2JU5A

Dsbh oxidoreductase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
b'ARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHKPIGLFFTGSDWCMWCIKMQDQILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQELKAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVKSALKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin Disulfide Isomerase
publication title Insight into Disulfide Bond Catalysis in Chlamydia from the Structure and Function of DsbH, a Novel Oxidoreductase.
pubmed doi rcsb
source organism Chlamydophila pneumoniae
molecule tags Oxidoreductase
total genus 31
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ju5A01
1M0UA 2M80A 2X8CA 5E59A 2E2MA 4HQZA 5H5RA 1GULA 7GSSA 2FNOA 2PUKC 5IQYA 3ZMKA 1GSSA 4I8BA 2MBSA 1G7OA 3FZ5A 1VF1A 5AN1A 1BG5A 3LWAA 2L4CA 4F82A 3TUEA 4K7IA 4I2UA 2LS5A 1KEBA 2AAWA 2O89A 4IGJA 3Q74A 3MDKA 1PKWA 1JLVA 1WMJA 1HD2A 10GSA 2CAIA 2F51A 4MZBA 5LCZA 4Z7XA 2HSYA 2CQ9A 3L9SA 2GDRA 4L5LA 4ZL9A 3GN3A 4ZB6A 1GUKA 1SL1B 4MJCA 1Z5YE 2YJHA 4ECCA 1M9BA 3C7MA 3HJPA 3I43A 2H8LA 4IP1A 2YWIA 3PH9A 1HQOA 2B3SA 3P2AA 2TRXA 4EC0A 2H66A 4DSSA 4GRFA 1S3AA 3HZ4A 1YF1A 4GSSA 1XOBA 5HFIA 5B7CA 4GQFA 5J41A 4F9ZA 4J57E 4KE3A 3APQA 1NHOA 1FHEA 1Y6EA 1ZGNA 2V6OA 2H74A 1YEXA 1AXDA 1ZMAA 3LQ7A 4FO5A 3S9FA 1V40A 2B6MA 4XS4A 2H75A 1K0NA 2GZZA 1GNWA 2FUG2 3GTUA 2H0GA 1XW6A 3P90A 2CX4A 4IQ1A 3HD5A 4MCUA 1O8WA 2B5YA 3I9V2 3DVXA 4PUFC 1TU7A 1NHYA 4FIWA 3BD2A 3FEUA 1QFNA 1XCCA 4MZWA 1MDKA 5J9BA 2YZHA 3GKMA 4MJBA 3DWVA 5G1KA 2H73A 5DALB 1FO5A 3N5OA 4IN0A 3IAS2 5F0GA 1O81A 2H1AA 2R2JA 1ON4A 2H70A 2VCZA 3IAM2 1YDKA 3ZIVA 4XRDA 2L5OA 1K0MA 2MMAA 5D9TA 3TJJA 5IMFA 3GX8A 4JRRA 4E8EA 2VCQA 5IOXA 3GNJA 2K8VA 2FLSA 4HZ4A 3RDWA 3G7IA 1K0DA 2ZNMA 1X9SB 1SK0A 1Y25A 2I3YA 4KSMA 3LYPA 4KDXA 2F3MA 3VI7A 2OJLA 2XHFA 1K3OA 3G7JA 2C0FA 3KEBA 5F07A 2I81A 1K0AA 1KBNA 2GVPA 2IFQA 1SL2B 2ZCTA 2GSSA 2YP6A 3DRNA 2YN1A 2C4JA 3IDVA 4K9ZA 4AF2A 3HY2A 1YKAA 3D4TA 2PWJA 4YQVA 2HZEB 3CSHA 2PPTA 4ML1A 4KCEA 1GSFA 3CRUA 2GQKA 3HDCA 4WETA 2H6YA 4ISDA 3P7XA 2GSRA 2VO4A 3GUSA 4TR1B 3L0HA 3Q19A 5D93A 1U87A 1SD8A 1GUHA 3EWLA 1M7TA 1K0CA 2G0FA 1FG4A 3IRAA 1XXUA 4PQ1A 4L0UA 5HR1A 1THOA 4Q5NA 3ZMLA 2H71A 1NM3A 2IMKA 5A4VA 3KCMA 2O85A 5IMCA 1B9XC 1VF2A 2VLVA 1B9YC 3ZIJA 1OYJA 