3WT1A

Crystal structure of the b'-a' domain of thermophilic fungal protein disulfide isomerase (reduced form)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
244
structure length
244
Chain Sequence
GSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase
publication title Redox-dependent conformational transition of catalytic domain of protein disulfide isomerase indicated by crystal structure-based molecular dynamics simulation
doi rcsb
source organism Humicola insolens
total genus 65
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wt1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wt1A01
1NHOA 4EVMA 2H1BA 3A3TA 4V1Ag 4WBRD 2GLRA 2P31A 2JZTA 1S3DA 2CT6A 1GSUA 3KP8A 3TKPA 2GZZA 1O8XA 3KXOA 1MDKA 1GUKA 4X0XA 4JRRA 4KNDA 3GHAA 5DBQA 1B4QA 2MBSA 2C8UA 1EGRA 4ILFA 3TJBA 3KIJA 1EWXA 2HSYA 5D93A 5G2ZA 4N10A 3M9JA 3M3MA 3TB2A 1TRSA 5DQYA 4WF5A 1ZCPA 4N0ZA 4G2EA 4RI6A 1ZYQB 4N0VA 2GQKA 1TJDA 2IMIA 1OC9B 2R2JA 3EU3A 4YH2A 5AIXA 2IMEA 5IMDA 2HRFA 3EWLA 4HU9A 2ALBA 3APQA 2GTUA 2DJ3A 1XZOA 4MMMA 2QGVA 2YZUA 3ED3A 3M8NA 1QQ2A 4K8MA 3P2AA 1B9YC 3UOMA 2RLIA 5B6MA 1YDKA 4AJ8A 5G5FA 3ZITA 2YCDA 2EIOA 2K6VA 1OKDA 3U6VA 4IP1A 4AGSA 3L9VA 1X5DA 4WXTA 2L5LA 1ERUA 1CQHA 1T8EB 1SENA 1SU9A 3TJKA 2VM1A 1HQOA 4OFNA 1EOHA 3QAGA 3O76A 1YKCA 5IMFA 4EE0A 2IN3A 4XHMA 1V58A 3D4MA 3HVSA 2N5AA 5C04A 2H0HA 1OAZA 1XW9A 1ERVA 4JEDA 4G10A 3F0IA 1X9WB 1XBSA 5CRWA 5HR2A 1XVWA 3V1WA 1ML6A 3TRPA 2R6KA 3KTBA 4J56E 5CO3A 4ID0A 5ECLB 1ZGNA 4D73A 5IIZA 1PD21 2V41A 1R4WA 3ISOA 3FKFA 4Z7XA 5E59A 1BYEA 4LLRA 3L9SA 2F51A 2YPMA 4BL7A 3IK7A 2NDOA 4AF2A 2ZUPA 2EC4A 2P0GA 3HZ8A 2IJYA 3CSIA 1T4YA 1TW9A 1UA5A 3HHVA 2QSIA 1B48A 2HSHA 4H86A 1FAAA 2WFCA 2B7KA 2V2GA 2HE3A 2KUCA 2GS3A 3UEMA 5IMCA 1DBYA 1Z5YE 5A4VA 4HI7A 3F3RA 3NIVA 2H6YA 3FR9A 4ZBBA 4YAPA 3HJPA 5F8BA 1AIUA 3PINA 4TW5A 3BJ5A 3ERFA 1F6MC 3DXBA 2YWIA 4K9ZA 1XVQA 2OE0A 2CAQA 2VLUA 1FW1A 4GLTA 2R4VA 5H5QA 1EGOA 2DJ1A 11GSA 2RIIA 4ZBDA 2ZCTA 3GSTA 3Q6OA 4L0WA 2R3XA 5AN1A 4MJCA 3CMIA 2HNLA 4K2DA 1B8XA 2L4QA 2N5BA 2JADA 2VCZA 4LL4B 4POBA 1THXA 1PRXA 4GWRA 2DSAA 2YWOA 5E4WA 4HEA2 5ID2A 5G5EA 1MD4A 5F07A 2IL3A 1K0MA 4L5LA 2WGRA 3QR6A 5F0GA 2YJ7A 5F06A 3WT2A 4KA0A 4JU5A 3FK8A 1ZL9A 5JCUA 2LJAA 3GKNA 4K7OA 5IO0A 5EL8A 6GSYA 4TXVA 3VK9A 1MDJA 3D0ZA 3TJJA 3BD2A 1GULA 3TJGA 3IPZA 4F0CA 1GL8A 2OADA 5D9XA 1SJIA 2CZ2A 2YWMA 1GSDA 1JLVA 2F8AA 1S3CA 2B5EA 5ECQB 3TJFA 2H8LA 1WJKA 4ZB8A 2O8VB 2WULA 3APOA 4MF5A 2I9HA 1PQNA 2N5FA 1TTZA 5DJMA 5DAKB 5DCGA 1TP9A 1TRVA 3FHKA 6GSTA 4TR4A 2CVKA 1OC9A 2H72A 4HZ2A 2M80A 2LRTA 3L4NA 4BWQA 4OO5A 1BEDA 3CBUA 1BX9A 1VF4A 4PQ1A 4N11A 3F4RA 3ZL5A 5GSTA 3GNJA 2L59A 3N5OA 2HXKA 3E9JB 1JZOA 5A4UA 1SD8A 2C3NA 2FY6A 1BJXA 2G0FA 1ZYEA 4XS6A 4MABA 4Q5NA 2LTKA 2YN1A 2X99A 4GSNA 1PL2A 1JZDA 3UARA 4OWYA 4JZQA 1Z6MA 1LJRA 4TXOB 4DSRA 2IPAA 1SL1B 4ECCA 3LWAA 4MZBA 2C0EA 1E2YA 2YZHA 4XIHA 2PMTA 3RAZA 3D6IA 2L6DA 5LD0A 3C8EA 3ZVJD 2VAFA 4OFMA 4LA1A 5EVOA 3FZ5A 1H4OA 2B3SA 3A2XA 2OACA 3FR6A 2VIMA 3QDNA 4EL1A 4ZB9A 3FZAA 2J23A 1M2AA 1GUHA 2HZEA 1NHYA 6GSSA 1HNAA 1SYRA 1K0CA 1V40A 3F6FA 2C80A 20GSA 1WWJA 3KJYA 4DSSB 5IPHA 1K3OA 2PU9C 3J7Yk 4KX4A 5DVBA 2GQMA 3RHCA 1QGVA 3UMAA 5D9TA 4LMVA 2JACA 4MK3A 1HNCA 5ECKB 2H74A 5GAPD 2CVDA 3I43A 3GURA 5CAXA 3QAWA 1R5PA 3LYKA 2GSRA 5KN3A 4NXIA 1SK0A 2ON5A 3VI7A 4EDZA 3C1SA 2Z9SA 4K1FA 4ZB6A 16GSA 1AQWA 5KN1A 2AYTA 1A2JA 1EOGA 2TRXA 3ERGA 1K0OA 1VF1A 5IMAA 2LNSA 3RPNA 3FEUA 2H1AA 2LS5A 2HRNA 3GL3A 1F37A 1Z3EA 3D21A 3ERWA 5HR0A 2TIRA 1A2MA 2PN8A 1ZZYA 1X9MB 4HDEA 4GQCA 2A2SA 4L8EA 1DUGA 1F2EA 1Z7RA 1J9BA 3GUSA 3GKXA 2VCXA 1Y25A 1R7HA 2LJRA 1G7OA 5EY6A 2I3YA 5AISA 3HVXA 4ZBAA 2RM6A 3F4TA 1AAZA 4MA9A 2JSYA 3TKRA 3HA9A 4K0NA 3D22A 2VLTA 2QKEA 3EE2A 5DALA 5D9WA 3ZLPA 4QL9A 3IDVA 3OR5A 3RBTA 22GSA 4GSSA 2GT5A 2LJKA 2F3MA 4PUFC 3ZVJA 2YJHA 3LEFA 1T1VA 2E0QA 1AW9A 1TDIA 4CDOA 5CNWA 2HYXA 3PR8A 4EF0A 1A0FA 2DJ2A 18GSA 2CV4A 3UVTA 1KEBA 3C71A 4GQFA 5AGYA 2PPTA 1K3LA 1VF3A 4HQZA 1H75A 2IMFA 1KBNA 4LMWA 1NM3A 5GAND 2YNXA 4TN8A 3WT1A 3C73A 4O5RA 2LSTA 3ME7A 2VL2A 4KUNA 2LKUA 3VWUA 1Y6EA 2MZCA 4MPGA 4EDYA 3P8WA 4F9ZA 4TRXA 2DJKA 1X5EA 3FYGA 3ZIVA 5FWGA 3DD3A 5DAKA 2IFQA 1FVKA 4V2LA 5J9CA 4KSMA 1EV4A 2PWJA 2LEGA 2K8VA 4KCEA 5KN2A 4OMVA 4MH2A 4NWYA 4PQIA 4RQRA 3TDGA 1Q4JA 4J57E 2KHPA 3TGZA 1O73A 2B5YA 4Q5QA 4ML6A 3GRXA 4ACSA 2VCVA 4L5OA 1J0FA 5EPFA 5ECNB 4RQXA 4PURA 3VWWA 5DDLA 2C3TA 4PGTA 2I4AA 4BWSA 1TI1A 2IIYA 4ECIA 2H0IA 3O6TA 3IBHA 4TXOA 1TK8B 1J08A 3N9JA 3LQ7A 4XCSA 1FB0A 17GSA 3ME8A 2JZRA 2JU5A 2HZFA 6GSUA 4HU7A 3GL5A 3TKSC 2MMAA 3TKSE 2GT6A 3EMXA 5ELGA 1U3AA 1A2LA 2CVBA 1GNEA 4WKWA 1WOUA 1QUWA 2E2MA 2PUKC 4PX1A 3M9KA 3A5WA 4CHSA 3G9BA 2FLSA 4GTUA 4K6XA 6GSVA 2A2RA 5G1KA 3KM6A 3VWVA 4FO5A 3CXGA 2GZPA 3Q18A 3QMXA 1A24A 4I8BA 2NBSA 2WDUA 3HCZA 3DRNA 1OC8A 2GVPA 3QFAC 5JCGA 4LL1B 1TI3A 2V32A 3LJRA 1NW2A 1A8YA 1B9XC 2C1YA 2LQOA 1JHBA 3CTGA 5ECMB 1AC1A 5DJLA 3KH7A 1F3AA 3IV4A 1YF0A 3EMPA 3DGQA 1A8LA 2P5QA 3ZYWA 3JCML 2MMOA 3W8JA 3ZMKA 2I81A 2H73A 1GSSA 1GSEA 3F9UA 1BAYA 3F3QA 1PA3A 4ECBA 3HY2A 4HZ4A 3RHBA 4NMUA 1WRYA 4I2TA 2TRCP 3M1GA 2F9SA 2FWHA 1SL0B 4IJ3A 4IJIA 1WMJA 4BVYA 1MD3A 2OBKA 1MDIA 2HFDA 2KOKA 1QK8A 2H30A 2VCWA 3QOUA 5CRGA 3CSHA 1XOBA 1XOAA 4IQ1A 4X43A 1O81A 2JSZA 5CRHA 5D96A 4N30A 1LU4A 3IOSA 2V6OA 1GSYA 1V57A 5C00A 4IS0A 3A2VA 1GSFA 2DJJA 5G1LA 3UBLA 2FWFA 4KE3A 2LV3A 4ZL9A 3KCMA 2EIRA 1M9BA 1PKWA 1ZOFA 3EC3A 2XPEA 4O32A 4XRAA 5J4UA 2XHFA 2VO4A 3GA4A 2FCHA 2H75A 2ON7A 5IOXA 5D9VA 5B8BA 1G6YA 4O7HA 1K0DA 2WS2A 5ABRA 4NHZA 3GYKA 1WE0A 2YV7A 1TOFA 5D8IA 4I97A 3CTFA 3KGKA 1NSWA 1O85A 2VL3A 4NV5A 4EO3A 5CP1A 4OFTA 4NHWA 1TRUA 3K8NA 4IELA 4NPBA 1B4PA 1AQVA 4IVFA 1XCCA 1SL2B 3HDCA 4XTSA 1DE1A 1XWGA 2B5XA 1OC3A 4IQAA 3AY8A 1PX7A 1EP8A 2IMKA 3GX0A 5HFKA 1EEJA 2H19A 3WD6A 5KEJA 5HQPA 5JWOB 3BCIA 4PXOA 4KAEA 3H93A 2KP1A 2HT9A 4IKHA 1XXUA 2C0GA 2H0GA 2FA8A 2VCTA 1URMA 5J41A 2NTOA 8GSSA 5JWQB 4QL7A 4HJ2A 1ZMAA 3TKQA 3GKKA 1ST9A 3KZQA 2VD1A 4POLA 2FGXA 2JL4A 2NVLA 1GWCA 3D5JA 1GNWA 5ECHB 4IW9A 1EP7A 4X1UA 1JLWA 2PVQA 2CX3A 2GGTA 1TXXA 1GUMA 3EU4A 2GSTA 1XW6A 2V6KA 3HJMA 3FR3A 4KDUA 4TKYA 3MDKA 2CQ9A 5G31A 1MEKA 2MMZA 4O92A 3WGEA 2LRNA 3TCOA 1XIYA 1PGTA 2HI7A 1Z6NA 2V1MA 1FO5A 2L6CA 1K3YA 4MCUA 3F4SA 4TR0A 1VRSD 2WJUA 5B7CA 4XRDA 1ERTA 1XWBA 3CSJA 4OCFA 1XWAA 3F6DA 4OCEA 4FYUA 1LBKA 1TK0B 2XPDA 2AHEA 3H8QA 4F03A 5IPGA 2AJQB 1V2AA 1YEXA 2VCQA 3I9V2 2I1UA 1EV9A 2O87A 3U5RE 4P3YB 2YV9A 4PQHA 1KNGA 3H1NA 2WRTA 4RUVA 5CRDA 3EVIA 2K9FA 2IMDA 4IP6A 3KTLA 4IBPA 1FOVA 1ILOA 1U87A 3RPPA 1MTCA 4PNGA 1E6BA 1DSBA 2MBTA 4IHUA 5CYYA 2OE1A 4TR3A 2BTOT 2G2QA 2GSSA 3UBKA 4MJBA 3KH9A 1PKZA 1JFUA 1X0RA 6GSXA 3ZZXA 2ES7A 2X8GA 3UVHA 1RQMA 1PX6A 1TKDB 2VL9A 1WPIA 4KSOA 3I69A 3LG6A 3Q74A 3ZTLA 4ZILA 2FA4A 4OO4A 3APSA 3LXTA 1PN9A 5ENUA 2DJ0A 4XS4B 3DKSA 2VD0A 2C4JA 5A5KA 4FIWA 4MZWA 1R26A 1GTAA 2WB9A 3DEXA 1AXDA 3WGDA 5AIVA 3GKMA 4PUAA 4ZXGA 3MNGA 3SBCA 1YEPA 4WR4A 4HQSA 2H01A 1SKSB 2E7PA 1SJ6A 4V2NA 2X8CA 1M0UA 3A2WA 4ECJA 3LORA 3MWHA 2VOCA 2PBJA 4ML1A 1OE7A 3P7XA 3FZ9A 3HKRA 2K8SA 1HYUA 3TOTA 1M7TA 2GZYA 2L4CA 3IAM2 1CQGA 3F8UA 2AAWA 1AQXA 5INYA 4MP4A 5IO2A 2RM5A 3VI5A 4FH8A 3TUEA 3S9FA 2L5OA 2ZNMA 3GFKA 1OYJA 4QQ7A 4JR6A 2YWNA 3L0HA 4G19A 1U3IA 2LRCA 1T4ZA 3VPTA 1JZWA 1G6WA 2EIQA 2QC7A 4BA7A 3IHQA 1N8JA 4YQVA 1I5GA 3ZIJA 4EUYA 1UVZA 1GH2A 3W6GA 3O3TA 4WETA 4CW9A 1GLQA 1GP1A 1WP0A 3Q19A 4GCIA 4JBBA 4NAXA 1IYHA 1G7EA 2YP6A 5IOWA 3ZFBA 1TK5B 2AV4A 1SYXA 1USBA 2H70A 4J2FA 3IE3A 2H1DA 4EKZA 3M0FA 4WR5A 1ABAA 3GMFA 1VF2A 1SD9A 3C7MA 3W8SA 2FUG2 2L57A 2MYGA 3F63A 2C3QA 4JE1A 3UL3A 4L0UA 3PH9A 1M99A 1F3BA 1A0RP 2B6MA 3GIXA 2R37A 3PGTA 12GSA 1PSQA 4I2UA 2H6XA 4KDXA 2AUVA 3P90A 3HVVA 5ECPB 7GSSA 1SKRB 3EURA 2HZEB 4F0BA 5HFGA 2PERA 4EC0A 3QCPA 3GTUB 2H6ZA 3R2QA 5B6NA 4I5QA 1QMVA 3VURA 3FY7A 4MPFA 1HNBA 4AJ6A 4EXJA 3I6AA 1EEMA 4FYCA 2D2ZA 4DSSA 3IXRA 1F9MA 1ERWA 4GSTA 4HJMA 4OD7A 4ZL7A 4MDCA 1O6JA 2PVOC 5D73A 1W4VA 3CYNA 3ZRDA 3G7YA 4G9HA 3UJ1A 2VM2A 1GSQA 5FHIA 1GTBA 2OE3A 3CRUA 1VGLA 4KGIA 1M2DA 5DCHA 4WBJA 5DQSA 1YY7A 2CA8A 3DVWA 5JWRB 3BBYA 1GTUA 9GSSA 2B7JA 5JCWA 2CX4A 3MAKA 1C72A 4YAVA 3NZNA 1THOA 3WGXA 5GSSA 3G7IA 4K7NA 3QFBC 1IYIA 4YQUA 1M9AA 3CRTA 4MF6A 5IMZA 4TR1B 1O8WA 2VLVA 3DWVA 1FVJA 1XWKA 1TRWA 4HS1A 1SJZA 1OE8A 2GQLA 3KMNA 2C0FA 4GRFA 2JZSA 3C1RA 4RI7A 2LNTA 3KMOA 4DSQA 1Z9HA 2HLSA 4IGJA 1Q98A 1V98A 3LFLA 4XS4A 3QAVA 1DE2A 2O85A 3UIWA 1RW1A 2R5GA 3SWLA 5DALB 3IRAA 1RK4A 3IC4A 2FD3A 2WZ9A 2X8HA 2LUSA 4HUAA 5CREA 3GN3A 3GV1A 2H66A 3J7Yb 1K0AA 3EYTA 5J9BA 2B1KA 3BCKA 1YJ6A 2OJLA 2M46A 3VPQA 1W89A 2VUPA 4K0GA 4ISDA 2RUEA 1QFNA 4K7IA 2A4VA 3IK9A 3L78A 3ZFLA 3HD5A 3GH9A 3FZ4A 4KH7A 2C0DA 4TVEA 3IR4A 2XBQA 5F05A 2H1GA 4F82A 3TKSA 13GSA 2IFQB 3TRQA 3IAS2 1FHEA 1GLPA 2DIZA 3HZ4A 5L71A 5GZZB 2GSQA 14GSA 3GX8A 5A4WA 3NOFA 3RDWA 4WEYA 2O89A 2WCIA 4MH3A 5ECOB 5COHA 4PNFA 1BG5A 2DMMA 4MLYA 5IQYA 2F8FA 2CZ3A 1XFLA 3QPMA 1TU7A 5ECIB 2DLXA 3KP9A 3TRXA 1PMTA 4POMA 1G0TA 2FNOA 4MZCA 4POKA 4V2MA 2DC5A 5ECRB 4MJEA 4IN0A 1V9WA 3DYRA 4ZL8A 2OKAA 5J3RA 2MMNA 1M2BA 1X5CA 19GSA 1Z7PA 3KEBA 3FRCA 2VL2C 3LSZA 3DMLA 3GSSA 4KW6A 5H5RA 3E0UA 5LCZA 5ELAA 1YF1A 2E2GA 4KB3A 4I6XA 2GDRA 1S3AA 2J9HA 1FG4A 2K18A 6GSWA 2BJXA 4D73B 4HOJA 2YOIA 2B1LA 3D4TA 3VLNA 4ULXA 5IMVA 1YKAA 3E3EA 3GTUA 4GXZA 3EINA 1UN2A 1GRXA 1OVNA 2DIYA 2DMLA 2IWTA 1A23A 4Q5FA 3HJOA 5IM9A 3DVXA 2FWEA 4V1Ap 2YANA 10GSA 2AB6A 3QD9A 3KD0A 4MF7A 5LNKe 3VFIA 1T00A 5FT3A 5G30A 1ACVA 5HR3A 3IA1A 1U88A 3MSZA 3VWXA 2CAIA 1ON4A 3TOUA 1O7UA 1SKWB 5ECSA 2NPBA 2XC2A 1AUCA 2H76A 1OKTA 4FYBA 4F2IA 1R5AA 1PL1A 2X64A 1HD2A 3WYWA 4WF4A 1T7PB 2BMXA 2M72A 2REMA 5B8AA 4DVCA 2H71A 4GF0A 2KP2A 1SK2A 3GH6A 4ZIJA 4BPYA 5KN0A 3US3A 3LYPA 4JR4A 1WIKA 4KDYA 1GTIA 1UC7A 3UAPA 1N2AA 1SK1A 1YZXA 1T3BA 2XBIA 1U6TA 3DIEA 1TU8A 2PGTA 4TOPA 4AJ7A 3H79A 4TR1A 3H4KA 4XS1A 5HR1A 5HFIA 1BQ7A 2FWGA 1XW5A 3LXZA 3ZMLA 1X9SB 4BVXA 2RUFA 3L9UA 1XWCA 2O7KA 5H5SA 1QXHA 2FHEA 3LGCA 5ID2B 4KCAA 1KTEA 3BOAA 5J5NA 4E8HA 1K0BA 2DBCA 4NV2A 4MJAA 1FB6A 1EZKA 3HXSA 4E8EA 1YQ1A 3G7JA 1I9DA 3HYPA 2LQQA 2KLXA 2OA7A 1XPVA 2OBIA 4YQMA 4DEJA 3ZREA 2P5RA 1JZRA 4Q5RA 1K0NA 3FW2A
