KP8 A;  4KCE A;  2IWT A;  3WT1 A;  2FGX A;  4KDX A;  2JZR A;  4GQF A;  1FVK A;  2TRX A;  3RBT A;  1OC9 B;  1TRS A;  2L4Q A;  1YEP A;  4Q5N A;  3NZN A;  3O3T A;  4MP4 A;  3QDN A;  4PNF A;  3FK8 A;  4JED A;  4KDU A;  2WDU A;  1XBS A;  2HI7 A;  1BG5 A;  3GNJ A;  3M8N A;  2G0F A;  2QKE A;  4GLT A;  1VF3 A;  1SU9 A;  3KTL A;  4XS1 A;  3FR9 A;  1I5G A;  4MZW A;  1R26 A;  2C3Q A;  3NIV A;  1RW1 A;  3HVX A;  2GSR A;  2AJQ B;  5LNK e;  1FB0 A;  5F07 A;  2ON5 A;  2YN1 A;  4MF5 A;  2R2J A;  3PH9 A;  4OWY A;  3FKF A;  2B7J A;  3FY7 A;  3HJO A;  4K6X A;  2OAD A;  1PRX A;  5DAK A;  1GNW A;  3LYK A;  3RPN A;  3HXS A;  3TKS E;  2R3X A;  2XPE A;  2YOI A;  4G10 A;  4Z7X A;  3L78 A;  1W4V A;  1H75 A;  3LGC A;  3W6G A;  4IS0 A;  5CRW A;  1V2A A;  2K6V A;  1Q4J A;  4IP6 A;  1O8W A;  4AGS A;  6GSV A;  2FWG A;  3IK7 A;  3MAK A;  2MMO A;  3A2W A;  1A24 A;  3FZ9 A;  2OAC A;  2AYT A;  1GTU A;  1ZYE A;  2IL3 A;  4BWS A;  1ZCP A;  3D5J A;  2H74 A;  2KP2 A;  1JHB A;  3CSJ A;  2ALB A;  2VCT A;  4KX4 A;  3KMO A;  4DSR A;  4NAX A;  1K0D A;  2H66 A;  4KA0 A;  1ERU A;  2DJ0 A;  4I2U A;  1U3I A;  3GTU B;  5GAP D;  3TJB A;  1ERV A;  1O81 A;  3SBC A;  3Q19 A;  3HCZ A;  2HRF A;  5D9X A;  3BCI A;  1VF1 A;  3ZMK A;  1MDK A;  2C0G A;  1FOV A;  3F9U A;  2N5B A;  1OVN A;  2MMZ A;  2YV7 A;  2F3M A;  4IW9 A;  1YKA A;  1QMV A;  3H8Q A;  4ML1 A;  1EOG A;  1Z3E A;  2CT6 A;  3MDK A;  2DIZ A;  4KUN A;  1GSF A;  3VWV A;  1O85 A;  4WF5 A;  1GUL A;  1JZD A;  3S9F A;  3MSZ A;  1K0A A;  2LUS A;  4L0U A;  1UVZ A;  1EZK A;  3DWV A;  2KHP A;  4TR4 A;  2ZCT A;  2AB6 A;  2HSH A;  2P5Q A;  3RHC A;  2WB9 A;  2GQM A;  3RAZ A;  2M80 A;  5AN1 A;  3QFA C;  4TXO B;  4X0X A;  3FHK A;  2MYG A;  3MWH A;  2H1B A;  1VF4 A;  1OYJ A;  4N0V A;  5ECM B;  1H4O A;  1Z9H A;  1TXX A;  3IRA A;  4HU7 A;  3L9V A;  2O7K A;  1T8E B;  4KSM A;  1XCC A;  4IJ3 A;  1AUC A;  4IEL A;  4LL1 B;  4KDY A;  2JZT A;  1TTZ A;  3GX0 A;  1V58 A;  2PGT A;  2H01 A;  3GUS A;  4KCA A;  2OE0 A;  1XXU A;  4YAV A;  1T3B A;  5G30 A;  8GSS A;  1ZMA A;  1GUH A;  1AC1 A;  4E8E A;  3MNG A;  3G7Y A;  1X5D A;  1BX9 A;  4JE1 A;  4ZIJ A;  3GSS A;  1QK8 A;  5D9W A;  3ZVJ A;  3JCM L;  1T00 A;  4K8M A;  4PX1 A;  4ZL9 A;  1URM A;  3F6D A;  5LD0 A;  4CDO A;  2C0E A;  1PD2 1;  2TIR A;  2I1U A;  4D73 A;  4NXI A;  2CA8 A;  3EC3 A;  5J9C A;  3IDV A;  3UBK A;  3A2V A;  1LU4 A;  3P2A A;  5HR3 A;  3M9J A;  3HKR A;  1A2M A;  3TUE A;  5IMC A;  2X8G A;  4KND A;  4HDE A;  3F4T A;  2V1M A;  1BAY A;  2A2R A;  3BBY A;  3DIE A;  3ZYW A;  4MMM A;  2REM A;  1PMT A;  3ZFB A;  2YJH A;  2RLI A;  4OO4 A;  3TRQ A;  1CQG A;  3G9B A;  4GQC A;  3V1W A;  5JWR B;  3TOT A;  4K7I A;  3GKX A;  1USB A;  3D22 A;  1PL2 A;  4MZC A;  3D6I A;  2VLU A;  2GVP A;  4IN0 A;  3CTF A;  4MK3 A;  3F3R A;  18GS A;  2VD1 A;  5DCH A;  4NV2 A;  13GS A;  4XRD A;  3UJ1 A;  2JL4 A;  2VM2 A;  3VPT A;  3A5W A;  4TVE A;  4WBJ A;  1WP0 A;  4K0N A;  1GTB A;  3F4S A;  4JU5 A;  1GLQ A;  2AUV A;  2ZNM A;  2IIY A;  3TJK A;  4PXO A;  5D93 A;  4DSQ A;  1X5C A;  6GST A;  1KBN A;  1A8L A;  3ZML A;  5FHI A;  2C4J A;  3C8E A;  5G1K A;  4HOJ A;  2CVB A;  2XBI A;  3GX8 A;  1T1V A;  2R5G A;  1O7U A;  4LL4 B;  1ML6 A;  1QUW A;  2V32 A;  3KMN A;  4I97 A;  2LJR A;  4GXZ A;  4GTU A;  1K0C A;  4ISD A;  4NHZ A;  4AF2 A;  3ZIJ A;  1WE0 A;  2H8L A;  2PMT A;  1GTI A;  1M99 A;  1DSB A;  1YEX A;  5D8I A;  2C8U A;  5IPH A;  5CNW A;  1TRV A;  1JZO A;  2JSZ A;  2VL2 A;  1WMJ A;  5IMF A;  1ZGN A;  4IBP A;  3L0H A;  2VD0 A;  3GA4 A;  16GS A;  1QQ2 A;  1Y6E A;  1R5P A;  1SJ6 A;  4OFM A;  2WUL A;  1TP9 A;  1J9B A;  4DSS A;  4FH8 A;  12GS A;  4ID0 A;  2YPM A;  1B48 A;  4PGT A;  3WD6 A;  2EC4 A;  1XWB A;  2AHE A; 
#chains in the Genus database with same CATH topology