2RUFA 4MPGA 1QGVA 2XPDA 1F37A 3LXTA 3EVIA 4ILFA 4K7NA 1GUMA 1SJ6A 1J9BA 2HSHA 5DJLA 3PR8A 1G0TA 4GCIA 1Z7RA 5AISA 1AAZA 3ERWA 2R4VA 3QFBC 1EV9A 2BJXA 2C0EA 4PXOA 1TK8B 3F9UA 1EWXA 3D4MA 4G2EA 3TRXA 3WT2A 4J56E 3ZTLA 4YQMA 3DKSA 3G9BA 4K0NA 4AJ8A 2LNTA 5IO0A 4LL4B 1MD3A 4ULXA 5CRDA 3E9JB 3FK8A 3KTBA 2C0DA 1E2YA 2DMLA 2XPEA 2VOCA 8GSSA 3VLNA 2KP2A 3M3MA 5ECNB 4NV2A 2I1UA 1TU8A 3KM6A 1F6MC 2Z9SA 4EKZA 4GSNA 2DLXA 3TJGA 1SKSB 5HFGA 6GSUA 4FYUA 1JHBA 1FW1A 2CZ2A 3QR6A 4BL7A 2DJ3A 1FOVA 1PX7A 1PMTA 4AJ7A 1H75A 3QD9A 2MZCA 4G9HA 14GSA 2IL3A 5KN1A 2VLTA 3VPTA 3DVWA 3IA1A 6GSVA 1PRXA 3GSSA 4POMA 2X99A 3L4NA 3C8EA 4PNFA 2L59A 2EIQA 4RI7A 5CP1A 1XFLA 2HFDA 2TIRA 4GLTA 1MEKA 4MK3A 1TKDB 3GA4A 2LRTA 2LQQA 4ZL7A 1T3BA 4F2IA 3CMIA 1AW9A 4OWYA 4POLA 2LJRA 3ME7A 4F03A 3WT1A 1TDIA 1PGTA 4MJAA 3BBYA 12GSA 1OE7A 3WGDA 2V2GA 1ZYQB 1YJ6A 1C72A 2RM5A 1PQNA 1M2BA 3D6IA 1JZDA 1XIYA 5IOWA 3R2QA 1TTZA 4ZBDA 1GRXA 2ALBA 3KZQA 1TRWA 1DSBA 1VRSD 2VM2A 1SL0B 4O92A 3DEXA 1X5DA 4EVMA 3TGZA 3ZREA 2B1KA 4Q5RA 3CYNA 1T8EB 1CQGA 1M99A 3WGEA 4FYCA 2WGRA 4K2DA 3GHAA 2MMNA 3OR5A 3LYKA 2OBKA 2PN8A 3U5RE 2FY6A 5IMDA 2CVKA 4HJMA 3ZVJA 1EV4A 3EC3A 2L57A 3EYTA 2GQLA 4DSSB 5DCHA 5C04A 2CAQA 2H1GA 1GNEA 4NWYA 1GTAA 2MMZA 5DAKA 1T4ZA 1ERWA 4KGIA 4RUVA 2WFCA 5ABRA 5ECIB 2CA8A 2LUSA 3O6TA 4X43A 4JBBA 3WD6A 2YPMA 4PQIA 2VM1A 2H1DA 3L9UA 2FCHA 5DQSA 1U3AA 4IW9A 4LLRA 5J9CA 4GXZA 2I9HA 20GSA 4XS4B 5ECPB 4TW5A 2C3TA 2EIOA 3UOMA 4XS1A 2F8FA 1V57A 4YQUA 4I2TA 2DIZA 2V1MA 1YQ1A 4TRXA 5EL8A 4OO4A 2E7PA 5IIZA 1XWKA 1FAAA 1ZL9A 5DDLA 4TXVA 3ZVJD 3IK7A 2XC2A 3US3A 3TOUA 3KGKA 2GT5A 2KUCA 4F0CA 4X0XA 2FA4A 4OO5A 4PGTA 1M2AA 2C0GA 3QDNA 4ZL8A 5D8IA 3F63A 3F4RA 5GAND 3LFLA 4I97A 1X5CA 3EU3A 3CTGA 4MDCA 2LRCA 3H79A 2MYGA 3BCIA 3RHCA 1AUCA 1V58A 3K8NA 3GFKA 1OC9B 2QSIA 3RHBA 3VK9A 4OD7A 1GSDA 4OMVA 3L9VA 5CRHA 4OCEA 5GSTA 1OC8A 3TRPA 1XVQA 3P8WA 2H30A 2LEGA 4J2FA 2DJ1A 1QK8A 3D0ZA 4L5OA 2H76A 4V1Ag 3Q6OA 3IPZA 3VWVA 2R37A 2OADA 1JZRA 3IOSA 4HI7A 5GZZB 22GSA 2YOIA 2WS2A 3FYGA 2JACA 1XWAA 1A0FA 1SD9A 3KXOA 4DSQA 2O7KA 1K3LA 4TN8A 1FVKA 2IFQB 2WZ9A 1Z9HA 6GSYA 3DD3A 1AQVA 2H6ZA 1ACVA 1U3IA 5DBQA 2YANA 1TK5B 1BYEA 4AGSA 3IBHA 2FWEA 3NIVA 2LSTA 1BJXA 1BQ7A 5GSSA 4EDYA 4O32A 1GTUA 3GKNA 1ILOA 4MABA 2YJ7A 3HZ8A 2A4VA 