3C1SA

Crystal structure of grx1 in glutathionylated form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
b'VSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-1
publication title Glutathionylation-triggered conformational changes of glutaredoxin Grx1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 39
structure length 107
sequence length 107
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3c1sA00
2LRNA 1ML6A 3ZITA 4K7NA 5ECOB 2I3YA 4OCFA 4IHUA 1SD9A 1XBSA 4KCEA 2H19A 3QMXA 4LL4B 4MF6A 1X9WB 4K6XA 3UVTA 2QGVA 1GP1A 4YQMA 3KZQA 2H01A 2YWNA 5J5NA 3P90A 5F06A 4NAXA 3E9JB 2GSSA 3BD2A 3LORA 4ZBAA 1NW2A 1VF4A 3GA4A 1K0MA 4HS1A 3TOUA 2ALBA 3VK9A 4IQ1A 1SL0B 3J7Yk 4JR6A 1ST9A 4ISDA 4N11A 4KSMA 2X8GA 2N5FA 3ERFA 2NVLA 4HJ2A 1TK8B 4KDYA 4BPYA 3W8JA 4G9HA 3BCIA 1ZYEA 3TGZA 5JCGA 2A2SA 1KTEA 2JADA 5B6NA 3KD0A 1FB0A 2B1LA 3EINA 3ZTLA 1U3AA 2GLRA 1T3BA 4OO4A 5C04A 1J0FA 5ABRA 1Q4JA 2WJUA 1UN2A 2R4VA 4MH3A 5DJMA 1TOFA 3LG6A 1PSQA 1FVKA 2WGRA 2GSQA 4G19A 4RUVA 2L4QA 2C80A 4TN8A 3VWVA 2B6MA 3DIEA 4Q5QA 2AAWA 4EL1A 1B9YC 2V6KA 4MJCA 2AV4A 2DJ2A 3QFAC 1M9AA 1XOBA 2O85A 2V2GA 1SKSB 5E4WA 1R4WA 3F6DA 1V40A 4EDZA 2XBQA 4WF5A 3F4SA 1ZZYA 1BQ7A 4K9ZA 3CSJA 5G1KA 1O7UA 1PKZA 3KCMA 1J9BA 4EF0A 1AQXA 3GKNA 3DVWA 3APSA 3HJMA 3VI7A 3HZ4A 4TKYA 2LTKA 4KGIA 4F03A 1K0AA 5HR3A 2JSYA 3BJ5A 2HZEA 1XIYA 4PXOA 2DMLA 3TB2A 4DSQA 3GSTA 4CW9A 3ZIJA 3C1RA 4KX4A 3TKSA 1GSFA 2H70A 1B48A 4JZQA 2ON5A 1NSWA 1T1VA 1MEKA 3KMOA 2H1AA 4HQSA 4Z7XA 1W4VA 4WEYA 4ECIA 2GVPA 4GF0A 1M2AA 2C0DA 4ZBBA 2FA8A 4ACSA 4YAVA 1GL8A 1JZDA 4ZBDA 1FW1A 1JLVA 2LQOA 4OMVA 5CREA 1SD8A 1XW6A 2I1UA 5IO2A 2G2QA 3KP9A 3L0HA 1WP0A 2IFQB 3FY7A 3ZMLA 1JZOA 2EC4A 4F0CA 2GDRA 5DJLA 5LD0A 1PMTA 3LXTA 2IMIA 3K8NA 2GTUA 4WR5A 2A4VA 3HVSA 1Y25A 2LV3A 2C3TA 4HU7A 1A23A 3GL3A 5JWOB 1Z9HA 2JL4A 4IJIA 4ULXA 1FOVA 1A2LA 6GSWA 3F8UA 14GSA 4ID0A 4KB3A 2XPDA 3HDCA 3M9KA 2B7JA 4EC0A 4L8EA 2PVOC 3TKPA 5CRDA 2FD3A 2FHEA 5HQPA 2VIMA 1RW1A 4N0ZA 4D73B 1GTAA 1K0CA 5D9XA 3D21A 3QR6A 4NMUA 2EIQA 4NWYA 5EL8A 8GSSA 1F37A 4XRAA 1XWCA 1MD4A 3UBKA 3IHQA 1WIKA 1ERWA 3GV1A 2DJ1A 1YF1A 4ZB9A 5CNWA 1AUCA 2R37A 5EPFA 2GZZA 3BBYA 2H73A 2PBJA 4G10A 4I6XA 3QD9A 1VF1A 3TJKA 3CTGA 4RQXA 9GSSA 3KJYA 3HJOA 2H6ZA 1VRSD 1AIUA 3SBCA 1GTIA 4AJ7A 3KH9A 1GNEA 2PN8A 1YEXA 2B7KA 2HXKA 3GYKA 5DAKA 2HT9A 1VF3A 1SK0A 4EO3A 5AN1A 3IK9A 2AUVA 4EVMA 3ED3A 3TJJA 4MF7A 2H76A 5D9TA 3NOFA 4DSSA 2OE1A 3UMAA 2H1DA 1PX6A 2XHFA 4IN0A 4I2UA 3A5WA 4XIHA 1B4PA 4XRDA 1PL2A 4TW5A 4XS1A 4N30A 3DVXA 3WYWA 2RIIA 3IE3A 2GQLA 4KA0A 5F8BA 2OBIA 2NTOA 4MA9A 3E0UA 1USBA 2X99A 4ZL9A 5D93A 3ZVJA 3D0ZA 4RI7A 1Z6NA 4ZL7A 5A4VA 1B4QA 2JZRA 2P5RA 4PNFA 4I97A 1F2EA 5FT3A 2VLVA 1FVJA 2PWJA 1XVWA 4PQ1A 5HR0A 3ZRDA 2LSTA 11GSA 1FHEA 1GLQA 1WJKA 2VL3A 3KGKA 3NIVA 3ZFBA 1A8YA 1XWGA 4F2IA 2B5YA 5IMFA 4IS0A 4BWSA 1EOHA 2J23A 4MF5A 3IPZA 4GTUA 1X0RA 3UIWA 2WZ9A 4AJ6A 1GSDA 2OKAA 1ZCPA 3W8SA 1K3OA 1OVNA 3KM6A 3LJRA 1XCCA 3QCPA 5AISA 2MMZA 2YV7A 2R5GA 4KW6A 1AC1A 3HD5A 3L9VA 3KTBA 2YP6A 3HCZA 2MMNA 3UAPA 1H75A 4L5LA 3EE2A 2OJLA 3VWXA 1SENA 1SJZA 3GIXA 1ACVA 2EIOA 4POLA 1OC3A 5HFIA 3A2WA 3TKQA 2VM1A 5ECKB 4AJ8A 4EUYA 1HD2A 5B6MA 1GUKA 1S3CA 1V57A 1AAZA 2H0HA 4GRFA 4NXIA 13GSA 5D73A 4XCSA 2ZNMA 3WT1A 2IMFA 3L4NA 1AXDA 5ECIB 1UVZA 2MMOA 4AGSA 2CAQA 2VD1A 4GCIA 3RAZA 5CAXA 4ECJA 5IMAA 1QK8A 2I81A 1WRYA 1ABAA 5DQSA 1SL1B 3J7Yb 4IW9A 2O89A 3KTLA 10GSA 2J9HA 4WBJA 4OD7A 1V9WA 1SL2B 18GSA 2VL2A 3G7YA 1A2JA 1PL1A 5DALB 2FWEA 4POMA 5AGYA 5GSTA 4PUFC 2YANA 5D9VA 5IQYA 3JCML 1G6YA 2R2JA 1HNAA 4LMWA 5H5QA 5DQYA 5LCZA 1GUMA 2YN1A 3PH9A 3DRNA 3EMXA 2H71A 4WETA 5L71A 3GKXA 2QC7A 2PUKC 5GSSA 6GSTA 6GSSA 2VO4A 1X5CA 1GNWA 2WS2A 2RM5A 1Z7RA 4K8MA 2CVDA 2K6VA 1K0OA 3C73A 1M0UA 1TP9A 2R6KA 1I9DA 2JZSA 2AYTA 5J9CA 2HZFA 4MPGA 2FGXA 5G2ZA 3GKKA 3L9UA 2VCWA 2IMDA 3Q19A 5C00A 1J08A 3DKSA 4JE1A 2F8FA 4V2LA 4F9ZA 3VPTA 3U6VA 3F4RA 4I5QA 2VOCA 2L5OA 2YV9A 2C3QA 1FAAA 5IPHA 3H79A 3GH6A 4HOJA 1QFNA 4YH2A 1DBYA 3FKFA 2KP1A 2L6CA 1IYIA 5FWGA 2TRCP 2KHPA 2N5BA 3IV4A 3Q74A 4NV2A 2KOKA 4QL7A 1K3LA 2GSTA 3GX0A 1BJXA 4Q5NA 1K3YA 3BOAA 2VM2A 3ZVJD 4LL1B 2F3MA 4E8HA 1BYEA 5J3RA 1YDKA 3SWLA 4TR1A 3KP8A 3WGDA 5JCWA 2P31A 1ILOA 2K8VA 1TI1A 4MLYA 4IVFA 4YAPA 4MK3A 4XS4A 1I5GA 4KH7A 4GWRA 4TR0A 1WE0A 4TXOA 4IJ3A 2YPMA 1QXHA 3MWHA 2M72A 2CA8A 2O87A 3G9BA 2CX3A 4FH8A 3VWUA 1R26A 2H75A 4LA1A 2WULA 1XFLA 3F3RA 5ELGA 1TW9A 1PA3A 2DIZA 1BX9A 2DBCA 2H1BA 3W6GA 4MDCA 3ZFLA 1KNGA 3PGTA 2PERA 1VGLA 2RUEA 2OA7A 2ES7A 4MMMA 2VCXA 6GSUA 2R3XA 5B8BA 4O92A 1Z5YE 2VAFA 3IAM2 3KH7A 4NV5A 2WRTA 5G31A 5CP1A 1O6JA 2FNOA 2QKEA 2AHEA 2KLXA 2GZPA 2CVBA 1TDIA 5ECPB 4H86A 1OYJA 3WD6A 1WPIA 2RLIA 4O5RA 4MP4A 2HRFA 3QDNA 2MMAA 3QPMA 3ME7A 4EKZA 3TUEA 1GSUA 4OFTA 3TKRA 1DUGA 3LYKA 1PX7A 3UJ1A 4FIWA 1CQHA 3DXBA 4FYUA 1X5EA 3DMLA 1ZGNA 3TJGA 1A2MA 1XWKA 1YZXA 3EURA 1ZMAA 4RI6A 2OE0A 3APQA 2PMTA 5IMDA 3ZREA 4BVYA 5IMCA 1JLWA 3EYTA 4ECCA 2H74A 3C8EA 3GNJA 4HZ4A 5H5RA 6GSYA 3HYPA 4IKHA 1THXA 1SU9A 4GXZA 3D4TA 1O81A 2YWMA 2OE3A 4FO5A 4IELA 1Q98A 3GHAA 1OC9A 1ERTA 3TRQA 4POKA 1R5AA 2GZYA 3VLNA 4OCEA 4ZIJA 3US3A 1ERVA 1GTBA 1RK4A 2PVQA 2XPEA 2I9HA 1YJ6A 5IIZA 4ZXGA 5ID2A 2C1YA 1TXXA 19GSA 3LGCA 3FR6A 5ECSA 2CVKA 1EGOA 4L5OA 1AQWA 5ECRB 4LMVA 1FB6A 2P0GA 1MDJA 3FW2A 2LS5A 2X8CA 4IP1A 5D96A 1X9MB 2E7PA 3QOUA 3TJFA 1Z7PA 1EV9A 4CDOA 2CZ3A 1A0RP 2REMA 2TIRA 4OWYA 1GLPA 4RQRA 1EP7A 2QSIA 1R5PA 1X5DA 2LJRA 3I9V2 1XXUA 2IMKA 3HY2A 2CT6A 1EEMA 3M9JA 3CRTA 2YJHA 5DCHA 3Q18A 3G7JA 2ZUPA 3F9UA 2O7KA 1YY7A 4CHSA 2VD0A 3DD3A 3D6IA 1PD21 4OO5A 1M7TA 4F0BA 2L6DA 4BA7A 5ECLB 3F63A 2E2MA 3CSIA 2DJ0A 3UBLA 4FYCA 2XBIA 1EGRA 4HEA2 3VWWA 1MTCA 1O8XA 2CQ9A 2FWFA 3F4TA 3GKMA 5H5SA 5J41A 1LJRA 1HQOA 3QAGA 2TRXA 3PINA 4NPBA 5DBQA 3APOA 5B7CA 3TJBA 1UA5A 3QFBC 2BJXA 3EU3A 1GULA 1MDKA 3O6TA 2OACA 1B8XA 5DDLA 1XZOA 2VLUA 1UC7A 3VPQA 4K0NA 4QL9A 3FR9A 5JWQB 1ON4A 4TR3A 1V58A 5DAKB 3H1NA 2K18A 1AW9A 3IC4A 4N0VA 3L9SA 3EVIA 3M3MA 5KN1A 4ZB6A 3ERWA 1TTZA 4DSSB 1HNCA 4FYBA 3VI5A 5ECHB 2GT5A 3IAS2 3H93A 2KUCA 1E6BA 2DSAA 2IJYA 3D22A 2OADA 2N5AA 4I2TA 3GUSA 2YZUA 3HHVA 3N5OA 3C71A 2I4AA 5IMVA 3IK7A 1TRVA 2CAIA 1YKAA 3GH9A 5JWRB 4WXTA 4Q5RA 3ZYWA 3O3TA 3F6FA 2GGTA 4POBA 5F0GA 3GTUB 1W89A 2IMEA 2A2RA 4MZWA 1C72A 3CMIA 2WDUA 2FUG2 1SYXA 1QMVA 1XVQA 4HI7A 2NDOA 3MAKA 2C8UA 5JCUA 1G7OA 1O8WA 5KN3A 5HR1A 4XS6A 3GMFA 5GAPD 3N9JA 5GAND 3HXSA 4GLTA 4YQVA 2JACA 1EV4A 3FZ5A 1G7EA 1M99A 2L5LA 2M80A 6GSXA 3ZMKA 2B5XA 2FWGA 4WBRD 2CV4A 5F05A 5G5FA 4XTSA 2DC5A 3FZ9A 1GRXA 2YNXA 4JU5A 5INYA 2PPTA 3A3TA 1JHBA 1HYUA 5KN0A 3I6AA 2LJAA 3RBTA 1SJ6A 4J2FA 2LRCA 2YOIA 2IL3A 3EC3A 1U3IA 1WOUA 4MJEA 3C1SA 4PGTA 4IQAA 4LLRA 5D8IA 1A0FA 2VCTA 1GSSA 1ZYQB 2F9SA 2LEGA 4PQHA 2VL9A 5D9WA 3DWVA 2GQKA 1ZOFA 2MBTA 2H0IA 3QAWA 5A4WA 3F0IA 4YQUA 3BCKA 2LNSA 3IRAA 1K0BA 5CRWA 2H66A 1NM3A 4DVCA 3CYNA 1R7HA 3IOSA 2F8AA 1TRUA 2B5EA 3UARA 1K0NA 4JRRA 5AIVA 3L78A 1DE1A 3EU4A 1GSYA 1T4YA 3CXGA 2BTOT 1TK0B 3LYPA 2HNLA 12GSA 1DSBA 3QAVA 4X0XA 5IOXA 4KSOA 3V1WA 4X43A 1SYRA 1TRSA 4PNGA 3M8NA 1EZKA 2V32A 3RHBA 2E0QA 4AF2A 4K0GA 1Z6MA 1OE7A 2NPBA 2X64A 3TKSE 4BWQA 1AQVA 3PR8A 1WWJA 2FY6A 4JBBA 1MD3A 3H8QA 1RQMA 4J57E 1H4OA 1T4ZA 5KN2A 4EXJA 1JFUA 3DGQA 2H1GA 1JZWA 3IDVA 2C0FA 4NHWA 2OBKA 2XC2A 1PN9A 3FK8A 1KEBA 1ZL9A 3LEFA 4TR4A 3CRUA 4HJMA 2VUPA 4F82A 5ECMB 4GQFA 3P7XA 4GSSA 1G6WA 3NZNA 5J4UA 2H0GA 1QGVA 3UVHA 1A8LA 4HDEA 2FWHA 2DIYA 2DLXA 4G2EA 5ELAA 4KNDA 2IFQA 5ENUA 3LSZA 4TR1B 1LBKA 3GN3A 4GSTA 3MNGA 4HU9A 4V2MA 2IWTA 5A4UA 4XS4B 5ECNB 4WR4A 4HZ2A 1T7PB 3I43A 5LNKe 1TK5B 3RDWA 5GZZB 1NHOA 1BEDA 1XPVA 5E59A 4TXOB 4MZBA 4PURA 1N2AA 2HI7A 1EWXA 4JEDA 2K8SA 2MBSA 5F07A 2YZHA 3OR5A 1GUHA 2L59A 3D5JA 3EMPA 1XWAA 4Q5FA 1GWCA 1DE2A 2IPAA 4TRXA 5G1LA 3U5RE 2H6XA 2RM6A 5CRHA 2K9FA 1GSEA 5CO3A 1S3DA 2FLSA 3TDGA 4ECBA 3H4KA 3DEXA 3GL5A 3WGXA 2LRTA 4D73A 4IP6A 3KEBA 7GSSA 4L0WA 1QUWA 1O73A 5DVBA 1YEPA 4ILFA 3FZ4A 5KEJA 2HE3A 4BL7A 2IN3A 3FYGA 4OFMA 2HZEB 3M1GA 4XHMA 5HR2A 3VFIA 1M2DA 4NHZA 2H30A 3UOMA 1TKDB 1XW9A 4KDXA 1HNBA 3FHKA 3ZZXA 1SJIA 1SK2A 3P2AA 2ON7A 3GSSA 1T00A 1V2AA 2C3NA 3HZ8A 4KAEA 2G0FA 3HVXA 1ERUA 5IPGA 5B8AA 2GSRA 5AIXA 2DJ3A 2GS3A 5DCGA 3MDKA 3C7MA 2C0GA 2DMMA 4K7OA 4I8BA 1MDIA 2M46A 2V6OA 4TXVA 4GSNA 2V41A 2C0EA 2V1MA 3AY8A 4HQZA 3FZAA 4L0UA 1U6TA 1TU8A 3EWLA 4ML1A 2LUSA 3I69A 1YQ1A 1EOGA 2FCHA 2HSHA 2YWOA 2F51A 2Z9SA 2B1KA 4GQCA 3ZLPA 2CZ2A 1PGTA 1BG5A 5ECQB 4ZILA 3ZL5A 1WMJA 1OC8A 1FO5A 3CSHA 1PQNA 6GSVA 1OC9B 4MJAA 5A5KA 4PX1A 2VL2C 17GSA 3M0FA 2L57A 2DJJA 1N8JA 2JZTA 1LU4A 2AB6A 4EE0A 1T8EB 5ID2B 1GTUA 2GQMA 3WT2A 3TOTA 4V2NA 2JSZA 1Y6EA 3TRPA 3LXZA 3RHCA 2YJ7A 3CTFA 5IOWA 2O8VB 1Z3EA 3E3EA 3MSZA 16GSA 2C4JA 4N10A 1FG4A 2GT6A 20GSA 1URMA 2WCIA 5HFGA 1F6MC 2H6YA 1CQGA 1PRXA 1M9BA 4HUAA 1B9XC 1THOA 4K2DA 4DSRA 3UL3A 3ME8A 3IBHA 2WFCA 1XWBA 2X8HA 4O32A 5IO0A 4PUAA 2HLSA 3GURA 5CYYA 2MZCA 2PGTA 1O85A 1GH2A 5HFKA 4MPFA 4WF4A 3HA9A 4OFNA 2DJKA 3RPPA 1TI3A 1NHYA 3GTUA 3IA1A 4KCAA 1TU7A 5COHA 3S9FA 3DYRA 3FR3A 2EIRA 3P8WA 4JR4A 1BAYA 5EVOA 2LNTA 5G30A 1G0TA 2H8LA 4V1Ap 22GSA 2MYGA 5IM9A 3WGEA 1V98A 2FA4A 1U88A 3UEMA 1U87A 2P5QA 4EDYA 3IXRA 4K1FA 2YWIA 1PKWA 4MZCA 2VCQA 1SKWB 3TRXA 2RUFA 1M2BA 5DALA 2WB9A 3IR4A 2LQQA 4IGJA 1SK1A 2LKUA 2NBSA 4IBPA 2ZCTA 1OKDA 1GSQA 4WKWA 4V1Ag 2CX4A 3GFKA 3RPNA 4TOPA 3A2VA 3LFLA 4O7HA 4MABA 4TVEA 2BMXA 2LJKA 2L4CA 2JU5A 1EP8A 2E2GA 1E2YA 3Q6OA 1K0DA 1F3BA 1YKCA 1TRWA 3TCOA 4X1UA 2HFDA 1A24A 4E8EA 1EEJA 1S3AA 3A2XA 1VF2A 5G5EA 1TJDA 1IYHA 2VCZA 2VCVA 2VLTA 3ERGA 1YF0A 3O76A 4QQ7A 3HKRA 3KMNA 3KXOA 3GX8A 5CRGA 3HVVA 1X9SB 3D4MA 3LWAA 3TKSC 5EY6A 4KDUA 4ZB8A 4BVXA 4DEJA 4ZL8A 4KE3A 5FHIA 2H72A 5IMZA 1JZRA 3ISOA 2B3SA 4J56E 4P3YB 1OE8A 1KBNA 3CBUA 1SKRB 1XOAA 3HJPA 1OKTA 2D2ZA 2AJQB 3KIJA 1QQ2A 2KP2A 2YCDA 3GRXA 2HYXA 4KUNA 3VURA 4MJBA 2HSYA 3LQ7A 3FEUA 3FRCA 4PQIA 1F3AA 3G7IA 4K7IA 3F3QA 2PU9C 1XW5A 4MH2A 1OAZA 2HRNA 2IIYA 3R2QA 4MCUA 3ZIVA 5J9BA 4ML6A 1F9MA
