4KCEA

Crystal structure of the mitochondrial peroxiredoxin from leishmania braziliensis in the dimeric form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
168
Chain Sequence
ATVRDPAPQFSGKAVVDGAIKEINSNDYKGKYIVLFFYPMVCPTEIIAFSDRYLEFEKLNTQVIAVSCDSEYSHLAWVNTPRKKGGLGEMKIPVLADKSMEIARDYGVLIESAGIALRGLFVIDKKGTLRHSTINDLPVGRNVDEVLRVVEAFQYADENGDAIPCGWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxidoxin
publication title Crystal structure of the mitochondrial peroxiredoxin from Leishmania braziliensis in the dimeric form
rcsb
source organism Leishmania braziliensis
total genus 46
structure length 168
sequence length 172
chains with identical sequence B
ec nomenclature ec 1.11.1.-:
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kceA00
3HJMA 5HR2A 2KP2A 3UARA 4DSQA 1XWGA 1U3IA 3UBLA 4O92A 1AQWA 1W4VA 3HZ4A 1T4ZA 1TRSA 2NDOA 5ECKB 2E7PA 1MD4A 2RIIA 2EIRA 3DGQA 1PKZA 1NHOA 2R5GA 3BJ5A 2H1AA 2LNTA 4MZWA 3PGTA 3CSIA 1SK1A 5B7CA 3A3TA 3TJBA 3L78A 4DSSA 2NBSA 3D5JA 1K3YA 2LRCA 1FB0A 1VF1A 2H74A 1GNWA 5C00A 4BVYA 1QK8A 2CVDA 1UVZA 2I1UA 1ZCPA 2V6KA 2DJKA 6GSSA 4PURA 1IYIA 5JWOB 3VI5A 3HCZA 3BD2A 4D73B 5CRDA 1SYRA 1GUHA 4GLTA 2PGTA 4BWSA 5D9XA 3FZ4A 2A2RA 4YQMA 2EIOA 4BVXA 3BBYA 5IPHA 1RK4A 1GTIA 1SJIA 1F3BA 2C1YA 5IMAA 5GAND 1GSEA 4PX1A 4BL7A 4EDYA 1K3OA 1B4QA 3UIWA 3CTFA 5DVBA 1URMA 4K9ZA 2JZRA 1PD21 3ERFA 2C3NA 1SK2A 4TXOA 14GSA 2QSIA 3WGDA 3IHQA 1K0DA 1B8XA 1AW9A 3FHKA 2P5QA 4HJ2A 5J41A 4HZ4A 2I3YA 5D9VA 1JZOA 4WBRD 6GSYA 3ZL5A 3DWVA 5J4UA 2C3QA 3KP8A 4OD7A 3ZMLA 5C04A 3F6FA 1A8YA 2H19A 2P0GA 4CHSA 4MJEA 4WEYA 4XCSA 5G30A 1EEMA 1H4OA 2YNXA 5A4UA 11GSA 4PQHA 2VCQA 4NV5A 2MMZA 3HDCA 1X9WB 1GRXA 5IMVA 2AJQB 3WGXA 3ZFBA 1ON4A 2L57A 2C0GA 1KNGA 2QGVA 1GTUA 5GZZB 5GAPD 5AN1A 1TXXA 1M2AA 2YWNA 5IMZA 3VLNA 2RUFA 1F6MC 1WIKA 4RUVA 3QD9A 3GX0A 2MBSA 3TB2A 2KP1A 3ZTLA 4Q5QA 2L4CA 3H1NA 4ULXA 1PQNA 4MK3A 4F82A 2E2MA 2LEGA 1EP8A 2X99A 3QAGA 3LWAA 2WZ9A 5B6NA 1RQMA 3GH6A 2PU9C 1VF4A 2NVLA 5ECRB 2FA4A 5ELGA 1K0CA 4MZCA 2LQQA 2TRCP 4LL1B 3ED3A 1NW2A 2PN8A 1K0OA 2O87A 3MSZA 1SD9A 2D2ZA 1IYHA 1GH2A 1YZXA 4NMUA 6GSXA 4WKWA 5JCGA 2JU5A 3I9V2 2REMA 4MLYA 1CQGA 1SU9A 2K6VA 5HFGA 1WE0A 3G7JA 3TKSC 2PVQA 1GSQA 1YF0A 2Z9SA 1WPIA 4F0BA 4ZB8A 3LQ7A 2IJYA 4F9ZA 4V2LA 4JR6A 1UC7A 2IMEA 4KE3A 5HR0A 2VCTA 1GP1A 3UBKA 2C0FA 3FZ9A 1HNBA 2K8VA 3P7XA 1TKDB 2M46A 4MDCA 1GSYA 1THOA 4LMWA 2M80A 1SL1B 2GTUA 3J7Yk 3RPNA 3KJYA 3WYWA 2RM6A 4POBA 1M7TA 3QFAC 3G7YA 3D4MA 3TKSA 3D6IA 2L6CA 3U6VA 5B8BA 3D0ZA 1BEDA 4I2UA 1U88A 2PPTA 3CMIA 2OBIA 1M2BA 3TRXA 4HQZA 3KIJA 2VM2A 2F51A 1BG5A 3EE2A 3ZIVA 3LSZA 1S3AA 3GKXA 4ZIJA 2GQMA 5DBQA 3EMPA 4HI7A 3AY8A 2CX4A 3A2XA 1ZYQB 4YH2A 4JRRA 4L5LA 3GTUB 4FYBA 4X1UA 4PUFC 3N5OA 1Z9HA 4G10A 5EL8A 4AJ7A 2IIYA 3LYKA 1GULA 4MABA 4XS1A 4Q5FA 4ZB6A 4IQAA 2I9HA 2AUVA 3F4RA 2L5OA 4K7OA 3EU4A 1EZKA 3UMAA 1XWAA 1M9AA 4RQXA 1V40A 1X5DA 4ZXGA 1ZOFA 4K7NA 3QAWA 4XIHA 3UJ1A 4DEJA 2IFQB 1PMTA 2HNLA 1OE8A 2YWIA 1TU7A 5D96A 2HI7A 3LEFA 3K8NA 5G1LA 1E6BA 4QL9A 2HRFA 5F06A 4EVMA 3C73A 3UOMA 3QR6A 1ERTA 4N30A 1LU4A 3Q18A 2RM5A 4XS4A 2JSYA 3TDGA 2VOCA 3IK7A 3VURA 5ID2A 4RQRA 1Q98A 2IL3A 2VCZA 1Q4JA 2H0IA 1ZZYA 2H8LA 3EMXA 2GQLA 3DD3A 4PXOA 1PN9A 5AISA 2FHEA 3VI7A 1NSWA 5CRWA 5JWQB 1XW9A 1TU8A 1PGTA 1UN2A 2VD1A 2YZUA 1PKWA 3RDWA 2FD3A 4NWYA 4JZQA 3A2WA 3GKNA 4YQUA 2OE0A 1TRVA 4ZBBA 2PVOC 3HVSA 2VO4A 1QMVA 3GUSA 1TW9A 3UEMA 1M99A 4EF0A 2FGXA 2I4AA 3IRAA 1AIUA 1QXHA 5ECSA 4FYUA 2WFCA 3ZVJA 4MA9A 2O89A 4KB3A 3V1WA 1GWCA 2MMAA 2C3TA 2H73A 5ECLB 1PL2A 1EGOA 3HXSA 4IJ3A 2H1GA 3MDKA 1Z5YE 8GSSA 4LLRA 4X0XA 1EV4A 1T4YA 4KA0A 1HNAA 2K8SA 2R4VA 2OBKA 2LV3A 1K0NA 2H6XA 3APSA 1U6TA 2JSZA 3NOFA 4IQ1A 2AHEA 4D73A 2B3SA 4N0ZA 5GSSA 2R6KA 1ZGNA 3KH9A 4MZBA 17GSA 1G6YA 4I8BA 5G5EA 2V2GA 4BWQA 3ZYWA 1RW1A 1HQOA 1KEBA 2OACA 2NTOA 3SBCA 2XPEA 1O73A 1PRXA 1E2YA 5EY6A 3FW2A 2FNOA 5IO0A 2XBQA 2O85A 2H66A 3APQA 1AQXA 1XWBA 3LXTA 1GTBA 1MTCA 1V57A 2OE1A 1AQVA 4WETA 4IP6A 4E8HA 4HZ2A 1XOAA 2IMKA 1HNCA 1QFNA 2AV4A 4TW5A 1B48A 1AC1A 4Z7XA 1FOVA 3I43A 4KNDA 4BA7A 1R5AA 5CRHA 1ABAA 1HD2A 3GSSA 5FT3A 1YY7A 4AF2A 1ERUA 2C80A 3WGEA 4FO5A 1S3DA 5KN0A 3ISOA 2IMFA 2VL2C 4L8EA 4HUAA 5IPGA 5ECIB 4K1FA 1F37A 5DJLA 2YPMA 2DIZA 1TTZA 3IE3A 1ST9A 1YJ6A 3L4NA 2YCDA 1DUGA 4ZL8A 3GSTA 1GSFA 1B9YC 3L9VA 3TKSE 2HT9A 1GSSA 1M2DA 5IIZA 4I5QA 3IDVA 1OKDA 4IHUA 3F3QA 2YV7A 4V1Ap 3CBUA 4X43A 2JZTA 3MNGA 4ILFA 6GSUA 2WULA 4RI7A 2PWJA 5FHIA 5AGYA 1XZOA 1K0BA 2C0DA 3IAS2 19GSA 2WRTA 1AXDA 1A2LA 2K18A 3M0FA 2HZFA 4O5RA 2MMNA 2DJ0A 2VL2A 4HS1A 5JCUA 2WCIA 5DALB 1K0MA 5IMCA 3IPZA 2CT6A 4Q5RA 5IM9A 1DE2A 2GDRA 5D8IA 3KMOA 3IR4A 3LG6A 2JL4A 2YANA 4MF5A 5F0GA 1THXA 3F9UA 2OA7A 2X8GA 3TKRA 1OC9B 2DMLA 2YZHA 1X9MB 1V98A 2H0GA 4IN0A 4NAXA 2CA8A 3VPTA 4PNGA 3E0UA 4J2FA 3WT1A 4AJ6A 3GL3A 3ZLPA 3PINA 1VF2A 2GZPA 1XW5A 1NM3A 3DRNA 4OO4A 1OYJA 2GT5A 3GRXA 4WF4A 3DVXA 2R37A 4IBPA 3KTLA 5DDLA 1EWXA 3L0HA 1Y25A 4HJMA 3JCML 4GSSA 2GSSA 1SYXA 3C71A 2A2SA 2WGRA 2I81A 1J08A 3DXBA 4I97A 3VWVA 1XOBA 2VD0A 5D73A 1ERWA 1TI1A 3GTUA 1WMJA 1I5GA 4XHMA 5G1KA 2F3MA 1FB6A 3IOSA 4I6XA 4TR4A 1J9BA 4YAVA 1SK0A 1JFUA 1X9SB 2VLTA 4EE0A 1Z6MA 1O85A 2O8VB 2VL9A 4HU9A 4ML1A 2WS2A 3C7MA 2DJ2A 4XRDA 3R2QA 5ECHB 4HU7A 5D9TA 5HFIA 2ES7A 10GSA 2O7KA 2VL3A 2IFQA 2IN3A 3M1GA 2YOIA 3TKQA 3F4TA 3H8QA 1F3AA 4YAPA 1V2AA 2LQOA 3FR3A 2EIQA 3DKSA 4WR5A 2FWHA 3Q6OA 3UVHA 2F8AA 2FCHA 1G6WA 1XWCA 1YQ1A 4PGTA 5IQYA 5A5KA 4NHWA 3HZ8A 2IMIA 5EPFA 2P31A 1TK0B 4FIWA 3QAVA 5CAXA 4EDZA 1EP7A 1MDIA 1T1VA 2B6MA 3H4KA 3TRPA 9GSSA 2KOKA 4EO3A 4V2NA 4E8EA 2DIYA 2MYGA 4ZBDA 2KLXA 5AIVA 5ECQB 1YEXA 1VF3A 4OFTA 4MH3A 4WXTA 5F05A 2AB6A 5CO3A 4K6XA 5E4WA 3VWXA 3L9SA 1OKTA 1X0RA 3DEXA 5IOXA 2L5LA 5KN1A 1BX9A 18GSA 3GIXA 4J57E 1LBKA 1ACVA 5KN2A 3H79A 7GSSA 4IGJA 3C1SA 5LNKe 4OCEA 5HR3A 3KH7A 5HFKA 4BPYA 3HY2A 2L4QA 3GL5A 1GUKA 1PA3A 3VPQA 4WR4A 2C8UA 2TRXA 2MMOA 2H6ZA 4POKA 1FAAA 2GSQA 4G9HA 2H30A 2E0QA 5IMFA 3F63A 3IBHA 5L71A 1BYEA 4L5OA 3PR8A 3TKPA 4KUNA 2H75A 3ME7A 5B6MA 4GXZA 1ZL9A 1QUWA 1S3CA 4GQCA 4NPBA 4TKYA 5JWRB 5DQYA 2DBCA 3EYTA 4JR4A 4MF7A 2ZUPA 1WRYA 3LYPA 1BAYA 2YWMA 2FLSA 2ZNMA 3RAZA 1O6JA 3ERGA 1JLVA 3L9UA 4NXIA 2TIRA 1TJDA 4K7IA 3TUEA 4AJ8A 2MZCA 3IA1A 3UL3A 4MP4A 3QOUA 3ZRDA 4RI6A 3EU3A 2C0EA 3GX8A 2B7KA 4HQSA 1G0TA 4MMMA 4CDOA 1YF1A 4F03A 3FRCA 4KSOA 3IAM2 3E9JB 2DMMA 4N0VA 5D93A 4ML6A 1OAZA 1JZRA 4POMA 4GCIA 4F2IA 3LXZA 5ECMB 3GNJA 2JACA 1A24A 2IWTA 4ISDA 2CVBA 2HLSA 4KDUA 1UA5A 4OO5A 1A2JA 2GS3A 2LJKA 2VCXA 4N10A 1ML6A 4MCUA 3FR6A 4KH7A 5A4VA 2L6DA 3A5WA 1ILOA 4IP1A 4EC0A 3M9JA 4OFNA 3KZQA 2JADA 5KN3A 2QC7A 1JLWA 2VLUA 2X64A 4K2DA 1A0RP 4OMVA 3FY7A 4KCAA 3APOA 4GRFA 1N2AA 1FO5A 1ZMAA 1TK8B 1PX6A 1OC8A 2GLRA 3P8WA 3D21A 3O3TA 5DCHA 2GZYA 1N8JA 1NHYA 3FKFA 1JHBA 3ZITA 2DJ1A 5DAKB 5LCZA 1MDKA 2N5AA 5AIXA 1G7OA 1Z3EA 3FZ5A 1TOFA 4KDXA 5ECNB 3CSJA 3GMFA 4G19A 4EXJA 2HYXA 1R26A 5IOWA 3LJRA 3U5RE 4L0WA 4TN8A 3HYPA 1B4PA 4XS4B 2AAWA 4IELA 3C1RA 3ZMKA 4O7HA 3GH9A 2R2JA 5DALA 6GSWA 2FUG2 2CV4A 1G7EA 3KP9A 4IVFA 1ERVA 3RHBA 1KTEA 3EWLA 5D9WA 3P2AA 2B1KA 2X8CA 5DJMA 1GLQA 3PH9A 2FY6A 2B1LA 1FVKA 1V9WA 4CW9A 1OC9A 3TJJA 1TP9A 5INYA 2YN1A 1A2MA 4GWRA 3FYGA 5A4WA 3VWUA 1M0UA 3BCIA 4JE1A 2J9HA 3MAKA 3CRTA 4PUAA 4LA1A 3F4SA 3IC4A 4KW6A 1QQ2A 2LRNA 3F6DA 3GKKA 5ABRA 4TR1B 2GGTA 4KGIA 1O8XA 3DVWA 2R3XA 4ECIA 4KDYA 3GFKA 2IMDA 2B5XA 3GV1A 1VGLA 2MBTA 1KBNA 1XWKA 4TXVA 5E59A 3GKMA 4V1Ag 3KMNA 2LSTA 3ZZXA 4DSRA 3Q19A 5IMDA 2H0HA 12GSA 2VCWA 1O8WA 4IJIA 4TVEA 2AYTA 4QQ7A 4KCEA 1JZDA 3I6AA 2N5FA 3GHAA 1OC3A 1XPVA 1PSQA 2PMTA 2CAQA 3LORA 2HZEB 5F8BA 4XS6A 1HYUA 3KEBA 2OADA 5J5NA 2LTKA 4J56E 1A0FA 1T8EB 1U3AA 2B5EA 4F0CA 1CQHA 1XVQA 3KCMA 2OJLA 3VK9A 4JBBA 4MH2A 2VLVA 5G5FA 2HXKA 2FA8A 1Z7RA 2LNSA 5ENUA 2YJHA 1EGRA 2DJ3A 4KSMA 2ALBA 2WJUA 4ZL7A 2H70A 4O32A 16GSA 4JEDA 4OWYA 1C72A 3GA4A 4HDEA 2YP6A 3C8EA 4GQFA 1OE7A 3H93A 1B9XC 4G2EA 4EKZA 4ZBAA 1SJ6A 2YWOA 3QFBC 1XFLA 5J3RA 3G7IA 3QPMA 1XVWA 1QGVA 22GSA 2RUEA 2FWEA 4ZB9A 1YDKA 2OKAA 2XBIA 3KTBA 2HFDA 2C4JA 2BMXA 1U87A 4DSSB 2CVKA 3NIVA 4N11A 1TDIA 1XW6A 2VUPA 3DIEA 4PNFA 4IKHA 3TCOA 3KM6A 2PBJA 5CREA 2N5BA 1K3LA 5DQSA 4MJCA 3FZAA 3A2VA 1JZWA 2LRTA 2YV9A 3MWHA 5DCGA 3IK9A 1USBA 5FWGA 2LUSA 13GSA 4GF0A 1J0FA 1A8LA 1TRWA 2DC5A 3F8UA 1R4WA 2XPDA 5CNWA 5JCWA 4JU5A 1Y6EA 1BQ7A 4WF5A 4POLA 1BJXA 3DYRA 1R7HA 1FHEA 1FG4A 3W8JA 2EC4A 3KXOA 3UVTA 4TXOB 2P5RA 2BTOT 4GSTA 1EEJA 1F9MA 3TJGA 2GQKA 5J9BA 1TRUA 1X5CA 4H86A 4NV2A 3F3RA 1T3BA 1GLPA 2L59A 3M8NA 4GTUA 2ZCTA 20GSA 5CP1A 3G9BA 2X8HA 5ELAA 2PERA 1V58A 2CZ3A 2NPBA 4QL7A 4ACSA 4DVCA 5IO2A 4LL4B 1AUCA 3O6TA 3RPPA 3ZVJD 2F9SA 1H75A 5B8AA 4HOJA 1GSUA 2PUKC 1PL1A 3TRQA 5H5QA 3FR9A 5HR1A 3QCPA 4NHZA 1EV9A 1W89A 3FK8A 2GSRA 2G2QA 3FEUA 5ECPB 5CYYA 1M9BA 2CAIA 3HA9A 3CXGA 1WWJA 2HE3A 1X5EA 6GSTA 2LJAA 1GNEA 4MPGA 1VRSD 3QDNA 3CRUA 4ID0A 2H01A 4PQ1A 1MEKA 3EINA 4I2TA 2H1DA 2V41A 3HHVA 4XTSA 5EVOA 1GSDA 2V6OA 1GUMA 1Z6NA 2ON7A 4P3YB 1SL0B 3CYNA 1MD3A 1MDJA 2IPAA 2QKEA 2HRNA 5H5RA 3HJOA 4YQVA 2XC2A 1GL8A 1TI3A 4PQIA 2LJRA 3ZREA 2VCVA 3HJPA 4MJBA 1OVNA 3HD5A 3RBTA 4Q5NA 3TJKA 2DLXA 1XCCA 2FWGA 5ECOB 5DAKA 2DSAA 3EVIA 1SKWB 3GYKA 1WJKA 3KD0A 3NZNA 1SKRB 3D4TA 3ME8A 2F8FA 1DE1A 3TOTA 4EL1A 2FWFA 4FH8A 3M9KA 4OFMA 3BCKA 4EUYA 5KEJA 1LJRA 4MF6A 4K0NA 2GZZA 4HEA2 5HQPA 3M3MA 3RHCA 4XRAA 3Q74A 4FYCA 2E2GA 3ZIJA 2H76A 5F07A 4KAEA 3J7Yb 4KX4A 5GSTA 1DSBA 2WB9A 3HKRA 2OE3A 3S9FA 4ECBA 3OR5A 1XXUA 4K0GA 1DBYA 2VAFA 2M72A 1EOGA 3IV4A 1F2EA 1SD8A 2H1BA 4GSNA 4TR3A 1T00A 4ECCA 3DMLA 2KHPA 1K0AA 1EOHA 2HSHA 3HVVA 2CZ2A 2CQ9A 4V2MA 2WDUA 3W8SA 2H71A 4TRXA 2ON5A 4OCFA 3VFIA 3E3EA 4AGSA 1R5PA 2YJ7A 6GSVA 1I9DA 4IW9A 3LFLA 3N9JA 2GT6A 4TR1A 1XIYA 3TJFA 1YKCA 2JZSA 3EC3A 2LKUA 4ZILA 1AAZA 4WBJA 2V32A 5H5SA 2G0FA 2A4VA 2H72A 3VWWA 2J23A 3WD6A 2VIMA 2KUCA 4TR0A 2HSYA 3CTGA 1SENA 1SJZA 1SL2B 2K9FA 3LGCA 3D22A 3BOAA 2GSTA 3HVXA 5LD0A 3QMXA 3GN3A 5G2ZA 4MJAA 1GTAA 3WT2A 2VM1A 2DJJA 2CX3A 1O7UA 1PX7A 2BJXA 3O76A 5J9CA 3F0IA 3SWLA 3GURA 1WP0A 4ECJA 1XBSA 2HZEA 2V1MA 2XHFA 4K8MA 2B7JA 5ID2B 2B5YA 1WOUA 1ZYEA 1TK5B 2GVPA 3P90A 1YKAA 3ERWA 1FVJA 3TOUA 3W6GA 2RLIA 3EURA 4IS0A 5CRGA 1SKSB 3ZFLA 3CSHA 4ZL9A 1T7PB 1A23A 5COHA 4L0UA 2H6YA 1Z7PA 2LS5A 4TOPA 3TGZA 1O81A 3US3A 3UAPA 1FW1A 5G31A 1YEPA 3KGKA 3IXRA 4LMVA 3I69A 4MPFA