3M0FA 1SYRA 3IR4A 3J7Yk 1J0FA 4N0ZA 1GSUA 4PQHA 2AB6A 3H4KA 2RLIA 1XZOA 4ZBAA 2GLRA 3F3QA 1GLPA 3F8UA 3LG6A 4F0BA 1J08A 4FYBA 2DBCA 2FHEA 2PERA 3BCKA 4HOJA 1HYUA 1O6JA 1SJZA 5ECHB 2DMMA 2KHPA 4BWQA 4HZ2A 3HVXA 5J5NA 3RPPA 1MDIA 3KIJA 1MD4A 2LRNA 4MH3A 4TR4A 1SK2A 4BVYA 4I6XA 3EMXA 3RAZA 2R3XA 5J4UA 1OC9A 4HQSA 3CSJA 4POBA 1X9MB 2IMIA 4NPBA 2K6VA 1K0BA 3DYRA 4WR4A 4ZIJA 1GTIA 5H5QA 3BOAA 1XVWA 1TRVA 2FA8A 1PKZA 5A4UA 3WGXA 1USBA 4D73A 4V1Ap 3TB2A 2TRCP 1A8YA 1O8XA 3W8JA 3H1NA 2E0QA 2H19A 4HU7A 1SYXA 3LXZA 1JLWA 2NVLA 4HS1A 4IQAA 1FB0A 3IHQA 4MZCA 4QL9A 2KOKA 4EO3A 2OE0A 1OVNA 1K3YA 5ECLB 3QCPA 1BX9A 3W6GA 2K9FA 4Q5QA 2R5GA 1X0RA 6GSSA 3FR3A 4QL7A 4H86A 1VF3A 1XOAA 2DSAA 2OE3A 4GSTA 1ERVA 1O73A 3C71A 1Q98A 1KTEA 4KUNA 4K6XA 1WP0A 3KH7A 3NOFA 4WEYA 3FZAA 4MH2A 2LKUA 3ZZXA 5CRGA 4CHSA 5JWOB 4LA1A 4KB3A 2HI7A 2YV9A 5KEJA 2GZPA 4TOPA 3GH9A 4WR5A 4LMVA 1OC3A 1A2LA 2O87A 2VD0A 2WJUA 1X5EA 4TR3A 4GWRA 1H4OA 2L4QA 3FKFA 4G19A 2H72A 5IO2A 3QOUA 4KDUA 3UIWA 5AIXA 5G30A 1B48A 3QMXA 2N5BA 2R6KA 5G31A 4ECJA 2IJYA 1U88A 1R5PA 5JWQB 2VL2A 2ON5A 3D22A 2P5RA 4L0WA 3QAGA 2IMDA 2NPBA 2M72A 5A4WA 2BTOT 5CREA 5DVBA 6GSXA 3FW2A 2XBQA 4HDEA 4XTSA 1R5AA 1EGOA 1SJIA 2B1LA 5DAKB 1PL2A 3I69A 3SWLA 4EL1A 1BAYA 3L78A 2XBIA 4KCAA 2HE3A 2FWFA 4IHUA 1XW5A 5F8BA 5DJMA 5KN0A 5LNKe 1TI1A 2IPAA 2GZYA 3M1GA 4NXIA 5ID2A 1WOUA 2GTUA 2PVOC 3F0IA 2JZTA 1IYHA 5HFKA 3HXSA 2YWMA 1FB6A 5ELAA 3FR9A 5A5KA 1X9WB 3KMOA 2B5EA 3UEMA 3A3TA 2A2SA 3GSTA 3ZYWA 1F2EA 3EINA 4QQ7A 1TP9A 4TR0A 3GX0A 3TJFA 4MA9A 4N30A 3CXGA 3A5WA 5HR3A 2NTOA 2HRNA 3KJYA 2PMTA 2YZUA 4BVXA 2OACA 3TJBA 3TRQA 3GRXA 3CTFA 4ZBBA 4K7OA 2C8UA 2DJJA 2LV3A 4JEDA 4K0GA 1ST9A 3TOTA 1TXXA 4XCSA 3GL5A 4TVEA 3CRTA 2M46A 1A2JA 1TK0B 3FRCA 3UAPA 3HVVA 3HCZA 1DE1A 3BJ5A 2VCTA 1AQWA 1XW9A 3CSIA 1Z3EA 2A2RA 2HNLA 3ZLPA 2CZ3A 2F8AA 2C1YA 4Q5FA 3M9KA 2DJKA 5H5SA 5FT3A 3HYPA 3D5JA 5ELGA 1A8LA 1T4YA 2C3QA 4EF0A 2G2QA 1TRUA 2VL9A 2LNSA 1QXHA 2VAFA 4EUYA 3VWWA 3ZITA 1HNCA 5ECQB 3C1RA 1DUGA 3GH6A 1G7EA 3TCOA 5G5FA 1Q4JA 4YAPA 3UVHA 1WE0A 3CBUA 5B6MA 4IJIA 1AQXA 5G5EA 1XBSA 1RK4A 1THXA 4YAVA 1JZOA 3GKKA 2GGTA 4JZQA 5KN2A 2C3NA 2L6CA 2FWGA 1QMVA 1TI3A 1Z6NA 3KH9A 3IV4A 4EXJA 5CYYA 3MSZA 2VD1A 3VPQA 1VGLA 3MNGA 4OFTA 1YKCA 1YZXA 2JADA 4MPFA 5EPFA 3FZ4A 