chains in the Genus database with same CATH superfamily
1NHOA 4EVMA 2H1BA 3A3TA 4V1Ag 4WBRD 2GLRA 2P31A 2JZTA 1S3DA 2CT6A 1GSUA 3KP8A 3TKPA 2GZZA 1O8XA 3KXOA 1MDKA 1GUKA 4X0XA 4JRRA 4KNDA 3GHAA 5DBQA 1B4QA 2MBSA 2C8UA 1EGRA 4ILFA 3TJBA 3KIJA 1EWXA 2HSYA 5D93A 5G2ZA 4N10A 3M9JA 3M3MA 3TB2A 1TRSA 5DQYA 4WF5A 1ZCPA 4N0ZA 4G2EA 4RI6A 1ZYQB 4N0VA 2GQKA 1TJDA 2IMIA 1OC9B 2R2JA 3EU3A 4YH2A 5AIXA 2IMEA 5IMDA 2HRFA 3EWLA 4HU9A 2ALBA 3APQA 4FQUA 2GTUA 2DJ3A 1XZOA 4MMMA 2QGVA 2YZUA 3ED3A 3M8NA 1QQ2A 4K8MA 3P2AA 1B9YC 3UOMA 2RLIA 5B6MA 1YDKA 4AJ8A 5G5FA 3ZITA 2YCDA 2EIOA 2K6VA 1OKDA 3U6VA 4IP1A 4AGSA 3L9VA 1X5DA 4WXTA 2L5LA 1ERUA 1M3IA 1CQHA 1T8EB 1SENA 1SU9A 4K2XA 5BRTA 3TJKA 2VM1A 1HQOA 4EIPA 4OFNA 1EOHA 3QAGA 3O76A 1YKCA 5IMFA 4EE0A 2IN3A 4XHMA 1V58A 3D4MA 3HVSA 2N5AA 5C04A 2H0HA 1OAZA 1XW9A 1ERVA 4JEDA 4G10A 3F0IA 1X9WB 1XBSA 5CRWA 5HR2A 1XVWA 3V1WA 1ML6A 3TRPA 2R6KA 3KTBA 4J56E 5CO3A 4ID0A 5ECLB 1ZGNA 4D73A 5IIZA 1PD21 4K5RA 2V41A 1R4WA 3ISOA 3FKFA 4Z7XA 5E59A 1BYEA 4LLRA 3L9SA 2F51A 4YKGA 2YPMA 4BL7A 3A5IA 3IK7A 2NDOA 4AF2A 2ZUPA 2EC4A 2P0GA 3HZ8A 2IJYA 3CSIA 1T4YA 1TW9A 1UA5A 4PTSA 3HHVA 2QSIA 1B48A 2HSHA 4H86A 1FAAA 2WFCA 2B7KA 2V2GA 2HE3A 2KUCA 2GS3A 2R0CA 3UEMA 5IMCA 1DBYA 1Z5YE 5A4VA 4HI7A 3F3RA 3NIVA 2H6YA 3FR9A 4ZBBA 4YAPA 3HJPA 5F8BA 1AIUA 3PINA 4TW5A 3BJ5A 3ERFA 3HVNA 1F6MC 3DXBA 2YWIA 4K9ZA 1XVQA 2OE0A 2CAQA 2VLUA 1FW1A 4GLTA 2R4VA 5H5QA 1EGOA 2DJ1A 11GSA 2RIIA 4ZBDA 2ZCTA 3GSTA 3Q6OA 4L0WA 2R3XA 5AN1A 4MJCA 3CMIA 2HNLA 4K2DA 1B8XA 2L4QA 2N5BA 2JADA 2VCZA 4LL4B 4BIKA 4POBA 1THXA 1PRXA 4GWRA 2DSAA 2YWOA 5E4WA 4CY8A 4HEA2 5ID2A 5G5EA 1MD4A 5F07A 2IL3A 1K0MA 4L5LA 2WGRA 3QR6A 5F0GA 2YJ7A 5F06A 3WT2A 4KA0A 4JU5A 3FK8A 1ZL9A 5JCUA 2LJAA 3GKNA 4K7OA 5IO0A 5EL8A 6GSYA 4TXVA 3VK9A 1MDJA 3D0ZA 3TJJA 3BD2A 1GULA 3TJGA 3IPZA 4F0CA 1GL8A 2OADA 5D9XA 1SJIA 2CZ2A 2YWMA 1GSDA 1JLVA 2F8AA 1S3CA 2B5EA 5ECQB 3TJFA 2H8LA 1WJKA 4ZB8A 2O8VB 2WULA 4MNNA 3APOA 4MF5A 2I9HA 1PQNA 2N5FA 1TTZA 5DJMA 5DAKB 5DCGA 1TP9A 1TRVA 4Z2RA 3FHKA 6GSTA 4TR4A 2CVKA 1OC9A 2H72A 4HZ2A 2M80A 2LRTA 3L4NA 4BWQA 4OO5A 1BEDA 3CBUA 1BX9A 1VF4A 4PQ1A 4N11A 3F4RA 4O5UA 3ZL5A 1ZYNA 5GSTA 3GNJA 2L59A 3N5OA 2HXKA 3E9JB 1JZOA 5A4UA 1SD8A 2C3NA 2FY6A 1BJXA 2G0FA 1ZYEA 2A2PA 4ICYA 4XS6A 4MABA 4Q5NA 2LTKA 2YN1A 2X99A 4GSNA 1PL2A 1JZDA 5BMUA 3UARA 4OWYA 4JZQA 1Z6MA 1LJRA 4TXOB 4DSRA 2IPAA 1SL1B 4ECCA 3LWAA 4MZBA 2C0EA 1E2YA 2YZHA 4XIHA 2PMTA 3RAZA 3D6IA 2L6DA 5LD0A 3C8EA 3ZVJD 2VAFA 4OFMA 4LA1A 5EVOA 3FZ5A 1H4OA 2B3SA 3A2XA 2OACA 3FR6A 2VIMA 3QDNA 4EL1A 4ZB9A 3FZAA 2J23A 1M2AA 1GUHA 2HZEA 1NHYA 6GSSA 1HNAA 1SYRA 1K0CA 1V40A 3F6FA 2C80A 20GSA 1WWJA 3KJYA 4DSSB 5IPHA 1K3OA 2PU9C 3J7Yk 4KX4A 5DVBA 2GQMA 3RHCA 1QGVA 3UMAA 5D9TA 4LMVA 2JACA 4MK3A 1HNCA 5ECKB 2H74A 5GAPD 2CVDA 3I43A 3GURA 5CAXA 3QAWA 1R5PA 3LYKA 4HSCX 2GSRA 5KN3A 4NXIA 1SK0A 2ON5A 3VI7A 4EDZA 3C1SA 2Z9SA 4K1FA 4ZB6A 16GSA 4X4JA 1AQWA 5KN1A 2AYTA 1A2JA 1EOGA 2TRXA 3ERGA 1K0OA 1VF1A 2QA2A 5IMAA 2LNSA 1FOHA 3RPNA 3FEUA 2H1AA 2LS5A 2HRNA 3GL3A 1F37A 1Z3EA 3D21A 3ERWA 5HR0A 2TIRA 1A2MA 1PN0A 2PN8A 1ZZYA 4BVYB 1X9MB 4HDEA 4GQCA 2A2SA 4L8EA 1DUGA 1F2EA 1Z7RA 1J9BA 3GUSA 3GKXA 2VCXA 1Y25A 1R7HA 2LJRA 1G7OA 5EY6A 2I3YA 5AISA 3HVXA 4ZBAA 2RM6A 3F4TA 1AAZA 4MA9A 2JSYA 3TKRA 2DKHA 3HA9A 4K0NA 3R3EA 3D22A 2VLTA 2QKEA 3EE2A 5DALA 5D9WA 3ZLPA 4QL9A 3IDVA 3OR5A 3RBTA 22GSA 4GSSA 2GT5A 2LJKA 2F3MA 4PUFC 3ZVJA 2YJHA 3LEFA 1T1VA 2E0QA 1AW9A 1TDIA 4CDOA 5CNWA 2HYXA 3PR8A 4EF0A 1A0FA 2DJ2A 18GSA 2CV4A 3UVTA 1KEBA 3C71A 4GQFA 5AGYA 2PPTA 1K3LA 1VF3A 4HQZA 1H75A 2IMFA 1KBNA 4LMWA 1NM3A 5GAND 2YNXA 4TN8A 3WT1A 3C73A 4O5RA 2LSTA 2A4HA 3ME7A 2VL2A 4KUNA 2LKUA 3VWUA 1Y6EA 2MZCA 4MPGA 4EDYA 3P8WA 4F9ZA 4TRXA 2DJKA 1X5EA 3FYGA 3ZIVA 5FWGA 3DD3A 5DAKA 2IFQA 1FVKA 4V2LA 5J9CA 4KSMA 1EV4A 4USSA 2PWJA 1XG8A 2LEGA 2K8VA 4KCEA 5KN2A 4OMVA 4MH2A 4NWYA 4PQIA 4RQRA 3TDGA 1Q4JA 4J57E 2KHPA 3TGZA 1O73A 2B5YA 4Q5QA 4ML6A 3GRXA 4ACSA 2VCVA 4L5OA 1J0FA 5EPFA 5ECNB 4RQXA 4PURA 3VWWA 5DDLA 2C3TA 4PGTA 2I4AA 4BWSA 1TI1A 2IIYA 4ECIA 2H0IA 3O6TA 3IBHA 4TXOA 1TK8B 1J08A 3N9JA 3LQ7A 4XCSA 1FB0A 17GSA 3ME8A 2JZRA 2JU5A 2HZFA 6GSUA 4HU7A 3GL5A 3TKSC 2MMAA 3TKSE 2GT6A 3EMXA 5ELGA 1U3AA 1A2LA 2CVBA 1GNEA 4WKWA 1WOUA 1QUWA 2E2MA 2PUKC 4PX1A 3M9KA 3A5WA 4CHSA 1PFOA 3G9BA 2FLSA 4GTUA 4K6XA 6GSVA 2A2RA 5G1KA 3KM6A 3VWVA 4FO5A 4YKFA 3CXGA 2GZPA 3Q18A 3QMXA 1A24A 4I8BA 2NBSA 2WDUA 3HCZA 3DRNA 1OC8A 2GVPA 3QFAC 5JCGA 4LL1B 1TI3A 2V32A 3LJRA 1NW2A 1A8YA 1B9XC 2C1YA 2LQOA 1JHBA 3CTGA 5ECMB 1AC1A 5DJLA 3KH7A 1F3AA 3IV4A 1YF0A 3EMPA 3DGQA 1A8LA 2P5QA 3ZYWA 3JCML 2MMOA 3W8JA 3ZMKA 2I81A 2H73A 1GSSA 1GSEA 3F9UA 1BAYA 3F3QA 1PA3A 4ECBA 3HY2A 4HZ4A 3RHBA 4NMUA 1WRYA 4I2TA 2TRCP 3M1GA 2F9SA 2FWHA 1SL0B 4IJ3A 4IJIA 1WMJA 4BVYA 1MD3A 2OBKA 1MDIA 2HFDA 2KOKA 1QK8A 2H30A 2VCWA 3QOUA 5CRGA 3CSHA 1XOBA 1XOAA 4IQ1A 4X43A 1O81A 2JSZA 5CRHA 5D96A 4N30A 1LU4A 3IOSA 2V6OA 1GSYA 1V57A 5C00A 4IS0A 3A2VA 1GSFA 2DJJA 5G1LA 3UBLA 2FWFA 4KE3A 2LV3A 4ZL9A 3KCMA 2EIRA 1M9BA 1PKWA 1ZOFA 3EC3A 2XPEA 4O32A 4XRAA 5J4UA 2XHFA 2VO4A 3GA4A 2FCHA 2H75A 2ON7A 5IOXA 5D9VA 5B8BA 1G6YA 4O7HA 1K0DA 2WS2A 5ABRA 4NHZA 3GYKA 1WE0A 2YV7A 1TOFA 5D8IA 4I97A 3CTFA 3KGKA 1NSWA 1O85A 2VL3A 4NV5A 4EO3A 5CP1A 4OFTA 4NHWA 4G0LA 1TRUA 3K8NA 4IELA 4NPBA 1B4PA 1AQVA 4IVFA 1XCCA 1SL2B 3HDCA 4XTSA 1DE1A 1XWGA 2B5XA 1OC3A 4IQAA 5KOXA 2X49A 3AY8A 1PX7A 1EP8A 2IMKA 3GX0A 5HFKA 1EEJA 2H19A 3WD6A 5KEJA 5HQPA 5JWOB 3BCIA 4PXOA 4KAEA 3H93A 2KP1A 2HT9A 4IKHA 2HRKA 1XXUA 2C0GA 2H0GA 2FA8A 2VCTA 1URMA 5J41A 2HSMA 2NTOA 8GSSA 5JWQB 4QL7A 4HJ2A 1ZMAA 3TKQA 3MYDA 3GKKA 1ST9A 3KZQA 2VD1A 4POLA 2FGXA 2JL4A 2NVLA 2R0GA 2HRAA 1GWCA 3D5JA 1GNWA 5ECHB 4IW9A 1EP7A 4X1UA 1JLWA 2PVQA 2CX3A 2GGTA 1TXXA 1GUMA 3EU4A 2GSTA 1XW6A 2V6KA 3HJMA 3FR3A 4KDUA 4TKYA 3MDKA 2CQ9A 5G31A 1MEKA 2MMZA 4O92A 3WGEA 2LRNA 3TCOA 1XIYA 1PGTA 2HI7A 1Z6NA 2V1MA 1FO5A 2L6CA 1K3YA 4MCUA 3CQFA 3F4SA 4A5PA 4TR0A 1VRSD 2WJUA 5B7CA 4XRDA 1ERTA 1XWBA 3CSJA 4OCFA 1XWAA 3F6DA 4OCEA 4FYUA 4K5SA 1LBKA 1TK0B 2XPDA 2AHEA 3H8QA 4F03A 5IPGA 2AJQB 1V2AA 1YEXA 2VCQA 3I9V2 2I1UA 1EV9A 2O87A 3U5RE 4P3YB 2YV9A 4PQHA 1KNGA 3H1NA 2WRTA 4RUVA 5CRDA 3EVIA 2K9FA 2IMDA 4IP6A 3KTLA 4IBPA 4Z2UA 1FOVA 1ILOA 1U87A 3RPPA 1MTCA 4PNGA 1E6BA 1DSBA 2MBTA 4IHUA 5CYYA 2OE1A 4TR3A 2BTOT 2G2QA 2GSSA 3UBKA 4MJBA 3KH9A 1PKZA 1JFUA 1X0RA 6GSXA 3ZZXA 2ES7A 2X8GA 3UVHA 1RQMA 2X4AA 1PX6A 1TKDB 2VL9A 1WPIA 4KSOA 3I69A 3LG6A 3Q74A 3ZTLA 4ZILA 2FA4A 4OO4A 3APSA 1ZYPA 3LXTA 1PN9A 5ENUA 2DJ0A 4XS4B 3DKSA 2VD0A 2C4JA 5A5KA 4FIWA 4MZWA 1R26A 1GTAA 2WB9A 3DEXA 1AXDA 3WGDA 5AIVA 3IC8A 3GKMA 4PUAA 4ZXGA 3MNGA 3SBCA 1YEPA 4WR4A 4HQSA 2H01A 1SKSB 2E7PA 1SJ6A 4V2NA 4EIQA 1M3JA 2X8CA 1M0UA 3A2WA 4ECJA 3LORA 3MWHA 2VOCA 2PBJA 4ML1A 1OE7A 3P7XA 3FZ9A 3HKRA 2K8SA 1HYUA 3TOTA 1M7TA 2GZYA 2L4CA 3IAM2 1CQGA 3F8UA 4Z2TA 2AAWA 1AQXA 5INYA 4MP4A 5IO2A 2RM5A 3VI5A 4FH8A 3TUEA 3S9FA 2L5OA 2ZNMA 3GFKA 1OYJA 4QQ7A 4JR6A 2YWNA 3L0HA 4G19A 1U3IA 2LRCA 1T4ZA 3VPTA 1JZWA 1G6WA 2EIQA 2QC7A 4BA7A 3IHQA 1N8JA 4YQVA 1I5GA 4G0KA 3ZIJA 4EUYA 1UVZA 1GH2A 3W6GA 3O3TA 4WETA 4CW9A 1GLQA 1GP1A 1WP0A 3Q19A 4GCIA 4JBBA 4NAXA 1IYHA 1G7EA 2YP6A 5IOWA 3ZFBA 1TK5B 2AV4A 1SYXA 1USBA 2H70A 4J2FA 3IE3A 2H1DA 4EKZA 3M0FA 4WR5A 1ABAA 3GMFA 1VF2A 1SD9A 3C7MA 3W8SA 2FUG2 2L57A 5KOWA 2MYGA 3F63A 2C3QA 4JE1A 3UL3A 4L0UA 3PH9A 1M99A 1F3BA 1A0RP 2B6MA 3GIXA 2R37A 3PGTA 12GSA 4O5QA 1PSQA 4I2UA 2H6XA 4KDXA 2AUVA 3P90A 3HVVA 5ECPB 7GSSA 1SKRB 3EURA 2HZEB 4F0BA 5HFGA 2PERA 4EC0A 3QCPA 3GTUB 2H6ZA 3R2QA 5B6NA 4I5QA 3FMWA 1QMVA 3VURA 3FY7A 4MPFA 1HNBA 4AJ6A 4EXJA 3I6AA 1EEMA 4FYCA 2D2ZA 4DSSA 3IXRA 1F9MA 3IHGA 1ERWA 4GSTA 4HJMA 4OD7A 4ZL7A 4MDCA 1O6JA 2PVOC 5D73A 1W4VA 3CYNA 3ZRDA 3G7YA 4G9HA 3UJ1A 2VM2A 1GSQA 5FHIA 1GTBA 2OE3A 3CRUA 1VGLA 4KGIA 1M2DA 5DCHA 4WBJA 5DQSA 1YY7A 2CA8A 3DVWA 5JWRB 3BBYA 1GTUA 9GSSA 2B7JA 5JCWA 2CX4A 3MAKA 1C72A 4YAVA 3NZNA 1THOA 3WGXA 5GSSA 3G7IA 4K7NA 3QFBC 1IYIA 4YQUA 1M9AA 3CRTA 4MF6A 5IMZA 4TR1B 1O8WA 2VLVA 3DWVA 1FVJA 3LW9A 1XWKA 4CY6A 1TRWA 4HS1A 1SJZA 1OE8A 2GQLA 4BVXB 3KMNA 3EPTA 2C0FA 4GRFA 2JZSA 3C1RA 2DKIA 4RI7A 2LNTA 3KMOA 4DSQA 1Z9HA 2HLSA 4IGJA 1Q98A 1V98A 3LFLA 4XS4A 3QAVA 1DE2A 2O85A 3UIWA 1RW1A 2R5GA 3SWLA 5DALB 3IRAA 1RK4A 3IC4A 2UZ8A 2FD3A 2WZ9A 2X8HA 2LUSA 4HUAA 5CREA 3GN3A 3GV1A 2H66A 3J7Yb 1K0AA 3EYTA 5J9BA 2B1KA 3BCKA 1YJ6A 2OJLA 2M46A 4G0IA 3VPQA 1W89A 2VUPA 4K0GA 4ISDA 2RUEA 1QFNA 