chains in the Genus database with same CATH superfamily
3HJMA 5HR2A 2KP2A 3UARA 4DSQA 1XWGA 1U3IA 3UBLA 4O92A 1AQWA 1W4VA 3HZ4A 1T4ZA 1TRSA 2NDOA 5ECKB 2E7PA 1MD4A 2RIIA 2EIRA 1S3RA 3DGQA 1PKZA 1NHOA 2R5GA 3BJ5A 2H1AA 2LNTA 4MZWA 3PGTA 3CSIA 1SK1A 5B7CA 3A3TA 3TJBA 3L78A 4DSSA 2NBSA 3D5JA 1K3YA 2LRCA 1FB0A 1VF1A 2H74A 1GNWA 5C00A 4BVYA 1QK8A 2CVDA 1UVZA 2I1UA 1ZCPA 2V6KA 2DJKA 6GSSA 4PURA 1IYIA 5JWOB 3VI5A 3HCZA 3BD2A 4D73B 5CRDA 1SYRA 1GUHA 4GLTA 2PGTA 4BWSA 5D9XA 3FZ4A 2A2RA 4YQMA 2EIOA 4BVXA 3BBYA 5IPHA 1RK4A 1GTIA 1SJIA 1F3BA 2C1YA 5IMAA 5GAND 1GSEA 4PX1A 4BL7A 4EDYA 1K3OA 1B4QA 3UIWA 3CTFA 5DVBA 1URMA 4K9ZA 2JZRA 1PD21 3ERFA 2C3NA 1SK2A 4TXOA 14GSA 2QSIA 3WGDA 3IHQA 1K0DA 1B8XA 1AW9A 3FHKA 2P5QA 4HJ2A 5J41A 4HZ4A 2I3YA 5D9VA 1JZOA 4WBRD 6GSYA 3ZL5A 3DWVA 5J4UA 2C3QA 3KP8A 4OD7A 3ZMLA 5C04A 3F6FA 1A8YA 2H19A 2P0GA 4CHSA 4HSCX 4MJEA 4WEYA 4XCSA 5G30A 4YKGA 1EEMA 1H4OA 2YNXA 5A4UA 11GSA 4PQHA 2VCQA 4NV5A 2MMZA 3HDCA 1X9WB 1GRXA 5IMVA 2AJQB 3WGXA 3ZFBA 1ON4A 2L57A 2C0GA 1KNGA 2QGVA 1GTUA 5GZZB 5GAPD 5AN1A 1TXXA 1M2AA 2YWNA 5IMZA 3VLNA 2RUFA 1F6MC 1WIKA 3LW9A 4RUVA 3QD9A 3GX0A 2MBSA 3TB2A 2KP1A 3ZTLA 4Q5QA 2L4CA 3H1NA 4ULXA 1PQNA 4MK3A 4F82A 2E2MA 2LEGA 1EP8A 2X99A 3QAGA 3LWAA 2WZ9A 5B6NA 2A2PA 1RQMA 3GH6A 2PU9C 1VF4A 2NVLA 5ECRB 2FA4A 5ELGA 1K0CA 4MZCA 2LQQA 2TRCP 4LL1B 3ED3A 1NW2A 2PN8A 1K0OA 2O87A 3MSZA 1SD9A 2D2ZA 1IYHA 1GH2A 1YZXA 4NMUA 6GSXA 3A5IA 4WKWA 5JCGA 2JU5A 3I9V2 2REMA 4MLYA 1CQGA 1SU9A 2K6VA 5HFGA 1WE0A 3G7JA 3TKSC 2PVQA 1GSQA 1YF0A 2Z9SA 1WPIA 4F0BA 4ZB8A 3LQ7A 2IJYA 4F9ZA 4V2LA 4JR6A 1UC7A 2IMEA 4K5RA 4KE3A 5HR0A 2VCTA 1GP1A 3UBKA 4EIQA 2C0FA 3FZ9A 1HNBA 2K8VA 3P7XA 1TKDB 2M46A 4MDCA 1GSYA 1THOA 3HVNA 4LMWA 2M80A 1SL1B 2GTUA 3J7Yk 3RPNA 3KJYA 3WYWA 2RM6A 4POBA 1M7TA 3QFAC 3G7YA 3D4MA 3TKSA 3D6IA 2L6CA 3U6VA 5B8BA 3D0ZA 1BEDA 4I2UA 1U88A 2PPTA 3CMIA 2OBIA 1M2BA 3TRXA 4HQZA 3KIJA 2VM2A 2F51A 1BG5A 3EE2A 3ZIVA 3LSZA 1S3AA 3GKXA 4ZIJA 2GQMA 5DBQA 3EMPA 4HI7A 3AY8A 2CX4A 3A2XA 1ZYQB 4YH2A 4JRRA 4L5LA 3GTUB 4FYBA 4X1UA 4PUFC 3N5OA 1Z9HA 4G10A 5EL8A 4AJ7A 1ZYNA 2IIYA 3LYKA 1GULA 4MABA 4XS1A 4Q5FA 4ZB6A 4IQAA 2I9HA 2AUVA 3F4RA 2L5OA 4K7OA 3EU4A 1EZKA 3UMAA 1XWAA 1M9AA 4RQXA 1V40A 1X5DA 4ZXGA 1ZOFA 4K7NA 3QAWA 4XIHA 3UJ1A 4DEJA 2IFQB 1PMTA 2HNLA 1OE8A 2YWIA 1TU7A 5D96A 2HI7A 3LEFA 3K8NA 5G1LA 1E6BA 4QL9A 2HRFA 5F06A 4EVMA 3C73A 3UOMA 3QR6A 1ERTA 4N30A 1LU4A 3Q18A 2RM5A 4XS4A 2JSYA 3TDGA 2VOCA 3IK7A 1M3IA 3VURA 5ID2A 4RQRA 4Z2TA 1Q98A 2IL3A 2VCZA 1Q4JA 2H0IA 4CY6A 1ZZYA 2H8LA 3EMXA 2GQLA 2R0PA 3DD3A 4PXOA 1PN9A 5AISA 2FHEA 3VI7A 1NSWA 5CRWA 5JWQB 1XW9A 1TU8A 1PGTA 1UN2A 2VD1A 2YZUA 1PKWA 4O5UA 3RDWA 2FD3A 4NWYA 4JZQA 3A2WA 3GKNA 4YQUA 2OE0A 1TRVA 4ZBBA 2PVOC 3HVSA 2VO4A 1QMVA 3GUSA 1TW9A 3UEMA 1M99A 4EF0A 2FGXA 2I4AA 3IRAA 1AIUA 1QXHA 5ECSA 4FYUA 2WFCA 3ZVJA 4MA9A 2O89A 4KB3A 3V1WA 1GWCA 2MMAA 2C3TA 2H73A 5ECLB 1PL2A 4USSA 1EGOA 3HXSA 4IJ3A 2H1GA 3MDKA 1Z5YE 8GSSA 4LLRA 4G0LA 3MIXA 4X0XA 1EV4A 4BIKA 1T4YA 3IHGA 4KA0A 1HNAA 2K8SA 2R4VA 2OBKA 2LV3A 1K0NA 2H6XA 3APSA 1U6TA 2JSZA 3NOFA 4IQ1A 2AHEA 4D73A 2B3SA 4N0ZA 5GSSA 2R6KA 1ZGNA 3KH9A 4MZBA 17GSA 1G6YA 5KOWA 4I8BA 5G5EA 2V2GA 4BWQA 3ZYWA 1RW1A 1HQOA 1KEBA 2OACA 2NTOA 3SBCA 2XPEA 1O73A 1PRXA 3IC8A 1E2YA 5EY6A 3FW2A 2FNOA 5IO0A 2XBQA 2O85A 2H66A 3APQA 4YKFA 1AQXA 1XWBA 3LXTA 1GTBA 1MTCA 1V57A 2OE1A 1AQVA 4WETA 4PTSA 4IP6A 4E8HA 4HZ2A 1XOAA 2IMKA 4Z2RA 1HNCA 1QFNA 2AV4A 4TW5A 1B48A 1AC1A 4Z7XA 1FOVA 3I43A 4KNDA 4BA7A 1R5AA 5CRHA 1ABAA 1HD2A 3GSSA 5FT3A 1YY7A 4AF2A 1ERUA 2C80A 3WGEA 4FO5A 1S3DA 5KN0A 3ISOA 2IMFA 2VL2C 4L8EA 4HUAA 5IPGA 5ECIB 4K1FA 1F37A 5DJLA 2YPMA 2DIZA 1TTZA 3IE3A 1ST9A 1YJ6A 3L4NA 2R0CA 2YCDA 4A5PA 1DUGA 4ZL8A 3GSTA 1GSFA 1B9YC 3L9VA 3TKSE 2HT9A 1GSSA 1M2DA 5IIZA 4I5QA 3IDVA 1OKDA 4IHUA 3F3QA 2YV7A 4V1Ap 3CBUA 4X43A 2JZTA 3MNGA 4ILFA 6GSUA 2WULA 4RI7A 2PWJA 5FHIA 2UZ8A 5AGYA 1XZOA 1K0BA 2C0DA 3IAS2 19GSA 2WRTA 1AXDA 1A2LA 2K18A 3M0FA 2HZFA 2DKHA 4O5RA 2MMNA 2DJ0A 2VL2A 4HS1A 5JCUA 2WCIA 5DALB 1K0MA 5IMCA 3IPZA 2CT6A 4Q5RA 5IM9A 1DE2A 2GDRA 2HSMA 3KMOA 5D8IA 3IR4A 3LG6A 2JL4A 2YANA 4MF5A 5F0GA 1THXA 3F9UA 2OA7A 2X8GA 3TKRA 1OC9B 2DMLA 2YZHA 1X9MB 1V98A 2H0GA 2X4AA 4IN0A 4NAXA 2CA8A 3VPTA 4PNGA 3E0UA 4J2FA 3WT1A 4AJ6A 3GL3A 3ZLPA 3PINA 1VF2A 2GZPA 1XW5A 1NM3A 3DRNA 4OO4A 1OYJA 2GT5A 3GRXA 4WF4A 3DVXA 1PN0A 2R37A 4IBPA 3KTLA 5DDLA 1EWXA 3L0HA 1Y25A 5BMUA 4HJMA 3JCML 4GSSA 4O5QA 2GSSA 1SYXA 3C71A 2A2SA 2WGRA 2I81A 1J08A 3DXBA 4I97A 3VWVA 1XOBA 2VD0A 5D73A 1ERWA 1TI1A 3GTUA 1WMJA 1I5GA 4XHMA 5G1KA 2F3MA 1FB6A 3IOSA 4I6XA 4BVXB 2HRAA 4TR4A 1J9BA 4YAVA 1SK0A 1JFUA 1X9SB 2VLTA 4EE0A 1Z6MA 1O85A 2O8VB 2VL9A 4HU9A 4ML1A 2WS2A 3C7MA 2DJ2A 4XRDA 3R2QA 5ECHB 4HU7A 4CY8A 5D9TA 5HFIA 2ES7A 10GSA 2O7KA 2VL3A 2IFQA 2IN3A 3M1GA 2YOIA 3TKQA 3F4TA 3H8QA 1F3AA 4YAPA 1V2AA 2LQOA 5KOXA 3FR3A 2EIQA 3DKSA 4WR5A 2FWHA 3Q6OA 3UVHA 2F8AA 2FCHA 1G6WA 1XWCA 1YQ1A 4PGTA 5IQYA 5A5KA 4NHWA 3HZ8A 2IMIA 5EPFA 2P31A 1TK0B 4FIWA 3QAVA 5CAXA 4EDZA 1EP7A 1MDIA 1T1VA 2B6MA 3H4KA 3TRPA 9GSSA 2KOKA 4EO3A 4V2NA 4E8EA 2DIYA 2MYGA 4ZBDA 2KLXA 5AIVA 5ECQB 1YEXA 1VF3A 4OFTA 4MH3A 4WXTA 5F05A 2AB6A 5CO3A 4K6XA 5E4WA 3VWXA 3L9SA 1OKTA 1X0RA 3DEXA 5IOXA 2L5LA 5KN1A 1BX9A 18GSA 3GIXA 4J57E 1LBKA 1ACVA 5KN2A 3H79A 7GSSA 4IGJA 3C1SA 5LNKe 4OCEA 5HR3A 3KH7A 5HFKA 4BPYA 3HY2A 2L4QA 3R3EA 3GL5A 1GUKA 1PA3A 3VPQA 4WR4A 2C8UA 2TRXA 2MMOA 2H6ZA 4POKA 1FAAA 2GSQA 4G9HA 2H30A 2E0QA 5IMFA 3F63A 3IBHA 5L71A 1BYEA 4L5OA 3PR8A 3TKPA 4KUNA 2H75A 3ME7A 5B6MA 4GXZA 1ZL9A 1QUWA 1S3CA 4GQCA 4NPBA 4TKYA 5JWRB 5DQYA 2DBCA 3EYTA 4JR4A 4MF7A 2ZUPA 1WRYA 3LYPA 1BAYA 2YWMA 2FLSA 2ZNMA 3RAZA 1O6JA 3ERGA 1JLVA 3L9UA 4NXIA 2TIRA 1TJDA 4K7IA 3PPUA 3TUEA 4AJ8A 2MZCA 3IA1A 3UL3A 4MP4A 3QOUA 3ZRDA 4RI6A 3EU3A 2C0EA 3GX8A 2B7KA 4HQSA 1G0TA 4MMMA 4CDOA 1YF1A 4F03A 3FRCA 4KSOA 4X4JA 1PFOA 3IAM2 3E9JB 2DMMA 4N0VA 5D93A 2QA2A 4ML6A 1OAZA 1JZRA 4POMA 4GCIA 4F2IA 2R0GA 3LXZA 5ECMB 3GNJA 2JACA 1A24A 2IWTA 4ISDA 2CVBA 2HLSA 4KDUA 1UA5A 4OO5A 1A2JA 2GS3A 2HRKA 2LJKA 2VCXA 4N10A 1ML6A 4MCUA 3FR6A 4KH7A 5A4VA 2L6DA 3A5WA 1M3JA 1ILOA 4IP1A 4EC0A 3M9JA 4OFNA 3KZQA 2JADA 5KN3A 2QC7A 1JLWA 2VLUA 2X64A 4K2DA 1A0RP 4OMVA 3FY7A 4KCAA 3APOA 4FQUA 4GRFA 1N2AA 1FO5A 1ZMAA 1TK8B 1PX6A 1OC8A 2GLRA 3P8WA 3D21A 3O3TA 5DCHA 2GZYA 1N8JA 1NHYA 3FKFA 1JHBA 3ZITA 2DJ1A 5DAKB 5LCZA 1MDKA 2N5AA 5AIXA 1G7OA 1Z3EA 3FZ5A 1TOFA 4KDXA 1XG8A 5ECNB 3CSJA 3GMFA 4G19A 4EXJA 2HYXA 1R26A 5IOWA 3LJRA 3U5RE 4L0WA 4TN8A 3HYPA 1B4PA 4XS4B 2AAWA 4IELA 3C1RA 3ZMKA 4O7HA 3GH9A 2R2JA 5DALA 6GSWA 2FUG2 2CV4A 2QA1A 1G7EA 3KP9A 4IVFA 1ERVA 3RHBA 1KTEA 3EWLA 5D9WA 3P2AA 2B1KA 2X8CA 5DJMA 1GLQA 3PH9A 2FY6A 2B1LA 1FVKA 1V9WA 4CW9A 1OC9A 3TJJA 1TP9A 5INYA 2YN1A 4G0KA 1A2MA 4GWRA 3FYGA 5A4WA 3VWUA 1M0UA 3BCIA 4JE1A 2J9HA 3MAKA 3CRTA 4PUAA 4LA1A 3F4SA 3IC4A 4KW6A 1QQ2A 3FMWA 2LRNA 3F6DA 3GKKA 5ABRA 4TR1B 2GGTA 4KGIA 1O8XA 3DVWA 2R3XA 4ECIA 4KDYA 3GFKA 2IMDA 2B5XA 3GV1A 1VGLA 2MBTA 1KBNA 1XWKA 4TXVA 5E59A 2DKIA 3GKMA 4V1Ag 3KMNA 2LSTA 3ZZXA 4DSRA 3Q19A 5IMDA 2H0HA 12GSA 2VCWA 1O8WA 4IJIA 4TVEA 4MNNA 2AYTA 4QQ7A 4KCEA 1JZDA 3I6AA 2N5FA 3GHAA 1OC3A 1XPVA 1PSQA 2PMTA 2CAQA 3LORA 2HZEB 5F8BA 4XS6A 1HYUA 3KEBA 2OADA 5J5NA 2LTKA 3CQFA 4J56E 1A0FA 1T8EB 1U3AA 2B5EA 4F0CA 1CQHA 1XVQA 3KCMA 2OJLA 3VK9A 4JBBA 4MH2A 2VLVA 5G5FA 3MYDA 2HXKA 2FA8A 1Z7RA 2LNSA 5ENUA 2YJHA 1EGRA 2DJ3A 4KSMA 2ALBA 2WJUA 4ZL7A 2H70A 4O32A 3EPTA 16GSA 4JEDA 4OWYA 1C72A 3GA4A 4HDEA 2YP6A 3C8EA 4GQFA 1OE7A 3H93A 1B9XC 4G2EA 4EKZA 4ZBAA 1SJ6A 2YWOA 3QFBC 1XFLA 5J3RA 3G7IA 1ZYPA 3QPMA 1XVWA 1QGVA 22GSA 2A4HA 2RUEA 2FWEA 4ZB9A 1YDKA 2OKAA 2XBIA 3KTBA 2HFDA 2C4JA 2BMXA 1U87A 4DSSB 2CVKA 3NIVA 4N11A 1TDIA 1XW6A 2VUPA 4BVYB 3DIEA 4PNFA 4IKHA 3TCOA 3KM6A 2PBJA 5CREA 2N5BA 1K3LA 5DQSA 4MJCA 3FZAA 3A2VA 1JZWA 2LRTA 2YV9A 3MWHA 5DCGA 3IK9A 1USBA 5FWGA 2LUSA 13GSA 4GF0A 1J0FA 1A8LA 1TRWA 2DC5A 3F8UA 1R4WA 2XPDA 5CNWA 5JCWA 4JU5A 1Y6EA 1BQ7A 4WF5A 4BL7B 4POLA 1BJXA 3DYRA 4G0IA 1R7HA 1FHEA 1FG4A 3W8JA 2EC4A 3KXOA 3UVTA 4TXOB 2P5RA 2BTOT 4GSTA 1EEJA 1F9MA 3TJGA 2GQKA 5J9BA 1TRUA 1X5CA 4H86A 4NV2A 3F3RA 1T3BA 1GLPA 2L59A 3M8NA 4GTUA 2ZCTA 20GSA 5CP1A 3G9BA 5BRTA 2X8HA 5ELAA 2PERA 1V58A 2CZ3A 2NPBA 4QL7A 4ACSA 4DVCA 5IO2A 4LL4B 1AUCA 3O6TA 3RPPA 3ZVJD 4Z2UA 2F9SA 4K2XA 1H75A 5B8AA 4HOJA 1GSUA 