 11GS A;  1BYE A;  1E2Y A;  1AQW A;  2IFQ A;  3F63 A;  1QXH A;  3DD3 A;  3I6A A;  1SKW B;  3GIX A;  3LG6 A;  2LS5 A;  2WJU A;  2OKA A;  2J23 A;  3ZTL A;  3CMI A;  1JLW A;  1YF1 A;  1PN0 A;  2PVO C;  2E0Q A;  4PQH A;  3HVV A;  4JBB A;  1WWJ A;  2NPB A;  3LEF A;  1XW6 A;  3GST A;  4N30 A;  2H1D A;  1TK0 B;  1NSW A;  2LJA A;  1TK5 B;  1XFL A;  2OBI A;  5F06 A;  1G0T A;  2A2P A;  1A2L A;  2HT9 A;  3TKS C;  2L4C A;  2B1K A;  4LLR A;  1HD2 A;  1BQ7 A;  1OE8 A;  4O32 A;  5B7C A;  5HFI A;  3LJR A;  4HZ4 A;  3IK9 A;  5ID2 B;  4ZB6 A;  3EPT A;  2A4H A;  4XHM A;  1IYI A;  1GSE A;  4J57 E;  4F9Z A;  4EKZ A;  1F9M A;  5CP1 A;  4KAE A;  4WBR D;  3D4M A;  4MH3 A;  5CRG A;  4X43 A;  3E0U A;  3TDG A;  2PU9 C;  4IQ1 A;  4BVX A;  5ECI B;  2UZ8 A;  4FYB A;  3FYG A;  4OD7 A;  1SD9 A;  1NM3 A;  1M3J A;  2CV4 A;  1J08 A;  2VCV A;  1AAZ A;  5ECL B;  5BMU A;  5H5R A;  1AQX A;  2R0C A;  3P7X A;  4GWR A;  1DUG A;  2FA8 A;  3CXG A;  1PX6 A;  1MD3 A;  4RQR A;  2LKU A;  2GLR A;  5IQY A;  1U88 A;  4HQS A;  3EU4 A;  4YQV A;  3KP9 A;  4TOP A;  5G1L A;  2N5A A;  1ZZY A;  3VWU A;  2VAF A;  1DE1 A;  2LNT A;  1C72 A;  4I8B A;  1DE2 A;  5KOX A;  2H73 A;  3IPZ A;  5EY6 A;  5F05 A;  1M7T A;  3GFK A;  1SD8 A;  4FIW A;  3D21 A;  2ZUP A;  2YP6 A;  1PGT A;  5DAK B;  4K0G A;  3C7M A;  1B8X A;  1PL1 A;  2FD3 A;  2XPD A;  5A4V A;  1A2J A;  22GS A;  1OE7 A;  2FCH A;  5D96 A;  5IOW A;  1PKW A;  3I69 A;  3O76 A;  4PQ1 A;  4V1A g;  4X4J A;  4MCU A;  2M72 A;  4F03 A;  3WGD A;  3PGT A;  3HJM A;  1GH2 A;  3CTG A;  3O6T A;  5J4U A;  1AIU A;  1FOH A;  2VL2 C;  2C80 A;  1Z6M A;  2HE3 A;  1Z5Y E;  3CRT A;  1ERT A;  4G0K A;  4GF0 A;  2KOK A;  2OJL A;  4ZIL A;  2HNL A;  3FZA A;  5DQS A;  1YF0 A;  4RI6 A;  2EIR A;  3IXR A;  4X1U A;  5LCZ A;  4TW5 A;  2B3S A;  4HEA 2;  4XS4 B;  2XC2 A;  4K9Z A;  2CZ2 A;  2JU5 A;  5B8B A;  4ML6 A;  3HDC A;  4EUY A;  4HI7 A;  4XS4 A;  3FW2 A;  2K8S A;  1EGR A;  2H72 A;  4BL7 A;  3ME8 A;  1T7P B;  5ECR B;  2L6D A;  4MLY A;  3CSH A;  3QCP A;  2C0F A;  4K2X A;  2OE1 A;  1XG8 A;  3PPU A;  1XVW A;  2IPA A;  1UN2 A;  1PN9 A;  2GSS A;  2VL3 A;  1KTE A;  3KTB A;  3HD5 A;  1TI1 A;  4CY6 A;  4HJM A;  4IVF A;  1M2B A;  2CAQ A;  3KXO A;  4MDC A;  2E7P A;  2HFD A;  1M0U A;  3DYR A;  2JSY A;  4HQZ A;  1FW1 A;  1EOH A;  1CQH A;  4IHU A;  1GRX A;  2DJ2 A;  2DJ3 A;  4MAB A;  2DJ1 A;  5JCU A;  4NV5 A;  4KSO A;  3BCK A;  1WPI A;  1OC8 A;  4MF6 A;  2H75 A;  3FZ5 A;  2MZC A;  2A4V A;  1ZYQ B;  2HRK A;  4MF7 A;  2E2G A;  1B9X C;  1V9W A;  2FA4 A;  2ON7 A;  3DGQ A;  4WET A;  5J41 A;  2P31 A;  1PX7 A;  2PN8 A;  1NHO A;  3LQ7 A;  3KCM A;  2HRA A;  2NTO A;  2QGV A;  3QR6 A;  2HYX A;  2VCQ A;  4YKF A;  3ZLP A;  5ECQ B;  3U6V A;  4E8H A;  2LNS A;  4CHS A;  2C3T A;  6GSS A;  1AQV A;  2LQO A;  1PA3 A;  1G6Y A;  3K8N A;  5IO2 A;  2GZZ A;  3IE3 A;  2LRN A;  3HJP A;  1B4Q A;  4G9H A;  5KN0 A;  3ZRE A;  5CRE A;  1K3L A;  2H0I A;  4Q5F A;  2VLV A;  1TKD B;  1GWC A;  5B8A A;  5COH A;  5DJL A;  1GSY A;  1J0F A;  1MD4 A;  1S3A A;  1M2A A;  3GKK A;  1SJZ A;  1V98 A;  3KGK A;  5G5F A;  2F9S A;  3LYP A;  2F51 A;  2GS3 A;  1SKR B;  2DBC A;  4OFT A;  2R0G A;  3UAP A;  2CAI A;  1A0F A;  1WJK A;  3RHB A;  1EV9 A;  4N11 A;  3C73 A;  3DVW A;  2NVL A;  3DXB A;  4OMV A;  1WRY A;  1ST9 A;  2VOC A;  2L5O A;  1BED A;  4CW9 A;  3LWA A;  4Z2R A;  2OA7 A;  1GTA A;  1XW9 A;  1SK2 A;  3I43 A;  5INY A;  5J3R A;  1JFU A;  3TKS A;  5DCG A;  1XWG A;  4D73 B;  2FWF A;  3FMW A;  1EP7 A;  3A2X A;  2B6M A;  4XS6 A;  3EUR A;  3VLN A;  2YNX A;  4O5R A;  1SL0 B;  3G7J A;  1SJI A;  2KLX A;  3IV4 A;  4IJI A;  3ISO A;  3CSI A;  1M9A A;  2O89 A;  4V2L A;  3HHV A;  14GS A;  3IC4 A;  4HZ2 A;  5IO0 A;  2H71 A;  1G6W A;  2PWJ A;  5J9B A;  3GUR A;  5GZZ B;  1TU8 A;  2LRT A;  1F37 A;  2G2Q A;  2YWM A;  3ZVJ D;  4EO3 A;  5ECN B;  2RII A;  2X8H A;  2EIQ A;  1SK0 A;  1GNE A;  1XVQ A;  1FO5 A;  3US3 A;  4EDZ A;  2ES7 A;  1N2A A;  1F3A A;  2FHE A;  7GSS A;  2CX3 A;  3EE2 A;  4GCI A;  3AY8 A;  6GSY A;  3EVI A;  4WR4 A;  2DKH A;  3E9J B;  1WIK A;  5DVB A;  2O87 A;  3VI5 A;  1TU7 A;  1TOF A;  1XIY A;  3KM6 A;  3VWX A;  3GHA A;  2LEG A;  4OO5 A;  3GMF A;  3J7Y b;  1VF2 A;  5ECH B;  3BJ5 A;  2WFC A;  2VO4 A;  4JR4 A;  5J5N A;  1SYX A;  5ECK B;  2IMD A;  3NOF A;  3M3M A;  4I6X A;  2H6Z A;  2FLS A;  1XW5 A;  4ECC A;  1ON4 A;  2R0P A;  3QAG A;  1MDJ A;  2WCI A;  4TR1 A;  4TRX A;  3KH9 A;  1U3A A;  4LMW A;  4ECB A;  2BTO T;  2DLX A;  2L6C A;  1O6J A;  4KB3 A;  1R5A A;  2LST A;  5IMD A;  3TCO A;  4G2E A;  2CZ3 A;  4V2N A;  2CQ9 