chains in the Genus database with same CATH superfamily
2LRNA 1ML6A 3ZITA 4K7NA 5ECOB 2I3YA 4OCFA 4IHUA 1SD9A 1XBSA 4KCEA 2H19A 3QMXA 4LL4B 4MF6A 1X9WB 4K6XA 3UVTA 2QGVA 1GP1A 4YQMA 3KZQA 2H01A 2YWNA 5J5NA 3P90A 5F06A 4NAXA 3E9JB 2GSSA 3BD2A 3LORA 4ZBAA 1NW2A 1VF4A 3GA4A 1K0MA 4HS1A 3TOUA 2ALBA 3VK9A 4IQ1A 1SL0B 3J7Yk 4JR6A 1ST9A 4ISDA 4N11A 4KSMA 4O5QA 2X8GA 2N5FA 3ERFA 2NVLA 4HJ2A 1TK8B 4KDYA 4BPYA 3W8JA 4G9HA 3BCIA 1ZYEA 3TGZA 5JCGA 2A2SA 1KTEA 2JADA 5B6NA 3KD0A 1FB0A 2B1LA 3EINA 3ZTLA 1U3AA 2GLRA 1T3BA 4OO4A 5C04A 1J0FA 5ABRA 1Q4JA 2WJUA 1UN2A 2R4VA 4MH3A 5DJMA 1TOFA 3LG6A 1PSQA 1FVKA 2WGRA 2GSQA 4G19A 4RUVA 2L4QA 2C80A 4TN8A 3VWVA 2B6MA 3DIEA 4Q5QA 2AAWA 4EL1A 1B9YC 2V6KA 4MJCA 2AV4A 2DJ2A 3QFAC 1M9AA 1XOBA 2O85A 2V2GA 1SKSB 5E4WA 1R4WA 3F6DA 1V40A 4EDZA 2XBQA 4WF5A 3F4SA 1ZZYA 1BQ7A 4K9ZA 3CSJA 5G1KA 1O7UA 1PKZA 2UZ8A 3KCMA 1J9BA 4EF0A 1AQXA 3GKNA 3DVWA 3APSA 3HJMA 3VI7A 3HZ4A 4TKYA 2LTKA 4KGIA 4F03A 1K0AA 5HR3A 2JSYA 3BJ5A 2HZEA 1XIYA 4PXOA 4ICYA 2DMLA 3TB2A 4DSQA 3GSTA 4CW9A 3ZIJA 3C1RA 4KX4A 3TKSA 1GSFA 2H70A 1B48A 4JZQA 2ON5A 1NSWA 1T1VA 1MEKA 3KMOA 2H1AA 4HQSA 4Z7XA 1W4VA 4WEYA 4ECIA 2GVPA 4GF0A 1M2AA 2C0DA 4ZBBA 2FA8A 2DKIA 4ACSA 4YAVA 1GL8A 1JZDA 4ZBDA 1FW1A 1JLVA 2LQOA 4OMVA 4Z2RA 3FMWA 5CREA 1SD8A 1XW6A 2I1UA 5IO2A 2G2QA 3KP9A 3L0HA 1WP0A 2IFQB 3FY7A 3ZMLA 4USSA 1JZOA 2EC4A 4F0CA 2GDRA 5DJLA 5LD0A 1PMTA 3LXTA 2IMIA 3K8NA 2GTUA 4WR5A 2A4VA 3HVSA 1Y25A 2LV3A 2C3TA 4HU7A 1A23A 3GL3A 5JWOB 1Z9HA 2JL4A 4IJIA 4ULXA 1FOVA 1A2LA 6GSWA 3F8UA 14GSA 4ID0A 4KB3A 2XPDA 4K5RA 3HDCA 3M9KA 2B7JA 4EC0A 4L8EA 2PVOC 3TKPA 5CRDA 2FD3A 2FHEA 5HQPA 2VIMA 1RW1A 2HSMA 4N0ZA 4D73B 1GTAA 1K0CA 4BVYB 5D9XA 3D21A 3QR6A 4NMUA 2EIQA 4NWYA 5EL8A 8GSSA 1F37A 4XRAA 1XWCA 4BL7B 1MD4A 3UBKA 3IHQA 1WIKA 1ERWA 3GV1A 2DJ1A 1YF1A 4ZB9A 5CNWA 1AUCA 2R37A 5EPFA 2GZZA 3BBYA 2H73A 2PBJA 4G10A 4I6XA 3QD9A 1VF1A 3TJKA 3CTGA 4RQXA 9GSSA 3KJYA 3HJOA 2H6ZA 1VRSD 1AIUA 3SBCA 2HRAA 1GTIA 4AJ7A 3KH9A 1GNEA 2PN8A 1YEXA 2B7KA 2HXKA 3GYKA 5DAKA 2HT9A 5BRTA 1VF3A 1SK0A 4EO3A 5AN1A 3IK9A 2AUVA 4EVMA 3ED3A 3TJJA 4MF7A 2H76A 5D9TA 3NOFA 4DSSA 2OE1A 3UMAA 2H1DA 1PX6A 2XHFA 4IN0A 4I2UA 3A5WA 1PN0A 4XIHA 1B4PA 4XRDA 1PL2A 4TW5A 4XS1A 4N30A 3DVXA 3WYWA 2RIIA 3IE3A 2GQLA 4KA0A 5F8BA 2OBIA 2NTOA 4MA9A 3E0UA 1USBA 2X99A 4ZL9A 5D93A 3ZVJA 3D0ZA 4RI7A 1Z6NA 4ZL7A 3A5IA 5A4VA 1B4QA 2JZRA 2P5RA 4PNFA 4I97A 1F2EA 5FT3A 2R0GA 2VLVA 1FVJA 2PWJA 1XVWA 4PQ1A 5HR0A 3ZRDA 2LSTA 11GSA 1FHEA 1GLQA 1WJKA 2VL3A 3KGKA 3NIVA 3ZFBA 1A8YA 1XWGA 4F2IA 2B5YA 5IMFA 4IS0A 4BWSA 1EOHA 2J23A 4MF5A 3IPZA 4GTUA 1X0RA 3UIWA 2WZ9A 4AJ6A 1GSDA 2OKAA 1ZCPA 3W8SA 1K3OA 1OVNA 3KM6A 3LJRA 1XCCA 3QCPA 5AISA 2MMZA 2DKHA 2YV7A 2R5GA 4KW6A 1AC1A 3HD5A 3L9VA 3KTBA 2YP6A 1XG8A 3HCZA 2MMNA 3UAPA 1H75A 4L5LA 3EE2A 2OJLA 3VWXA 1SENA 1SJZA 3GIXA 1ACVA 2EIOA 4POLA 1OC3A 5HFIA 3A2WA 3TKQA 2VM1A 5ECKB 4AJ8A 4EUYA 4G0IA 1HD2A 5B6MA 1GUKA 1S3CA 1V57A 1AAZA 2H0HA 4GRFA 4NXIA 13GSA 5D73A 4XCSA 2ZNMA 3WT1A 2IMFA 3L4NA 1AXDA 5ECIB 1UVZA 2MMOA 4AGSA 2CAQA 2VD1A 4GCIA 3RAZA 5CAXA 4ECJA 5IMAA 1QK8A 2I81A 1WRYA 1ABAA 5DQSA 4PTSA 1SL1B 3J7Yb 4IW9A 2O89A 3KTLA 10GSA 2J9HA 4WBJA 4OD7A 1V9WA 1SL2B 18GSA 2VL2A 3G7YA 1A2JA 1PL1A 5DALB 2FWEA 4POMA 5AGYA 5GSTA 4PUFC 2YANA 5D9VA 5IQYA 3JCML 1G6YA 2R2JA 1HNAA 4LMWA 5H5QA 5DQYA 5LCZA 1GUMA 2YN1A 3PH9A 3DRNA 3EMXA 2H71A 4WETA 5L71A 3GKXA 2QC7A 2PUKC 5GSSA 6GSTA 6GSSA 2VO4A 1X5CA 1GNWA 2WS2A 2RM5A 1Z7RA 4K8MA 1PFOA 2CVDA 2K6VA 1K0OA 3C73A 1M0UA 1TP9A 2R6KA 1I9DA 2JZSA 2AYTA 5J9CA 2HZFA 4MPGA 2FGXA 5G2ZA 5KOWA 1ZYPA 3GKKA 3L9UA 2VCWA 2IMDA 3Q19A 5C00A 1J08A 3DKSA 4JE1A 2F8FA 4V2LA 4F9ZA 3VPTA 3U6VA 3F4RA 4I5QA 2VOCA 2L5OA 2YV9A 2C3QA 1FAAA 5IPHA 3H79A 3GH6A 4HOJA 1QFNA 4O5UA 4YH2A 1DBYA 3FKFA 2KP1A 2L6CA 1IYIA 5FWGA 2TRCP 2KHPA 2N5BA 3IV4A 3Q74A 4NV2A 2KOKA 4QL7A 1K3LA 2GSTA 3GX0A 1BJXA 4Q5NA 1K3YA 1M3JA 3BOAA 2VM2A 3ZVJD 4LL1B 2F3MA 4E8HA 1BYEA 5J3RA 1YDKA 3SWLA 4TR1A 3KP8A 3WGDA 5JCWA 2P31A 1ILOA 2K8VA 1TI1A 4MLYA 4IVFA 4YAPA 4MK3A 4XS4A 1I5GA 4KH7A 4GWRA 4TR0A 1WE0A 4TXOA 4IJ3A 2YPMA 1QXHA 3MWHA 2M72A 2CA8A 2O87A 3G9BA 2CX3A 4FH8A 3VWUA 1R26A 2H75A 4LA1A 2WULA 1XFLA 3F3RA 5ELGA 1TW9A 4K5SA 1ZYNA 1PA3A 2DIZA 3R3EA 1BX9A 2DBCA 2H1BA 3W6GA 4MDCA 3ZFLA 1KNGA 3PGTA 2PERA 1VGLA 2RUEA 2OA7A 2ES7A 4MMMA 2VCXA 6GSUA 2R3XA 5B8BA 4O92A 1Z5YE 2VAFA 3IAM2 3KH7A 4NV5A 2WRTA 5G31A 5CP1A 1O6JA 2FNOA 2QKEA 2AHEA 2KLXA 2GZPA 2CVBA 1TDIA 5ECPB 4H86A 4FQUA 1OYJA 3WD6A 1WPIA 2RLIA 4O5RA 4MP4A 2HRFA 3QDNA 2MMAA 3QPMA 3ME7A 4EKZA 3TUEA 1GSUA 4OFTA 3TKRA 1DUGA 3LYKA 1PX7A 3UJ1A 4FIWA 1CQHA 3DXBA 4FYUA 1X5EA 3DMLA 1ZGNA 3TJGA 1A2MA 1XWKA 1YZXA 2QA2A 3EURA 1ZMAA 4RI6A 2OE0A 3APQA 2PMTA 5IMDA 3ZREA 4BVYA 3HVNA 5IMCA 1JLWA 3EYTA 4ECCA 2H74A 3C8EA 3GNJA 4HZ4A 5H5RA 6GSYA 3HYPA 4A5PA 4IKHA 1THXA 1SU9A 4GXZA 3D4TA 1O81A 2YWMA 2OE3A 4FO5A 4IELA 1Q98A 3GHAA 1OC9A 1ERTA 3TRQA 4POKA 1R5AA 2GZYA 3VLNA 4OCEA 4ZIJA 3US3A 1ERVA 1GTBA 1RK4A 2PVQA 2XPEA 2I9HA 1YJ6A 5IIZA 4ZXGA 5ID2A 2C1YA 1TXXA 19GSA 3LGCA 3FR6A 5ECSA 2CVKA 1EGOA 4L5OA 1AQWA 5ECRB 4LMVA 1FB6A 2P0GA 1MDJA 3FW2A 2LS5A 2X8CA 4IP1A 5D96A 3PPUA 1X9MB 2E7PA 3QOUA 3TJFA 1Z7PA 1EV9A 4CDOA 2CZ3A 1A0RP 2REMA 2TIRA 4OWYA 1GLPA 4RQRA 1EP7A 2QSIA 1R5PA 1X5DA 2LJRA 3I9V2 1XXUA 2IMKA 3HY2A 2CT6A 1EEMA 5KOXA 3M9JA 4KF9A 3CRTA 2YJHA 5DCHA 3Q18A 3G7JA 2ZUPA 3F9UA 2O7KA 1YY7A 4CHSA 2VD0A 3DD3A 3D6IA 1PD21 4OO5A 1M7TA 4F0BA 2L6DA 4BA7A 5ECLB 3F63A 2E2MA 3CSIA 2DJ0A 3UBLA 4FYCA 2XBIA 1EGRA 4HEA2 3VWWA 1MTCA 1O8XA 2CQ9A 2FWFA 3F4TA 3GKMA 5H5SA 5J41A 1LJRA 1HQOA 3QAGA 2TRXA 3PINA 4NPBA 5DBQA 3APOA 5B7CA 3TJBA 1UA5A 3QFBC 2BJXA 3EU3A 1GULA 1MDKA 3O6TA 2OACA 1B8XA 5DDLA 2R0PA 1XZOA 2VLUA 1UC7A 3VPQA 4K0NA 4QL9A 3FR9A 5JWQB 1ON4A 4TR3A 1V58A 1FOHA 5DAKB 3H1NA 2K18A 1AW9A 3IC4A 4N0VA 4Z2TA 3L9SA 3EVIA 3M3MA 5KN1A 4ZB6A 3ERWA 1TTZA 2X49A 4DSSB 1HNCA 4FYBA 3VI5A 5ECHB 2GT5A 3IAS2 3H93A 2KUCA 1E6BA 2DSAA 2IJYA 3D22A 4X4JA 3MYDA 2OADA 2N5AA 4I2TA 2QA1A 3GUSA 2YZUA 3HHVA 3N5OA 3C71A 2I4AA 5IMVA 3IK7A 1TRVA 2CAIA 1YKAA 3GH9A 5JWRB 4WXTA 4Q5RA 3ZYWA 3O3TA 3F6FA 2GGTA 4POBA 5F0GA 3GTUB 1W89A 2IMEA 2A2RA 4MZWA 1C72A 3CMIA 2WDUA 2FUG2 1SYXA 1QMVA 1XVQA 4HI7A 2NDOA 3MAKA 2C8UA 5JCUA 1G7OA 1O8WA 5KN3A 4Z2UA 5HR1A 4XS6A 3GMFA 5GAPD 3N9JA 5GAND 3HXSA 4GLTA 4YQVA 4EIPA 2JACA 1EV4A 3FZ5A 1G7EA 1M99A 2L5LA 2M80A 6GSXA 3ZMKA 2B5XA 2FWGA 4WBRD 2CV4A 5F05A 5G5FA 4XTSA 2DC5A 3FZ9A 1GRXA 2YNXA 4JU5A 5INYA 2PPTA 3A3TA 1JHBA 1HYUA 5KN0A 3I6AA 2LJAA 3RBTA 1SJ6A 4J2FA 2LRCA 2YOIA 2IL3A 3EC3A 1U3IA 1WOUA 4MJEA 3C1SA 4PGTA 4IQAA 4LLRA 5D8IA 1A0FA 2VCTA 1GSSA 1ZYQB 2F9SA 2LEGA 4PQHA 2VL9A 3IHGA 5D9WA 3DWVA 2GQKA 1ZOFA 2MBTA 2H0IA 3QAWA 5A4WA 3IC8A 3F0IA 4YQUA 3BCKA 2LNSA 2X4AA 3IRAA 1K0BA 5CRWA 2H66A 1NM3A 4DVCA 3CYNA 1R7HA 3IOSA 2F8AA 1TRUA 2B5EA 3UARA 1K0NA 4BVXB 3LW9A 4JRRA 5AIVA 3L78A 1DE1A 3EU4A 1GSYA 1T4YA 3CXGA 2BTOT 1TK0B 3LYPA 2HNLA 12GSA 1DSBA 3QAVA 4X0XA 5IOXA 4KSOA 3V1WA 4X43A 1SYRA 1TRSA 4BIKA 4PNGA 3M8NA 1EZKA 2V32A 3RHBA 2E0QA 4AF2A 4K0GA 1Z6MA 1OE7A 2NPBA 2X64A 3TKSE 4BWQA 1AQVA 3PR8A 1WWJA 2FY6A 4JBBA 1MD3A 3H8QA 1RQMA 4J57E 1H4OA 1T4ZA 5KN2A 4EXJA 1JFUA 3DGQA 2H1GA 1JZWA 3IDVA 2C0FA 4NHWA 2OBKA 2XC2A 1PN9A 3FK8A 1KEBA 1ZL9A 3LEFA 4TR4A 3CRUA 4HJMA 2VUPA 4F82A 5ECMB 4GQFA 3P7XA 4GSSA 1G6WA 4G0KA 3NZNA 5J4UA 2H0GA 1QGVA 4CY8A 3UVHA 1A8LA 4HDEA 2FWHA 2DIYA 2DLXA 4G2EA 4MNNA 5ELAA 5BMUA 4KNDA 2IFQA 5ENUA 3LSZA 4TR1B 1LBKA 3GN3A 4GSTA 3MNGA 4HU9A 4V2MA 4G0LA 2IWTA 5A4UA 4XS4B 5ECNB 4WR4A 4HZ2A 1T7PB 3I43A 5LNKe 2A4HA 1TK5B 3RDWA 5GZZB 1NHOA 1BEDA 1XPVA 5E59A 4TXOB 4MZBA 4PURA 1N2AA 2HI7A 1EWXA 4JEDA 2K8SA 2MBSA 5F07A 2YZHA 3OR5A 1GUHA 4CY6A 2L59A 3D5JA 3EMPA 1XWAA 4Q5FA 1GWCA 1DE2A 2IPAA 4TRXA 5G1LA 3U5RE 2H6XA 2RM6A 5CRHA 2K9FA 1GSEA 5CO3A 1S3DA 2FLSA 3TDGA 4ECBA 3H4KA 3DEXA 3GL5A 3WGXA 2LRTA 4D73A 4IP6A 3KEBA 7GSSA 4L0WA 1QUWA 1O73A 5DVBA 1YEPA 4ILFA 3FZ4A 5KEJA 2HE3A 4BL7A 2IN3A 3FYGA 4OFMA 2HZEB 3M1GA 4XHMA 5HR2A 3VFIA 1M2DA 4NHZA 2H30A 3UOMA 1TKDB 1XW9A 4KDXA 1HNBA 3FHKA 3ZZXA 1SJIA 1SK2A 3P2AA 2ON7A 3GSSA 1T00A 1V2AA 2C3NA 3HZ8A 4KAEA 2G0FA 3HVXA 1ERUA 5IPGA 5B8AA 2GSRA 5AIXA 2DJ3A 2GS3A 5DCGA 3MDKA 3C7MA 2C0GA 4YKFA 2DMMA 4K7OA 4I8BA 1MDIA 2M46A 2V6OA 4TXVA 4GSNA 2V41A 2C0EA 2V1MA 3AY8A 4HQZA 3FZAA 4L0UA 1U6TA 1TU8A 3EWLA 4ML1A 2LUSA 3I69A 1YQ1A 1EOGA 2FCHA 2HSHA 2YWOA 2F51A 2Z9SA 2B1KA 4GQCA 3ZLPA 2CZ2A 1PGTA 1BG5A 5ECQB 4ZILA 3ZL5A 1WMJA 1OC8A 1FO5A 1M3IA 3CSHA 1PQNA 6GSVA 1OC9B 4MJAA 5A5KA 4PX1A 2VL2C 17GSA 3M0FA 2L57A 2DJJA 1N8JA 2JZTA 1LU4A 2AB6A 4EE0A 1T8EB 5ID2B 1GTUA 2GQMA 3WT2A 3TOTA 