2H1BA 2VL2C 5D96A 5EY6A 1O85A 6GSTA 2HYXA 2K18A 2H01A 1B4QA 3VWXA 1SKWB 1ERTA 2J9HA 2PVQA 3E0UA 4WXTA 1ZYEA 3GYKA 4HU9A 3DMLA 4N10A 4DVCA 2CVBA 3GURA 3TKSE 3GMFA 5D9WA 4KA0A 4XRAA 2GQMA 5DQYA 2EC4A 3KTLA 2OBIA 4GQCA 5IPHA 3ZRDA 3TKRA 1UN2A 3UJ1A 4K8MA 2AJQB 5IMZA 1ERUA 3C1SA 1EP7A 1GLQA 1TJDA 4ZILA 1A24A 1GH2A 4O5RA 2IWTA 4D73B 1URMA 3HHVA 1LU4A 2N5AA 4LL1B 1BEDA 4E8HA 2C80A 1A23A 4RQXA 4ML6A 3O76A 4JR4A 5HR0A 3VWUA 1UVZA 1PA3A 2QC7A 1JFUA 1GSQA 4WBRD 3F3RA 4KDYA 1E6BA 3NZNA 2NBSA 17GSA 5J3RA 4NAXA 4OFNA 1UA5A 4WKWA 2VUPA 2X8GA 5IMVA 1TRSA 4CW9A 4POKA 3IXRA 1G6WA 3ERGA 1XWBA 4ID0A 3IE3A 2GSTA 3FR6A 2VCXA 2FWHA 2AV4A 1HNAA 2HZFA 1V98A 4WF5A 3F4TA 3DGQA 5D9XA 1OAZA 5INYA 1GL8A 2BMXA 2ZUPA 4I5QA 3A2VA 4EDZA 4FH8A 3A2XA 2X64A 4DSRA 1RW1A 1EOHA 2VIMA 3UMAA 2IIYA 1LJRA 5B8BA 3IC4A 3FZ9A 4BPYA 3F6DA 4MF7A 5ECOB 4GTUA 1UC7A 3Q18A 11GSA 1KNGA 2VL3A 4G10A 1N8JA 4ZB8A 2ON7A 2HRFA 1GSEA 1HNBA 4HUAA 4MJEA 1EOGA 2YNXA 4WF4A 5JWRB 2CX3A 3RBTA 2PU9C 1NSWA 4BA7A 1ML6A 3ME8A 4XHMA 2E2GA 4KW6A 2PGTA 4KAEA 5ECKB 18GSA 4RQRA 3U6VA 1N2AA 3TDGA 1YY7A 2NDOA 2VCVA 1B8XA 3ERFA 2JZRA 4DEJA 2ES7A 4AJ6A 4YH2A 3WYWA 1B4PA 2KP1A 3HJMA 3FHKA 2JL4A 2RUEA 1ZZYA 2DIYA 1GTBA 3KD0A 3EU4A 4ECBA 3APSA 5JCWA 4JU5A 2AYTA 1WIKA 3IK9A 3APOA 4TKYA 2QGVA 4RI6A 4JR6A 2P31A 2DC5A 2RM6A 4PNGA 4MP4A 4K1FA 4TXOB 5G2ZA 2AUVA 1PN9A 5HR2A 19GSA 2V41A 2N5FA 1ABAA 4IP6A 1ZOFA 5LD0A 1XPVA 3KP8A 4KH7A 2HLSA 4NMUA 1OE8A 4MMMA 3UBKA 4KX4A 3MAKA 5ID2B 3LSZA 1G6YA 1LBKA 1YEPA 1MDJA 3PGTA 4OCFA 3N9JA 3EMPA 2L5LA 1XWCA 3UARA 1W4VA 1PSQA 3F4SA 3LEFA 4L8EA 1ZCPA 1U6TA 5CNWA 4ZXGA 3LGCA 2FD3A 3PINA 1Z7PA 1SU9A 1OKDA 3D21A 4NV5A 3C73A 5CAXA 3TKPA 2CV4A 4N0VA 1WPIA 4KSOA 1I5GA 5IMAA 1DE2A 2X8HA 2RIIA 4MLYA 1NW2A 1CQHA 1EEJA 2IMFA 1WWJA 2FGXA 3O3TA 5L71A 4KNDA 1TOFA 5DALA 3H93A 4HEA2 5F05A 2JZSA 2DJ0A 2LJKA 3ZFBA 5AGYA 3V1WA 4BWSA 3VFIA 2IMEA 1T7PB 1XWGA 1F3BA 4NHWA 1WJKA 1T00A 1QQ2A 4CDOA 2GS3A 4IVFA 5ECRB 5G1LA 4ECIA 3F6FA 5GAPD 1SENA 2AHEA 3HVSA 5COHA 1DBYA 3TKSA 2YWNA 1EGRA 1F9MA 4MF5A 3GV1A 2D2ZA 3UL3A 2YCDA 2HT9A 5HQPA 4GF0A 3G7YA 1PD21 1Z6MA 1R4WA 3QAVA 2V6KA 2MBTA 3M8NA 3ED3A 1R7HA 1F3AA 2YWOA 5FHIA 1EEMA 2HXKA 2H6XA 1RQMA 5AIVA 1QUWA 4TXOA 3HKRA 2CT6A 2LTKA 2WDUA 4V2NA 2VCWA 3FY7A 2HZEA 5EVOA 5CO3A 2IN3A 