A;  3C71 A;  1G7O A;  1OKT A;  1GSU A;  1YDK A;  2H6Y A;  3PIN A;  3VK9 A;  1X0R A;  3KJY A;  5FWG A;  4TXV A;  4DSS B;  4ZBD A;  1ZYN A;  4ZL8 A;  1TRU A;  5BRT A;  1VRS D;  1U6T A;  3VFI A;  5JWO B;  1AXD A;  2O85 A;  4AJ7 A;  4GSN A;  1ERW A;  1BJX A;  1XOA A;  4QL7 A;  4ACS A;  1K3Y A;  2B1L A;  2IFQ B;  1K0B A;  4MPF A;  1FB6 A;  3PR8 A;  3Q18 A;  2YWN A;  4JR6 A;  3SWL A;  6GSU A;  3DKS A;  3LXZ A;  3CBU A;  2YZH A;  4FO5 A;  4PNG A;  4K5S A;  3TB2 A;  1R7H A;  3MYD A;  4HU9 A;  1YKC A;  3N5O A;  3ZIV A;  1E6B A;  1GUM A;  4MZB A;  3LW9 A;  1THX A;  4EIP A;  2YWI A;  3CQF A;  3M9K A;  3UIW A;  1TRW A;  4IKH A;  2WGR A;  1PSQ A;  3ZRD A;  4GST A;  5CO3 A;  2B7K A;  2NBS A;  4MPG A;  3GN3 A;  2PVQ A;  1ABA A;  1V57 A;  1ACV A;  4K5R A;  4TR0 A;  2H1G A;  2HLS A;  1X9W B;  2RUF A;  3KD0 A;  1I9D A;  4EDY A;  4LMV A;  1XWA A;  3CYN A;  2HRN A;  1X9S B;  1M2D A;  3VPQ A;  4OCE A;  1SYR A;  3GRX A;  1JZR A;  3GH6 A;  4ECJ A;  1QGV A;  3F3Q A;  5EPF A;  2P5R A;  2YJ7 A;  2GQK A;  2I9H A;  1UA5 A;  3WGE A;  4J2F A;  4BVX B;  1PQN A;  3A3T A;  2BMX A;  2PER A;  2WZ9 A;  3KIJ A;  5E59 A;  1EWX A;  4KW6 A;  3R2Q A;  2DML A;  3VUR A;  1EEJ A;  4PQI A;  4IGJ A;  4RQX A;  1Z7P A;  5AIS A;  3TJF A;  1EP8 A;  2LV3 A;  3W8S A;  2VCX A;  5HR0 A;  1MTC A;  2KUC A;  4YQM A;  3QMX A;  3IHQ A;  3P90 A;  1V40 A;  4JRR A;  2PBJ A;  2CX4 A;  2V6K A;  3HYP A;  3EMX A;  3F0I A;  3F8U A;  4O92 A;  4WEY A;  1ILO A;  2I3Y A;  4NHW A;  1OC9 A;  1GSS A;  2V41 A;  5D73 A;  4HUA A;  4QQ7 A;  1SK1 A;  3M0F A;  4IQA A;  3C1S A;  5CRH A;  1K0N A;  3DRN A;  4KGI A;  1SL1 B;  2B5Y A;  4L8E A;  2VM1 A;  5AIV A;  4N0Z A;  3KH7 A;  2HSY A;  1HNB A;  5H5S A;  1T4Z A;  4LA1 A;  1S3C A;  1EEM A;  1Z7R A;  5EVO A;  3TRX A;  4AJ6 A;  4F0C A;  2H6X A;  2YCD A;  3EMP A;  1AW9 A;  2MBT A;  2DJJ A;  4YQU A;  2IMI A;  4EIQ A;  2AV4 A;  1M3I A;  2WS2 A;  2V6O A;  3DEX A;  2FWE A;  5ECO B;  5KN2 A;  2GGT A;  4TKY A;  1NW2 A;  4G19 A;  1YQ1 A;  4OCF A;  3TKP A;  1T4Y A;  4HS1 A;  3Q6O A;  5GSS A;  2PUK C;  5DBQ A;  1PKZ A;  2C3N A;  1XZO A;  1JZW A;  1THO A;  1XWC A;  2TRC P;  1XPV A;  4NWY A;  2X64 A;  4BL7 B;  4K2D A;  3GL3 A;  3RDW A;  4XIH A;  2MMA A;  3UAR A;  5AIX A;  5IPG A;  1FG4 A;  5HFG A;  3I9V 2;  2DJK A;  3L9U A;  3QOU A;  4ZBA A;  3KZQ A;  4MJB A;  2E2M A;  3G7I A;  2IMK A;  2GT5 A;  1K3O A;  2B5E A;  5HQP A;  4WXT A;  2O8V B;  1HQO A;  3KEB A;  5JWQ B;  1XWK A;  4J56 E;  2H76 A;  3P8W A;  2CVK A;  1LBK A;  3GV1 A;  4K1F A;  4O7H A;  5AGY A;  4DVC A;  3FR6 A;  2XHF A;  4H86 A;  5DAL B;  4IP1 A;  1O8X A;  5H5Q A;  6GSW A;  3IBH A;  5DQY A;  5IMV A;  3APQ A;  5DAL A;  2R6K A;  5A5K A;  10GS A;  3GTU A;  3U5R E;  1GLP A;  4ZB8 A;  2A2S A;  2HZE B;  4Z2T A;  5KN1 A;  3TKR A;  3APO A;  5ELG A;  1Q98 A;  3HY2 A;  2HZE A;  4PUA A;  2IMF A;  3TRP A;  3GKN A;  4F0B A;  2IN3 A;  4POK A;  2K9F A;  4K7N A;  2DMM A;  5CYY A;  4MH2 A;  1VGL A;  3IAM 2;  20GS A;  3D4T A;  4USS A;  5EL8 A;  2H0H A;  2Z9S A;  2JZS A;  1QFN A;  3GKM A;  3E3E A;  3APS A;  2GDR A;  1JLV A;  3UL3 A;  4WKW A;  5CRD A;  2AAW A;  5G31 A;  5ECS A;  3ERW A;  1SEN A;  1ZOF A;  3DVX A;  1EV4 A;  2LTK A;  4BVY A;  2IJY A;  1DBY A;  1GUK A;  3W8J A;  3IR4 A;  1X9M B;  3DML A;  5D9V A;  6GSX A;  2QSI A;  3QAW A;  2JAC A;  1TK8 B;  2OE3 A;  4L0W A;  3QPM A;  2RM6 A;  9GSS A;  2WRT A;  4O5Q A;  2BJX A;  3VWW A;  5A4U A;  3L4N A;  4I2T A;  4JZQ A;  3D0Z A;  1XOB A;  2B5X A;  3ERG A;  1Y25 A;  2K18 A;  2YV9 A;  4TXO A;  4DEJ A;  2FWH A;  4KE3 A;  4EVM A;  2C1Y A;  2GQL A;  2RM5 A;  3IAS 2;  4YH2 A;  4ZBB A;  5C00 A;  1UC7 A;  2VLT A;  5ENU A;  3CRU A;  1EGO A;  5IMA A;  3IOS A;  3L9S A;  4ILF A;  3N9J A;  2GZP A;  2VIM A;  4POL A;  3H4K A;  4NPB A;  3ZL5 A;  2L59 A;  3LOR A;  5G2Z A;  1HYU A;  3UVT A;  3TGZ A;  1NHY A;  2L57 A;  3GL5 A;  4EC0 A;  2HZF A;  3HVS A;  2H0G A;  2R37 A;  2LRC A;  1SKS B;  4ZL7 A;  2VUP A;  2FUG 2;  4OFN A;  5JCW A;  2D2Z A;  2MBS A;  3BOA A;  3QAV A;  4EE0 A;  3HZ4 A;  1B4P A;  5HR1 A;  3ME7 A;  1MEK A;  5F0G A;  4HSC X;  3EIN A;  2GTU A;  5CAX A;  4ULX A;  4K7O A;  2JAD A;  1HNC A;  4I5Q