1X9SB

T7 dna polymerase in complex with a primer/template dna containing a disordered n-2 aminofluorene on the template, crystallized with dideoxy-ctp as the incoming nucleotide.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*AP*GP*AP*GP*TP*GP*AP*TP*T*GP*GP*TP*AP*GP*TP*GP*T
publication title Crystal structures of 2-acetylaminofluorene and 2-aminofluorene in complex with T7 DNA polymerase reveal mechanisms of mutagenesis.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x9sB00
1M2AA 1JZOA 5LCZA 4RUVA 2HZEB 2C0EA 2KLXA 2ZUPA 3IRAA 1A2LA 2HRFA 1XWGA 2GS3A 1WRYA 1Z3EA 2QKEA 2H1AA 4X1UA 17GSA 2IIYA 3WT1A 2VCQA 4EDYA 3F0IA 3KM6A 1EOHA 3VFIA 1U87A 5G1LA 3ZFLA 2C80A 3BD2A 1PMTA 3LQ7A 2P0GA 4XS4A 2FGXA 3QD9A 3APSA 3H4KA 3Q19A 3M1GA 3FEUA 2G2QA 3ZFBA 1BYEA 2NDOA 1VF1A 2C4JA 1X9WB 5D9XA 1PL1A 3U5RE 4NV5A 2B7KA 2NVLA 1GNWA 2LQQA 1V9WA 2JZTA 2TRCP 5CYYA 1K0AA 5A4VA 1SL2B 1TK8B 2FLSA 4WKWA 5ELAA 5DCGA 3IK9A 4YAPA 3FZ5A 1ILOA 2IMFA 2O8VB 1USBA 4I5QA 3ED3A 4WBRD 2MBTA 2DJ1A 4FO5A 1NSWA 1K3OA 3G9BA 4IKHA 2CVKA 2EIQA 2M72A 3IXRA 2CVDA 2B1LA 2IWTA 5G1KA 2EC4A 3FYGA 5DBQA 2K8VA 2JADA 3ZZXA 3Q6OA 2FY6A 2OADA 3UEMA 1WE0A 4ML6A 1XVQA 3FW2A 2DC5A 4MF6A 4K7OA 1E2YA 2CQ9A 4BWQA 2LSTA 2C0GA 4JE1A 1SKWB 1FOVA 3FRCA 1QK8A 3HXSA 1WPIA 4HDEA 1LBKA 1ZMAA 2FCHA 4KNDA 5HR1A 2YV7A 4G9HA 2HE3A 1XOAA 4MPGA 1E6BA 2GZPA 1TRVA 4KCEA 3ZYWA 5AISA 3HJMA 1OAZA 2RUEA 1OKDA 2HNLA 2H66A 3MNGA 3C1SA 3FHKA 13GSA 2IMDA 3VWUA 3TJBA 1A2JA 1U3IA 4Z7XA 2I1UA 3M9JA 2H0GA 4WR4A 4NV2A 4G2EA 2C1YA 2CT6A 1GTIA 2NTOA 3W6GA 4V2LA 2YOIA 3QAVA 1X9MB 2LJAA 2I81A 5H5QA 2MBSA 2H6YA 4DSSB 3GMFA 2IL3A 1XVWA 4POMA 1W4VA 3ERFA 1K0NA 4FH8A 2DJ3A 3HCZA 3RDWA 3IR4A 3MAKA 2H74A 1YDKA 3TKSC 1FHEA 4JZQA 4K7IA 5EL8A 1WJKA 4FYBA 4AJ7A 4CDOA 3UOMA 5ECIB 3I6AA 1BQ7A 2YWMA 5E59A 2X99A 1SK2A 4KB3A 3BCKA 2LEGA 3GV1A 1SYXA 3M9KA 1IYHA 1BAYA 1ML6A 1PSQA 1NHOA 5JCGA 5HFIA 3GA4A 1PX6A 4OCEA 1YKAA 1ACVA 3D4TA 2LJKA 4ZL8A 2OE3A 5JWQB 1YY7A 2XPEA 4N30A 2OBIA 2B1KA 4GTUA 3ZL5A 1M2BA 3GL5A 2R37A 2B3SA 4MZWA 4P3YB 2R4VA 3HHVA 1JZWA 3HJPA 5FWGA 1TI3A 3VWVA 2F9SA 4L0WA 5D96A 2CX3A 20GSA 2XPDA 4TXVA 4MP4A 5D9VA 5C00A 3GSSA 3D6IA 1PA3A 2PERA 3LJRA 2H73A 1T00A 1BG5A 3CRUA 5IMCA 6GSXA 1TXXA 1GLQA 2EIOA 3HDCA 3LXTA 4FYCA 2FUG2 3LGCA 4IELA 3J7Yk 5ID2A 1R5AA 1MDKA 2L57A 3DWVA 3G7JA 4YQMA 3S9FA 4NXIA 4EDZA 1B4QA 4MDCA 2VCXA 3EYTA 3N9JA 3DD3A 4K9ZA 1ZGNA 2AV4A 2FWFA 5HR2A 6GSYA 1NW2A 1ZYEA 4PX1A 5H5RA 3GURA 5CO3A 3ZIVA 3C73A 2KP1A 3D0ZA 1I9DA 2WJUA 1KEBA 6GSSA 2QGVA 4PXOA 3KXOA 4HOJA 4PQHA 1TKDB 1FB0A 1EP8A 2VL2A 1QMVA 3GTUB 2ZCTA 5GAPD 4N0ZA 4FYUA 1R5PA 4IP1A 2O87A 3EE2A 2H0HA 1Z6NA 1K0MA 4PNFA 4QL7A 3KZQA 4ZL7A 2GSTA 4V1Ag 4ZBBA 1AAZA 4KDUA 3O3TA 5JCUA 2OE1A 1SYRA 2PPTA 5GZZB 2LQOA 4V2MA 3IPZA 5ECOB 4O92A 1OC8A 1M7TA 2R3XA 3DKSA 2CVBA 2C3NA 2H6ZA 1UN2A 3IBHA 1GUHA 4NPBA 3VI7A 2FA8A 4TVEA 1OE7A 1DE2A 2F8FA 2WZ9A 4O5RA 3UBLA 3HY2A 1LU4A 2DMLA 2HYXA 1PRXA 1J0FA 5DQYA 2YP6A 2DSAA 2LTKA 3GFKA 3L9VA 2B6MA 1FO5A 5CAXA 3DIEA 3L9SA 2DJJA 4BPYA 3GX0A 2DJKA 2H1GA 1XWCA 4RQXA 2B5EA 4V1Ap 5G2ZA 2E2GA 4NHWA 1FVKA 3CSHA 2I4AA 3FR6A 1A23A 3PGTA 3TUEA 1DSBA 2I3YA 3NOFA 4MMMA 2LNSA 2A2SA 5ECQB 5GSSA 1PX7A 2FA4A 4IS0A 4WF5A 4KUNA 1Y6EA 3KH9A 3GIXA 1O7UA 1YF1A 4TR3A 4WF4A 3WGXA 5B8AA 1WWJA 4OO4A 4JRRA 5G5FA 5AIVA 4G19A 5HQPA 5E4WA 1M9BA 3VWWA 1C72A 1H4OA 4GQCA 4OFNA 4IJIA 1QFNA 1XPVA 2VO4A 1M9AA 2WCIA 1RW1A 3GSTA 3M8NA 6GSTA 3W8SA 4F2IA 3QDNA 1SJZA 3DYRA 4WETA 3WGEA 1ERTA 4K8MA 4J2FA 5D9TA 2GQMA 16GSA 1G0TA 4JR6A 3E0UA 3R2QA 3EVIA 2IFQA 2X8CA 1FAAA 3H93A 4MJAA 3EINA 4MF5A 4ECIA 2IMEA 3TRQA 3BBYA 4K7NA 3IAM2 1MD4A 1AXDA 1EOGA 1VGLA 3GN3A 4KE3A 4EC0A 4GWRA 3QPMA 1Z6MA 5KN3A 1X5EA 2XC2A 18GSA 5AGYA 1A8LA 3H79A 3M0FA 2VLTA 1OC9B 1ZOFA 3ZVJD 3WD6A 5HFGA 3CBUA 3V1WA 3U6VA 1M99A 1THOA 1G6YA 3HA9A 3TKSE 3LG6A 2B5XA 2GSQA 4K2DA 2YN1A 3FY7A 5DDLA 4F0BA 4NHZA 2YZUA 2GSSA 3F4TA 1BX9A 4OWYA 2BMXA 2MMNA 1JFUA 2YPMA 4I2UA 1V98A 1VF3A 1XIYA 1YZXA 3DEXA 2NBSA 3DMLA 4D73B 2O85A 3GRXA 1T1VA 5GSTA 4TR4A 4L8EA 4MJEA 4CW9A 2H0IA 4KDXA 1I5GA 2YWNA 1ZCPA 5J9CA 5IQYA 7GSSA 3SBCA 1GSQA 3CYNA 2LKUA 1O8WA 5IOXA 3KGKA 3FZ9A 2AUVA 2HSYA 3FKFA 4GCIA 1EGOA 2VD0A 4IQ1A 4FIWA 1R4WA 1XWAA 1T3BA 2XBIA 1SENA 2WGRA 4HJ2A 1T7PB 4LA1A 4XS4B 4ZB6A 1F37A 1FVJA 4J56E 1K3YA 3CTFA 3VI5A 1EZKA 14GSA 5IMZA 2PN8A 4X0XA 2IJYA 1FB6A 3D5JA 2NPBA 4L0UA 2PGTA 2A4VA 2VM2A 3WYWA 3SWLA 2B7JA 2ES7A 2ZNMA 4KX4A 3MWHA 3IOSA 3IHQA 4N0VA 5F8BA 4IJ3A 4ZB9A 1TU7A 4EXJA 2KP2A 3A5WA 5D9WA 4LLRA 2GGTA 1SD8A 4NMUA 3GHAA 3ISOA 3HD5A 3F6DA 5ECPB 2L5LA 3UARA 1QXHA 1PKWA 3TCOA 2LRCA 3F4SA 3IDVA 1ABAA 1BJXA 2ON5A 3TDGA 3F4RA 2HZFA 4AJ8A 5CRGA 3CMIA 1JLWA 2MZCA 4TXOA 4XS6A 2E2MA 4RQRA 3FR3A 2OE0A 2PU9C 3TJFA 3WT2A 1WMJA 3KH7A 2FWGA 2HXKA 5F05A 4TW5A 2H72A 4V2NA 4HZ2A 5ECSA 1T4YA 1TW9A 3VPTA 6GSWA 4BWSA 2HI7A 5JWOB 2JACA 3LORA 2YJ7A 1GULA 2O7KA 2P5RA 3LSZA 3KMNA 2WRTA 4GSTA 3BJ5A 1TRUA 4ZL9A 4PGTA 3BCIA 1ST9A 3US3A 2K8SA 3TOTA 3TJGA 1S3DA 1EEJA 2MMZA 1GLPA 4K1FA 3GKNA 3RPPA 1IYIA 2YCDA 1AIUA 2X64A 1JHBA 1U3AA 1GH2A 4WBJA 1OE8A 5KN0A 3QFBC 1GSDA 2N5FA 3UVHA 3TOUA 3ERGA 4KCAA 3F3QA 4ZXGA 2H8LA 2RM6A 4IVFA 4EE0A 3HVSA 1YQ1A 1GUKA 1B4PA 3HYPA 5DJMA 4ZIJA 1SKRB 5DAKA 3QAGA 5HR0A 1Q4JA 10GSA 2H6XA 3VWXA 5DQSA 2DJ2A 1TRWA 4ISDA 5J5NA 4ZBDA 2OACA 3ZREA 2G0FA 2GSRA 5DALA 5ELGA 4WEYA 1VF4A 1ERWA 4GLTA 3DRNA 3HVXA 4PQIA 2BJXA 6GSVA 1YF0A 3KD0A 1YEXA 12GSA 4F9ZA 4PUAA 1JLVA 4N11A 1PQNA 1WOUA 3CRTA 2C0DA 3A2XA 1YJ6A 4Q5FA 4XRAA 1THXA 2LRTA 2VL9A 4LL1B 2KOKA 3QOUA 3LXZA 1X5CA 3G7YA 1QGVA 3E3EA 1YKCA 3GKMA 3F8UA 4YQVA 5F07A 1EV9A 2J9HA 3O76A 4HZ4A 4IHUA 3UVTA 4MJBA 3HJOA 2VCWA 2MYGA 2WFCA 5HR3A 2YNXA 1G6WA 3HKRA 2H1DA 1SD9A 4HEA2 4DSRA 4HS1A 5A4UA 3NZNA 2REMA 1AQWA 4Q5QA 4ML1A 2J23A 4ZB8A 1TRSA 4HUAA 2YV9A 2VCTA 1UVZA 4XCSA 2IPAA 2M80A 2LNTA 5IMDA 4F82A 2E0QA 4F03A 3ZMLA 5ID2B 4H86A 4EF0A 2V41A 1X9SB 4NAXA 2VLUA 4JR4A 3ME7A 1NHYA 1O8XA 1O85A 1A24A 3KEBA 1F9MA 5J4UA 3IE3A 3EU4A 4WXTA 4O7HA 2H30A 2P5QA 4GRFA 3RPNA 4HJMA 3UJ1A 4K6XA 4PNGA 3IA1A 3TRXA 5ABRA 2IMIA 5EPFA 3IC4A 3LEFA 1HD2A 3A2VA 1FW1A 3ZRDA 4HQZA 4ZBAA 1T4ZA 3QAWA 1NM3A 1HNBA 4POLA 2K18A 4XS1A 2WS2A 1TK0B 2AJQB 4RI6A 3RAZA 3ZIJA 2JZSA 3TB2A 5F0GA 3KIJA 4E8HA 1GP1A 4IW9A 3KTBA 1PL2A 4XHMA 2V6OA 2V6KA 5B6NA 3OR5A 3W8JA 4EUYA 2FNOA 1GWCA 4YAVA 1JZDA 4MCUA 2WULA 2DBCA 3NIVA 2HLSA 1GTAA 2JSYA 4IGJA 4MABA 2VM1A 4TR1B 3Q74A 3TKQA 2L4QA 3QCPA 8GSSA 3K8NA 5G31A 2OA7A 5DJLA 3P7XA 4PQ1A 1K0CA 4OFTA 4TOPA 4RI7A 1BEDA 3GNJA 2LUSA 3ZITA 1O73A 3ZVJA 1PN9A 4EL1A 4KSOA 3GUSA 3UMAA 1Z9HA 2YWOA 1ZZYA 4LL4B 4IBPA 4MLYA 3CXGA 5L71A 2N5BA 3F3RA 2AB6A 2HZEA 3RHBA 4TRXA 3UBKA 3LYPA 2H76A 2DIYA 3TKSA 1URMA 2CV4A 3L78A 2VLVA 2PWJA 1MD3A 3KP8A 1EV4A 1A0RP 5A4WA 1TK5B 4IP6A 4OO5A 2Z9SA 1H75A 1YEPA 3KP9A 2C3QA 3VLNA 1ZL9A 1Q98A 2ON7A 3F9UA 3CSJA 22GSA 1Z7PA 5F06A 3PR8A 2F3MA 1RK4A 4ECJA 3O6TA 1ERUA 2IFQB 2WB9A 2VOCA 2L6CA 5IPGA 3HVVA 4HI7A 1FG4A 2R6KA 4KA0A 2GQKA 1SK0A 3PH9A 4GSSA 2K6VA 5LD0A 1HNCA 1F3BA 1TI1A 2YWIA 3P90A 1XW5A 5IPHA 2L6DA 5FHIA 1VRSD 1A0FA 1GSSA 2XHFA 1OKTA 3A2WA 3C71A 1Z5YE 4JBBA 3DGQA 2R2JA 5IMVA 4YH2A 1GSUA 2QSIA 3FR9A 1V40A 3TJJA 1G7EA 3KJYA 1AQXA 2VL2C 2VCVA 3GH6A 5ECHB 3WGDA 2TIRA 3APQA 5D73A 4KDYA 4BVYA 1U6TA 1LJRA 2V1MA 4ZILA 1SKSB 1K0DA 2YZHA 2DMMA 5INYA 2LV3A 3D4MA 4JU5A 4I8BA 5B7CA 1UC7A 3L9UA 4EVMA 1XOBA 5IM9A 1GRXA 2JSZA 3C1RA 3IAS2 1PGTA 2PMTA 2H01A 3RHCA 1TDIA 1OYJA 4KH7A 1TOFA 2QC7A 2GT6A 1WIKA 5JCWA 3HZ4A 1F3AA 2YJHA 4MZBA 1SJIA 2CZ2A 2PBJA 2H1BA 2BTOT 5CP1A 1O81A 4AF2A 2LRNA 1R7HA 5LNKe 4ULXA 1B48A 3QFAC 4BA7A 4DSSA 2C8UA 3DVWA 3JCML 4Q5NA 1M0UA 4KW6A 5KN2A 1GSYA 4GSNA 3GH9A 2M46A 2V32A 3EURA 3J7Yb 2CZ3A 1XWKA 5D93A 3GYKA 5IO2A 2A2RA 1J08A 5EVOA 2HRNA 3ZMKA 1U88A 4TR0A 1JZRA 3GX8A 2CAQA 2FWEA 4I6XA 1S3CA 2FHEA 1ERVA 2GDRA 3TRPA 2PUKC 2OJLA 4KAEA 5H5SA 5COHA 3I69A 4OMVA 2GQLA 1TP9A 1W89A 4KGIA 5IOWA 4ACSA 1DUGA 1XW9A 3TGZA 5IO0A 4MH3A 4HU9A 1AW9A 4OCFA 5G30A 2RLIA 2JL4A 2B5YA 2H19A 1XWBA 4TKYA 1B8XA 4TN8A 1HNAA 1TJDA 3KCMA 1DE1A 4ILFA 1SU9A 5ENUA 2KUCA 3EC3A 4TXOB 4HU7A 1X5DA 4NWYA 4BVXA 1GUMA 1TTZA 3CTGA 4K0GA 1DBYA 1A8YA 2GZZA 4XRDA 3M3MA 3GKXA 3H1NA 1S3AA 4XTSA 2RM5A 4L5OA 1SJ6A 4AGSA 1GSEA 1K3LA 2DIZA 2JZRA 2N5AA 3VPQA 1EP7A 1J9BA 1XZOA 2R5GA 4MH2A 4MJCA 3TKRA 2AYTA 9GSSA 2VUPA 3L4NA 1KNGA 2H70A 2MMAA 1A2MA 2X8GA 1K0BA 2RIIA 5J41A 1QUWA 3TJKA 1HYUA 1XCCA 2L4CA 4G10A 3P2AA 6GSUA 4GF0A 2O89A 3IK7A 2E7PA 1EEMA 19GSA 1X0RA 3E9JB 2GVPA 1EWXA 1V57A 1KBNA 4OD7A 1CQGA 1SK1A 3C8EA 3FK8A 3QR6A 3GTUA 5KN1A 1TU8A 1N2AA 5CRWA 1ZYQB 2CA8A 3I9V2 4MPFA 5IMAA 5DAKB 4MZCA 3DVXA 1SL1B 5DVBA 5GAND 3C7MA 3MDKA 5DCHA 3VK9A 1B9YC 5IMFA 3IV4A 4QL9A 4GXZA 3PINA 1SL0B 4N10A 1G7OA 1F6MC 5DALB 3MSZA 5CRDA 4J57E 4X43A 3D22A 1GL8A 4DSQA 4O32A 1Y25A 3TKPA 4AJ6A 2C0FA 3HZ8A 3DXBA 2TRXA 1HQOA 2P31A 3GL3A 3I43A 2FWHA 5ECLB 4I97A 5C04A 1MEKA 2HFDA 5ECNB 1GNEA 5EY6A 1OC3A 3UAPA 2OKAA 5G5EA 4IN0A 5B8BA 1QQ2A 2L59A 3ZTLA 5IIZA 5J3RA 4WR5A 3Q18A 4BL7A 2L5OA 2H71A 2OBKA 1GTUA 1EGRA 1B9XC 5A5KA 3N5OA 1XFLA 2KHPA 3UL3A 3EU3A 3KTLA 1F2EA 2HSHA 3QMXA 4JEDA 2I9HA 2PVOC 3LYKA 1WP0A 3UIWA 4TR1A 4PUFC 4POKA 4IQAA 2HT9A 5HFKA 1O6JA 3P8WA 4I2TA 4MK3A 5CRHA 4OFMA 2YANA 5ECRB 2PVQA 4YQUA 2K9FA 2GLRA 2H75A 5CNWA 4E8EA 1KTEA 5ECKB 2MMOA 4LMVA 1OVNA 1CQHA 11GSA 5J9BA 2LJRA 4PURA 2FD3A 2V2GA 3APOA 2GZYA 2RUFA 5FT3A 1MDIA 1AC1A 3EMXA 1V58A 4XIHA 4DVCA 1Z7RA 2D2ZA 1MTCA 3RBTA 1PD21 3F63A 3F6FA 3LWAA 2JU5A 3ZLPA 3VURA 3GKKA 4EO3A 1PKZA 1XW6A 4ID0A 5D8IA 2C3TA 3LFLA 2ALBA 2DLXA 3EWLA 2VD1A 2CAIA 4CHSA 2IMKA 3H8QA 3AY8A 2AHEA 1N8JA 1ON4A 3BOAA 2AAWA 3EMPA 5JWRB 2IN3A 1OC9A 1RQMA 4ECCA 2EIRA 1VF2A 3A3TA 4LMWA 1XBSA 4KSMA 4L5LA 4DEJA 2X8HA 5CREA 1T8EB 4QQ7A 1UA5A 1AQVA 1R26A 4F0CA 2LS5A 4K0NA 2VIMA 5AN1A 5ECMB 2VL3A 1AUCA 4ECBA 2VCZA 3ERWA 2VAFA 5AIXA 1MDJA 3FZAA 5KEJA 1XXUA 2WDUA 2XBQA 3D21A 1M2DA 4EKZA 3FZ4A 1K0OA 3CSIA 2GTUA 4MF7A 1V2AA 2F8AA 1GTBA 2GT5A 1GSFA 4MA9A 3L0HA 4POBA 5B6MA 4D73A 2F51A 4Q5RA 4HQSA 4GQFA 3G7IA 2CX4A 3KMOA 3ME8A 2DJ0A