4K7IA 2A4VA 3IK9A 3L78A 3ZFLA 3HD5A 3GH9A 3FZ4A 4KH7A 2C0DA 4TVEA 3IR4A 2XBQA 5F05A 3MIXA 2H1GA 4F82A 3TKSA 13GSA 2IFQB 3TRQA 3IAS2 1FHEA 1GLPA 2DIZA 3HZ4A 5L71A 5GZZB 2GSQA 14GSA 3GX8A 5A4WA 3NOFA 3RDWA 4WEYA 2O89A 2WCIA 4MH3A 5ECOB 5COHA 4PNFA 1BG5A 2DMMA 4MLYA 5IQYA 2F8FA 2CZ3A 1XFLA 3QPMA 1TU7A 5ECIB 2DLXA 3KP9A 3TRXA 1PMTA 4POMA 1G0TA 2FNOA 4MZCA 4POKA 4V2MA 2DC5A 5ECRB 4MJEA 4IN0A 1V9WA 3DYRA 4ZL8A 2OKAA 5J3RA 2MMNA 1M2BA 1X5CA 19GSA 1Z7PA 3KEBA 3FRCA 2VL2C 3LSZA 3DMLA 3GSSA 4KW6A 5H5RA 3E0UA 5LCZA 5ELAA 1YF1A 2E2GA 4KB3A 4I6XA 2GDRA 3PPUA 1S3AA 2J9HA 1FG4A 2K18A 6GSWA 2BJXA 4D73B 4HOJA 2YOIA 2B1LA 3D4TA 3VLNA 4ULXA 5IMVA 1YKAA 1S3RA 3E3EA 3GTUA 4GXZA 3EINA 4BL7B 1UN2A 1GRXA 1OVNA 2DIYA 2DMLA 2IWTA 1A23A 4Q5FA 3HJOA 5IM9A 3DVXA 2FWEA 4V1Ap 2YANA 10GSA 2AB6A 3QD9A 3KD0A 4MF7A 5LNKe 3VFIA 1T00A 5FT3A 5G30A 1ACVA 5HR3A 3IA1A 1U88A 3MSZA 3VWXA 2CAIA 1ON4A 3TOUA 1O7UA 1SKWB 5ECSA 2NPBA 2XC2A 1AUCA 2H76A 1OKTA 4FYBA 4F2IA 1R5AA 1PL1A 2X64A 1HD2A 3WYWA 4WF4A 1T7PB 2BMXA 2M72A 2REMA 5B8AA 4DVCA 2H71A 4GF0A 2KP2A 1SK2A 3GH6A 4KF9A 4ZIJA 4BPYA 5KN0A 3US3A 3LYPA 4JR4A 1WIKA 4KDYA 1GTIA 1UC7A 3UAPA 1N2AA 1SK1A 1YZXA 1T3BA 2XBIA 1U6TA 3DIEA 1TU8A 2PGTA 4TOPA 4AJ7A 3H79A 4TR1A 3H4KA 4XS1A 5HR1A 5HFIA 1BQ7A 2FWGA 1XW5A 3LXZA 3ZMLA 1X9SB 4BVXA 2RUFA 3L9UA 1XWCA 2O7KA 5H5SA 1QXHA 2FHEA 3LGCA 5ID2B 4KCAA 1KTEA 3BOAA 5J5NA 4E8HA 1K0BA 2DBCA 4NV2A 2R0PA 4MJAA 1FB6A 1EZKA 3HXSA 4E8EA 1YQ1A 3G7JA 1I9DA 3HYPA 2LQQA 2KLXA 2OA7A 1XPVA 2OBIA 4YQMA 2QA1A 4DEJA 3ZREA 2P5RA 1JZRA 4Q5RA 1K0NA 3FW2A
chains in the Genus database with same CATH topology
1NHOA 4EVMA 2H1BA 3A3TA 4V1Ag 4WBRD 2GLRA 2P31A 2JZTA 1S3DA 2CT6A 1GSUA 3KP8A 3TKPA 2GZZA 1O8XA 3KXOA 1MDKA 1GUKA 4X0XA 4JRRA 4KNDA 3GHAA 5DBQA 1B4QA 2MBSA 2C8UA 1EGRA 4ILFA 3TJBA 3KIJA 1EWXA 2HSYA 5D93A 5G2ZA 4N10A 3M9JA 3M3MA 3TB2A 1TRSA 5DQYA 4WF5A 1ZCPA 4N0ZA 4G2EA 4RI6A 1ZYQB 4N0VA 2GQKA 1TJDA 2IMIA 1OC9B 2R2JA 3EU3A 4YH2A 5AIXA 2IMEA 5IMDA 2HRFA 3EWLA 4HU9A 2ALBA 3APQA 4FQUA 2GTUA 2DJ3A 1XZOA 4MMMA 2QGVA 2YZUA 3ED3A 3M8NA 1QQ2A 4K8MA 3P2AA 1B9YC 3UOMA 2RLIA 5B6MA 1YDKA 4AJ8A 5G5FA 3ZITA 2YCDA 2EIOA 2K6VA 1OKDA 3U6VA 4IP1A 4AGSA 3L9VA 1X5DA 4WXTA 2L5LA 1ERUA 1CQHA 1T8EB 1SENA 1SU9A 4K2XA 5BRTA 3TJKA 2VM1A 1HQOA 4EIPA 4OFNA 1EOHA 3QAGA 3O76A 1YKCA 5IMFA 4EE0A 2IN3A 4XHMA 1V58A 3D4MA 3HVSA 2N5AA 5C04A 2H0HA 1OAZA 1XW9A 1ERVA 4JEDA 4G10A 3F0IA 1X9WB 1XBSA 5CRWA 5HR2A 1XVWA 3V1WA 1ML6A 3TRPA 2R6KA 3KTBA 4J56E 5CO3A 4ID0A 5ECLB 1ZGNA 4D73A 5IIZA 1PD21 4K5RA 2V41A 1R4WA 3ISOA 3FKFA 4Z7XA 5E59A 1BYEA 4LLRA 3L9SA 2F51A 4YKGA 2YPMA 4BL7A 3A5IA 3IK7A 2NDOA 4AF2A 2ZUPA 2EC4A 2P0GA 3HZ8A 2IJYA 3CSIA 1T4YA 1TW9A 1UA5A 4PTSA 3HHVA 2QSIA 1B48A 2HSHA 4H86A 1FAAA 2WFCA 2B7KA 2V2GA 2HE3A 2KUCA 2GS3A 2R0CA 3UEMA 5IMCA 1DBYA 1Z5YE 5A4VA 4HI7A 3F3RA 3NIVA 2H6YA 3FR9A 4ZBBA 4YAPA 3HJPA 5F8BA 1AIUA 3PINA 4TW5A 3BJ5A 3ERFA 1F6MC 3DXBA 2YWIA 4K9ZA 1XVQA 2OE0A 2CAQA 2VLUA 1FW1A 4GLTA 2R4VA 5H5QA 1EGOA 2DJ1A 11GSA 2RIIA 4ZBDA 2ZCTA 3GSTA 3Q6OA 4L0WA 2R3XA 5AN1A 4MJCA 3CMIA 2HNLA 4K2DA 1B8XA 2L4QA 2N5BA 2JADA 2VCZA 4LL4B 4POBA 1THXA 1PRXA 4GWRA 2DSAA 2YWOA 5E4WA 4CY8A 4HEA2 5ID2A 5G5EA 1MD4A 5F07A 2IL3A 1K0MA 4L5LA 2WGRA 3QR6A 5F0GA 2YJ7A 5F06A 3WT2A 4KA0A 4JU5A 3FK8A 1ZL9A 5JCUA 2LJAA 3GKNA 4K7OA 5IO0A 5EL8A 6GSYA 4TXVA 3VK9A 1MDJA 3D0ZA 3TJJA 3BD2A 1GULA 3TJGA 3IPZA 4F0CA 1GL8A 2OADA 5D9XA 1SJIA 2CZ2A 2YWMA 1GSDA 1JLVA 2F8AA 1S3CA 2B5EA 5ECQB 3TJFA 2H8LA 1WJKA 4ZB8A 2O8VB 2WULA 4MNNA 3APOA 4MF5A 2I9HA 1PQNA 2N5FA 1TTZA 5DJMA 5DAKB 5DCGA 1TP9A 1TRVA 4Z2RA 3FHKA 6GSTA 4TR4A 2CVKA 1OC9A 2H72A 4HZ2A 2M80A 2LRTA 3L4NA 4BWQA 4OO5A 1BEDA 3CBUA 1BX9A 1VF4A 4PQ1A 4N11A 3F4RA 4O5UA 3ZL5A 1ZYNA 5GSTA 3GNJA 2L59A 3N5OA 2HXKA 3E9JB 1JZOA 5A4UA 1SD8A 2C3NA 2FY6A 1BJXA 2G0FA 1ZYEA 2A2PA 4ICYA 4XS6A 4MABA 4Q5NA 2LTKA 2YN1A 2X99A 4GSNA 1PL2A 1JZDA 5BMUA 3UARA 4OWYA 4JZQA 1Z6MA 1LJRA 4TXOB 4DSRA 2IPAA 1SL1B 4ECCA 3LWAA 4MZBA 2C0EA 1E2YA 2YZHA 4XIHA 2PMTA 3RAZA 3D6IA 2L6DA 5LD0A 3C8EA 3ZVJD 2VAFA 4OFMA 4LA1A 5EVOA 3FZ5A 1H4OA 2B3SA 3A2XA 2OACA 3FR6A 2VIMA 3QDNA 4EL1A 4ZB9A 3FZAA 2J23A 1M2AA 1GUHA 2HZEA 1NHYA 6GSSA 1HNAA 1SYRA 1K0CA 1V40A 3F6FA 2C80A 20GSA 1WWJA 3KJYA 4DSSB 5IPHA 1K3OA 2PU9C 3J7Yk 4KX4A 5DVBA 2GQMA 3RHCA 1QGVA 3UMAA 5D9TA 4LMVA 2JACA 4MK3A 1HNCA 5ECKB 2H74A 5GAPD 2CVDA 3I43A 3GURA 5CAXA 3QAWA 1R5PA 3LYKA 2GSRA 5KN3A 4NXIA 1SK0A 2ON5A 3VI7A 4EDZA 3C1SA 2Z9SA 4K1FA 4ZB6A 16GSA 4X4JA 1AQWA 5KN1A 2AYTA 1A2JA 1EOGA 2TRXA 3ERGA 1K0OA 1VF1A 2QA2A 5IMAA 2LNSA 1FOHA 3RPNA 3FEUA 2H1AA 2LS5A 2HRNA 3GL3A 1F37A 1Z3EA 3D21A 3ERWA 5HR0A 2TIRA 1A2MA 1PN0A 2PN8A 1ZZYA 4BVYB 1X9MB 4HDEA 4GQCA 2A2SA 4L8EA 1DUGA 1F2EA 1Z7RA 1J9BA 3GUSA 3GKXA 2VCXA 1Y25A 1R7HA 2LJRA 1G7OA 5EY6A 2I3YA 5AISA 3HVXA 4ZBAA 2RM6A 3F4TA 1AAZA 4MA9A 2JSYA 3TKRA 2DKHA 3HA9A 4K0NA 3R3EA 3D22A 2VLTA 2QKEA 3EE2A 5DALA 5D9WA 3ZLPA 4QL9A 3IDVA 3OR5A 3RBTA 22GSA 4GSSA 2GT5A 2LJKA 2F3MA 4PUFC 3ZVJA 2YJHA 3LEFA 1T1VA 2E0QA 1AW9A 1TDIA 4CDOA 5CNWA 2HYXA 3PR8A 4EF0A 1A0FA 2DJ2A 18GSA 2CV4A 3UVTA 1KEBA 3C71A 4GQFA 5AGYA 2PPTA 1K3LA 1VF3A 4HQZA 1H75A 2IMFA 1KBNA 4LMWA 1NM3A 5GAND 2YNXA 4TN8A 3WT1A 3C73A 4O5RA 2LSTA 2A4HA 3ME7A 2VL2A 4KUNA 2LKUA 3VWUA 1Y6EA 2MZCA 4MPGA 4EDYA 3P8WA 4F9ZA 4TRXA 2DJKA 1X5EA 3FYGA 3ZIVA 5FWGA 3DD3A 5DAKA 2IFQA 1FVKA 4V2LA 5J9CA 4KSMA 1EV4A 4USSA 2PWJA 2LEGA 2K8VA 4KCEA 5KN2A 4OMVA 4MH2A 4NWYA 4PQIA 4RQRA 3TDGA 1Q4JA 4J57E 2KHPA 3TGZA 1O73A 2B5YA 4Q5QA 4ML6A 3GRXA 4ACSA 2VCVA 4L5OA 1J0FA 5EPFA 5ECNB 4RQXA 4PURA 3VWWA 5DDLA 2C3TA 4PGTA 2I4AA 4BWSA 1TI1A 2IIYA 4ECIA 2H0IA 3O6TA 3IBHA 4TXOA 1TK8B 1J08A 3N9JA 3LQ7A 4XCSA 1FB0A 17GSA 3ME8A 2JZRA 2JU5A 2HZFA 6GSUA 4HU7A 3GL5A 3TKSC 2MMAA 3TKSE 2GT6A 3EMXA 5ELGA 1U3AA 1A2LA 2CVBA 1GNEA 4WKWA 1WOUA 1QUWA 2E2MA 2PUKC 4PX1A 3M9KA 3A5WA 4CHSA 3G9BA 2FLSA 4GTUA 4K6XA 6GSVA 2A2RA 5G1KA 3KM6A 3VWVA 4FO5A 4YKFA 3CXGA 2GZPA 3Q18A 3QMXA 1A24A 4I8BA 2NBSA 2WDUA 3HCZA 3DRNA 1OC8A 2GVPA 3QFAC 5JCGA 4LL1B 1TI3A 2V32A 3LJRA 1NW2A 1A8YA 1B9XC 2C1YA 2LQOA 1JHBA 3CTGA 5ECMB 1AC1A 5DJLA 3KH7A 1F3AA 3IV4A 1YF0A 3EMPA 3DGQA 1A8LA 2P5QA 3ZYWA 3JCML 2MMOA 3W8JA 3ZMKA 2I81A 2H73A 1GSSA 1GSEA 3F9UA 1BAYA 3F3QA 1PA3A 4ECBA 3HY2A 4HZ4A 3RHBA 4NMUA 1WRYA 4I2TA 2TRCP 3M1GA 2F9SA 2FWHA 1SL0B 4IJ3A 4IJIA 1WMJA 4BVYA 1MD3A 2OBKA 1MDIA 2HFDA 2KOKA 1QK8A 2H30A 2VCWA 3QOUA 5CRGA 3CSHA 1XOBA 1XOAA 4IQ1A 4X43A 1O81A 2JSZA 5CRHA 5D96A 4N30A 1LU4A 3IOSA 2V6OA 1GSYA 1V57A 5C00A 4IS0A 3A2VA 1GSFA 2DJJA 5G1LA 3UBLA 2FWFA 4KE3A 2LV3A 4ZL9A 3KCMA 2EIRA 1M9BA 1PKWA 1ZOFA 3EC3A 2XPEA 4O32A 4XRAA 5J4UA 2XHFA 2VO4A 3GA4A 2FCHA 2H75A 2ON7A 5IOXA 5D9VA 5B8BA 1G6YA 4O7HA 1K0DA 2WS2A 5ABRA 4NHZA 3GYKA 1WE0A 2YV7A 1TOFA 5D8IA 4I97A 3CTFA 3KGKA 1NSWA 1O85A 2VL3A 4NV5A 4EO3A 5CP1A 4OFTA 4NHWA 4G0LA 1TRUA 3K8NA 4IELA 4NPBA 1B4PA 1AQVA 4IVFA 1XCCA 1SL2B 3HDCA 4XTSA 1DE1A 1XWGA 2B5XA 1OC3A 4IQAA 5KOXA 2X49A 3AY8A 1PX7A 1EP8A 2IMKA 3GX0A 5HFKA 1EEJA 2H19A 3WD6A 5KEJA 5HQPA 5JWOB 3BCIA 4PXOA 4KAEA 3H93A 2KP1A 2HT9A 4IKHA 2HRKA 1XXUA 2C0GA 2H0GA 2FA8A 2VCTA 1URMA 5J41A 2HSMA 2NTOA 8GSSA 5JWQB 4QL7A 4HJ2A 1ZMAA 3TKQA 3MYDA 3GKKA 1ST9A 3KZQA 2VD1A 4POLA 2FGXA 2JL4A 2NVLA 2R0GA 2HRAA 1GWCA 3D5JA 1GNWA 5ECHB 4IW9A 1EP7A 4X1UA 1JLWA 2PVQA 2CX3A 2GGTA 1TXXA 1GUMA 3EU4A 2GSTA 1XW6A 2V6KA 3HJMA 3FR3A 4KDUA 4TKYA 3MDKA 2CQ9A 5G31A 1MEKA 2MMZA 4O92A 3WGEA 2LRNA 3TCOA 1XIYA 1PGTA 2HI7A 1Z6NA 2V1MA 1FO5A 2L6CA 1K3YA 4MCUA 3F4SA 4A5PA 4TR0A 1VRSD 2WJUA 5B7CA 4XRDA 1ERTA 1XWBA 3CSJA 4OCFA 1XWAA 3F6DA 4OCEA 4FYUA 4K5SA 1LBKA 1TK0B 2XPDA 2AHEA 3H8QA 4F03A 5IPGA 2AJQB 1V2AA 1YEXA 2VCQA 3I9V2 2I1UA 1EV9A 2O87A 3U5RE 4P3YB 2YV9A 4PQHA 1KNGA 3H1NA 2WRTA 4RUVA 5CRDA 3EVIA 2K9FA 2IMDA 4IP6A 3KTLA 4IBPA 4Z2UA 1FOVA 1ILOA 1U87A 3RPPA 1MTCA 4PNGA 1E6BA 1DSBA 2MBTA 4IHUA 5CYYA 2OE1A 4TR3A 2BTOT 2G2QA 2GSSA 3UBKA 4MJBA 3KH9A 1PKZA 1JFUA 1X0RA 6GSXA 3ZZXA 2ES7A 2X8GA 3UVHA 1RQMA 2X4AA 1PX6A 1TKDB 2VL9A 1WPIA 4KSOA 3I69A 3LG6A 3Q74A 3ZTLA 4ZILA 2FA4A 4OO4A 3APSA 1ZYPA 3LXTA 1PN9A 5ENUA 2DJ0A 4XS4B 3DKSA 2VD0A 2C4JA 5A5KA 4FIWA 4MZWA 1R26A 1GTAA 2WB9A 3DEXA 1AXDA 3WGDA 5AIVA 3IC8A 3GKMA 4PUAA 4ZXGA 3MNGA 3SBCA 1YEPA 4WR4A 4HQSA 2H01A 1SKSB 2E7PA 1SJ6A 4V2NA 4EIQA 2X8CA 1M0UA 3A2WA 4ECJA 3LORA 3MWHA 2VOCA 2PBJA 4ML1A 1OE7A 3P7XA 3FZ9A 3HKRA 2K8SA 1HYUA 3TOTA 1M7TA 2GZYA 2L4CA 3IAM2 1CQGA 3F8UA 4Z2TA 2AAWA 1AQXA 5INYA 4MP4A 5IO2A 2RM5A 3VI5A 4FH8A 3TUEA 3S9FA 2L5OA 2ZNMA 3GFKA 1OYJA 4QQ7A 4JR6A 2YWNA 3L0HA 4G19A 1U3IA 2LRCA 1T4ZA 3VPTA 1JZWA 1G6WA 2EIQA 2QC7A 4BA7A 3IHQA 1N8JA 4YQVA 1I5GA 4G0KA 3ZIJA 4EUYA 1UVZA 1GH2A 3W6GA 3O3TA 4WETA 4CW9A 1GLQA 1GP1A 1WP0A 3Q19A 4GCIA 4JBBA 4NAXA 1IYHA 1G7EA 2YP6A 5IOWA 3ZFBA 1TK5B 2AV4A 1SYXA 1USBA 2H70A 4J2FA 3IE3A 2H1DA 4EKZA 3M0FA 4WR5A 1ABAA 3GMFA 1VF2A 1SD9A 3C7MA 3W8SA 2FUG2 2L57A 5KOWA 2MYGA 3F63A 2C3QA 4JE1A 3UL3A 4L0UA 3PH9A 1M99A 1F3BA 1A0RP 2B6MA 3GIXA 2R37A 3PGTA 12GSA 4O5QA 1PSQA 4I2UA 2H6XA 4KDXA 2AUVA 3P90A 3HVVA 5ECPB 7GSSA 1SKRB 3EURA 2HZEB 4F0BA 5HFGA 2PERA 4EC0A 3QCPA 3GTUB 2H6ZA 3R2QA 5B6NA 4I5QA 3FMWA 1QMVA 3VURA 3FY7A 4MPFA 1HNBA 4AJ6A 4EXJA 3I6AA 1EEMA 4FYCA 2D2ZA 4DSSA 3IXRA 1F9MA 3IHGA 1ERWA 4GSTA 4HJMA 4OD7A 4ZL7A 4MDCA 1O6JA 2PVOC 5D73A 1W4VA 3CYNA 3ZRDA 3G7YA 4G9HA 3UJ1A 2VM2A 1GSQA 5FHIA 1GTBA 