2PUKC 1PL1A 3TRQA 5H5QA 3FR9A 5HR1A 3QCPA 4NHZA 1EV9A 1W89A 3FK8A 2GSRA 2G2QA 3FEUA 5ECPB 5CYYA 1M9BA 2CAIA 3HA9A 3CXGA 1WWJA 2HE3A 1X5EA 6GSTA 2LJAA 1GNEA 4MPGA 1VRSD 3QDNA 3CRUA 4ID0A 2H01A 4PQ1A 1MEKA 3EINA 4I2TA 2H1DA 4KF9A 2V41A 3HHVA 4XTSA 5EVOA 1GSDA 2V6OA 1GUMA 1Z6NA 2ON7A 4P3YB 1SL0B 3CYNA 1MD3A 1MDJA 2IPAA 2QKEA 2HRNA 5H5RA 3HJOA 4EIPA 4YQVA 2XC2A 1GL8A 1TI3A 4PQIA 2LJRA 3ZREA 2VCVA 3HJPA 4MJBA 1OVNA 3HD5A 3RBTA 4Q5NA 3TJKA 2DLXA 4K5SA 1XCCA 2FWGA 5ECOB 5DAKA 2DSAA 3EVIA 1SKWB 3GYKA 1WJKA 3KD0A 3NZNA 1SKRB 3D4TA 3ME8A 2F8FA 1DE1A 3TOTA 1FOHA 4EL1A 2FWFA 4FH8A 3M9KA 4OFMA 3BCKA 4EUYA 5KEJA 1LJRA 4MF6A 4K0NA 2GZZA 4HEA2 5HQPA 3M3MA 3RHCA 4XRAA 3Q74A 4FYCA 2E2GA 3ZIJA 2H76A 5F07A 4KAEA 3J7Yb 4KX4A 4ICYA 5GSTA 1DSBA 2WB9A 3HKRA 2OE3A 3S9FA 4ECBA 3OR5A 1XXUA 4K0GA 1DBYA 2VAFA 2M72A 1EOGA 3IV4A 1F2EA 1SD8A 2H1BA 4GSNA 4TR3A 1T00A 4ECCA 3DMLA 2KHPA 1K0AA 1EOHA 2HSHA 3HVVA 2CZ2A 2CQ9A 4V2MA 2WDUA 3W8SA 2H71A 4TRXA 2ON5A 4OCFA 3VFIA 3E3EA 4AGSA 1R5PA 2YJ7A 6GSVA 1I9DA 4IW9A 3LFLA 3N9JA 2GT6A 4TR1A 1XIYA 3TJFA 1YKCA 2JZSA 3EC3A 2LKUA 4ZILA 1AAZA 4WBJA 2V32A 5H5SA 2G0FA 2A4VA 2H72A 3VWWA 2J23A 3WD6A 2VIMA 2KUCA 4TR0A 2HSYA 3CTGA 1SENA 1SJZA 1SL2B 2K9FA 3LGCA 3D22A 3BOAA 2GSTA 3HVXA 5LD0A 3QMXA 3GN3A 5G2ZA 4MJAA 1GTAA 3WT2A 2VM1A 2DJJA 2CX3A 1O7UA 1PX7A 2BJXA 3O76A 5J9CA 3F0IA 3SWLA 3GURA 1WP0A 4ECJA 1XBSA 2HZEA 2V1MA 2XHFA 4K8MA 2B7JA 5ID2B 2X49A 2B5YA 1WOUA 1ZYEA 1TK5B 2GVPA 3P90A 1YKAA 3ERWA 1FVJA 3TOUA 3W6GA 2RLIA 3EURA 4IS0A 5CRGA 1SKSB 3ZFLA 3CSHA 4ZL9A 1T7PB 1A23A 5COHA 4L0UA 2H6YA 1Z7PA 2LS5A 4TOPA 3TGZA 1O81A 3US3A 3UAPA 1FW1A 5G31A 1YEPA 3KGKA 3IXRA 4LMVA 3I69A 4MPFA
chains in the Genus database with same CATH topology
3HJMA 5HR2A 2KP2A 3UARA 4DSQA 1XWGA 1U3IA 3UBLA 4O92A 1AQWA 1W4VA 3HZ4A 1T4ZA 1TRSA 2NDOA 5ECKB 2E7PA 1MD4A 2RIIA 2EIRA 3DGQA 1PKZA 1NHOA 2R5GA 3BJ5A 2H1AA 2LNTA 4MZWA 3PGTA 3CSIA 1SK1A 5B7CA 3A3TA 3TJBA 3L78A 4DSSA 2NBSA 3D5JA 1K3YA 2LRCA 1FB0A 1VF1A 2H74A 1GNWA 5C00A 4BVYA 1QK8A 2CVDA 1UVZA 2I1UA 1ZCPA 2V6KA 2DJKA 6GSSA 4PURA 1IYIA 5JWOB 3VI5A 3HCZA 3BD2A 4D73B 5CRDA 1SYRA 1GUHA 4GLTA 2PGTA 4BWSA 5D9XA 3FZ4A 2A2RA 4YQMA 2EIOA 4BVXA 3BBYA 5IPHA 1RK4A 1GTIA 1SJIA 1F3BA 2C1YA 5IMAA 5GAND 1GSEA 4PX1A 4BL7A 4EDYA 1K3OA 1B4QA 3UIWA 3CTFA 5DVBA 1URMA 4K9ZA 2JZRA 1PD21 3ERFA 2C3NA 1SK2A 4TXOA 14GSA 2QSIA 3WGDA 3IHQA 1K0DA 1B8XA 1AW9A 3FHKA 2P5QA 4HJ2A 5J41A 4HZ4A 2I3YA 5D9VA 1JZOA 4WBRD 6GSYA 3ZL5A 3DWVA 5J4UA 2C3QA 3KP8A 4OD7A 3ZMLA 5C04A 3F6FA 1A8YA 2H19A 2P0GA 4CHSA 4MJEA 4WEYA 4XCSA 5G30A 4YKGA 1EEMA 1H4OA 2YNXA 5A4UA 11GSA 4PQHA 2VCQA 4NV5A 2MMZA 3HDCA 1X9WB 1GRXA 5IMVA 2AJQB 3WGXA 3ZFBA 1ON4A 2L57A 2C0GA 1KNGA 2QGVA 1GTUA 5GZZB 5GAPD 5AN1A 1TXXA 1M2AA 2YWNA 5IMZA 3VLNA 2RUFA 1F6MC 1WIKA 3LW9A 4RUVA 3QD9A 3GX0A 2MBSA 3TB2A 2KP1A 3ZTLA 4Q5QA 2L4CA 3H1NA 4ULXA 1PQNA 4MK3A 4F82A 2E2MA 2LEGA 1EP8A 2X99A 3QAGA 3LWAA 2WZ9A 5B6NA 2A2PA 1RQMA 3GH6A 2PU9C 1VF4A 2NVLA 5ECRB 2FA4A 5ELGA 1K0CA 4MZCA 2LQQA 2TRCP 4LL1B 3ED3A 1NW2A 2PN8A 1K0OA 2O87A 3MSZA 1SD9A 2D2ZA 1IYHA 1GH2A 1YZXA 4NMUA 6GSXA 3A5IA 4WKWA 5JCGA 2JU5A 3I9V2 2REMA 4MLYA 1CQGA 1SU9A 2K6VA 5HFGA 1WE0A 3G7JA 3TKSC 2PVQA 1GSQA 1YF0A 2Z9SA 1WPIA 4F0BA 4ZB8A 3LQ7A 2IJYA 4F9ZA 4V2LA 4JR6A 1UC7A 2IMEA 4K5RA 4KE3A 5HR0A 2VCTA 1GP1A 3UBKA 4EIQA 2C0FA 3FZ9A 1HNBA 2K8VA 3P7XA 1TKDB 2M46A 4MDCA 1GSYA 1THOA 4LMWA 2M80A 1SL1B 2GTUA 3J7Yk 3RPNA 3KJYA 3WYWA 2RM6A 4POBA 1M7TA 3QFAC 3G7YA 3D4MA 3TKSA 3D6IA 2L6CA 3U6VA 5B8BA 3D0ZA 1BEDA 4I2UA 1U88A 2PPTA 3CMIA 2OBIA 1M2BA 3TRXA 4HQZA 3KIJA 2VM2A 2F51A 1BG5A 3EE2A 3ZIVA 3LSZA 1S3AA 3GKXA 4ZIJA 2GQMA 5DBQA 3EMPA 4HI7A 3AY8A 2CX4A 3A2XA 1ZYQB 4YH2A 4JRRA 4L5LA 3GTUB 4FYBA 4X1UA 4PUFC 3N5OA 1Z9HA 4G10A 5EL8A 4AJ7A 1ZYNA 2IIYA 3LYKA 1GULA 4MABA 4XS1A 4Q5FA 4ZB6A 4IQAA 2I9HA 2AUVA 3F4RA 2L5OA 4K7OA 3EU4A 1EZKA 3UMAA 1XWAA 1M9AA 4RQXA 1V40A 1X5DA 4ZXGA 1ZOFA 4K7NA 3QAWA 4XIHA 3UJ1A 4DEJA 2IFQB 1PMTA 2HNLA 1OE8A 2YWIA 1TU7A 5D96A 2HI7A 3LEFA 3K8NA 5G1LA 1E6BA 4QL9A 2HRFA 5F06A 4EVMA 3C73A 3UOMA 3QR6A 1ERTA 4N30A 1LU4A 3Q18A 2RM5A 4XS4A 2JSYA 3TDGA 2VOCA 3IK7A 3VURA 5ID2A 4RQRA 4Z2TA 1Q98A 2IL3A 2VCZA 1Q4JA 2H0IA 4CY6A 1ZZYA 2H8LA 3EMXA 2GQLA 2R0PA 3DD3A 4PXOA 1PN9A 5AISA 2FHEA 3VI7A 1NSWA 5CRWA 5JWQB 1XW9A 1TU8A 1PGTA 1UN2A 2VD1A 2YZUA 1PKWA 4O5UA 3RDWA 2FD3A 4NWYA 4JZQA 3A2WA 3GKNA 4YQUA 2OE0A 1TRVA 4ZBBA 2PVOC 3HVSA 2VO4A 1QMVA 3GUSA 1TW9A 3UEMA 1M99A 4EF0A 2FGXA 2I4AA 3IRAA 1AIUA 1QXHA 5ECSA 4FYUA 2WFCA 3ZVJA 4MA9A 2O89A 4KB3A 3V1WA 1GWCA 2MMAA 2C3TA 2H73A 5ECLB 1PL2A 4USSA 1EGOA 3HXSA 4IJ3A 2H1GA 3MDKA 1Z5YE 8GSSA 4LLRA 4G0LA 3MIXA 4X0XA 1EV4A 1T4YA 3IHGA 4KA0A 1HNAA 2K8SA 2R4VA 2OBKA 2LV3A 1K0NA 2H6XA 3APSA 1U6TA 2JSZA 3NOFA 4IQ1A 2AHEA 4D73A 2B3SA 4N0ZA 5GSSA 2R6KA 1ZGNA 3KH9A 4MZBA 17GSA 1G6YA 5KOWA 4I8BA 5G5EA 2V2GA 4BWQA 3ZYWA 1RW1A 1HQOA 1KEBA 2OACA 2NTOA 3SBCA 2XPEA 1O73A 1PRXA 3IC8A 1E2YA 5EY6A 3FW2A 2FNOA 5IO0A 2XBQA 2O85A 2H66A 3APQA 4YKFA 1AQXA 1XWBA 3LXTA 1GTBA 1MTCA 1V57A 2OE1A 1AQVA 4WETA 4PTSA 4IP6A 4E8HA 4HZ2A 1XOAA 2IMKA 4Z2RA 1HNCA 1QFNA 2AV4A 4TW5A 1B48A 1AC1A 4Z7XA 1FOVA 3I43A 4KNDA 4BA7A 1R5AA 5CRHA 1ABAA 1HD2A 3GSSA 5FT3A 1YY7A 4AF2A 1ERUA 2C80A 3WGEA 4FO5A 1S3DA 5KN0A 3ISOA 2IMFA 2VL2C 4L8EA 4HUAA 5IPGA 5ECIB 4K1FA 1F37A 5DJLA 2YPMA 2DIZA 1TTZA 3IE3A 1ST9A 1YJ6A 3L4NA 2R0CA 2YCDA 4A5PA 1DUGA 4ZL8A 3GSTA 1GSFA 1B9YC 3L9VA 3TKSE 2HT9A 1GSSA 1M2DA 5IIZA 4I5QA 3IDVA 1OKDA 4IHUA 3F3QA 2YV7A 4V1Ap 3CBUA 4X43A 2JZTA 3MNGA 4ILFA 6GSUA 2WULA 4RI7A 2PWJA 5FHIA 2UZ8A 5AGYA 1XZOA 1K0BA 2C0DA 3IAS2 19GSA 2WRTA 1AXDA 1A2LA 2K18A 3M0FA 2HZFA 2DKHA 4O5RA 2MMNA 2DJ0A 2VL2A 4HS1A 5JCUA 2WCIA 5DALB 1K0MA 5IMCA 3IPZA 2CT6A 4Q5RA 5IM9A 1DE2A 2GDRA 2HSMA 3KMOA 5D8IA 3IR4A 3LG6A 2JL4A 2YANA 4MF5A 5F0GA 1THXA 3F9UA 2OA7A 2X8GA 3TKRA 1OC9B 2DMLA 2YZHA 1X9MB 1V98A 2H0GA 2X4AA 4IN0A 4NAXA 2CA8A 3VPTA 4PNGA 3E0UA 4J2FA 3WT1A 4AJ6A 3GL3A 3ZLPA 3PINA 1VF2A 2GZPA 1XW5A 1NM3A 3DRNA 4OO4A 1OYJA 2GT5A 3GRXA 4WF4A 3DVXA 1PN0A 2R37A 4IBPA 3KTLA 5DDLA 1EWXA 3L0HA 1Y25A 5BMUA 4HJMA 3JCML 4GSSA 4O5QA 2GSSA 1SYXA 3C71A 2A2SA 2WGRA 2I81A 1J08A 3DXBA 4I97A 3VWVA 1XOBA 2VD0A 5D73A 1ERWA 1TI1A 3GTUA 1WMJA 1I5GA 4XHMA 5G1KA 2F3MA 1FB6A 3IOSA 4I6XA 4BVXB 2HRAA 4TR4A 1J9BA 4YAVA 1SK0A 1JFUA 1X9SB 2VLTA 4EE0A 1Z6MA 1O85A 2O8VB 2VL9A 4HU9A 4ML1A 2WS2A 3C7MA 2DJ2A 4XRDA 3R2QA 5ECHB 4HU7A 4CY8A 5D9TA 5HFIA 2ES7A 10GSA 2O7KA 2VL3A 2IFQA 2IN3A 3M1GA 2YOIA 3TKQA 3F4TA 3H8QA 1F3AA 4YAPA 1V2AA 2LQOA 5KOXA 3FR3A 2EIQA 3DKSA 4WR5A 2FWHA 3Q6OA 3UVHA 2F8AA 2FCHA 1G6WA 1XWCA 1YQ1A 4PGTA 5IQYA 5A5KA 4NHWA 3HZ8A 2IMIA 5EPFA 2P31A 1TK0B 4FIWA 3QAVA 5CAXA 4EDZA 1EP7A 1MDIA 1T1VA 2B6MA 3H4KA 3TRPA 9GSSA 2KOKA 4EO3A 4V2NA 4E8EA 2DIYA 2MYGA 4ZBDA 2KLXA 5AIVA 5ECQB 1YEXA 1VF3A 4OFTA 4MH3A 4WXTA 5F05A 2AB6A 5CO3A 4K6XA 5E4WA 3VWXA 3L9SA 1OKTA 1X0RA 3DEXA 5IOXA 2L5LA 5KN1A 1BX9A 18GSA 3GIXA 4J57E 1LBKA 1ACVA 5KN2A 3H79A 7GSSA 4IGJA 3C1SA 5LNKe 4OCEA 5HR3A 3KH7A 5HFKA 4BPYA 3HY2A 2L4QA 3R3EA 3GL5A 1GUKA 1PA3A 3VPQA 4WR4A 2C8UA 2TRXA 2MMOA 2H6ZA 4POKA 1FAAA 2GSQA 4G9HA 2H30A 2E0QA 5IMFA 3F63A 3IBHA 5L71A 1BYEA 4L5OA 3PR8A 3TKPA 4KUNA 2H75A 3ME7A 5B6MA 4GXZA 1ZL9A 1QUWA 1S3CA 4GQCA 4NPBA 4TKYA 5JWRB 5DQYA 2DBCA 3EYTA 4JR4A 4MF7A 2ZUPA 1WRYA 3LYPA 1BAYA 2YWMA 2FLSA 2ZNMA 3RAZA 1O6JA 3ERGA 1JLVA 3L9UA 4NXIA 2TIRA 1TJDA 4K7IA 3PPUA 3TUEA 4AJ8A 2MZCA 3IA1A 3UL3A 4MP4A 3QOUA 3ZRDA 4RI6A 3EU3A 2C0EA 3GX8A 2B7KA 4HQSA 1G0TA 4MMMA 4CDOA 1YF1A 4F03A 3FRCA 4KSOA 4X4JA 3IAM2 3E9JB 2DMMA 4N0VA 5D93A 2QA2A 4ML6A 1OAZA 1JZRA 4POMA 4GCIA 4F2IA 2R0GA 3LXZA 5ECMB 3GNJA 2JACA 1A24A 2IWTA 4ISDA 2CVBA 2HLSA 4KDUA 1UA5A 4OO5A 1A2JA 2GS3A 2HRKA 2LJKA 2VCXA 4N10A 1ML6A 4MCUA 3FR6A 4KH7A 5A4VA 2L6DA 3A5WA 1ILOA 4IP1A 4EC0A 3M9JA 4OFNA 3KZQA 2JADA 5KN3A 2QC7A 1JLWA 2VLUA 2X64A 4K2DA 1A0RP 4OMVA 3FY7A 4KCAA 3APOA 4FQUA 4GRFA 1N2AA 1FO5A 1ZMAA 1TK8B 1PX6A 1OC8A 2GLRA 3P8WA 3D21A 3O3TA 5DCHA 2GZYA 1N8JA 1NHYA 3FKFA 1JHBA 3ZITA 2DJ1A 5DAKB 5LCZA 1MDKA 2N5AA 5AIXA 1G7OA 1Z3EA 3FZ5A 1TOFA 4KDXA 5ECNB 3CSJA 3GMFA 4G19A 4EXJA 2HYXA 1R26A 5IOWA 3LJRA 3U5RE 4L0WA 4TN8A 3HYPA 1B4PA 4XS4B 2AAWA 4IELA 3C1RA 3ZMKA 4O7HA 3GH9A 2R2JA 5DALA 6GSWA 2FUG2 2CV4A 2QA1A 1G7EA 3KP9A 4IVFA 1ERVA 3RHBA 1KTEA 3EWLA 5D9WA 3P2AA 2B1KA 2X8CA 5DJMA 1GLQA 3PH9A 2FY6A 2B1LA 1FVKA 1V9WA 4CW9A 1OC9A 3TJJA 1TP9A 5INYA 2YN1A 4G0KA 1A2MA 4GWRA 3FYGA 5A4WA 3VWUA 1M0UA 3BCIA 4JE1A 2J9HA 3MAKA 3CRTA 4PUAA 4LA1A 3F4SA 3IC4A 4KW6A 1QQ2A 3FMWA 2LRNA 3F6DA 3GKKA 5ABRA 4TR1B 2GGTA 4KGIA 1O8XA 3DVWA 2R3XA 4ECIA 4KDYA 3GFKA 2IMDA 2B5XA 3GV1A 1VGLA 2MBTA 1KBNA 1XWKA 4TXVA 5E59A 2DKIA 3GKMA 4V1Ag 3KMNA 2LSTA 3ZZXA 4DSRA 3Q19A 5IMDA 2H0HA 12GSA 2VCWA 1O8WA 4IJIA 4TVEA 4MNNA 2AYTA 4QQ7A 4KCEA 1JZDA 3I6AA 2N5FA 3GHAA 1OC3A 1XPVA 1PSQA 2PMTA 2CAQA 3LORA 2HZEB 5F8BA 4XS6A 1HYUA 3KEBA 2OADA 5J5NA 2LTKA 4J56E 1A0FA 1T8EB 1U3AA 2B5EA 4F0CA 1CQHA 1XVQA 3KCMA 2OJLA 3VK9A 4JBBA 4MH2A 2VLVA 5G5FA 3MYDA 2HXKA 2FA8A 1Z7RA 2LNSA 5ENUA 2YJHA 1EGRA 2DJ3A 4KSMA 2ALBA 2WJUA 4ZL7A 2H70A 4O32A 3EPTA 16GSA 4JEDA 4OWYA 1C72A 3GA4A 4HDEA 2YP6A 3C8EA 4GQFA 1OE7A 3H93A 1B9XC 4G2EA 4EKZA 4ZBAA 1SJ6A 2YWOA 3QFBC 1XFLA 5J3RA 3G7IA 1ZYPA 3QPMA 1XVWA 1QGVA 22GSA 2A4HA 2RUEA 2FWEA 4ZB9A 1YDKA 2OKAA 2XBIA 3KTBA 2HFDA 2C4JA 2BMXA 1U87A 4DSSB 2CVKA 