chains in the Genus database with same CATH superfamily
1M2AA 1JZOA 5LCZA 4RUVA 2HZEB 2C0EA 2KLXA 2ZUPA 3IRAA 1A2LA 4Z2TA 2HRFA 1XWGA 2GS3A 1WRYA 1Z3EA 2QKEA 2H1AA 4X1UA 17GSA 2IIYA 5KOXA 1ZYNA 3WT1A 2VCQA 4EDYA 3F0IA 3KM6A 4K5SA 1EOHA 3VFIA 1U87A 5G1LA 3ZFLA 2C80A 2HRKA 3BD2A 3R3EA 1PMTA 3LQ7A 5KOWA 2P0GA 4XS4A 2FGXA 3QD9A 3APSA 3H4KA 3Q19A 3M1GA 3FEUA 2G2QA 3ZFBA 1BYEA 2NDOA 1VF1A 2C4JA 1X9WB 5D9XA 1PL1A 3U5RE 4NV5A 2B7KA 2NVLA 1GNWA 2LQQA 1V9WA 2JZTA 2TRCP 2QA1A 5CYYA 1K0AA 5A4VA 1SL2B 1TK8B 2FLSA 4WKWA 5ELAA 5DCGA 3IK9A 4YAPA 3FZ5A 1ILOA 4Z2RA 2IMFA 2O8VB 1USBA 4I5QA 3ED3A 4WBRD 2MBTA 2DJ1A 4FO5A 1NSWA 1K3OA 3G9BA 4IKHA 2A2PA 2CVKA 2EIQA 2M72A 3IXRA 2CVDA 2B1LA 3MYDA 2IWTA 5G1KA 2EC4A 3FYGA 5DBQA 2K8VA 2JADA 3ZZXA 3Q6OA 2FY6A 2OADA 3UEMA 1WE0A 4ML6A 3LW9A 1XVQA 3FW2A 2DC5A 4MF6A 4K7OA 4BVYB 1E2YA 2CQ9A 4BWQA 2LSTA 2C0GA 4JE1A 1SKWB 1FOVA 3FRCA 1QK8A 3HXSA 1WPIA 4HDEA 1LBKA 1ZMAA 2FCHA 4KNDA 5HR1A 2YV7A 4G9HA 2HE3A 1XOAA 4MPGA 1E6BA 2GZPA 1TRVA 4KCEA 3ZYWA 5AISA 3HJMA 1OAZA 2RUEA 1OKDA 2HNLA 2H66A 3MNGA 3C1SA 3FHKA 13GSA 2IMDA 3VWUA 3TJBA 1A2JA 1U3IA 4Z7XA 2I1UA 3M9JA 2H0GA 4WR4A 4NV2A 4G2EA 2C1YA 2CT6A 1GTIA 2NTOA 3W6GA 4V2LA 2YOIA 3QAVA 1X9MB 2LJAA 2I81A 5H5QA 2MBSA 2H6YA 4DSSB 3GMFA 4EIQA 2IL3A 1XVWA 4POMA 1W4VA 3ERFA 1K0NA 4FH8A 2DJ3A 3HCZA 3MIXA 3RDWA 3IR4A 3MAKA 2H74A 1YDKA 3TKSC 1FHEA 4JZQA 4K7IA 5EL8A 1WJKA 4FYBA 4AJ7A 4CDOA 3UOMA 5ECIB 3I6AA 1BQ7A 2YWMA 5E59A 2X99A 1SK2A 4KB3A 3BCKA 2LEGA 3GV1A 1SYXA 3M9KA 1IYHA 1BAYA 1ML6A 1PSQA 1NHOA 5JCGA 5HFIA 3GA4A 1PX6A 4OCEA 1YKAA 1ACVA 3D4TA 2LJKA 4ZL8A 2OE3A 5JWQB 1YY7A 2XPEA 4N30A 2OBIA 2B1KA 4GTUA 3ZL5A 1M2BA 3GL5A 2R37A 2B3SA 4MZWA 2X4AA 4P3YB 2R4VA 4KF9A 3HHVA 1JZWA 3HJPA 5FWGA 1TI3A 3VWVA 2F9SA 4BIKA 4L0WA 5D96A 1M3IA 2CX3A 20GSA 2XPDA 4TXVA 4MP4A 5D9VA 5C00A 4BVXB 3GSSA 3D6IA 1PA3A 2PERA 3LJRA 3FMWA 2H73A 1T00A 1BG5A 3CRUA 5IMCA 6GSXA 1TXXA 1GLQA 2EIOA 3HDCA 3LXTA 4FYCA 2DKIA 2FUG2 3LGCA 4IELA 3J7Yk 5ID2A 1R5AA 1MDKA 2L57A 3DWVA 3G7JA 4YQMA 3S9FA 4NXIA 4EDZA 1B4QA 4MDCA 2VCXA 3EYTA 3N9JA 3DD3A 4K9ZA 1ZGNA 2AV4A 4G0IA 2FWFA 5HR2A 6GSYA 1NW2A 1ZYEA 4PX1A 5H5RA 3GURA 2A4HA 5CO3A 3ZIVA 3C73A 2KP1A 3D0ZA 1I9DA 2WJUA 1KEBA 6GSSA 2QGVA 4PXOA 3KXOA 4HOJA 4PQHA 1TKDB 1FB0A 1EP8A 2VL2A 1QMVA 3GTUB 2ZCTA 5GAPD 4N0ZA 4FYUA 1R5PA 4IP1A 2O87A 3EE2A 2H0HA 1Z6NA 1K0MA 4PNFA 4QL7A 3KZQA 4ZL7A 2GSTA 4V1Ag 3A5IA 4ZBBA 1AAZA 4KDUA 3O3TA 5JCUA 2OE1A 1SYRA 2PPTA 5GZZB 2LQOA 4V2MA 3IPZA 5ECOB 4O92A 1OC8A 1M7TA 2R3XA 3DKSA 2CVBA 2C3NA 2H6ZA 1UN2A 3IBHA 1GUHA 4NPBA 1XG8A 3VI7A 2FA8A 4TVEA 1OE7A 1DE2A 2F8FA 2WZ9A 4O5RA 3UBLA 3HY2A 1PN0A 1LU4A 2DMLA 2HYXA 1PRXA 1J0FA 5DQYA 2YP6A 2DSAA 2LTKA 3GFKA 3L9VA 2B6MA 1FO5A 5CAXA 3DIEA 3L9SA 2DJJA 4BPYA 3GX0A 2DJKA 2H1GA 1XWCA 4RQXA 2B5EA 4V1Ap 5G2ZA 2E2GA 4NHWA 4BL7B 1FVKA 3CSHA 2I4AA 3FR6A 1A23A 3PGTA 3TUEA 1DSBA 2I3YA 3NOFA 4MMMA 2LNSA 2A2SA 5ECQB 5GSSA 1PX7A 2FA4A 4IS0A 4WF5A 4KUNA 1Y6EA 3KH9A 3PPUA 3GIXA 1O7UA 1YF1A 4TR3A 4WF4A 3WGXA 5B8AA 1WWJA 4OO4A 4JRRA 5G5FA 5AIVA 4G19A 5HQPA 5E4WA 1M9BA 3VWWA 1C72A 1H4OA 4GQCA 4OFNA 2R0CA 4IJIA 1QFNA 1XPVA 2VO4A 1M9AA 2WCIA 1RW1A 3GSTA 3M8NA 4HSCX 6GSTA 3W8SA 4F2IA 3QDNA 1SJZA 3DYRA 4WETA 3WGEA 1ERTA 4K8MA 4J2FA 5D9TA 2GQMA 16GSA 1G0TA 4JR6A 3E0UA 3R2QA 3EVIA 2IFQA 2X8CA 1FAAA 3H93A 4MJAA 3EINA 4MF5A 4ECIA 2IMEA 3TRQA 3BBYA 1S3RA 4MNNA 4K7NA 3IAM2 1MD4A 1AXDA 1EOGA 1VGLA 3GN3A 4KE3A 4EC0A 4GWRA 3QPMA 1Z6MA 5KN3A 1X5EA 2XC2A 3IHGA 18GSA 5AGYA 1A8LA 3H79A 3M0FA 4G0LA 2VLTA 4CY6A 1OC9B 1ZOFA 3ZVJD 3WD6A 5HFGA 2DKHA 3CBUA 3V1WA 3U6VA 1M99A 1THOA 1G6YA 3HA9A 3TKSE 3LG6A 2B5XA 2GSQA 4K2DA 2YN1A 3FY7A 5DDLA 4O5QA 4NHZA 2YZUA 4F0BA 2GSSA 3F4TA 1BX9A 4OWYA 2BMXA 2MMNA 1JFUA 2YPMA 4I2UA 1V98A 1VF3A 1XIYA 1YZXA 3DEXA 2NBSA 2HRAA 3DMLA 4D73B 2O85A 3GRXA 1T1VA 5GSTA 4TR4A 4L8EA 4MJEA 4CW9A 2H0IA 4KDXA 1I5GA 2YWNA 1ZCPA 4YKFA 5J9CA 5IQYA 7GSSA 3SBCA 1GSQA 1FOHA 3CYNA 2LKUA 1O8WA 5IOXA 3KGKA 3FZ9A 2AUVA 2HSYA 3FKFA 4GCIA 1EGOA 2VD0A 4IQ1A 4FIWA 1R4WA 1XWAA 1T3BA 2XBIA 1SENA 2WGRA 4HJ2A 1T7PB 4LA1A 4XS4B 4ZB6A 1F37A 1FVJA 4J56E 1K3YA 3CTFA 3VI5A 1EZKA 14GSA 5IMZA 2PN8A 4X0XA 2IJYA 1FB6A 3D5JA 2NPBA 4L0UA 2PGTA 2A4VA 2VM2A 3WYWA 3SWLA 2B7JA 2ES7A 2ZNMA 4KX4A 3MWHA 3IOSA 3IHQA 4N0VA 5F8BA 4IJ3A 4ZB9A 1TU7A 4EXJA 2KP2A 3A5WA 5D9WA 4LLRA 2GGTA 1SD8A 4NMUA 3GHAA 3ISOA 3HD5A 3F6DA 5ECPB 2L5LA 3UARA 1QXHA 1PKWA 3TCOA 2LRCA 3F4SA 4O5UA 3IDVA 1ABAA 1BJXA 2ON5A 3TDGA 2QA2A 3F4RA 2HZFA 4AJ8A 5CRGA 3CMIA 1JLWA 2MZCA 4TXOA 4XS6A 2E2MA 4RQRA 3FR3A 2OE0A 2PU9C 3TJFA 3WT2A 1WMJA 3KH7A 2FWGA 2HXKA 5F05A 4TW5A 2H72A 4V2NA 4HZ2A 5ECSA 1T4YA 1TW9A 3VPTA 6GSWA 4BWSA 2HI7A 5JWOB 2JACA 3LORA 2YJ7A 1GULA 2O7KA 2P5RA 3LSZA 3KMNA 2WRTA 4GSTA 3BJ5A 1TRUA 4ZL9A 4PGTA 3BCIA 1ST9A 3US3A 2K8SA 3TOTA 3TJGA 1S3DA 1EEJA 2MMZA 1GLPA 4K1FA 3GKNA 3RPPA 1IYIA 2YCDA 1AIUA 2X64A 1JHBA 4FQUA 1U3AA 1GH2A 4WBJA 1OE8A 5KN0A 3QFBC 1GSDA 2N5FA 3UVHA 3TOUA 3ERGA 4KCAA 3F3QA 4ZXGA 2H8LA 2RM6A 4IVFA 4EE0A 3HVSA 1YQ1A 1GUKA 1B4PA 3HYPA 5DJMA 4ZIJA 1SKRB 5DAKA 3QAGA 5HR0A 1Q4JA 10GSA 2H6XA 3VWXA 5DQSA 2DJ2A 1TRWA 4ISDA 5J5NA 4ZBDA 2OACA 3ZREA 2G0FA 2GSRA 5DALA 5ELGA 4WEYA 1VF4A 1ERWA 4G0KA 4GLTA 3DRNA 3HVXA 4PQIA 2BJXA 6GSVA 4ICYA 1YF0A 3KD0A 1YEXA 12GSA 4F9ZA 4PUAA 1JLVA 4N11A 1PQNA 1WOUA 3CRTA 2C0DA 3A2XA 1YJ6A 4Q5FA 4XRAA 1THXA 2LRTA 2VL9A 4LL1B 2KOKA 3QOUA 3LXZA 1X5CA 3G7YA 1QGVA 3E3EA 1YKCA 3GKMA 3F8UA 4YQVA 5F07A 1EV9A 2J9HA 3O76A 4HZ4A 4IHUA 3UVTA 4MJBA 3HJOA 2VCWA 2MYGA 2WFCA 5HR3A 2YNXA 1G6WA 3HKRA 2H1DA 1SD9A 4HEA2 4DSRA 4HS1A 5A4UA 5BMUA 3NZNA 2REMA 1AQWA 4Q5QA 4ML1A 2J23A 2R0PA 4ZB8A 1TRSA 4HUAA 2YV9A 2VCTA 5BRTA 1UVZA 4XCSA 2IPAA 2M80A 2LNTA 5IMDA 4F82A 2E0QA 4F03A 3ZMLA 5ID2B 4H86A 4EF0A 2V41A 1X9SB 4NAXA 2VLUA 4JR4A 3ME7A 1NHYA 1O8XA 1O85A 1A24A 3KEBA 1F9MA 5J4UA 3IE3A 3EU4A 4WXTA 4O7HA 2H30A 2P5QA 4GRFA 3RPNA 4HJMA 3UJ1A 4K6XA 4PNGA 3HVNA 3IA1A 3TRXA 5ABRA 2IMIA 2UZ8A 5EPFA 3IC4A 3LEFA 1HD2A 3A2VA 1FW1A 3ZRDA 4HQZA 4ZBAA 1T4ZA 3QAWA 1NM3A 1HNBA 4POLA 2K18A 4XS1A 2WS2A 1TK0B 2AJQB 4RI6A 3RAZA 3ZIJA 2JZSA 3TB2A 5F0GA 3KIJA 4E8HA 1GP1A 4IW9A 3KTBA 1PL2A 4XHMA 2V6OA 2V6KA 5B6NA 3OR5A 3W8JA 4EUYA 2FNOA 1GWCA 4YAVA 1JZDA 4MCUA 2WULA 2DBCA 3NIVA 2HLSA 1GTAA 2JSYA 4IGJA 4MABA 2VM1A 4TR1B 3Q74A 3TKQA 2L4QA 3QCPA 8GSSA 3K8NA 5G31A 2OA7A 5DJLA 3P7XA 4PQ1A 1K0CA 4OFTA 4TOPA 4RI7A 1BEDA 3GNJA 2LUSA 3ZITA 1O73A 3ZVJA 1PN9A 4EL1A 4KSOA 3GUSA 3UMAA 1Z9HA 2YWOA 1ZZYA 4LL4B 4IBPA 4MLYA 3CXGA 5L71A 2N5BA 3F3RA 2AB6A 2HZEA 4X4JA 3RHBA 4TRXA 3UBKA 3LYPA 2H76A 2DIYA 3TKSA 1URMA 2CV4A 3L78A 2VLVA 4YKGA 2PWJA 1MD3A 3KP8A 1EV4A 1A0RP 5A4WA 1TK5B 4IP6A 4OO5A 2Z9SA 1H75A 1YEPA 3KP9A 2C3QA 3VLNA 1ZL9A 1Q98A 2ON7A 3F9UA 3CSJA 22GSA 1Z7PA 5F06A 3PR8A 2F3MA 1RK4A 4ECJA 3O6TA 1ERUA 2IFQB 2WB9A 2VOCA 2L6CA 5IPGA 3HVVA 4HI7A 1FG4A 2R6KA 4KA0A 2GQKA 1SK0A 3PH9A 4GSSA 2K6VA 5LD0A 1HNCA 1F3BA 1TI1A 2YWIA 3P90A 1XW5A 5IPHA 2L6DA 5FHIA 1VRSD 1A0FA 1GSSA 2XHFA 1OKTA 3A2WA 3C71A 1Z5YE 4JBBA 3DGQA 4PTSA 2R2JA 5IMVA 4YH2A 1GSUA 2QSIA 3FR9A 1V40A 3TJJA 1G7EA 3KJYA 1AQXA 2VL2C 2VCVA 3GH6A 5ECHB 3WGDA 2TIRA 3APQA 5D73A 4KDYA 4BVYA 1U6TA 1LJRA 2V1MA 4ZILA 4Z2UA 1SKSB 1K0DA 2YZHA 2DMMA 5INYA 2LV3A 3D4MA 4JU5A 4I8BA 5B7CA 1UC7A 2HSMA 3L9UA 4EVMA 1XOBA 5IM9A 1GRXA 2JSZA 3C1RA 3IAS2 1PGTA 2PMTA 2H01A 3RHCA 1TDIA 1OYJA 4KH7A 1TOFA 2QC7A 2GT6A 1WIKA 5JCWA 3HZ4A 1F3AA 2YJHA 4MZBA 1SJIA 2CZ2A 2PBJA 2H1BA 2BTOT 5CP1A 1O81A 4AF2A 2LRNA 1R7HA 5LNKe 4ULXA 1B48A 3QFAC 4BA7A 4DSSA 2C8UA 3DVWA 3JCML 4Q5NA 1M0UA 4KW6A 5KN2A 1GSYA 4GSNA 3GH9A 2M46A 2V32A 3EURA 3J7Yb 2CZ3A 1XWKA 5D93A 3GYKA 5IO2A 2A2RA 1J08A 5EVOA 2HRNA 3ZMKA 1U88A 4TR0A 1JZRA 3GX8A 2CAQA 2FWEA 4I6XA 1S3CA 2FHEA 1ERVA 2GDRA 3TRPA 2PUKC 2OJLA 4KAEA 5H5SA 5COHA 3I69A 4OMVA 2GQLA 1TP9A 1W89A 4KGIA 5IOWA 4ACSA 1DUGA 1XW9A 3TGZA 5IO0A 4MH3A 4HU9A 1AW9A 4OCFA 5G30A 2RLIA 2JL4A 2B5YA 2H19A 1XWBA 4TKYA 1B8XA 4TN8A 1HNAA 1TJDA 3KCMA 1DE1A 4ILFA 1SU9A 5ENUA 2KUCA 3EC3A 4TXOB 4HU7A 1X5DA 4NWYA 4BVXA 1GUMA 1TTZA 3CTGA 4K0GA 1DBYA 1A8YA 2GZZA 4XRDA 3M3MA 3GKXA 3H1NA 1S3AA 4XTSA 2RM5A 4L5OA 1SJ6A 4AGSA 1GSEA 1K3LA 2DIZA 2JZRA 2N5AA 3VPQA 1EP7A 1J9BA 1XZOA 2R5GA 4MH2A 4MJCA 3TKRA 2AYTA 9GSSA 2VUPA 3L4NA 1KNGA 1PFOA 2H70A 2MMAA 1A2MA 2X8GA 1K0BA 2RIIA 5J41A 1QUWA 3TJKA 1HYUA 1XCCA 2L4CA 4G10A 3P2AA 3IC8A 6GSUA 4GF0A 2O89A 3IK7A 2E7PA 1EEMA 19GSA 1X0RA 3E9JB 2GVPA 1EWXA 1V57A 1KBNA 4OD7A 1CQGA 1SK1A 3C8EA 3FK8A 3QR6A 3GTUA 5KN1A 1TU8A 1N2AA 5CRWA 1ZYQB 2CA8A 3I9V2 4MPFA 5IMAA 5DAKB 4MZCA 3DVXA 1SL1B 5DVBA 2X49A 