A;  1KNG A;  5KN3 A;  1TW9 A;  1R4W A;  4FYU A;  3ZFL A;  1F2E A;  5G5E A;  4ECI A;  5DJM A;  3UBL A;  4BA7 A;  5KEJ A;  2VCW A;  4POB A;  2DSA A;  4HJ2 A;  4WR5 A;  1A8Y A;  3F4R A;  2GZY A;  3LSZ A;  2F8A A;  5IM9 A;  5ABR A;  2LJK A;  5JCG A;  4TR3 A;  4POM A;  2YAN A;  4RUV A;  3EYT A;  2I4A A;  3C1R A;  3ZZX A;  1FAA A;  5A4W A;  1N8J A;  1A23 A;  1WOU A;  3H93 A;  1RQM A;  5GST A;  2KP1 A;  17GS A;  2LQQ A;  3UVH A;  1TDI A;  2X8C A;  4P3Y B;  5GAN D;  1K0O A;  4L5O A;  2MMN A;  2C0D A;  2N5F A;  3EU3 A;  4WF4 A;  5HFK A;  4V1A p;  1GP1 A;  3H79 A;  2PPT A;  2CVD A;  2DC5 A;  1PFO A;  2H70 A;  1G7E A;  4TR1 B;  3FR3 A;  5HR2 A;  3TOU A;  3WYW A;  2EIO A;  5DDL A;  1FVJ A;  2M46 A;  1KEB A;  1YY7 A;  2F8F A;  3IA1 A;  2OBK A;  3UOM A;  3Q74 A;  3RPP A;  1IYH A;  2H30 A;  2NDO A;  4Q5R A;  3UEM A;  4V2M A;  3OR5 A;  5E4W A;  5FT3 A;  2I81 A;  3WGX A;  1TJD A;  4Q5Q A;  4XCS A;  2IME A;  4AJ8 A;  4GSS A;  4MJA A;  4EL1 A;  1TI3 A;  2DIY A;  1W89 A;  2V2G A;  2HXK A;  2VL9 A;  4L5L A;  4PTS A;  1YJ6 A;  3FZ4 A;  1A0R P;  1F6M C;  2RUE A;  3GYK A;  5IOX A;  2GT6 A;  3TKQ A;  3VI7 A;  1LJR A;  1YZX A;  2X99 A;  3ED3 A;  2YZU A;  4G0L A;  4QL9 A;  2H19 A;  2GSQ A;  4F82 A;  4RI7 A;  3H1N A;  4BPY A;  3EWL A;  4TN8 A;  1U87 A;  1MDI A;  3QFB C;  5B6M A;  1OC3 A;  1S3D A;  2QC7 A;  2J9H A;  1OAZ A;  3UMA A;  5IIZ A;  1GSD A;  4GRF A;  2XBQ A;  4N10 A;  3QD9 A;  5L71 A;  2X49 A;  3FRC A;  3LXT A;  4EXJ A;  3HZ8 A;  3LFL A;  1GSQ A;  1SL2 B;  3R3E A;  3F6F A;  4KH7 A;  5ECP B;  1RK4 A;  5IMZ A;  2YWO A;  2FY6 A;  3BD2 A;  1O73 A;  5B6N A;  2GST A;  1Z6N A;  2QA2 A;  2R4V A;  1ZL9 A;  4XRA A;  3WT2 A;  1F3B A;  1M9B A;  3HVN A;  4MJC A;  1B9Y C;  2K8V A;  19GS A;  4XTS A;  3FEU A;  3GH9 A;  3TJJ A;  3HA9 A;  1HNA A;  4ZXG A;  3ZIT A;  1OKD A;  3TJG A;  4EF0 A;  4MJE A;  1GL8 A;  2L5L A;  2FNO A;  3ERF A;  4PUF C;  4NMU A;  1K0M A;  2P0G A;  1FHE A;  4ZB9 A;  5ELA A;  4MA9 A;  4PUR A;  5D9T A;  5ID2 A;  4FYC A;  4YAP A;  5C04 A;  4F2I A;  4BWQ A;  3M1G A;  2H1A A;  1X5E A;  5F8B A;  4YKG A;  3J7Y k;  2VCZ A;  3IC8 A;  3KP8 A;  4KCE A;  2IWT A;  3WT1 A;  2FGX A;  4KDX A;  2JZR A;  4GQF A;  1FVK A;  2TRX A;  3RBT A;  1OC9 B;  1TRS A;  2L4Q A;  1YEP A;  4Q5N A;  3NZN A;  3O3T A;  4MP4 A;  3QDN A;  4PNF A;  3FK8 A;  4JED A;  4KDU A;  2WDU A;  1XBS A;  2HI7 A;  1BG5 A;  3GNJ A;  3M8N A;  4O5U A;  2G0F A;  2QKE A;  4GLT A;  1VF3 A;  1SU9 A;  3KTL A;  4XS1 A;  3FR9 A;  1I5G A;  4MZW A;  1R26 A;  2C3Q A;  3NIV A;  1ZYP A;  1RW1 A;  3HVX A;  2GSR A;  2AJQ B;  5LNK e;  1FB0 A;  5F07 A;  2ON5 A;  2YN1 A;  4MF5 A;  2R2J A;  3PH9 A;  4OWY A;  3FKF A;  2B7J A;  3FY7 A;  3HJO A;  4K6X A;  2OAD A;  1PRX A;  5DAK A;  1GNW A;  3LYK A;  3MIX A;  3RPN A;  3HXS A;  3TKS E;  2R3X A;  2XPE A;  2YOI A;  4G10 A;  4Z7X A;  3L78 A;  1W4V A;  1H75 A;  3LGC A;  3W6G A;  4IS0 A;  5CRW A;  1V2A A;  2K6V A;  1Q4J A;  4IP6 A;  1O8W A;  4AGS A;  6GSV A;  2FWG A;  3IK7 A;  3MAK A;  2MMO A;  3A2W A;  1A24 A;  3FZ9 A;  2OAC A;  2AYT A;  1GTU A;  1ZYE A;  2IL3 A;  4BWS A;  1ZCP A;  3D5J A;  2H74 A;  2KP2 A;  1JHB A;  3CSJ A;  2ALB A;  2VCT A;  4KX4 A;  3KMO A;  4DSR A;  4NAX A;  1K0D A;  2H66 A;  4KA0 A;  1ERU A;  2DJ0 A;  4I2U A;  1S3R A;  1U3I A;  3GTU B;  5GAP D;  3TJB A;  1ERV A;  1O81 A;  3SBC A;  3Q19 A;  3HCZ A;  2HRF A;  5D9X A;  3BCI A;  1VF1 A;  3ZMK A;  1MDK A;  2C0G A;  1FOV A;  3F9U A;  2N5B A;  2DKI A;  1OVN A;  2MMZ A;  2YV7 A;  2F3M A;  4IW9 A;  1YKA A;  1QMV A;  3H8Q A;  4ML1 A;  1EOG A;  1Z3E A;  2CT6 A;  3MDK A;  2DIZ A;  4KUN A;  1GSF A;  3VWV A;  1O85 A;  4WF5 A;  1GUL A;  1JZD A;  3S9F A;  2QA1 A;  3MSZ A;  1K0A A;  2LUS A;  4L0U A;  4BVY B;  4Z2U A;  1UVZ A;  1EZK A;  3DWV A;  2KHP A;  4KF9 A;  4TR4 A;  2ZCT A;  2AB6 A;  2HSH A;  2P5Q A;  3RHC A;  2WB9 A;  2GQM A;  3RAZ A;  2M80 A;  5AN1 A;  3QFA C;  4TXO B;  4X0X A;  3FHK A;  2MYG A;  3MWH A;  2H1B A;  1VF4 A;  1OYJ A;  4N0V A;  5ECM B;  1H4O A;  1Z9H A;  1TXX A;  3IRA A;  4HU7 A;  3L9V A;  2O7K A;  1T8E B;  4KSM A;  1XCC A;  4IJ3 A;  1AUC A;  4IEL A;  4LL1 B;  4KDY A;  2JZT A;  1TTZ A;  3GX0 A;  4BIK A;  