3NIVA 4N11A 1TDIA 1XW6A 2VUPA 4BVYB 3DIEA 4PNFA 4IKHA 3TCOA 3KM6A 2PBJA 5CREA 2N5BA 1K3LA 5DQSA 4MJCA 3FZAA 3A2VA 1JZWA 2LRTA 2YV9A 3MWHA 5DCGA 3IK9A 1USBA 5FWGA 2LUSA 13GSA 4GF0A 1J0FA 1A8LA 1TRWA 2DC5A 3F8UA 1R4WA 2XPDA 5CNWA 5JCWA 4JU5A 1Y6EA 1BQ7A 4WF5A 4BL7B 4POLA 1BJXA 3DYRA 4G0IA 1R7HA 1FHEA 1FG4A 3W8JA 2EC4A 3KXOA 3UVTA 4TXOB 2P5RA 2BTOT 4GSTA 1EEJA 1F9MA 3TJGA 2GQKA 5J9BA 1TRUA 1X5CA 4H86A 4NV2A 3F3RA 1T3BA 1GLPA 2L59A 3M8NA 4GTUA 2ZCTA 20GSA 5CP1A 3G9BA 5BRTA 2X8HA 5ELAA 2PERA 1V58A 2CZ3A 2NPBA 4QL7A 4ACSA 4DVCA 5IO2A 4LL4B 1AUCA 3O6TA 3RPPA 3ZVJD 4Z2UA 2F9SA 4K2XA 1H75A 5B8AA 4HOJA 1GSUA 2PUKC 1PL1A 3TRQA 5H5QA 3FR9A 5HR1A 3QCPA 4NHZA 1EV9A 1W89A 3FK8A 2GSRA 2G2QA 3FEUA 5ECPB 5CYYA 1M9BA 2CAIA 3HA9A 3CXGA 1WWJA 2HE3A 1X5EA 6GSTA 2LJAA 1GNEA 4MPGA 1VRSD 3QDNA 3CRUA 4ID0A 2H01A 4PQ1A 1MEKA 3EINA 4I2TA 2H1DA 4KF9A 2V41A 3HHVA 4XTSA 5EVOA 1GSDA 2V6OA 1GUMA 1Z6NA 2ON7A 4P3YB 1SL0B 3CYNA 1MD3A 1MDJA 2IPAA 2QKEA 2HRNA 5H5RA 3HJOA 4EIPA 4YQVA 2XC2A 1GL8A 1TI3A 4PQIA 2LJRA 3ZREA 2VCVA 3HJPA 4MJBA 1OVNA 3HD5A 3RBTA 4Q5NA 3TJKA 2DLXA 4K5SA 1XCCA 2FWGA 5ECOB 5DAKA 2DSAA 3EVIA 1SKWB 3GYKA 1WJKA 3KD0A 3NZNA 1SKRB 3D4TA 3ME8A 2F8FA 1DE1A 3TOTA 1FOHA 4EL1A 2FWFA 4FH8A 3M9KA 4OFMA 3BCKA 4EUYA 5KEJA 1LJRA 4MF6A 4K0NA 2GZZA 4HEA2 5HQPA 3M3MA 3RHCA 4XRAA 3Q74A 4FYCA 2E2GA 3ZIJA 2H76A 5F07A 4KAEA 3J7Yb 4KX4A 4ICYA 5GSTA 1DSBA 2WB9A 3HKRA 2OE3A 3S9FA 4ECBA 3OR5A 1XXUA 4K0GA 1DBYA 2VAFA 2M72A 1EOGA 3IV4A 1F2EA 1SD8A 2H1BA 4GSNA 4TR3A 1T00A 4ECCA 3DMLA 2KHPA 1K0AA 1EOHA 2HSHA 3HVVA 2CZ2A 2CQ9A 4V2MA 2WDUA 3W8SA 2H71A 4TRXA 2ON5A 4OCFA 3VFIA 3E3EA 4AGSA 1R5PA 2YJ7A 6GSVA 1I9DA 4IW9A 3LFLA 3N9JA 2GT6A 4TR1A 1XIYA 3TJFA 1YKCA 2JZSA 3EC3A 2LKUA 4ZILA 1AAZA 4WBJA 2V32A 5H5SA 2G0FA 2A4VA 2H72A 3VWWA 2J23A 3WD6A 2VIMA 2KUCA 4TR0A 2HSYA 3CTGA 1SENA 1SJZA 1SL2B 2K9FA 3LGCA 3D22A 3BOAA 2GSTA 3HVXA 5LD0A 3QMXA 3GN3A 5G2ZA 4MJAA 1GTAA 3WT2A 2VM1A 2DJJA 2CX3A 1O7UA 1PX7A 2BJXA 3O76A 5J9CA 3F0IA 3SWLA 3GURA 1WP0A 4ECJA 1XBSA 2HZEA 2V1MA 2XHFA 4K8MA 2B7JA 5ID2B 2X49A 2B5YA 1WOUA 1ZYEA 1TK5B 2GVPA 3P90A 1YKAA 3ERWA 1FVJA 3TOUA 3W6GA 2RLIA 3EURA 4IS0A 5CRGA 1SKSB 3ZFLA 3CSHA 4ZL9A 1T7PB 1A23A 5COHA 4L0UA 2H6YA 1Z7PA 2LS5A 4TOPA 3TGZA 1O81A 3US3A 3UAPA 1FW1A 5G31A 1YEPA 3KGKA 3IXRA 4LMVA 3I69A 4MPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJM A;  5HR2 A;  2KP2 A;  3UAR A;  4DSQ A;  1XWG A;  1U3I A;  3UBL A;  4O92 A;  1AQW A;  1W4V A;  3HZ4 A;  1T4Z A;  1TRS A;  2NDO A;  5ECK B;  2E7P A;  1MD4 A;  2RII A;  2EIR A;  3DGQ A;  1PKZ A;  1NHO A;  2R5G A;  3BJ5 A;  2H1A A;  2LNT A;  4MZW A;  3PGT A;  3CSI A;  1SK1 A;  5B7C A;  3A3T A;  3TJB A;  3L78 A;  4DSS A;  2NBS A;  3D5J A;  1K3Y A;  2LRC A;  1FB0 A;  1VF1 A;  2H74 A;  1GNW A;  5C00 A;  4BVY A;  1QK8 A;  2CVD A;  1UVZ A;  2I1U A;  1ZCP A;  2V6K A;  2DJK A;  6GSS A;  4PUR A;  1IYI A;  5JWO B;  3VI5 A;  3HCZ A;  3BD2 A;  4D73 B;  5CRD A;  1SYR A;  1GUH A;  4GLT A;  2PGT A;  4BWS A;  5D9X A;  3FZ4 A;  2A2R A;  4YQM A;  2EIO A;  4BVX A;  3BBY A;  5IPH A;  1RK4 A;  1GTI A;  1SJI A;  1F3B A;  2C1Y A;  5IMA A;  5GAN D;  1GSE A;  4PX1 A;  4BL7 A;  4EDY A;  1K3O A;  1B4Q A;  3UIW A;  3CTF A;  5DVB A;  1URM A;  4K9Z A;  2JZR A;  1PD2 1;  3ERF A;  2C3N A;  1SK2 A;  4TXO A;  14GS A;  2QSI A;  3WGD A;  3IHQ A;  1K0D A;  1B8X A;  1AW9 A;  3FHK A;  2P5Q A;  4HJ2 A;  5J41 A;  4HZ4 A;  2I3Y A;  5D9V A;  1JZO A;  4WBR D;  6GSY A;  3ZL5 A;  3DWV A;  5J4U A;  2C3Q A;  3KP8 A;  4OD7 A;  3ZML A;  5C04 A;  3F6F A;  1A8Y A;  2H19 A;  2P0G A;  4CHS A;  4MJE A;  4WEY A;  4XCS A;  5G30 A;  1EEM A;  1H4O A;  2YNX A;  5A4U A;  11GS A;  4PQH A;  2VCQ A;  4NV5 A;  2MMZ A;  3HDC A;  1X9W B;  1GRX A;  5IMV A;  2AJQ B;  3WGX A;  3ZFB A;  1ON4 A;  2L57 A;  2C0G A;  1KNG A;  2QGV A;  1GTU A;  5GZZ B;  5GAP D;  5AN1 A;  1TXX A;  1M2A A;  2YWN A;  5IMZ A;  3VLN A;  2RUF A;  1F6M C;  1WIK A;  4RUV A;  3QD9 A;  3GX0 A;  2MBS A;  3TB2 A;  2KP1 A;  3ZTL A;  4Q5Q A;  2L4C A;  3H1N A;  4ULX A;  1PQN A;  4MK3 A;  4F82 A;  2E2M A;  2LEG A;  1EP8 A;  2X99 A;  3QAG A;  3LWA A;  2WZ9 A;  5B6N A;  1RQM A;  3GH6 A;  2PU9 C;  1VF4 A;  2NVL A;  5ECR B;  2FA4 A;  5ELG A;  1K0C A;  4MZC A;  2LQQ A;  2TRC P;  4LL1 B;  3ED3 A;  1NW2 A;  2PN8 A;  1K0O A;  2O87 A;  3MSZ A;  1SD9 A;  2D2Z A;  1IYH A;  1GH2 A;  1YZX A;  4NMU A;  6GSX A;  4WKW A;  5JCG A;  2JU5 A;  3I9V 2;  2REM A;  4MLY A;  1CQG A;  1SU9 A;  2K6V A;  5HFG A;  1WE0 A;  3G7J A;  3TKS C;  2PVQ A;  1GSQ A;  1YF0 A;  2Z9S A;  1WPI A;  4F0B A;  4ZB8 A;  3LQ7 A;  2IJY A;  4F9Z A;  4V2L A;  4JR6 A;  1UC7 A;  2IME A;  4KE3 A;  5HR0 A;  2VCT A;  1GP1 A;  3UBK A;  2C0F A;  3FZ9 A;  1HNB A;  2K8V A;  3P7X A;  1TKD B;  2M46 A;  4MDC A;  1GSY A;  1THO A;  4LMW A;  2M80 A;  1SL1 B;  2GTU A;  3J7Y k;  3RPN A;  3KJY A;  3WYW A;  2RM6 A;  4POB A;  1M7T A;  3QFA C;  3G7Y A;  3D4M A;  3TKS A;  3D6I A;  2L6C A;  3U6V A;  5B8B A;  3D0Z A;  1BED A;  4I2U A;  1U88 A;  2PPT A;  3CMI A;  2OBI A;  1M2B A;  3TRX A;  4HQZ A;  3KIJ A;  2VM2 A;  2F51 A;  1BG5 A;  3EE2 A;  3ZIV A;  3LSZ A;  1S3A A;  3GKX A;  4ZIJ A;  2GQM A;  5DBQ A;  3EMP A;  4HI7 A;  3AY8 A;  2CX4 A;  3A2X A;  1ZYQ B;  4YH2 A;  4JRR A;  4L5L A;  3GTU B;  4FYB A;  4X1U A;  4PUF C;  3N5O A;  1Z9H A;  4G10 A;  5EL8 A;  4AJ7 A;  2IIY A;  3LYK A;  1GUL A;  4MAB A;  4XS1 A;  4Q5F A;  4ZB6 A;  4IQA A;  2I9H A;  2AUV A;  3F4R A;  2L5O A;  4K7O A;  3EU4 A;  1EZK A;  3UMA A;  1XWA A;  1M9A A;  4RQX A;  1V40 A;  1X5D A;  4ZXG A;  1ZOF A;  4K7N A;  3QAW A;  4XIH A;  3UJ1 A;  4DEJ A;  2IFQ B;  1PMT A;  2HNL A;  1OE8 A;  2YWI A;  1TU7 A;  5D96 A;  2HI7 A;  3LEF A;  3K8N A;  5G1L A;  1E6B A;  4QL9 A;  2HRF A;  5F06 A;  4EVM A;  3C73 A;  3UOM A;  3QR6 A;  1ERT A;  4N30 A;  1LU4 A;  3Q18 A;  2RM5 A;  4XS4 A;  2JSY A;  3TDG A;  2VOC A;  3IK7 A;  3VUR A;  5ID2 A;  4RQR A;  1Q98 A;  2IL3 A;  2VCZ A;  1Q4J A;  2H0I A;  1ZZY A;  2H8L A;  3EMX A;  2GQL A;  3DD3 A;  4PXO A;  1PN9 A;  5AIS A;  2FHE A;  3VI7 A;  1NSW A;  5CRW A;  5JWQ B;  1XW9 A;  1TU8 A;  1PGT A;  1UN2 A;  2VD1 A;  2YZU A;  1PKW A;  3RDW A;  2FD3 A;  4NWY A;  4JZQ A;  3A2W A;  3GKN A;  4YQU A;  2OE0 A;  1TRV A;  4ZBB A;  2PVO C;  3HVS A;  2VO4 A;  1QMV A;  3GUS A;  1TW9 A;  3UEM A;  1M99 A;  4EF0 A;  2FGX A;  2I4A A;  3IRA A;  1AIU A;  1QXH A;  5ECS A;  4FYU A;  2WFC A;  3ZVJ A;  4MA9 A;  2O89 A;  4KB3 A;  3V1W A;  1GWC A;  2MMA A;  2C3T A;  2H73 A;  5ECL B;  1PL2 A;  1EGO A;  3HXS A;  4IJ3 A;  2H1G A;  3MDK A;  1Z5Y E;  8GSS A;  4LLR A;  4X0X A;  1EV4 A;  1T4Y A;  4KA0 A;  1HNA A;  2K8S A;  2R4V A;  2OBK A;  2LV3 A;  1K0N A;  2H6X A;  3APS A;  1U6T A;  2JSZ A;  3NOF A;  4IQ1 A;  2AHE A;  4D73 A;  2B3S A;  4N0Z A;  5GSS A;  2R6K A;  1ZGN A;  3KH9 A;  4MZB A;  17GS A;  1G6Y A;  4I8B A;  5G5E A;  2V2G A;  4BWQ A;  3ZYW A;  1RW1 A;  1HQO A;  1KEB A;  2OAC A;  2NTO A;  3SBC A;  2XPE A;  1O73 A;  1PRX A;  1E2Y A;  5EY6 A;  3FW2 A;  2FNO A;  5IO0 A;  2XBQ A;  2O85 A;  2H66 A;  3APQ A;  1AQX A;  1XWB A;  3LXT A;  1GTB A;  1MTC A;  1V57 A;  2OE1 A;  1AQV A;  4WET A;  4IP6 A;  4E8H A;  4HZ2 A;  1XOA A;  2IMK A;  1HNC A;  1QFN A;  2AV4 A;  4TW5 A;  1B48 A;  1AC1 A;  4Z7X A;  1FOV A;  3I43 A;  4KND A;  4BA7 A;  1R5A A;  5CRH A;  1ABA A;  1HD2 A;  3GSS A;  5FT3 A;  1YY7 A;  4AF2 A;  1ERU A;  2C80 A;  3WGE A;  4FO5 A;  1S3D A;  5KN0 A;  3ISO A;  2IMF A;  2VL2 C;  4L8E A;  4HUA A;  5IPG A;  5ECI B;  4K1F A;  1F37 A;  5DJL A;  2YPM A;  2DIZ A;  1TTZ A;  3IE3 A;  1ST9 A;  1YJ6 A;  3L4N A;  2YCD A;  1DUG A;  4ZL8 A;  3GST A;  1GSF A;  1B9Y C;  3L9V A;  3TKS E;  2HT9 A;  1GSS A;  1M2D A;  5IIZ A;  4I5Q A;  3IDV A;  1OKD A;  4IHU A;  3F3Q A;  2YV7 A;  4V1A p;  3CBU A;  4X43 A;  2JZT A;  3MNG A;  4ILF A;  6GSU A;  2WUL A;  4RI7 A;  2PWJ A;  5FHI A;  5AGY A;  1XZO A;  1K0B A;  2C0D A;  3IAS 2;  19GS A;  2WRT A;  1AXD A;  1A2L A;  2K18 A;  3M0F A;  2HZF A;  4O5R A;  2MMN A;  2DJ0 A;  2VL2 A;  4HS1 A;  5JCU A;  2WCI A;  5DAL B;  1K0M A;  5IMC A;  3IPZ A;  2CT6 A;  4Q5R A;  5IM9 A;  1DE2 A;  2GDR A;  5D8I A;  3KMO A;  3IR4 A;  3LG6 A;  2JL4 A;  2YAN A;  4MF5 A;  5F0G A;  1THX A;  3F9U A;  2OA7 A;  2X8G A;  3TKR A;  1OC9 B;  2DML A;  2YZH A;  1X9M B;  1V98 A;  2H0G A;  4IN0 A;  4NAX A;  2CA8 A;  3VPT A;  4PNG A;  3E0U A;  4J2F A;  3WT1 A;  4AJ6 A;  3GL3 A;  3ZLP A;  3PIN A;  1VF2 A;  2GZP A;  1XW5 A;  1NM3 A;  3DRN A;  4OO4 A;  1OYJ A;  2GT5 A;  3GRX A;  4WF4 A;  3DVX A;  2R37 A;  4IBP A;  3KTL A;  5DDL A;  1EWX A;  3L0H A;  1Y25 A;  4HJM A;  3JCM L;  4GSS A;  2GSS A;  1SYX A;  3C71 A;  2A2S A;  2WGR A;  2I81 A;  1J08 A;  3DXB A;  4I97 A;  3VWV A;  1XOB A;  2VD0 A;  5D73 A;  1ERW A;  1TI1 A;  3GTU A;  1WMJ A;  1I5G A;  4XHM A;  5G1K A;  2F3M A;  1FB6 A;  3IOS A;  4I6X A;  4TR4 A;  1J9B A;  4YAV A;  1SK0 A;  1JFU A;  1X9S B;  2VLT A;  4EE0 A;  1Z6M A;  1O85 A;  2O8V B;  2VL9 A;  4HU9 A;  4ML1 A;  2WS2 A;  3C7M A;  2DJ2 A;  4XRD A;  3R2Q A;  5ECH B;  4HU7 A;  5D9T A;  5HFI A;  2ES7 A;  10GS A;  2O7K A;  2VL3 A;  2IFQ A;  2IN3 A;  3M1G A;  2YOI A;  3TKQ A;  3F4T A;  3H8Q A;  1F3A A;  4YAP A;  1V2A A;  2LQO A;  3FR3 A;  2EIQ A;  3DKS A;  4WR5 A;  2FWH A;  3Q6O A;  3UVH A;  2F8A A;  2FCH A;  1G6W A;  1XWC A;  