5GAND 3C7MA 3MDKA 5DCHA 3VK9A 1B9YC 5IMFA 3IV4A 4QL9A 4GXZA 3PINA 1SL0B 4N10A 1G7OA 1F6MC 1ZYPA 5DALB 3MSZA 5CRDA 4J57E 4X43A 3D22A 1GL8A 4DSQA 4O32A 1Y25A 3TKPA 4AJ6A 2C0FA 3HZ8A 3DXBA 2TRXA 1HQOA 2P31A 3GL3A 3I43A 2FWHA 5ECLB 4I97A 5C04A 1MEKA 2HFDA 5ECNB 2R0GA 1GNEA 5EY6A 1OC3A 3UAPA 2OKAA 5G5EA 4IN0A 4A5PA 5B8BA 1QQ2A 2L59A 3ZTLA 4CY8A 5IIZA 5J3RA 4WR5A 3Q18A 4BL7A 2L5OA 2H71A 2OBKA 1GTUA 1EGRA 1B9XC 5A5KA 3N5OA 1XFLA 2KHPA 3UL3A 3EU3A 3KTLA 1F2EA 2HSHA 3QMXA 4JEDA 2I9HA 2PVOC 3LYKA 1WP0A 3UIWA 4TR1A 4PUFC 4POKA 4IQAA 2HT9A 5HFKA 1O6JA 3P8WA 4I2TA 4MK3A 5CRHA 1M3JA 4OFMA 2YANA 5ECRB 2PVQA 4YQUA 2K9FA 2GLRA 2H75A 5CNWA 4E8EA 1KTEA 5ECKB 4K5RA 2MMOA 4LMVA 1OVNA 1CQHA 11GSA 5J9BA 2LJRA 4PURA 2FD3A 2V2GA 3APOA 2GZYA 2RUFA 5FT3A 1MDIA 1AC1A 3EMXA 1V58A 4XIHA 4DVCA 1Z7RA 2D2ZA 1MTCA 3RBTA 4K2XA 1PD21 3F63A 3F6FA 3LWAA 2JU5A 3ZLPA 3VURA 3GKKA 4EO3A 1PKZA 1XW6A 4ID0A 5D8IA 2C3TA 3LFLA 2ALBA 2DLXA 3EWLA 3EPTA 2VD1A 2CAIA 3CQFA 4CHSA 2IMKA 3H8QA 3AY8A 2AHEA 1N8JA 1ON4A 3BOAA 2AAWA 3EMPA 5JWRB 2IN3A 1OC9A 1RQMA 4USSA 2EIRA 4ECCA 1VF2A 3A3TA 4LMWA 1XBSA 4KSMA 4L5LA 4DEJA 2X8HA 5CREA 1T8EB 4QQ7A 1UA5A 1AQVA 1R26A 4F0CA 2LS5A 4K0NA 2VIMA 5AN1A 5ECMB 2VL3A 1AUCA 4ECBA 2VCZA 3ERWA 2VAFA 5AIXA 1MDJA 3FZAA 5KEJA 1XXUA 2WDUA 2XBQA 3D21A 1M2DA 4EKZA 3FZ4A 1K0OA 3CSIA 2GTUA 4MF7A 1V2AA 2F8AA 1GTBA 2GT5A 1GSFA 4MA9A 3L0HA 4POBA 5B6MA 4D73A 2F51A 4Q5RA 4HQSA 4GQFA 3G7IA 4EIPA 2CX4A 3KMOA 3ME8A 2DJ0A
chains in the Genus database with same CATH topology
1M2AA 1JZOA 5LCZA 4RUVA 2HZEB 2C0EA 2KLXA 2ZUPA 3IRAA 1A2LA 4Z2TA 2HRFA 1XWGA 2GS3A 1WRYA 1Z3EA 2QKEA 2H1AA 4X1UA 17GSA 2IIYA 5KOXA 1ZYNA 3WT1A 2VCQA 4EDYA 3F0IA 3KM6A 4K5SA 1EOHA 3VFIA 1U87A 5G1LA 3ZFLA 2C80A 2HRKA 3BD2A 3R3EA 1PMTA 3LQ7A 5KOWA 2P0GA 4XS4A 2FGXA 3QD9A 3APSA 3H4KA 3Q19A 3M1GA 3FEUA 2G2QA 3ZFBA 1BYEA 2NDOA 1VF1A 2C4JA 1X9WB 5D9XA 1PL1A 3U5RE 4NV5A 2B7KA 2NVLA 1GNWA 2LQQA 1V9WA 2JZTA 2TRCP 2QA1A 5CYYA 1K0AA 5A4VA 1SL2B 1TK8B 2FLSA 4WKWA 5ELAA 5DCGA 3IK9A 4YAPA 3FZ5A 1ILOA 4Z2RA 2IMFA 2O8VB 1USBA 4I5QA 3ED3A 4WBRD 2MBTA 2DJ1A 4FO5A 1NSWA 1K3OA 3G9BA 4IKHA 2A2PA 2CVKA 2EIQA 2M72A 3IXRA 2CVDA 2B1LA 3MYDA 2IWTA 5G1KA 2EC4A 3FYGA 5DBQA 2K8VA 2JADA 3ZZXA 3Q6OA 2FY6A 2OADA 3UEMA 1WE0A 4ML6A 3LW9A 1XVQA 3FW2A 2DC5A 4MF6A 4K7OA 4BVYB 1E2YA 2CQ9A 4BWQA 2LSTA 2C0GA 4JE1A 1SKWB 1FOVA 3FRCA 1QK8A 3HXSA 1WPIA 4HDEA 1LBKA 1ZMAA 2FCHA 4KNDA 5HR1A 2YV7A 4G9HA 2HE3A 1XOAA 4MPGA 1E6BA 2GZPA 1TRVA 4KCEA 3ZYWA 5AISA 3HJMA 1OAZA 2RUEA 1OKDA 2HNLA 2H66A 3MNGA 3C1SA 3FHKA 13GSA 2IMDA 3VWUA 3TJBA 1A2JA 1U3IA 4Z7XA 2I1UA 3M9JA 2H0GA 4WR4A 4NV2A 4G2EA 2C1YA 2CT6A 1GTIA 2NTOA 3W6GA 4V2LA 2YOIA 3QAVA 1X9MB 2LJAA 2I81A 5H5QA 2MBSA 2H6YA 4DSSB 3GMFA 4EIQA 2IL3A 1XVWA 4POMA 1W4VA 3ERFA 1K0NA 4FH8A 2DJ3A 3HCZA 3MIXA 3RDWA 3IR4A 3MAKA 2H74A 1YDKA 3TKSC 1FHEA 4JZQA 4K7IA 5EL8A 1WJKA 4FYBA 4AJ7A 4CDOA 3UOMA 5ECIB 3I6AA 1BQ7A 2YWMA 5E59A 2X99A 1SK2A 4KB3A 3BCKA 2LEGA 3GV1A 1SYXA 3M9KA 1IYHA 1BAYA 1ML6A 1PSQA 1NHOA 5JCGA 5HFIA 3GA4A 1PX6A 4OCEA 1YKAA 1ACVA 3D4TA 2LJKA 4ZL8A 2OE3A 5JWQB 1YY7A 2XPEA 4N30A 2OBIA 2B1KA 4GTUA 3ZL5A 1M2BA 3GL5A 2R37A 2B3SA 4MZWA 2X4AA 4P3YB 2R4VA 4KF9A 3HHVA 1JZWA 3HJPA 5FWGA 1TI3A 3VWVA 2F9SA 4L0WA 5D96A 2CX3A 20GSA 2XPDA 4TXVA 4MP4A 5D9VA 5C00A 4BVXB 3GSSA 3D6IA 1PA3A 2PERA 3LJRA 3FMWA 2H73A 1T00A 1BG5A 3CRUA 5IMCA 6GSXA 1TXXA 1GLQA 2EIOA 3HDCA 3LXTA 4FYCA 2DKIA 2FUG2 3LGCA 4IELA 3J7Yk 5ID2A 1R5AA 1MDKA 2L57A 3DWVA 3G7JA 4YQMA 3S9FA 4NXIA 4EDZA 1B4QA 4MDCA 2VCXA 3EYTA 3N9JA 3DD3A 4K9ZA 1ZGNA 2AV4A 4G0IA 2FWFA 5HR2A 6GSYA 1NW2A 1ZYEA 4PX1A 5H5RA 3GURA 2A4HA 5CO3A 3ZIVA 3C73A 2KP1A 3D0ZA 1I9DA 2WJUA 1KEBA 6GSSA 2QGVA 4PXOA 3KXOA 4HOJA 4PQHA 1TKDB 1FB0A 1EP8A 2VL2A 1QMVA 3GTUB 2ZCTA 5GAPD 4N0ZA 4FYUA 1R5PA 4IP1A 2O87A 3EE2A 2H0HA 1Z6NA 1K0MA 4PNFA 4QL7A 3KZQA 4ZL7A 2GSTA 4V1Ag 3A5IA 4ZBBA 1AAZA 4KDUA 3O3TA 5JCUA 2OE1A 1SYRA 2PPTA 5GZZB 2LQOA 4V2MA 3IPZA 5ECOB 4O92A 1OC8A 1M7TA 2R3XA 3DKSA 2CVBA 2C3NA 2H6ZA 1UN2A 3IBHA 1GUHA 4NPBA 3VI7A 2FA8A 4TVEA 1OE7A 1DE2A 2F8FA 2WZ9A 4O5RA 3UBLA 3HY2A 1PN0A 1LU4A 2DMLA 2HYXA 1PRXA 1J0FA 5DQYA 2YP6A 2DSAA 2LTKA 3GFKA 3L9VA 2B6MA 1FO5A 5CAXA 3DIEA 3L9SA 2DJJA 4BPYA 3GX0A 2DJKA 2H1GA 1XWCA 4RQXA 2B5EA 4V1Ap 5G2ZA 2E2GA 4NHWA 4BL7B 1FVKA 3CSHA 2I4AA 3FR6A 1A23A 3PGTA 3TUEA 1DSBA 2I3YA 3NOFA 4MMMA 2LNSA 2A2SA 5ECQB 5GSSA 1PX7A 2FA4A 4IS0A 4WF5A 4KUNA 1Y6EA 3KH9A 3PPUA 3GIXA 1O7UA 1YF1A 4TR3A 4WF4A 3WGXA 5B8AA 1WWJA 4OO4A 4JRRA 5G5FA 5AIVA 4G19A 5HQPA 5E4WA 1M9BA 3VWWA 1C72A 1H4OA 4GQCA 4OFNA 2R0CA 4IJIA 1QFNA 1XPVA 2VO4A 1M9AA 2WCIA 1RW1A 3GSTA 3M8NA 6GSTA 3W8SA 4F2IA 3QDNA 1SJZA 3DYRA 4WETA 3WGEA 1ERTA 4K8MA 4J2FA 5D9TA 2GQMA 16GSA 1G0TA 4JR6A 3E0UA 3R2QA 3EVIA 2IFQA 2X8CA 1FAAA 3H93A 4MJAA 3EINA 4MF5A 4ECIA 2IMEA 3TRQA 3BBYA 4MNNA 4K7NA 3IAM2 1MD4A 1AXDA 1EOGA 1VGLA 3GN3A 4KE3A 4EC0A 4GWRA 3QPMA 1Z6MA 5KN3A 1X5EA 2XC2A 3IHGA 18GSA 5AGYA 1A8LA 3H79A 3M0FA 4G0LA 2VLTA 4CY6A 1OC9B 1ZOFA 3ZVJD 3WD6A 5HFGA 2DKHA 3CBUA 3V1WA 3U6VA 1M99A 1THOA 1G6YA 3HA9A 3TKSE 3LG6A 2B5XA 2GSQA 4K2DA 2YN1A 3FY7A 5DDLA 4O5QA 4NHZA 2YZUA 4F0BA 2GSSA 3F4TA 1BX9A 4OWYA 2BMXA 2MMNA 1JFUA 2YPMA 4I2UA 1V98A 1VF3A 1XIYA 1YZXA 3DEXA 2NBSA 2HRAA 3DMLA 4D73B 2O85A 3GRXA 1T1VA 5GSTA 4TR4A 4L8EA 4MJEA 4CW9A 2H0IA 4KDXA 1I5GA 2YWNA 1ZCPA 4YKFA 5J9CA 5IQYA 7GSSA 3SBCA 1GSQA 1FOHA 3CYNA 2LKUA 1O8WA 5IOXA 3KGKA 3FZ9A 2AUVA 2HSYA 3FKFA 4GCIA 1EGOA 2VD0A 4IQ1A 4FIWA 1R4WA 1XWAA 1T3BA 2XBIA 1SENA 2WGRA 4HJ2A 1T7PB 4LA1A 4XS4B 4ZB6A 1F37A 1FVJA 4J56E 1K3YA 3CTFA 3VI5A 1EZKA 14GSA 5IMZA 2PN8A 4X0XA 2IJYA 1FB6A 3D5JA 2NPBA 4L0UA 2PGTA 2A4VA 2VM2A 3WYWA 3SWLA 2B7JA 2ES7A 2ZNMA 4KX4A 3MWHA 3IOSA 3IHQA 4N0VA 5F8BA 4IJ3A 4ZB9A 1TU7A 4EXJA 2KP2A 3A5WA 5D9WA 4LLRA 2GGTA 1SD8A 4NMUA 3GHAA 3ISOA 3HD5A 3F6DA 5ECPB 2L5LA 3UARA 1QXHA 1PKWA 3TCOA 2LRCA 3F4SA 4O5UA 3IDVA 1ABAA 1BJXA 2ON5A 3TDGA 2QA2A 3F4RA 2HZFA 4AJ8A 5CRGA 3CMIA 1JLWA 2MZCA 4TXOA 4XS6A 2E2MA 4RQRA 3FR3A 2OE0A 2PU9C 3TJFA 3WT2A 1WMJA 3KH7A 2FWGA 2HXKA 5F05A 4TW5A 2H72A 4V2NA 4HZ2A 5ECSA 1T4YA 1TW9A 3VPTA 6GSWA 4BWSA 2HI7A 5JWOB 2JACA 3LORA 2YJ7A 1GULA 2O7KA 2P5RA 3LSZA 3KMNA 2WRTA 4GSTA 3BJ5A 1TRUA 4ZL9A 4PGTA 3BCIA 1ST9A 3US3A 2K8SA 3TOTA 3TJGA 1S3DA 1EEJA 2MMZA 1GLPA 4K1FA 3GKNA 3RPPA 1IYIA 2YCDA 1AIUA 2X64A 1JHBA 4FQUA 1U3AA 1GH2A 4WBJA 1OE8A 5KN0A 3QFBC 1GSDA 2N5FA 3UVHA 3TOUA 3ERGA 4KCAA 3F3QA 4ZXGA 2H8LA 2RM6A 4IVFA 4EE0A 3HVSA 1YQ1A 1GUKA 1B4PA 3HYPA 5DJMA 4ZIJA 1SKRB 5DAKA 3QAGA 5HR0A 1Q4JA 10GSA 2H6XA 3VWXA 5DQSA 2DJ2A 1TRWA 4ISDA 5J5NA 4ZBDA 2OACA 3ZREA 2G0FA 2GSRA 5DALA 5ELGA 4WEYA 1VF4A 1ERWA 4G0KA 4GLTA 3DRNA 3HVXA 4PQIA 2BJXA 6GSVA 4ICYA 1YF0A 3KD0A 1YEXA 12GSA 4F9ZA 4PUAA 1JLVA 4N11A 1PQNA 1WOUA 3CRTA 2C0DA 3A2XA 1YJ6A 4Q5FA 4XRAA 1THXA 2LRTA 2VL9A 4LL1B 2KOKA 3QOUA 3LXZA 1X5CA 3G7YA 1QGVA 3E3EA 1YKCA 3GKMA 3F8UA 4YQVA 5F07A 1EV9A 2J9HA 3O76A 4HZ4A 4IHUA 3UVTA 4MJBA 3HJOA 2VCWA 2MYGA 2WFCA 5HR3A 2YNXA 1G6WA 3HKRA 2H1DA 1SD9A 4HEA2 4DSRA 4HS1A 5A4UA 5BMUA 3NZNA 2REMA 1AQWA 4Q5QA 4ML1A 2J23A 2R0PA 4ZB8A 1TRSA 4HUAA 2YV9A 2VCTA 5BRTA 1UVZA 4XCSA 2IPAA 2M80A 2LNTA 5IMDA 4F82A 2E0QA 4F03A 3ZMLA 5ID2B 4H86A 4EF0A 2V41A 1X9SB 4NAXA 2VLUA 4JR4A 3ME7A 1NHYA 1O8XA 1O85A 1A24A 3KEBA 1F9MA 5J4UA 3IE3A 3EU4A 4WXTA 4O7HA 2H30A 2P5QA 4GRFA 3RPNA 4HJMA 3UJ1A 4K6XA 4PNGA 3IA1A 3TRXA 5ABRA 2IMIA 2UZ8A 5EPFA 3IC4A 3LEFA 1HD2A 3A2VA 1FW1A 3ZRDA 4HQZA 4ZBAA 1T4ZA 3QAWA 1NM3A 1HNBA 4POLA 2K18A 4XS1A 2WS2A 1TK0B 2AJQB 4RI6A 3RAZA 3ZIJA 2JZSA 3TB2A 5F0GA 3KIJA 4E8HA 1GP1A 4IW9A 3KTBA 1PL2A 4XHMA 2V6OA 2V6KA 5B6NA 3OR5A 3W8JA 4EUYA 2FNOA 1GWCA 4YAVA 1JZDA 4MCUA 2WULA 2DBCA 3NIVA 2HLSA 1GTAA 2JSYA 4IGJA 4MABA 2VM1A 4TR1B 3Q74A 3TKQA 2L4QA 3QCPA 8GSSA 3K8NA 5G31A 2OA7A 5DJLA 3P7XA 4PQ1A 1K0CA 4OFTA 4TOPA 4RI7A 1BEDA 3GNJA 2LUSA 3ZITA 1O73A 3ZVJA 1PN9A 4EL1A 4KSOA 3GUSA 3UMAA 1Z9HA 2YWOA 1ZZYA 4LL4B 4IBPA 4MLYA 3CXGA 5L71A 2N5BA 3F3RA 2AB6A 2HZEA 4X4JA 3RHBA 4TRXA 3UBKA 3LYPA 2H76A 2DIYA 3TKSA 1URMA 2CV4A 3L78A 2VLVA 4YKGA 2PWJA 1MD3A 3KP8A 1EV4A 1A0RP 5A4WA 1TK5B 4IP6A 4OO5A 2Z9SA 1H75A 1YEPA 3KP9A 2C3QA 3VLNA 1ZL9A 1Q98A 2ON7A 3F9UA 3CSJA 22GSA 1Z7PA 5F06A 3PR8A 2F3MA 1RK4A 4ECJA 3O6TA 1ERUA 2IFQB 2WB9A 2VOCA 2L6CA 5IPGA 3HVVA 4HI7A 1FG4A 2R6KA 4KA0A 2GQKA 1SK0A 3PH9A 4GSSA 2K6VA 5LD0A 1HNCA 1F3BA 1TI1A 2YWIA 3P90A 1XW5A 5IPHA 2L6DA 5FHIA 1VRSD 1A0FA 1GSSA 2XHFA 1OKTA 3A2WA 3C71A 1Z5YE 4JBBA 3DGQA 4PTSA 2R2JA 5IMVA 4YH2A 1GSUA 2QSIA 3FR9A 1V40A 3TJJA 1G7EA 3KJYA 1AQXA 2VL2C 2VCVA 3GH6A 5ECHB 3WGDA 2TIRA 3APQA 5D73A 4KDYA 4BVYA 1U6TA 1LJRA 2V1MA 4ZILA 4Z2UA 1SKSB 1K0DA 2YZHA 2DMMA 5INYA 2LV3A 3D4MA 4JU5A 4I8BA 5B7CA 1UC7A 2HSMA 3L9UA 4EVMA 1XOBA 5IM9A 1GRXA 2JSZA 3C1RA 3IAS2 1PGTA 2PMTA 2H01A 3RHCA 1TDIA 1OYJA 4KH7A 1TOFA 2QC7A 2GT6A 1WIKA 5JCWA 3HZ4A 1F3AA 2YJHA 4MZBA 1SJIA 2CZ2A 2PBJA 2H1BA 2BTOT 5CP1A 1O81A 4AF2A 2LRNA 1R7HA 5LNKe 4ULXA 1B48A 3QFAC 4BA7A 4DSSA 2C8UA 3DVWA 3JCML 4Q5NA 1M0UA 4KW6A 5KN2A 1GSYA 4GSNA 3GH9A 2M46A 2V32A 3EURA 3J7Yb 2CZ3A 1XWKA 5D93A 3GYKA 5IO2A 2A2RA 1J08A 5EVOA 2HRNA 3ZMKA 1U88A 4TR0A 1JZRA 3GX8A 2CAQA 2FWEA 4I6XA 1S3CA 2FHEA 1ERVA 2GDRA 3TRPA 2PUKC 2OJLA 4KAEA 5H5SA 5COHA 3I69A 4OMVA 2GQLA 1TP9A 1W89A 4KGIA 5IOWA 4ACSA 1DUGA 1XW9A 3TGZA 5IO0A 4MH3A 4HU9A 1AW9A 4OCFA 