4V2NA 2JSZA 1Y6EA 3TRPA 3MIXA 3LXZA 2A2PA 3RHCA 2YJ7A 3CTFA 5IOWA 2O8VB 1Z3EA 3E3EA 3MSZA 16GSA 2HRKA 2C4JA 4N10A 1FG4A 2GT6A 4YKGA 20GSA 1URMA 2WCIA 5HFGA 1F6MC 2H6YA 1CQGA 1PRXA 1M9BA 4HUAA 1B9XC 1THOA 4K2DA 4DSRA 4HSCX 3UL3A 3ME8A 3IBHA 2WFCA 1XWBA 2X8HA 4O32A 5IO0A 4PUAA 2HLSA 3GURA 2MZCA 2PGTA 1O85A 5CYYA 1GH2A 5HFKA 4MPFA 4WF4A 3HA9A 4OFNA 2DJKA 3RPPA 1TI3A 1NHYA 3GTUA 3IA1A 4KCAA 1TU7A 5COHA 3S9FA 3DYRA 3FR3A 2EIRA 3P8WA 4JR4A 1BAYA 5EVOA 2LNTA 5G30A 1G0TA 2H8LA 4V1Ap 22GSA 2MYGA 5IM9A 3WGEA 1V98A 2FA4A 1U88A 3UEMA 1S3RA 1U87A 2P5QA 4EDYA 3IXRA 4K1FA 2YWIA 1PKWA 4MZCA 2VCQA 1SKWB 3TRXA 2RUFA 1M2BA 5DALA 2WB9A 3IR4A 2LQQA 4IGJA 1SK1A 2LKUA 2NBSA 4IBPA 4EIQA 2ZCTA 1OKDA 1GSQA 4WKWA 4V1Ag 2CX4A 3GFKA 3RPNA 3CQFA 4TOPA 3A2VA 3LFLA 4O7HA 4MABA 4TVEA 2BMXA 2LJKA 2L4CA 2JU5A 1EP8A 2E2GA 1E2YA 3Q6OA 1K0DA 1F3BA 1YKCA 1TRWA 3TCOA 4X1UA 2HFDA 1A24A 4E8EA 1EEJA 1S3AA 3A2XA 1VF2A 5G5EA 1TJDA 1IYHA 2VCZA 2VCVA 2VLTA 3EPTA 1YF0A 3ERGA 2R0CA 3O76A 4QQ7A 3HKRA 3KMNA 3KXOA 4K2XA 3GX8A 5CRGA 3HVVA 1X9SB 3D4MA 3LWAA 3TKSC 5EY6A 4KDUA 4ZB8A 4BVXA 4DEJA 4ZL8A 4KE3A 5FHIA 2H72A 5IMZA 1JZRA 3ISOA 2B3SA 4J56E 4P3YB 1OE8A 1KBNA 3CBUA 1SKRB 1XOAA 3HJPA 1OKTA 2D2ZA 2AJQB 3KIJA 1QQ2A 2KP2A 2YCDA 3GRXA 2HYXA 4KUNA 3VURA 4MJBA 2HSYA 3LQ7A 3FEUA 3FRCA 4PQIA 1F3AA 3G7IA 4K7IA 3F3QA 2PU9C 1XW5A 4MH2A 1OAZA 2HRNA 2IIYA 3R2QA 4MCUA 3ZIVA 5J9BA 4ML6A 1F9MA
chains in the Genus database with same CATH topology
2LRNA 1ML6A 3ZITA 4K7NA 5ECOB 2I3YA 4OCFA 4IHUA 1SD9A 1XBSA 4KCEA 2H19A 3QMXA 4LL4B 4MF6A 1X9WB 4K6XA 3UVTA 2QGVA 1GP1A 4YQMA 3KZQA 2H01A 2YWNA 5J5NA 3P90A 5F06A 4NAXA 3E9JB 2GSSA 3BD2A 3LORA 4ZBAA 1NW2A 1VF4A 3GA4A 1K0MA 4HS1A 3TOUA 2ALBA 3VK9A 4IQ1A 1SL0B 3J7Yk 4JR6A 1ST9A 4ISDA 4N11A 4KSMA 4O5QA 2X8GA 2N5FA 3ERFA 2NVLA 4HJ2A 1TK8B 4KDYA 4BPYA 3W8JA 4G9HA 3BCIA 1ZYEA 3TGZA 5JCGA 2A2SA 1KTEA 2JADA 5B6NA 3KD0A 1FB0A 2B1LA 3EINA 3ZTLA 1U3AA 2GLRA 1T3BA 4OO4A 5C04A 1J0FA 5ABRA 1Q4JA 2WJUA 1UN2A 2R4VA 4MH3A 5DJMA 1TOFA 3LG6A 1PSQA 1FVKA 2WGRA 2GSQA 4G19A 4RUVA 2L4QA 2C80A 4TN8A 3VWVA 2B6MA 3DIEA 4Q5QA 2AAWA 4EL1A 1B9YC 2V6KA 4MJCA 2AV4A 2DJ2A 3QFAC 1M9AA 1XOBA 2O85A 2V2GA 1SKSB 5E4WA 1R4WA 3F6DA 1V40A 4EDZA 2XBQA 4WF5A 3F4SA 1ZZYA 1BQ7A 4K9ZA 3CSJA 5G1KA 1O7UA 1PKZA 2UZ8A 3KCMA 1J9BA 4EF0A 1AQXA 3GKNA 3DVWA 3APSA 3HJMA 3VI7A 3HZ4A 4TKYA 2LTKA 4KGIA 4F03A 1K0AA 5HR3A 2JSYA 3BJ5A 2HZEA 1XIYA 4PXOA 4ICYA 2DMLA 3TB2A 4DSQA 3GSTA 4CW9A 3ZIJA 3C1RA 4KX4A 3TKSA 1GSFA 2H70A 1B48A 4JZQA 2ON5A 1NSWA 1T1VA 1MEKA 3KMOA 2H1AA 4HQSA 4Z7XA 1W4VA 4WEYA 4ECIA 2GVPA 4GF0A 1M2AA 2C0DA 4ZBBA 2FA8A 2DKIA 4ACSA 4YAVA 1GL8A 1JZDA 4ZBDA 1FW1A 1JLVA 2LQOA 4OMVA 4Z2RA 3FMWA 5CREA 1SD8A 1XW6A 2I1UA 5IO2A 2G2QA 3KP9A 3L0HA 1WP0A 2IFQB 3FY7A 3ZMLA 4USSA 1JZOA 2EC4A 4F0CA 2GDRA 5DJLA 5LD0A 1PMTA 3LXTA 2IMIA 3K8NA 2GTUA 4WR5A 2A4VA 3HVSA 1Y25A 2LV3A 2C3TA 4HU7A 1A23A 3GL3A 5JWOB 1Z9HA 2JL4A 4IJIA 4ULXA 1FOVA 1A2LA 6GSWA 3F8UA 14GSA 4ID0A 4KB3A 2XPDA 4K5RA 3HDCA 3M9KA 2B7JA 4EC0A 4L8EA 2PVOC 3TKPA 5CRDA 2FD3A 2FHEA 5HQPA 2VIMA 1RW1A 2HSMA 4N0ZA 4D73B 1GTAA 1K0CA 4BVYB 5D9XA 3D21A 3QR6A 4NMUA 2EIQA 4NWYA 5EL8A 8GSSA 1F37A 4XRAA 1XWCA 4BL7B 1MD4A 3UBKA 3IHQA 1WIKA 1ERWA 3GV1A 2DJ1A 1YF1A 4ZB9A 5CNWA 1AUCA 2R37A 5EPFA 2GZZA 3BBYA 2H73A 2PBJA 4G10A 4I6XA 3QD9A 1VF1A 3TJKA 3CTGA 4RQXA 9GSSA 3KJYA 3HJOA 2H6ZA 1VRSD 1AIUA 3SBCA 2HRAA 1GTIA 4AJ7A 3KH9A 1GNEA 2PN8A 1YEXA 2B7KA 2HXKA 3GYKA 5DAKA 2HT9A 5BRTA 1VF3A 1SK0A 4EO3A 5AN1A 3IK9A 2AUVA 4EVMA 3ED3A 3TJJA 4MF7A 2H76A 5D9TA 3NOFA 4DSSA 2OE1A 3UMAA 2H1DA 1PX6A 2XHFA 4IN0A 4I2UA 3A5WA 1PN0A 4XIHA 1B4PA 4XRDA 1PL2A 4TW5A 4XS1A 4N30A 3DVXA 3WYWA 2RIIA 3IE3A 2GQLA 4KA0A 5F8BA 2OBIA 2NTOA 4MA9A 3E0UA 1USBA 2X99A 4ZL9A 5D93A 3ZVJA 3D0ZA 4RI7A 1Z6NA 4ZL7A 3A5IA 5A4VA 1B4QA 2JZRA 2P5RA 4PNFA 4I97A 1F2EA 5FT3A 2R0GA 2VLVA 1FVJA 2PWJA 1XVWA 4PQ1A 5HR0A 3ZRDA 2LSTA 11GSA 1FHEA 1GLQA 1WJKA 2VL3A 3KGKA 3NIVA 3ZFBA 1A8YA 1XWGA 4F2IA 2B5YA 5IMFA 4IS0A 4BWSA 1EOHA 2J23A 4MF5A 3IPZA 4GTUA 1X0RA 3UIWA 2WZ9A 4AJ6A 1GSDA 2OKAA 1ZCPA 3W8SA 1K3OA 1OVNA 3KM6A 3LJRA 1XCCA 3QCPA 5AISA 2MMZA 2DKHA 2YV7A 2R5GA 4KW6A 1AC1A 3HD5A 3L9VA 3KTBA 2YP6A 3HCZA 2MMNA 3UAPA 1H75A 4L5LA 3EE2A 2OJLA 3VWXA 1SENA 1SJZA 3GIXA 1ACVA 2EIOA 4POLA 1OC3A 5HFIA 3A2WA 3TKQA 2VM1A 5ECKB 4AJ8A 4EUYA 4G0IA 1HD2A 5B6MA 1GUKA 1S3CA 1V57A 1AAZA 2H0HA 4GRFA 4NXIA 13GSA 5D73A 4XCSA 2ZNMA 3WT1A 2IMFA 3L4NA 1AXDA 5ECIB 1UVZA 2MMOA 4AGSA 2CAQA 2VD1A 4GCIA 3RAZA 5CAXA 4ECJA 5IMAA 1QK8A 2I81A 1WRYA 1ABAA 5DQSA 4PTSA 1SL1B 3J7Yb 4IW9A 2O89A 3KTLA 10GSA 2J9HA 4WBJA 4OD7A 1V9WA 1SL2B 18GSA 2VL2A 3G7YA 1A2JA 1PL1A 5DALB 2FWEA 4POMA 5AGYA 5GSTA 4PUFC 2YANA 5D9VA 5IQYA 3JCML 1G6YA 2R2JA 1HNAA 4LMWA 5H5QA 5DQYA 5LCZA 1GUMA 2YN1A 3PH9A 3DRNA 3EMXA 2H71A 4WETA 5L71A 3GKXA 2QC7A 2PUKC 5GSSA 6GSTA 6GSSA 2VO4A 1X5CA 1GNWA 2WS2A 2RM5A 1Z7RA 4K8MA 2CVDA 2K6VA 1K0OA 3C73A 1M0UA 1TP9A 2R6KA 1I9DA 2JZSA 2AYTA 5J9CA 2HZFA 4MPGA 2FGXA 5G2ZA 5KOWA 1ZYPA 3GKKA 3L9UA 2VCWA 2IMDA 3Q19A 5C00A 1J08A 3DKSA 4JE1A 2F8FA 4V2LA 4F9ZA 3VPTA 3U6VA 3F4RA 4I5QA 2VOCA 2L5OA 2YV9A 2C3QA 1FAAA 5IPHA 3H79A 3GH6A 4HOJA 1QFNA 4O5UA 4YH2A 1DBYA 3FKFA 2KP1A 2L6CA 1IYIA 5FWGA 2TRCP 2KHPA 2N5BA 3IV4A 3Q74A 4NV2A 2KOKA 4QL7A 1K3LA 2GSTA 3GX0A 1BJXA 4Q5NA 1K3YA 3BOAA 2VM2A 3ZVJD 4LL1B 2F3MA 4E8HA 1BYEA 5J3RA 1YDKA 3SWLA 4TR1A 3KP8A 3WGDA 5JCWA 2P31A 1ILOA 2K8VA 1TI1A 4MLYA 4IVFA 4YAPA 4MK3A 4XS4A 1I5GA 4KH7A 4GWRA 4TR0A 1WE0A 4TXOA 4IJ3A 2YPMA 1QXHA 3MWHA 2M72A 2CA8A 2O87A 3G9BA 2CX3A 4FH8A 3VWUA 1R26A 2H75A 4LA1A 2WULA 1XFLA 3F3RA 5ELGA 1TW9A 4K5SA 1ZYNA 1PA3A 2DIZA 3R3EA 1BX9A 2DBCA 2H1BA 3W6GA 4MDCA 3ZFLA 1KNGA 3PGTA 2PERA 1VGLA 2RUEA 2OA7A 2ES7A 4MMMA 2VCXA 6GSUA 2R3XA 5B8BA 4O92A 1Z5YE 2VAFA 3IAM2 3KH7A 4NV5A 2WRTA 5G31A 5CP1A 1O6JA 2FNOA 2QKEA 2AHEA 2KLXA 2GZPA 2CVBA 1TDIA 5ECPB 4H86A 4FQUA 1OYJA 3WD6A 1WPIA 2RLIA 4O5RA 4MP4A 2HRFA 3QDNA 2MMAA 3QPMA 3ME7A 4EKZA 3TUEA 1GSUA 4OFTA 3TKRA 1DUGA 3LYKA 1PX7A 3UJ1A 4FIWA 1CQHA 3DXBA 4FYUA 1X5EA 3DMLA 1ZGNA 3TJGA 1A2MA 1XWKA 1YZXA 2QA2A 3EURA 1ZMAA 4RI6A 2OE0A 3APQA 2PMTA 5IMDA 3ZREA 4BVYA 5IMCA 1JLWA 3EYTA 4ECCA 2H74A 3C8EA 3GNJA 4HZ4A 5H5RA 6GSYA 3HYPA 4A5PA 4IKHA 1THXA 1SU9A 4GXZA 3D4TA 1O81A 2YWMA 2OE3A 4FO5A 4IELA 1Q98A 3GHAA 1OC9A 1ERTA 3TRQA 4POKA 1R5AA 2GZYA 3VLNA 4OCEA 4ZIJA 3US3A 1ERVA 1GTBA 1RK4A 2PVQA 2XPEA 2I9HA 1YJ6A 5IIZA 4ZXGA 5ID2A 2C1YA 1TXXA 19GSA 3LGCA 3FR6A 5ECSA 2CVKA 1EGOA 4L5OA 1AQWA 5ECRB 4LMVA 1FB6A 2P0GA 1MDJA 3FW2A 2LS5A 2X8CA 4IP1A 5D96A 3PPUA 1X9MB 2E7PA 3QOUA 3TJFA 1Z7PA 1EV9A 4CDOA 2CZ3A 1A0RP 2REMA 2TIRA 4OWYA 1GLPA 4RQRA 1EP7A 2QSIA 1R5PA 1X5DA 2LJRA 3I9V2 1XXUA 2IMKA 3HY2A 2CT6A 1EEMA 5KOXA 3M9JA 4KF9A 3CRTA 2YJHA 5DCHA 3Q18A 3G7JA 2ZUPA 3F9UA 2O7KA 1YY7A 4CHSA 2VD0A 3DD3A 3D6IA 1PD21 4OO5A 1M7TA 4F0BA 2L6DA 4BA7A 5ECLB 3F63A 2E2MA 3CSIA 2DJ0A 3UBLA 4FYCA 2XBIA 1EGRA 4HEA2 3VWWA 1MTCA 1O8XA 2CQ9A 2FWFA 3F4TA 3GKMA 5H5SA 5J41A 1LJRA 1HQOA 3QAGA 2TRXA 3PINA 4NPBA 5DBQA 3APOA 5B7CA 3TJBA 1UA5A 3QFBC 2BJXA 3EU3A 1GULA 1MDKA 3O6TA 2OACA 1B8XA 5DDLA 2R0PA 1XZOA 2VLUA 1UC7A 3VPQA 4K0NA 4QL9A 3FR9A 5JWQB 1ON4A 4TR3A 1V58A 1FOHA 5DAKB 3H1NA 2K18A 1AW9A 3IC4A 4N0VA 4Z2TA 3L9SA 3EVIA 3M3MA 5KN1A 4ZB6A 3ERWA 1TTZA 2X49A 4DSSB 1HNCA 4FYBA 3VI5A 5ECHB 2GT5A 3IAS2 3H93A 2KUCA 1E6BA 2DSAA 2IJYA 3D22A 4X4JA 3MYDA 2OADA 2N5AA 4I2TA 2QA1A 3GUSA 2YZUA 3HHVA 3N5OA 3C71A 2I4AA 5IMVA 3IK7A 1TRVA 2CAIA 1YKAA 3GH9A 5JWRB 4WXTA 4Q5RA 3ZYWA 3O3TA 3F6FA 2GGTA 4POBA 5F0GA 3GTUB 1W89A 2IMEA 2A2RA 4MZWA 1C72A 3CMIA 2WDUA 2FUG2 1SYXA 1QMVA 1XVQA 4HI7A 2NDOA 3MAKA 2C8UA 5JCUA 1G7OA 1O8WA 5KN3A 4Z2UA 5HR1A 4XS6A 3GMFA 5GAPD 3N9JA 5GAND 3HXSA 4GLTA 4YQVA 4EIPA 2JACA 1EV4A 3FZ5A 1G7EA 1M99A 2L5LA 2M80A 6GSXA 3ZMKA 2B5XA 2FWGA 4WBRD 2CV4A 5F05A 5G5FA 4XTSA 2DC5A 3FZ9A 1GRXA 2YNXA 4JU5A 5INYA 2PPTA 3A3TA 1JHBA 1HYUA 5KN0A 3I6AA 2LJAA 3RBTA 1SJ6A 4J2FA 2LRCA 2YOIA 2IL3A 3EC3A 1U3IA 1WOUA 4MJEA 3C1SA 4PGTA 4IQAA 4LLRA 5D8IA 1A0FA 2VCTA 1GSSA 1ZYQB 2F9SA 2LEGA 4PQHA 2VL9A 3IHGA 5D9WA 3DWVA 2GQKA 1ZOFA 2MBTA 2H0IA 3QAWA 5A4WA 3IC8A 3F0IA 4YQUA 3BCKA 2LNSA 2X4AA 3IRAA 1K0BA 5CRWA 2H66A 1NM3A 4DVCA 3CYNA 1R7HA 3IOSA 2F8AA 1TRUA 2B5EA 3UARA 1K0NA 4BVXB 3LW9A 4JRRA 5AIVA 3L78A 1DE1A 3EU4A 1GSYA 1T4YA 3CXGA 2BTOT 1TK0B 3LYPA 2HNLA 12GSA 1DSBA 3QAVA 4X0XA 5IOXA 4KSOA 3V1WA 4X43A 1SYRA 1TRSA 4PNGA 3M8NA 1EZKA 2V32A 3RHBA 2E0QA 4AF2A 4K0GA 1Z6MA 1OE7A 2NPBA 2X64A 3TKSE 4BWQA 1AQVA 3PR8A 1WWJA 2FY6A 4JBBA 1MD3A 3H8QA 1RQMA 4J57E 1H4OA 1T4ZA 5KN2A 4EXJA 1JFUA 3DGQA 2H1GA 1JZWA 3IDVA 2C0FA 4NHWA 2OBKA 2XC2A 1PN9A 3FK8A 1KEBA 1ZL9A 3LEFA 4TR4A 3CRUA 4HJMA 2VUPA 4F82A 5ECMB 4GQFA 3P7XA 4GSSA 1G6WA 4G0KA 3NZNA 5J4UA 2H0GA 1QGVA 4CY8A 3UVHA 1A8LA 4HDEA 2FWHA 2DIYA 2DLXA 4G2EA 4MNNA 5ELAA 5BMUA 4KNDA 2IFQA 5ENUA 3LSZA 4TR1B 1LBKA 3GN3A 4GSTA 3MNGA 4HU9A 4V2MA 4G0LA 2IWTA 5A4UA 4XS4B 5ECNB 4WR4A 4HZ2A 1T7PB 3I43A 5LNKe 2A4HA 1TK5B 3RDWA 5GZZB 1NHOA 1BEDA 1XPVA 5E59A 4TXOB 4MZBA 4PURA 1N2AA 2HI7A 1EWXA 4JEDA 2K8SA 2MBSA 5F07A 2YZHA 3OR5A 1GUHA 4CY6A 2L59A 3D5JA 3EMPA 1XWAA 4Q5FA 1GWCA 1DE2A 2IPAA 4TRXA 5G1LA 3U5RE 2H6XA 2RM6A 5CRHA 2K9FA 1GSEA 5CO3A 1S3DA 2FLSA 3TDGA 4ECBA 3H4KA 3DEXA 3GL5A 3WGXA 2LRTA 4D73A 4IP6A 3KEBA 7GSSA 4L0WA 1QUWA 1O73A 5DVBA 