1YQ1 A;  4PGT A;  5IQY A;  5A5K A;  4NHW A;  3HZ8 A;  2IMI A;  5EPF A;  2P31 A;  1TK0 B;  4FIW A;  3QAV A;  5CAX A;  4EDZ A;  1EP7 A;  1MDI A;  1T1V A;  2B6M A;  3H4K A;  3TRP A;  9GSS A;  2KOK A;  4EO3 A;  4V2N A;  4E8E A;  2DIY A;  2MYG A;  4ZBD A;  2KLX A;  5AIV A;  5ECQ B;  1YEX A;  1VF3 A;  4OFT A;  4MH3 A;  4WXT A;  5F05 A;  2AB6 A;  5CO3 A;  4K6X A;  5E4W A;  3VWX A;  3L9S A;  1OKT A;  1X0R A;  3DEX A;  5IOX A;  2L5L A;  5KN1 A;  1BX9 A;  18GS A;  3GIX A;  4J57 E;  1LBK A;  1ACV A;  5KN2 A;  3H79 A;  7GSS A;  4IGJ A;  3C1S A;  5LNK e;  4OCE A;  5HR3 A;  3KH7 A;  5HFK A;  4BPY A;  3HY2 A;  2L4Q A;  3GL5 A;  1GUK A;  1PA3 A;  3VPQ A;  4WR4 A;  2C8U A;  2TRX A;  2MMO A;  2H6Z A;  4POK A;  1FAA A;  2GSQ A;  4G9H A;  2H30 A;  2E0Q A;  5IMF A;  3F63 A;  3IBH A;  5L71 A;  1BYE A;  4L5O A;  3PR8 A;  3TKP A;  4KUN A;  2H75 A;  3ME7 A;  5B6M A;  4GXZ A;  1ZL9 A;  1QUW A;  1S3C A;  4GQC A;  4NPB A;  4TKY A;  5JWR B;  5DQY A;  2DBC A;  3EYT A;  4JR4 A;  4MF7 A;  2ZUP A;  1WRY A;  3LYP A;  1BAY A;  2YWM A;  2FLS A;  2ZNM A;  3RAZ A;  1O6J A;  3ERG A;  1JLV A;  3L9U A;  4NXI A;  2TIR A;  1TJD A;  4K7I A;  3TUE A;  4AJ8 A;  2MZC A;  3IA1 A;  3UL3 A;  4MP4 A;  3QOU A;  3ZRD A;  4RI6 A;  3EU3 A;  2C0E A;  3GX8 A;  2B7K A;  4HQS A;  1G0T A;  4MMM A;  4CDO A;  1YF1 A;  4F03 A;  3FRC A;  4KSO A;  3IAM 2;  3E9J B;  2DMM A;  4N0V A;  5D93 A;  4ML6 A;  1OAZ A;  1JZR A;  4POM A;  4GCI A;  4F2I A;  3LXZ A;  5ECM B;  3GNJ A;  2JAC A;  1A24 A;  2IWT A;  4ISD A;  2CVB A;  2HLS A;  4KDU A;  1UA5 A;  4OO5 A;  1A2J A;  2GS3 A;  2LJK A;  2VCX A;  4N10 A;  1ML6 A;  4MCU A;  3FR6 A;  4KH7 A;  5A4V A;  2L6D A;  3A5W A;  1ILO A;  4IP1 A;  4EC0 A;  3M9J A;  4OFN A;  3KZQ A;  2JAD A;  5KN3 A;  2QC7 A;  1JLW A;  2VLU A;  2X64 A;  4K2D A;  1A0R P;  4OMV A;  3FY7 A;  4KCA A;  3APO A;  4GRF A;  1N2A A;  1FO5 A;  1ZMA A;  1TK8 B;  1PX6 A;  1OC8 A;  2GLR A;  3P8W A;  3D21 A;  3O3T A;  5DCH A;  2GZY A;  1N8J A;  1NHY A;  3FKF A;  1JHB A;  3ZIT A;  2DJ1 A;  5DAK B;  5LCZ A;  1MDK A;  2N5A A;  5AIX A;  1G7O A;  1Z3E A;  3FZ5 A;  1TOF A;  4KDX A;  5ECN B;  3CSJ A;  3GMF A;  4G19 A;  4EXJ A;  2HYX A;  1R26 A;  5IOW A;  3LJR A;  3U5R E;  4L0W A;  4TN8 A;  3HYP A;  1B4P A;  4XS4 B;  2AAW A;  4IEL A;  3C1R A;  3ZMK A;  4O7H A;  3GH9 A;  2R2J A;  5DAL A;  6GSW A;  2FUG 2;  2CV4 A;  1G7E A;  3KP9 A;  4IVF A;  1ERV A;  3RHB A;  1KTE A;  3EWL A;  5D9W A;  3P2A A;  2B1K A;  2X8C A;  5DJM A;  1GLQ A;  3PH9 A;  2FY6 A;  2B1L A;  1FVK A;  1V9W A;  4CW9 A;  1OC9 A;  3TJJ A;  1TP9 A;  5INY A;  2YN1 A;  1A2M A;  4GWR A;  3FYG A;  5A4W A;  3VWU A;  1M0U A;  3BCI A;  4JE1 A;  2J9H A;  3MAK A;  3CRT A;  4PUA A;  4LA1 A;  3F4S A;  3IC4 A;  4KW6 A;  1QQ2 A;  2LRN A;  3F6D A;  3GKK A;  5ABR A;  4TR1 B;  2GGT A;  4KGI A;  1O8X A;  3DVW A;  2R3X A;  4ECI A;  4KDY A;  3GFK A;  2IMD A;  2B5X A;  3GV1 A;  1VGL A;  2MBT A;  1KBN A;  1XWK A;  4TXV A;  5E59 A;  3GKM A;  4V1A g;  3KMN A;  2LST A;  3ZZX A;  4DSR A;  3Q19 A;  5IMD A;  2H0H A;  12GS A;  2VCW A;  1O8W A;  4IJI A;  4TVE A;  2AYT A;  4QQ7 A;  4KCE A;  1JZD A;  3I6A A;  2N5F A;  3GHA A;  1OC3 A;  1XPV A;  1PSQ A;  2PMT A;  2CAQ A;  3LOR A;  2HZE B;  5F8B A;  4XS6 A;  1HYU A;  3KEB A;  2OAD A;  5J5N A;  2LTK A;  4J56 E;  1A0F A;  1T8E B;  1U3A A;  2B5E A;  4F0C A;  1CQH A;  1XVQ A;  3KCM A;  2OJL A;  3VK9 A;  4JBB A;  4MH2 A;  2VLV A;  5G5F A;  2HXK A;  2FA8 A;  1Z7R A;  2LNS A;  5ENU A;  2YJH A;  1EGR A;  2DJ3 A;  4KSM A;  2ALB A;  2WJU A;  4ZL7 A;  2H70 A;  4O32 A;  16GS A;  4JED A;  4OWY A;  1C72 A;  3GA4 A;  4HDE A;  2YP6 A;  3C8E A;  4GQF A;  1OE7 A;  3H93 A;  1B9X C;  4G2E A;  4EKZ A;  4ZBA A;  1SJ6 A;  2YWO A;  3QFB C;  1XFL A;  5J3R A;  3G7I A;  3QPM A;  1XVW A;  1QGV A;  22GS A;  2RUE A;  2FWE A;  4ZB9 A;  1YDK A;  2OKA A;  2XBI A;  3KTB A;  2HFD A;  2C4J A;  2BMX A;  1U87 A;  4DSS B;  2CVK A;  3NIV A;  4N11 A;  1TDI A;  1XW6 A;  2VUP A;  3DIE A;  4PNF A;  4IKH A;  3TCO A;  3KM6 A;  2PBJ A;  5CRE A;  2N5B A;  1K3L A;  5DQS A;  4MJC A;  3FZA A;  3A2V A;  1JZW A;  2LRT A;  2YV9 A;  3MWH A;  5DCG A;  3IK9 A;  1USB A;  5FWG A;  2LUS A;  13GS A;  4GF0 A;  1J0F A;  1A8L A;  1TRW A;  2DC5 A;  3F8U A;  1R4W A;  2XPD A;  5CNW A;  5JCW A;  4JU5 A;  1Y6E A;  1BQ7 A;  4WF5 A;  4POL A;  1BJX A;  3DYR A;  1R7H A;  1FHE A;  1FG4 A;  3W8J A;  2EC4 A;  3KXO A;  3UVT A;  4TXO B;  2P5R A;  2BTO T;  4GST A;  1EEJ A;  1F9M A;  3TJG A;  2GQK A;  5J9B A;  1TRU A;  1X5C A;  4H86 A;  4NV2 A;  3F3R A;  1T3B A;  1GLP A;  2L59 A;  3M8N A;  4GTU A;  2ZCT A;  20GS A;  5CP1 A;  3G9B A;  2X8H A;  5ELA A;  2PER A;  1V58 A;  2CZ3 A;  2NPB A;  4QL7 A;  4ACS A;  4DVC A;  5IO2 A;  4LL4 B;  1AUC A;  3O6T A;  3RPP A;  3ZVJ D;  2F9S A;  1H75 A;  5B8A A;  4HOJ A;  1GSU A;  2PUK C;  1PL1 A;  3TRQ A;  5H5Q A;  3FR9 A;  5HR1 A;  3QCP A;  4NHZ A;  1EV9 A;  1W89 A;  3FK8 A;  2GSR A;  2G2Q A;  3FEU A;  5ECP B;  5CYY A;  1M9B A;  2CAI A;  3HA9 A;  3CXG A;  1WWJ A;  2HE3 A;  1X5E A;  6GST A;  2LJA A;  1GNE A;  4MPG A;  1VRS D;  3QDN A;  3CRU A;  4ID0 A;  2H01 A;  4PQ1 A;  1MEK A;  3EIN A;  4I2T A;  2H1D A;  2V41 A;  3HHV A;  4XTS A;  5EVO A;  1GSD A;  2V6O A;  1GUM A;  1Z6N A;  2ON7 A;  4P3Y B;  1SL0 B;  3CYN A;  1MD3 A;  1MDJ A;  2IPA A;  2QKE A;  2HRN A;  5H5R A;  3HJO A;  4YQV A;  2XC2 A;  1GL8 A;  1TI3 A;  4PQI A;  2LJR A;  3ZRE A;  2VCV A;  3HJP A;  4MJB A;  1OVN A;  3HD5 A;  3RBT A;  4Q5N A;  3TJK A;  2DLX A;  1XCC A;  2FWG A;  5ECO B;  5DAK A;  2DSA A;  3EVI A;  1SKW B;  3GYK A;  1WJK A;  3KD0 A;  3NZN A;  1SKR B;  3D4T A;  3ME8 A;  2F8F A;  1DE1 A;  3TOT A;  4EL1 A;  2FWF A;  4FH8 A;  3M9K A;  4OFM A;  3BCK A;  4EUY A;  5KEJ A;  1LJR A;  4MF6 A;  4K0N A;  2GZZ A;  4HEA 2;  5HQP A;  3M3M A;  3RHC A;  4XRA A;  3Q74 A;  4FYC A;  2E2G A;  3ZIJ A;  2H76 A;  5F07 A;  4KAE A;  3J7Y b;  4KX4 A;  5GST A;  1DSB A;  2WB9 A;  3HKR A;  2OE3 A;  3S9F A;  4ECB A;  3OR5 A;  1XXU A;  4K0G A;  1DBY A;  2VAF A;  2M72 A;  1EOG A;  3IV4 A;  1F2E A;  1SD8 A;  2H1B A;  4GSN A;  4TR3 A;  1T00 A;  4ECC A;  3DML A;  2KHP A;  1K0A A;  1EOH A;  2HSH A;  3HVV A;  2CZ2 A;  2CQ9 A;  4V2M A;  2WDU A;  3W8S A;  2H71 A;  4TRX A;  2ON5 A;  4OCF A;  3VFI A;  3E3E A;  4AGS A;  1R5P A;  2YJ7 A;  6GSV A;  1I9D A;  4IW9 A;  3LFL A;  3N9J A;  2GT6 A;  4TR1 A;  1XIY A;  3TJF A;  1YKC A;  2JZS A;  3EC3 A;  2LKU A;  4ZIL A;  1AAZ A;  4WBJ A;  2V32 A;  5H5S A;  2G0F A;  2A4V A;  2H72 A;  3VWW A;  2J23 A;  3WD6 A;  2VIM A;  2KUC A;  4TR0 A;  2HSY A;  3CTG A;  1SEN A;  1SJZ A;  1SL2 B;  2K9F A;  3LGC A;  3D22 A;  3BOA A;  2GST A;  3HVX A;  5LD0 A;  3QMX A;  3GN3 A;  5G2Z A;  4MJA A;  1GTA A;  3WT2 A;  2VM1 A;  2DJJ A;  2CX3 A;  1O7U A;  1PX7 A;  2BJX A;  3O76 A;  5J9C A;  3F0I A;  3SWL A;  3GUR A;  1WP0 A;  4ECJ A;  1XBS A;  2HZE A;  2V1M A;  2XHF A;  4K8M A;  2B7J A;  5ID2 B;  2B5Y A;  1WOU A;  1ZYE A;  1TK5 B;  2GVP A;  3P90 A;  1YKA A;  3ERW A;  1FVJ A;  3TOU A;  3W6G A;  2RLI A;  3EUR A;  4IS0 A;  5CRG A;  1SKS B;  3ZFL A;  3CSH A;  4ZL9 A;  1T7P B;  1A23 A;  5COH A;  4L0U A;  2H6Y A;  1Z7P A;  2LS5 A;  4TOP A;  3TGZ A;  1O81 A;  3US3 A;  3UAP A;  1FW1 A;  5G31 A;  1YEP A;  3KGK A;  3IXR A;  4LMV A;  3I69 A;  4MPF A; 
#chains in the Genus database with same CATH topology
 3HJM A;  5HR2 A;  2KP2 A;  3UAR A;  4DSQ A;  1XWG A;  1U3I A;  3UBL A;  4O92 A;  1AQW A;  1W4V A;  3HZ4 A;  1T4Z A;  1TRS A;  2NDO A;  5ECK B;  2E7P A;  1MD4 A;  2RII A;  2EIR A;  1S3R A;  3DGQ A;  1PKZ A;  1NHO A;  2R5G A;  3BJ5 A;  2H1A A;  2LNT A;  4MZW A;  3PGT A;  3CSI A;  1SK1 A;  5B7C A;  3A3T A;  3TJB A;  3L78 A;  4DSS A;  2NBS A;  3D5J A;  1K3Y A;  2LRC A;  1FB0 A;  1VF1 A;  2H74 A;  1GNW A;  5C00 A;  4BVY A;  1QK8 A;  2CVD A;  1UVZ A;  2I1U A;  1ZCP A;  2V6K A;  2DJK A;  6GSS A;  4PUR A;  1IYI A;  5JWO B;  3VI5 A;  3HCZ A;  3BD2 A;  4D73 B;  5CRD A;  1SYR A;  1GUH A;  4GLT A;  2PGT A;  4BWS A;  5D9X A;  3FZ4 A;  2A2R A;  4YQM A;  2EIO A;  4BVX A;  3BBY A;  5IPH A;  1RK4 A;  1GTI A;  1SJI A;  1F3B A;  2C1Y A;  5IMA A;  5GAN D;  1GSE A;  4PX1 A;  4BL7 A;  4EDY A;  1K3O A;  1B4Q A;  3UIW A;  3CTF A;  5DVB A;  1URM A;  4K9Z A;  2JZR A;  1PD2 1;  3ERF A;  2C3N A;  1SK2 A;  4TXO A;  14GS A;  2QSI A;  3WGD A;  3IHQ A;  1K0D A;  1B8X A;  1AW9 A;  3FHK A;  2P5Q A;  4HJ2 A;  5J41 A;  4HZ4 A;  2I3Y A;  5D9V A;  1JZO A;  4WBR D;  6GSY A;  3ZL5 A;  3DWV A;  5J4U A;  2C3Q A;  3KP8 A;  4OD7 A;  3ZML A;  5C04 A;  3F6F A;  1A8Y A;  2H19 A;  2P0G A;  4CHS A;  4HSC X;  4MJE A;  4WEY A;  4XCS A;  5G30 A;  4YKG A;  1EEM A;  1H4O A;  2YNX A;  5A4U A;  11GS A;  4PQH A;  2VCQ A;  4NV5 A;  2MMZ A;  3HDC A;  1X9W B;  1GRX A;  5IMV A;  2AJQ B;  3WGX A;  3ZFB A;  1ON4 A;  2L57 A;  2C0G A;  1KNG A;  2QGV A;  1GTU A;  5GZZ B;  5GAP D;  5AN1 A;  1TXX A;  1M2A A;  2YWN A;  5IMZ A;  3VLN A;  2RUF A;  1F6M C;  1WIK A;  3LW9 A;  4RUV A;  3QD9 A;  3GX0 A;  2MBS A;  3TB2 A;  2KP1 A;  3ZTL A;  4Q5Q A;  2L4C A;  3H1N A;  4ULX A;  1PQN A;  4MK3 A;  4F82 A;  2E2M A;  2LEG A;  1EP8 A;  2X99 A;  3QAG A;  3LWA A;  2WZ9 A;  5B6N A;  2A2P A;  1RQM A;  3GH6 A;  2PU9 C;  1VF4 A;  2NVL A;  5ECR B;  2FA4 A;  5ELG A;  1K0C A;  4MZC A;  2LQQ A;  2TRC