5G30A 2RLIA 2JL4A 2B5YA 2H19A 1XWBA 4TKYA 1B8XA 4TN8A 1HNAA 1TJDA 3KCMA 1DE1A 4ILFA 1SU9A 5ENUA 2KUCA 3EC3A 4TXOB 4HU7A 1X5DA 4NWYA 4BVXA 1GUMA 1TTZA 3CTGA 4K0GA 1DBYA 1A8YA 2GZZA 4XRDA 3M3MA 3GKXA 3H1NA 1S3AA 4XTSA 2RM5A 4L5OA 1SJ6A 4AGSA 1GSEA 1K3LA 2DIZA 2JZRA 2N5AA 3VPQA 1EP7A 1J9BA 1XZOA 2R5GA 4MH2A 4MJCA 3TKRA 2AYTA 9GSSA 2VUPA 3L4NA 1KNGA 2H70A 2MMAA 1A2MA 2X8GA 1K0BA 2RIIA 5J41A 1QUWA 3TJKA 1HYUA 1XCCA 2L4CA 4G10A 3P2AA 3IC8A 6GSUA 4GF0A 2O89A 3IK7A 2E7PA 1EEMA 19GSA 1X0RA 3E9JB 2GVPA 1EWXA 1V57A 1KBNA 4OD7A 1CQGA 1SK1A 3C8EA 3FK8A 3QR6A 3GTUA 5KN1A 1TU8A 1N2AA 5CRWA 1ZYQB 2CA8A 3I9V2 4MPFA 5IMAA 5DAKB 4MZCA 3DVXA 1SL1B 5DVBA 2X49A 5GAND 3C7MA 3MDKA 5DCHA 3VK9A 1B9YC 5IMFA 3IV4A 4QL9A 4GXZA 3PINA 1SL0B 4N10A 1G7OA 1F6MC 1ZYPA 5DALB 3MSZA 5CRDA 4J57E 4X43A 3D22A 1GL8A 4DSQA 4O32A 1Y25A 3TKPA 4AJ6A 2C0FA 3HZ8A 3DXBA 2TRXA 1HQOA 2P31A 3GL3A 3I43A 2FWHA 5ECLB 4I97A 5C04A 1MEKA 2HFDA 5ECNB 2R0GA 1GNEA 5EY6A 1OC3A 3UAPA 2OKAA 5G5EA 4IN0A 4A5PA 5B8BA 1QQ2A 2L59A 3ZTLA 4CY8A 5IIZA 5J3RA 4WR5A 3Q18A 4BL7A 2L5OA 2H71A 2OBKA 1GTUA 1EGRA 1B9XC 5A5KA 3N5OA 1XFLA 2KHPA 3UL3A 3EU3A 3KTLA 1F2EA 2HSHA 3QMXA 4JEDA 2I9HA 2PVOC 3LYKA 1WP0A 3UIWA 4TR1A 4PUFC 4POKA 4IQAA 2HT9A 5HFKA 1O6JA 3P8WA 4I2TA 4MK3A 5CRHA 4OFMA 2YANA 5ECRB 2PVQA 4YQUA 2K9FA 2GLRA 2H75A 5CNWA 4E8EA 1KTEA 5ECKB 4K5RA 2MMOA 4LMVA 1OVNA 1CQHA 11GSA 5J9BA 2LJRA 4PURA 2FD3A 2V2GA 3APOA 2GZYA 2RUFA 5FT3A 1MDIA 1AC1A 3EMXA 1V58A 4XIHA 4DVCA 1Z7RA 2D2ZA 1MTCA 3RBTA 4K2XA 1PD21 3F63A 3F6FA 3LWAA 2JU5A 3ZLPA 3VURA 3GKKA 4EO3A 1PKZA 1XW6A 4ID0A 5D8IA 2C3TA 3LFLA 2ALBA 2DLXA 3EWLA 3EPTA 2VD1A 2CAIA 4CHSA 2IMKA 3H8QA 3AY8A 2AHEA 1N8JA 1ON4A 3BOAA 2AAWA 3EMPA 5JWRB 2IN3A 1OC9A 1RQMA 4USSA 2EIRA 4ECCA 1VF2A 3A3TA 4LMWA 1XBSA 4KSMA 4L5LA 4DEJA 2X8HA 5CREA 1T8EB 4QQ7A 1UA5A 1AQVA 1R26A 4F0CA 2LS5A 4K0NA 2VIMA 5AN1A 5ECMB 2VL3A 1AUCA 4ECBA 2VCZA 3ERWA 2VAFA 5AIXA 1MDJA 3FZAA 5KEJA 1XXUA 2WDUA 2XBQA 3D21A 1M2DA 4EKZA 3FZ4A 1K0OA 3CSIA 2GTUA 4MF7A 1V2AA 2F8AA 1GTBA 2GT5A 1GSFA 4MA9A 3L0HA 4POBA 5B6MA 4D73A 2F51A 4Q5RA 4HQSA 4GQFA 3G7IA 4EIPA 2CX4A 3KMOA 3ME8A 2DJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M2A A;  1JZO A;  5LCZ A;  4RUV A;  2HZE B;  2C0E A;  2KLX A;  2ZUP A;  3IRA A;  1A2L A;  2HRF A;  1XWG A;  2GS3 A;  1WRY A;  1Z3E A;  2QKE A;  2H1A A;  4X1U A;  17GS A;  2IIY A;  3WT1 A;  2VCQ A;  4EDY A;  3F0I A;  3KM6 A;  1EOH A;  3VFI A;  1U87 A;  5G1L A;  3ZFL A;  2C80 A;  3BD2 A;  1PMT A;  3LQ7 A;  2P0G A;  4XS4 A;  2FGX A;  3QD9 A;  3APS A;  3H4K A;  3Q19 A;  3M1G A;  3FEU A;  2G2Q A;  3ZFB A;  1BYE A;  2NDO A;  1VF1 A;  2C4J A;  1X9W B;  5D9X A;  1PL1 A;  3U5R E;  4NV5 A;  2B7K A;  2NVL A;  1GNW A;  2LQQ A;  1V9W A;  2JZT A;  2TRC P;  5CYY A;  1K0A A;  5A4V A;  1SL2 B;  1TK8 B;  2FLS A;  4WKW A;  5ELA A;  5DCG A;  3IK9 A;  4YAP A;  3FZ5 A;  1ILO A;  2IMF A;  2O8V B;  1USB A;  4I5Q A;  3ED3 A;  4WBR D;  2MBT A;  2DJ1 A;  4FO5 A;  1NSW A;  1K3O A;  3G9B A;  4IKH A;  2CVK A;  2EIQ A;  2M72 A;  3IXR A;  2CVD A;  2B1L A;  2IWT A;  5G1K A;  2EC4 A;  3FYG A;  5DBQ A;  2K8V A;  2JAD A;  3ZZX A;  3Q6O A;  2FY6 A;  2OAD A;  3UEM A;  1WE0 A;  4ML6 A;  1XVQ A;  3FW2 A;  2DC5 A;  4MF6 A;  4K7O A;  1E2Y A;  2CQ9 A;  4BWQ A;  2LST A;  2C0G A;  4JE1 A;  1SKW B;  1FOV A;  3FRC A;  1QK8 A;  3HXS A;  1WPI A;  4HDE A;  1LBK A;  1ZMA A;  2FCH A;  4KND A;  5HR1 A;  2YV7 A;  4G9H A;  2HE3 A;  1XOA A;  4MPG A;  1E6B A;  2GZP A;  1TRV A;  4KCE A;  3ZYW A;  5AIS A;  3HJM A;  1OAZ A;  2RUE A;  1OKD A;  2HNL A;  2H66 A;  3MNG A;  3C1S A;  3FHK A;  13GS A;  2IMD A;  3VWU A;  3TJB A;  1A2J A;  1U3I A;  4Z7X A;  2I1U A;  3M9J A;  2H0G A;  4WR4 A;  4NV2 A;  4G2E A;  2C1Y A;  2CT6 A;  1GTI A;  2NTO A;  3W6G A;  4V2L A;  2YOI A;  3QAV A;  1X9M B;  2LJA A;  2I81 A;  5H5Q A;  2MBS A;  2H6Y A;  4DSS B;  3GMF A;  2IL3 A;  1XVW A;  4POM A;  1W4V A;  3ERF A;  1K0N A;  4FH8 A;  2DJ3 A;  3HCZ A;  3RDW A;  3IR4 A;  3MAK A;  2H74 A;  1YDK A;  3TKS C;  1FHE A;  4JZQ A;  4K7I A;  5EL8 A;  1WJK A;  4FYB A;  4AJ7 A;  4CDO A;  3UOM A;  5ECI B;  3I6A A;  1BQ7 A;  2YWM A;  5E59 A;  2X99 A;  1SK2 A;  4KB3 A;  3BCK A;  2LEG A;  3GV1 A;  1SYX A;  3M9K A;  1IYH A;  1BAY A;  1ML6 A;  1PSQ A;  1NHO A;  5JCG A;  5HFI A;  3GA4 A;  1PX6 A;  4OCE A;  1YKA A;  1ACV A;  3D4T A;  2LJK A;  4ZL8 A;  2OE3 A;  5JWQ B;  1YY7 A;  2XPE A;  4N30 A;  2OBI A;  2B1K A;  4GTU A;  3ZL5 A;  1M2B A;  3GL5 A;  2R37 A;  2B3S A;  4MZW A;  4P3Y B;  2R4V A;  3HHV A;  1JZW A;  3HJP A;  5FWG A;  1TI3 A;  3VWV A;  2F9S A;  4L0W A;  5D96 A;  2CX3 A;  20GS A;  2XPD A;  4TXV A;  4MP4 A;  5D9V A;  5C00 A;  3GSS A;  3D6I A;  1PA3 A;  2PER A;  3LJR A;  2H73 A;  1T00 A;  1BG5 A;  3CRU A;  5IMC A;  6GSX A;  1TXX A;  1GLQ A;  2EIO A;  3HDC A;  3LXT A;  4FYC A;  2FUG 2;  3LGC A;  4IEL A;  3J7Y k;  5ID2 A;  1R5A A;  1MDK A;  2L57 A;  3DWV A;  3G7J A;  4YQM A;  3S9F A;  4NXI A;  4EDZ A;  1B4Q A;  4MDC A;  2VCX A;  3EYT A;  3N9J A;  3DD3 A;  4K9Z A;  1ZGN A;  2AV4 A;  2FWF A;  5HR2 A;  6GSY A;  1NW2 A;  1ZYE A;  4PX1 A;  5H5R A;  3GUR A;  5CO3 A;  3ZIV A;  3C73 A;  2KP1 A;  3D0Z A;  1I9D A;  2WJU A;  1KEB A;  6GSS A;  2QGV A;  4PXO A;  3KXO A;  4HOJ A;  4PQH A;  1TKD B;  1FB0 A;  1EP8 A;  2VL2 A;  1QMV A;  3GTU B;  2ZCT A;  5GAP D;  4N0Z A;  4FYU A;  1R5P A;  4IP1 A;  2O87 A;  3EE2 A;  2H0H A;  1Z6N A;  1K0M A;  4PNF A;  4QL7 A;  3KZQ A;  4ZL7 A;  2GST A;  4V1A g;  4ZBB A;  1AAZ A;  4KDU A;  3O3T A;  5JCU A;  2OE1 A;  1SYR A;  2PPT A;  5GZZ B;  2LQO A;  4V2M A;  3IPZ A;  5ECO B;  4O92 A;  1OC8 A;  1M7T A;  2R3X A;  3DKS A;  2CVB A;  2C3N A;  2H6Z A;  1UN2 A;  3IBH A;  1GUH A;  4NPB A;  3VI7 A;  2FA8 A;  4TVE A;  1OE7 A;  1DE2 A;  2F8F A;  2WZ9 A;  4O5R A;  3UBL A;  3HY2 A;  1LU4 A;  2DML A;  2HYX A;  1PRX A;  1J0F A;  5DQY A;  2YP6 A;  2DSA A;  2LTK A;  3GFK A;  3L9V A;  2B6M A;  1FO5 A;  5CAX A;  3DIE A;  3L9S A;  2DJJ A;  4BPY A;  3GX0 A;  2DJK A;  2H1G A;  1XWC A;  4RQX A;  2B5E A;  4V1A p;  5G2Z A;  2E2G A;  4NHW A;  1FVK A;  3CSH A;  2I4A A;  3FR6 A;  1A23 A;  3PGT A;  3TUE A;  1DSB A;  2I3Y A;  3NOF A;  4MMM A;  2LNS A;  2A2S A;  5ECQ B;  5GSS A;  1PX7 A;  2FA4 A;  4IS0 A;  4WF5 A;  4KUN A;  1Y6E A;  3KH9 A;  3GIX A;  1O7U A;  1YF1 A;  4TR3 A;  4WF4 A;  3WGX A;  5B8A A;  1WWJ A;  4OO4 A;  4JRR A;  5G5F A;  5AIV A;  4G19 A;  5HQP A;  5E4W A;  1M9B A;  3VWW A;  1C72 A;  1H4O A;  4GQC A;  4OFN A;  4IJI A;  1QFN A;  1XPV A;  2VO4 A;  1M9A A;  2WCI A;  1RW1 A;  3GST A;  3M8N A;  6GST A;  3W8S A;  4F2I A;  3QDN A;  1SJZ A;  3DYR A;  4WET A;  3WGE A;  1ERT A;  4K8M A;  4J2F A;  5D9T A;  2GQM A;  16GS A;  1G0T A;  4JR6 A;  3E0U A;  3R2Q A;  3EVI A;  2IFQ A;  2X8C A;  1FAA A;  3H93 A;  4MJA A;  3EIN A;  4MF5 A;  4ECI A;  2IME A;  3TRQ A;  3BBY A;  4K7N A;  3IAM 2;  1MD4 A;  1AXD A;  1EOG A;  1VGL A;  3GN3 A;  4KE3 A;  4EC0 A;  4GWR A;  3QPM A;  1Z6M A;  5KN3 A;  1X5E A;  2XC2 A;  18GS A;  5AGY A;  1A8L A;  3H79 A;  3M0F A;  2VLT A;  1OC9 B;  1ZOF A;  3ZVJ D;  3WD6 A;  5HFG A;  3CBU A;  3V1W A;  3U6V A;  1M99 A;  1THO A;  1G6Y A;  3HA9 A;  3TKS E;  3LG6 A;  2B5X A;  2GSQ A;  4K2D A;  2YN1 A;  3FY7 A;  5DDL A;  4F0B A;  4NHZ A;  2YZU A;  2GSS A;  3F4T A;  1BX9 A;  4OWY A;  2BMX A;  2MMN A;  1JFU A;  2YPM A;  4I2U A;  1V98 A;  1VF3 A;  1XIY A;  1YZX A;  3DEX A;  2NBS A;  3DML A;  4D73 B;  2O85 A;  3GRX A;  1T1V A;  5GST A;  4TR4 A;  4L8E A;  4MJE A;  4CW9 A;  2H0I A;  4KDX A;  1I5G A;  2YWN A;  1ZCP A;  5J9C A;  5IQY A;  7GSS A;  3SBC A;  1GSQ A;  3CYN A;  2LKU A;  1O8W A;  5IOX A;  3KGK A;  3FZ9 A;  2AUV A;  2HSY A;  3FKF A;  4GCI A;  1EGO A;  2VD0 A;  4IQ1 A;  4FIW A;  1R4W A;  1XWA A;  1T3B A;  2XBI A;  1SEN A;  2WGR A;  4HJ2 A;  1T7P B;  4LA1 A;  4XS4 B;  4ZB6 A;  1F37 A;  1FVJ A;  4J56 E;  1K3Y A;  3CTF A;  3VI5 A;  1EZK A;  14GS A;  5IMZ A;  2PN8 A;  4X0X A;  2IJY A;  1FB6 A;  3D5J A;  2NPB A;  4L0U A;  2PGT A;  2A4V A;  2VM2 A;  3WYW A;  3SWL A;  2B7J A;  2ES7 A;  2ZNM A;  4KX4 A;  3MWH A;  3IOS A;  3IHQ A;  4N0V A;  5F8B A;  4IJ3 A;  4ZB9 A;  1TU7 A;  4EXJ A;  2KP2 A;  3A5W A;  5D9W A;  4LLR A;  2GGT A;  1SD8 A;  4NMU A;  3GHA A;  3ISO A;  3HD5 A;  3F6D A;  5ECP B;  2L5L A;  3UAR A;  1QXH A;  1PKW A;  3TCO A;  2LRC A;  3F4S A;  3IDV A;  1ABA A;  1BJX A;  2ON5 A;  3TDG A;  3F4R A;  2HZF A;  4AJ8 A;  5CRG A;  3CMI A;  1JLW A;  2MZC A;  4TXO A;  4XS6 A;  2E2M A;  4RQR A;  3FR3 A;  2OE0 A;  2PU9 C;  3TJF A;  3WT2 A;  1WMJ A;  3KH7 A;  2FWG A;  2HXK A;  5F05 A;  4TW5 A;  2H72 A;  4V2N A;  4HZ2 A;  5ECS A;  1T4Y A;  1TW9 A;  3VPT A;  6GSW A;  4BWS A;  2HI7 A;  5JWO B;  2JAC A;  3LOR A;  2YJ7 A;  1GUL A;  2O7K A;  2P5R A;  3LSZ A;  3KMN A;  2WRT A;  4GST A;  3BJ5 A;  1TRU A;  4ZL9 A;  4PGT A;  3BCI A;  1ST9 A;  3US3 A;  2K8S A;  3TOT A;  3TJG A;  1S3D A;  1EEJ A;  2MMZ A;  1GLP A;  4K1F A;  3GKN A;  3RPP A;  1IYI A;  2YCD A;  1AIU A;  2X64 A;  1JHB A;  1U3A A;  1GH2 A;  4WBJ A;  1OE8 A;  5KN0 A;  3QFB C;  1GSD A;  2N5F A;  3UVH A;  3TOU A;  3ERG A;  4KCA A;  3F3Q A;  4ZXG A;  2H8L A;  2RM6 A;  4IVF A;  4EE0 A;  3HVS A;  1YQ1 A;  1GUK A;  1B4P A;  3HYP A;  5DJM A;  4ZIJ A;  1SKR B;  5DAK A;  3QAG A;  5HR0 