1V58 A;  2PGT A;  2H01 A;  3GUS A;  4KCA A;  2OE0 A;  1XXU A;  4YAV A;  1T3B A;  5G30 A;  8GSS A;  1ZMA A;  1GUH A;  1AC1 A;  4E8E A;  3MNG A;  3G7Y A;  1X5D A;  1BX9 A;  4JE1 A;  4ZIJ A;  3GSS A;  1QK8 A;  5D9W A;  3ZVJ A;  3JCM L;  2X4A A;  1T00 A;  4K8M A;  4PX1 A;  3IHG A;  4ZL9 A;  1URM A;  3F6D A;  5LD0 A;  4CDO A;  2C0E A;  1PD2 1;  2TIR A;  2I1U A;  4D73 A;  4NXI A;  2CA8 A;  3EC3 A;  5J9C A;  3IDV A;  3UBK A;  3A2V A;  1LU4 A;  3P2A A;  5HR3 A;  3M9J A;  3HKR A;  1A2M A;  3TUE A;  5IMC A;  2X8G A;  4KND A;  4HDE A;  3F4T A;  2V1M A;  1BAY A;  2A2R A;  3BBY A;  3DIE A;  3ZYW A;  4MMM A;  2REM A;  1PMT A;  3ZFB A;  2YJH A;  2RLI A;  4OO4 A;  3TRQ A;  1CQG A;  3G9B A;  4GQC A;  3V1W A;  5JWR B;  3TOT A;  4K7I A;  3GKX A;  1USB A;  3D22 A;  1PL2 A;  4MZC A;  3D6I A;  2VLU A;  2GVP A;  4IN0 A;  3CTF A;  4MK3 A;  3F3R A;  4ICY A;  18GS A;  2VD1 A;  5DCH A;  4NV2 A;  13GS A;  4XRD A;  3UJ1 A;  3A5I A;  2JL4 A;  2VM2 A;  3VPT A;  3A5W A;  4TVE A;  4WBJ A;  1WP0 A;  4K0N A;  1GTB A;  3F4S A;  4JU5 A;  1GLQ A;  2AUV A;  2ZNM A;  2IIY A;  3TJK A;  4PXO A;  5D93 A;  4DSQ A;  5KOW A;  1X5C A;  6GST A;  1KBN A;  1A8L A;  3ZML A;  5FHI A;  2C4J A;  3C8E A;  5G1K A;  4HOJ A;  2CVB A;  2XBI A;  3GX8 A;  1T1V A;  2R5G A;  1O7U A;  4LL4 B;  1ML6 A;  4A5P A;  1QUW A;  2V32 A;  3KMN A;  4I97 A;  2LJR A;  4GXZ A;  4GTU A;  1K0C A;  4ISD A;  4NHZ A;  4AF2 A;  3ZIJ A;  1WE0 A;  2H8L A;  2PMT A;  1GTI A;  4CY8 A;  1M99 A;  1DSB A;  1YEX A;  5D8I A;  2C8U A;  2HSM A;  5IPH A;  5CNW A;  1TRV A;  4FQU A;  1JZO A;  2JSZ A;  2VL2 A;  4G0I A;  1WMJ A;  5IMF A;  1ZGN A;  4IBP A;  3L0H A;  2VD0 A;  3GA4 A;  16GS A;  1QQ2 A;  1Y6E A;  1R5P A;  4MNN A;  1SJ6 A;  4OFM A;  2WUL A;  1TP9 A;  1J9B A;  4DSS A;  4FH8 A;  12GS A;  4ID0 A;  2YPM A;  1B48 A;  4PGT A;  3WD6 A;  2EC4 A;  1XWB A;  2AHE A; 
#chains in the Genus database with same CATH homology
 11GS A;  1BYE A;  1E2Y A;  1AQW A;  2IFQ A;  3F63 A;  1QXH A;  3DD3 A;  3I6A A;  1SKW B;  3GIX A;  3LG6 A;  2LS5 A;  2WJU A;  2OKA A;  2J23 A;  3ZTL A;  3CMI A;  1JLW A;  1YF1 A;  1PN0 A;  2PVO C;  2E0Q A;  4PQH A;  3HVV A;  4JBB A;  1WWJ A;  2NPB A;  3LEF A;  1XW6 A;  3GST A;  4N30 A;  2H1D A;  1TK0 B;  1NSW A;  2LJA A;  1TK5 B;  1XFL A;  2OBI A;  5F06 A;  1G0T A;  2A2P A;  1A2L A;  2HT9 A;  3TKS C;  2L4C A;  2B1K A;  4LLR A;  1HD2 A;  1BQ7 A;  1OE8 A;  4O32 A;  5B7C A;  5HFI A;  3LJR A;  4HZ4 A;  3IK9 A;  5ID2 B;  4ZB6 A;  3EPT A;  2A4H A;  4XHM A;  1IYI A;  1GSE A;  4J57 E;  4F9Z A;  4EKZ A;  1F9M A;  5CP1 A;  4KAE A;  4WBR D;  3D4M A;  4MH3 A;  5CRG A;  4X43 A;  3E0U A;  3TDG A;  2PU9 C;  4IQ1 A;  4BVX A;  5ECI B;  2UZ8 A;  4FYB A;  3FYG A;  4OD7 A;  1SD9 A;  1NM3 A;  2CV4 A;  1J08 A;  2VCV A;  1AAZ A;  5ECL B;  5BMU A;  5H5R A;  1AQX A;  2R0C A;  3P7X A;  4GWR A;  1DUG A;  2FA8 A;  3CXG A;  1PX6 A;  1MD3 A;  4RQR A;  2LKU A;  2GLR A;  5IQY A;  1U88 A;  4HQS A;  3EU4 A;  4YQV A;  3KP9 A;  4TOP A;  5G1L A;  2N5A A;  1ZZY A;  3VWU A;  2VAF A;  1DE1 A;  2LNT A;  1C72 A;  4I8B A;  1DE2 A;  5KOX A;  2H73 A;  3IPZ A;  5EY6 A;  5F05 A;  1M7T A;  3GFK A;  1SD8 A;  4FIW A;  3D21 A;  2ZUP A;  2YP6 A;  1PGT A;  5DAK B;  4K0G A;  3C7M A;  1B8X A;  1PL1 A;  2FD3 A;  2XPD A;  5A4V A;  1A2J A;  22GS A;  1OE7 A;  2FCH A;  5D96 A;  5IOW A;  1PKW A;  3I69 A;  3O76 A;  4PQ1 A;  4V1A g;  4X4J A;  4MCU A;  2M72 A;  4F03 A;  3WGD A;  3PGT A;  3HJM A;  1GH2 A;  3CTG A;  3O6T A;  5J4U A;  1AIU A;  1FOH A;  2VL2 C;  2C80 A;  1Z6M A;  2HE3 A;  1Z5Y E;  3CRT A;  1ERT A;  4G0K A;  4GF0 A;  2KOK A;  2OJL A;  4ZIL A;  2HNL A;  3FZA A;  5DQS A;  1YF0 A;  4RI6 A;  2EIR A;  3IXR A;  4X1U A;  5LCZ A;  4TW5 A;  2B3S A;  4HEA 2;  4XS4 B;  2XC2 A;  4K9Z A;  2CZ2 A;  2JU5 A;  5B8B A;  4ML6 A;  3HDC A;  4EUY A;  4HI7 A;  4XS4 A;  3FW2 A;  2K8S A;  1EGR A;  2H72 A;  4BL7 A;  3ME8 A;  1T7P B;  5ECR B;  2L6D A;  4MLY A;  3CSH A;  3QCP A;  2C0F A;  4K2X A;  2OE1 A;  3PPU A;  1XVW A;  2IPA A;  1UN2 A;  1PN9 A;  2GSS A;  2VL3 A;  1KTE A;  3KTB A;  3HD5 A;  1TI1 A;  4CY6 A;  4HJM A;  4IVF A;  1M2B A;  2CAQ A;  3KXO A;  4MDC A;  2E7P A;  2HFD A;  1M0U A;  