P;  4LL1 B;  3ED3 A;  1NW2 A;  2PN8 A;  1K0O A;  2O87 A;  3MSZ A;  1SD9 A;  2D2Z A;  1IYH A;  1GH2 A;  1YZX A;  4NMU A;  6GSX A;  3A5I A;  4WKW A;  5JCG A;  2JU5 A;  3I9V 2;  2REM A;  4MLY A;  1CQG A;  1SU9 A;  2K6V A;  5HFG A;  1WE0 A;  3G7J A;  3TKS C;  2PVQ A;  1GSQ A;  1YF0 A;  2Z9S A;  1WPI A;  4F0B A;  4ZB8 A;  3LQ7 A;  2IJY A;  4F9Z A;  4V2L A;  4JR6 A;  1UC7 A;  2IME A;  4K5R A;  4KE3 A;  5HR0 A;  2VCT A;  1GP1 A;  3UBK A;  4EIQ A;  2C0F A;  3FZ9 A;  1HNB A;  2K8V A;  3P7X A;  1TKD B;  2M46 A;  4MDC A;  1GSY A;  1THO A;  3HVN A;  4LMW A;  2M80 A;  1SL1 B;  2GTU A;  3J7Y k;  3RPN A;  3KJY A;  3WYW A;  2RM6 A;  4POB A;  1M7T A;  3QFA C;  3G7Y A;  3D4M A;  3TKS A;  3D6I A;  2L6C A;  3U6V A;  5B8B A;  3D0Z A;  1BED A;  4I2U A;  1U88 A;  2PPT A;  3CMI A;  2OBI A;  1M2B A;  3TRX A;  4HQZ A;  3KIJ A;  2VM2 A;  2F51 A;  1BG5 A;  3EE2 A;  3ZIV A;  3LSZ A;  1S3A A;  3GKX A;  4ZIJ A;  2GQM A;  5DBQ A;  3EMP A;  4HI7 A;  3AY8 A;  2CX4 A;  3A2X A;  1ZYQ B;  4YH2 A;  4JRR A;  4L5L A;  3GTU B;  4FYB A;  4X1U A;  4PUF C;  3N5O A;  1Z9H A;  4G10 A;  5EL8 A;  4AJ7 A;  1ZYN A;  2IIY A;  3LYK A;  1GUL A;  4MAB A;  4XS1 A;  4Q5F A;  4ZB6 A;  4IQA A;  2I9H A;  2AUV A;  3F4R A;  2L5O A;  4K7O A;  3EU4 A;  1EZK A;  3UMA A;  1XWA A;  1M9A A;  4RQX A;  1V40 A;  1X5D A;  4ZXG A;  1ZOF A;  4K7N A;  3QAW A;  4XIH A;  3UJ1 A;  4DEJ A;  2IFQ B;  1PMT A;  2HNL A;  1OE8 A;  2YWI A;  1TU7 A;  5D96 A;  2HI7 A;  3LEF A;  3K8N A;  5G1L A;  1E6B A;  4QL9 A;  2HRF A;  5F06 A;  4EVM A;  3C73 A;  3UOM A;  3QR6 A;  1ERT A;  4N30 A;  1LU4 A;  3Q18 A;  2RM5 A;  4XS4 A;  2JSY A;  3TDG A;  2VOC A;  3IK7 A;  1M3I A;  3VUR A;  5ID2 A;  4RQR A;  4Z2T A;  1Q98 A;  2IL3 A;  2VCZ A;  1Q4J A;  2H0I A;  4CY6 A;  1ZZY A;  2H8L A;  3EMX A;  2GQL A;  2R0P A;  3DD3 A;  4PXO A;  1PN9 A;  5AIS A;  2FHE A;  3VI7 A;  1NSW A;  5CRW A;  5JWQ B;  1XW9 A;  1TU8 A;  1PGT A;  1UN2 A;  2VD1 A;  2YZU A;  1PKW A;  4O5U A;  3RDW A;  2FD3 A;  4NWY A;  4JZQ A;  3A2W A;  3GKN A;  4YQU A;  2OE0 A;  1TRV A;  4ZBB A;  2PVO C;  3HVS A;  2VO4 A;  1QMV A;  3GUS A;  1TW9 A;  3UEM A;  1M99 A;  4EF0 A;  2FGX A;  2I4A A;  3IRA A;  1AIU A;  1QXH A;  5ECS A;  4FYU A;  2WFC A;  3ZVJ A;  4MA9 A;  2O89 A;  4KB3 A;  3V1W A;  1GWC A;  2MMA A;  2C3T A;  2H73 A;  5ECL B;  1PL2 A;  4USS A;  1EGO A;  3HXS A;  4IJ3 A;  2H1G A;  3MDK A;  1Z5Y E;  8GSS A;  4LLR A;  4G0L A;  3MIX A;  4X0X A;  1EV4 A;  4BIK A;  1T4Y A;  3IHG A;  4KA0 A;  1HNA A;  2K8S A;  2R4V A;  2OBK A;  2LV3 A;  1K0N A;  2H6X A;  3APS A;  1U6T A;  2JSZ A;  3NOF A;  4IQ1 A;  2AHE A;  4D73 A;  2B3S A;  4N0Z A;  5GSS A;  2R6K A;  1ZGN A;  3KH9 A;  4MZB A;  17GS A;  1G6Y A;  5KOW A;  4I8B A;  5G5E A;  2V2G A;  4BWQ A;  3ZYW A;  1RW1 A;  1HQO A;  1KEB A;  2OAC A;  2NTO A;  3SBC A;  2XPE A;  1O73 A;  1PRX A;  3IC8 A;  1E2Y A;  5EY6 A;  3FW2 A;  2FNO A;  5IO0 A;  2XBQ A;  2O85 A;  2H66 A;  3APQ A;  4YKF A;  1AQX A;  1XWB A;  3LXT A;  1GTB A;  1MTC A;  1V57 A;  2OE1 A;  1AQV A;  4WET A;  4PTS A;  4IP6 A;  4E8H A;  4HZ2 A;  1XOA A;  2IMK A;  4Z2R A;  1HNC A;  1QFN A;  2AV4 A;  4TW5 A;  1B48 A;  1AC1 A;  4Z7X A;  1FOV A;  3I43 A;  4KND A;  4BA7 A;  1R5A A;  5CRH A;  1ABA A;  1HD2 A;  3GSS A;  5FT3 A;  1YY7 A;  4AF2 A;  1ERU A;  2C80 A;  3WGE A;  4FO5 A;  1S3D A;  5KN0 A;  3ISO A;  2IMF A;  2VL2 C;  4L8E A;  4HUA A;  5IPG A;  5ECI B;  4K1F A;  1F37 A;  5DJL A;  2YPM A;  2DIZ A;  1TTZ A;  3IE3 A;  1ST9 A;  1YJ6 A;  3L4N A;  2R0C A;  2YCD A;  4A5P A;  1DUG A;  4ZL8 A;  3GST A;  1GSF A;  1B9Y C;  3L9V A;  3TKS E;  2HT9 A;  1GSS A;  1M2D A;  5IIZ A;  4I5Q A;  3IDV A;  1OKD A;  4IHU A;  3F3Q A;  2YV7 A;  4V1A p;  3CBU A;  4X43 A;  2JZT A;  3MNG A;  4ILF A;  6GSU A;  2WUL A;  4RI7 A;  2PWJ A;  5FHI A;  2UZ8 A;  5AGY A;  1XZO A;  1K0B A;  2C0D A;  3IAS 2;  19GS A;  2WRT A;  1AXD A;  1A2L A;  2K18 A;  3M0F A;  2HZF A;  2DKH A;  4O5R A;  2MMN A;  2DJ0 A;  2VL2 A;  4HS1 A;  5JCU A;  2WCI A;  5DAL B;  1K0M A;  5IMC A;  3IPZ A;  2CT6 A;  4Q5R A;  5IM9 A;  1DE2 A;  2GDR A;  2HSM A;  3KMO A;  5D8I A;  3IR4 A;  3LG6 A;  2JL4 A;  2YAN A;  4MF5 A;  5F0G A;  1THX A;  3F9U A;  2OA7 A;  2X8G A;  3TKR A;  1OC9 B;  2DML A;  2YZH A;  1X9M B;  1V98 A;  2H0G A;  2X4A A;  4IN0 A;  4NAX A;  2CA8 A;  3VPT A;  4PNG A;  3E0U A;  4J2F A;  3WT1 A;  4AJ6 A;  3GL3 A;  3ZLP A;  3PIN A;  1VF2 A;  2GZP A;  1XW5 A;  1NM3 A;  3DRN A;  4OO4 A;  1OYJ A;  2GT5 A;  3GRX A;  4WF4 A;  3DVX A;  1PN0 A;  2R37 A;  4IBP A;  3KTL A;  5DDL A;  1EWX A;  3L0H A;  1Y25 A;  5BMU A;  4HJM A;  3JCM L;  4GSS A;  4O5Q A;  2GSS A;  1SYX A;  3C71 A;  2A2S A;  2WGR A;  2I81 A;  1J08 A;  3DXB A;  4I97 A;  3VWV A;  1XOB A;  2VD0 A;  5D73 A;  1ERW A;  1TI1 A;  3GTU A;  1WMJ A;  1I5G A;  4XHM A;  5G1K A;  2F3M A;  1FB6 A;  3IOS A;  4I6X A;  4BVX B;  2HRA A;  4TR4 A;  1J9B A;  4YAV A;  1SK0 A;  1JFU A;  1X9S B;  2VLT A;  4EE0 A;  1Z6M A;  1O85 A;  2O8V B;  2VL9 A;  4HU9 A;  4ML1 A;  2WS2 A;  3C7M A;  2DJ2 A;  4XRD A;  3R2Q A;  5ECH B;  4HU7 A;  4CY8 A;  5D9T A;  5HFI A;  2ES7 A;  10GS A;  2O7K A;  2VL3 A;  2IFQ A;  2IN3 A;  3M1G A;  2YOI A;  3TKQ A;  3F4T A;  3H8Q A;  1F3A A;  4YAP A;  1V2A A;  2LQO A;  5KOX A;  3FR3 A;  2EIQ A;  3DKS A;  4WR5 A;  2FWH A;  3Q6O A;  3UVH A;  2F8A A;  2FCH A;  1G6W A;  1XWC A;  1YQ1 A;  4PGT A;  5IQY A;  5A5K A;  4NHW A;  3HZ8 A;  2IMI A;  5EPF A;  2P31 A;  1TK0 B;  4FIW A;  3QAV A;  5CAX A;  4EDZ A;  1EP7 A;  1MDI A;  1T1V A;  2B6M A;  3H4K A;  3TRP A;  9GSS A;  2KOK A;  4EO3 A;  4V2N A;  4E8E A;  2DIY A;  2MYG A;  4ZBD A;  2KLX A;  5AIV A;  5ECQ B;  1YEX A;  1VF3 A;  4OFT A;  4MH3 A;  4WXT A;  5F05 A;  2AB6 A;  5CO3 A;  4K6X A;  5E4W A;  3VWX A;  3L9S A;  1OKT A;  1X0R A;  3DEX A;  5IOX A;  2L5L A;  5KN1 A;  1BX9 A;  18GS A;  3GIX A;  4J57 E;  1LBK A;  1ACV A;  5KN2 A;  3H79 A;  7GSS A;  4IGJ A;  3C1S A;  5LNK e;  4OCE A;  5HR3 A;  3KH7 A;  5HFK A;  4BPY A;  3HY2 A;  2L4Q A;  3R3E A;  3GL5 A;  1GUK A;  1PA3 A;  3VPQ A;  4WR4 A;  2C8U A;  2TRX A;  2MMO A;  2H6Z A;  4POK A;  1FAA A;  2GSQ A;  4G9H A;  2H30 A;  2E0Q A;  5IMF A;  3F63 A;  3IBH A;  5L71 A;  1BYE A;  4L5O A;  3PR8 A;  3TKP A;  4KUN A;  2H75 A;  3ME7 A;  5B6M A;  4GXZ A;  1ZL9 A;  1QUW A;  1S3C A;  4GQC A;  4NPB A;  4TKY A;  5JWR B;  5DQY A;  2DBC A;  3EYT A;  4JR4 A;  4MF7 A;  2ZUP A;  1WRY A;  3LYP A;  1BAY A;  2YWM A;  2FLS A;  2ZNM A;  3RAZ A;  1O6J A;  3ERG A;  1JLV A;  3L9U A;  4NXI A;  2TIR A;  1TJD A;  4K7I A;  3PPU A;  3TUE A;  4AJ8 A;  2MZC A;  3IA1 A;  3UL3 A;  4MP4 A;  3QOU A;  3ZRD A;  4RI6 A;  3EU3 A;  2C0E A;  3GX8 A;  2B7K A;  4HQS A;  1G0T A;  4MMM A;  4CDO A;  1YF1 A;  4F03 A;  3FRC A;  4KSO A;  4X4J A;  1PFO A;  3IAM 2;  3E9J B;  2DMM A;  4N0V A;  5D93 A;  2QA2 A;  4ML6 A;  1OAZ A;  1JZR A;  4POM A;  4GCI A;  4F2I A;  2R0G A;  3LXZ A;  5ECM B;  3GNJ A;  2JAC A;  1A24 A;  2IWT A;  4ISD A;  2CVB A;  2HLS A;  4KDU A;  1UA5 A;  4OO5 A;  1A2J A;  2GS3 A;  2HRK A;  2LJK A;  2VCX A;  4N10 A;  1ML6 A;  4MCU A;  3FR6 A;  4KH7 A;  5A4V A;  2L6D A;  3A5W A;  1M3J A;  1ILO A;  4IP1 A;  4EC0 A;  3M9J A;  4OFN A;  3KZQ A;  2JAD A;  5KN3 A;  2QC7 A;  1JLW A;  2VLU A;  2X64 A;  4K2D A;  1A0R P;  4OMV A;  3FY7 A;  4KCA A;  3APO A;  4FQU A;  4GRF A;  1N2A A;  1FO5 A;  1ZMA A;  1TK8 B;  1PX6 A;  1OC8 A;  2GLR A;  3P8W A;  3D21 A;  3O3T A;  5DCH A;  2GZY A;  1N8J A;  1NHY A;  3FKF A;  1JHB A;  3ZIT A;  2DJ1 A;  5DAK B;  5LCZ A;  1MDK A;  2N5A A;  5AIX A;  1G7O A;  1Z3E A;  3FZ5 A;  1TOF A;  4KDX A;  1XG8 A;  5ECN B;  3CSJ A;  3GMF A;  4G19 A;  4EXJ A;  2HYX A;  1R26 A;  5IOW A;  3LJR A;  3U5R E;  4L0W A;  4TN8 A;  3HYP A;  1B4P A;  4XS4 B;  2AAW A;  4IEL A;  3C1R A;  3ZMK A;  4O7H A;  3GH9 A;  2R2J A;  5DAL A;  6GSW A;  2FUG 2;  2CV4 A;  2QA1 A;  1G7E A;  3KP9 A;  4IVF A;  1ERV A;  3RHB A;  1KTE A;  3EWL A;  5D9W A;  3P2A A;  2B1K A;  2X8C A;  5DJM A;  1GLQ A;  3PH9 A;  2FY6 A;  2B1L A;  1FVK A;  1V9W A;  4CW9 A;  1OC9 A;  3TJJ A;  1TP9 A;  5INY A;  2YN1 A;  4G0K A;  1A2M A;  4GWR A;  3FYG A;  5A4W A;  3VWU A;  1M0U A;  3BCI A;  4JE1 A;  2J9H A;  3MAK A;  3CRT A;  4PUA A;  4LA1 A;  3F4S A;  3IC4 A;  4KW6 A;  1QQ2 A;  3FMW A;  2LRN A;  3F6D A;  3GKK A;  5ABR A;  4TR1 B;  2GGT A;  4KGI A;  1O8X A;  3DVW A;  2R3X A;  4ECI A;  4KDY A;  3GFK A;  2IMD A;  2B5X A;  3GV1 A;  1VGL A;  2MBT A;  1KBN A;  1XWK A;  4TXV A;  5E59 A;  2DKI A;  3GKM A;  4V1A g;  3KMN A;  2LST A;  3ZZX A;  4DSR A;  3Q19 A;  5IMD A;  2H0H A;  12GS A;  2VCW A;  1O8W A;  4IJI A;  4TVE A;  4MNN A;  2AYT A;  4QQ7 A;  4KCE A;  1JZD A;  3I6A A;  2N5F A;  3GHA A;  1OC3 A;  1XPV A;  1PSQ A;  2PMT A;  2CAQ A;  3LOR A;  2HZE B;  5F8B A;  4XS6 A;  1HYU A;  3KEB A;  2OAD A;  5J5N A;  2LTK A;  3CQF A;  4J56 E;  1A0F A;  1T8E B;  1U3A A;  2B5E A;  4F0C A;  1CQH A;  1XVQ A;  3KCM A;  2OJL A;  3VK9 A;  4JBB A;  4MH2 A;  2VLV A;  5G5F A;  3MYD A;  2HXK A;  2FA8 A;  1Z7R A;  2LNS A;  5ENU A;  2YJH A;  1EGR A;  2DJ3 A;  4KSM A;  2ALB A;  2WJU A;  4ZL7 A;  2H70 A;  4O32 A;  3EPT A;  16GS A;  4JED A;  4OWY A;  1C72 A;  3GA4 A;  4HDE A;  2YP6 A;  3C8E A;  4GQF A;  1OE7 A;  3H93 A;  1B9X C;  4G2E A;  4EKZ A;  4ZBA A;  1SJ6 A;  2YWO A;  3QFB C;  1XFL A;  5J3R