A;  1Q4J A;  10GS A;  2H6X A;  3VWX A;  5DQS A;  2DJ2 A;  1TRW A;  4ISD A;  5J5N A;  4ZBD A;  2OAC A;  3ZRE A;  2G0F A;  2GSR A;  5DAL A;  5ELG A;  4WEY A;  1VF4 A;  1ERW A;  4GLT A;  3DRN A;  3HVX A;  4PQI A;  2BJX A;  6GSV A;  1YF0 A;  3KD0 A;  1YEX A;  12GS A;  4F9Z A;  4PUA A;  1JLV A;  4N11 A;  1PQN A;  1WOU A;  3CRT A;  2C0D A;  3A2X A;  1YJ6 A;  4Q5F A;  4XRA A;  1THX A;  2LRT A;  2VL9 A;  4LL1 B;  2KOK A;  3QOU A;  3LXZ A;  1X5C A;  3G7Y A;  1QGV A;  3E3E A;  1YKC A;  3GKM A;  3F8U A;  4YQV A;  5F07 A;  1EV9 A;  2J9H A;  3O76 A;  4HZ4 A;  4IHU A;  3UVT A;  4MJB A;  3HJO A;  2VCW A;  2MYG A;  2WFC A;  5HR3 A;  2YNX A;  1G6W A;  3HKR A;  2H1D A;  1SD9 A;  4HEA 2;  4DSR A;  4HS1 A;  5A4U A;  3NZN A;  2REM A;  1AQW A;  4Q5Q A;  4ML1 A;  2J23 A;  4ZB8 A;  1TRS A;  4HUA A;  2YV9 A;  2VCT A;  1UVZ A;  4XCS A;  2IPA A;  2M80 A;  2LNT A;  5IMD A;  4F82 A;  2E0Q A;  4F03 A;  3ZML A;  5ID2 B;  4H86 A;  4EF0 A;  2V41 A;  1X9S B;  4NAX A;  2VLU A;  4JR4 A;  3ME7 A;  1NHY A;  1O8X A;  1O85 A;  1A24 A;  3KEB A;  1F9M A;  5J4U A;  3IE3 A;  3EU4 A;  4WXT A;  4O7H A;  2H30 A;  2P5Q A;  4GRF A;  3RPN A;  4HJM A;  3UJ1 A;  4K6X A;  4PNG A;  3IA1 A;  3TRX A;  5ABR A;  2IMI A;  5EPF A;  3IC4 A;  3LEF A;  1HD2 A;  3A2V A;  1FW1 A;  3ZRD A;  4HQZ A;  4ZBA A;  1T4Z A;  3QAW A;  1NM3 A;  1HNB A;  4POL A;  2K18 A;  4XS1 A;  2WS2 A;  1TK0 B;  2AJQ B;  4RI6 A;  3RAZ A;  3ZIJ A;  2JZS A;  3TB2 A;  5F0G A;  3KIJ A;  4E8H A;  1GP1 A;  4IW9 A;  3KTB A;  1PL2 A;  4XHM A;  2V6O A;  2V6K A;  5B6N A;  3OR5 A;  3W8J A;  4EUY A;  2FNO A;  1GWC A;  4YAV A;  1JZD A;  4MCU A;  2WUL A;  2DBC A;  3NIV A;  2HLS A;  1GTA A;  2JSY A;  4IGJ A;  4MAB A;  2VM1 A;  4TR1 B;  3Q74 A;  3TKQ A;  2L4Q A;  3QCP A;  8GSS A;  3K8N A;  5G31 A;  2OA7 A;  5DJL A;  3P7X A;  4PQ1 A;  1K0C A;  4OFT A;  4TOP A;  4RI7 A;  1BED A;  3GNJ A;  2LUS A;  3ZIT A;  1O73 A;  3ZVJ A;  1PN9 A;  4EL1 A;  4KSO A;  3GUS A;  3UMA A;  1Z9H A;  2YWO A;  1ZZY A;  4LL4 B;  4IBP A;  4MLY A;  3CXG A;  5L71 A;  2N5B A;  3F3R A;  2AB6 A;  2HZE A;  3RHB A;  4TRX A;  3UBK A;  3LYP A;  2H76 A;  2DIY A;  3TKS A;  1URM A;  2CV4 A;  3L78 A;  2VLV A;  2PWJ A;  1MD3 A;  3KP8 A;  1EV4 A;  1A0R P;  5A4W A;  1TK5 B;  4IP6 A;  4OO5 A;  2Z9S A;  1H75 A;  1YEP A;  3KP9 A;  2C3Q A;  3VLN A;  1ZL9 A;  1Q98 A;  2ON7 A;  3F9U A;  3CSJ A;  22GS A;  1Z7P A;  5F06 A;  3PR8 A;  2F3M A;  1RK4 A;  4ECJ A;  3O6T A;  1ERU A;  2IFQ B;  2WB9 A;  2VOC A;  2L6C A;  5IPG A;  3HVV A;  4HI7 A;  1FG4 A;  2R6K A;  4KA0 A;  2GQK A;  1SK0 A;  3PH9 A;  4GSS A;  2K6V A;  5LD0 A;  1HNC A;  1F3B A;  1TI1 A;  2YWI A;  3P90 A;  1XW5 A;  5IPH A;  2L6D A;  5FHI A;  1VRS D;  1A0F A;  1GSS A;  2XHF A;  1OKT A;  3A2W A;  3C71 A;  1Z5Y E;  4JBB A;  3DGQ A;  2R2J A;  5IMV A;  4YH2 A;  1GSU A;  2QSI A;  3FR9 A;  1V40 A;  3TJJ A;  1G7E A;  3KJY A;  1AQX A;  2VL2 C;  2VCV A;  3GH6 A;  5ECH B;  3WGD A;  2TIR A;  3APQ A;  5D73 A;  4KDY A;  4BVY A;  1U6T A;  1LJR A;  2V1M A;  4ZIL A;  1SKS B;  1K0D A;  2YZH A;  2DMM A;  5INY A;  2LV3 A;  3D4M A;  4JU5 A;  4I8B A;  5B7C A;  1UC7 A;  3L9U A;  4EVM A;  1XOB A;  5IM9 A;  1GRX A;  2JSZ A;  3C1R A;  3IAS 2;  1PGT A;  2PMT A;  2H01 A;  3RHC A;  1TDI A;  1OYJ A;  4KH7 A;  1TOF A;  2QC7 A;  2GT6 A;  1WIK A;  5JCW A;  3HZ4 A;  1F3A A;  2YJH A;  4MZB A;  1SJI A;  2CZ2 A;  2PBJ A;  2H1B A;  2BTO T;  5CP1 A;  1O81 A;  4AF2 A;  2LRN A;  1R7H A;  5LNK e;  4ULX A;  1B48 A;  3QFA C;  4BA7 A;  4DSS A;  2C8U A;  3DVW A;  3JCM L;  4Q5N A;  1M0U A;  4KW6 A;  5KN2 A;  1GSY A;  4GSN A;  3GH9 A;  2M46 A;  2V32 A;  3EUR A;  3J7Y b;  2CZ3 A;  1XWK A;  5D93 A;  3GYK A;  5IO2 A;  2A2R A;  1J08 A;  5EVO A;  2HRN A;  3ZMK A;  1U88 A;  4TR0 A;  1JZR A;  3GX8 A;  2CAQ A;  2FWE A;  4I6X A;  1S3C A;  2FHE A;  1ERV A;  2GDR A;  3TRP A;  2PUK C;  2OJL A;  4KAE A;  5H5S A;  5COH A;  3I69 A;  4OMV A;  2GQL A;  1TP9 A;  1W89 A;  4KGI A;  5IOW A;  4ACS A;  1DUG A;  1XW9 A;  3TGZ A;  5IO0 A;  4MH3 A;  4HU9 A;  1AW9 A;  4OCF A;  5G30 A;  2RLI A;  2JL4 A;  2B5Y A;  2H19 A;  1XWB A;  4TKY A;  1B8X A;  4TN8 A;  1HNA A;  1TJD A;  3KCM A;  1DE1 A;  4ILF A;  1SU9 A;  5ENU A;  2KUC A;  3EC3 A;  4TXO B;  4HU7 A;  1X5D A;  4NWY A;  4BVX A;  1GUM A;  1TTZ A;  3CTG A;  4K0G A;  1DBY A;  1A8Y A;  2GZZ A;  4XRD A;  3M3M A;  3GKX A;  3H1N A;  1S3A A;  4XTS A;  2RM5 A;  4L5O A;  1SJ6 A;  4AGS A;  1GSE A;  1K3L A;  2DIZ A;  2JZR A;  2N5A A;  3VPQ A;  1EP7 A;  1J9B A;  1XZO A;  2R5G A;  4MH2 A;  4MJC A;  3TKR A;  2AYT A;  9GSS A;  2VUP A;  3L4N A;  1KNG A;  2H70 A;  2MMA A;  1A2M A;  2X8G A;  1K0B A;  2RII A;  5J41 A;  1QUW A;  3TJK A;  1HYU A;  1XCC A;  2L4C A;  4G10 A;  3P2A A;  6GSU A;  4GF0 A;  2O89 A;  3IK7 A;  2E7P A;  1EEM A;  19GS A;  1X0R A;  3E9J B;  2GVP A;  1EWX A;  1V57 A;  1KBN A;  4OD7 A;  1CQG A;  1SK1 A;  3C8E A;  3FK8 A;  3QR6 A;  3GTU A;  5KN1 A;  1TU8 A;  1N2A A;  5CRW A;  1ZYQ B;  2CA8 A;  3I9V 2;  4MPF A;  5IMA A;  5DAK B;  4MZC A;  3DVX A;  1SL1 B;  5DVB A;  5GAN D;  3C7M A;  3MDK A;  5DCH A;  3VK9 A;  1B9Y C;  5IMF A;  3IV4 A;  4QL9 A;  4GXZ A;  3PIN A;  1SL0 B;  4N10 A;  1G7O A;  1F6M C;  5DAL B;  3MSZ A;  5CRD A;  4J57 E;  4X43 A;  3D22 A;  1GL8 A;  4DSQ A;  4O32 A;  1Y25 A;  3TKP A;  4AJ6 A;  2C0F A;  3HZ8 A;  3DXB A;  2TRX A;  1HQO A;  2P31 A;  3GL3 A;  3I43 A;  2FWH A;  5ECL B;  4I97 A;  5C04 A;  1MEK A;  2HFD A;  5ECN B;  1GNE A;  5EY6 A;  1OC3 A;  3UAP A;  2OKA A;  5G5E A;  4IN0 A;  5B8B A;  1QQ2 A;  2L59 A;  3ZTL A;  5IIZ A;  5J3R A;  4WR5 A;  3Q18 A;  4BL7 A;  2L5O A;  2H71 A;  2OBK A;  1GTU A;  1EGR A;  1B9X C;  5A5K A;  3N5O A;  1XFL A;  2KHP A;  3UL3 A;  3EU3 A;  3KTL A;  1F2E A;  2HSH A;  3QMX A;  4JED A;  2I9H A;  2PVO C;  3LYK A;  1WP0 A;  3UIW A;  4TR1 A;  4PUF C;  4POK A;  4IQA A;  2HT9 A;  5HFK A;  1O6J A;  3P8W A;  4I2T A;  4MK3 A;  5CRH A;  4OFM A;  2YAN A;  5ECR B;  2PVQ A;  4YQU A;  2K9F A;  2GLR A;  2H75 A;  5CNW A;  4E8E A;  1KTE A;  5ECK B;  2MMO A;  4LMV A;  1OVN A;  1CQH A;  11GS A;  5J9B A;  2LJR A;  4PUR A;  2FD3 A;  2V2G A;  3APO A;  2GZY A;  2RUF A;  5FT3 A;  1MDI A;  1AC1 A;  3EMX A;  1V58 A;  4XIH A;  4DVC A;  1Z7R A;  2D2Z A;  1MTC A;  3RBT A;  1PD2 1;  3F63 A;  3F6F A;  3LWA A;  2JU5 A;  3ZLP A;  3VUR A;  3GKK A;  4EO3 A;  1PKZ A;  1XW6 A;  4ID0 A;  5D8I A;  2C3T A;  3LFL A;  2ALB A;  2DLX A;  3EWL A;  2VD1 A;  2CAI A;  4CHS A;  2IMK A;  3H8Q A;  3AY8 A;  2AHE A;  1N8J A;  1ON4 A;  3BOA A;  2AAW A;  3EMP A;  5JWR B;  2IN3 A;  1OC9 A;  1RQM A;  4ECC A;  2EIR A;  1VF2 A;  3A3T A;  4LMW A;  1XBS A;  4KSM A;  4L5L A;  4DEJ A;  2X8H A;  5CRE A;  1T8E B;  4QQ7 A;  1UA5 A;  1AQV A;  1R26 A;  4F0C A;  2LS5 A;  4K0N A;  2VIM A;  5AN1 A;  5ECM B;  2VL3 A;  1AUC A;  4ECB A;  2VCZ A;  3ERW A;  2VAF A;  5AIX A;  1MDJ A;  3FZA A;  5KEJ A;  1XXU A;  2WDU A;  2XBQ A;  3D21 A;  1M2D A;  4EKZ A;  3FZ4 A;  1K0O A;  3CSI A;  2GTU A;  4MF7 A;  1V2A A;  2F8A A;  1GTB A;  2GT5 A;  1GSF A;  4MA9 A;  3L0H A;  4POB A;  5B6M A;  4D73 A;  2F51 A;  4Q5R A;  4HQS A;  4GQF A;  3G7I A;  2CX4 A;  3KMO A;  3ME8 A;  2DJ0 A; 
#chains in the Genus database with same CATH topology
 1M2A A;  1JZO A;  5LCZ A;  4RUV A;  2HZE B;  2C0E A;  2KLX A;  2ZUP A;  3IRA A;  1A2L A;  4Z2T A;  2HRF A;  1XWG A;  2GS3 A;  1WRY A;  1Z3E A;  2QKE A;  2H1A A;  4X1U A;  17GS A;  2IIY A;  5KOX A;  1ZYN A;  3WT1 A;  2VCQ A;  4EDY A;  3F0I A;  3KM6 A;  4K5S A;  1EOH A;  3VFI A;  1U87 A;  5G1L A;  3ZFL A;  2C80 A;  2HRK A;  3BD2 A;  3R3E A;  1PMT A;  3LQ7 A;  5KOW A;  2P0G A;  4XS4 A;  2FGX A;  3QD9 A;  3APS A;  3H4K A;  3Q19 A;  3M1G A;  3FEU A;  2G2Q A;  3ZFB A;  1BYE A;  2NDO A;  1VF1 A;  2C4J A;  1X9W B;  5D9X A;  1PL1 A;  3U5R E;  4NV5 A;  2B7K A;  2NVL A;  1GNW A;  2LQQ A;  1V9W A;  2JZT A;  2TRC P;  2QA1 A;  5CYY A;  1K0A A;  5A4V A;  1SL2 B;  1TK8 B;  2FLS A;  4WKW A;  5ELA A;  5DCG A;  3IK9 A;  4YAP A;  3FZ5 A;  1ILO A;  4Z2R A;  2IMF A;  2O8V B;  1USB A;  4I5Q A;  3ED3 A;  4WBR D;  2MBT A;  2DJ1 A;  4FO5 A;  1NSW A;  1K3O A;  3G9B A;  4IKH A;  2A2P A;  2CVK A;  2EIQ A;  2M72 A;  3IXR A;  2CVD A;  2B1L A;  3MYD A;  2IWT A;  5G1K A;  2EC4 A;  3FYG A;  5DBQ A;  2K8V A;  2JAD A;  3ZZX A;  3Q6O A;  2FY6 A;  2OAD A;  3UEM A;  1WE0 A;  4ML6 A;  3LW9 A;  1XVQ A;  3FW2 A;  2DC5 A;  4MF6 A;  4K7O A;  4BVY B;  1E2Y A;  2CQ9 A;  4BWQ A;  2LST A;  2C0G A;  4JE1 A;  1SKW B;  1FOV A;  3FRC A;  1QK8 A;  3HXS A;  1WPI A;  4HDE A;  1LBK A;  1ZMA A;  2FCH A;  4KND A;  5HR1 A;  2YV7 A;  4G9H A;  2HE3 A;  1XOA A;  4MPG A;  1E6B A;  2GZP A;  1TRV A;  4KCE A;  3ZYW A;  5AIS A;  3HJM A;  1OAZ A;  2RUE A;  1OKD A;  2HNL A;  2H66 A;  3MNG A;  3C1S A;  3FHK A;  13GS A;  2IMD A;  3VWU A;  3TJB A;  1A2J A;  1U3I A;  4Z7X A;  2I1U A;  3M9J A;  2H0G A;  4WR4 A;  4NV2 A;  4G2E A;  2C1Y A;  2CT6 A;  1GTI A;  2NTO A;  3W6G A;  4V2L A;  2YOI A;  3QAV A;  1X9M B;  2LJA A;  2I81 A;  5H5Q A;  2MBS A;  2H6Y A;  4DSS B;  3GMF A;  4EIQ A;  2IL3 A;  1XVW A;  4POM A;  1W4V A;  3ERF A;  1K0N A;  4FH8 A;  2DJ3 A;  3HCZ A;  3MIX A;  3RDW A;  3IR4 A;  3MAK A;  2H74 A;  1YDK A;  3TKS C;  1FHE A;  4JZQ A;  4K7I A;  5EL8 A;  1WJK A;  4FYB A;  4AJ7 