1YEPA 4ILFA 3FZ4A 5KEJA 2HE3A 4BL7A 2IN3A 3FYGA 4OFMA 2HZEB 3M1GA 4XHMA 5HR2A 3VFIA 1M2DA 4NHZA 2H30A 3UOMA 1TKDB 1XW9A 4KDXA 1HNBA 3FHKA 3ZZXA 1SJIA 1SK2A 3P2AA 2ON7A 3GSSA 1T00A 1V2AA 2C3NA 3HZ8A 4KAEA 2G0FA 3HVXA 1ERUA 5IPGA 5B8AA 2GSRA 5AIXA 2DJ3A 2GS3A 5DCGA 3MDKA 3C7MA 2C0GA 4YKFA 2DMMA 4K7OA 4I8BA 1MDIA 2M46A 2V6OA 4TXVA 4GSNA 2V41A 2C0EA 2V1MA 3AY8A 4HQZA 3FZAA 4L0UA 1U6TA 1TU8A 3EWLA 4ML1A 2LUSA 3I69A 1YQ1A 1EOGA 2FCHA 2HSHA 2YWOA 2F51A 2Z9SA 2B1KA 4GQCA 3ZLPA 2CZ2A 1PGTA 1BG5A 5ECQB 4ZILA 3ZL5A 1WMJA 1OC8A 1FO5A 3CSHA 1PQNA 6GSVA 1OC9B 4MJAA 5A5KA 4PX1A 2VL2C 17GSA 3M0FA 2L57A 2DJJA 1N8JA 2JZTA 1LU4A 2AB6A 4EE0A 1T8EB 5ID2B 1GTUA 2GQMA 3WT2A 3TOTA 4V2NA 2JSZA 1Y6EA 3TRPA 3MIXA 3LXZA 2A2PA 3RHCA 2YJ7A 3CTFA 5IOWA 2O8VB 1Z3EA 3E3EA 3MSZA 16GSA 2HRKA 2C4JA 4N10A 1FG4A 2GT6A 4YKGA 20GSA 1URMA 2WCIA 5HFGA 1F6MC 2H6YA 1CQGA 1PRXA 1M9BA 4HUAA 1B9XC 1THOA 4K2DA 4DSRA 3UL3A 3ME8A 3IBHA 2WFCA 1XWBA 2X8HA 4O32A 5IO0A 4PUAA 2HLSA 3GURA 5CYYA 2MZCA 2PGTA 1O85A 1GH2A 5HFKA 4MPFA 4WF4A 3HA9A 4OFNA 2DJKA 3RPPA 1TI3A 1NHYA 3GTUA 3IA1A 4KCAA 1TU7A 5COHA 3S9FA 3DYRA 3FR3A 2EIRA 3P8WA 4JR4A 1BAYA 5EVOA 2LNTA 5G30A 1G0TA 2H8LA 4V1Ap 22GSA 2MYGA 5IM9A 3WGEA 1V98A 2FA4A 1U88A 3UEMA 1U87A 2P5QA 4EDYA 3IXRA 4K1FA 2YWIA 1PKWA 4MZCA 2VCQA 1SKWB 3TRXA 2RUFA 1M2BA 5DALA 2WB9A 3IR4A 2LQQA 4IGJA 1SK1A 2LKUA 2NBSA 4IBPA 4EIQA 2ZCTA 1OKDA 1GSQA 4WKWA 4V1Ag 2CX4A 3GFKA 3RPNA 4TOPA 3A2VA 3LFLA 4O7HA 4MABA 4TVEA 2BMXA 2LJKA 2L4CA 2JU5A 1EP8A 2E2GA 1E2YA 3Q6OA 1K0DA 1F3BA 1YKCA 1TRWA 3TCOA 4X1UA 2HFDA 1A24A 4E8EA 1EEJA 1S3AA 3A2XA 1VF2A 5G5EA 1TJDA 1IYHA 2VCZA 2VCVA 2VLTA 3EPTA 1YF0A 3ERGA 2R0CA 3O76A 4QQ7A 3HKRA 3KMNA 3KXOA 4K2XA 3GX8A 5CRGA 3HVVA 1X9SB 3D4MA 3LWAA 3TKSC 5EY6A 4KDUA 4ZB8A 4BVXA 4DEJA 4ZL8A 4KE3A 5FHIA 2H72A 5IMZA 1JZRA 3ISOA 2B3SA 4J56E 4P3YB 1OE8A 1KBNA 3CBUA 1SKRB 1XOAA 3HJPA 1OKTA 2D2ZA 2AJQB 3KIJA 1QQ2A 2KP2A 2YCDA 3GRXA 2HYXA 4KUNA 3VURA 4MJBA 2HSYA 3LQ7A 3FEUA 3FRCA 4PQIA 1F3AA 3G7IA 4K7IA 3F3QA 2PU9C 1XW5A 4MH2A 1OAZA 2HRNA 2IIYA 3R2QA 4MCUA 3ZIVA 5J9BA 4ML6A 1F9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRN A;  1ML6 A;  3ZIT A;  4K7N A;  5ECO B;  2I3Y A;  4OCF A;  4IHU A;  1SD9 A;  1XBS A;  4KCE A;  2H19 A;  3QMX A;  4LL4 B;  4MF6 A;  1X9W B;  4K6X A;  3UVT A;  2QGV A;  1GP1 A;  4YQM A;  3KZQ A;  2H01 A;  2YWN A;  5J5N A;  3P90 A;  5F06 A;  4NAX A;  3E9J B;  2GSS A;  3BD2 A;  3LOR A;  4ZBA A;  1NW2 A;  1VF4 A;  3GA4 A;  1K0M A;  4HS1 A;  3TOU A;  2ALB A;  3VK9 A;  4IQ1 A;  1SL0 B;  3J7Y k;  4JR6 A;  1ST9 A;  4ISD A;  4N11 A;  4KSM A;  2X8G A;  2N5F A;  3ERF A;  2NVL A;  4HJ2 A;  1TK8 B;  4KDY A;  4BPY A;  3W8J A;  4G9H A;  3BCI A;  1ZYE A;  3TGZ A;  5JCG A;  2A2S A;  1KTE A;  2JAD A;  5B6N A;  3KD0 A;  1FB0 A;  2B1L A;  3EIN A;  3ZTL A;  1U3A A;  2GLR A;  1T3B A;  4OO4 A;  5C04 A;  1J0F A;  5ABR A;  1Q4J A;  2WJU A;  1UN2 A;  2R4V A;  4MH3 A;  5DJM A;  1TOF A;  3LG6 A;  1PSQ A;  1FVK A;  2WGR A;  2GSQ A;  4G19 A;  4RUV A;  2L4Q A;  2C80 A;  4TN8 A;  3VWV A;  2B6M A;  3DIE A;  4Q5Q A;  2AAW A;  4EL1 A;  1B9Y C;  2V6K A;  4MJC A;  2AV4 A;  2DJ2 A;  3QFA C;  1M9A A;  1XOB A;  2O85 A;  2V2G A;  1SKS B;  5E4W A;  1R4W A;  3F6D A;  1V40 A;  4EDZ A;  2XBQ A;  4WF5 A;  3F4S A;  1ZZY A;  1BQ7 A;  4K9Z A;  3CSJ A;  5G1K A;  1O7U A;  1PKZ A;  3KCM A;  1J9B A;  4EF0 A;  1AQX A;  3GKN A;  3DVW A;  3APS A;  3HJM A;  3VI7 A;  3HZ4 A;  4TKY A;  2LTK A;  4KGI A;  4F03 A;  1K0A A;  5HR3 A;  2JSY A;  3BJ5 A;  2HZE A;  1XIY A;  4PXO A;  2DML A;  3TB2 A;  4DSQ A;  3GST A;  4CW9 A;  3ZIJ A;  3C1R A;  4KX4 A;  3TKS A;  1GSF A;  2H70 A;  1B48 A;  4JZQ A;  2ON5 A;  1NSW A;  1T1V A;  1MEK A;  3KMO A;  2H1A A;  4HQS A;  4Z7X A;  1W4V A;  4WEY A;  4ECI A;  2GVP A;  4GF0 A;  1M2A A;  2C0D A;  4ZBB A;  2FA8 A;  4ACS A;  4YAV A;  1GL8 A;  1JZD A;  4ZBD A;  1FW1 A;  1JLV A;  2LQO A;  4OMV A;  5CRE A;  1SD8 A;  1XW6 A;  2I1U A;  5IO2 A;  2G2Q A;  3KP9 A;  3L0H A;  1WP0 A;  2IFQ B;  3FY7 A;  3ZML A;  1JZO A;  2EC4 A;  4F0C A;  2GDR A;  5DJL A;  5LD0 A;  1PMT A;  3LXT A;  2IMI A;  3K8N A;  2GTU A;  4WR5 A;  2A4V A;  3HVS A;  1Y25 A;  2LV3 A;  2C3T A;  4HU7 A;  1A23 A;  3GL3 A;  5JWO B;  1Z9H A;  2JL4 A;  4IJI A;  4ULX A;  1FOV A;  1A2L A;  6GSW A;  3F8U A;  14GS A;  4ID0 A;  4KB3 A;  2XPD A;  3HDC A;  3M9K A;  2B7J A;  4EC0 A;  4L8E A;  2PVO C;  3TKP A;  5CRD A;  2FD3 A;  2FHE A;  5HQP A;  2VIM A;  1RW1 A;  4N0Z A;  4D73 B;  1GTA A;  1K0C A;  5D9X A;  3D21 A;  3QR6 A;  4NMU A;  2EIQ A;  4NWY A;  5EL8 A;  8GSS A;  1F37 A;  4XRA A;  1XWC A;  1MD4 A;  3UBK A;  3IHQ A;  1WIK A;  1ERW A;  3GV1 A;  2DJ1 A;  1YF1 A;  4ZB9 A;  5CNW A;  1AUC A;  2R37 A;  5EPF A;  2GZZ A;  3BBY A;  2H73 A;  2PBJ A;  4G10 A;  4I6X A;  3QD9 A;  1VF1 A;  3TJK A;  3CTG A;  4RQX A;  9GSS A;  3KJY A;  3HJO A;  2H6Z A;  1VRS D;  1AIU A;  3SBC A;  1GTI A;  4AJ7 A;  3KH9 A;  1GNE A;  2PN8 A;  1YEX A;  2B7K A;  2HXK A;  3GYK A;  5DAK A;  2HT9 A;  1VF3 A;  1SK0 A;  4EO3 A;  5AN1 A;  3IK9 A;  2AUV A;  4EVM A;  3ED3 A;  3TJJ A;  4MF7 A;  2H76 A;  5D9T A;  3NOF A;  4DSS A;  2OE1 A;  3UMA A;  2H1D A;  1PX6 A;  2XHF A;  4IN0 A;  4I2U A;  3A5W A;  4XIH A;  1B4P A;  4XRD A;  1PL2 A;  4TW5 A;  4XS1 A;  4N30 A;  3DVX A;  3WYW A;  2RII A;  3IE3 A;  2GQL A;  4KA0 A;  5F8B A;  2OBI A;  2NTO A;  4MA9 A;  3E0U A;  1USB A;  2X99 A;  4ZL9 A;  5D93 A;  3ZVJ A;  3D0Z A;  4RI7 A;  1Z6N A;  4ZL7 A;  5A4V A;  1B4Q A;  2JZR A;  2P5R A;  4PNF A;  4I97 A;  1F2E A;  5FT3 A;  2VLV A;  1FVJ A;  2PWJ A;  1XVW A;  4PQ1 A;  5HR0 A;  3ZRD A;  2LST A;  11GS A;  1FHE A;  1GLQ A;  1WJK A;  2VL3 A;  3KGK A;  3NIV A;  3ZFB A;  1A8Y A;  1XWG A;  4F2I A;  2B5Y A;  5IMF A;  4IS0 A;  4BWS A;  1EOH A;  2J23 A;  4MF5 A;  3IPZ A;  4GTU A;  1X0R A;  3UIW A;  2WZ9 A;  4AJ6 A;  1GSD A;  2OKA A;  1ZCP A;  3W8S A;  1K3O A;  1OVN A;  3KM6 A;  3LJR A;  1XCC A;  3QCP A;  5AIS A;  2MMZ A;  2YV7 A;  2R5G A;  4KW6 A;  1AC1 A;  3HD5 A;  3L9V A;  3KTB A;  2YP6 A;  3HCZ A;  2MMN A;  3UAP A;  1H75 A;  4L5L A;  3EE2 A;  2OJL A;  3VWX A;  1SEN A;  1SJZ A;  3GIX A;  1ACV A;  2EIO A;  4POL A;  1OC3 A;  5HFI A;  3A2W A;  3TKQ A;  2VM1 A;  5ECK B;  4AJ8 A;  4EUY A;  1HD2 A;  5B6M A;  1GUK A;  1S3C A;  1V57 A;  1AAZ A;  2H0H A;  4GRF A;  4NXI A;  13GS A;  5D73 A;  4XCS A;  2ZNM A;  3WT1 A;  2IMF A;  3L4N A;  1AXD A;  5ECI B;  1UVZ A;  2MMO A;  4AGS A;  2CAQ A;  2VD1 A;  4GCI A;  3RAZ A;  5CAX A;  4ECJ A;  5IMA A;  1QK8 A;  2I81 A;  1WRY A;  1ABA A;  5DQS A;  1SL1 B;  3J7Y b;  4IW9 A;  2O89 A;  3KTL A;  10GS A;  2J9H A;  4WBJ A;  4OD7 A;  1V9W A;  1SL2 B;  18GS A;  2VL2 A;  3G7Y A;  1A2J A;  1PL1 A;  5DAL B;  2FWE A;  4POM A;  5AGY A;  5GST A;  4PUF C;  2YAN A;  5D9V A;  5IQY A;  3JCM L;  1G6Y A;  2R2J A;  1HNA A;  4LMW A;  5H5Q A;  5DQY A;  5LCZ A;  1GUM A;  2YN1 A;  3PH9 A;  3DRN A;  3EMX A;  2H71 A;  4WET A;  5L71 A;  3GKX A;  2QC7 A;  2PUK C;  5GSS A;  6GST A;  6GSS A;  2VO4 A;  1X5C A;  1GNW A;  2WS2 A;  2RM5 A;  1Z7R A;  4K8M A;  2CVD A;  2K6V A;  1K0O A;  3C73 A;  1M0U A;  1TP9 A;  2R6K A;  1I9D A;  2JZS A;  2AYT A;  5J9C A;  2HZF A;  4MPG A;  2FGX A;  5G2Z A;  3GKK A;  3L9U A;  2VCW A;  2IMD A;  3Q19 A;  5C00 A;  1J08 A;  3DKS A;  4JE1 A;  2F8F A;  4V2L A;  4F9Z A;  3VPT A;  3U6V A;  3F4R A;  4I5Q A;  2VOC A;  2L5O A;  2YV9 A;  2C3Q A;  1FAA A;  5IPH A;  3H79 A;  3GH6 A;  4HOJ A;  1QFN A;  4YH2 A;  1DBY A;  3FKF A;  2KP1 A;  2L6C A;  1IYI A;  5FWG A;  2TRC P;  2KHP A;  2N5B A;  3IV4 A;  3Q74 A;  4NV2 A;  2KOK A;  4QL7 A;  1K3L A;  2GST A;  3GX0 A;  1BJX A;  4Q5N A;  1K3Y A;  3BOA A;  2VM2 A;  3ZVJ D;  4LL1 B;  2F3M A;  4E8H A;  1BYE A;  5J3R A;  1YDK A;  3SWL A;  4TR1 A;  3KP8 A;  3WGD A;  5JCW A;  2P31 A;  1ILO A;  2K8V A;  1TI1 A;  4MLY A;  4IVF A;  4YAP A;  4MK3 A;  4XS4 A;  1I5G A;  4KH7 A;  4GWR A;  4TR0 A;  1WE0 A;  4TXO A;  4IJ3 A;  2YPM A;  1QXH A;  3MWH A;  2M72 A;  2CA8 A;  2O87 A;  3G9B A;  2CX3 A;  4FH8 A;  3VWU A;  1R26 A;  2H75 A;  4LA1 A;  2WUL A;  1XFL A;  3F3R A;  5ELG A;  1TW9 A;  1PA3 A;  2DIZ A;  1BX9 A;  2DBC A;  2H1B A;  3W6G A;  4MDC A;  3ZFL A;  1KNG A;  3PGT A;  2PER A;  1VGL A;  2RUE A;  2OA7 A;  2ES7 A;  4MMM A;  2VCX A;  6GSU A;  2R3X A;  5B8B A;  4O92 A;  1Z5Y E;  2VAF A;  3IAM 2;  3KH7 A;  4NV5 A;  2WRT A;  5G31 A;  5CP1 A;  1O6J A;  2FNO A;  2QKE A;  2AHE A;  2KLX A;  2GZP A;  2CVB A;  1TDI A;  5ECP B;  4H86 A;  1OYJ A;  3WD6 A;  1WPI A;  2RLI A;  4O5R A;  4MP4 A;  2HRF A;  3QDN A;  2MMA A;  3QPM A;  3ME7 A;  4EKZ A;  3TUE A;  1GSU A;  4OFT A;  3TKR A;  1DUG A;  3LYK A;  1PX7 A;  3UJ1 A;  4FIW A;  1CQH A;  3DXB A;  4FYU A;  1X5E A;  3DML A;  1ZGN A;  3TJG A;  1A2M A;  1XWK A;  1YZX A;  3EUR A;  1ZMA A;  4RI6 A;  2OE0 A;  3APQ A;  2PMT A;  5IMD A;  3ZRE A;  4BVY A;  5IMC A;  1JLW A;  3EYT A;  4ECC A;  2H74 A;  3C8E A;  3GNJ A;  4HZ4 A;  5H5R A;  6GSY A;  3HYP A;  4IKH A;  1THX A;  1SU9 A;  4GXZ A;  3D4T A;  1O81 A;  2YWM A;  2OE3 A;  4FO5 A;  4IEL A;  1Q98 A;  3GHA A;  1OC9 A;  1ERT A;  3TRQ A;  4POK A;  1R5A A;  2GZY A;  3VLN A;  4OCE A;  4ZIJ A;  3US3 A;  1ERV A;  1GTB A;  1RK4 A;  2PVQ A;  2XPE A;  2I9H A;  1YJ6 A;  5IIZ A;  4ZXG A;  5ID2 