2OE3A 3CRUA 1VGLA 4KGIA 1M2DA 5DCHA 4WBJA 5DQSA 1YY7A 2CA8A 3DVWA 5JWRB 3BBYA 1GTUA 9GSSA 2B7JA 5JCWA 2CX4A 3MAKA 1C72A 4YAVA 3NZNA 1THOA 3WGXA 5GSSA 3G7IA 4K7NA 3QFBC 1IYIA 4YQUA 1M9AA 3CRTA 4MF6A 5IMZA 4TR1B 1O8WA 2VLVA 3DWVA 1FVJA 3LW9A 1XWKA 4CY6A 1TRWA 4HS1A 1SJZA 1OE8A 2GQLA 4BVXB 3KMNA 3EPTA 2C0FA 4GRFA 2JZSA 3C1RA 2DKIA 4RI7A 2LNTA 3KMOA 4DSQA 1Z9HA 2HLSA 4IGJA 1Q98A 1V98A 3LFLA 4XS4A 3QAVA 1DE2A 2O85A 3UIWA 1RW1A 2R5GA 3SWLA 5DALB 3IRAA 1RK4A 3IC4A 2UZ8A 2FD3A 2WZ9A 2X8HA 2LUSA 4HUAA 5CREA 3GN3A 3GV1A 2H66A 3J7Yb 1K0AA 3EYTA 5J9BA 2B1KA 3BCKA 1YJ6A 2OJLA 2M46A 4G0IA 3VPQA 1W89A 2VUPA 4K0GA 4ISDA 2RUEA 1QFNA 4K7IA 2A4VA 3IK9A 3L78A 3ZFLA 3HD5A 3GH9A 3FZ4A 4KH7A 2C0DA 4TVEA 3IR4A 2XBQA 5F05A 3MIXA 2H1GA 4F82A 3TKSA 13GSA 2IFQB 3TRQA 3IAS2 1FHEA 1GLPA 2DIZA 3HZ4A 5L71A 5GZZB 2GSQA 14GSA 3GX8A 5A4WA 3NOFA 3RDWA 4WEYA 2O89A 2WCIA 4MH3A 5ECOB 5COHA 4PNFA 1BG5A 2DMMA 4MLYA 5IQYA 2F8FA 2CZ3A 1XFLA 3QPMA 1TU7A 5ECIB 2DLXA 3KP9A 3TRXA 1PMTA 4POMA 1G0TA 2FNOA 4MZCA 4POKA 4V2MA 2DC5A 5ECRB 4MJEA 4IN0A 1V9WA 3DYRA 4ZL8A 2OKAA 5J3RA 2MMNA 1M2BA 1X5CA 19GSA 1Z7PA 3KEBA 3FRCA 2VL2C 3LSZA 3DMLA 3GSSA 4KW6A 5H5RA 3E0UA 5LCZA 5ELAA 1YF1A 2E2GA 4KB3A 4I6XA 2GDRA 3PPUA 1S3AA 2J9HA 1FG4A 2K18A 6GSWA 2BJXA 4D73B 4HOJA 2YOIA 2B1LA 3D4TA 3VLNA 4ULXA 5IMVA 1YKAA 3E3EA 3GTUA 4GXZA 3EINA 4BL7B 1UN2A 1GRXA 1OVNA 2DIYA 2DMLA 2IWTA 1A23A 4Q5FA 3HJOA 5IM9A 3DVXA 2FWEA 4V1Ap 2YANA 10GSA 2AB6A 3QD9A 3KD0A 4MF7A 5LNKe 3VFIA 1T00A 5FT3A 5G30A 1ACVA 5HR3A 3IA1A 1U88A 3MSZA 3VWXA 2CAIA 1ON4A 3TOUA 1O7UA 1SKWB 5ECSA 2NPBA 2XC2A 1AUCA 2H76A 1OKTA 4FYBA 4F2IA 1R5AA 1PL1A 2X64A 1HD2A 3WYWA 4WF4A 1T7PB 2BMXA 2M72A 2REMA 5B8AA 4DVCA 2H71A 4GF0A 2KP2A 1SK2A 3GH6A 4KF9A 4ZIJA 4BPYA 5KN0A 3US3A 3LYPA 4JR4A 1WIKA 4KDYA 1GTIA 1UC7A 3UAPA 1N2AA 1SK1A 1YZXA 1T3BA 2XBIA 1U6TA 3DIEA 1TU8A 2PGTA 4TOPA 4AJ7A 3H79A 4TR1A 3H4KA 4XS1A 5HR1A 5HFIA 1BQ7A 2FWGA 1XW5A 3LXZA 3ZMLA 1X9SB 4BVXA 2RUFA 3L9UA 1XWCA 2O7KA 5H5SA 1QXHA 2FHEA 3LGCA 5ID2B 4KCAA 1KTEA 3BOAA 5J5NA 4E8HA 1K0BA 2DBCA 4NV2A 2R0PA 4MJAA 1FB6A 1EZKA 3HXSA 4E8EA 1YQ1A 3G7JA 1I9DA 3HYPA 2LQQA 2KLXA 2OA7A 1XPVA 2OBIA 4YQMA 2QA1A 4DEJA 3ZREA 2P5RA 1JZRA 4Q5RA 1K0NA 3FW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHO A;  4EVM A;  2H1B A;  3A3T A;  4V1A g;  4WBR D;  2GLR A;  2P31 A;  2JZT A;  1S3D A;  2CT6 A;  1GSU A;  3KP8 A;  3TKP A;  2GZZ A;  1O8X A;  3KXO A;  1MDK A;  1GUK A;  4X0X A;  4JRR A;  4KND A;  3GHA A;  5DBQ A;  1B4Q A;  2MBS A;  2C8U A;  1EGR A;  4ILF A;  3TJB A;  3KIJ A;  1EWX A;  2HSY A;  5D93 A;  5G2Z A;  4N10 A;  3M9J A;  3M3M A;  3TB2 A;  1TRS A;  5DQY A;  4WF5 A;  1ZCP A;  4N0Z A;  4G2E A;  4RI6 A;  1ZYQ B;  4N0V A;  2GQK A;  1TJD A;  2IMI A;  1OC9 B;  2R2J A;  3EU3 A;  4YH2 A;  5AIX A;  2IME A;  5IMD A;  2HRF A;  3EWL A;  4HU9 A;  2ALB A;  3APQ A;  2GTU A;  2DJ3 A;  1XZO A;  4MMM A;  2QGV A;  2YZU A;  3ED3 A;  3M8N A;  1QQ2 A;  4K8M A;  3P2A A;  1B9Y C;  3UOM A;  2RLI A;  5B6M A;  1YDK A;  4AJ8 A;  5G5F A;  3ZIT A;  2YCD A;  2EIO A;  2K6V A;  1OKD A;  3U6V A;  4IP1 A;  4AGS A;  3L9V A;  1X5D A;  4WXT A;  2L5L A;  1ERU A;  1CQH A;  1T8E B;  1SEN A;  1SU9 A;  3TJK A;  2VM1 A;  1HQO A;  4OFN A;  1EOH A;  3QAG A;  3O76 A;  1YKC A;  5IMF A;  4EE0 A;  2IN3 A;  4XHM A;  1V58 A;  3D4M A;  3HVS A;  2N5A A;  5C04 A;  2H0H A;  1OAZ A;  1XW9 A;  1ERV A;  4JED A;  4G10 A;  3F0I A;  1X9W B;  1XBS A;  5CRW A;  5HR2 A;  1XVW A;  3V1W A;  1ML6 A;  3TRP A;  2R6K A;  3KTB A;  4J56 E;  5CO3 A;  4ID0 A;  5ECL B;  1ZGN A;  4D73 A;  5IIZ A;  1PD2 1;  2V41 A;  1R4W A;  3ISO A;  3FKF A;  4Z7X A;  5E59 A;  1BYE A;  4LLR A;  3L9S A;  2F51 A;  2YPM A;  4BL7 A;  3IK7 A;  2NDO A;  4AF2 A;  2ZUP A;  2EC4 A;  2P0G A;  3HZ8 A;  2IJY A;  3CSI A;  1T4Y A;  1TW9 A;  1UA5 A;  3HHV A;  2QSI A;  1B48 A;  2HSH A;  4H86 A;  1FAA A;  2WFC A;  2B7K A;  2V2G A;  2HE3 A;  2KUC A;  2GS3 A;  3UEM A;  5IMC A;  1DBY A;  1Z5Y E;  5A4V A;  4HI7 A;  3F3R A;  3NIV A;  2H6Y A;  3FR9 A;  4ZBB A;  4YAP A;  3HJP A;  5F8B A;  1AIU A;  3PIN A;  4TW5 A;  3BJ5 A;  3ERF A;  1F6M C;  3DXB A;  2YWI A;  4K9Z A;  1XVQ A;  2OE0 A;  2CAQ A;  2VLU A;  1FW1 A;  4GLT A;  2R4V A;  5H5Q A;  1EGO A;  2DJ1 A;  11GS A;  2RII A;  4ZBD A;  2ZCT A;  3GST A;  3Q6O A;  4L0W A;  2R3X A;  5AN1 A;  4MJC A;  3CMI A;  2HNL A;  4K2D A;  1B8X A;  2L4Q A;  2N5B A;  2JAD A;  2VCZ A;  4LL4 B;  4POB A;  1THX A;  1PRX A;  4GWR A;  2DSA A;  2YWO A;  5E4W A;  4HEA 2;  5ID2 A;  5G5E A;  1MD4 A;  5F07 A;  2IL3 A;  1K0M A;  4L5L A;  2WGR A;  3QR6 A;  5F0G A;  2YJ7 A;  5F06 A;  3WT2 A;  4KA0 A;  4JU5 A;  3FK8 A;  1ZL9 A;  5JCU A;  2LJA A;  3GKN A;  4K7O A;  5IO0 A;  5EL8 A;  6GSY A;  4TXV A;  3VK9 A;  1MDJ A;  3D0Z A;  3TJJ A;  3BD2 A;  1GUL A;  3TJG A;  3IPZ A;  4F0C A;  1GL8 A;  2OAD A;  5D9X A;  1SJI A;  2CZ2 A;  2YWM A;  1GSD A;  1JLV A;  2F8A A;  1S3C A;  2B5E A;  5ECQ B;  3TJF A;  2H8L A;  1WJK A;  4ZB8 A;  2O8V B;  2WUL A;  3APO A;  4MF5 A;  2I9H A;  1PQN A;  2N5F A;  1TTZ A;  5DJM A;  5DAK B;  5DCG A;  1TP9 A;  1TRV A;  3FHK A;  6GST A;  4TR4 A;  2CVK A;  1OC9 A;  2H72 A;  4HZ2 A;  2M80 A;  2LRT A;  3L4N A;  4BWQ A;  4OO5 A;  1BED A;  3CBU A;  1BX9 A;  1VF4 A;  4PQ1 A;  4N11 A;  3F4R A;  3ZL5 A;  5GST A;  3GNJ A;  2L59 A;  3N5O A;  2HXK A;  3E9J B;  1JZO A;  5A4U A;  1SD8 A;  2C3N A;  2FY6 A;  1BJX A;  2G0F A;  1ZYE A;  4XS6 A;  4MAB A;  4Q5N A;  2LTK A;  2YN1 A;  2X99 A;  4GSN A;  1PL2 A;  1JZD A;  3UAR A;  4OWY A;  4JZQ A;  1Z6M A;  1LJR A;  4TXO B;  4DSR A;  2IPA A;  1SL1 B;  4ECC A;  3LWA A;  4MZB A;  2C0E A;  1E2Y A;  2YZH A;  4XIH A;  2PMT A;  3RAZ A;  3D6I A;  2L6D A;  5LD0 A;  3C8E A;  3ZVJ D;  2VAF A;  4OFM A;  4LA1 A;  5EVO A;  3FZ5 A;  1H4O A;  2B3S A;  3A2X A;  2OAC A;  3FR6 A;  2VIM A;  3QDN A;  4EL1 A;  4ZB9 A;  3FZA A;  2J23 A;  1M2A A;  1GUH A;  2HZE A;  1NHY A;  6GSS A;  1HNA A;  1SYR A;  1K0C A;  1V40 A;  3F6F A;  2C80 A;  20GS A;  1WWJ A;  3KJY A;  4DSS B;  5IPH A;  1K3O A;  2PU9 C;  3J7Y k;  4KX4 A;  5DVB A;  2GQM A;  3RHC A;  1QGV A;  3UMA A;  5D9T A;  4LMV A;  2JAC A;  4MK3 A;  1HNC A;  5ECK B;  2H74 A;  5GAP D;  2CVD A;  3I43 A;  3GUR A;  5CAX A;  3QAW A;  1R5P A;  3LYK A;  2GSR A;  5KN3 A;  4NXI A;  1SK0 A;  2ON5 A;  3VI7 A;  4EDZ A;  3C1S A;  2Z9S A;  4K1F A;  4ZB6 A;  16GS A;  1AQW A;  5KN1 A;  2AYT A;  1A2J A;  1EOG A;  2TRX A;  3ERG A;  1K0O A;  1VF1 A;  5IMA A;  2LNS A;  3RPN A;  3FEU A;  2H1A A;  2LS5 A;  2HRN A;  3GL3 A;  1F37 A;  1Z3E A;  3D21 A;  3ERW A;  5HR0 A;  2TIR A;  1A2M A;  2PN8 A;  1ZZY A;  1X9M B;  4HDE A;  4GQC A;  2A2S A;  4L8E A;  1DUG A;  1F2E A;  1Z7R A;  1J9B A;  3GUS A;  3GKX A;  2VCX A;  1Y25 A;  1R7H A;  2LJR A;  1G7O A;  5EY6 A;  2I3Y A;  5AIS A;  3HVX A;  4ZBA A;  2RM6 A;  3F4T A;  1AAZ A;  4MA9 A;  2JSY A;  3TKR A;  3HA9 A;  4K0N A;  3D22 A;  2VLT A;  2QKE A;  3EE2 A;  5DAL A;  5D9W A;  3ZLP A;  4QL9 A;  3IDV A;  3OR5 A;  3RBT A;  22GS A;  4GSS A;  2GT5 A;  2LJK A;  2F3M A;  4PUF C;  3ZVJ A;  2YJH A;  3LEF A;  1T1V A;  2E0Q A;  1AW9 A;  1TDI A;  4CDO A;  5CNW A;  2HYX A;  3PR8 A;  4EF0 A;  1A0F A;  2DJ2 A;  18GS A;  2CV4 A;  3UVT A;  1KEB A;  3C71 A;  4GQF A;  5AGY A;  2PPT A;  1K3L A;  1VF3 A;  4HQZ A;  1H75 A;  2IMF A;  1KBN A;  4LMW A;  1NM3 A;  5GAN D;  2YNX A;  4TN8 A;  3WT1 A;  3C73 A;  4O5R A;  2LST A;  3ME7 A;  2VL2 A;  4KUN A;  2LKU A;  3VWU A;  1Y6E A;  2MZC A;  4MPG A;  4EDY A;  3P8W A;  4F9Z A;  4TRX A;  2DJK A;  1X5E A;  3FYG A;  3ZIV A;  5FWG A;  3DD3 A;  5DAK A;  2IFQ A;  1FVK A;  4V2L A;  5J9C A;  4KSM A;  1EV4 A;  2PWJ A;  2LEG A;  2K8V A;  4KCE A;  5KN2 A;  4OMV A;  4MH2 A;  4NWY A;  4PQI A;  4RQR A;  3TDG A;  1Q4J A;  4J57 E;  2KHP A;  3TGZ A;  1O73 A;  2B5Y A;  4Q5Q A;  4ML6 A;  3GRX A;  4ACS A;  2VCV A;  4L5O A;  1J0F A;  5EPF A;  5ECN B;  4RQX A;  4PUR A;  3VWW A;  5DDL A;  2C3T A;  4PGT A;  2I4A A;  4BWS A;  1TI1 A;  2IIY A;  4ECI A;  2H0I A;  3O6T A;  3IBH A;  4TXO A;  1TK8 B;  1J08 A;  3N9J A;  3LQ7 A;  4XCS A;  1FB0 A;  17GS A;  3ME8 A;  2JZR A;  2JU5 A;  2HZF A;  6GSU A;  4HU7 A;  3GL5 A;  3TKS C;  2MMA A;  3TKS E;  2GT6 A;  3EMX A;  5ELG A;  1U3A A;  1A2L A;  2CVB A;  1GNE A;  4WKW A;  1WOU A;  1QUW A;  2E2M A;  2PUK C;  4PX1 A;  3M9K A;  3A5W A;  4CHS A;  3G9B A;  2FLS A;  4GTU A;  4K6X A;  6GSV A;  2A2R A;  5G1K A;  3KM6 A;  3VWV A;  4FO5 A;  3CXG A;  2GZP A;  3Q18 A;  3QMX A;  1A24 A;  4I8B A;  2NBS A;  2WDU A;  3HCZ A;  3DRN A;  1OC8 A;  2GVP A;  3QFA C;  5JCG A;  4LL1 B;  1TI3 A;  2V32 A;  3LJR A;  1NW2 A;  1A8Y A;  1B9X C;  2C1Y A;  2LQO A;  1JHB A;  3CTG A;  5ECM B;  1AC1 A;  5DJL A;  3KH7 A;  1F3A A;  3IV4 A;  1YF0 A;  3EMP A;  3DGQ A;  1A8L A;  2P5Q A;  3ZYW A;  3JCM L;  2MMO A;  3W8J A;  3ZMK A;  2I81 A;  2H73 A;  1GSS A;  1GSE A;  3F9U A;  1BAY A;  3F3Q A;  1PA3 A;  4ECB A;  3HY2 A;  4HZ4 A;  3RHB A;  4NMU A;  1WRY A;  4I2T A;  2TRC P;  3M1G A;  2F9S A;  2FWH A;  1SL0 B;  4IJ3 A;  4IJI A;  1WMJ A;  4BVY A;  1MD3 A;  2OBK A;  1MDI A;  2HFD A;  2KOK A;  1QK8 A;  2H30 A;  2VCW A;  3QOU A;  5CRG A;  3CSH A;  1XOB A;  1XOA A;  4IQ1 A;  4X43 A;  1O81 A;  2JSZ A;  5CRH A;  5D96 A;  4N30 A;  1LU4 A;  3IOS A;  2V6O A;  1GSY A;  1V57 A;  5C00 A;  