A;  4CDO A;  3UOM A;  5ECI B;  3I6A A;  1BQ7 A;  2YWM A;  5E59 A;  2X99 A;  1SK2 A;  4KB3 A;  3BCK A;  2LEG A;  3GV1 A;  1SYX A;  3M9K A;  1IYH A;  1BAY A;  1ML6 A;  1PSQ A;  1NHO A;  5JCG A;  5HFI A;  3GA4 A;  1PX6 A;  4OCE A;  1YKA A;  1ACV A;  3D4T A;  2LJK A;  4ZL8 A;  2OE3 A;  5JWQ B;  1YY7 A;  2XPE A;  4N30 A;  2OBI A;  2B1K A;  4GTU A;  3ZL5 A;  1M2B A;  3GL5 A;  2R37 A;  2B3S A;  4MZW A;  2X4A A;  4P3Y B;  2R4V A;  4KF9 A;  3HHV A;  1JZW A;  3HJP A;  5FWG A;  1TI3 A;  3VWV A;  2F9S A;  4BIK A;  4L0W A;  5D96 A;  1M3I A;  2CX3 A;  20GS A;  2XPD A;  4TXV A;  4MP4 A;  5D9V A;  5C00 A;  4BVX B;  3GSS A;  3D6I A;  1PA3 A;  2PER A;  3LJR A;  3FMW A;  2H73 A;  1T00 A;  1BG5 A;  3CRU A;  5IMC A;  6GSX A;  1TXX A;  1GLQ A;  2EIO A;  3HDC A;  3LXT A;  4FYC A;  2DKI A;  2FUG 2;  3LGC A;  4IEL A;  3J7Y k;  5ID2 A;  1R5A A;  1MDK A;  2L57 A;  3DWV A;  3G7J A;  4YQM A;  3S9F A;  4NXI A;  4EDZ A;  1B4Q A;  4MDC A;  2VCX A;  3EYT A;  3N9J A;  3DD3 A;  4K9Z A;  1ZGN A;  2AV4 A;  4G0I A;  2FWF A;  5HR2 A;  6GSY A;  1NW2 A;  1ZYE A;  4PX1 A;  5H5R A;  3GUR A;  2A4H A;  5CO3 A;  3ZIV A;  3C73 A;  2KP1 A;  3D0Z A;  1I9D A;  2WJU A;  1KEB A;  6GSS A;  2QGV A;  4PXO A;  3KXO A;  4HOJ A;  4PQH A;  1TKD B;  1FB0 A;  1EP8 A;  2VL2 A;  1QMV A;  3GTU B;  2ZCT A;  5GAP D;  4N0Z A;  4FYU A;  1R5P A;  4IP1 A;  2O87 A;  3EE2 A;  2H0H A;  1Z6N A;  1K0M A;  4PNF A;  4QL7 A;  3KZQ A;  4ZL7 A;  2GST A;  4V1A g;  3A5I A;  4ZBB A;  1AAZ A;  4KDU A;  3O3T A;  5JCU A;  2OE1 A;  1SYR A;  2PPT A;  5GZZ B;  2LQO A;  4V2M A;  3IPZ A;  5ECO B;  4O92 A;  1OC8 A;  1M7T A;  2R3X A;  3DKS A;  2CVB A;  2C3N A;  2H6Z A;  1UN2 A;  3IBH A;  1GUH A;  4NPB A;  1XG8 A;  3VI7 A;  2FA8 A;  4TVE A;  1OE7 A;  1DE2 A;  2F8F A;  2WZ9 A;  4O5R A;  3UBL A;  3HY2 A;  1PN0 A;  1LU4 A;  2DML A;  2HYX A;  1PRX A;  1J0F A;  5DQY A;  2YP6 A;  2DSA A;  2LTK A;  3GFK A;  3L9V A;  2B6M A;  1FO5 A;  5CAX A;  3DIE A;  3L9S A;  2DJJ A;  4BPY A;  3GX0 A;  2DJK A;  2H1G A;  1XWC A;  4RQX A;  2B5E A;  4V1A p;  5G2Z A;  2E2G A;  4NHW A;  4BL7 B;  1FVK A;  3CSH A;  2I4A A;  3FR6 A;  1A23 A;  3PGT A;  3TUE A;  1DSB A;  2I3Y A;  3NOF A;  4MMM A;  2LNS A;  2A2S A;  5ECQ B;  5GSS A;  1PX7 A;  2FA4 A;  4IS0 A;  4WF5 A;  4KUN A;  1Y6E A;  3KH9 A;  3PPU A;  3GIX A;  1O7U A;  1YF1 A;  4TR3 A;  4WF4 A;  3WGX A;  5B8A A;  1WWJ A;  4OO4 A;  4JRR A;  5G5F A;  5AIV A;  4G19 A;  5HQP A;  5E4W A;  1M9B A;  3VWW A;  1C72 A;  1H4O A;  4GQC A;  4OFN A;  2R0C A;  4IJI A;  1QFN A;  1XPV A;  2VO4 A;  1M9A A;  2WCI A;  1RW1 A;  3GST A;  3M8N A;  4HSC X;  6GST A;  3W8S A;  4F2I A;  3QDN A;  1SJZ A;  3DYR A;  4WET A;  3WGE A;  1ERT A;  4K8M A;  4J2F A;  5D9T A;  2GQM A;  16GS A;  1G0T A;  4JR6 A;  3E0U A;  3R2Q A;  3EVI A;  2IFQ A;  2X8C A;  1FAA A;  3H93 A;  4MJA A;  3EIN A;  4MF5 A;  4ECI A;  2IME A;  3TRQ A;  3BBY A;  1S3R A;  4MNN A;  4K7N A;  3IAM 2;  1MD4 A;  1AXD A;  1EOG A;  1VGL A;  3GN3 A;  4KE3 A;  4EC0 A;  4GWR A;  3QPM A;  1Z6M A;  5KN3 A;  1X5E A;  2XC2 A;  3IHG A;  18GS A;  5AGY A;  1A8L A;  3H79 A;  3M0F A;  4G0L A;  2VLT A;  4CY6 A;  1OC9 B;  1ZOF A;  3ZVJ D;  3WD6 A;  5HFG A;  2DKH A;  3CBU A;  3V1W A;  3U6V A;  1M99 A;  1THO A;  1G6Y A;  3HA9 A;  3TKS E;  3LG6 A;  2B5X A;  2GSQ A;  4K2D A;  2YN1 A;  3FY7 A;  5DDL A;  4O5Q A;  4NHZ A;  2YZU A;  4F0B A;  2GSS A;  3F4T A;  1BX9 A;  4OWY A;  2BMX A;  2MMN A;  1JFU A;  2YPM A;  4I2U A;  1V98 A;  1VF3 A;  1XIY A;  1YZX A;  3DEX A;  2NBS A;  2HRA A;  3DML A;  4D73 B;  2O85 A;  3GRX A;  1T1V A;  5GST A;  4TR4 A;  4L8E A;  4MJE A;  4CW9 A;  2H0I A;  4KDX A;  1I5G A;  2YWN A;  1ZCP A;  4YKF A;  5J9C A;  5IQY A;  7GSS A;  3SBC A;  1GSQ A;  1FOH A;  3CYN A;  2LKU A;  1O8W A;  5IOX A;  3KGK A;  3FZ9 A;  2AUV A;  2HSY A;  3FKF A;  4GCI A;  1EGO A;  2VD0 A;  4IQ1 A;  4FIW A;  1R4W A;  1XWA A;  1T3B A;  2XBI A;  1SEN A;  2WGR A;  4HJ2 A;  1T7P B;  4LA1 A;  4XS4 B;  4ZB6 A;  1F37 A;  1FVJ A;  4J56 E;  1K3Y A;  3CTF A;  3VI5 A;  1EZK A;  14GS A;  5IMZ A;  2PN8 A;  4X0X A;  2IJY A;  1FB6 A;  3D5J A;  2NPB A;  4L0U A;  2PGT A;  2A4V A;  2VM2 A;  3WYW A;  3SWL A;  2B7J A;  2ES7 A;  2ZNM A;  4KX4 A;  3MWH A;  3IOS A;  3IHQ A;  4N0V A;  5F8B A;  4IJ3 A;  4ZB9 A;  1TU7 A;  4EXJ A;  2KP2 A;  3A5W A;  5D9W A;  4LLR A;  2GGT A;  1SD8 A;  4NMU A;  3GHA A;  3ISO A;  3HD5 A;  3F6D A;  5ECP B;  2L5L A;  3UAR A;  1QXH A;  1PKW A;  3TCO A;  2LRC A;  3F4S A;  4O5U A;  3IDV A;  1ABA A;  1BJX A;  2ON5 A;  3TDG A;  2QA2 A;  3F4R A;  2HZF A;  4AJ8 A;  5CRG A;  3CMI A;  1JLW A;  2MZC A;  4TXO A;  4XS6 A;  2E2M A;  4RQR A;  3FR3 A;  2OE0 A;  2PU9 C;  3TJF A;  3WT2 A;  1WMJ A;  3KH7 A;  2FWG A;  2HXK A;  5F05 A;  4TW5 A;  2H72 A;  4V2N A;  4HZ2 A;  5ECS A;  1T4Y A;  1TW9 A;  3VPT A;  6GSW A;  4BWS A;  2HI7 A;  5JWO B;  2JAC A;  3LOR A;  2YJ7 A;  1GUL A;  2O7K A;  2P5R A;  3LSZ A;  3KMN A;  2WRT A;  4GST A;  3BJ5 A;  1TRU A;  4ZL9 A;  4PGT A;  3BCI A;  1ST9 A;  3US3 A;  2K8S A;  3TOT A;  3TJG A;  1S3D A;  1EEJ A;  2MMZ A;  1GLP A;  4K1F A;  3GKN A;  3RPP A;  1IYI A;  2YCD A;  1AIU A;  2X64 A;  1JHB A;  4FQU A;  1U3A A;  1GH2 A;  4WBJ A;  1OE8 A;  5KN0 A;  3QFB C;  1GSD A;  2N5F A;  3UVH A;  3TOU A;  3ERG A;  4KCA A;  3F3Q A;  4ZXG A;  2H8L A;  2RM6 A;  4IVF A;  4EE0 A;  3HVS A;  1YQ1 A;  1GUK A;  1B4P A;  3HYP A;  5DJM A;  4ZIJ A;  1SKR B;  5DAK A;  3QAG A;  5HR0 A;  1Q4J A;  10GS A;  2H6X A;  3VWX A;  5DQS A;  2DJ2 A;  1TRW A;  4ISD A;  5J5N A;  4ZBD A;  2OAC A;  3ZRE A;  2G0F A;  2GSR A;  5DAL A;  5ELG A;  4WEY A;  1VF4 A;  1ERW A;  4G0K A;  4GLT A;  3DRN A;  3HVX A;  4PQI A;  2BJX A;  6GSV A;  4ICY A;  1YF0 A;  3KD0 A;  1YEX A;  12GS A;  4F9Z A;  4PUA A;  1JLV A;  4N11 A;  1PQN A;  1WOU A;  3CRT A;  2C0D A;  3A2X A;  1YJ6 A;  4Q5F A;  4XRA A;  1THX A;  2LRT A;  2VL9 A;  4LL1 B;  2KOK A;  3QOU A;  3LXZ A;  1X5C A;  3G7Y A;  1QGV A;  3E3E A;  1YKC A;  3GKM A;  3F8U A;  4YQV A;  5F07 A;  1EV9 A;  2J9H A;  3O76 A;  4HZ4 A;  4IHU A;  3UVT A;  4MJB A;  3HJO A;  2VCW A;  2MYG A;  2WFC A;  5HR3 A;  2YNX A;  1G6W A;  3HKR A;  2H1D A;  1SD9 A;  4HEA 2;  4DSR A;  4HS1 A;  5A4U A;  5BMU A;  3NZN A;  2REM A;  1AQW A;  4Q5Q A;  4ML1 A;  2J23 A;  2R0P A;  4ZB8 A;  1TRS A;  4HUA A;  2YV9 A;  2VCT A;  5BRT A;  1UVZ A;  4XCS A;  2IPA A;  2M80 A;  2LNT A;  5IMD A;  4F82 A;  2E0Q A;  4F03 A;  3ZML A;  5ID2 B;  4H86 A;  4EF0 A;  2V41 A;  1X9S B;  4NAX A;  2VLU A;  4JR4 A;  3ME7 A;  1NHY A;  1O8X A;  1O85 A;  1A24 A;  3KEB A;  1F9M A;  5J4U A;  3IE3 A;  3EU4 A;  4WXT A;  4O7H A;  2H30 A;  2P5Q A;  4GRF A;  3RPN A;  4HJM A;  3UJ1 A;  4K6X A;  4PNG A;  3HVN A;  3IA1 A;  3TRX A;  5ABR A;  2IMI A;  2UZ8 A;  5EPF A;  3IC4 A;  3LEF A;  1HD2 A;  3A2V A;  1FW1 A;  3ZRD A;  4HQZ A;  4ZBA A;  1T4Z A;  3QAW A;  1NM3 A;  1HNB A;  4POL A;  2K18 A;  4XS1 A;  2WS2 A;  1TK0 B;  2AJQ B;  4RI6 A;  3RAZ A;  3ZIJ A;  2JZS A;  3TB2 A;  5F0G A;  3KIJ A;  4E8H A;  1GP1 A;  4IW9 A;  3KTB A;  1PL2 A;  4XHM A;  2V6O A;  2V6K A;  5B6N A;  3OR5 A;  3W8J A;  4EUY A;  2FNO A;  1GWC A;  4YAV A;  1JZD A;  4MCU A;  2WUL A;  2DBC A;  3NIV A;  2HLS A;  1GTA A;  2JSY A;  4IGJ A;  4MAB A;  2VM1 A;  4TR1 B;  3Q74 A;  3TKQ A;  2L4Q A;  3QCP A;  8GSS A;  3K8N A;  5G31 A;  2OA7 A;  5DJL A;  3P7X A;  4PQ1 A;  1K0C A;  4OFT A;  4TOP A;  4RI7 A;  1BED A;  3GNJ A;  2LUS A;  3ZIT A;  1O73 A;  3ZVJ A;  1PN9 A;  4EL1 A;  4KSO A;  3GUS A;  3UMA A;  1Z9H A;  2YWO A;  1ZZY A;  4LL4 B;  4IBP A;  4MLY A;  3CXG A;  5L71 A;  2N5B A;  3F3R A;  2AB6 A;  2HZE A;  4X4J A;  3RHB A;  4TRX A;  3UBK A;  3LYP A;  2H76 A;  2DIY A;  3TKS A;  1URM A;  2CV4 A;  3L78 A;  2VLV A;  4YKG A;  2PWJ A;  1MD3 A;  3KP8 A;  1EV4 A;  1A0R P;  5A4W A;  1TK5 B;  4IP6 A;  4OO5 A;  2Z9S A;  1H75 A;  1YEP A;  3KP9 A;  2C3Q A;  3VLN A;  1ZL9 A;  1Q98 A;  2ON7 A;  3F9U A;  3CSJ A;  22GS A;  1Z7P A;  5F06 A;  3PR8 A;  2F3M A;  1RK4 A;  4ECJ A;  3O6T A;  1ERU A;  2IFQ B;  2WB9 A;  2VOC A;  2L6C A;  5IPG A;  3HVV A;  4HI7 A;  1FG4 A;  2R6K A;  4KA0 A;  2GQK A;  1SK0 A;  3PH9 A;  4GSS A;  2K6V A;  5LD0 A;  1HNC A;  1F3B A;  1TI1 A;  2YWI A;  3P90 A;  1XW5 A;  5IPH A;  2L6D A;  5FHI A;  1VRS D;  1A0F A;  1GSS A;  2XHF A;  1OKT A;  3A2W A;  3C71 A;  1Z5Y E;  4JBB A;  3DGQ A;  4PTS A;  2R2J A;  5IMV A;  4YH2 A;  1GSU A;  2QSI A;  3FR9 A;  1V40 A;  3TJJ A;  1G7E A;  3KJY A;  1AQX A;  2VL2 C;  2VCV A;  3GH6 A;  5ECH B;  3WGD A;  2TIR A;  3APQ A;  5D73 A;  4KDY A;  4BVY A;  1U6T A;  1LJR A;  2V1M A;  4ZIL A;  4Z2U A;  1SKS B;  1K0D A;  2YZH A;  2DMM A;  5INY A;  2LV3 A;  3D4M A;  4JU5 A;  4I8B A;  5B7C A;  1UC7 A;  2HSM A;  3L9U A;  4EVM A;  1XOB A;  5IM9 A;  1GRX A;  2JSZ A;  3C1R A;  3IAS 2;  1PGT A;  2PMT A;  2H01 A;  3RHC A;  1TDI A;  1OYJ A;  4KH7 A;  1TOF A;  2QC7 A;  2GT6 A;  1WIK A;  5JCW A;  3HZ4 A;  1F3A A;  2YJH A;  4MZB A;  1SJI A;  2CZ2 A;  2PBJ A;  2H1B A;  2BTO T;  5CP1 A;  1O81 A;  4AF2 A;  2LRN A;  1R7H A;  5LNK e;  4ULX A;  1B48 A;  3QFA C;  4BA7 A;  4DSS A;  2C8U A;  3DVW A;  3JCM L;  4Q5N A;  1M0U A;  4KW6 A;  5KN2 A;  1GSY A;  4GSN A;  3GH9 A;  2M46 A;  2V32 A;  3EUR A;  3J7Y b;  2CZ3 A;  1XWK A;  5D93 A;  3GYK A;  5IO2 