2DJ2A 1T1VA 1M2DA 3VURA 1IYIA 1R26A 2P5QA 1FVJA 3KP9A 5IM9A 3QPMA 2JSZA 4TR1A 2JSYA 1GSYA 2EIRA 4IBPA 5B6NA 2OKAA 2WULA 2P0GA 4PUAA 1VF4A 2I4AA 1GP1A 3TKQA 3GIXA 16GSA 3EURA 1AC1A 4EE0A 1TW9A 4ZB9A 3TJKA 2REMA 1K0OA 5F06A 4N11A 5JCUA 5B8AA 3HA9A 4MF6A 6GSWA 2B7JA 2L6DA 1S3DA 4V2MA 4IKHA 1V2AA 3KMNA 1PX6A 4LMWA 9GSSA 3E3EA 4PX1A 1A2MA 3UBLA 1M9AA 1OKTA 2K8SA 2LQOA 2WRTA 2WB9A 4O7HA 3J7Yb 2VLUA 2B7KA 5FWGA 4V2LA 4HJ2A 1O7UA 5KN3A 5C00A 1MTCA 3VI5A 3QAWA 2J23A 1A0RP 3QFAC 1SKRB 3EE2A 2JU5A 5D73A 3JCML 2YV7A 5E4WA 3ISOA 1S3CA 4JE1A 3ZFLA 2OA7A 4OFMA 4WBJA 5CRWA 3DXBA 2GSQA 1V9WA 1PL1A 1I9DA 3H8QA 3UVTA 4P3YB 3I6AA 4NHZA 2F9SA 3RPNA 2LJAA 2O8VB 4X1UA 1YF0A 5JCGA 2H0IA 3DIEA 2MMOA 1EP8A 3AY8A 3M9JA 4XS6A 1W89A 5D9VA 1AIUA 2CVDA 1GWCA 4PURA 3ZL5A 13GSA 1WRYA 3GL3A 5IPGA 3A2WA 3W8SA 3LORA 1SK1A 5ECSA 4IJ3A 2QKEA 5DCGA 3HJOA 1EZKA 1JZWA 3GKXA 2KLXA 3MWHA 4ACSA 2B5XA 4XIHA 4IS0A 4IELA 5ENUA 2V32A 2GT6A 5ECMB 3LJRA 3SBCA 3TKSC 3GTUB 2PBJA 2OE1A 2H0HA 2WCIA
chains in the Genus database with same CATH superfamily
1M0UA 2M80A 2X8CA 5E59A 2E2MA 4HQZA 5H5RA 1GULA 7GSSA 2FNOA 2PUKC 5IQYA 3ZMKA 1GSSA 4I8BA 2MBSA 1G7OA 3FZ5A 1VF1A 5AN1A 1BG5A 3LWAA 2L4CA 4F82A 3TUEA 4K7IA 4I2UA 2LS5A 1KEBA 2AAWA 2O89A 4IGJA 3Q74A 3MDKA 1PKWA 1JLVA 1WMJA 1HD2A 10GSA 2CAIA 2F51A 4MZBA 5LCZA 4Z7XA 2HSYA 2CQ9A 3L9SA 2GDRA 4L5LA 4ZL9A 3GN3A 4ZB6A 1GUKA 1SL1B 4MJCA 1Z5YE 2YJHA 4ECCA 1M9BA 3C7MA 3HJPA 3I43A 2H8LA 4IP1A 2YWIA 3PH9A 1HQOA 2B3SA 3P2AA 2TRXA 4EC0A 2H66A 4DSSA 4GRFA 1S3AA 3HZ4A 1YF1A 4GSSA 1XOBA 4A5PA 5HFIA 1PN0A 5B7CA 4GQFA 5J41A 4F9ZA 4J57E 4KE3A 3APQA 1NHOA 1FHEA 1Y6EA 1ZGNA 2V6OA 2H74A 1YEXA 1AXDA 1ZMAA 3LQ7A 4FO5A 3S9FA 1V40A 3CQFA 2B6MA 4XS4A 3MIXA 2H75A 1K0NA 2GZZA 1GNWA 2FUG2 3GTUA 2H0GA 1XW6A 4X4JA 3IHGA 3P90A 2CX4A 4IQ1A 3HD5A 4MCUA 1O8WA 2B5YA 3I9V2 3DVXA 4PUFC 1TU7A 1NHYA 4FIWA 3BD2A 3FEUA 1QFNA 1XCCA 4MZWA 1MDKA 5J9BA 2YZHA 3GKMA 4MJBA 3DWVA 5G1KA 2H73A 5DALB 1FO5A 3N5OA 4IN0A 3IAS2 5F0GA 1O81A 2H1AA 4KF9A 2R2JA 1ON4A 2H70A 2VCZA 3IAM2 1YDKA 4MNNA 3ZIVA 4XRDA 2L5OA 3IC8A 1K0MA 2MMAA 5D9TA 3TJJA 5IMFA 3GX8A 4JRRA 4E8EA 2VCQA 5IOXA 3GNJA 2K8VA 2FLSA 4HZ4A 3RDWA 3G7IA 1K0DA 2ZNMA 1X9SB 1SK0A 1Y25A 2I3YA 4KSMA 3LYPA 4KDXA 2F3MA 3VI7A 2OJLA 2XHFA 1K3OA 3G7JA 2C0FA 3KEBA 