4IS0 A;  3A2V A;  1GSF A;  2DJJ A;  5G1L A;  3UBL A;  2FWF A;  4KE3 A;  2LV3 A;  4ZL9 A;  3KCM A;  2EIR A;  1M9B A;  1PKW A;  1ZOF A;  3EC3 A;  2XPE A;  4O32 A;  4XRA A;  5J4U A;  2XHF A;  2VO4 A;  3GA4 A;  2FCH A;  2H75 A;  2ON7 A;  5IOX A;  5D9V A;  5B8B A;  1G6Y A;  4O7H A;  1K0D A;  2WS2 A;  5ABR A;  4NHZ A;  3GYK A;  1WE0 A;  2YV7 A;  1TOF A;  5D8I A;  4I97 A;  3CTF A;  3KGK A;  1NSW A;  1O85 A;  2VL3 A;  4NV5 A;  4EO3 A;  5CP1 A;  4OFT A;  4NHW A;  1TRU A;  3K8N A;  4IEL A;  4NPB A;  1B4P A;  1AQV A;  4IVF A;  1XCC A;  1SL2 B;  3HDC A;  4XTS A;  1DE1 A;  1XWG A;  2B5X A;  1OC3 A;  4IQA A;  3AY8 A;  1PX7 A;  1EP8 A;  2IMK A;  3GX0 A;  5HFK A;  1EEJ A;  2H19 A;  3WD6 A;  5KEJ A;  5HQP A;  5JWO B;  3BCI A;  4PXO A;  4KAE A;  3H93 A;  2KP1 A;  2HT9 A;  4IKH A;  1XXU A;  2C0G A;  2H0G A;  2FA8 A;  2VCT A;  1URM A;  5J41 A;  2NTO A;  8GSS A;  5JWQ B;  4QL7 A;  4HJ2 A;  1ZMA A;  3TKQ A;  3GKK A;  1ST9 A;  3KZQ A;  2VD1 A;  4POL A;  2FGX A;  2JL4 A;  2NVL A;  1GWC A;  3D5J A;  1GNW A;  5ECH B;  4IW9 A;  1EP7 A;  4X1U A;  1JLW A;  2PVQ A;  2CX3 A;  2GGT A;  1TXX A;  1GUM A;  3EU4 A;  2GST A;  1XW6 A;  2V6K A;  3HJM A;  3FR3 A;  4KDU A;  4TKY A;  3MDK A;  2CQ9 A;  5G31 A;  1MEK A;  2MMZ A;  4O92 A;  3WGE A;  2LRN A;  3TCO A;  1XIY A;  1PGT A;  2HI7 A;  1Z6N A;  2V1M A;  1FO5 A;  2L6C A;  1K3Y A;  4MCU A;  3F4S A;  4TR0 A;  1VRS D;  2WJU A;  5B7C A;  4XRD A;  1ERT A;  1XWB A;  3CSJ A;  4OCF A;  1XWA A;  3F6D A;  4OCE A;  4FYU A;  1LBK A;  1TK0 B;  2XPD A;  2AHE A;  3H8Q A;  4F03 A;  5IPG A;  2AJQ B;  1V2A A;  1YEX A;  2VCQ A;  3I9V 2;  2I1U A;  1EV9 A;  2O87 A;  3U5R E;  4P3Y B;  2YV9 A;  4PQH A;  1KNG A;  3H1N A;  2WRT A;  4RUV A;  5CRD A;  3EVI A;  2K9F A;  2IMD A;  4IP6 A;  3KTL A;  4IBP A;  1FOV A;  1ILO A;  1U87 A;  3RPP A;  1MTC A;  4PNG A;  1E6B A;  1DSB A;  2MBT A;  4IHU A;  5CYY A;  2OE1 A;  4TR3 A;  2BTO T;  2G2Q A;  2GSS A;  3UBK A;  4MJB A;  3KH9 A;  1PKZ A;  1JFU A;  1X0R A;  6GSX A;  3ZZX A;  2ES7 A;  2X8G A;  3UVH A;  1RQM A;  1PX6 A;  1TKD B;  2VL9 A;  1WPI A;  4KSO A;  3I69 A;  3LG6 A;  3Q74 A;  3ZTL A;  4ZIL A;  2FA4 A;  4OO4 A;  3APS A;  3LXT A;  1PN9 A;  5ENU A;  2DJ0 A;  4XS4 B;  3DKS A;  2VD0 A;  2C4J A;  5A5K A;  4FIW A;  4MZW A;  1R26 A;  1GTA A;  2WB9 A;  3DEX A;  1AXD A;  3WGD A;  5AIV A;  3GKM A;  4PUA A;  4ZXG A;  3MNG A;  3SBC A;  1YEP A;  4WR4 A;  4HQS A;  2H01 A;  1SKS B;  2E7P A;  1SJ6 A;  4V2N A;  2X8C A;  1M0U A;  3A2W A;  4ECJ A;  3LOR A;  3MWH A;  2VOC A;  2PBJ A;  4ML1 A;  1OE7 A;  3P7X A;  3FZ9 A;  3HKR A;  2K8S A;  1HYU A;  3TOT A;  1M7T A;  2GZY A;  2L4C A;  3IAM 2;  1CQG A;  3F8U A;  2AAW A;  1AQX A;  5INY A;  4MP4 A;  5IO2 A;  2RM5 A;  3VI5 A;  4FH8 A;  3TUE A;  3S9F A;  2L5O A;  2ZNM A;  3GFK A;  1OYJ A;  4QQ7 A;  4JR6 A;  2YWN A;  3L0H A;  4G19 A;  1U3I A;  2LRC A;  1T4Z A;  3VPT A;  1JZW A;  1G6W A;  2EIQ A;  2QC7 A;  4BA7 A;  3IHQ A;  1N8J A;  4YQV A;  1I5G A;  3ZIJ A;  4EUY A;  1UVZ A;  1GH2 A;  3W6G A;  3O3T A;  4WET A;  4CW9 A;  1GLQ A;  1GP1 A;  1WP0 A;  3Q19 A;  4GCI A;  4JBB A;  4NAX A;  1IYH A;  1G7E A;  2YP6 A;  5IOW A;  3ZFB A;  1TK5 B;  2AV4 A;  1SYX A;  1USB A;  2H70 A;  4J2F A;  3IE3 A;  2H1D A;  4EKZ A;  3M0F A;  4WR5 A;  1ABA A;  3GMF A;  1VF2 A;  1SD9 A;  3C7M A;  3W8S A;  2FUG 2;  2L57 A;  2MYG A;  3F63 A;  2C3Q A;  4JE1 A;  3UL3 A;  4L0U A;  3PH9 A;  1M99 A;  1F3B A;  1A0R P;  2B6M A;  3GIX A;  2R37 A;  3PGT A;  12GS A;  1PSQ A;  4I2U A;  2H6X A;  4KDX A;  2AUV A;  3P90 A;  3HVV A;  5ECP B;  7GSS A;  1SKR B;  3EUR A;  2HZE B;  4F0B A;  5HFG A;  2PER A;  4EC0 A;  3QCP A;  3GTU B;  2H6Z A;  3R2Q A;  5B6N A;  4I5Q A;  1QMV A;  3VUR A;  3FY7 A;  4MPF A;  1HNB A;  4AJ6 A;  4EXJ A;  3I6A A;  1EEM A;  4FYC A;  2D2Z A;  4DSS A;  3IXR A;  1F9M A;  1ERW A;  4GST A;  4HJM A;  4OD7 A;  4ZL7 A;  4MDC A;  1O6J A;  2PVO C;  5D73 A;  1W4V A;  3CYN A;  3ZRD A;  3G7Y A;  4G9H A;  3UJ1 A;  2VM2 A;  1GSQ A;  5FHI A;  1GTB A;  2OE3 A;  3CRU A;  1VGL A;  4KGI A;  1M2D A;  5DCH A;  4WBJ A;  5DQS A;  1YY7 A;  2CA8 A;  3DVW A;  5JWR B;  3BBY A;  1GTU A;  9GSS A;  2B7J A;  5JCW A;  2CX4 A;  3MAK A;  1C72 A;  4YAV A;  3NZN A;  1THO A;  3WGX A;  5GSS A;  3G7I A;  4K7N A;  3QFB C;  1IYI A;  4YQU A;  1M9A A;  3CRT A;  4MF6 A;  5IMZ A;  4TR1 B;  1O8W A;  2VLV A;  3DWV A;  1FVJ A;  1XWK A;  1TRW A;  4HS1 A;  1SJZ A;  1OE8 A;  2GQL A;  3KMN A;  2C0F A;  4GRF A;  2JZS A;  3C1R A;  4RI7 A;  2LNT A;  3KMO A;  4DSQ A;  1Z9H A;  2HLS A;  4IGJ A;  1Q98 A;  1V98 A;  3LFL A;  4XS4 A;  3QAV A;  1DE2 A;  2O85 A;  3UIW A;  1RW1 A;  2R5G A;  3SWL A;  5DAL B;  3IRA A;  1RK4 A;  3IC4 A;  2FD3 A;  2WZ9 A;  2X8H A;  2LUS A;  4HUA A;  5CRE A;  3GN3 A;  3GV1 A;  2H66 A;  3J7Y b;  1K0A A;  3EYT A;  5J9B A;  2B1K A;  3BCK A;  1YJ6 A;  2OJL A;  2M46 A;  3VPQ A;  1W89 A;  2VUP A;  4K0G A;  4ISD A;  2RUE A;  1QFN A;  4K7I A;  2A4V A;  3IK9 A;  3L78 A;  3ZFL A;  3HD5 A;  3GH9 A;  3FZ4 A;  4KH7 A;  2C0D A;  4TVE A;  3IR4 A;  2XBQ A;  5F05 A;  2H1G A;  4F82 A;  3TKS A;  13GS A;  2IFQ B;  3TRQ A;  3IAS 2;  1FHE A;  1GLP A;  2DIZ A;  3HZ4 A;  5L71 A;  5GZZ B;  2GSQ A;  14GS A;  3GX8 A;  5A4W A;  3NOF A;  3RDW A;  4WEY A;  2O89 A;  2WCI A;  4MH3 A;  5ECO B;  5COH A;  4PNF A;  1BG5 A;  2DMM A;  4MLY A;  5IQY A;  2F8F A;  2CZ3 A;  1XFL A;  3QPM A;  1TU7 A;  5ECI B;  2DLX A;  3KP9 A;  3TRX A;  1PMT A;  4POM A;  1G0T A;  2FNO A;  4MZC A;  4POK A;  4V2M A;  2DC5 A;  5ECR B;  4MJE A;  4IN0 A;  1V9W A;  3DYR A;  4ZL8 A;  2OKA A;  5J3R A;  2MMN A;  1M2B A;  1X5C A;  19GS A;  1Z7P A;  3KEB A;  3FRC A;  2VL2 C;  3LSZ A;  3DML A;  3GSS A;  4KW6 A;  5H5R A;  3E0U A;  5LCZ A;  5ELA A;  1YF1 A;  2E2G A;  4KB3 A;  4I6X A;  2GDR A;  1S3A A;  2J9H A;  1FG4 A;  2K18 A;  6GSW A;  2BJX A;  4D73 B;  4HOJ A;  2YOI A;  2B1L A;  3D4T A;  3VLN A;  4ULX A;  5IMV A;  1YKA A;  3E3E A;  3GTU A;  4GXZ A;  3EIN A;  1UN2 A;  1GRX A;  1OVN A;  2DIY A;  2DML A;  2IWT A;  1A23 A;  4Q5F A;  3HJO A;  5IM9 A;  3DVX A;  2FWE A;  4V1A p;  2YAN A;  10GS A;  2AB6 A;  3QD9 A;  3KD0 A;  4MF7 A;  5LNK e;  3VFI A;  1T00 A;  5FT3 A;  5G30 A;  1ACV A;  5HR3 A;  3IA1 A;  1U88 A;  3MSZ A;  3VWX A;  2CAI A;  1ON4 A;  3TOU A;  1O7U A;  1SKW B;  5ECS A;  2NPB A;  2XC2 A;  1AUC A;  2H76 A;  1OKT A;  4FYB A;  4F2I A;  1R5A A;  1PL1 A;  2X64 A;  1HD2 A;  3WYW A;  4WF4 A;  1T7P B;  2BMX A;  2M72 A;  2REM A;  5B8A A;  4DVC A;  2H71 A;  4GF0 A;  2KP2 A;  1SK2 A;  3GH6 A;  4ZIJ A;  4BPY A;  5KN0 A;  3US3 A;  3LYP A;  4JR4 A;  1WIK A;  4KDY A;  1GTI A;  1UC7 A;  3UAP A;  1N2A A;  1SK1 A;  1YZX A;  1T3B A;  2XBI A;  1U6T A;  3DIE A;  1TU8 A;  2PGT A;  4TOP A;  4AJ7 A;  3H79 A;  4TR1 A;  3H4K A;  4XS1 A;  5HR1 A;  5HFI A;  1BQ7 A;  2FWG A;  1XW5 A;  3LXZ A;  3ZML A;  1X9S B;  4BVX A;  2RUF A;  3L9U A;  1XWC A;  2O7K A;  5H5S A;  1QXH A;  2FHE A;  3LGC A;  5ID2 B;  4KCA A;  1KTE A;  3BOA A;  5J5N A;  4E8H A;  1K0B A;  2DBC A;  4NV2 A;  4MJA A;  1FB6 A;  1EZK A;  3HXS A;  4E8E A;  1YQ1 A;  3G7J A;  1I9D A;  3HYP A;  2LQQ A;  2KLX A;  2OA7 A;  1XPV A;  2OBI A;  4YQM A;  4DEJ A;  3ZRE A;  2P5R A;  1JZR A;  4Q5R A;  1K0N A;  3FW2 A; 
#chains in the Genus database with same CATH topology
 1NHO A;  4EVM A;  2H1B A;  3A3T A;  4V1A g;  4WBR D;  2GLR A;  2P31 A;  2JZT A;  1S3D A;  2CT6 A;  1GSU A;  3KP8 A;  3TKP A;  2GZZ A;  1O8X A;  3KXO A;  1MDK A;  1GUK A;  4X0X A;  4JRR A;  4KND A;  3GHA A;  5DBQ A;  1B4Q A;  2MBS A;  2C8U A;  1EGR A;  4ILF A;  3TJB A;  3KIJ A;  1EWX A;  2HSY A;  5D93 A;  5G2Z A;  4N10 A;  3M9J A;  3M3M A;  3TB2 A;  1TRS A;  5DQY A;  4WF5 A;  1ZCP A;  4N0Z A;  4G2E A;  4RI6 A;  1ZYQ B;  4N0V A;  2GQK A;  1TJD A;  2IMI A;  1OC9 B;  2R2J A;  3EU3 A;  4YH2 A;  5AIX A;  2IME A;  5IMD A;  2HRF A;  3EWL A;  4HU9 A;  2ALB A;  3APQ A;  4FQU A;  2GTU A;  2DJ3 A;  1XZO A;  4MMM A;  2QGV A;  2YZU A;  3ED3 A;  3M8N A;  1QQ2 A;  4K8M A;  3P2A A;  1B9Y C;  3UOM A;  2RLI A;  5B6M A;  1YDK A;  4AJ8 A;  5G5F A;  3ZIT A;  2YCD A;  2EIO A;  2K6V A;  1OKD A;  3U6V A;  4IP1 A;  4AGS A;  3L9V A;  1X5D A;  4WXT A;  2L5L A;  1ERU A;  1M3I A;  1CQH A;  1T8E B;  1SEN A;  1SU9 A;  4K2X A;  5BRT A;  3TJK A;  2VM1 A;  1HQO A;  4EIP A;  4OFN A;  1EOH A;  3QAG A;  3O76 A;  1YKC A;  5IMF A;  4EE0 A;  2IN3 A;  4XHM A;  1V58 A;  3D4M A;  3HVS A;  2N5A A;  5C04 A;  2H0H A;  1OAZ A;  1XW9 A;  1ERV A;  4JED A;  4G10 A;  3F0I A;  1X9W B;  1XBS A;  5CRW A;  5HR2 A;  1XVW A;  3V1W A;  1ML6 A;  3TRP A;  2R6K A;  3KTB A;  4J56 E;  5CO3 A;  4ID0 A;  5ECL B;  1ZGN A;  4D73 A;  5IIZ A;  1PD2 1;  4K5R A;  2V41 A;  1R4W A;  3ISO A;  3FKF A;  4Z7X A;  5E59 A;  1BYE A;  4LLR A;  3L9S A;  2F51 A;  4YKG A;  2YPM A;  4BL7 A;  3A5I A;  3IK7 A;  2NDO A;  4AF2 A;  2ZUP A;  2EC4 A;  2P0G A;  3HZ8 A;  2IJY A;  3CSI A;  1T4Y A;  1TW9 A;  1UA5 A;  4PTS A;  3HHV A;  2QSI A;  1B48 A;  2HSH A;  4H86 A;  1FAA A;  2WFC A;  2B7K A;  2V2G A;  2HE3 A;  2KUC A;  2GS3 A;  2R0C A;  3UEM A;  5IMC A;  1DBY A;  1Z5Y E;  5A4V A;  4HI7 A;  3F3R A;  3NIV A;  2H6Y A;  3FR9 A;  4ZBB A;  4YAP A;  3HJP A;  5F8B A;  1AIU A;  3PIN A;  4TW5 A;  3BJ5 A;  3ERF A;  3HVN A;  1F6M C;  3DXB A;  2YWI A;  4K9Z A;  1XVQ A;  2OE0 A;  2CAQ A;  2VLU A;  1FW1 A;  4GLT A;  2R4V A;  5H5Q A;  1EGO A;  2DJ1 A;  11GS A;  2RII A;  4ZBD A;  2ZCT A;  3GST A;  3Q6O A;  4L0W A;  2R3X A;  5AN1 A;  4MJC A;  3CMI A;  2HNL A;  4K2D A;  1B8X A;  2L4Q A;  2N5B A;  2JAD A;  2VCZ A;  4LL4 B;  4BIK A;  4POB A;  1THX A;  1PRX A;  4GWR A;  2DSA A;  2YWO A;  5E4W A;  4CY8 A;  4HEA 2;  5ID2 A;  5G5E A;  1MD4 A;  5F07 A;  2IL3 A;  1K0M A;  4L5L A;  2WGR A;  3QR6 A;  5F0G A;  2YJ7 A;  5F06 A;  3WT2 A;  4KA0 A;  4JU5 A;  3FK8 A;  1ZL9 A;  5JCU A;  2LJA A;  3GKN A;  4K7O A;  5IO0 A;  5EL8 A;  6GSY A;  4TXV A;  3VK9 A;  1MDJ A;  3D0Z A;  3TJJ A;  3BD2 A;  1GUL A;  3TJG A;  3IPZ A;  4F0C A;  1GL8 A;  2OAD A;  5D9X A;  1SJI A;  2CZ2 A;  2YWM A;  1GSD A;  1JLV A;  2F8A A;  1S3C A;  2B5E A;  5ECQ B;  3TJF A;  2H8L A;  1WJK A;  4ZB8 A;  2O8V B;  2WUL A;  4MNN A;  3APO A;  4MF5 A;  2I9H A;  1PQN A;  2N5F A;  1TTZ A;  5DJM A;  5DAK B;  5DCG A;  1TP9 A;  1TRV A;  4Z2R A;  3FHK A;  6GST A;  4TR4 A;  2CVK A;  1OC9 A;  2H72 A;  4HZ2 A;  2M80 A;  2LRT A;  3L4N A;  4BWQ A;  4OO5 A;  1BED A;  3CBU A;  1BX9 A;  1VF4 A;  4PQ1 A;  4N11 A;  3F4R A;  4O5U A;  3ZL5 A;  1ZYN A;  5GST A;  3GNJ A;  2L59 A;  3N5O A;  2HXK A;  3E9J B;  1JZO A;  5A4U A;  1SD8 A;  2C3N A;  2FY6 A;  1BJX A;  2G0F A;  1ZYE A;  2A2P A;  4ICY A;  4XS6 A;  4MAB A;  4Q5N A;  2LTK A;  2YN1 A;  2X99 A;  4GSN A;  1PL2 A;  1JZD A;  5BMU A;  3UAR A;  4OWY A;  4JZQ A;  1Z6M A;  1LJR A;  4TXO B;  4DSR A;  2IPA A;  1SL1 B;  4ECC A;  3LWA A;  4MZB A;  2C0E A;  1E2Y A;  2YZH A;  4XIH A;  2PMT A;  3RAZ A;  3D6I A;  2L6D A;  5LD0 A;  3C8E A;  3ZVJ D;  2VAF A;  4OFM A;  4LA1 A;  5EVO A;  3FZ5 A;  1H4O A;  2B3S A;  3A2X A;  2OAC A;  3FR6 A;  2VIM A;  3QDN A;  4EL1 A;  4ZB9 A;  3FZA A;  2J23 A;  1M2A A;  1GUH A;  2HZE A;  1NHY A;  6GSS A;  1HNA A;  1SYR A;  1K0C A;  1V40 A;  3F6F A;  2C80 A;  20GS A;  1WWJ A;  3KJY A;  4DSS B;  5IPH A;  1K3O A;  2PU9 C;  3J7Y k;  4KX4 A;  5DVB A;  2GQM A;  3RHC A;  1QGV A;  3UMA A;  5D9T A;  4LMV A;  2JAC A;  4MK3 A;  1HNC A;  5ECK B;  2H74 A;  5GAP D;  2CVD A;  3I43 A;  3GUR A;  5CAX A;  3QAW A;  1R5P A;  3LYK A;  4HSC X;  2GSR A;  5KN3 A;  4NXI A;  1SK0 A;  2ON5 A;  3VI7 A;  4EDZ A;  3C1S A;  2Z9S A;  4K1F A;  4ZB6 A;  16GS A;  4X4J A;  1AQW A;  5KN1 A;  2AYT A;  1A2J A;  1EOG A;  2TRX A;  3ERG A;  1K0O A;  1VF1 A;  2QA2 A;  5IMA A;  2LNS A;  1FOH A;  3RPN A;  3FEU A;  2H1A A;  2LS5 A;  2HRN A;  3GL3 A;  1F37 A;  1Z3E A;  3D21 A;  3ERW A;  5HR0 A;  2TIR A;  1A2M A;  1PN0 A;  2PN8 A;  1ZZY A;  4BVY B;  1X9M B;  4HDE A;  4GQC A;  2A2S A;  4L8E A;  1DUG A;  1F2E A;  1Z7R A;  1J9B A;  3GUS A;  3GKX A;  2VCX A;  1Y25 A;  1R7H A;  2LJR A;  1G7O A;  5EY6 A;  2I3Y A;  5AIS A;  3HVX A;  4ZBA A;  2RM6 A;  3F4T A;  1AAZ A;  4MA9 A;  2JSY A;  3TKR A;  2DKH A;  3HA9 A;  4K0N A;  3R3E A;  3D22 A;  2VLT A;  2QKE A;  3EE2 A;  5DAL A;  5D9W A;  3ZLP A;  4QL9 A;  3IDV A;  3OR5 A;  3RBT A;  22GS A;  4GSS A;  2GT5 A;  2LJK A;  2F3M A;  4PUF C;  3ZVJ A;  2YJH A;  3LEF A;  1T1V A;  2E0Q A;  1AW9 A;  1TDI A;  4CDO A;  5CNW A;  2HYX A;  3PR8 A;  4EF0 A;  1A0F A;  2DJ2 A;  18GS A;  2CV4 A;  3UVT A;  1KEB A;  3C71 A;  4GQF A;  5AGY A;  2PPT A;  1K3L A;  1VF3 A;  4HQZ A;  1H75 A;  2IMF A;  1KBN A;  4LMW A;  1NM3 A;  5GAN D;  2YNX A;  4TN8 A;  3WT1 A;  3C73 A;  4O5R A;  2LST A;  2A4H A;  3ME7 A;  2VL2 A;  4KUN A;  2LKU A;  3VWU A;  1Y6E A;  2MZC A;  4MPG A;  4EDY A;  3P8W A;  4F9Z A;  4TRX A;  2DJK A;  1X5E A;  3FYG A;  3ZIV A;  5FWG A;  3DD3 A;  5DAK A;  2IFQ A;  1FVK A;  4V2L A;  5J9C A;  4KSM A;  1EV4 A;  4USS A;  2PWJ A;  1XG8 A;  2LEG A;  2K8V A;  4KCE A;  5KN2 A;  4OMV A;  4MH2 A;  4NWY A;  4PQI A;  4RQR A;  3TDG A;  1Q4J A;  4J57 E;  2KHP A;  3TGZ A;  1O73 A;  2B5Y A;  4Q5Q A;  4ML6 A;  3GRX A;  4ACS A;  2VCV A;  4L5O A;  1J0F A;  5EPF A;  5ECN B;  4RQX A;  4PUR A;  3VWW A;  5DDL A;  2C3T A;  4PGT A;  2I4A A;  4BWS A;  1TI1 A;  2IIY A;  4ECI A;  2H0I A;  3O6T A;  3IBH A;  4TXO A;  1TK8 B;  1J08 A;  3N9J A;  3LQ7 A;  4XCS A;  1FB0 A;  17GS A;  3ME8 A;  2JZR A;  2JU5 A;  2HZF A;  6GSU A;  4HU7 A;  3GL5 A;  3TKS C;  2MMA A;  3TKS E;  2GT6 A;  3EMX A;  5ELG A;  1U3A A;  1A2L A;  2CVB A;  1GNE A;  4WKW A;  1WOU A;  1QUW A;  2E2M A;  2PUK C;  4PX1 A;  3M9K A;  3A5W A;  4CHS A;  1PFO A;  3G9B A;  2FLS A;  4GTU A;  4K6X A;  6GSV A;  2A2R A;  5G1K A;  3KM6 A;  3VWV A;  4FO5 A;  4YKF A;  3CXG A;  2GZP A;  3Q18 A;  3QMX A;  1A24 A;  4I8B A;  2NBS A;  2WDU A;  3HCZ A;  3DRN A;  1OC8 A;  2GVP A;  3QFA C;  5JCG A;  4LL1 B;  1TI3 A;  2V32 A;  3LJR A;  1NW2 A;  1A8Y A;  1B9X C;  2C1Y A;  2LQO A;  1JHB A;  3CTG A;  5ECM B;  1AC1 A;  5DJL A;  3KH7 A;  1F3A A;  3IV4 A;  1YF0 A;  3EMP A;  3DGQ A;  1A8L A;  2P5Q A;  3ZYW A;  3JCM L;  2MMO A;  3W8J A;  3ZMK A;  2I81 A;  2H73 A;  1GSS A;  1GSE A;  3F9U A;  1BAY A;  3F3Q A;  1PA3 A;  4ECB A;  3HY2 A;  4HZ4 A;  3RHB A;  4NMU A;  1WRY A;  4I2T A;  2TRC P;  3M1G A;  2F9S A;  2FWH A;  1SL0 B;  4IJ3 A;  4IJI A;  1WMJ A;  4BVY A;  1MD3 A;  2OBK A;  1MDI A;  2HFD A;  2KOK A;  1QK8 A;  2H30 A;  2VCW A;  3QOU A;  5CRG A;  3CSH A;  1XOB A;  1XOA A;  4IQ1 A;  4X43 A;  1O81 A;  2JSZ A;  5CRH A;  5D96 A;  4N30 A;  1LU4 A;  3IOS A;  2V6O A;  1GSY A;  1V57 A;  5C00 A;  4IS0 A;  3A2V A;  1GSF A;  2DJJ A;  5G1L A;  3UBL A;  2FWF A;  4KE3 A;  2LV3 A;  4ZL9 A;  3KCM A;  2EIR A;  1M9B A;  1PKW A;  1ZOF A;  3EC3 A;  2XPE A;  4O32 A;  4XRA A;  5J4U A;  2XHF A;  2VO4 A;  3GA4 A;  2FCH A;  2H75 A;  2ON7 A;  5IOX A;  5D9V A;  5B8B A;  1G6Y A;  4O7H A;  1K0D A;  2WS2 A;  5ABR A;  4NHZ A;  3GYK A;  1WE0 A;  2YV7 A;  1TOF A;  5D8I A;  4I97 A;  3CTF A;  3KGK A;  1NSW A;  1O85 A;  2VL3 A;  4NV5 A;  4EO3 A;  5CP1 A;  4OFT A;  4NHW A;  4G0L A;  1TRU A;  3K8N A;  4IEL A;  4NPB A;  1B4P A;  1AQV A;  4IVF A;  1XCC A;  1SL2 B;  3HDC A;  4XTS A;  1DE1 A;  1XWG A;  2B5X A;  1OC3 A;  4IQA A;  5KOX A;  2X49 A;  3AY8 A;  1PX7 A;  1EP8 A;  2IMK A;  3GX0 A;  5HFK A;  1EEJ A;  2H19 A;  3WD6 A;  5KEJ A;  5HQP A;  5JWO B;  3BCI A;  4PXO A;  4KAE A;  3H93 A;  2KP1 A;  2HT9 A;  4IKH A;  2HRK A;  1XXU A;  2C0G A;  2H0G A;  2FA8 A;  2VCT A;  1URM A;  5J41 A;  2HSM A;  2NTO A;  8GSS A;  5JWQ B;  4QL7 A;  4HJ2 A;  1ZMA A;  3TKQ A;  3MYD A;  3GKK A;  1ST9 A;  3KZQ A;  2VD1 A;  4POL A;  2FGX A;  2JL4 A;  2NVL A;  2R0G A;  2HRA A;  1GWC A;  3D5J A;  1GNW A;  5ECH B;  4IW9 A;  1EP7 A;  4X1U A;  1JLW A;  2PVQ A;  2CX3 A;  2GGT A;  1TXX A;  1GUM A;  3EU4 A;  2GST A;  1XW6 A;  2V6K A;  3HJM A;  3FR3 A;  4KDU A;  4TKY A;  3MDK A;  2CQ9 A;  5G31 A;  1MEK A;  2MMZ A;  4O92 A;  3WGE A;  2LRN A;  3TCO A;  1XIY A;  1PGT A;  2HI7 A;  1Z6N A;  2V1M A;  1FO5 A;  2L6C A;  1K3Y A;  4MCU A;  3CQF A;  3F4S A;  4A5P A;  4TR0 A;  1VRS D;  2WJU A;  5B7C A;  4XRD A;  1ERT A;  1XWB A;  3CSJ A;  4OCF A;  1XWA A;  3F6D A;  4OCE A;  4FYU A;  4K5S A;  1LBK A;  1TK0 B;  2XPD A;  2AHE A;  3H8Q A;  4F03 A;  5IPG A;  2AJQ B;  1V2A A;  1YEX A;  2VCQ A;  3I9V 2;  2I1U A;  1EV9 A;  2O87 A;  3U5R E;  4P3Y B;  2YV9 A;  4PQH A;  1KNG A;  3H1N A;  2WRT A;  4RUV A;  5CRD A;  3EVI A;  2K9F A;  2IMD A;  4IP6 A;  3KTL A;  4IBP A;  4Z2U A;  1FOV A;  1ILO A;  1U87 A;  3RPP A;  1MTC A;  4PNG A;  1E6B A;  1DSB A;  2MBT A;  4IHU A;  5CYY A;  2OE1 A;  4TR3 A;  2BTO T;  2G2Q A;  2GSS A;  3UBK A;  4MJB A;  3KH9 A;  1PKZ A;  1JFU A;  1X0R A;  6GSX A;  3ZZX A;  2ES7 A;  2X8G A;  3UVH A;  1RQM A;  2X4A A;  1PX6 A;  1TKD B;  2VL9 A;  1WPI A;  4KSO A;  3I69 A;  3LG6 A;  3Q74 A;  3ZTL A;  4ZIL A;  2FA4 A;  4OO4 A;  3APS A;  1ZYP A;  3LXT A;  1PN9 A;  5ENU A;  2DJ0 A;  4XS4 B;  3DKS A;  2VD0 A;  2C4J A;  5A5K A;  4FIW A;  4MZW A;  1R26 A;  1GTA A;  2WB9 A;  3DEX A;  1AXD A;  3WGD A;  5AIV A;  3IC8 A;  3GKM A;  4PUA A;  4ZXG A;  3MNG A;  3SBC A;  1YEP A;  4WR4 A;  4HQS A;  2H01 A;  1SKS B;  2E7P A;  1SJ6 A;  4V2N A;  4EIQ A;  1M3J A;  2X8C A;  1M0U A;  3A2W A;  4ECJ A;  3LOR A;  3MWH A;  2VOC A;  2PBJ A;  4ML1 A;  1OE7 A;  3P7X A;  3FZ9 A;  3HKR A;  2K8S A;  1HYU A;  3TOT A;  1M7T A;  2GZY A;  2L4C A;  3IAM 2;  1CQG A;  3F8U A;  4Z2T A;  2AAW A;  1AQX A;  5INY A;  4MP4 A;  5IO2 A;  2RM5 A;  3VI5 A;  4FH8 A;  3TUE A;  3S9F A;  2L5O A;  2ZNM A;  3GFK A;  1OYJ A;  4QQ7 A;  4JR6 A;  2YWN A;  3L0H A;  4G19 A;  1U3I A;  2LRC A;  1T4Z A;  3VPT A;  1JZW A;  1G6W A;  2EIQ A;  2QC7 A;  4BA7 A;  3IHQ A;  1N8J A;  4YQV A;  1I5G A;  4G0K A;  3ZIJ A;  4EUY A;  1UVZ A;  1GH2 A;  3W6G A;  3O3T A;  4WET A;  4CW9 A;  1GLQ A;  1GP1 A;  1WP0 A;  3Q19 A;  4GCI A;  4JBB A;  4NAX A;  1IYH A;  1G7E A;  2YP6 A;  5IOW A;  3ZFB A;  1TK5 B;  2AV4 A;  1SYX A;  1USB A;  2H70 A;  4J2F A;  3IE3 A;  2H1D A;  4EKZ A;  3M0F A;  4WR5 A;  1ABA A;  3GMF A;  1VF2 A;  1SD9 A;  3C7M A;  3W8S A;  2FUG 2;  2L57 A;  5KOW A;  2MYG A;  3F63 A;  2C3Q A;  4JE1 A;  3UL3 A;  4L0U A;  3PH9 A;  1M99 A;  1F3B A;  1A0R P;  2B6M A;  3GIX A;  2R37 A;  3PGT A;  12GS A;  4O5Q A;  1PSQ A;  4I2U A;  2H6X A;  4KDX A;  2AUV A;  3P90 A;  3HVV A;  5ECP B;  7GSS A;  1SKR B;  3EUR A;  2HZE B;  4F0B A;  5HFG A;  2PER A;  4EC0 A;  3QCP A;  3GTU B;  2H6Z A;  3R2Q A;  5B6N A;  4I5Q A;  3FMW A;  1QMV A;  3VUR A;  3FY7 A;  