A;  2C1Y A;  1TXX A;  19GS A;  3LGC A;  3FR6 A;  5ECS A;  2CVK A;  1EGO A;  4L5O A;  1AQW A;  5ECR B;  4LMV A;  1FB6 A;  2P0G A;  1MDJ A;  3FW2 A;  2LS5 A;  2X8C A;  4IP1 A;  5D96 A;  1X9M B;  2E7P A;  3QOU A;  3TJF A;  1Z7P A;  1EV9 A;  4CDO A;  2CZ3 A;  1A0R P;  2REM A;  2TIR A;  4OWY A;  1GLP A;  4RQR A;  1EP7 A;  2QSI A;  1R5P A;  1X5D A;  2LJR A;  3I9V 2;  1XXU A;  2IMK A;  3HY2 A;  2CT6 A;  1EEM A;  3M9J A;  3CRT A;  2YJH A;  5DCH A;  3Q18 A;  3G7J A;  2ZUP A;  3F9U A;  2O7K A;  1YY7 A;  4CHS A;  2VD0 A;  3DD3 A;  3D6I A;  1PD2 1;  4OO5 A;  1M7T A;  4F0B A;  2L6D A;  4BA7 A;  5ECL B;  3F63 A;  2E2M A;  3CSI A;  2DJ0 A;  3UBL A;  4FYC A;  2XBI A;  1EGR A;  4HEA 2;  3VWW A;  1MTC A;  1O8X A;  2CQ9 A;  2FWF A;  3F4T A;  3GKM A;  5H5S A;  5J41 A;  1LJR A;  1HQO A;  3QAG A;  2TRX A;  3PIN A;  4NPB A;  5DBQ A;  3APO A;  5B7C A;  3TJB A;  1UA5 A;  3QFB C;  2BJX A;  3EU3 A;  1GUL A;  1MDK A;  3O6T A;  2OAC A;  1B8X A;  5DDL A;  1XZO A;  2VLU A;  1UC7 A;  3VPQ A;  4K0N A;  4QL9 A;  3FR9 A;  5JWQ B;  1ON4 A;  4TR3 A;  1V58 A;  5DAK B;  3H1N A;  2K18 A;  1AW9 A;  3IC4 A;  4N0V A;  3L9S A;  3EVI A;  3M3M A;  5KN1 A;  4ZB6 A;  3ERW A;  1TTZ A;  4DSS B;  1HNC A;  4FYB A;  3VI5 A;  5ECH B;  2GT5 A;  3IAS 2;  3H93 A;  2KUC A;  1E6B A;  2DSA A;  2IJY A;  3D22 A;  2OAD A;  2N5A A;  4I2T A;  3GUS A;  2YZU A;  3HHV A;  3N5O A;  3C71 A;  2I4A A;  5IMV A;  3IK7 A;  1TRV A;  2CAI A;  1YKA A;  3GH9 A;  5JWR B;  4WXT A;  4Q5R A;  3ZYW A;  3O3T A;  3F6F A;  2GGT A;  4POB A;  5F0G A;  3GTU B;  1W89 A;  2IME A;  2A2R A;  4MZW A;  1C72 A;  3CMI A;  2WDU A;  2FUG 2;  1SYX A;  1QMV A;  1XVQ A;  4HI7 A;  2NDO A;  3MAK A;  2C8U A;  5JCU A;  1G7O A;  1O8W A;  5KN3 A;  5HR1 A;  4XS6 A;  3GMF A;  5GAP D;  3N9J A;  5GAN D;  3HXS A;  4GLT A;  4YQV A;  2JAC A;  1EV4 A;  3FZ5 A;  1G7E A;  1M99 A;  2L5L A;  2M80 A;  6GSX A;  3ZMK A;  2B5X A;  2FWG A;  4WBR D;  2CV4 A;  5F05 A;  5G5F A;  4XTS A;  2DC5 A;  3FZ9 A;  1GRX A;  2YNX A;  4JU5 A;  5INY A;  2PPT A;  3A3T A;  1JHB A;  1HYU A;  5KN0 A;  3I6A A;  2LJA A;  3RBT A;  1SJ6 A;  4J2F A;  2LRC A;  2YOI A;  2IL3 A;  3EC3 A;  1U3I A;  1WOU A;  4MJE A;  3C1S A;  4PGT A;  4IQA A;  4LLR A;  5D8I A;  1A0F A;  2VCT A;  1GSS A;  1ZYQ B;  2F9S A;  2LEG A;  4PQH A;  2VL9 A;  5D9W A;  3DWV A;  2GQK A;  1ZOF A;  2MBT A;  2H0I A;  3QAW A;  5A4W A;  3F0I A;  4YQU A;  3BCK A;  2LNS A;  3IRA A;  1K0B A;  5CRW A;  2H66 A;  1NM3 A;  4DVC A;  3CYN A;  1R7H A;  3IOS A;  2F8A A;  1TRU A;  2B5E A;  3UAR A;  1K0N A;  4JRR A;  5AIV A;  3L78 A;  1DE1 A;  3EU4 A;  1GSY A;  1T4Y A;  3CXG A;  2BTO T;  1TK0 B;  3LYP A;  2HNL A;  12GS A;  1DSB A;  3QAV A;  4X0X A;  5IOX A;  4KSO A;  3V1W A;  4X43 A;  1SYR A;  1TRS A;  4PNG A;  3M8N A;  1EZK A;  2V32 A;  3RHB A;  2E0Q A;  4AF2 A;  4K0G A;  1Z6M A;  1OE7 A;  2NPB A;  2X64 A;  3TKS E;  4BWQ A;  1AQV A;  3PR8 A;  1WWJ A;  2FY6 A;  4JBB A;  1MD3 A;  3H8Q A;  1RQM A;  4J57 E;  1H4O A;  1T4Z A;  5KN2 A;  4EXJ A;  1JFU A;  3DGQ A;  2H1G A;  1JZW A;  3IDV A;  2C0F A;  4NHW A;  2OBK A;  2XC2 A;  1PN9 A;  3FK8 A;  1KEB A;  1ZL9 A;  3LEF A;  4TR4 A;  3CRU A;  4HJM A;  2VUP A;  4F82 A;  5ECM B;  4GQF A;  3P7X A;  4GSS A;  1G6W A;  3NZN A;  5J4U A;  2H0G A;  1QGV A;  3UVH A;  1A8L A;  4HDE A;  2FWH A;  2DIY A;  2DLX A;  4G2E A;  5ELA A;  4KND A;  2IFQ A;  5ENU A;  3LSZ A;  4TR1 B;  1LBK A;  3GN3 A;  4GST A;  3MNG A;  4HU9 A;  4V2M A;  2IWT A;  5A4U A;  4XS4 B;  5ECN B;  4WR4 A;  4HZ2 A;  1T7P B;  3I43 A;  5LNK e;  1TK5 B;  3RDW A;  5GZZ B;  1NHO A;  1BED A;  1XPV A;  5E59 A;  4TXO B;  4MZB A;  4PUR A;  1N2A A;  2HI7 A;  1EWX A;  4JED A;  2K8S A;  2MBS A;  5F07 A;  2YZH A;  3OR5 A;  1GUH A;  2L59 A;  3D5J A;  3EMP A;  1XWA A;  4Q5F A;  1GWC A;  1DE2 A;  2IPA A;  4TRX A;  5G1L A;  3U5R E;  2H6X A;  2RM6 A;  5CRH A;  2K9F A;  1GSE A;  5CO3 A;  1S3D A;  2FLS A;  3TDG A;  4ECB A;  3H4K A;  3DEX A;  3GL5 A;  3WGX A;  2LRT A;  4D73 A;  4IP6 A;  3KEB A;  7GSS A;  4L0W A;  1QUW A;  1O73 A;  5DVB A;  1YEP A;  4ILF A;  3FZ4 A;  5KEJ A;  2HE3 A;  4BL7 A;  2IN3 A;  3FYG A;  4OFM A;  2HZE B;  3M1G A;  4XHM A;  5HR2 A;  3VFI A;  1M2D A;  4NHZ A;  2H30 A;  3UOM A;  1TKD B;  1XW9 A;  4KDX A;  1HNB A;  3FHK A;  3ZZX A;  1SJI A;  1SK2 A;  3P2A A;  2ON7 A;  3GSS A;  1T00 A;  1V2A A;  2C3N A;  3HZ8 A;  4KAE A;  2G0F A;  3HVX A;  1ERU A;  5IPG A;  5B8A A;  2GSR A;  5AIX A;  2DJ3 A;  2GS3 A;  5DCG A;  3MDK A;  3C7M A;  2C0G A;  2DMM A;  4K7O A;  4I8B A;  1MDI A;  2M46 A;  2V6O A;  4TXV A;  4GSN A;  2V41 A;  2C0E A;  2V1M A;  3AY8 A;  4HQZ A;  3FZA A;  4L0U A;  1U6T A;  1TU8 A;  3EWL A;  4ML1 A;  2LUS A;  3I69 A;  1YQ1 A;  1EOG A;  2FCH A;  2HSH A;  2YWO A;  2F51 A;  2Z9S A;  2B1K A;  4GQC A;  3ZLP A;  2CZ2 A;  1PGT A;  1BG5 A;  5ECQ B;  4ZIL A;  3ZL5 A;  1WMJ A;  1OC8 A;  1FO5 A;  3CSH A;  1PQN A;  6GSV A;  1OC9 B;  4MJA A;  5A5K A;  4PX1 A;  2VL2 C;  17GS A;  3M0F A;  2L57 A;  2DJJ A;  1N8J A;  2JZT A;  1LU4 A;  2AB6 A;  4EE0 A;  1T8E B;  5ID2 B;  1GTU A;  2GQM A;  3WT2 A;  3TOT A;  4V2N A;  2JSZ A;  1Y6E A;  3TRP A;  3LXZ A;  3RHC A;  2YJ7 A;  3CTF A;  5IOW A;  2O8V B;  1Z3E A;  3E3E A;  3MSZ A;  16GS A;  2C4J A;  4N10 A;  1FG4 A;  2GT6 A;  20GS A;  1URM A;  2WCI A;  5HFG A;  1F6M C;  2H6Y A;  1CQG A;  1PRX A;  1M9B A;  4HUA A;  1B9X C;  1THO A;  4K2D A;  4DSR A;  3UL3 A;  3ME8 A;  3IBH A;  2WFC A;  1XWB A;  2X8H A;  4O32 A;  5IO0 A;  4PUA A;  2HLS A;  3GUR A;  5CYY A;  2MZC A;  2PGT A;  1O85 A;  1GH2 A;  5HFK A;  4MPF A;  4WF4 A;  3HA9 A;  4OFN A;  2DJK A;  3RPP A;  1TI3 A;  1NHY A;  3GTU A;  3IA1 A;  4KCA A;  1TU7 A;  5COH A;  3S9F A;  3DYR A;  3FR3 A;  2EIR A;  3P8W A;  4JR4 A;  1BAY A;  5EVO A;  2LNT A;  5G30 A;  1G0T A;  2H8L A;  4V1A p;  22GS A;  2MYG A;  5IM9 A;  3WGE A;  1V98 A;  2FA4 A;  1U88 A;  3UEM A;  1U87 A;  2P5Q A;  4EDY A;  3IXR A;  4K1F A;  2YWI A;  1PKW A;  4MZC A;  2VCQ A;  1SKW B;  3TRX A;  2RUF A;  1M2B A;  5DAL A;  2WB9 A;  3IR4 A;  2LQQ A;  4IGJ A;  1SK1 A;  2LKU A;  2NBS A;  4IBP A;  2ZCT A;  1OKD A;  1GSQ A;  4WKW A;  4V1A g;  2CX4 A;  3GFK A;  3RPN A;  4TOP A;  3A2V A;  3LFL A;  4O7H A;  4MAB A;  4TVE A;  2BMX A;  2LJK A;  2L4C A;  2JU5 A;  1EP8 A;  2E2G A;  1E2Y A;  3Q6O A;  1K0D A;  1F3B A;  1YKC A;  1TRW A;  3TCO A;  4X1U A;  2HFD A;  1A24 A;  4E8E A;  1EEJ A;  1S3A A;  3A2X A;  1VF2 A;  5G5E A;  1TJD A;  1IYH A;  2VCZ A;  2VCV A;  2VLT A;  3ERG A;  1YF0 A;  3O76 A;  4QQ7 A;  3HKR A;  3KMN A;  3KXO A;  3GX8 A;  5CRG A;  3HVV A;  1X9S B;  3D4M A;  3LWA A;  3TKS C;  5EY6 A;  4KDU A;  4ZB8 A;  4BVX A;  4DEJ A;  4ZL8 A;  4KE3 A;  5FHI A;  2H72 A;  5IMZ A;  1JZR A;  3ISO A;  2B3S A;  4J56 E;  4P3Y B;  1OE8 A;  1KBN A;  3CBU A;  1SKR B;  1XOA A;  3HJP A;  1OKT A;  2D2Z A;  2AJQ B;  3KIJ A;  1QQ2 A;  2KP2 A;  2YCD A;  3GRX A;  2HYX A;  4KUN A;  3VUR A;  4MJB A;  2HSY A;  3LQ7 A;  3FEU A;  3FRC A;  4PQI A;  1F3A A;  3G7I A;  4K7I A;  3F3Q A;  2PU9 C;  1XW5 A;  4MH2 A;  1OAZ A;  2HRN A;  2IIY A;  3R2Q A;  4MCU A;  3ZIV A;  5J9B A;  4ML6 A;  1F9M A; 
#chains in the Genus database with same CATH topology
 2LRN A;  1ML6 A;  3ZIT A;  4K7N A;  5ECO B;  2I3Y A;  4OCF A;  4IHU A;  1SD9 A;  1XBS A;  4KCE A;  2H19 A;  3QMX A;  4LL4 B;  4MF6 A;  1X9W B;  4K6X A;  3UVT A;  2QGV A;  1GP1 A;  4YQM A;  3KZQ A;  2H01 A;  2YWN A;  5J5N A;  3P90 A;  5F06 A;  4NAX A;  3E9J B;  2GSS A;  3BD2 A;  3LOR A;  4ZBA A;  1NW2 A;  1VF4 A;  3GA4 A;  1K0M A;  4HS1 A;  3TOU A;  2ALB A;  3VK9 A;  4IQ1 A;  1SL0 B;  3J7Y k;  4JR6 A;  1ST9 A;  4ISD A;  4N11 A;  4KSM A;  4O5Q A;  2X8G A;  2N5F A;  3ERF A;  2NVL A;  4HJ2 A;  1TK8 B;  4KDY A;  4BPY A;  3W8J A;  4G9H A;  3BCI A;  1ZYE A;  3TGZ A;  5JCG A;  2A2S A;  1KTE A;  2JAD A;  5B6N A;  3KD0 A;  1FB0 A;  2B1L A;  3EIN A;  3ZTL A;  1U3A A;  2GLR A;  1T3B A;  4OO4 A;  5C04 A;  1J0F A;  5ABR A;  1Q4J A;  2WJU A;  1UN2 A;  2R4V A;  4MH3 A;  5DJM A;  1TOF A;  3LG6 A;  1PSQ A;  1FVK A;  2WGR A;  2GSQ A;  4G19 A;  4RUV A;  2L4Q A;  2C80 A;  4TN8 A;  3VWV A;  2B6M A;  3DIE A;  4Q5Q A;  2AAW A;  4EL1 A;  1B9Y C;  2V6K A;  4MJC A;  2AV4 A;  2DJ2 A;  3QFA C;  1M9A A;  1XOB A;  2O85 A;  2V2G A;  1SKS B;  5E4W A;  1R4W A;  3F6D A;  1V40 A;  4EDZ A;  2XBQ A;  4WF5 A;  3F4S A;  1ZZY A;  1BQ7 A;  4K9Z A;  3CSJ A;  5G1K A;  1O7U A;  1PKZ A;  2UZ8 A;  3KCM A;  1J9B A;  4EF0 A;  1AQX A;  3GKN A;  3DVW A;  3APS A;  3HJM A;  3VI7 A;  3HZ4 A;  4TKY A;  2LTK A;  4KGI A;  4F03 A;  1K0A A;  5HR3 A;  2JSY A;  3BJ5 A;  2HZE A;  1XIY A;  4PXO A;  4ICY A;  2DML A;  3TB2 A;  4DSQ A;  3GST A;  4CW9 A;  3ZIJ A;  3C1R A;  4KX4 A;  3TKS A;  1GSF A;  2H70 A;  1B48 A;  4JZQ A;  2ON5 A;  1NSW A;  1T1V A;  1MEK A;  3KMO A;  2H1A A;  4HQS A;  4Z7X A;  1W4V A;  4WEY A;  4ECI A;  2GVP A;  4GF0 A;  1M2A A;  2C0D A;  4ZBB A;  2FA8 A;  2DKI A;  4ACS A;  4YAV A;  1GL8 A;  1JZD A;  4ZBD A;  1FW1 A;  1JLV A;  2LQO A;  4OMV A;  4Z2R A;  3FMW A;  5CRE A;  1SD8 A;  1XW6 A;  2I1U A;  5IO2 A;  2G2Q A;  3KP9 A;  3L0H A;  1WP0 A;  2IFQ B;  3FY7 A;  3ZML A;  4USS A;  1JZO A;  2EC4 A;  4F0C A;  2GDR A;  5DJL A;  5LD0 A;  1PMT A;  3LXT A;  2IMI A;  3K8N A;  2GTU A;  4WR5 A;  2A4V A;  3HVS A;  1Y25 A;  2LV3 A;  2C3T A;  4HU7 A;  1A23 A;  3GL3 A;  5JWO B;  1Z9H A;  2JL4 A;  4IJI A;  4ULX A;  1FOV A;  1A2L A;  6GSW A;  3F8U A;  14GS A;  4ID0 A;  4KB3 A;  2XPD A;  4K5R A;  3HDC A;  3M9K A;  2B7J A;  4EC0 A;  4L8E A;  2PVO C;  3TKP A;  5CRD A;  2FD3 A;  2FHE A;  5HQP A;  2VIM A;  1RW1 A;  2HSM A;  4N0Z A;  4D73 B;  1GTA A;  1K0C A;  4BVY B;  5D9X A;  3D21 A;  3QR6 A;  4NMU A;  2EIQ A;  4NWY A;  5EL8 A;  8GSS A;  1F37 A;  4XRA A;  1XWC A;  4BL7 B;  1MD4 A;  3UBK A;  3IHQ A;  1WIK A;  1ERW A;  3GV1 A;  2DJ1 A;  1YF1 A;  4ZB9 A;  5CNW A;  1AUC A;  2R37 A;  5EPF A;  2GZZ A;  3BBY A;  2H73 A;  2PBJ A;  4G10 A;  4I6X A;  3QD9 A;  1VF1 A;  3TJK A;  3CTG A;  4RQX A;  9GSS A;  3KJY A;  3HJO A;  2H6Z A;  1VRS D;  1AIU A;  3SBC A;  2HRA A;  1GTI A;  4AJ7 A;  3KH9 A;  1GNE A;  2PN8 A;  1YEX A;  2B7K A;  2HXK A;  3GYK A;  5DAK A;  2HT9 A;  5BRT A;  1VF3 A;  1SK0 A;  4EO3 A;  5AN1 A;  3IK9 A;  2AUV A;  4EVM A;  3ED3 A;  3TJJ A;  4MF7 A;  2H76 A;  5D9T A;  3NOF A;  4DSS A;  2OE1 A;  3UMA A;  2H1D A;  1PX6 A;  2XHF A;  4IN0 A;  4I2U A;  3A5W A;  1PN0 A;  4XIH A;  1B4P A;  4XRD A;  1PL2 A;  4TW5 A;  4XS1 A;  4N30 A;  3DVX A;  3WYW A;  2RII A;  3IE3 A;  2GQL A;  4KA0 A;  5F8B A;  2OBI A;  2NTO A;  4MA9 A;  3E0U A;  1USB A;  2X99 A;  4ZL9 A;  5D93 A;  3ZVJ A;  3D0Z A;  4RI7 A;  1Z6N A;  4ZL7 A;  3A5I A;  5A4V A;  1B4Q A;  2JZR A;  2P5R A;  4PNF A;  4I97 A;  1F2E A;  5FT3 A;  2R0G A;  2VLV A;  1FVJ A;  2PWJ A;  1XVW A;  4PQ1 A;  5HR0 A;  3ZRD A;  2LST A;  11GS A;  1FHE A;  1GLQ A;  1WJK A;  2VL3 A;  3KGK A;  3NIV A;  3ZFB A;  1A8Y A;  1XWG A;  4F2I A;  2B5Y A;  5IMF A;  4IS0 A;  4BWS A;  1EOH A;  2J23 A;  4MF5 A;  3IPZ A;  4GTU A;  1X0R A;  3UIW A;  2WZ9 A;  4AJ6 A;  1GSD A;  2OKA A;  1ZCP A;  3W8S A;  1K3O A;  1OVN A;  3KM6 A;  3LJR A;  1XCC A;  3QCP A;  5AIS A;  2MMZ A;  2DKH A;  2YV7 A;  2R5G A;  4KW6 A;  1AC1 A;  3HD5 A;  3L9V A;  3KTB A;  2YP6 A;  1XG8 A;  3HCZ A;  2MMN A;  3UAP A;  1H75 A;  4L5L A;  3EE2 A;  2OJL A;  3VWX A;  1SEN A;  1SJZ A;  3GIX A;  1ACV A;  2EIO A;  4POL A;  1OC3 A;  5HFI A;  3A2W A;  3TKQ A;  2VM1 A;  5ECK B;  4AJ8 A;  4EUY A;  4G0I A;  1HD2 A;  5B6M A;  1GUK A;  1S3C A;  1V57 A;  1AAZ A;  2H0H A;  4GRF A;  4NXI A;  13GS A;  5D73 A;  4XCS A;  2ZNM A;  3WT1 A;  2IMF A;  3L4N A;  1AXD A;  5ECI B;  1UVZ A;  2MMO A;  4AGS A;  2CAQ A;  2VD1 A;  4GCI A;  3RAZ A;  5CAX A;  4ECJ A;  5IMA A;  1QK8 A;  2I81 A;  1WRY A;  1ABA A;  5DQS A;  4PTS A;  1SL1 B;  3J7Y b;  4IW9 A;  2O89 A;  3KTL A;  10GS A;  2J9H A;  4WBJ A;  4OD7 A;  1V9W A;  1SL2 B;  18GS A;  2VL2 A;  3G7Y A;  1A2J A;  1PL1 A;  5DAL B;  2FWE A;  4POM A;  5AGY A;  5GST A;  4PUF C;  2YAN A;  5D9V A;  5IQY A;  3JCM L;  1G6Y A;  2R2J A;  1HNA A;  4LMW A;  5H5Q A;  5DQY A;  5LCZ A;  1GUM A;  2YN1 A;  3PH9 A;  3DRN A;  3EMX A;  2H71 A;  4WET A;  5L71 A;  3GKX A;  2QC7 A;  2PUK C;  5GSS A;  6GST A;  6GSS A;  2VO4 A;  1X5C A;  1GNW A;  2WS2 A;  2RM5 A;  1Z7R A;  4K8M A;  1PFO A;  2CVD A;  2K6V A;  1K0O A;  3C73 A;  1M0U A;  1TP9 A;  2R6K A;  1I9D A;  2JZS A;  2AYT A;  5J9C A;  2HZF A;  4MPG A;  2FGX A;  5G2Z A;  5KOW A;  1ZYP A;  3GKK A;  3L9U A;  2VCW A;  2IMD A;  3Q19 A;  5C00 A;  1J08 A;  3DKS A;  4JE1 A;  2F8F A;  4V2L A;  4F9Z A;  3VPT A;  3U6V A;  3F4R A;  4I5Q A;  2VOC A;  2L5O A;  2YV9 A;  2C3Q A;  1FAA A;  5IPH A;  3H79 A;  3GH6 A;  4HOJ A;  1QFN A;  4O5U A;  4YH2 A;  1DBY A;  3FKF A;  2KP1 A;  2L6C A;  1IYI A;  5FWG A;  2TRC P;  2KHP A;  2N5B A;  3IV4 A;  3Q74 A;  4NV2 A;  2KOK A;  4QL7 A;  1K3L A;  2GST A;  3GX0 A;  1BJX A;  4Q5N A;  1K3Y A;  1M3J A;  3BOA A;  2VM2 A;  3ZVJ D;  4LL1 B;  2F3M A;  4E8H A;  1BYE A;  5J3R A;  1YDK A;  3SWL A;  4TR1 A;  3KP8 A;  3WGD A;  5JCW A;  2P31 A;  1ILO A;  2K8V A;  1TI1 A;  4MLY A;  4IVF A;  4YAP A;  4MK3 A;  4XS4 A;  1I5G A;  4KH7 A;  4GWR A;  4TR0 A;  1WE0 A;  4TXO A;  4IJ3 A;  2YPM A;  1QXH A;  3MWH A;  2M72 A;  2CA8 A;  2O87 A;  3G9B A;  2CX3 A;  4FH8 A;  3VWU A;  1R26 A;  2H75 A;  4LA1 A;  2WUL A;  1XFL A;  3F3R A;  5ELG A;  1TW9 A;  4K5S A;  1ZYN A;  1PA3 A;  2DIZ A;  3R3E A;  1BX9 A;  2DBC A;  2H1B A;  3W6G A;  4MDC A;  3ZFL A;  1KNG A;  3PGT A;  2PER A;  1VGL A;  2RUE A;  2OA7 A;  2ES7 A;  4MMM A;  2VCX A;  6GSU A;  2R3X A;  5B8B A;  4O92 A;  1Z5Y E;  2VAF A;  3IAM 2;  3KH7 A;  4NV5 A;  2WRT A;  5G31 A;  5CP1 A;  1O6J A;  2FNO A;  2QKE A;  2AHE A;  2KLX A;  2GZP A;  2CVB A;  1TDI A;  5ECP B;  4H86 A;  4FQU A;  1OYJ A;  3WD6 A;  1WPI A;  2RLI A;  4O5R A;  4MP4 A;  2HRF A;  3QDN A;  2MMA A;  3QPM A;  3ME7 A;  4EKZ A;  3TUE A;  1GSU A;  4OFT A;  3TKR A;  1DUG A;  3LYK A;  1PX7 A;  3UJ1 A;  4FIW A;  1CQH A;  3DXB A;  4FYU A;  1X5E A;  3DML A;  1ZGN A;  3TJG A;  1A2M A;  1XWK A;  1YZX A;  2QA2 A;  3EUR A;  1ZMA A;  4RI6 A;  2OE0 A;  3APQ A;  2PMT A;  5IMD A;  3ZRE A;  4BVY A;  3HVN A;  5IMC A;  1JLW A;  3EYT A;  4ECC A;  2H74 A;  3C8E A;  3GNJ A;  4HZ4 A;  5H5R A;  6GSY A;  3HYP A;  4A5P A;  4IKH A;  1THX A;  1SU9 A;  4GXZ A;  3D4T A;  1O81 A;  2YWM A;  2OE3 A;  4FO5 A;  4IEL A;  1Q98 A;  3GHA A;  1OC9 A;  1ERT A;  3TRQ A;  4POK A;  1R5A A;  2GZY A;  3VLN A;  4OCE A;  4ZIJ A;  3US3 A;  1ERV A;  1GTB A;  1RK4 A;  2PVQ A;  2XPE A;  2I9H A;  1YJ6 A;  5IIZ A;  4ZXG A;  5ID2 A;  2C1Y A;  1TXX A;  19GS A;  3LGC A;  3FR6 A;  5ECS A;  2CVK A;  1EGO A;  4L5O A;  1AQW A;  5ECR B;  4LMV A;  1FB6 A;  2P0G A;  1MDJ A;  3FW2 A;  2LS5 A;  2X8C A;  4IP1 A;  5D96 A;  3PPU A;  1X9M B;  2E7P A;  3QOU A;  3TJF A;  1Z7P A;  1EV9 A;  4CDO A;  2CZ3 A;  1A0R P;  2REM A;  2TIR A;  4OWY A;  1GLP A;  4RQR A;  1EP7 A;  2QSI A;  1R5P A;  1X5D A;  2LJR A;  3I9V 2;  1XXU A;  2IMK A;  3HY2 A;  2CT6 A;  1EEM A;  5KOX A;  3M9J A;  4KF9 A;  3CRT A;  2YJH A;  5DCH A;  3Q18 A;  3G7J A;  2ZUP A;  3F9U A;  2O7K A;  1YY7 A;  4CHS A;  2VD0 A;  3DD3 A;  3D6I A;  1PD2 1;  4OO5 A;  1M7T A;  4F0B A;  2L6D A;  4BA7 A;  5ECL B;  3F63 A;  2E2M A;  3CSI A;  2DJ0 A;  3UBL A;  4FYC A;  2XBI A;  1EGR A;  4HEA 2;  3VWW A;  1MTC A;  1O8X A;  2CQ9 A;  2FWF A;  3F4T A;  3GKM A;  5H5S A;  5J41 A;  1LJR A;  1HQO A;  3QAG A;  2TRX A;  3PIN A;  4NPB A;  5DBQ A;  3APO A;  5B7C A;  3TJB A;  1UA5 A;  3QFB C;  2BJX A;  3EU3 A;  1GUL A;  1MDK A;  3O6T A;  2OAC A;  1B8X A;  5DDL A;  2R0P A;  1XZO A;  2VLU A;  1UC7 A;  3VPQ A;  4K0N A;  4QL9 A;  3FR9 A;  5JWQ B;  1ON4 A;  4TR3 A;  1V58 A;  1FOH A;  5DAK B;  3H1N A;  2K18 A;  1AW9 A;  3IC4 A;  4N0V A;  4Z2T A;  3L9S A;  3EVI A;  3M3M A;  5KN1 A;  4ZB6 A;  3ERW A;  1TTZ A;  2X49 A;  4DSS B;  1HNC A;  4FYB A;  3VI5 A;  5ECH B;  2GT5 A;  3IAS 2;  3H93 A;  2KUC A;  1E6B A;  2DSA A;  2IJY A;  3D22 A;  4X4J A;  3MYD A;  2OAD A;  2N5A A;  4I2T A;  2QA1 A;  3GUS A;  2YZU A;  3HHV A;  3N5O A;  3C71 A;  2I4A A;  5IMV A;  3IK7 A;  1TRV A;  2CAI A;  1YKA A;  3GH9 A;  5JWR B;  4WXT A;  4Q5R A;  3ZYW A;  3O3T A;  3F6F A;  2GGT A;  4POB A;  5F0G A;  3GTU B;  1W89 A;  2IME A;  2A2R A;  4MZW A;  1C72 A;  3CMI A;  2WDU A;  2FUG 2;  1SYX A;  1QMV A;  1XVQ A;  4HI7 A;  2NDO A;  3MAK A;  2C8U A;  5JCU A;  1G7O A;  1O8W A;  5KN3 A;  4Z2U A;  5HR1 A;  4XS6 A;  3GMF A;  5GAP D;  3N9J A;  5GAN D;  3HXS A;  4GLT A;  4YQV A;  4EIP A;  2JAC A;  1EV4 A;  3FZ5 A;  1G7E A;  1M99 A;  2L5L A;  2M80 A;  6GSX A;  3ZMK A;  2B5X A;  2FWG A;  4WBR D;  2CV4 A;  5F05 A;  5G5F A;  4XTS A;  2DC5 A;  3FZ9 A;  1GRX A;  2YNX A;  4JU5 A;  5INY A;  2PPT A;  3A3T A;  1JHB A;  1HYU A;  5KN0 A;  3I6A A;  2LJA A;  3RBT A;  1SJ6 A;  4J2F A;  2LRC A;  2YOI A;  2IL3 A;  3EC3 A;  1U3I A;  1WOU A;  4MJE A;  3C1S A;  4PGT A;  4IQA A;  4LLR A;  5D8I A;  1A0F A;  2VCT A;  1GSS A;  1ZYQ B;  2F9S A;  2LEG A;  4PQH A;  2VL9 A;  3IHG A;  5D9W A;  3DWV A;  2GQK A;  1ZOF A;  2MBT A;  2H0I A;  3QAW A;  5A4W A;  3IC8 A;  3F0I A;  4YQU A;  3BCK A;  2LNS A;  2X4A A;  3IRA A;  1K0B A;  5CRW A;  2H66 A;  1NM3 A;  4DVC A;  3CYN A;  1R7H A;  3IOS A;  2F8A A;  1TRU A;  2B5E A;  3UAR A;  1K0N A;  4BVX B;  3LW9 A;  4JRR A;  5AIV A;  3L78 A;  1DE1 A;  3EU4 A;  1GSY A;  1T4Y A;  3CXG A;  2BTO T;  1TK0 B;  3LYP A;  2HNL A;  12GS A;  1DSB A;  3QAV A;  4X0X A;  5IOX A;  4KSO A;  3V1W A;  4X43 A;  1SYR A;  1TRS A;  4BIK A;  4PNG A;  3M8N A;  1EZK A;  2V32 A;  3RHB A;  2E0Q A;  4AF2 A;  4K0G A;  1Z6M A;  1OE7 A;  2NPB A;  2X64 A;  3TKS E;  4BWQ A;  1AQV A;  3PR8 A;  1WWJ A;  2FY6 A;  4JBB A;  1MD3 A;  3H8Q A;  1RQM A;  4J57 E;  1H4O A;  1T4Z A;  5KN2 A;  4EXJ A;  1JFU A;  3DGQ A;  2H1G A;  1JZW A;  3IDV A;  2C0F A;  4NHW A;  2OBK A;  2XC2 A;  1PN9 A;  3FK8 A;  1KEB A;  1ZL9 A;  3LEF A;  4TR4 A;  3CRU A;  4HJM A;  2VUP A;  4F82 A;  5ECM B;  4GQF A;  3P7X A;  4GSS A;  1G6W A;  4G0K A;  3NZN A;  5J4U A;  2H0G A;  1QGV A;  4CY8 A;  3UVH A;  1A8L A;  4HDE A;  2FWH A;  2DIY A;  2DLX A;  4G2E A;  4MNN A;  5ELA A;  5BMU A;  4KND A;  2IFQ A;  5ENU A;  3LSZ A;  4TR1 B;  1LBK A;  3GN3 A;  4GST A;  3MNG A;  4HU9 A;  4V2M A;  4G0L A;  2IWT A;  5A4U A;  4XS4 B;  5ECN B;  4WR4 A;  4HZ2 A;  1T7P B;  3I43 A;  5LNK e;  2A4H A;  1TK5 B;  3RDW A;  5GZZ B;  1NHO A;  1BED A;  1XPV A;  5E59 A;  4TXO B;  4MZB A;  4PUR A;  1N2A A;  2HI7 A;  1EWX