5F07A 2I81A 1K0AA 1KBNA 2GVPA 2IFQA 1SL2B 2ZCTA 2GSSA 2YP6A 4BL7B 3DRNA 2YN1A 2C4JA 3IDVA 4K9ZA 4AF2A 3HY2A 1YKAA 3D4TA 2PWJA 4YQVA 2HZEB 3CSHA 2PPTA 4ML1A 4KCEA 1GSFA 3CRUA 2GQKA 3HDCA 4WETA 2H6YA 4ISDA 3P7XA 2GSRA 2VO4A 3GUSA 4TR1B 3L0HA 3Q19A 5D93A 1U87A 1SD8A 1GUHA 3EWLA 1M7TA 1K0CA 2G0FA 1FG4A 3IRAA 1XXUA 4PQ1A 4L0UA 5HR1A 1THOA 4Q5NA 3ZMLA 2H71A 1NM3A 2IMKA 5A4VA 3KCMA 2O85A 5IMCA 1B9XC 1VF2A 2VLVA 1B9YC 3ZIJA 1OYJA 2RUFA 4MPGA 3HVNA 1QGVA 2XPDA 1F37A 3LXTA 3EVIA 4ILFA 4K7NA 1GUMA 1SJ6A 1J9BA 2HSHA 5DJLA 3PR8A 1G0TA 4EIPA 4GCIA 1Z7RA 2R0CA 5AISA 1AAZA 3ERWA 2R4VA 3QFBC 1EV9A 2BJXA 2C0EA 4PXOA 1TK8B 3F9UA 1EWXA 3D4MA 4G2EA 3TRXA 3WT2A 3LW9A 4J56E 3ZTLA 4YQMA 3DKSA 4HSCX 3G9BA 4K0NA 4AJ8A 2LNTA 5IO0A 4LL4B 1MD3A 4ULXA 5CRDA 3E9JB 3FK8A 3KTBA 2C0DA 1E2YA 2DMLA 2XPEA 2VOCA 8GSSA 3VLNA 2KP2A 3M3MA 2X49A 5ECNB 4NV2A 2I1UA 1TU8A 3KM6A 1F6MC 2Z9SA 4EKZA 4GSNA 2DLXA 3TJGA 1SKSB 5HFGA 6GSUA 4FYUA 1JHBA 1FW1A 2CZ2A 3QR6A 4BL7A 2DJ3A 1FOVA 1PX7A 1PMTA 4AJ7A 1H75A 3QD9A 2MZCA 4G9HA 14GSA 2IL3A 5KN1A 2VLTA 3VPTA 3DVWA 3IA1A 6GSVA 1PRXA 3GSSA 4POMA 2X99A 3L4NA 3C8EA 4PNFA 2L59A 2EIQA 2R0PA 4RI7A 5CP1A 1XFLA 2HFDA 2TIRA 4GLTA 1MEKA 4MK3A 1TKDB 3GA4A 2LRTA 3FMWA 2LQQA 4ZL7A 1T3BA 4F2IA 3CMIA 1AW9A 4OWYA 4POLA 2LJRA 3ME7A 4F03A 3WT1A 1TDIA 1PGTA 4MJAA 3BBYA 12GSA 1OE7A 3WGDA 2V2GA 1ZYQB 1YJ6A 1C72A 2RM5A 1PQNA 1M2BA 3D6IA 1JZDA 1XIYA 5IOWA 3R2QA 1TTZA 4ZBDA 1GRXA 2ALBA 3KZQA 1XG8A 1TRWA 1DSBA 1VRSD 2VM2A 1SL0B 4O92A 3DEXA 1X5DA 4EVMA 3TGZA 3ZREA 2B1KA 4Q5RA 3CYNA 1T8EB 1CQGA 1M99A 3WGEA 4FYCA 2WGRA 4K2DA 3GHAA 2MMNA 3OR5A 3LYKA 2OBKA 2PN8A 3U5RE 2FY6A 5IMDA 2CVKA 4HJMA 3ZVJA 1EV4A 3EC3A 2L57A 3EYTA 2GQLA 4DSSB 5DCHA 5C04A 2CAQA 2H1GA 1GNEA 4NWYA 1GTAA 2MMZA 5DAKA 1T4ZA 1ERWA 4KGIA 4RUVA 2WFCA 5ABRA 5ECIB 2CA8A 2LUSA 5BMUA 3O6TA 4X43A 4JBBA 3WD6A 2YPMA 4PQIA 2VM1A 2H1DA 3L9UA 2FCHA 5DQSA 1U3AA 4IW9A 4LLRA 5J9CA 4GXZA 2I9HA 20GSA 4XS4B 5ECPB 4TW5A 2C3TA 2EIOA 3UOMA 4XS1A 2F8FA 1V57A 4YQUA 4I2TA 2DIZA 2V1MA 4G0KA 1YQ1A 4TRXA 5EL8A 4OO4A 2E7PA 5IIZA 1XWKA 1FAAA 1ZL9A 2QA2A 5DDLA 4TXVA 3ZVJD 3IK7A 2XC2A 3US3A 3TOUA 3KGKA 2GT5A 2KUCA 4F0CA 4X0XA 2FA4A 4OO5A 4PGTA 1M2AA 2C0GA 3QDNA 4ZL8A 2A2PA 5D8IA 5KOXA 3F63A 3F4RA 5GAND 3LFLA 4I97A 1X5CA 3EU3A 4MDCA 3CTGA 4Z2RA 