4MPF A;  1HNB A;  4AJ6 A;  4EXJ A;  3I6A A;  1EEM A;  4FYC A;  2D2Z A;  4DSS A;  3IXR A;  1F9M A;  3IHG A;  1ERW A;  4GST A;  4HJM A;  4OD7 A;  4ZL7 A;  4MDC A;  1O6J A;  2PVO C;  5D73 A;  1W4V A;  3CYN A;  3ZRD A;  3G7Y A;  4G9H A;  3UJ1 A;  2VM2 A;  1GSQ A;  5FHI A;  1GTB A;  2OE3 A;  3CRU A;  1VGL A;  4KGI A;  1M2D A;  5DCH A;  4WBJ A;  5DQS A;  1YY7 A;  2CA8 A;  3DVW A;  5JWR B;  3BBY A;  1GTU A;  9GSS A;  2B7J A;  5JCW A;  2CX4 A;  3MAK A;  1C72 A;  4YAV A;  3NZN A;  1THO A;  3WGX A;  5GSS A;  3G7I A;  4K7N A;  3QFB C;  1IYI A;  4YQU A;  1M9A A;  3CRT A;  4MF6 A;  5IMZ A;  4TR1 B;  1O8W A;  2VLV A;  3DWV A;  1FVJ A;  3LW9 A;  1XWK A;  4CY6 A;  1TRW A;  4HS1 A;  1SJZ A;  1OE8 A;  2GQL A;  4BVX B;  3KMN A;  3EPT A;  2C0F A;  4GRF A;  2JZS A;  3C1R A;  2DKI A;  4RI7 A;  2LNT A;  3KMO A;  4DSQ A;  1Z9H A;  2HLS A;  4IGJ A;  1Q98 A;  1V98 A;  3LFL A;  4XS4 A;  3QAV A;  1DE2 A;  2O85 A;  3UIW A;  1RW1 A;  2R5G A;  3SWL A;  5DAL B;  3IRA A;  1RK4 A;  3IC4 A;  2UZ8 A;  2FD3 A;  2WZ9 A;  2X8H A;  2LUS A;  4HUA A;  5CRE A;  3GN3 A;  3GV1 A;  2H66 A;  3J7Y b;  1K0A A;  3EYT A;  5J9B A;  2B1K A;  3BCK A;  1YJ6 A;  2OJL A;  2M46 A;  4G0I A;  3VPQ A;  1W89 A;  2VUP A;  4K0G A;  4ISD A;  2RUE A;  1QFN A;  4K7I A;  2A4V A;  3IK9 A;  3L78 A;  3ZFL A;  3HD5 A;  3GH9 A;  3FZ4 A;  4KH7 A;  2C0D A;  4TVE A;  3IR4 A;  2XBQ A;  5F05 A;  3MIX A;  2H1G A;  4F82 A;  3TKS A;  13GS A;  2IFQ B;  3TRQ A;  3IAS 2;  1FHE A;  1GLP A;  2DIZ A;  3HZ4 A;  5L71 A;  5GZZ B;  2GSQ A;  14GS A;  3GX8 A;  5A4W A;  3NOF A;  3RDW A;  4WEY A;  2O89 A;  2WCI A;  4MH3 A;  5ECO B;  5COH A;  4PNF A;  1BG5 A;  2DMM A;  4MLY A;  5IQY A;  2F8F A;  2CZ3 A;  1XFL A;  3QPM A;  1TU7 A;  5ECI B;  2DLX A;  3KP9 A;  3TRX A;  1PMT A;  4POM A;  1G0T A;  2FNO A;  4MZC A;  4POK A;  4V2M A;  2DC5 A;  5ECR B;  4MJE A;  4IN0 A;  1V9W A;  3DYR A;  4ZL8 A;  2OKA A;  5J3R A;  2MMN A;  1M2B A;  1X5C A;  19GS A;  1Z7P A;  3KEB A;  3FRC A;  2VL2 C;  3LSZ A;  3DML A;  3GSS A;  4KW6 A;  5H5R A;  3E0U A;  5LCZ A;  5ELA A;  1YF1 A;  2E2G A;  4KB3 A;  4I6X A;  2GDR A;  3PPU A;  1S3A A;  2J9H A;  1FG4 A;  2K18 A;  6GSW A;  2BJX A;  4D73 B;  4HOJ A;  2YOI A;  2B1L A;  3D4T A;  3VLN A;  4ULX A;  5IMV A;  1YKA A;  1S3R A;  3E3E A;  3GTU A;  4GXZ A;  3EIN A;  4BL7 B;  1UN2 A;  1GRX A;  1OVN A;  2DIY A;  2DML A;  2IWT A;  1A23 A;  4Q5F A;  3HJO A;  5IM9 A;  3DVX A;  2FWE A;  4V1A p;  2YAN A;  10GS A;  2AB6 A;  3QD9 A;  3KD0 A;  4MF7 A;  5LNK e;  3VFI A;  1T00 A;  5FT3 A;  5G30 A;  1ACV A;  5HR3 A;  3IA1 A;  1U88 A;  3MSZ A;  3VWX A;  2CAI A;  1ON4 A;  3TOU A;  1O7U A;  1SKW B;  5ECS A;  2NPB A;  2XC2 A;  1AUC A;  2H76 A;  1OKT A;  4FYB A;  4F2I A;  1R5A A;  1PL1 A;  2X64 A;  1HD2 A;  3WYW A;  4WF4 A;  1T7P B;  2BMX A;  2M72 A;  2REM A;  5B8A A;  4DVC A;  2H71 A;  4GF0 A;  2KP2 A;  1SK2 A;  3GH6 A;  4KF9 A;  4ZIJ A;  4BPY A;  5KN0 A;  3US3 A;  3LYP A;  4JR4 A;  1WIK A;  4KDY A;  1GTI A;  1UC7 A;  3UAP A;  1N2A A;  1SK1 A;  1YZX A;  1T3B A;  2XBI A;  1U6T A;  3DIE A;  1TU8 A;  2PGT A;  4TOP A;  4AJ7 A;  3H79 A;  4TR1 A;  3H4K A;  4XS1 A;  5HR1 A;  5HFI A;  1BQ7 A;  2FWG A;  1XW5 A;  3LXZ A;  3ZML A;  1X9S B;  4BVX A;  2RUF A;  3L9U A;  1XWC A;  2O7K A;  5H5S A;  1QXH A;  2FHE A;  3LGC A;  5ID2 B;  4KCA A;  1KTE A;  3BOA A;  5J5N A;  4E8H A;  1K0B A;  2DBC A;  4NV2 A;  2R0P A;  4MJA A;  1FB6 A;  1EZK A;  3HXS A;  4E8E A;  1YQ1 A;  3G7J A;  1I9D A;  3HYP A;  2LQQ A;  2KLX A;  2OA7 A;  1XPV A;  2OBI A;  4YQM A;  2QA1 A;  4DEJ A;  3ZRE A;  2P5R A;  1JZR A;  4Q5R A;  1K0N A;  3FW2 A; 
#chains in the Genus database with same CATH homology
 1NHO A;  4EVM A;  2H1B A;  3A3T A;  4V1A g;  4WBR D;  2GLR A;  2P31 A;  2JZT A;  1S3D A;  2CT6 A;  1GSU A;  3KP8 A;  3TKP A;  2GZZ A;  1O8X A;  3KXO A;  1MDK A;  1GUK A;  4X0X A;  4JRR A;  4KND A;  3GHA A;  5DBQ A;  1B4Q A;  2MBS A;  2C8U A;  1EGR A;  4ILF A;  3TJB A;  3KIJ A;  1EWX A;  2HSY A;  5D93 A;  5G2Z A;  4N10 A;  3M9J A;  3M3M A;  3TB2 A;  1TRS A;  5DQY A;  4WF5 A;  1ZCP A;  4N0Z A;  4G2E A;  4RI6 A;  1ZYQ B;  4N0V A;  2GQK A;  1TJD A;  2IMI A;  1OC9 B;  2R2J A;  3EU3 A;  4YH2 A;  5AIX A;  2IME A;  5IMD A;  2HRF A;  3EWL A;  4HU9 A;  2ALB A;  3APQ A;  4FQU A;  2GTU A;  2DJ3 A;  1XZO A;  4MMM A;  2QGV A;  2YZU A;  3ED3 A;  3M8N A;  1QQ2 A;  4K8M A;  3P2A A;  1B9Y C;  3UOM A;  2RLI A;  5B6M A;  1YDK A;  4AJ8 A;  5G5F A;  3ZIT A;  2YCD A;  2EIO A;  2K6V A;  1OKD A;  3U6V A;  4IP1 A;  4AGS A;  3L9V A;  1X5D A;  4WXT A;  2L5L A;  1ERU A;  1CQH A;  1T8E B;  1SEN A;  1SU9 A;  4K2X A;  5BRT A;  3TJK A;  2VM1 A;  1HQO A;  4EIP A;  4OFN A;  1EOH A;  3QAG A;  3O76 A;  1YKC A;  5IMF A;  4EE0 A;  2IN3 A;  4XHM A;  1V58 A;  3D4M A;  3HVS A;  2N5A A;  5C04 A;  2H0H A;  1OAZ A;  1XW9 A;  1ERV A;  4JED A;  4G10 A;  3F0I A;  1X9W B;  1XBS A;  5CRW A;  5HR2 A;  1XVW A;  3V1W A;  1ML6 A;  3TRP A;  2R6K A;  3KTB A;  4J56 E;  5CO3 A;  4ID0 A;  5ECL B;  1ZGN A;  4D73 A;  5IIZ A;  1PD2 1;  4K5R A;  2V41 A;  1R4W A;  3ISO A;  3FKF A;  4Z7X A;  5E59 A;  1BYE A;  4LLR A;  3L9S A;  2F51 A;  4YKG A;  2YPM A;  4BL7 A;  3A5I A;  3IK7 A;  2NDO A;  4AF2 A;  2ZUP A;  2EC4 A;  2P0G A;  3HZ8 A;  2IJY A;  3CSI A;  1T4Y A;  1TW9 A;  1UA5 A;  4PTS A;  3HHV A;  2QSI A;  1B48 A;  2HSH A;  4H86 A;  1FAA A;  2WFC A;  2B7K A;  2V2G A;  2HE3 A;  2KUC A;  2GS3 A;  2R0C A;  3UEM A;  5IMC A;  1DBY A;  1Z5Y E;  5A4V A;  4HI7 A;  3F3R A;  3NIV A;  2H6Y A;  3FR9 A;  4ZBB A;  4YAP A;  3HJP A;  5F8B A;  1AIU A;  3PIN A;  4TW5 A;  3BJ5 A;  3ERF A;  1F6M C;  3DXB A;  2YWI A;  4K9Z A;  1XVQ A;  2OE0 A;  2CAQ A;  2VLU A;  1FW1 A;  4GLT A;  2R4V A;  5H5Q A;  1EGO A;  2DJ1 A;  11GS A;  2RII A;  4ZBD A;  2ZCT A;  3GST A;  3Q6O A;  4L0W A;  2R3X A;  5AN1 A;  4MJC A;  3CMI A;  2HNL A;  4K2D A;  1B8X A;  2L4Q A;  2N5B A;  2JAD A;  2VCZ A;  4LL4 B;  4POB A;  1THX A;  1PRX A;  4GWR A;  2DSA A;  2YWO A;  5E4W A;  4CY8 A;  4HEA 2;  5ID2 A;  5G5E A;  1MD4 A;  5F07 A;  2IL3 A;  1K0M A;  4L5L A;  2WGR A;  3QR6 A;  5F0G A;  2YJ7 A;  5F06 A;  3WT2 A;  4KA0 A;  4JU5 A;  3FK8 A;  1ZL9 A;  5JCU A;  2LJA A;  3GKN A;  4K7O A;  5IO0 A;  5EL8 A;  6GSY A;  4TXV A;  3VK9 A;  1MDJ A;  3D0Z A;  3TJJ A;  3BD2 A;  1GUL A;  3TJG A;  3IPZ A;  4F0C A;  1GL8 A;  2OAD A;  5D9X A;  1SJI A;  2CZ2 A;  2YWM A;  1GSD A;  1JLV A;  2F8A A;  1S3C A;  2B5E A;  5ECQ B;  3TJF A;  2H8L A;  1WJK A;  4ZB8 A;  2O8V B;  2WUL A;  4MNN A;  3APO A;  4MF5 A;  2I9H A;  1PQN A;  2N5F A;  1TTZ A;  5DJM A;  5DAK B;  5DCG A;  1TP9 A;  1TRV A;  4Z2R A;  3FHK A;  6GST A;  4TR4 A;  2CVK A;  1OC9 A;  2H72 A;  4HZ2 A;  2M80 A;  2LRT A;  3L4N A;  4BWQ A;  4OO5 A;  1BED A;  3CBU A;  1BX9 A;  1VF4 A;  4PQ1 A;  4N11 A;  3F4R A;  4O5U A;  3ZL5 A;  1ZYN A;  5GST A;  3GNJ A;  2L59 A;  3N5O A;  2HXK A;  3E9J B;  1JZO A;  5A4U A;  1SD8 A;  2C3N A;  2FY6 A;  1BJX A;  2G0F A;  1ZYE A;  2A2P A;  4ICY A;  4XS6 A;  4MAB A;  4Q5N A;  2LTK A;  2YN1 A;  2X99 A;  4GSN A;  1PL2 A;  1JZD A;  5BMU A;  3UAR A;  4OWY A;  4JZQ A;  1Z6M A;  1LJR A;  4TXO B;  4DSR A;  2IPA A;  1SL1 B;  4ECC A;  3LWA A;  4MZB A;  2C0E A;  1E2Y A;  2YZH A;  4XIH A;  2PMT A;  3RAZ A;  3D6I A;  2L6D A;  5LD0 A;  3C8E A;  3ZVJ D;  2VAF A;  4OFM A;  4LA1 A;  5EVO A;  3FZ5 A;  1H4O A;  2B3S A;  3A2X A;  2OAC A;  3FR6 A;  2VIM A;  3QDN A;  4EL1 A;  4ZB9 A;  3FZA A;  2J23 A;  1M2A A;  1GUH A;  2HZE A;  1NHY A;  6GSS A;  1HNA A;  1SYR A;  1K0C A;  1V40 A;  3F6F A;  2C80 A;  20GS A;  1WWJ A;  3KJY A;  4DSS B;  5IPH A;  1K3O A;  2PU9 C;  3J7Y k;  4KX4 A;  5DVB A;  2GQM A;  3RHC A;  1QGV A;  3UMA A;  5D9T A;  4LMV A;  2JAC A;  4MK3 A;  1HNC A;  5ECK B;  2H74 A;  5GAP D;  2CVD A;  3I43 A;  3GUR A;  5CAX A;  3QAW A;  1R5P A;  3LYK A;  2GSR A;  5KN3 A;  4NXI A;  1SK0 A;  2ON5 A;  3VI7 A;  4EDZ A;  3C1S A;  2Z9S A;  4K1F A;  4ZB6 A;  16GS A;  4X4J A;  1AQW A;  5KN1 A;  2AYT A;  1A2J A;  1EOG A;  2TRX A;  3ERG A;  1K0O A;  1VF1 A;  2QA2 A;  5IMA A;  2LNS A;  1FOH A;  3RPN A;  3FEU A;  2H1A A;  2LS5 A;  2HRN A;  3GL3 A;  1F37 A;  1Z3E A;  3D21 A;  3ERW A;  5HR0 A;  2TIR A;  1A2M A;  1PN0 A;  2PN8 A;  1ZZY A;  4BVY B;  1X9M B;  4HDE A;  4GQC A;  2A2S A;  4L8E A;  1DUG A;  1F2E A;  1Z7R A;  1J9B A;  3GUS A;  3GKX A;  2VCX A;  1Y25 A;  1R7H A;  2LJR A;  1G7O A;  5EY6 A;  2I3Y A;  5AIS A;  3HVX A;  4ZBA A;  2RM6 A;  3F4T A;  1AAZ A;  4MA9 A;  2JSY A;  3TKR A;  2DKH A;  3HA9 A;  4K0N A;  3R3E A;  3D22 A;  2VLT A;  2QKE A;  3EE2 A;  5DAL A;  5D9W A;  3ZLP A;  4QL9 A;  3IDV A;  3OR5 A;  3RBT A;  22GS A;  4GSS A;  2GT5 A;  2LJK A;  2F3M A;  4PUF C;  3ZVJ A;  2YJH A;  3LEF A;  1T1V A;  2E0Q A;  1AW9 A;  1TDI A;  4CDO A;  5CNW A;  2HYX A;  3PR8 A;  4EF0 A;  1A0F A;  2DJ2 A;  18GS A;  2CV4 A;  3UVT A;  1KEB A;  3C71 A;  4GQF A;  5AGY A;  2PPT A;  1K3L A;  1VF3 A;  4HQZ A;  1H75 A;  2IMF A;  1KBN A;  4LMW A;  1NM3 A;  5GAN D;  2YNX A;  4TN8 A;  3WT1 A;  3C73 A;  4O5R A;  2LST A;  2A4H A;  3ME7 A;  2VL2 A;  4KUN A;  2LKU A;  3VWU A;  1Y6E A;  2MZC A;  4MPG A;  4EDY A;  3P8W A;  4F9Z A;  4TRX A;  2DJK A;  1X5E A;  3FYG A;  3ZIV A;  5FWG A;  3DD3 A;  5DAK A;  2IFQ A;  1FVK A;  4V2L A;  5J9C A;  4KSM A;  1EV4 A;  