A;  4JED A;  2K8S A;  2MBS A;  5F07 A;  2YZH A;  3OR5 A;  1GUH A;  4CY6 A;  2L59 A;  3D5J A;  3EMP A;  1XWA A;  4Q5F A;  1GWC A;  1DE2 A;  2IPA A;  4TRX A;  5G1L A;  3U5R E;  2H6X A;  2RM6 A;  5CRH A;  2K9F A;  1GSE A;  5CO3 A;  1S3D A;  2FLS A;  3TDG A;  4ECB A;  3H4K A;  3DEX A;  3GL5 A;  3WGX A;  2LRT A;  4D73 A;  4IP6 A;  3KEB A;  7GSS A;  4L0W A;  1QUW A;  1O73 A;  5DVB A;  1YEP A;  4ILF A;  3FZ4 A;  5KEJ A;  2HE3 A;  4BL7 A;  2IN3 A;  3FYG A;  4OFM A;  2HZE B;  3M1G A;  4XHM A;  5HR2 A;  3VFI A;  1M2D A;  4NHZ A;  2H30 A;  3UOM A;  1TKD B;  1XW9 A;  4KDX A;  1HNB A;  3FHK A;  3ZZX A;  1SJI A;  1SK2 A;  3P2A A;  2ON7 A;  3GSS A;  1T00 A;  1V2A A;  2C3N A;  3HZ8 A;  4KAE A;  2G0F A;  3HVX A;  1ERU A;  5IPG A;  5B8A A;  2GSR A;  5AIX A;  2DJ3 A;  2GS3 A;  5DCG A;  3MDK A;  3C7M A;  2C0G A;  4YKF A;  2DMM A;  4K7O A;  4I8B A;  1MDI A;  2M46 A;  2V6O A;  4TXV A;  4GSN A;  2V41 A;  2C0E A;  2V1M A;  3AY8 A;  4HQZ A;  3FZA A;  4L0U A;  1U6T A;  1TU8 A;  3EWL A;  4ML1 A;  2LUS A;  3I69 A;  1YQ1 A;  1EOG A;  2FCH A;  2HSH A;  2YWO A;  2F51 A;  2Z9S A;  2B1K A;  4GQC A;  3ZLP A;  2CZ2 A;  1PGT A;  1BG5 A;  5ECQ B;  4ZIL A;  3ZL5 A;  1WMJ A;  1OC8 A;  1FO5 A;  1M3I A;  3CSH A;  1PQN A;  6GSV A;  1OC9 B;  4MJA A;  5A5K A;  4PX1 A;  2VL2 C;  17GS A;  3M0F A;  2L57 A;  2DJJ A;  1N8J A;  2JZT A;  1LU4 A;  2AB6 A;  4EE0 A;  1T8E B;  5ID2 B;  1GTU A;  2GQM A;  3WT2 A;  3TOT A;  4V2N A;  2JSZ A;  1Y6E A;  3TRP A;  3MIX A;  3LXZ A;  2A2P A;  3RHC A;  2YJ7 A;  3CTF A;  5IOW A;  2O8V B;  1Z3E A;  3E3E A;  3MSZ A;  16GS A;  2HRK A;  2C4J A;  4N10 A;  1FG4 A;  2GT6 A;  4YKG A;  20GS A;  1URM A;  2WCI A;  5HFG A;  1F6M C;  2H6Y A;  1CQG A;  1PRX A;  1M9B A;  4HUA A;  1B9X C;  1THO A;  4K2D A;  4DSR A;  4HSC X;  3UL3 A;  3ME8 A;  3IBH A;  2WFC A;  1XWB A;  2X8H A;  4O32 A;  5IO0 A;  4PUA A;  2HLS A;  3GUR A;  2MZC A;  2PGT A;  1O85 A;  5CYY A;  1GH2 A;  5HFK A;  4MPF A;  4WF4 A;  3HA9 A;  4OFN A;  2DJK A;  3RPP A;  1TI3 A;  1NHY A;  3GTU A;  3IA1 A;  4KCA A;  1TU7 A;  5COH A;  3S9F A;  3DYR A;  3FR3 A;  2EIR A;  3P8W A;  4JR4 A;  1BAY A;  5EVO A;  2LNT A;  5G30 A;  1G0T A;  2H8L A;  4V1A p;  22GS A;  2MYG A;  5IM9 A;  3WGE A;  1V98 A;  2FA4 A;  1U88 A;  3UEM A;  1S3R A;  1U87 A;  2P5Q A;  4EDY A;  3IXR A;  4K1F A;  2YWI A;  1PKW A;  4MZC A;  2VCQ A;  1SKW B;  3TRX A;  2RUF A;  1M2B A;  5DAL A;  2WB9 A;  3IR4 A;  2LQQ A;  4IGJ A;  1SK1 A;  2LKU A;  2NBS A;  4IBP A;  4EIQ A;  2ZCT A;  1OKD A;  1GSQ A;  4WKW A;  4V1A g;  2CX4 A;  3GFK A;  3RPN A;  3CQF A;  4TOP A;  3A2V A;  3LFL A;  4O7H A;  4MAB A;  4TVE A;  2BMX A;  2LJK A;  2L4C A;  2JU5 A;  1EP8 A;  2E2G A;  1E2Y A;  3Q6O A;  1K0D A;  1F3B A;  1YKC A;  1TRW A;  3TCO A;  4X1U A;  2HFD A;  1A24 A;  4E8E A;  1EEJ A;  1S3A A;  3A2X A;  1VF2 A;  5G5E A;  1TJD A;  1IYH A;  2VCZ A;  2VCV A;  2VLT A;  3EPT A;  1YF0 A;  3ERG A;  2R0C A;  3O76 A;  4QQ7 A;  3HKR A;  3KMN A;  3KXO A;  4K2X A;  3GX8 A;  5CRG A;  3HVV A;  1X9S B;  3D4M A;  3LWA A;  3TKS C;  5EY6 A;  4KDU A;  4ZB8 A;  4BVX A;  4DEJ A;  4ZL8 A;  4KE3 A;  5FHI A;  2H72 A;  5IMZ A;  1JZR A;  3ISO A;  2B3S A;  4J56 E;  4P3Y B;  1OE8 A;  1KBN A;  3CBU A;  1SKR B;  1XOA A;  3HJP A;  1OKT A;  2D2Z A;  2AJQ B;  3KIJ A;  1QQ2 A;  2KP2 A;  2YCD A;  3GRX A;  2HYX A;  4KUN A;  3VUR A;  4MJB A;  2HSY A;  3LQ7 A;  3FEU A;  3FRC A;  4PQI A;  1F3A A;  3G7I A;  4K7I A;  3F3Q A;  2PU9 C;  1XW5 A;  4MH2 A;  1OAZ A;  2HRN A;  2IIY A;  3R2Q A;  4MCU A;  3ZIV A;  5J9B A;  4ML6 A;  1F9M A; 
#chains in the Genus database with same CATH homology
 2LRN A;  1ML6 A;  3ZIT A;  4K7N A;  5ECO B;  2I3Y A;  4OCF A;  4IHU A;  1SD9 A;  1XBS A;  4KCE A;  2H19 A;  3QMX A;  4LL4 B;  4MF6 A;  1X9W B;  4K6X A;  3UVT A;  2QGV A;  1GP1 A;  4YQM A;  3KZQ A;  2H01 A;  2YWN A;  5J5N A;  3P90 A;  5F06 A;  4NAX A;  3E9J B;  2GSS A;  3BD2 A;  3LOR A;  4ZBA A;  1NW2 A;  1VF4 A;  3GA4 A;  1K0M A;  4HS1 A;  3TOU A;  2ALB A;  3VK9 A;  4IQ1 A;  1SL0 B;  3J7Y k;  4JR6 A;  1ST9 A;  4ISD A;  4N11 A;  4KSM A;  4O5Q A;  2X8G A;  2N5F A;  3ERF A;  2NVL A;  4HJ2 A;  1TK8 B;  4KDY A;  4BPY A;  3W8J A;  4G9H A;  3BCI A;  1ZYE A;  3TGZ A;  5JCG A;  2A2S A;  1KTE A;  2JAD A;  5B6N A;  3KD0 A;  1FB0 A;  2B1L A;  3EIN A;  3ZTL A;  1U3A A;  2GLR A;  1T3B A;  4OO4 A;  5C04 A;  1J0F A;  5ABR A;  1Q4J A;  2WJU A;  1UN2 A;  2R4V A;  4MH3 A;  5DJM A;  1TOF A;  3LG6 A;  1PSQ A;  1FVK A;  2WGR A;  2GSQ A;  4G19 A;  4RUV A;  2L4Q A;  2C80 A;  4TN8 A;  3VWV A;  2B6M A;  3DIE A;  4Q5Q A;  2AAW A;  4EL1 A;  1B9Y C;  2V6K A;  4MJC A;  2AV4 A;  2DJ2 A;  3QFA C;  1M9A A;  1XOB A;  2O85 A;  2V2G A;  1SKS B;  5E4W A;  1R4W A;  3F6D A;  1V40 A;  4EDZ A;  2XBQ A;  4WF5 A;  3F4S A;  1ZZY A;  1BQ7 A;  4K9Z A;  3CSJ A;  5G1K A;  1O7U A;  1PKZ A;  2UZ8 A;  3KCM A;  1J9B A;  4EF0 A;  1AQX A;  3GKN A;  3DVW A;  3APS A;  3HJM A;  3VI7 A;  3HZ4 A;  4TKY A;  2LTK A;  4KGI A;  4F03 A;  1K0A A;  5HR3 A;  2JSY A;  3BJ5 A;  2HZE A;  1XIY A;  4PXO A;  4ICY A;  2DML A;  3TB2 A;  4DSQ A;  3GST A;  4CW9 A;  3ZIJ A;  3C1R A;  4KX4 A;  3TKS A;  1GSF A;  2H70 A;  1B48 A;  4JZQ A;  2ON5 A;  1NSW A;  1T1V A;  1MEK A;  3KMO A;  2H1A A;  4HQS A;  4Z7X A;  1W4V A;  4WEY A;  4ECI A;  2GVP A;  4GF0 A;  1M2A A;  2C0D A;  4ZBB A;  2FA8 A;  2DKI A;  4ACS A;  4YAV A;  1GL8 A;  1JZD A;  4ZBD A;  1FW1 A;  1JLV A;  2LQO A;  4OMV A;  4Z2R A;  3FMW A;  5CRE A;  1SD8 A;  1XW6 A;  2I1U A;  5IO2 A;  2G2Q A;  3KP9 A;  3L0H A;  1WP0 A;  2IFQ B;  3FY7 A;  3ZML A;  4USS A;  1JZO A;  2EC4 A;  4F0C A;  2GDR A;  5DJL A;  5LD0 A;  1PMT A;  3LXT A;  2IMI A;  3K8N A;  2GTU A;  4WR5 A;  2A4V A;  3HVS A;  1Y25 A;  2LV3 A;  2C3T A;  4HU7 A;  1A23 A;  3GL3 A;  5JWO B;  1Z9H A;  2JL4 A;  4IJI A;  4ULX A;  1FOV A;  1A2L A;  6GSW A;  3F8U A;  14GS A;  4ID0 A;  4KB3 A;  2XPD A;  4K5R A;  3HDC A;  3M9K A;  2B7J A;  4EC0 A;  4L8E A;  2PVO C;  3TKP A;  5CRD A;  2FD3 A;  2FHE A;  5HQP A;  2VIM A;  1RW1 A;  2HSM A;  4N0Z A;  4D73 B;  1GTA A;  1K0C A;  4BVY B;  5D9X A;  3D21 A;  3QR6 A;  4NMU A;  2EIQ A;  4NWY A;  5EL8 A;  8GSS A;  1F37 A;  4XRA A;  1XWC A;  4BL7 B;  1MD4 A;  3UBK A;  3IHQ A;  1WIK A;  1ERW A;  3GV1 A;  2DJ1 A;  1YF1 A;  4ZB9 A;  5CNW A;  1AUC A;  2R37 A;  5EPF A;  2GZZ A;  3BBY A;  2H73 A;  2PBJ A;  4G10 A;  4I6X A;  3QD9 A;  1VF1 A;  3TJK A;  3CTG A;  4RQX A;  9GSS A;  3KJY A;  3HJO A;  2H6Z A;  1VRS D;  1AIU A;  3SBC A;  2HRA A;  1GTI A;  4AJ7 A;  3KH9 A;  1GNE A;  2PN8 A;  1YEX A;  2B7K A;  2HXK A;  3GYK A;  5DAK A;  2HT9 A;  5BRT A;  1VF3 A;  1SK0 A;  4EO3 A;  5AN1 A;  3IK9 A;  2AUV A;  4EVM A;  3ED3 A;  3TJJ A;  4MF7 A;  2H76 A;  5D9T A;  3NOF A;  4DSS A;  2OE1 A;  3UMA A;  2H1D A;  1PX6 A;  2XHF A;  4IN0 A;  4I2U A;  3A5W A;  1PN0 A;  4XIH A;  1B4P A;  4XRD A;  1PL2 A;  4TW5 A;  4XS1 A;  4N30 A;  3DVX A;  3WYW A;  2RII A;  3IE3 A;  2GQL A;  4KA0 A;  5F8B A;  2OBI A;  2NTO A;  4MA9 A;  3E0U A;  1USB A;  2X99 A;  4ZL9 A;  5D93 A;  3ZVJ A;  3D0Z A;  4RI7 A;  1Z6N A;  4ZL7 A;  3A5I A;  5A4V A;  1B4Q A;  2JZR A;  2P5R A;  4PNF A;  4I97 A;  1F2E A;  5FT3 A;  2R0G A;  2VLV A;  1FVJ A;  2PWJ A;  1XVW A;  4PQ1 A;  5HR0 A;  3ZRD A;  2LST A;  11GS A;  1FHE A;  1GLQ A;  1WJK A;  2VL3 A;  3KGK A;  3NIV A;  3ZFB A;  1A8Y A;  1XWG A;  4F2I A;  2B5Y A;  5IMF A;  4IS0 A;  4BWS A;  1EOH A;  2J23 A;  4MF5 A;  3IPZ A;  4GTU A;  1X0R A;  3UIW A;  2WZ9 A;  4AJ6 A;  1GSD A;  2OKA A;  1ZCP A;  3W8S A;  1K3O A;  1OVN A;  3KM6 A;  3LJR A;  1XCC A;  3QCP A;  5AIS A;  2MMZ A;  2DKH A;  2YV7 A;  2R5G A;  4KW6 A;  1AC1 A;  3HD5 A;  3L9V A;  3KTB A;  2YP6 A;  3HCZ A;  2MMN A;  3UAP A;  1H75 A;  4L5L A;  3EE2 A;  2OJL A;  3VWX A;  1SEN A;  1SJZ A;  3GIX A;  1ACV A;  2EIO A;  4POL A;  1OC3 A;  5HFI A;  3A2W A;  3TKQ A;  2VM1 A;  5ECK B;  4AJ8 A;  4EUY A;  4G0I A;  1HD2 A;  5B6M A;  1GUK A;  1S3C A;  1V57 A;  1AAZ A;  2H0H A;  4GRF A;  4NXI A;  13GS A;  5D73 A;  4XCS A;  2ZNM A;  3WT1 A;  2IMF A;  3L4N A;  1AXD A;  5ECI B;  1UVZ A;  2MMO A;  4AGS A;  2CAQ A;  2VD1 A;  4GCI A;  3RAZ A;  5CAX A;  4ECJ A;  5IMA A;  1QK8 A;  2I81 A;  1WRY A;  1ABA A;  5DQS A;  4PTS A;  1SL1 B;  3J7Y b;  4IW9 A;  2O89 A;  3KTL A;  10GS A;  2J9H A;  4WBJ A;  4OD7 A;  1V9W A;  1SL2 B;  18GS A;  2VL2 A;  3G7Y A;  1A2J A;  1PL1 A;  5DAL B;  2FWE A;  4POM A;  5AGY A;  5GST A;  4PUF C;  2YAN A;  5D9V A;  5IQY A;  3JCM L;  1G6Y A;  2R2J A;  1HNA A;  4LMW A;  5H5Q A;  5DQY A;  5LCZ A;  1GUM A;  2YN1 A;  3PH9 A;  3DRN A;  3EMX A;  2H71 A;  4WET A;  5L71 A;  3GKX A;  2QC7 A;  2PUK C;  5GSS A;  6GST A;  6GSS A;  2VO4 A;  1X5C A;  1GNW A;  2WS2 A;  2RM5 A;  1Z7R A;  4K8M A;  2CVD A;  2K6V A;  1K0O A;  3C73 A;  1M0U A;  1TP9 A;  2R6K A;  1I9D A;  2JZS A;  2AYT A;  5J9C A;  2HZF A;  4MPG A;  2FGX A;  5G2Z A;  5KOW A;  1ZYP A;  3GKK A;  3L9U A;  2VCW A;  2IMD A;  3Q19 A;  5C00 A;  1J08 A;  3DKS A;  4JE1 A;  2F8F A;  4V2L A;  4F9Z A;  3VPT A;  3U6V A;  3F4R A;  4I5Q A;  2VOC A;  2L5O A;  2YV9 A;  2C3Q A;  1FAA A;  5IPH A;  3H79 A;  3GH6 A;  4HOJ A;  1QFN A;  4O5U A;  4YH2 A;  1DBY A;  3FKF A;  2KP1 A;  2L6C A;  1IYI A;  5FWG A;  2TRC P;  2KHP A;  2N5B A;  3IV4 