2LRCA 3H79A 2MYGA 3BCIA 3RHCA 1AUCA 1V58A 3K8NA 3GFKA 1OC9B 2QSIA 3RHBA 3VK9A 4OD7A 1GSDA 4OMVA 3L9VA 5CRHA 4OCEA 5GSTA 1OC8A 3TRPA 1XVQA 3P8WA 2H30A 2LEGA 4J2FA 2DJ1A 3MYDA 1QK8A 3D0ZA 4L5OA 2H76A 4V1Ag 3Q6OA 3IPZA 3VWVA 2R37A 2OADA 1JZRA 3IOSA 4HI7A 5GZZB 22GSA 2YOIA 2WS2A 3FYGA 2JACA 1XWAA 1A0FA 1SD9A 3KXOA 4DSQA 2O7KA 1K3LA 4TN8A 1FVKA 2IFQB 3R3EA 2WZ9A 1Z9HA 6GSYA 3DD3A 1AQVA 2H6ZA 1ACVA 1U3IA 5DBQA 2YANA 1TK5B 1BYEA 4AGSA 3IBHA 2FWEA 3NIVA 2LSTA 1BJXA 1BQ7A 5GSSA 4EDYA 4O32A 1GTUA 3GKNA 1ILOA 4MABA 2YJ7A 3HZ8A 2A4VA 3M0FA 1SYRA 3IR4A 3J7Yk 1J0FA 4N0ZA 1GSUA 4PQHA 2AB6A 3H4KA 2RLIA 1XZOA 4ZBAA 2GLRA 1ZYNA 3F3QA 1GLPA 3F8UA 3LG6A 3PPUA 4F0BA 1J08A 4FYBA 2DBCA 4CY6A 2FHEA 2PERA 3BCKA 4HOJA 1HYUA 1O6JA 1SJZA 5ECHB 2DMMA 2KHPA 4BWQA 4HZ2A 3HVXA 5J5NA 3RPPA 1ZYPA 1MDIA 3KIJA 1MD4A 2LRNA 4MH3A 4TR4A 1SK2A 4BVYA 4I6XA 3EMXA 3RAZA 2R3XA 5J4UA 1OC9A 4HQSA 3A5IA 3CSJA 4POBA 1X9MB 2IMIA 4NPBA 2K6VA 1K0BA 3DYRA 4WR4A 4ZIJA 1GTIA 5H5QA 4EIQA 3BOAA 1XVWA 1TRVA 2FA8A 1PKZA 5A4UA 3WGXA 1USBA 4D73A 4V1Ap 3TB2A 2TRCP 1A8YA 1O8XA 3W8JA 3H1NA 2E0QA 2H19A 4HU7A 1SYXA 3LXZA 1JLWA 2NVLA 4HS1A 4IQAA 1FB0A 3IHQA 4MZCA 4QL9A 2KOKA 4EO3A 2OE0A 1OVNA 1K3YA 5ECLB 3QCPA 1BX9A 3W6GA 2K9FA 4Q5QA 2R5GA 1X0RA 6GSSA 3FR3A 4QL7A 4H86A 1VF3A 1XOAA 2DSAA 2OE3A 4GSTA 1ERVA 1O73A 3C71A 1Q98A 1KTEA 4KUNA 4K6XA 1WP0A 3KH7A 3NOFA 4WEYA 3FZAA 4MH2A 2LKUA 3ZZXA 5CRGA 4CHSA 5JWOB 4LA1A 4K5RA 4KB3A 2HI7A 2YV9A 5KEJA 2GZPA 4Z2UA 4TOPA 3GH9A 4WR5A 4LMVA 1OC3A 1A2LA 2O87A 2VD0A 2WJUA 1X5EA 4TR3A 2HRKA 4GWRA 1H4OA 2L4QA 3FKFA 4G19A 4YKGA 2H72A 4K5SA 5IO2A 3QOUA 4KDUA 3UIWA 5AIXA 5G30A 1B48A 4O5UA 3QMXA 2N5BA 2R6KA 5G31A 4ECJA 2IJYA 1U88A 1R5PA 5JWQB 2VL2A 2ON5A 3D22A 2P5RA 4L0WA 1S3RA 3QAGA 2IMDA 2NPBA 4BIKA 2M72A 5A4WA 2BTOT 4FQUA 5CREA 5DVBA 6GSXA 3FW2A 2XBQA 4HDEA 4XTSA 1R5AA 1EGOA 1SJIA 2B1LA 5DAKB 1PL2A 3I69A 3SWLA 4EL1A 1BAYA 3L78A 2XBIA 4KCAA 2HE3A 2FWFA 4IHUA 1XW5A 5F8BA 5DJMA 5KN0A 5LNKe 1TI1A 2IPAA 2GZYA 3M1GA 4NXIA 5ID2A 1WOUA 2GTUA 2PVOC 3F0IA 2JZTA 1IYHA 5HFKA 3HXSA 2YWMA 1FB6A 5ELAA 3FR9A 5A5KA 2R0GA 1X9WB 3KMOA 2B5EA 3UEMA 3A3TA 2A2SA 3GSTA 3ZYWA 1F2EA 3EINA 4QQ7A 1TP9A 4TR0A 3GX0A 3TJFA 4MA9A 4N30A 3CXGA 3A5WA 5HR3A 2NTOA 2HRNA 3KJYA 2PMTA 2YZUA 5KOWA 4BVXA 2OACA 3TJBA 3TRQA 3GRXA 