4USS A;  2PWJ A;  2LEG A;  2K8V A;  4KCE A;  5KN2 A;  4OMV A;  4MH2 A;  4NWY A;  4PQI A;  4RQR A;  3TDG A;  1Q4J A;  4J57 E;  2KHP A;  3TGZ A;  1O73 A;  2B5Y A;  4Q5Q A;  4ML6 A;  3GRX A;  4ACS A;  2VCV A;  4L5O A;  1J0F A;  5EPF A;  5ECN B;  4RQX A;  4PUR A;  3VWW A;  5DDL A;  2C3T A;  4PGT A;  2I4A A;  4BWS A;  1TI1 A;  2IIY A;  4ECI A;  2H0I A;  3O6T A;  3IBH A;  4TXO A;  1TK8 B;  1J08 A;  3N9J A;  3LQ7 A;  4XCS A;  1FB0 A;  17GS A;  3ME8 A;  2JZR A;  2JU5 A;  2HZF A;  6GSU A;  4HU7 A;  3GL5 A;  3TKS C;  2MMA A;  3TKS E;  2GT6 A;  3EMX A;  5ELG A;  1U3A A;  1A2L A;  2CVB A;  1GNE A;  4WKW A;  1WOU A;  1QUW A;  2E2M A;  2PUK C;  4PX1 A;  3M9K A;  3A5W A;  4CHS A;  3G9B A;  2FLS A;  4GTU A;  4K6X A;  6GSV A;  2A2R A;  5G1K A;  3KM6 A;  3VWV A;  4FO5 A;  4YKF A;  3CXG A;  2GZP A;  3Q18 A;  3QMX A;  1A24 A;  4I8B A;  2NBS A;  2WDU A;  3HCZ A;  3DRN A;  1OC8 A;  2GVP A;  3QFA C;  5JCG A;  4LL1 B;  1TI3 A;  2V32 A;  3LJR A;  1NW2 A;  1A8Y A;  1B9X C;  2C1Y A;  2LQO A;  1JHB A;  3CTG A;  5ECM B;  1AC1 A;  5DJL A;  3KH7 A;  1F3A A;  3IV4 A;  1YF0 A;  3EMP A;  3DGQ A;  1A8L A;  2P5Q A;  3ZYW A;  3JCM L;  2MMO A;  3W8J A;  3ZMK A;  2I81 A;  2H73 A;  1GSS A;  1GSE A;  3F9U A;  1BAY A;  3F3Q A;  1PA3 A;  4ECB A;  3HY2 A;  4HZ4 A;  3RHB A;  4NMU A;  1WRY A;  4I2T A;  2TRC P;  3M1G A;  2F9S A;  2FWH A;  1SL0 B;  4IJ3 A;  4IJI A;  1WMJ A;  4BVY A;  1MD3 A;  2OBK A;  1MDI A;  2HFD A;  2KOK A;  1QK8 A;  2H30 A;  2VCW A;  3QOU A;  5CRG A;  3CSH A;  1XOB A;  1XOA A;  4IQ1 A;  4X43 A;  1O81 A;  2JSZ A;  5CRH A;  5D96 A;  4N30 A;  1LU4 A;  3IOS A;  2V6O A;  1GSY A;  1V57 A;  5C00 A;  4IS0 A;  3A2V A;  1GSF A;  2DJJ A;  5G1L A;  3UBL A;  2FWF A;  4KE3 A;  2LV3 A;  4ZL9 A;  3KCM A;  2EIR A;  1M9B A;  1PKW A;  1ZOF A;  3EC3 A;  2XPE A;  4O32 A;  4XRA A;  5J4U A;  2XHF A;  2VO4 A;  3GA4 A;  2FCH A;  2H75 A;  2ON7 A;  5IOX A;  5D9V A;  5B8B A;  1G6Y A;  4O7H A;  1K0D A;  2WS2 A;  5ABR A;  4NHZ A;  3GYK A;  1WE0 A;  2YV7 A;  1TOF A;  5D8I A;  4I97 A;  3CTF A;  3KGK A;  1NSW A;  1O85 A;  2VL3 A;  4NV5 A;  4EO3 A;  5CP1 A;  4OFT A;  4NHW A;  4G0L A;  1TRU A;  3K8N A;  4IEL A;  4NPB A;  1B4P A;  1AQV A;  4IVF A;  1XCC A;  1SL2 B;  3HDC A;  4XTS A;  1DE1 A;  1XWG A;  2B5X A;  1OC3 A;  4IQA A;  5KOX A;  2X49 A;  3AY8 A;  1PX7 A;  1EP8 A;  2IMK A;  3GX0 A;  5HFK A;  1EEJ A;  2H19 A;  3WD6 A;  5KEJ A;  5HQP A;  5JWO B;  3BCI A;  4PXO A;  4KAE A;  3H93 A;  2KP1 A;  2HT9 A;  4IKH A;  2HRK A;  1XXU A;  2C0G A;  2H0G A;  2FA8 A;  2VCT A;  1URM A;  5J41 A;  2HSM A;  2NTO A;  8GSS A;  5JWQ B;  4QL7 A;  4HJ2 A;  1ZMA A;  3TKQ A;  3MYD A;  3GKK A;  1ST9 A;  3KZQ A;  2VD1 A;  4POL A;  2FGX A;  2JL4 A;  2NVL A;  2R0G A;  2HRA A;  1GWC A;  3D5J A;  1GNW A;  5ECH B;  4IW9 A;  1EP7 A;  4X1U A;  1JLW A;  2PVQ A;  2CX3 A;  2GGT A;  1TXX A;  1GUM A;  3EU4 A;  2GST A;  1XW6 A;  2V6K A;  3HJM A;  3FR3 A;  4KDU A;  4TKY A;  3MDK A;  2CQ9 A;  5G31 A;  1MEK A;  2MMZ A;  4O92 A;  3WGE A;  2LRN A;  3TCO A;  1XIY A;  1PGT A;  2HI7 A;  1Z6N A;  2V1M A;  1FO5 A;  2L6C A;  1K3Y A;  4MCU A;  3F4S A;  4A5P A;  4TR0 A;  1VRS D;  2WJU A;  5B7C A;  4XRD A;  1ERT A;  1XWB A;  3CSJ A;  4OCF A;  1XWA A;  3F6D A;  4OCE A;  4FYU A;  4K5S A;  1LBK A;  1TK0 B;  2XPD A;  2AHE A;  3H8Q A;  4F03 A;  5IPG A;  2AJQ B;  1V2A A;  1YEX A;  2VCQ A;  3I9V 2;  2I1U A;  1EV9 A;  2O87 A;  3U5R E;  4P3Y B;  2YV9 A;  4PQH A;  1KNG A;  3H1N A;  2WRT A;  4RUV A;  5CRD A;  3EVI A;  2K9F A;  2IMD A;  4IP6 A;  3KTL A;  4IBP A;  4Z2U A;  1FOV A;  1ILO A;  1U87 A;  3RPP A;  1MTC A;  4PNG A;  1E6B A;  1DSB A;  2MBT A;  4IHU A;  5CYY A;  2OE1 A;  4TR3 A;  2BTO T;  2G2Q A;  2GSS A;  3UBK A;  4MJB A;  3KH9 A;  1PKZ A;  1JFU A;  1X0R A;  6GSX A;  3ZZX A;  2ES7 A;  2X8G A;  3UVH A;  1RQM A;  2X4A A;  1PX6 A;  1TKD B;  2VL9 A;  1WPI A;  4KSO A;  3I69 A;  3LG6 A;  3Q74 A;  3ZTL A;  4ZIL A;  2FA4 A;  4OO4 A;  3APS A;  1ZYP A;  3LXT A;  1PN9 A;  5ENU A;  2DJ0 A;  4XS4 B;  3DKS A;  2VD0 A;  2C4J A;  5A5K A;  4FIW A;  4MZW A;  1R26 A;  1GTA A;  2WB9 A;  3DEX A;  1AXD A;  3WGD A;  5AIV A;  3IC8 A;  3GKM A;  4PUA A;  4ZXG A;  3MNG A;  3SBC A;  1YEP A;  4WR4 A;  4HQS A;  2H01 A;  1SKS B;  2E7P A;  1SJ6 A;  4V2N A;  4EIQ A;  2X8C A;  1M0U A;  3A2W A;  4ECJ A;  3LOR A;  3MWH A;  2VOC A;  2PBJ A;  4ML1 A;  1OE7 A;  3P7X A;  3FZ9 A;  3HKR A;  2K8S A;  1HYU A;  3TOT A;  1M7T A;  2GZY A;  2L4C A;  3IAM 2;  1CQG A;  3F8U A;  4Z2T A;  2AAW A;  1AQX A;  5INY A;  4MP4 A;  5IO2 A;  2RM5 A;  3VI5 A;  4FH8 A;  3TUE A;  3S9F A;  2L5O A;  2ZNM A;  3GFK A;  1OYJ A;  4QQ7 A;  4JR6 A;  2YWN A;  3L0H A;  4G19 A;  1U3I A;  2LRC A;  1T4Z A;  3VPT A;  1JZW A;  1G6W A;  2EIQ A;  2QC7 A;  4BA7 A;  3IHQ A;  1N8J A;  4YQV A;  1I5G A;  4G0K A;  3ZIJ A;  4EUY A;  1UVZ A;  1GH2 A;  3W6G A;  3O3T A;  4WET A;  4CW9 A;  1GLQ A;  1GP1 A;  1WP0 A;  3Q19 A;  4GCI A;  4JBB A;  4NAX A;  1IYH A;  1G7E A;  2YP6 A;  5IOW A;  3ZFB A;  1TK5 B;  2AV4 A;  1SYX A;  1USB A;  2H70 A;  4J2F A;  3IE3 A;  2H1D A;  4EKZ A;  3M0F A;  4WR5 A;  1ABA A;  3GMF A;  1VF2 A;  1SD9 A;  3C7M A;  3W8S A;  2FUG 2;  2L57 A;  5KOW A;  2MYG A;  3F63 A;  2C3Q A;  4JE1 A;  3UL3 A;  4L0U A;  3PH9 A;  1M99 A;  1F3B A;  1A0R P;  2B6M A;  3GIX A;  2R37 A;  3PGT A;  12GS A;  4O5Q A;  1PSQ A;  4I2U A;  2H6X A;  4KDX A;  2AUV A;  3P90 A;  3HVV A;  5ECP B;  7GSS A;  1SKR B;  3EUR A;  2HZE B;  4F0B A;  5HFG A;  2PER A;  4EC0 A;  3QCP A;  3GTU B;  2H6Z A;  3R2Q A;  5B6N A;  4I5Q A;  3FMW A;  1QMV A;  3VUR A;  3FY7 A;  4MPF A;  1HNB A;  4AJ6 A;  4EXJ A;  3I6A A;  1EEM A;  4FYC A;  2D2Z A;  4DSS A;  3IXR A;  1F9M A;  3IHG A;  1ERW A;  4GST A;  4HJM A;  4OD7 A;  4ZL7 A;  4MDC A;  1O6J A;  2PVO C;  5D73 A;  1W4V A;  3CYN A;  3ZRD A;  3G7Y A;  4G9H A;  3UJ1 A;  2VM2 A;  1GSQ A;  5FHI A;  1GTB A;  2OE3 A;  3CRU A;  1VGL A;  4KGI A;  1M2D A;  5DCH A;  4WBJ A;  5DQS A;  1YY7 A;  2CA8 A;  3DVW A;  5JWR B;  3BBY A;  1GTU A;  9GSS A;  2B7J A;  5JCW A;  2CX4 A;  3MAK A;  1C72 A;  4YAV A;  3NZN A;  1THO A;  3WGX A;  5GSS A;  3G7I A;  4K7N A;  3QFB C;  1IYI A;  4YQU A;  1M9A A;  3CRT A;  4MF6 A;  5IMZ A;  4TR1 B;  1O8W A;  2VLV A;  3DWV A;  1FVJ A;  3LW9 A;  1XWK A;  4CY6 A;  1TRW A;  4HS1 A;  1SJZ A;  1OE8 A;  2GQL A;  4BVX B;  3KMN A;  3EPT A;  2C0F A;  4GRF A;  2JZS A;  3C1R A;  2DKI A;  4RI7 A;  2LNT A;  3KMO A;  4DSQ A;  1Z9H A;  2HLS A;  4IGJ A;  1Q98 A;  1V98 A;  3LFL A;  4XS4 A;  3QAV A;  1DE2 A;  2O85 A;  3UIW A;  1RW1 A;  2R5G A;  3SWL A;  5DAL B;  3IRA A;  1RK4 A;  3IC4 A;  2UZ8 A;  2FD3 A;  2WZ9 A;  2X8H A;  2LUS A;  4HUA A;  5CRE A;  3GN3 A;  3GV1 A;  2H66 A;  3J7Y b;  1K0A A;  3EYT A;  5J9B A;  2B1K A;  3BCK A;  1YJ6 A;  2OJL A;  2M46 A;  4G0I A;  3VPQ A;  1W89 A;  2VUP A;  4K0G A;  4ISD A;  2RUE A;  1QFN A;  4K7I A;  2A4V A;  3IK9 A;  3L78 A;  3ZFL A;  3HD5 A;  3GH9 A;  3FZ4 A;  4KH7 A;  2C0D A;  4TVE A;  3IR4 A;  2XBQ A;  5F05 A;  3MIX A;  2H1G A;  4F82 A;  3TKS A;  13GS A;  2IFQ B;  3TRQ A;  3IAS 2;  1FHE A;  1GLP A;  2DIZ A;  3HZ4 A;  5L71 A;  5GZZ B;  2GSQ A;  14GS A;  3GX8 A;  5A4W A;  3NOF A;  3RDW A;  4WEY A;  2O89 A;  2WCI A;  4MH3 A;  5ECO B;  5COH A;  4PNF A;  1BG5 A;  2DMM A;  4MLY A;  5IQY A;  2F8F A;  2CZ3 A;  1XFL A;  3QPM A;  1TU7 A;  5ECI B;  2DLX A;  3KP9 A;  3TRX A;  1PMT A;  4POM A;  1G0T A;  2FNO A;  4MZC A;  4POK A;  4V2M A;  2DC5 A;  5ECR B;  4MJE A;  4IN0 A;  1V9W A;  3DYR A;  4ZL8 A;  2OKA A;  5J3R A;  2MMN A;  1M2B A;  1X5C A;  19GS A;  1Z7P A;  3KEB A;  3FRC A;  2VL2 C;  3LSZ A;  3DML A;  3GSS A;  4KW6 A;  5H5R A;  3E0U A;  5LCZ A;  5ELA A;  1YF1 A;  2E2G A;  4KB3 A;  4I6X A;  2GDR A;  3PPU A;  1S3A A;  2J9H A;  1FG4 A;  2K18 A;  6GSW A;  2BJX A;  4D73 B;  4HOJ A;  2YOI A;  2B1L A;  3D4T A;  3VLN A;  4ULX A;  5IMV A;  1YKA A;  3E3E A;  3GTU A;  4GXZ A;  3EIN A;  4BL7 B;  1UN2 A;  1GRX A;  1OVN A;  2DIY A;  2DML A;  2IWT A;  1A23 A;  4Q5F A;  3HJO A;  5IM9 A;  3DVX A;  2FWE A;  4V1A p;  2YAN A;  10GS A;  2AB6 A;  3QD9 A;  3KD0 A;  4MF7 A;  5LNK e;  3VFI A;  1T00 A;  5FT3 A;  5G30 A;  1ACV A;  5HR3 A;  3IA1 A;  1U88 A;  3MSZ A;  3VWX A;  2CAI A;  1ON4 A;  3TOU A;  1O7U A;  1SKW B;  5ECS A;  2NPB A;  2XC2 A;  1AUC A;  2H76 A;  1OKT A;  4FYB A;  4F2I A;  1R5A A;  1PL1 A;  2X64 A;  1HD2 A;  3WYW A;  4WF4 A;  1T7P B;  2BMX A;  2M72 A;  2REM A;  5B8A A;  4DVC A;  2H71 A;  4GF0 A;  2KP2 A;  1SK2 A;  3GH6 A;  4KF9 A;  4ZIJ A;  4BPY A;  5KN0 A;  3US3 A;  3LYP A;  4JR4 A;  1WIK A;  4KDY A;  1GTI A;  1UC7 A;  3UAP A;  1N2A A;  1SK1 A;  1YZX A;  1T3B A;  2XBI A;  1U6T A;  3DIE A;  1TU8 A;  2PGT A;  4TOP A;  4AJ7 A;  3H79 A;  4TR1 A;  3H4K A;  4XS1 A;  5HR1 A;  5HFI A;  1BQ7 A;  2FWG A;  1XW5 A;  3LXZ A;  3ZML A;  1X9S B;  4BVX A;  2RUF A;  3L9U A;  1XWC A;  2O7K A;  5H5S A;  1QXH A;  2FHE A;  3LGC A;  5ID2 B;  4KCA A;  1KTE A;  3BOA A;  5J5N A;  4E8H A;  1K0B A;  2DBC A;  4NV2 A;  2R0P A;  4MJA A;  1FB6 A;  1EZK A;  3HXS A;  4E8E A;  1YQ1 A;  3G7J A;  1I9D A;  3HYP A;  2LQQ A;  2KLX A;  2OA7 A;  1XPV A;  2OBI A;  4YQM A;  2QA1 A;  4DEJ A;  3ZRE A;  2P5R A;  1JZR A;  4Q5R A;  1K0N A;  3FW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...