3DYR A;  2JSY A;  4HQZ A;  1FW1 A;  1EOH A;  1CQH A;  4IHU A;  1GRX A;  2DJ2 A;  2DJ3 A;  4MAB A;  2DJ1 A;  5JCU A;  4NV5 A;  4KSO A;  3BCK A;  1WPI A;  1OC8 A;  4MF6 A;  2H75 A;  3FZ5 A;  2MZC A;  2A4V A;  1ZYQ B;  2HRK A;  4MF7 A;  2E2G A;  1B9X C;  1V9W A;  2FA4 A;  2ON7 A;  3DGQ A;  4WET A;  5J41 A;  2P31 A;  1PX7 A;  2PN8 A;  1NHO A;  3LQ7 A;  3KCM A;  2HRA A;  2NTO A;  2QGV A;  3QR6 A;  2HYX A;  2VCQ A;  4YKF A;  3ZLP A;  5ECQ B;  3U6V A;  4E8H A;  2LNS A;  4CHS A;  2C3T A;  6GSS A;  1AQV A;  2LQO A;  1PA3 A;  1G6Y A;  3K8N A;  5IO2 A;  2GZZ A;  3IE3 A;  2LRN A;  3HJP A;  1B4Q A;  4G9H A;  5KN0 A;  3ZRE A;  5CRE A;  1K3L A;  2H0I A;  4Q5F A;  2VLV A;  1TKD B;  1GWC A;  5B8A A;  5COH A;  5DJL A;  1GSY A;  1J0F A;  1MD4 A;  1S3A A;  1M2A A;  3GKK A;  1SJZ A;  1V98 A;  3KGK A;  5G5F A;  2F9S A;  3LYP A;  2F51 A;  2GS3 A;  1SKR B;  2DBC A;  4OFT A;  2R0G A;  3UAP A;  2CAI A;  1A0F A;  1WJK A;  3RHB A;  1EV9 A;  4N11 A;  3C73 A;  3DVW A;  2NVL A;  3DXB A;  4OMV A;  1WRY A;  1ST9 A;  2VOC A;  2L5O A;  1BED A;  4CW9 A;  3LWA A;  4Z2R A;  2OA7 A;  1GTA A;  1XW9 A;  1SK2 A;  3I43 A;  5INY A;  5J3R A;  1JFU A;  3TKS A;  5DCG A;  1XWG A;  4D73 B;  2FWF A;  3FMW A;  1EP7 A;  3A2X A;  2B6M A;  4XS6 A;  3EUR A;  3VLN A;  2YNX A;  4O5R A;  1SL0 B;  3G7J A;  1SJI A;  2KLX A;  3IV4 A;  4IJI A;  3ISO A;  3CSI A;  1M9A A;  2O89 A;  4V2L A;  3HHV A;  14GS A;  3IC4 A;  4HZ2 A;  5IO0 A;  2H71 A;  1G6W A;  2PWJ A;  5J9B A;  3GUR A;  5GZZ B;  1TU8 A;  2LRT A;  1F37 A;  2G2Q A;  2YWM A;  3ZVJ D;  4EO3 A;  5ECN B;  2RII A;  2X8H A;  2EIQ A;  1SK0 A;  1GNE A;  1XVQ A;  1FO5 A;  3US3 A;  4EDZ A;  2ES7 A;  1N2A A;  1F3A A;  2FHE A;  7GSS A;  2CX3 A;  3EE2 A;  4GCI A;  3AY8 A;  6GSY A;  3EVI A;  4WR4 A;  2DKH A;  3E9J B;  1WIK A;  5DVB A;  2O87 A;  3VI5 A;  1TU7 A;  1TOF A;  1XIY A;  3KM6 A;  3VWX A;  3GHA A;  2LEG A;  4OO5 A;  3GMF A;  3J7Y b;  1VF2 A;  5ECH B;  3BJ5 A;  2WFC A;  2VO4 A;  4JR4 A;  5J5N A;  1SYX A;  5ECK B;  2IMD A;  3NOF A;  3M3M A;  4I6X A;  2H6Z A;  2FLS A;  1XW5 A;  4ECC A;  1ON4 A;  2R0P A;  3QAG A;  1MDJ A;  2WCI A;  4TR1 A;  4TRX A;  3KH9 A;  1U3A A;  4LMW A;  4ECB A;  2BTO T;  2DLX A;  2L6C A;  1O6J A;  4KB3 A;  1R5A A;  2LST A;  5IMD A;  3TCO A;  4G2E A;  2CZ3 A;  4V2N A;  2CQ9 A;  3C71 A;  1G7O A;  1OKT A;  1GSU A;  1YDK A;  2H6Y A;  3PIN A;  3VK9 A;  1X0R A;  3KJY A;  5FWG A;  4TXV A;  4DSS B;  4ZBD A;  1ZYN A;  4ZL8 A;  1TRU A;  5BRT A;  1VRS D;  1U6T A;  3VFI A;  5JWO B;  1AXD A;  2O85 A;  4AJ7 A;  4GSN A;  1ERW A;  1BJX A;  1XOA A;  4QL7 A;  4ACS A;  1K3Y A;  2B1L A;  2IFQ B;  1K0B A;  4MPF A;  1FB6 A;  3PR8 A;  3Q18 A;  2YWN A;  4JR6 A;  3SWL A;  6GSU A;  3DKS A;  3LXZ A;  3CBU A;  2YZH A;  4FO5 A;  4PNG A;  4K5S A;  3TB2 A;  1R7H A;  3MYD A;  4HU9 A;  1YKC A;  3N5O A;  3ZIV A;  1E6B A;  1GUM A;  4MZB A;  3LW9 A;  1THX A;  4EIP A;  2YWI A;  3M9K A;  3UIW A;  1TRW A;  4IKH A;  2WGR A;  1PSQ A;  3ZRD A;  4GST A;  5CO3 A;  2B7K A;  2NBS A;  4MPG A;  3GN3 A;  2PVQ A;  1ABA A;  1V57 A;  1ACV A;  4K5R A;  4TR0 A;  2H1G A;  2HLS A;  1X9W B;  2RUF A;  3KD0 A;  1I9D A;  4EDY A;  4LMV A;  1XWA A;  3CYN A;  2HRN A;  1X9S B;  1M2D A;  3VPQ A;  4OCE A;  1SYR A;  3GRX A;  1JZR A;  3GH6 A;  4ECJ A;  1QGV A;  3F3Q A;  5EPF A;  2P5R A;  2YJ7 A;  2GQK A;  2I9H A;  1UA5 A;  3WGE A;  4J2F A;  4BVX B;  1PQN A;  3A3T A;  2BMX A;  2PER A;  2WZ9 A;  3KIJ A;  5E59 A;  1EWX A;  4KW6 A;  3R2Q A;  2DML A;  3VUR A;  1EEJ A;  4PQI A;  4IGJ A;  4RQX A;  1Z7P A;  5AIS A;  3TJF A;  1EP8 A;  2LV3 A;  3W8S A;  2VCX A;  5HR0 A;  1MTC A;  2KUC A;  4YQM A;  3QMX A;  3IHQ A;  3P90 A;  1V40 A;  4JRR A;  2PBJ A;  2CX4 A;  2V6K A;  3HYP A;  3EMX A;  3F0I A;  3F8U A;  4O92 A;  4WEY A;  1ILO A;  2I3Y A;  4NHW A;  1OC9 A;  1GSS A;  2V41 A;  5D73 A;  4HUA A;  4QQ7 A;  1SK1 A;  3M0F A;  4IQA A;  3C1S A;  5CRH A;  1K0N A;  3DRN A;  4KGI A;  1SL1 B;  2B5Y A;  4L8E A;  2VM1 A;  5AIV A;  4N0Z A;  3KH7 A;  2HSY A;  1HNB A;  5H5S A;  1T4Z A;  4LA1 A;  1S3C A;  1EEM A;  1Z7R A;  5EVO A;  3TRX A;  4AJ6 A;  4F0C A;  2H6X A;  2YCD A;  3EMP A;  1AW9 A;  2MBT A;  2DJJ A;  4YQU A;  