A;  3G7I A;  1ZYP A;  3QPM A;  1XVW A;  1QGV A;  22GS A;  2A4H A;  2RUE A;  2FWE A;  4ZB9 A;  1YDK A;  2OKA A;  2XBI A;  3KTB A;  2HFD A;  2C4J A;  2BMX A;  1U87 A;  4DSS B;  2CVK A;  3NIV A;  4N11 A;  1TDI A;  1XW6 A;  2VUP A;  4BVY B;  3DIE A;  4PNF A;  4IKH A;  3TCO A;  3KM6 A;  2PBJ A;  5CRE A;  2N5B A;  1K3L A;  5DQS A;  4MJC A;  3FZA A;  3A2V A;  1JZW A;  2LRT A;  2YV9 A;  3MWH A;  5DCG A;  3IK9 A;  1USB A;  5FWG A;  2LUS A;  13GS A;  4GF0 A;  1J0F A;  1A8L A;  1TRW A;  2DC5 A;  3F8U A;  1R4W A;  2XPD A;  5CNW A;  5JCW A;  4JU5 A;  1Y6E A;  1BQ7 A;  4WF5 A;  4BL7 B;  4POL A;  1BJX A;  3DYR A;  4G0I A;  1R7H A;  1FHE A;  1FG4 A;  3W8J A;  2EC4 A;  3KXO A;  3UVT A;  4TXO B;  2P5R A;  2BTO T;  4GST A;  1EEJ A;  1F9M A;  3TJG A;  2GQK A;  5J9B A;  1TRU A;  1X5C A;  4H86 A;  4NV2 A;  3F3R A;  1T3B A;  1GLP A;  2L59 A;  3M8N A;  4GTU A;  2ZCT A;  20GS A;  5CP1 A;  3G9B A;  5BRT A;  2X8H A;  5ELA A;  2PER A;  1V58 A;  2CZ3 A;  2NPB A;  4QL7 A;  4ACS A;  4DVC A;  5IO2 A;  4LL4 B;  1AUC A;  3O6T A;  3RPP A;  3ZVJ D;  4Z2U A;  2F9S A;  4K2X A;  1H75 A;  5B8A A;  4HOJ A;  1GSU A;  2PUK C;  1PL1 A;  3TRQ A;  5H5Q A;  3FR9 A;  5HR1 A;  3QCP A;  4NHZ A;  1EV9 A;  1W89 A;  3FK8 A;  2GSR A;  2G2Q A;  3FEU A;  5ECP B;  5CYY A;  1M9B A;  2CAI A;  3HA9 A;  3CXG A;  1WWJ A;  2HE3 A;  1X5E A;  6GST A;  2LJA A;  1GNE A;  4MPG A;  1VRS D;  3QDN A;  3CRU A;  4ID0 A;  2H01 A;  4PQ1 A;  1MEK A;  3EIN A;  4I2T A;  2H1D A;  4KF9 A;  2V41 A;  3HHV A;  4XTS A;  5EVO A;  1GSD A;  2V6O A;  1GUM A;  1Z6N A;  2ON7 A;  4P3Y B;  1SL0 B;  3CYN A;  1MD3 A;  1MDJ A;  2IPA A;  2QKE A;  2HRN A;  5H5R A;  3HJO A;  4EIP A;  4YQV A;  2XC2 A;  1GL8 A;  1TI3 A;  4PQI A;  2LJR A;  3ZRE A;  2VCV A;  3HJP A;  4MJB A;  1OVN A;  3HD5 A;  3RBT A;  4Q5N A;  3TJK A;  2DLX A;  4K5S A;  1XCC A;  2FWG A;  5ECO B;  5DAK A;  2DSA A;  3EVI A;  1SKW B;  3GYK A;  1WJK A;  3KD0 A;  3NZN A;  1SKR B;  3D4T A;  3ME8 A;  2F8F A;  1DE1 A;  3TOT A;  1FOH A;  4EL1 A;  2FWF A;  4FH8 A;  3M9K A;  4OFM A;  3BCK A;  4EUY A;  5KEJ A;  1LJR A;  4MF6 A;  4K0N A;  2GZZ A;  4HEA 2;  5HQP A;  3M3M A;  3RHC A;  4XRA A;  3Q74 A;  4FYC A;  2E2G A;  3ZIJ A;  2H76 A;  5F07 A;  4KAE A;  3J7Y b;  4KX4 A;  4ICY A;  5GST A;  1DSB A;  2WB9 A;  3HKR A;  2OE3 A;  3S9F A;  4ECB A;  3OR5 A;  1XXU A;  4K0G A;  1DBY A;  2VAF A;  2M72 A;  1EOG A;  3IV4 A;  1F2E A;  1SD8 A;  2H1B A;  4GSN A;  4TR3 A;  1T00 A;  4ECC A;  3DML A;  2KHP A;  1K0A A;  1EOH A;  2HSH A;  3HVV A;  2CZ2 A;  2CQ9 A;  4V2M A;  2WDU A;  3W8S A;  2H71 A;  4TRX A;  2ON5 A;  4OCF A;  3VFI A;  3E3E A;  4AGS A;  1R5P A;  2YJ7 A;  6GSV A;  1I9D A;  4IW9 A;  3LFL A;  3N9J A;  2GT6 A;  4TR1 A;  1XIY A;  3TJF A;  1YKC A;  2JZS A;  3EC3 A;  2LKU A;  4ZIL A;  1AAZ A;  4WBJ A;  2V32 A;  5H5S A;  2G0F A;  2A4V A;  2H72 A;  3VWW A;  2J23 A;  3WD6 A;  2VIM A;  2KUC A;  4TR0 A;  2HSY A;  3CTG A;  1SEN A;  1SJZ A;  1SL2 B;  2K9F A;  3LGC A;  3D22 A;  3BOA A;  2GST A;  3HVX A;  5LD0 A;  3QMX A;  3GN3 A;  5G2Z A;  4MJA A;  1GTA A;  3WT2 A;  2VM1 A;  2DJJ A;  2CX3 A;  1O7U A;  1PX7 A;  2BJX A;  3O76 A;  5J9C A;  3F0I A;  3SWL A;  3GUR A;  1WP0 A;  4ECJ A;  1XBS A;  2HZE A;  2V1M A;  2XHF A;  4K8M A;  2B7J A;  5ID2 B;  2X49 A;  2B5Y A;  1WOU A;  1ZYE A;  1TK5 B;  2GVP A;  3P90 A;  1YKA A;  3ERW A;  1FVJ A;  3TOU A;  3W6G A;  2RLI A;  3EUR A;  4IS0 A;  5CRG A;  1SKS B;  3ZFL A;  3CSH A;  4ZL9 A;  1T7P B;  1A23 A;  5COH A;  4L0U A;  2H6Y A;  1Z7P A;  2LS5 A;  4TOP A;  3TGZ A;  1O81 A;  3US3 A;  3UAP A;  1FW1 A;  5G31 A;  1YEP A;  3KGK A;  3IXR A;  4LMV A;  3I69 A;  4MPF A; 
#chains in the Genus database with same CATH homology
 3HJM A;  5HR2 A;  2KP2 A;  3UAR A;  4DSQ A;  1XWG A;  1U3I A;  3UBL A;  4O92 A;  1AQW A;  1W4V A;  3HZ4 A;  1T4Z A;  1TRS A;  2NDO A;  5ECK B;  2E7P A;  1MD4 A;  2RII A;  2EIR A;  3DGQ A;  1PKZ A;  1NHO A;  2R5G A;  3BJ5 A;  2H1A A;  2LNT A;  4MZW A;  3PGT A;  3CSI A;  1SK1 A;  5B7C A;  3A3T A;  3TJB A;  3L78 A;  4DSS A;  2NBS A;  3D5J A;  1K3Y A;  2LRC A;  1FB0 A;  1VF1 A;  2H74 A;  1GNW A;  5C00 A;  4BVY A;  1QK8 A;  2CVD A;  1UVZ A;  2I1U A;  1ZCP A;  2V6K A;  2DJK A;  6GSS A;  4PUR A;  1IYI A;  5JWO B;  3VI5 A;  3HCZ A;  3BD2 A;  4D73 B;  5CRD A;  1SYR A;  1GUH A;  4GLT A;  2PGT A;  4BWS A;  5D9X A;  3FZ4 A;  2A2R A;  4YQM A;  2EIO A;  4BVX A;  3BBY A;  5IPH A;  1RK4 A;  1GTI A;  1SJI A;  1F3B A;  2C1Y A;  5IMA A;  5GAN D;  1GSE A;  4PX1 A;  4BL7 A;  4EDY A;  1K3O A;  1B4Q A;  3UIW A;  3CTF A;  5DVB A;  1URM A;  4K9Z A;  2JZR A;  1PD2 1;  3ERF A;  2C3N A;  1SK2 A;  4TXO A;  14GS A;  2QSI A;  3WGD A;  3IHQ A;  1K0D A;  1B8X A;  1AW9 A;  3FHK A;  2P5Q A;  4HJ2 A;  5J41 A;  4HZ4 A;  2I3Y A;  5D9V A;  1JZO A;  4WBR D;  6GSY A;  3ZL5 A;  3DWV A;  5J4U A;  2C3Q A;  3KP8 A;  4OD7 A;  3ZML A;  5C04 A;  3F6F A;  1A8Y A;  2H19 A;  2P0G A;  4CHS A;  4MJE A;  4WEY A;  4XCS A;  5G30 A;  4YKG A;  1EEM A;  1H4O A;  2YNX A;  5A4U A;  11GS A;  4PQH A;  2VCQ A;  4NV5 A;  2MMZ A;  3HDC A;  1X9W B;  1GRX A;  5IMV A;  2AJQ B;  3WGX A;  3ZFB A;  1ON4 A;  2L57 A;  2C0G A;  1KNG A;  2QGV A;  1GTU A;  5GZZ B;  5GAP D;  5AN1 A;  1TXX A;  1M2A A;  2YWN A;  5IMZ A;  3VLN A;  2RUF A;  1F6M C;  1WIK A;  3LW9 A;  4RUV A;  3QD9 A;  3GX0 A;  2MBS A;  3TB2 A;  2KP1 A;  3ZTL A;  4Q5Q A;  2L4C A;  3H1N A;  4ULX A;  1PQN A;  4MK3 A;  4F82 A;  2E2M A;  2LEG A;  1EP8 A;  2X99 A;  3QAG A;  3LWA A;  2WZ9 A;  5B6N A;  2A2P A;  1RQM A;  3GH6 A;  2PU9 C;  1VF4 A;  2NVL A;  5ECR B;  2FA4 A;  5ELG A;  1K0C A;  4MZC A;  2LQQ A;  2TRC P;  4LL1 B;  3ED3 A;  1NW2 A;  2PN8 A;  1K0O A;  2O87 A;  3MSZ A;  1SD9 A;  2D2Z A;  1IYH A;  1GH2 A;  1YZX A;  4NMU A;  6GSX A;  3A5I A;  4WKW A;  5JCG A;  2JU5 A;  3I9V 2;  2REM A;  4MLY A;  1CQG A;  1SU9 A;  2K6V A;  5HFG A;  1WE0 A;  3G7J A;  3TKS C;  2PVQ A;  1GSQ A;  1YF0 A;  2Z9S A;  1WPI A;  4F0B A;  4ZB8 A;  3LQ7 A;  2IJY A;  4F9Z A;  4V2L A;  4JR6 A;  1UC7 A;  2IME A;  4K5R A;  4KE3 A;  5HR0 A;  2VCT A;  1GP1 A;  3UBK A;  4EIQ A;  2C0F A;  3FZ9 A;  1HNB A;  2K8V A;  3P7X A;  1TKD B;  2M46 A;  4MDC A;  1GSY A;  1THO A;  4LMW A;  2M80 A;  1SL1 B;  2GTU A;  3J7Y k;  3RPN A;  3KJY A;  3WYW A;  2RM6 A;  4POB A;  1M7T A;  3QFA C;  3G7Y A;  3D4M A;  3TKS A;  3D6I A;  2L6C A;  3U6V A;  5B8B A;  3D0Z A;  1BED A;  4I2U A;  1U88 A;  2PPT A;  3CMI A;  2OBI A;  1M2B A;  3TRX A;  4HQZ A;  3KIJ A;  2VM2 A;  2F51 A;  1BG5 A;  3EE2 A;  3ZIV A;  3LSZ A;  1S3A A;  3GKX A;  4ZIJ A;  2GQM A;  5DBQ A;  3EMP A;  4HI7 A;  3AY8 A;  2CX4 A;  3A2X A;  1ZYQ B;  4YH2 A;  4JRR A;  4L5L A;  3GTU B;  4FYB A;  4X1U A;  4PUF C;  3N5O A;  1Z9H A;  4G10 A;  5EL8 A;  4AJ7 A;  1ZYN A;  2IIY A;  3LYK A;  1GUL A;  4MAB A;  4XS1 A;  4Q5F A;  4ZB6 A;  4IQA A;  2I9H A;  2AUV A;  3F4R A;  2L5O A;  4K7O A;  3EU4 A;  1EZK A;  3UMA A;  1XWA A;  1M9A A;  4RQX A;  1V40 A;  1X5D A;  4ZXG A;  1ZOF A;  4K7N A;  3QAW A;  4XIH A;  3UJ1 A;  4DEJ A;  2IFQ B;  1PMT A;  2HNL A;  1OE8 A;  2YWI A;  1TU7 A;  5D96 A;  2HI7 A;  3LEF A;  3K8N A;  5G1L A;  1E6B A;  4QL9 A;  2HRF A;  5F06 A;  4EVM A;  3C73 A;  3UOM A;  3QR6 A;  1ERT A;  4N30 A;  1LU4 A;  3Q18 A;  2RM5 A;  4XS4 A;  2JSY A;  3TDG A;  2VOC A;  3IK7 A;  3VUR A;  5ID2 A;  4RQR A;  4Z2T A;  1Q98 A;  2IL3 A;  2VCZ A;  1Q4J A;  2H0I A;  4CY6 A;  1ZZY A;  2H8L A;  3EMX A;  2GQL A;  2R0P A;  3DD3 A;  4PXO A;  1PN9 A;  5AIS A;  2FHE A;  3VI7 A;  1NSW A;  5CRW A;  5JWQ B;  1XW9 A;  1TU8 A;  1PGT A;  1UN2 A;  2VD1 A;  2YZU A;  1PKW A;  4O5U A;  3RDW A;  2FD3 A;  4NWY A;  4JZQ A;  3A2W A;  3GKN A;  4YQU A;  2OE0 A;  1TRV A;  4ZBB A;  2PVO C;  3HVS A;  2VO4 A;  1QMV A;  3GUS A;  1TW9 A;  3UEM A;  1M99 A;  4EF0 A;  2FGX A;  2I4A A;  3IRA A;  1AIU A;  1QXH A;  5ECS A;  4FYU A;  2WFC A;  3ZVJ A;  4MA9 A;  2O89 A;  4KB3 A;  3V1W A;  1GWC A;  2MMA A;  2C3T A;  2H73 A;  5ECL B;  1PL2 A;  4USS A;  1EGO A;  3HXS A;  4IJ3 A;  2H1G A;  3MDK A;  1Z5Y E;  8GSS A;  4LLR A;  4G0L A;  3MIX A;  4X0X A;  1EV4 A;  1T4Y A;  3IHG A;  4KA0 A;  1HNA A;  2K8S A;  2R4V A;  2OBK A;  2LV3 A;  1K0N A;  2H6X A;  3APS A;  1U6T A;  2JSZ A;  3NOF A;  4IQ1 A;  2AHE A;  4D73 A;  2B3S A;  4N0Z A;  5GSS A;  2R6K A;  1ZGN A;  3KH9 A;  4MZB A;  17GS A;  1G6Y A;  5KOW A;  4I8B A;  5G5E A;  2V2G A;  4BWQ A;  3ZYW A;  1RW1 A;  1HQO A;  1KEB A;  2OAC A;  2NTO A;  3SBC A;  2XPE A;  1O73 A;  1PRX A;  3IC8 A;  1E2Y A;  5EY6 A;  3FW2 A;  2FNO A;  5IO0 A;  2XBQ A;  2O85 A;  2H66 A;  3APQ A;  4YKF A;  1AQX A;  1XWB A;  3LXT A;  1GTB A;  1MTC A;  1V57 A;  2OE1 A;  1AQV A;  4WET A;  4PTS A;  4IP6 A;  4E8H A;  4HZ2 A;  1XOA A;  2IMK A;  4Z2R A;  1HNC A;  1QFN A;  2AV4 A;  4TW5 A;  1B48 A;  1AC1 A;  4Z7X A;  1FOV A;  3I43 A;  4KND A;  4BA7 A;  1R5A A;  5CRH A;  1ABA A;  1HD2 A;  3GSS A;  5FT3 A;  1YY7 A;  4AF2 A;  1ERU A;  2C80 A;  3WGE A;  4FO5 A;  1S3D A;  5KN0 A;  3ISO A;  2IMF A;  2VL2 C;  4L8E A;  4HUA A;  5IPG A;  5ECI B;  4K1F A;  1F37 A;  5DJL A;  2YPM A;  2DIZ A;  1TTZ A;  3IE3 A;  1ST9 A;  1YJ6 A;  3L4N A;  2R0C A;  2YCD A;  4A5P A;  1DUG A;  4ZL8 A;  3GST A;  1GSF A;  1B9Y C;  3L9V A;  3TKS E;  2HT9 A;  1GSS A;  1M2D A;  5IIZ A;  4I5Q A;  3IDV A;  1OKD A;  4IHU A;  