A;  2A2R A;  1J08 A;  5EVO A;  2HRN A;  3ZMK A;  1U88 A;  4TR0 A;  1JZR A;  3GX8 A;  2CAQ A;  2FWE A;  4I6X A;  1S3C A;  2FHE A;  1ERV A;  2GDR A;  3TRP A;  2PUK C;  2OJL A;  4KAE A;  5H5S A;  5COH A;  3I69 A;  4OMV A;  2GQL A;  1TP9 A;  1W89 A;  4KGI A;  5IOW A;  4ACS A;  1DUG A;  1XW9 A;  3TGZ A;  5IO0 A;  4MH3 A;  4HU9 A;  1AW9 A;  4OCF A;  5G30 A;  2RLI A;  2JL4 A;  2B5Y A;  2H19 A;  1XWB A;  4TKY A;  1B8X A;  4TN8 A;  1HNA A;  1TJD A;  3KCM A;  1DE1 A;  4ILF A;  1SU9 A;  5ENU A;  2KUC A;  3EC3 A;  4TXO B;  4HU7 A;  1X5D A;  4NWY A;  4BVX A;  1GUM A;  1TTZ A;  3CTG A;  4K0G A;  1DBY A;  1A8Y A;  2GZZ A;  4XRD A;  3M3M A;  3GKX A;  3H1N A;  1S3A A;  4XTS A;  2RM5 A;  4L5O A;  1SJ6 A;  4AGS A;  1GSE A;  1K3L A;  2DIZ A;  2JZR A;  2N5A A;  3VPQ A;  1EP7 A;  1J9B A;  1XZO A;  2R5G A;  4MH2 A;  4MJC A;  3TKR A;  2AYT A;  9GSS A;  2VUP A;  3L4N A;  1KNG A;  1PFO A;  2H70 A;  2MMA A;  1A2M A;  2X8G A;  1K0B A;  2RII A;  5J41 A;  1QUW A;  3TJK A;  1HYU A;  1XCC A;  2L4C A;  4G10 A;  3P2A A;  3IC8 A;  6GSU A;  4GF0 A;  2O89 A;  3IK7 A;  2E7P A;  1EEM A;  19GS A;  1X0R A;  3E9J B;  2GVP A;  1EWX A;  1V57 A;  1KBN A;  4OD7 A;  1CQG A;  1SK1 A;  3C8E A;  3FK8 A;  3QR6 A;  3GTU A;  5KN1 A;  1TU8 A;  1N2A A;  5CRW A;  1ZYQ B;  2CA8 A;  3I9V 2;  4MPF A;  5IMA A;  5DAK B;  4MZC A;  3DVX A;  1SL1 B;  5DVB A;  2X49 A;  5GAN D;  3C7M A;  3MDK A;  5DCH A;  3VK9 A;  1B9Y C;  5IMF A;  3IV4 A;  4QL9 A;  4GXZ A;  3PIN A;  1SL0 B;  4N10 A;  1G7O A;  1F6M C;  1ZYP A;  5DAL B;  3MSZ A;  5CRD A;  4J57 E;  4X43 A;  3D22 A;  1GL8 A;  4DSQ A;  4O32 A;  1Y25 A;  3TKP A;  4AJ6 A;  2C0F A;  3HZ8 A;  3DXB A;  2TRX A;  1HQO A;  2P31 A;  3GL3 A;  3I43 A;  2FWH A;  5ECL B;  4I97 A;  5C04 A;  1MEK A;  2HFD A;  5ECN B;  2R0G A;  1GNE A;  5EY6 A;  1OC3 A;  3UAP A;  2OKA A;  5G5E A;  4IN0 A;  4A5P A;  5B8B A;  1QQ2 A;  2L59 A;  3ZTL A;  4CY8 A;  5IIZ A;  5J3R A;  4WR5 A;  3Q18 A;  4BL7 A;  2L5O A;  2H71 A;  2OBK A;  1GTU A;  1EGR A;  1B9X C;  5A5K A;  3N5O A;  1XFL A;  2KHP A;  3UL3 A;  3EU3 A;  3KTL A;  1F2E A;  2HSH A;  3QMX A;  4JED A;  2I9H A;  2PVO C;  3LYK A;  1WP0 A;  3UIW A;  4TR1 A;  4PUF C;  4POK A;  4IQA A;  2HT9 A;  5HFK A;  1O6J A;  3P8W A;  4I2T A;  4MK3 A;  5CRH A;  1M3J A;  4OFM A;  2YAN A;  5ECR B;  2PVQ A;  4YQU A;  2K9F A;  2GLR A;  2H75 A;  5CNW A;  4E8E A;  1KTE A;  5ECK B;  4K5R A;  2MMO A;  4LMV A;  1OVN A;  1CQH A;  11GS A;  5J9B A;  2LJR A;  4PUR A;  2FD3 A;  2V2G A;  3APO A;  2GZY A;  2RUF A;  5FT3 A;  1MDI A;  1AC1 A;  3EMX A;  1V58 A;  4XIH A;  4DVC A;  1Z7R A;  2D2Z A;  1MTC A;  3RBT A;  4K2X A;  1PD2 1;  3F63 A;  3F6F A;  3LWA A;  2JU5 A;  3ZLP A;  3VUR A;  3GKK A;  4EO3 A;  1PKZ A;  1XW6 A;  4ID0 A;  5D8I A;  2C3T A;  3LFL A;  2ALB A;  2DLX A;  3EWL A;  3EPT A;  2VD1 A;  2CAI A;  3CQF A;  4CHS A;  2IMK A;  3H8Q A;  3AY8 A;  2AHE A;  1N8J A;  1ON4 A;  3BOA A;  2AAW A;  3EMP A;  5JWR B;  2IN3 A;  1OC9 A;  1RQM A;  4USS A;  2EIR A;  4ECC A;  1VF2 A;  3A3T A;  4LMW A;  1XBS A;  4KSM A;  4L5L A;  4DEJ A;  2X8H A;  5CRE A;  1T8E B;  4QQ7 A;  1UA5 A;  1AQV A;  1R26 A;  4F0C A;  2LS5 A;  4K0N A;  2VIM A;  5AN1 A;  5ECM B;  2VL3 A;  1AUC A;  4ECB A;  2VCZ A;  3ERW A;  2VAF A;  5AIX A;  1MDJ A;  3FZA A;  5KEJ A;  1XXU A;  2WDU A;  2XBQ A;  3D21 A;  1M2D A;  4EKZ A;  3FZ4 A;  1K0O A;  3CSI A;  2GTU A;  4MF7 A;  1V2A A;  2F8A A;  1GTB A;  2GT5 A;  1GSF A;  4MA9 A;  3L0H A;  4POB A;  5B6M A;  4D73 A;  2F51 A;  4Q5R A;  4HQS A;  4GQF A;  3G7I A;  4EIP A;  2CX4 A;  3KMO A;  3ME8 A;  2DJ0 A; 
#chains in the Genus database with same CATH homology
 1M2A A;  1JZO A;  5LCZ A;  4RUV A;  2HZE B;  2C0E A;  2KLX A;  2ZUP A;  3IRA A;  1A2L A;  4Z2T A;  2HRF A;  1XWG A;  2GS3 A;  1WRY A;  1Z3E A;  2QKE A;  2H1A A;  4X1U A;  17GS A;  2IIY A;  5KOX A;  1ZYN A;  3WT1 A;  2VCQ A;  4EDY A;  3F0I A;  3KM6 A;  4K5S A;  1EOH A;  3VFI A;  1U87 A;  5G1L A;  3ZFL A;  2C80 A;  2HRK A;  3BD2 A;  3R3E A;  1PMT A;  3LQ7 A;  5KOW A;  2P0G A;  4XS4 A;  2FGX A;  3QD9 A;  3APS A;  3H4K A;  3Q19 A;  3M1G A;  3FEU A;  2G2Q A;  3ZFB A;  1BYE A;  2NDO A;  1VF1 A;  2C4J A;  1X9W B;  5D9X A;  1PL1 A;  3U5R E;  4NV5 A;  2B7K A;  2NVL A;  1GNW A;  2LQQ A;  1V9W A;  2JZT A;  2TRC P;  2QA1 A;  5CYY A;  1K0A A;  5A4V A;  1SL2 B;  1TK8 B;  2FLS A;  4WKW A;  5ELA A;  5DCG A;  3IK9 A;  4YAP A;  3FZ5 A;  1ILO A;  4Z2R A;  2IMF A;  2O8V B;  1USB A;  4I5Q A;  3ED3 A;  4WBR D;  2MBT A;  2DJ1 A;  4FO5 A;  1NSW A;  1K3O A;  3G9B A;  4IKH A;  2A2P A;  2CVK A;  2EIQ A;  2M72 A;  3IXR A;  2CVD A;  2B1L A;  3MYD A;  2IWT A;  5G1K A;  2EC4 A;  3FYG A;  5DBQ A;  2K8V A;  2JAD A;  3ZZX A;  3Q6O A;  2FY6 A;  2OAD A;  3UEM A;  1WE0 A;  4ML6 A;  3LW9 A;  1XVQ A;  3FW2 A;  2DC5 A;  4MF6 A;  4K7O A;  4BVY B;  1E2Y A;  2CQ9 A;  4BWQ A;  2LST A;  2C0G A;  4JE1 A;  1SKW B;  1FOV A;  3FRC A;  1QK8 A;  3HXS A;  1WPI A;  4HDE A;  1LBK A;  1ZMA A;  2FCH A;  4KND A;  5HR1 A;  2YV7 A;  4G9H A;  2HE3 A;  1XOA A;  4MPG A;  1E6B A;  2GZP A;  1TRV A;  4KCE A;  3ZYW A;  5AIS A;  3HJM A;  1OAZ A;  2RUE A;  1OKD A;  2HNL A;  2H66 A;  3MNG A;  3C1S A;  3FHK A;  13GS A;  2IMD A;  3VWU A;  3TJB A;  1A2J A;  1U3I A;  4Z7X A;  2I1U A;  3M9J A;  2H0G A;  4WR4 A;  4NV2 A;  4G2E A;  2C1Y A;  2CT6 A;  1GTI A;  2NTO A;  3W6G A;  4V2L A;  2YOI A;  3QAV A;  1X9M B;  2LJA A;  2I81 A;  5H5Q A;  2MBS A;  2H6Y A;  4DSS B;  3GMF A;  4EIQ A;  2IL3 A;  1XVW A;  4POM A;  1W4V A;  3ERF A;  1K0N A;  4FH8 A;  2DJ3 A;  3HCZ A;  3MIX A;  3RDW A;  3IR4 A;  3MAK A;  2H74 A;  1YDK A;  3TKS C;  1FHE A;  4JZQ A;  4K7I A;  5EL8 A;  1WJK A;  4FYB A;  4AJ7 A;  4CDO A;  3UOM A;  5ECI B;  3I6A A;  1BQ7 A;  2YWM A;  5E59 A;  2X99 A;  1SK2 A;  4KB3 A;  3BCK A;  2LEG A;  3GV1 A;  1SYX A;  3M9K A;  1IYH A;  1BAY A;  1ML6 A;  1PSQ A;  1NHO A;  5JCG A;  5HFI A;  3GA4 A;  1PX6 A;  4OCE A;  1YKA A;  1ACV A;  3D4T A;  2LJK A;  4ZL8 A;  2OE3 A;  5JWQ B;  1YY7 A;  2XPE A;  4N30 A;  2OBI A;  2B1K A;  4GTU A;  3ZL5 A;  1M2B A;  3GL5 A;  2R37 A;  2B3S A;  4MZW A;  2X4A A;  4P3Y B;  2R4V A;  4KF9 A;  3HHV A;  1JZW A;  3HJP A;  5FWG A;  1TI3 A;  3VWV A;  2F9S A;  4L0W A;  5D96 A;  2CX3 A;  20GS A;  2XPD A;  4TXV A;  4MP4 A;  5D9V A;  5C00 A;  4BVX B;  3GSS A;  3D6I A;  1PA3 A;  2PER A;  3LJR A;  3FMW A;  2H73 A;  1T00 A;  1BG5 A;  3CRU A;  5IMC A;  6GSX A;  1TXX A;  1GLQ A;  2EIO A;  3HDC A;  3LXT A;  4FYC A;  2DKI A;  2FUG 2;  3LGC A;  4IEL A;  3J7Y k;  5ID2 A;  1R5A A;  1MDK A;  2L57 A;  3DWV A;  3G7J A;  4YQM A;  3S9F A;  4NXI A;  4EDZ A;  1B4Q A;  4MDC A;  2VCX A;  3EYT A;  3N9J A;  3DD3 A;  4K9Z A;  1ZGN A;  2AV4 A;  4G0I A;  2FWF A;  5HR2 A;  6GSY A;  1NW2 A;  1ZYE A;  4PX1 A;  5H5R A;  3GUR A;  2A4H A;  5CO3 A;  3ZIV A;  3C73 A;  2KP1 A;  3D0Z A;  1I9D A;  2WJU A;  1KEB A;  6GSS A;  2QGV A;  4PXO A;  3KXO A;  4HOJ A;  4PQH A;  1TKD B;  1FB0 A;  1EP8 A;  2VL2 A;  1QMV A;  3GTU B;  2ZCT A;  5GAP D;  4N0Z A;  4FYU A;  1R5P A;  4IP1 A;  2O87 A;  3EE2 A;  2H0H A;  1Z6N A;  1K0M A;  4PNF A;  4QL7 A;  3KZQ A;  4ZL7 A;  2GST A;  4V1A g;  3A5I A;  4ZBB A;  1AAZ A;  4KDU A;  3O3T A;  5JCU A;  2OE1 A;  1SYR A;  2PPT A;  5GZZ B;  2LQO A;  4V2M A;  3IPZ A;  5ECO B;  4O92 A;  1OC8 A;  1M7T A;  2R3X A;  3DKS A;  2CVB A;  2C3N A;  2H6Z A;  1UN2 A;  3IBH A;  1GUH A;  4NPB A;  3VI7 A;  2FA8 A;  4TVE A;  1OE7 A;  1DE2 A;  2F8F A;  2WZ9 A;  4O5R A;  3UBL A;  3HY2 A;  1PN0 A;  1LU4 A;  2DML A;  2HYX A;  1PRX A;  1J0F A;  5DQY A;  2YP6 A;  2DSA A;  2LTK A;  3GFK A;  3L9V A;  2B6M A;  1FO5 A;  5CAX A;  3DIE A;  3L9S A;  2DJJ A;  4BPY A;  3GX0 A;  2DJK A;  2H1G A;  1XWC A;  4RQX A;  2B5E A;  4V1A p;  5G2Z A;  2E2G A;  4NHW A;  4BL7 B;  1FVK A;  3CSH A;  2I4A A;  3FR6 A;  1A23 A;  3PGT A;  3TUE A;  1DSB A;  2I3Y A;  3NOF A;  4MMM A;  2LNS A;  2A2S A;  5ECQ B;  5GSS A;  1PX7 A;  2FA4 A;  4IS0 A;  4WF5 A;  4KUN A;  1Y6E A;  3KH9 A;  3PPU A;  3GIX A;  1O7U A;  1YF1 A;  4TR3 A;  4WF4 A;  3WGX A;  5B8A A;  1WWJ A;  4OO4 A;  4JRR A;  5G5F A;  5AIV A;  4G19 A;  5HQP A;  5E4W A;  1M9B A;  3VWW A;  1C72 A;  1H4O A;  4GQC A;  4OFN A;  2R0C A;  4IJI A;  1QFN A;  1XPV A;  2VO4 A;  1M9A A;  2WCI A;  1RW1 A;  3GST A;  3M8N A;  6GST A;  3W8S A;  4F2I A;  3QDN A;  1SJZ A;  3DYR A;  4WET A;  3WGE A;  1ERT A;  4K8M A;  4J2F A;  5D9T A;  2GQM A;  16GS A;  1G0T A;  4JR6 A;  3E0U A;  3R2Q A;  3EVI A;  2IFQ A;  2X8C A;  1FAA A;  3H93 A;  4MJA A;  3EIN A;  4MF5 A;  4ECI A;  2IME A;  3TRQ A;  3BBY A;  4MNN A;  4K7N A;  3IAM 2;  1MD4 A;  1AXD A;  1EOG A;  1VGL A;  3GN3 A;  4KE3 A;  4EC0 A;  4GWR A;  3QPM A;  1Z6M A;  5KN3 A;  1X5E A;  2XC2 A;  3IHG A;  18GS A;  5AGY A;  1A8L A;  3H79 A;  3M0F A;  4G0L A;  2VLT A;  4CY6 A;  1OC9 B;  1ZOF A;  3ZVJ D;  3WD6 A;  5HFG A;  2DKH A;  3CBU A;  3V1W A;  3U6V A;  1M99 A;  1THO A;  1G6Y A;  3HA9 A;  3TKS E;  3LG6 A;  2B5X A;  2GSQ A;  4K2D A;  2YN1 A;  3FY7 A;  5DDL A;  4O5Q A;  4NHZ A;  2YZU A;  4F0B A;  2GSS A;  3F4T A;  1BX9 A;  4OWY A;  2BMX A;  2MMN A;  1JFU A;  2YPM A;  4I2U A;  1V98 A;  1VF3 A;  1XIY A;  1YZX A;  3DEX A;  2NBS A;  2HRA A;  3DML A;  4D73 B;  2O85 A;  3GRX A;  1T1V A;  5GST A;  4TR4 A;  4L8E