2IMI A;  4EIQ A;  2AV4 A;  2WS2 A;  2V6O A;  3DEX A;  2FWE A;  5ECO B;  5KN2 A;  2GGT A;  4TKY A;  1NW2 A;  4G19 A;  1YQ1 A;  4OCF A;  3TKP A;  1T4Y A;  4HS1 A;  3Q6O A;  5GSS A;  2PUK C;  5DBQ A;  1PKZ A;  2C3N A;  1XZO A;  1JZW A;  1THO A;  1XWC A;  2TRC P;  1XPV A;  4NWY A;  2X64 A;  4BL7 B;  4K2D A;  3GL3 A;  3RDW A;  4XIH A;  2MMA A;  3UAR A;  5AIX A;  5IPG A;  1FG4 A;  5HFG A;  3I9V 2;  2DJK A;  3L9U A;  3QOU A;  4ZBA A;  3KZQ A;  4MJB A;  2E2M A;  3G7I A;  2IMK A;  2GT5 A;  1K3O A;  2B5E A;  5HQP A;  4WXT A;  2O8V B;  1HQO A;  3KEB A;  5JWQ B;  1XWK A;  4J56 E;  2H76 A;  3P8W A;  2CVK A;  1LBK A;  3GV1 A;  4K1F A;  4O7H A;  5AGY A;  4DVC A;  3FR6 A;  2XHF A;  4H86 A;  5DAL B;  4IP1 A;  1O8X A;  5H5Q A;  6GSW A;  3IBH A;  5DQY A;  5IMV A;  3APQ A;  5DAL A;  2R6K A;  5A5K A;  10GS A;  3GTU A;  3U5R E;  1GLP A;  4ZB8 A;  2A2S A;  2HZE B;  4Z2T A;  5KN1 A;  3TKR A;  3APO A;  5ELG A;  1Q98 A;  3HY2 A;  2HZE A;  4PUA A;  2IMF A;  3TRP A;  3GKN A;  4F0B A;  2IN3 A;  4POK A;  2K9F A;  4K7N A;  2DMM A;  5CYY A;  4MH2 A;  1VGL A;  3IAM 2;  20GS A;  3D4T A;  4USS A;  5EL8 A;  2H0H A;  2Z9S A;  2JZS A;  1QFN A;  3GKM A;  3E3E A;  3APS A;  2GDR A;  1JLV A;  3UL3 A;  4WKW A;  5CRD A;  2AAW A;  5G31 A;  5ECS A;  3ERW A;  1SEN A;  1ZOF A;  3DVX A;  1EV4 A;  2LTK A;  4BVY A;  2IJY A;  1DBY A;  1GUK A;  3W8J A;  3IR4 A;  1X9M B;  3DML A;  5D9V A;  6GSX A;  2QSI A;  3QAW A;  2JAC A;  1TK8 B;  2OE3 A;  4L0W A;  3QPM A;  2RM6 A;  9GSS A;  2WRT A;  4O5Q A;  2BJX A;  3VWW A;  5A4U A;  3L4N A;  4I2T A;  4JZQ A;  3D0Z A;  1XOB A;  2B5X A;  3ERG A;  1Y25 A;  2K18 A;  2YV9 A;  4TXO A;  4DEJ A;  2FWH A;  4KE3 A;  4EVM A;  2C1Y A;  2GQL A;  2RM5 A;  3IAS 2;  4YH2 A;  4ZBB A;  5C00 A;  1UC7 A;  2VLT A;  5ENU A;  3CRU A;  1EGO A;  5IMA A;  3IOS A;  3L9S A;  4ILF A;  3N9J A;  2GZP A;  2VIM A;  4POL A;  3H4K A;  4NPB A;  3ZL5 A;  2L59 A;  3LOR A;  5G2Z A;  1HYU A;  3UVT A;  3TGZ A;  1NHY A;  2L57 A;  3GL5 A;  4EC0 A;  2HZF A;  3HVS A;  2H0G A;  2R37 A;  2LRC A;  1SKS B;  4ZL7 A;  2VUP A;  2FUG 2;  4OFN A;  5JCW A;  2D2Z A;  2MBS A;  3BOA A;  3QAV A;  4EE0 A;  3HZ4 A;  1B4P A;  5HR1 A;  3ME7 A;  1MEK A;  5F0G A;  3EIN A;  2GTU A;  5CAX A;  4ULX A;  4K7O A;  2JAD A;  1HNC A;  4I5Q A;  1KNG A;  5KN3 A;  1TW9 A;  1R4W A;  4FYU A;  3ZFL A;  1F2E A;  5G5E A;  4ECI A;  5DJM A;  3UBL A;  4BA7 A;  5KEJ A;  2VCW A;  4POB A;  2DSA A;  4HJ2 A;  4WR5 A;  1A8Y A;  3F4R A;  2GZY A;  3LSZ A;  2F8A A;  5IM9 A;  5ABR A;  2LJK A;  5JCG A;  4TR3 A;  4POM A;  2YAN A;  4RUV A;  3EYT A;  2I4A A;  3C1R A;  3ZZX A;  1FAA A;  5A4W A;  1N8J A;  1A23 A;  1WOU A;  3H93 A;  1RQM A;  5GST A;  2KP1 A;  17GS A;  2LQQ A;  3UVH A;  1TDI A;  2X8C A;  4P3Y B;  5GAN D;  1K0O A;  4L5O A;  2MMN A;  2C0D A;  2N5F A;  3EU3 A;  4WF4 A;  5HFK A;  4V1A p;  1GP1 A;  3H79 A;  2PPT A;  2CVD A;  2DC5 A;  2H70 A;  1G7E A;  4TR1 B;  3FR3 A;  5HR2 A;  3TOU A;  3WYW A;  2EIO A;  5DDL A;  1FVJ A;  2M46 A;  1KEB A;  1YY7 A;  2F8F A;  3IA1 A;  2OBK A;  3UOM A;  3Q74 A;  3RPP A;  1IYH A;  2H30 A;  2NDO A;  4Q5R A;  3UEM A;  4V2M A;  3OR5 A;  5E4W A;  5FT3 A;  2I81 A;  3WGX A;  1TJD A;  4Q5Q A;  4XCS A;  2IME A;  4AJ8 A;  4GSS A;  4MJA A;  4EL1 A;  1TI3 A;  2DIY A;  1W89 A;  2V2G A;  2HXK A;  2VL9 A;  4L5L A;  4PTS A;  1YJ6 A;  3FZ4 A;  1A0R P;  1F6M C;  2RUE A;  3GYK A;  5IOX A;  2GT6 A;  3TKQ A;  3VI7 A;  1LJR A;  1YZX A;  2X99 A;  3ED3 A;  2YZU A;  4G0L A;  4QL9 A;  2H19 A;  2GSQ A;  4F82 A;  4RI7 A;  3H1N A;  4BPY A;  3EWL A;  4TN8 A;  1U87 A;  1MDI A;  3QFB C;  5B6M A;  1OC3 A;  1S3D A;  2QC7 A;  2J9H A;  1OAZ A;  3UMA A;  5IIZ A;  1GSD A;  4GRF A;  2XBQ A;  4N10 A;  3QD9 A;  5L71 A;  2X49 A;  3FRC A;  3LXT A;  4EXJ A;  3HZ8 A;  3LFL A;  1GSQ A;  1SL2 B;  3R3E A;  3F6F A;  4KH7 A;  5ECP B;  1RK4 A;  5IMZ A;  2YWO A;  2FY6 A;  3BD2 A;  1O73 A;  5B6N A;  2GST A;  1Z6N A;  2QA2 A;  2R4V A;  1ZL9 A;  4XRA A;  3WT2 A;  1F3B A;  1M9B A;  4MJC A;  1B9Y C;  2K8V A;  19GS A;  4XTS A;  3FEU A;  3GH9 A;  3TJJ A;  3HA9 A;  1HNA A;  4ZXG A;  3ZIT A;  1OKD A;  3TJG A;  4EF0 A;  4MJE A;  1GL8 A;  2L5L A;  2FNO A;  3ERF A;  4PUF