A;  3Q74 A;  4NV2 A;  2KOK A;  4QL7 A;  1K3L A;  2GST A;  3GX0 A;  1BJX A;  4Q5N A;  1K3Y A;  3BOA A;  2VM2 A;  3ZVJ D;  4LL1 B;  2F3M A;  4E8H A;  1BYE A;  5J3R A;  1YDK A;  3SWL A;  4TR1 A;  3KP8 A;  3WGD A;  5JCW A;  2P31 A;  1ILO A;  2K8V A;  1TI1 A;  4MLY A;  4IVF A;  4YAP A;  4MK3 A;  4XS4 A;  1I5G A;  4KH7 A;  4GWR A;  4TR0 A;  1WE0 A;  4TXO A;  4IJ3 A;  2YPM A;  1QXH A;  3MWH A;  2M72 A;  2CA8 A;  2O87 A;  3G9B A;  2CX3 A;  4FH8 A;  3VWU A;  1R26 A;  2H75 A;  4LA1 A;  2WUL A;  1XFL A;  3F3R A;  5ELG A;  1TW9 A;  4K5S A;  1ZYN A;  1PA3 A;  2DIZ A;  3R3E A;  1BX9 A;  2DBC A;  2H1B A;  3W6G A;  4MDC A;  3ZFL A;  1KNG A;  3PGT A;  2PER A;  1VGL A;  2RUE A;  2OA7 A;  2ES7 A;  4MMM A;  2VCX A;  6GSU A;  2R3X A;  5B8B A;  4O92 A;  1Z5Y E;  2VAF A;  3IAM 2;  3KH7 A;  4NV5 A;  2WRT A;  5G31 A;  5CP1 A;  1O6J A;  2FNO A;  2QKE A;  2AHE A;  2KLX A;  2GZP A;  2CVB A;  1TDI A;  5ECP B;  4H86 A;  4FQU A;  1OYJ A;  3WD6 A;  1WPI A;  2RLI A;  4O5R A;  4MP4 A;  2HRF A;  3QDN A;  2MMA A;  3QPM A;  3ME7 A;  4EKZ A;  3TUE A;  1GSU A;  4OFT A;  3TKR A;  1DUG A;  3LYK A;  1PX7 A;  3UJ1 A;  4FIW A;  1CQH A;  3DXB A;  4FYU A;  1X5E A;  3DML A;  1ZGN A;  3TJG A;  1A2M A;  1XWK A;  1YZX A;  2QA2 A;  3EUR A;  1ZMA A;  4RI6 A;  2OE0 A;  3APQ A;  2PMT A;  5IMD A;  3ZRE A;  4BVY A;  5IMC A;  1JLW A;  3EYT A;  4ECC A;  2H74 A;  3C8E A;  3GNJ A;  4HZ4 A;  5H5R A;  6GSY A;  3HYP A;  4A5P A;  4IKH A;  1THX A;  1SU9 A;  4GXZ A;  3D4T A;  1O81 A;  2YWM A;  2OE3 A;  4FO5 A;  4IEL A;  1Q98 A;  3GHA A;  1OC9 A;  1ERT A;  3TRQ A;  4POK A;  1R5A A;  2GZY A;  3VLN A;  4OCE A;  4ZIJ A;  3US3 A;  1ERV A;  1GTB A;  1RK4 A;  2PVQ A;  2XPE A;  2I9H A;  1YJ6 A;  5IIZ A;  4ZXG A;  5ID2 A;  2C1Y A;  1TXX A;  19GS A;  3LGC A;  3FR6 A;  5ECS A;  2CVK A;  1EGO A;  4L5O A;  1AQW A;  5ECR B;  4LMV A;  1FB6 A;  2P0G A;  1MDJ A;  3FW2 A;  2LS5 A;  2X8C A;  4IP1 A;  5D96 A;  3PPU A;  1X9M B;  2E7P A;  3QOU A;  3TJF A;  1Z7P A;  1EV9 A;  4CDO A;  2CZ3 A;  1A0R P;  2REM A;  2TIR A;  4OWY A;  1GLP A;  4RQR A;  1EP7 A;  2QSI A;  1R5P A;  1X5D A;  2LJR A;  3I9V 2;  1XXU A;  2IMK A;  3HY2 A;  2CT6 A;  1EEM A;  5KOX A;  3M9J A;  4KF9 A;  3CRT A;  2YJH A;  5DCH A;  3Q18 A;  3G7J A;  2ZUP A;  3F9U A;  2O7K A;  1YY7 A;  4CHS A;  2VD0 A;  3DD3 A;  3D6I A;  1PD2 1;  4OO5 A;  1M7T A;  4F0B A;  2L6D A;  4BA7 A;  5ECL B;  3F63 A;  2E2M A;  3CSI A;  2DJ0 A;  3UBL A;  4FYC A;  2XBI A;  1EGR A;  4HEA 2;  3VWW A;  1MTC A;  1O8X A;  2CQ9 A;  2FWF A;  3F4T A;  3GKM A;  5H5S A;  5J41 A;  1LJR A;  1HQO A;  3QAG A;  2TRX A;  3PIN A;  4NPB A;  5DBQ A;  3APO A;  5B7C A;  3TJB A;  1UA5 A;  3QFB C;  2BJX A;  3EU3 A;  1GUL A;  1MDK A;  3O6T A;  2OAC A;  1B8X A;  5DDL A;  2R0P A;  1XZO A;  2VLU A;  1UC7 A;  3VPQ A;  4K0N A;  4QL9 A;  3FR9 A;  5JWQ B;  1ON4 A;  4TR3 A;  1V58 A;  1FOH A;  5DAK B;  3H1N A;  2K18 A;  1AW9 A;  3IC4 A;  4N0V A;  4Z2T A;  3L9S A;  3EVI A;  3M3M A;  5KN1 A;  4ZB6 A;  3ERW A;  1TTZ A;  2X49 A;  4DSS B;  1HNC A;  4FYB A;  3VI5 A;  5ECH B;  2GT5 A;  3IAS 2;  3H93 A;  2KUC A;  1E6B A;  2DSA A;  2IJY A;  3D22 A;  4X4J A;  3MYD A;  2OAD A;  2N5A A;  4I2T A;  2QA1 A;  3GUS A;  2YZU A;  3HHV A;  3N5O A;  3C71 A;  2I4A A;  5IMV A;  3IK7 A;  1TRV A;  2CAI A;  1YKA A;  3GH9 A;  5JWR B;  4WXT A;  4Q5R A;  3ZYW A;  3O3T A;  3F6F A;  2GGT A;  4POB A;  5F0G A;  3GTU B;  1W89 A;  2IME A;  2A2R A;  4MZW A;  1C72 A;  3CMI A;  2WDU A;  2FUG 2;  1SYX A;  1QMV A;  1XVQ A;  4HI7 A;  2NDO A;  3MAK A;  2C8U A;  5JCU A;  1G7O A;  1O8W A;  5KN3 A;  4Z2U A;  5HR1 A;  4XS6 A;  3GMF A;  5GAP D;  3N9J A;  5GAN D;  3HXS A;  4GLT A;  4YQV A;  4EIP A;  2JAC A;  1EV4 A;  3FZ5 A;  1G7E A;  1M99 A;  2L5L A;  2M80 A;  6GSX A;  3ZMK A;  2B5X A;  2FWG A;  4WBR D;  2CV4 A;  5F05 A;  5G5F A;  4XTS A;  2DC5 A;  3FZ9 A;  1GRX A;  2YNX A;  4JU5 A;  5INY A;  2PPT A;  3A3T A;  1JHB A;  1HYU A;  5KN0 A;  3I6A A;  2LJA A;  3RBT A;  1SJ6 A;  4J2F A;  2LRC A;  2YOI A;  2IL3 A;  3EC3 A;  1U3I A;  1WOU A;  4MJE A;  3C1S A;  4PGT A;  4IQA A;  4LLR A;  5D8I A;  1A0F A;  2VCT A;  1GSS A;  1ZYQ B;  2F9S A;  2LEG A;  4PQH A;  2VL9 A;  3IHG A;  5D9W A;  3DWV A;  2GQK A;  1ZOF A;  2MBT A;  2H0I A;  3QAW A;  5A4W A;  3IC8 A;  3F0I A;  4YQU A;  3BCK A;  2LNS A;  2X4A A;  3IRA A;  1K0B A;  5CRW A;  2H66 A;  1NM3 A;  4DVC A;  3CYN A;  1R7H A;  3IOS A;  2F8A A;  1TRU A;  2B5E A;  3UAR A;  1K0N A;  4BVX B;  3LW9 A;  4JRR A;  5AIV A;  3L78 A;  1DE1 A;  3EU4 A;  1GSY A;  1T4Y A;  3CXG A;  2BTO T;  1TK0 B;  3LYP A;  2HNL A;  12GS A;  1DSB A;  3QAV A;  4X0X A;  5IOX A;  4KSO A;  3V1W A;  4X43 A;  1SYR A;  1TRS A;  4PNG A;  3M8N A;  1EZK A;  2V32 A;  3RHB A;  2E0Q A;  4AF2 A;  4K0G A;  1Z6M A;  1OE7 A;  2NPB A;  2X64 A;  3TKS E;  4BWQ A;  1AQV A;  3PR8 A;  1WWJ A;  2FY6 A;  4JBB A;  1MD3 A;  3H8Q A;  1RQM A;  4J57 E;  1H4O A;  1T4Z A;  5KN2 A;  4EXJ A;  1JFU A;  3DGQ A;  2H1G A;  1JZW A;  3IDV A;  2C0F A;  4NHW A;  2OBK A;  2XC2 A;  1PN9 A;  3FK8 A;  1KEB A;  1ZL9 A;  3LEF A;  4TR4 A;  3CRU A;  4HJM A;  2VUP A;  4F82 A;  5ECM B;  4GQF A;  3P7X A;  4GSS A;  1G6W A;  4G0K A;  3NZN A;  5J4U A;  2H0G A;  1QGV A;  4CY8 A;  3UVH A;  1A8L A;  4HDE A;  2FWH A;  2DIY A;  2DLX A;  4G2E A;  4MNN A;  5ELA A;  5BMU A;  4KND A;  2IFQ A;  5ENU A;  3LSZ A;  4TR1 B;  1LBK A;  3GN3 A;  4GST A;  3MNG A;  4HU9 A;  4V2M A;  4G0L A;  2IWT A;  5A4U A;  4XS4 B;  5ECN B;  4WR4 A;  4HZ2 A;  1T7P B;  3I43 A;  5LNK e;  2A4H A;  1TK5 B;  3RDW A;  5GZZ B;  1NHO A;  1BED A;  1XPV A;  5E59 A;  4TXO B;  4MZB A;  4PUR A;  1N2A A;  2HI7 A;  1EWX A;  4JED A;  2K8S A;  2MBS A;  5F07 A;  2YZH A;  3OR5 A;  1GUH A;  4CY6 A;  2L59 A;  3D5J A;  3EMP A;  1XWA A;  4Q5F A;  1GWC A;  1DE2 A;  2IPA A;  4TRX A;  5G1L A;  3U5R E;  2H6X A;  2RM6 A;  5CRH A;  2K9F A;  1GSE A;  5CO3 A;  1S3D A;  2FLS A;  3TDG A;  4ECB A;  3H4K A;  3DEX A;  3GL5 A;  3WGX A;  2LRT A;  4D73 A;  4IP6 A;  3KEB A;  7GSS A;  4L0W A;  1QUW A;  1O73 A;  5DVB A;  1YEP A;  4ILF A;  3FZ4 A;  5KEJ A;  2HE3 A;  4BL7 A;  2IN3 A;  3FYG A;  4OFM A;  2HZE B;  3M1G A;  4XHM A;  5HR2 A;  3VFI A;  1M2D A;  4NHZ A;  2H30 A;  3UOM A;  1TKD B;  1XW9 A;  4KDX A;  1HNB A;  3FHK A;  3ZZX A;  1SJI A;  1SK2 A;  3P2A A;  2ON7 A;  3GSS A;  1T00 A;  1V2A A;  2C3N A;  3HZ8 A;  4KAE A;  2G0F A;  3HVX A;  1ERU A;  5IPG A;  5B8A A;  2GSR A;  5AIX A;  2DJ3 A;  2GS3 A;  5DCG A;  3MDK A;  3C7M A;  2C0G A;  4YKF A;  2DMM A;  4K7O A;  4I8B A;  1MDI A;  2M46 A;  2V6O A;  4TXV A;  4GSN A;  2V41 A;  2C0E A;  2V1M A;  3AY8 A;  4HQZ A;  3FZA A;  4L0U A;  1U6T A;  1TU8 A;  3EWL A;  4ML1 A;  2LUS A;  3I69 A;  1YQ1 A;  1EOG A;  2FCH A;  2HSH A;  2YWO A;  2F51 A;  2Z9S A;  2B1K A;  4GQC A;  3ZLP A;  2CZ2 A;  1PGT A;  1BG5 A;  5ECQ B;  4ZIL A;  3ZL5 A;  1WMJ A;  1OC8 A;  1FO5 A;  3CSH A;  1PQN A;  6GSV A;  1OC9 B;  4MJA A;  5A5K A;  4PX1 A;  2VL2 C;  17GS A;  3M0F A;  2L57 A;  2DJJ A;  1N8J A;  2JZT A;  1LU4 A;  2AB6 A;  4EE0 A;  1T8E B;  5ID2 B;  1GTU A;  2GQM A;  3WT2 A;  3TOT A;  4V2N A;  2JSZ A;  1Y6E A;  3TRP A;  3MIX A;  3LXZ A;  2A2P A;  3RHC A;  2YJ7 A;  3CTF A;  5IOW A;  2O8V B;  1Z3E A;  3E3E A;  3MSZ A;  16GS A;  2HRK A;  2C4J A;  4N10 A;  1FG4 A;  2GT6 A;  4YKG A;  20GS A;  1URM A;  2WCI A;  5HFG A;  1F6M C;  2H6Y A;  1CQG A;  1PRX A;  1M9B A;  4HUA A;  1B9X C;  1THO A;  4K2D A;  4DSR A;  3UL3 A;  3ME8 A;  3IBH A;  2WFC A;  1XWB A;  2X8H A;  4O32 A;  5IO0 A;  4PUA A;  2HLS A;  3GUR A;  5CYY A;  2MZC A;  2PGT A;  1O85 A;  1GH2 A;  5HFK A;  4MPF A;  4WF4 A;  3HA9 A;  4OFN A;  2DJK A;  3RPP A;  1TI3 A;  1NHY A;  3GTU A;  3IA1 A;  4KCA A;  1TU7 A;  5COH A;  3S9F A;  3DYR A;  3FR3 A;  2EIR A;  3P8W A;  4JR4 A;  1BAY A;  5EVO A;  2LNT A;  5G30 A;  1G0T A;  2H8L A;  4V1A p;  22GS A;  2MYG A;  5IM9 A;  3WGE A;  1V98 A;  2FA4 A;  1U88 A;  3UEM A;  1U87 A;  2P5Q A;  4EDY A;  3IXR A;  4K1F A;  2YWI A;  1PKW A;  4MZC A;  2VCQ A;  1SKW B;  3TRX A;  2RUF A;  1M2B A;  5DAL A;  2WB9 A;  3IR4 A;  2LQQ A;  4IGJ A;  1SK1 A;  2LKU A;  2NBS A;  4IBP A;  4EIQ A;  2ZCT A;  1OKD A;  1GSQ A;  4WKW A;  4V1A g;  2CX4 A;  3GFK A;  3RPN A;  4TOP A;  3A2V A;  3LFL A;  4O7H A;  4MAB A;  4TVE A;  2BMX A;  2LJK A;  2L4C A;  2JU5 A;  1EP8 A;  2E2G A;  1E2Y A;  3Q6O A;  1K0D A;  1F3B A;  1YKC A;  1TRW A;  3TCO A;  4X1U A;  2HFD A;  1A24 A;  4E8E A;  1EEJ A;  1S3A A;  3A2X A;  1VF2 A;  5G5E A;  1TJD A;  1IYH A;  2VCZ A;  2VCV A;  2VLT A;  3EPT A;  1YF0 A;  3ERG A;  2R0C A;  3O76 A;  4QQ7 A;  3HKR A;  3KMN A;  3KXO A;  4K2X A;  3GX8 A;  5CRG A;  3HVV A;  1X9S B;  3D4M A;  3LWA A;  3TKS C;  5EY6 A;  4KDU A;  4ZB8 A;  4BVX A;  4DEJ A;  4ZL8 A;  4KE3 A;  5FHI A;  2H72 A;  5IMZ A;  1JZR A;  3ISO A;  2B3S A;  4J56 E;  4P3Y B;  1OE8 A;  1KBN A;  3CBU A;  1SKR B;  1XOA A;  3HJP A;  1OKT A;  2D2Z A;  2AJQ B;  3KIJ A;  1QQ2 A;  2KP2 A;  2YCD A;  3GRX A;  2HYX A;  4KUN A;  3VUR A;  4MJB A;  2HSY A;  3LQ7 A;  3FEU A;  3FRC A;  4PQI A;  1F3A A;  3G7I A;  4K7I A;  3F3Q A;  2PU9 C;  1XW5 A;  4MH2 A;  1OAZ A;  2HRN A;  2IIY A;  3R2Q A;  4MCU A;  3ZIV A;  5J9B A;  4ML6 A;  1F9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...