A;  4MJE A;  4CW9 A;  2H0I A;  4KDX A;  1I5G A;  2YWN A;  1ZCP A;  4YKF A;  5J9C A;  5IQY A;  7GSS A;  3SBC A;  1GSQ A;  1FOH A;  3CYN A;  2LKU A;  1O8W A;  5IOX A;  3KGK A;  3FZ9 A;  2AUV A;  2HSY A;  3FKF A;  4GCI A;  1EGO A;  2VD0 A;  4IQ1 A;  4FIW A;  1R4W A;  1XWA A;  1T3B A;  2XBI A;  1SEN A;  2WGR A;  4HJ2 A;  1T7P B;  4LA1 A;  4XS4 B;  4ZB6 A;  1F37 A;  1FVJ A;  4J56 E;  1K3Y A;  3CTF A;  3VI5 A;  1EZK A;  14GS A;  5IMZ A;  2PN8 A;  4X0X A;  2IJY A;  1FB6 A;  3D5J A;  2NPB A;  4L0U A;  2PGT A;  2A4V A;  2VM2 A;  3WYW A;  3SWL A;  2B7J A;  2ES7 A;  2ZNM A;  4KX4 A;  3MWH A;  3IOS A;  3IHQ A;  4N0V A;  5F8B A;  4IJ3 A;  4ZB9 A;  1TU7 A;  4EXJ A;  2KP2 A;  3A5W A;  5D9W A;  4LLR A;  2GGT A;  1SD8 A;  4NMU A;  3GHA A;  3ISO A;  3HD5 A;  3F6D A;  5ECP B;  2L5L A;  3UAR A;  1QXH A;  1PKW A;  3TCO A;  2LRC A;  3F4S A;  4O5U A;  3IDV A;  1ABA A;  1BJX A;  2ON5 A;  3TDG A;  2QA2 A;  3F4R A;  2HZF A;  4AJ8 A;  5CRG A;  3CMI A;  1JLW A;  2MZC A;  4TXO A;  4XS6 A;  2E2M A;  4RQR A;  3FR3 A;  2OE0 A;  2PU9 C;  3TJF A;  3WT2 A;  1WMJ A;  3KH7 A;  2FWG A;  2HXK A;  5F05 A;  4TW5 A;  2H72 A;  4V2N A;  4HZ2 A;  5ECS A;  1T4Y A;  1TW9 A;  3VPT A;  6GSW A;  4BWS A;  2HI7 A;  5JWO B;  2JAC A;  3LOR A;  2YJ7 A;  1GUL A;  2O7K A;  2P5R A;  3LSZ A;  3KMN A;  2WRT A;  4GST A;  3BJ5 A;  1TRU A;  4ZL9 A;  4PGT A;  3BCI A;  1ST9 A;  3US3 A;  2K8S A;  3TOT A;  3TJG A;  1S3D A;  1EEJ A;  2MMZ A;  1GLP A;  4K1F A;  3GKN A;  3RPP A;  1IYI A;  2YCD A;  1AIU A;  2X64 A;  1JHB A;  4FQU A;  1U3A A;  1GH2 A;  4WBJ A;  1OE8 A;  5KN0 A;  3QFB C;  1GSD A;  2N5F A;  3UVH A;  3TOU A;  3ERG A;  4KCA A;  3F3Q A;  4ZXG A;  2H8L A;  2RM6 A;  4IVF A;  4EE0 A;  3HVS A;  1YQ1 A;  1GUK A;  1B4P A;  3HYP A;  5DJM A;  4ZIJ A;  1SKR B;  5DAK A;  3QAG A;  5HR0 A;  1Q4J A;  10GS A;  2H6X A;  3VWX A;  5DQS A;  2DJ2 A;  1TRW A;  4ISD A;  5J5N A;  4ZBD A;  2OAC A;  3ZRE A;  2G0F A;  2GSR A;  5DAL A;  5ELG A;  4WEY A;  1VF4 A;  1ERW A;  4G0K A;  4GLT A;  3DRN A;  3HVX A;  4PQI A;  2BJX A;  6GSV A;  4ICY A;  1YF0 A;  3KD0 A;  1YEX A;  12GS A;  4F9Z A;  4PUA A;  1JLV A;  4N11 A;  1PQN A;  1WOU A;  3CRT A;  2C0D A;  3A2X A;  1YJ6 A;  4Q5F A;  4XRA A;  1THX A;  2LRT A;  2VL9 A;  4LL1 B;  2KOK A;  3QOU A;  3LXZ A;  1X5C A;  3G7Y A;  1QGV A;  3E3E A;  1YKC A;  3GKM A;  3F8U A;  4YQV A;  5F07 A;  1EV9 A;  2J9H A;  3O76 A;  4HZ4 A;  4IHU A;  3UVT A;  4MJB A;  3HJO A;  2VCW A;  2MYG A;  2WFC A;  5HR3 A;  2YNX A;  1G6W A;  3HKR A;  2H1D A;  1SD9 A;  4HEA 2;  4DSR A;  4HS1 A;  5A4U A;  5BMU A;  3NZN A;  2REM A;  1AQW A;  4Q5Q A;  4ML1 A;  2J23 A;  2R0P A;  4ZB8 A;  1TRS A;  4HUA A;  2YV9 A;  2VCT A;  5BRT A;  1UVZ A;  4XCS A;  2IPA A;  2M80 A;  2LNT A;  5IMD A;  4F82 A;  2E0Q A;  4F03 A;  3ZML A;  5ID2 B;  4H86 A;  4EF0 A;  2V41 A;  1X9S B;  4NAX A;  2VLU A;  4JR4 A;  3ME7 A;  1NHY A;  1O8X A;  1O85 A;  1A24 A;  3KEB A;  1F9M A;  5J4U A;  3IE3 A;  3EU4 A;  4WXT A;  4O7H A;  2H30 A;  2P5Q A;  4GRF A;  3RPN A;  4HJM A;  3UJ1 A;  4K6X A;  4PNG A;  3IA1 A;  3TRX A;  5ABR A;  2IMI A;  2UZ8 A;  5EPF A;  3IC4 A;  3LEF A;  1HD2 A;  3A2V A;  1FW1 A;  3ZRD A;  4HQZ A;  4ZBA A;  1T4Z A;  3QAW A;  1NM3 A;  1HNB A;  4POL A;  2K18 A;  4XS1 A;  2WS2 A;  1TK0 B;  2AJQ B;  4RI6 A;  3RAZ A;  3ZIJ A;  2JZS A;  3TB2 A;  5F0G A;  3KIJ A;  4E8H A;  1GP1 A;  4IW9 A;  3KTB A;  1PL2 A;  4XHM A;  2V6O A;  2V6K A;  5B6N A;  3OR5 A;  3W8J A;  4EUY A;  2FNO A;  1GWC A;  4YAV A;  1JZD A;  4MCU A;  2WUL A;  2DBC A;  3NIV A;  2HLS A;  1GTA A;  2JSY A;  4IGJ A;  4MAB A;  2VM1 A;  4TR1 B;  3Q74 A;  3TKQ A;  2L4Q A;  3QCP A;  8GSS A;  3K8N A;  5G31 A;  2OA7 A;  5DJL A;  3P7X A;  4PQ1 A;  1K0C A;  4OFT A;  4TOP A;  4RI7 A;  1BED A;  3GNJ A;  2LUS A;  3ZIT A;  1O73 A;  3ZVJ A;  1PN9 A;  4EL1 A;  4KSO A;  3GUS A;  3UMA A;  1Z9H A;  2YWO A;  1ZZY A;  4LL4 B;  4IBP A;  4MLY A;  3CXG A;  5L71 A;  2N5B A;  3F3R A;  2AB6 A;  2HZE A;  4X4J A;  3RHB A;  4TRX A;  3UBK A;  3LYP A;  2H76 A;  2DIY A;  3TKS A;  1URM A;  2CV4 A;  3L78 A;  2VLV A;  4YKG A;  2PWJ A;  1MD3 A;  3KP8 A;  1EV4 A;  1A0R P;  5A4W A;  1TK5 B;  4IP6 A;  4OO5 A;  2Z9S A;  1H75 A;  1YEP A;  3KP9 A;  2C3Q A;  3VLN A;  1ZL9 A;  1Q98 A;  2ON7 A;  3F9U A;  3CSJ A;  22GS A;  1Z7P A;  5F06 A;  3PR8 A;  2F3M A;  1RK4 A;  4ECJ A;  3O6T A;  1ERU A;  2IFQ B;  2WB9 A;  2VOC A;  2L6C A;  5IPG A;  3HVV A;  4HI7 A;  1FG4 A;  2R6K A;  4KA0 A;  2GQK A;  1SK0 A;  3PH9 A;  4GSS A;  2K6V A;  5LD0 A;  1HNC A;  1F3B A;  1TI1 A;  2YWI A;  3P90 A;  1XW5 A;  5IPH A;  2L6D A;  5FHI A;  1VRS D;  1A0F A;  1GSS A;  2XHF A;  1OKT A;  3A2W A;  3C71 A;  1Z5Y E;  4JBB A;  3DGQ A;  4PTS A;  2R2J A;  5IMV A;  4YH2 A;  1GSU A;  2QSI A;  3FR9 A;  1V40 A;  3TJJ A;  1G7E A;  3KJY A;  1AQX A;  2VL2 C;  2VCV A;  3GH6 A;  5ECH B;  3WGD A;  2TIR A;  3APQ A;  5D73 A;  4KDY A;  4BVY A;  1U6T A;  1LJR A;  2V1M A;  4ZIL A;  4Z2U A;  1SKS B;  1K0D A;  2YZH A;  2DMM A;  5INY A;  2LV3 A;  3D4M A;  4JU5 A;  4I8B A;  5B7C A;  1UC7 A;  2HSM A;  3L9U A;  4EVM A;  1XOB A;  5IM9 A;  1GRX A;  2JSZ A;  3C1R A;  3IAS 2;  1PGT A;  2PMT A;  2H01 A;  3RHC A;  1TDI A;  1OYJ A;  4KH7 A;  1TOF A;  2QC7 A;  2GT6 A;  1WIK A;  5JCW A;  3HZ4 A;  1F3A A;  2YJH A;  4MZB A;  1SJI A;  2CZ2 A;  2PBJ A;  2H1B A;  2BTO T;  5CP1 A;  1O81 A;  4AF2 A;  2LRN A;  1R7H A;  5LNK e;  4ULX A;  1B48 A;  3QFA C;  4BA7 A;  4DSS A;  2C8U A;  3DVW A;  3JCM L;  4Q5N A;  1M0U A;  4KW6 A;  5KN2 A;  1GSY A;  4GSN A;  3GH9 A;  2M46 A;  2V32 A;  3EUR A;  3J7Y b;  2CZ3 A;  1XWK A;  5D93 A;  3GYK A;  5IO2 A;  2A2R A;  1J08 A;  5EVO A;  2HRN A;  3ZMK A;  1U88 A;  4TR0 A;  1JZR A;  3GX8 A;  2CAQ A;  2FWE A;  4I6X A;  1S3C A;  2FHE A;  1ERV A;  2GDR A;  3TRP A;  2PUK C;  2OJL A;  4KAE A;  5H5S A;  5COH A;  3I69 A;  4OMV A;  2GQL A;  1TP9 A;  1W89 A;  4KGI A;  5IOW A;  4ACS A;  1DUG A;  1XW9 A;  3TGZ A;  5IO0 A;  4MH3 A;  4HU9 A;  1AW9 A;  4OCF A;  5G30 A;  2RLI A;  2JL4 A;  2B5Y A;  2H19 A;  1XWB A;  4TKY A;  1B8X A;  4TN8 A;  1HNA A;  1TJD A;  3KCM A;  1DE1 A;  4ILF A;  1SU9 A;  5ENU A;  2KUC A;  3EC3 A;  4TXO B;  4HU7 A;  1X5D A;  4NWY A;  4BVX A;  1GUM A;  1TTZ A;  3CTG A;  4K0G A;  1DBY A;  1A8Y A;  2GZZ A;  4XRD A;  3M3M A;  3GKX A;  3H1N A;  1S3A A;  4XTS A;  2RM5 A;  4L5O A;  1SJ6 A;  4AGS A;  1GSE A;  1K3L A;  2DIZ A;  2JZR A;  2N5A A;  3VPQ A;  1EP7 A;  1J9B A;  1XZO A;  2R5G A;  4MH2 A;  4MJC A;  3TKR A;  2AYT A;  9GSS A;  2VUP A;  3L4N A;  1KNG A;  2H70 A;  2MMA A;  1A2M A;  2X8G A;  1K0B A;  2RII A;  5J41 A;  1QUW A;  3TJK A;  1HYU A;  1XCC A;  2L4C A;  4G10 A;  3P2A A;  3IC8 A;  6GSU A;  4GF0 A;  2O89 A;  3IK7 A;  2E7P A;  1EEM A;  19GS A;  1X0R A;  3E9J B;  2GVP A;  1EWX A;  1V57 A;  1KBN A;  4OD7 A;  1CQG A;  1SK1 A;  3C8E A;  3FK8 A;  3QR6 A;  3GTU A;  5KN1 A;  1TU8 A;  1N2A A;  5CRW A;  1ZYQ B;  2CA8 A;  3I9V 2;  4MPF A;  5IMA A;  5DAK B;  4MZC A;  3DVX A;  1SL1 B;  5DVB A;  2X49 A;  5GAN D;  3C7M A;  3MDK A;  5DCH A;  3VK9 A;  1B9Y C;  5IMF A;  3IV4 A;  4QL9 A;  4GXZ A;  3PIN A;  1SL0 B;  4N10 A;  1G7O A;  1F6M C;  1ZYP A;  5DAL B;  3MSZ A;  5CRD A;  4J57 E;  4X43 A;  3D22 A;  1GL8 A;  4DSQ A;  4O32 A;  1Y25 A;  3TKP A;  4AJ6 A;  2C0F A;  3HZ8 A;  3DXB A;  2TRX A;  1HQO A;  2P31 A;  3GL3 A;  3I43 A;  2FWH A;  5ECL B;  4I97 A;  5C04 A;  1MEK A;  2HFD A;  5ECN B;  2R0G A;  1GNE A;  5EY6 A;  1OC3 A;  3UAP A;  2OKA A;  5G5E A;  4IN0 A;  4A5P A;  5B8B A;  1QQ2 A;  2L59 A;  3ZTL A;  4CY8 A;  5IIZ A;  5J3R A;  4WR5 A;  3Q18 A;  4BL7 A;  2L5O A;  2H71 A;  2OBK A;  1GTU A;  1EGR A;  1B9X C;  5A5K A;  3N5O A;  1XFL A;  2KHP A;  3UL3 A;  3EU3 A;  3KTL A;  1F2E A;  2HSH A;  3QMX A;  4JED A;  2I9H A;  2PVO C;  3LYK A;  1WP0 A;  3UIW A;  4TR1 A;  4PUF C;  4POK A;  4IQA A;  2HT9 A;  5HFK A;  1O6J A;  3P8W A;  4I2T A;  4MK3 A;  5CRH A;  4OFM A;  2YAN A;  5ECR B;  2PVQ A;  4YQU A;  2K9F A;  2GLR A;  2H75 A;  5CNW A;  4E8E A;  1KTE A;  5ECK B;  4K5R A;  2MMO A;  4LMV A;  1OVN A;  1CQH A;  11GS A;  5J9B A;  2LJR A;  4PUR A;  2FD3 A;  2V2G A;  3APO A;  2GZY A;  2RUF A;  5FT3 A;  1MDI A;  1AC1 A;  3EMX A;  1V58 A;  4XIH A;  4DVC A;  1Z7R A;  2D2Z A;  1MTC A;  3RBT A;  4K2X A;  1PD2 1;  3F63 A;  3F6F A;  3LWA A;  2JU5 A;  3ZLP A;  3VUR A;  3GKK A;  4EO3 A;  1PKZ A;  1XW6 A;  4ID0 A;  5D8I A;  2C3T A;  3LFL A;  2ALB A;  2DLX A;  3EWL A;  3EPT A;  2VD1 A;  2CAI A;  4CHS A;  2IMK A;  3H8Q A;  3AY8 A;  2AHE A;  1N8J A;  1ON4 A;  3BOA A;  2AAW A;  3EMP A;  5JWR B;  2IN3 A;  1OC9 A;  1RQM A;  4USS A;  2EIR A;  4ECC A;  1VF2 A;  3A3T A;  4LMW A;  1XBS A;  4KSM A;  4L5L A;  4DEJ A;  2X8H A;  5CRE A;  1T8E B;  4QQ7 A;  1UA5 A;  1AQV A;  1R26 A;  4F0C A;  2LS5 A;  4K0N A;  2VIM A;  5AN1 A;  5ECM B;  2VL3 A;  1AUC A;  4ECB A;  2VCZ A;  3ERW A;  2VAF A;  5AIX A;  1MDJ A;  3FZA A;  5KEJ A;  1XXU A;  2WDU A;  2XBQ A;  3D21 A;  1M2D A;  4EKZ A;  3FZ4 A;  1K0O A;  3CSI A;  2GTU A;  4MF7 A;  1V2A A;  2F8A A;  1GTB A;  2GT5 A;  1GSF A;  4MA9 A;  3L0H A;  4POB A;  5B6M A;  4D73 A;  2F51 A;  4Q5R A;  4HQS A;  4GQF A;  3G7I A;  4EIP A;  2CX4 A;  3KMO A;  3ME8 A;  2DJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...