C;  4NMU A;  1K0M A;  2P0G A;  1FHE A;  4ZB9 A;  5ELA A;  4MA9 A;  4PUR A;  5D9T A;  5ID2 A;  4FYC A;  4YAP A;  5C04 A;  4F2I A;  4BWQ A;  3M1G A;  2H1A A;  1X5E A;  5F8B A;  4YKG A;  3J7Y k;  2VCZ A;  3IC8 A;  3KP8 A;  4KCE A;  2IWT A;  3WT1 A;  2FGX A;  4KDX A;  2JZR A;  4GQF A;  1FVK A;  2TRX A;  3RBT A;  1OC9 B;  1TRS A;  2L4Q A;  1YEP A;  4Q5N A;  3NZN A;  3O3T A;  4MP4 A;  3QDN A;  4PNF A;  3FK8 A;  4JED A;  4KDU A;  2WDU A;  1XBS A;  2HI7 A;  1BG5 A;  3GNJ A;  3M8N A;  4O5U A;  2G0F A;  2QKE A;  4GLT A;  1VF3 A;  1SU9 A;  3KTL A;  4XS1 A;  3FR9 A;  1I5G A;  4MZW A;  1R26 A;  2C3Q A;  3NIV A;  1ZYP A;  1RW1 A;  3HVX A;  2GSR A;  2AJQ B;  5LNK e;  1FB0 A;  5F07 A;  2ON5 A;  2YN1 A;  4MF5 A;  2R2J A;  3PH9 A;  4OWY A;  3FKF A;  2B7J A;  3FY7 A;  3HJO A;  4K6X A;  2OAD A;  1PRX A;  5DAK A;  1GNW A;  3LYK A;  3MIX A;  3RPN A;  3HXS A;  3TKS E;  2R3X A;  2XPE A;  2YOI A;  4G10 A;  4Z7X A;  3L78 A;  1W4V A;  1H75 A;  3LGC A;  3W6G A;  4IS0 A;  5CRW A;  1V2A A;  2K6V A;  1Q4J A;  4IP6 A;  1O8W A;  4AGS A;  6GSV A;  2FWG A;  3IK7 A;  3MAK A;  2MMO A;  3A2W A;  1A24 A;  3FZ9 A;  2OAC A;  2AYT A;  1GTU A;  1ZYE A;  2IL3 A;  4BWS A;  1ZCP A;  3D5J A;  2H74 A;  2KP2 A;  1JHB A;  3CSJ A;  2ALB A;  2VCT A;  4KX4 A;  3KMO A;  4DSR A;  4NAX A;  1K0D A;  2H66 A;  4KA0 A;  1ERU A;  2DJ0 A;  4I2U A;  1U3I A;  3GTU B;  5GAP D;  3TJB A;  1ERV A;  1O81 A;  3SBC A;  3Q19 A;  3HCZ A;  2HRF A;  5D9X A;  3BCI A;  1VF1 A;  3ZMK A;  1MDK A;  2C0G A;  1FOV A;  3F9U A;  2N5B A;  2DKI A;  1OVN A;  2MMZ A;  2YV7 A;  2F3M A;  4IW9 A;  1YKA A;  1QMV A;  3H8Q A;  4ML1 A;  1EOG A;  1Z3E A;  2CT6 A;  3MDK A;  2DIZ A;  4KUN A;  1GSF A;  3VWV A;  1O85 A;  4WF5 A;  1GUL A;  1JZD A;  3S9F A;  2QA1 A;  3MSZ A;  1K0A A;  2LUS A;  4L0U A;  4BVY B;  4Z2U A;  1UVZ A;  1EZK A;  3DWV A;  2KHP A;  4KF9 A;  4TR4 A;  2ZCT A;  2AB6 A;  2HSH A;  2P5Q A;  3RHC A;  2WB9 A;  2GQM A;  3RAZ A;  2M80 A;  5AN1 A;  3QFA C;  4TXO B;  4X0X A;  3FHK A;  2MYG A;  3MWH A;  2H1B A;  1VF4 A;  1OYJ A;  4N0V A;  5ECM B;  1H4O A;  1Z9H A;  1TXX A;  3IRA A;  4HU7 A;  3L9V A;  2O7K A;  1T8E B;  4KSM A;  1XCC A;  4IJ3 A;  1AUC A;  4IEL A;  4LL1 B;  4KDY A;  2JZT A;  1TTZ A;  3GX0 A;  1V58 A;  2PGT A;  2H01 A;  3GUS A;  4KCA A;  2OE0 A;  1XXU A;  4YAV A;  1T3B A;  5G30 A;  8GSS A;  1ZMA A;  1GUH A;  1AC1 A;  4E8E A;  3MNG A;  3G7Y A;  1X5D A;  1BX9 A;  4JE1 A;  4ZIJ A;  3GSS A;  1QK8 A;  5D9W A;  3ZVJ A;  3JCM L;  2X4A A;  1T00 A;  4K8M A;  4PX1 A;  3IHG A;  4ZL9 A;  1URM A;  3F6D A;  5LD0 A;  4CDO A;  2C0E A;  1PD2 1;  2TIR A;  2I1U A;  4D73 A;  4NXI A;  2CA8 A;  3EC3 A;  5J9C A;  3IDV A;  3UBK A;  3A2V A;  1LU4 A;  3P2A A;  5HR3 A;  3M9J A;  3HKR A;  1A2M A;  3TUE A;  5IMC A;  2X8G A;  4KND A;  4HDE A;  3F4T A;  2V1M A;  1BAY A;  2A2R A;  3BBY A;  3DIE A;  3ZYW A;  4MMM A;  2REM A;  1PMT A;  3ZFB A;  2YJH A;  2RLI A;  4OO4 A;  3TRQ A;  1CQG A;  3G9B A;  4GQC A;  3V1W A;  5JWR B;  3TOT A;  4K7I A;  3GKX A;  1USB A;  3D22 A;  1PL2 A;  4MZC A;  3D6I A;  2VLU A;  2GVP A;  4IN0 A;  3CTF A;  4MK3 A;  3F3R A;  4ICY A;  18GS A;  2VD1 A;  5DCH A;  4NV2 A;  13GS A;  4XRD A;  3UJ1 A;  3A5I A;  2JL4 A;  2VM2 A;  3VPT A;  3A5W A;  4TVE A;  4WBJ A;  1WP0 A;  4K0N A;  1GTB A;  3F4S A;  4JU5 A;  1GLQ A;  2AUV A;  2ZNM A;  2IIY A;  3TJK A;  4PXO A;  5D93 A;  4DSQ A;  5KOW A;  1X5C A;  6GST A;  1KBN A;  1A8L A;  3ZML A;  5FHI A;  2C4J A;  3C8E A;  5G1K A;  4HOJ A;  2CVB A;  2XBI A;  3GX8 A;  1T1V A;  2R5G A;  1O7U A;  4LL4 B;  1ML6 A;  4A5P A;  1QUW A;  2V32 A;  3KMN A;  4I97 A;  2LJR A;  4GXZ A;  4GTU A;  1K0C A;  4ISD A;  4NHZ A;  4AF2 A;  3ZIJ A;  1WE0 A;  2H8L A;  2PMT A;  1GTI A;  4CY8 A;  1M99 A;  1DSB A;  1YEX A;  5D8I A;  2C8U A;  2HSM A;  5IPH A;  5CNW A;  1TRV A;  4FQU A;  1JZO A;  2JSZ A;  2VL2 A;  4G0I A;  1WMJ A;  5IMF A;  1ZGN A;  4IBP A;  3L0H A;  2VD0 A;  3GA4 A;  16GS A;  1QQ2 A;  1Y6E A;  1R5P A;  4MNN A;  1SJ6 A;  4OFM A;  2WUL A;  1TP9 A;  1J9B A;  4DSS A;  4FH8 A;  12GS A;  4ID0 A;  2YPM A;  1B48 A;  4PGT A;  3WD6 A;  2EC4 A;  1XWB A;  2AHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...