3F3Q A;  2YV7 A;  4V1A p;  3CBU A;  4X43 A;  2JZT A;  3MNG A;  4ILF A;  6GSU A;  2WUL A;  4RI7 A;  2PWJ A;  5FHI A;  2UZ8 A;  5AGY A;  1XZO A;  1K0B A;  2C0D A;  3IAS 2;  19GS A;  2WRT A;  1AXD A;  1A2L A;  2K18 A;  3M0F A;  2HZF A;  2DKH A;  4O5R A;  2MMN A;  2DJ0 A;  2VL2 A;  4HS1 A;  5JCU A;  2WCI A;  5DAL B;  1K0M A;  5IMC A;  3IPZ A;  2CT6 A;  4Q5R A;  5IM9 A;  1DE2 A;  2GDR A;  2HSM A;  3KMO A;  5D8I A;  3IR4 A;  3LG6 A;  2JL4 A;  2YAN A;  4MF5 A;  5F0G A;  1THX A;  3F9U A;  2OA7 A;  2X8G A;  3TKR A;  1OC9 B;  2DML A;  2YZH A;  1X9M B;  1V98 A;  2H0G A;  2X4A A;  4IN0 A;  4NAX A;  2CA8 A;  3VPT A;  4PNG A;  3E0U A;  4J2F A;  3WT1 A;  4AJ6 A;  3GL3 A;  3ZLP A;  3PIN A;  1VF2 A;  2GZP A;  1XW5 A;  1NM3 A;  3DRN A;  4OO4 A;  1OYJ A;  2GT5 A;  3GRX A;  4WF4 A;  3DVX A;  1PN0 A;  2R37 A;  4IBP A;  3KTL A;  5DDL A;  1EWX A;  3L0H A;  1Y25 A;  5BMU A;  4HJM A;  3JCM L;  4GSS A;  4O5Q A;  2GSS A;  1SYX A;  3C71 A;  2A2S A;  2WGR A;  2I81 A;  1J08 A;  3DXB A;  4I97 A;  3VWV A;  1XOB A;  2VD0 A;  5D73 A;  1ERW A;  1TI1 A;  3GTU A;  1WMJ A;  1I5G A;  4XHM A;  5G1K A;  2F3M A;  1FB6 A;  3IOS A;  4I6X A;  4BVX B;  2HRA A;  4TR4 A;  1J9B A;  4YAV A;  1SK0 A;  1JFU A;  1X9S B;  2VLT A;  4EE0 A;  1Z6M A;  1O85 A;  2O8V B;  2VL9 A;  4HU9 A;  4ML1 A;  2WS2 A;  3C7M A;  2DJ2 A;  4XRD A;  3R2Q A;  5ECH B;  4HU7 A;  4CY8 A;  5D9T A;  5HFI A;  2ES7 A;  10GS A;  2O7K A;  2VL3 A;  2IFQ A;  2IN3 A;  3M1G A;  2YOI A;  3TKQ A;  3F4T A;  3H8Q A;  1F3A A;  4YAP A;  1V2A A;  2LQO A;  5KOX A;  3FR3 A;  2EIQ A;  3DKS A;  4WR5 A;  2FWH A;  3Q6O A;  3UVH A;  2F8A A;  2FCH A;  1G6W A;  1XWC A;  1YQ1 A;  4PGT A;  5IQY A;  5A5K A;  4NHW A;  3HZ8 A;  2IMI A;  5EPF A;  2P31 A;  1TK0 B;  4FIW A;  3QAV A;  5CAX A;  4EDZ A;  1EP7 A;  1MDI A;  1T1V A;  2B6M A;  3H4K A;  3TRP A;  9GSS A;  2KOK A;  4EO3 A;  4V2N A;  4E8E A;  2DIY A;  2MYG A;  4ZBD A;  2KLX A;  5AIV A;  5ECQ B;  1YEX A;  1VF3 A;  4OFT A;  4MH3 A;  4WXT A;  5F05 A;  2AB6 A;  5CO3 A;  4K6X A;  5E4W A;  3VWX A;  3L9S A;  1OKT A;  1X0R A;  3DEX A;  5IOX A;  2L5L A;  5KN1 A;  1BX9 A;  18GS A;  3GIX A;  4J57 E;  1LBK A;  1ACV A;  5KN2 A;  3H79 A;  7GSS A;  4IGJ A;  3C1S A;  5LNK e;  4OCE A;  5HR3 A;  3KH7 A;  5HFK A;  4BPY A;  3HY2 A;  2L4Q A;  3R3E A;  3GL5 A;  1GUK A;  1PA3 A;  3VPQ A;  4WR4 A;  2C8U A;  2TRX A;  2MMO A;  2H6Z A;  4POK A;  1FAA A;  2GSQ A;  4G9H A;  2H30 A;  2E0Q A;  5IMF A;  3F63 A;  3IBH A;  5L71 A;  1BYE A;  4L5O A;  3PR8 A;  3TKP A;  4KUN A;  2H75 A;  3ME7 A;  5B6M A;  4GXZ A;  1ZL9 A;  1QUW A;  1S3C A;  4GQC A;  4NPB A;  4TKY A;  5JWR B;  5DQY A;  2DBC A;  3EYT A;  4JR4 A;  4MF7 A;  2ZUP A;  1WRY A;  3LYP A;  1BAY A;  2YWM A;  2FLS A;  2ZNM A;  3RAZ A;  1O6J A;  3ERG A;  1JLV A;  3L9U A;  4NXI A;  2TIR A;  1TJD A;  4K7I A;  3PPU A;  3TUE A;  4AJ8 A;  2MZC A;  3IA1 A;  3UL3 A;  4MP4 A;  3QOU A;  3ZRD A;  4RI6 A;  3EU3 A;  2C0E A;  3GX8 A;  2B7K A;  4HQS A;  1G0T A;  4MMM A;  4CDO A;  1YF1 A;  4F03 A;  3FRC A;  4KSO A;  4X4J A;  3IAM 2;  3E9J B;  2DMM A;  4N0V A;  5D93 A;  2QA2 A;  4ML6 A;  1OAZ A;  1JZR A;  4POM A;  4GCI A;  4F2I A;  2R0G A;  3LXZ A;  5ECM B;  3GNJ A;  2JAC A;  1A24 A;  2IWT A;  4ISD A;  2CVB A;  2HLS A;  4KDU A;  1UA5 A;  4OO5 A;  1A2J A;  2GS3 A;  2HRK A;  2LJK A;  2VCX A;  4N10 A;  1ML6 A;  4MCU A;  3FR6 A;  4KH7 A;  5A4V A;  2L6D A;  3A5W A;  1ILO A;  4IP1 A;  4EC0 A;  3M9J A;  4OFN A;  3KZQ A;  2JAD A;  5KN3 A;  2QC7 A;  1JLW A;  2VLU A;  2X64 A;  4K2D A;  1A0R P;  4OMV A;  3FY7 A;  4KCA A;  3APO A;  4FQU A;  4GRF A;  1N2A A;  1FO5 A;  1ZMA A;  1TK8 B;  1PX6 A;  1OC8 A;  2GLR A;  3P8W A;  3D21 A;  3O3T A;  5DCH A;  2GZY A;  1N8J A;  1NHY A;  3FKF A;  1JHB A;  3ZIT A;  2DJ1 A;  5DAK B;  5LCZ A;  1MDK A;  2N5A A;  5AIX A;  1G7O A;  1Z3E A;  3FZ5 A;  1TOF A;  4KDX A;  5ECN B;  3CSJ A;  3GMF A;  4G19 A;  4EXJ A;  2HYX A;  1R26 A;  5IOW A;  3LJR A;  3U5R E;  4L0W A;  4TN8 A;  3HYP A;  1B4P A;  4XS4 B;  2AAW A;  4IEL A;  3C1R A;  3ZMK A;  4O7H A;  3GH9 A;  2R2J A;  5DAL A;  6GSW A;  2FUG 2;  2CV4 A;  2QA1 A;  1G7E A;  3KP9 A;  4IVF A;  1ERV A;  3RHB A;  1KTE A;  3EWL A;  5D9W A;  3P2A A;  2B1K A;  2X8C A;  5DJM A;  1GLQ A;  3PH9 A;  2FY6 A;  2B1L A;  1FVK A;  1V9W A;  4CW9 A;  1OC9 A;  3TJJ A;  1TP9 A;  5INY A;  2YN1 A;  4G0K A;  1A2M A;  4GWR A;  3FYG A;  5A4W A;  3VWU A;  1M0U A;  3BCI A;  4JE1 A;  2J9H A;  3MAK A;  3CRT A;  4PUA A;  4LA1 A;  3F4S A;  3IC4 A;  4KW6 A;  1QQ2 A;  3FMW A;  2LRN A;  3F6D A;  3GKK A;  5ABR A;  4TR1 B;  2GGT A;  4KGI A;  1O8X A;  3DVW A;  2R3X A;  4ECI A;  4KDY A;  3GFK A;  2IMD A;  2B5X A;  3GV1 A;  1VGL A;  2MBT A;  1KBN A;  1XWK A;  4TXV A;  5E59 A;  2DKI A;  3GKM A;  4V1A g;  3KMN A;  2LST A;  3ZZX A;  4DSR A;  3Q19 A;  5IMD A;  2H0H A;  12GS A;  2VCW A;  1O8W A;  4IJI A;  4TVE A;  4MNN A;  2AYT A;  4QQ7 A;  4KCE A;  1JZD A;  3I6A A;  2N5F A;  3GHA A;  1OC3 A;  1XPV A;  1PSQ A;  2PMT A;  2CAQ A;  3LOR A;  2HZE B;  5F8B A;  4XS6 A;  1HYU A;  3KEB A;  2OAD A;  5J5N A;  2LTK A;  4J56 E;  1A0F A;  1T8E B;  1U3A A;  2B5E A;  4F0C A;  1CQH A;  1XVQ A;  3KCM A;  2OJL A;  3VK9 A;  4JBB A;  4MH2 A;  2VLV A;  5G5F A;  3MYD A;  2HXK A;  2FA8 A;  1Z7R A;  2LNS A;  5ENU A;  2YJH A;  1EGR A;  2DJ3 A;  4KSM A;  2ALB A;  2WJU A;  4ZL7 A;  2H70 A;  4O32 A;  3EPT A;  16GS A;  4JED A;  4OWY A;  1C72 A;  3GA4 A;  4HDE A;  2YP6 A;  3C8E A;  4GQF A;  1OE7 A;  3H93 A;  1B9X C;  4G2E A;  4EKZ A;  4ZBA A;  1SJ6 A;  2YWO A;  3QFB C;  1XFL A;  5J3R A;  3G7I A;  1ZYP A;  3QPM A;  1XVW A;  1QGV A;  22GS A;  2A4H A;  2RUE A;  2FWE A;  4ZB9 A;  1YDK A;  2OKA A;  2XBI A;  3KTB A;  2HFD A;  2C4J A;  2BMX A;  1U87 A;  4DSS B;  2CVK A;  3NIV A;  4N11 A;  1TDI A;  1XW6 A;  2VUP A;  4BVY B;  3DIE A;  4PNF A;  4IKH A;  3TCO A;  3KM6 A;  2PBJ A;  5CRE A;  2N5B A;  1K3L A;  5DQS A;  4MJC A;  3FZA A;  3A2V A;  1JZW A;  2LRT A;  2YV9 A;  3MWH A;  5DCG A;  3IK9 A;  1USB A;  5FWG A;  2LUS A;  13GS A;  4GF0 A;  1J0F A;  1A8L A;  1TRW A;  2DC5 A;  3F8U A;  1R4W A;  2XPD A;  5CNW A;  5JCW A;  4JU5 A;  1Y6E A;  1BQ7 A;  4WF5 A;  4BL7 B;  4POL A;  1BJX A;  3DYR A;  4G0I A;  1R7H A;  1FHE A;  1FG4 A;  3W8J A;  2EC4 A;  3KXO A;  3UVT A;  4TXO B;  2P5R A;  2BTO T;  4GST A;  1EEJ A;  1F9M A;  3TJG A;  2GQK A;  5J9B A;  1TRU A;  1X5C A;  4H86 A;  4NV2 A;  3F3R A;  1T3B A;  1GLP A;  2L59 A;  3M8N A;  4GTU A;  2ZCT A;  20GS A;  5CP1 A;  3G9B A;  5BRT A;  2X8H A;  5ELA A;  2PER A;  1V58 A;  2CZ3 A;  2NPB A;  4QL7 A;  4ACS A;  4DVC A;  5IO2 A;  4LL4 B;  1AUC A;  3O6T A;  3RPP A;  3ZVJ D;  4Z2U A;  2F9S A;  4K2X A;  1H75 A;  5B8A A;  4HOJ A;  1GSU A;  2PUK C;  1PL1 A;  3TRQ A;  5H5Q A;  3FR9 A;  5HR1 A;  3QCP A;  4NHZ A;  1EV9 A;  1W89 A;  3FK8 A;  2GSR A;  2G2Q A;  3FEU A;  5ECP B;  5CYY A;  1M9B A;  2CAI A;  3HA9 A;  3CXG A;  1WWJ A;  2HE3 A;  1X5E A;  6GST A;  2LJA A;  1GNE A;  4MPG A;  1VRS D;  3QDN A;  3CRU A;  4ID0 A;  2H01 A;  4PQ1 A;  1MEK A;  3EIN A;  4I2T A;  2H1D A;  4KF9 A;  2V41 A;  3HHV A;  4XTS A;  5EVO A;  1GSD A;  2V6O A;  1GUM A;  1Z6N A;  2ON7 A;  4P3Y B;  1SL0 B;  3CYN A;  1MD3 A;  1MDJ A;  2IPA A;  2QKE A;  2HRN A;  5H5R A;  3HJO A;  4EIP A;  4YQV A;  2XC2 A;  1GL8 A;  1TI3 A;  4PQI A;  2LJR A;  3ZRE A;  2VCV A;  3HJP A;  4MJB A;  1OVN A;  3HD5 A;  3RBT A;  4Q5N A;  3TJK A;  2DLX A;  4K5S A;  1XCC A;  2FWG A;  5ECO B;  5DAK A;  2DSA A;  3EVI A;  1SKW B;  3GYK A;  1WJK A;  3KD0 A;  3NZN A;  1SKR B;  3D4T A;  3ME8 A;  2F8F A;  1DE1 A;  3TOT A;  1FOH A;  4EL1 A;  2FWF A;  4FH8 A;  3M9K A;  4OFM A;  3BCK A;  4EUY A;  5KEJ A;  1LJR A;  4MF6 A;  4K0N A;  2GZZ A;  4HEA 2;  5HQP A;  3M3M A;  3RHC A;  4XRA A;  3Q74 A;  4FYC A;  2E2G A;  3ZIJ A;  2H76 A;  5F07 A;  4KAE A;  3J7Y b;  4KX4 A;  4ICY A;  5GST A;  1DSB A;  2WB9 A;  3HKR A;  2OE3 A;  3S9F A;  4ECB A;  3OR5 A;  1XXU A;  4K0G A;  1DBY A;  2VAF A;  2M72 A;  1EOG A;  3IV4 A;  1F2E A;  1SD8 A;  2H1B A;  4GSN A;  4TR3 A;  1T00 A;  4ECC A;  3DML A;  2KHP A;  1K0A A;  1EOH A;  2HSH A;  3HVV A;  2CZ2 A;  2CQ9 A;  4V2M A;  2WDU A;  3W8S A;  2H71 A;  4TRX A;  2ON5 A;  4OCF A;  3VFI A;  3E3E A;  4AGS A;  1R5P A;  2YJ7 A;  6GSV A;  1I9D A;  4IW9 A;  3LFL A;  3N9J A;  2GT6 A;  4TR1 A;  1XIY A;  3TJF A;  1YKC A;  2JZS A;  3EC3 A;  2LKU A;  4ZIL A;  1AAZ A;  4WBJ A;  2V32 A;  5H5S A;  2G0F A;  2A4V A;  2H72 A;  3VWW A;  2J23 A;  3WD6 A;  2VIM A;  2KUC A;  4TR0 A;  2HSY A;  3CTG A;  1SEN A;  1SJZ A;  1SL2 B;  2K9F A;  3LGC A;  3D22 A;  3BOA A;  2GST A;  3HVX A;  5LD0 A;  3QMX A;  3GN3 A;  5G2Z A;  4MJA A;  1GTA A;  3WT2 A;  2VM1 A;  2DJJ A;  2CX3 A;  1O7U A;  1PX7 A;  2BJX A;  3O76 A;  5J9C A;  3F0I A;  3SWL A;  3GUR A;  1WP0 A;  4ECJ A;  1XBS A;  2HZE A;  2V1M A;  2XHF A;  4K8M A;  2B7J A;  5ID2 B;  2X49 A;  2B5Y A;  1WOU A;  1ZYE A;  1TK5 B;  2GVP A;  3P90 A;  1YKA A;  3ERW A;  1FVJ A;  3TOU A;  3W6G A;  2RLI A;  3EUR A;  4IS0 A;  5CRG A;  1SKS B;  3ZFL A;  3CSH A;  4ZL9 A;  1T7P B;  1A23 A;  5COH A;  4L0U A;  2H6Y A;  1Z7P A;  2LS5 A;  4TOP A;  3TGZ A;  1O81 A;  3US3 A;  3UAP A;  1FW1 A;  5G31 A;  1YEP A;  3KGK A;  3IXR A;  4LMV A;  3I69 A;  4MPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...