3CTFA 4ZBBA 4K7OA 2C8UA 2DJJA 2LV3A 4JEDA 4K0GA 1ST9A 3TOTA 1TXXA 4XCSA 3GL5A 4TVEA 3CRTA 2M46A 1A2JA 1TK0B 3FRCA 3UAPA 3HVVA 3HCZA 1DE1A 3BJ5A 2VCTA 1AQWA 1XW9A 3CSIA 1Z3EA 2A2RA 2HNLA 3ZLPA 2CZ3A 2F8AA 2C1YA 4Q5FA 3M9KA 2DJKA 5H5SA 5FT3A 3HYPA 3D5JA 5ELGA 1A8LA 1T4YA 2C3QA 4EF0A 2G2QA 1TRUA 2VL9A 2LNSA 1QXHA 2VAFA 4EUYA 3VWWA 3ZITA 1HNCA 5ECQB 3C1RA 4CY8A 1DUGA 3GH6A 1G7EA 3TCOA 5G5FA 1Q4JA 4YAPA 3UVHA 1WE0A 3CBUA 5B6MA 4IJIA 1AQXA 5G5EA 1XBSA 1RK4A 1THXA 4YAVA 1JZOA 3GKKA 2GGTA 4JZQA 5KN2A 2C3NA 2L6CA 2FWGA 1QMVA 1TI3A 1Z6NA 3KH9A 3IV4A 4EXJA 5CYYA 3MSZA 2VD1A 3VPQA 1VGLA 3MNGA 4OFTA 1YKCA 1YZXA 2JADA 4MPFA 5EPFA 3FZ4A 4USSA 2H1BA 2VL2C 5D96A 5EY6A 1O85A 6GSTA 2HYXA 2K18A 2H01A 1FOHA 2DKIA 1B4QA 3VWXA 1SKWB 1ERTA 2J9HA 2PVQA 3E0UA 4WXTA 1ZYEA 3GYKA 4HU9A 3DMLA 4N10A 4DVCA 2CVBA 3GURA 3TKSE 3GMFA 5D9WA 4KA0A 4XRAA 2GQMA 5DQYA 2EC4A 4BVYB 3KTLA 2OBIA 4GQCA 5IPHA 3ZRDA 3TKRA 1UN2A 3UJ1A 4K8MA 2AJQB 5BRTA 5IMZA 1ERUA 3C1SA 1EP7A 1GLQA 1TJDA 4ZILA 1A24A 1GH2A 4O5RA 2IWTA 4D73B 1URMA 3HHVA 1LU4A 2N5AA 4LL1B 1BEDA 4E8HA 2C80A 1A23A 4RQXA 4ML6A 3O76A 4JR4A 5HR0A 3VWUA 1UVZA 1PA3A 2QC7A 1JFUA 1GSQA 4WBRD 3F3RA 4KDYA 1E6BA 3NZNA 2NBSA 17GSA 5J3RA 4NAXA 4ICYA 4OFNA 1UA5A 4WKWA 2VUPA 2X8GA 5IMVA 1TRSA 4CW9A 4POKA 3IXRA 1G6WA 3ERGA 1XWBA 4ID0A 3IE3A 2GSTA 3FR6A 2VCXA 2FWHA 2AV4A 1HNAA 2HZFA 1V98A 4WF5A 3F4TA 3DGQA 5D9XA 1OAZA 5INYA 1GL8A 2BMXA 2ZUPA 4I5QA 3A2VA 4EDZA 4FH8A 3A2XA 2X64A 4DSRA 1RW1A 1EOHA 2VIMA 2A4HA 3UMAA 2IIYA 1LJRA 5B8BA 3IC4A 3FZ9A 4BPYA 3F6DA 4MF7A 5ECOB 4GTUA 1UC7A 3Q18A 11GSA 1KNGA 2VL3A 4G10A 1N8JA 4ZB8A 2ON7A 2HRFA 1GSEA 1HNBA 4HUAA 4MJEA 1EOGA 2YNXA 4WF4A 5JWRB 2CX3A 3RBTA 2PU9C 1NSWA 4BA7A 1ML6A 3ME8A 4XHMA 2E2GA 4G0IA 4KW6A 2PGTA 4KAEA 5ECKB 18GSA 4RQRA 3U6VA 1N2AA 3TDGA 1YY7A 2NDOA 2VCVA 1B8XA 3ERFA 2JZRA 4DEJA 2ES7A 4AJ6A 4YH2A 3WYWA 1B4PA 2KP1A 3HJMA 3FHKA 2JL4A 2RUEA 1ZZYA 2DIYA 1GTBA 3KD0A 3EU4A 4ECBA 3APSA 5JCWA 4JU5A 2AYTA 1WIKA 3IK9A 3APOA 4TKYA 2QGVA 4RI6A 4JR6A 2P31A 2DC5A 2RM6A 4PNGA 4MP4A 4K1FA 4TXOB 5G2ZA 2AUVA 1PN9A 5HR2A 19GSA 2V41A 2N5FA 1ABAA 4IP6A 1ZOFA 5LD0A 1XPVA 3KP8A 4KH7A 2HLSA 4NMUA 1OE8A 4MMMA 3UBKA 2QA1A 4KX4A 3MAKA 5ID2B 3LSZA 1G6YA 1LBKA 1YEPA 1MDJA 3PGTA 4OCFA 3N9JA 3EMPA 2L5LA 1XWCA 3UARA 1W4VA 1PSQA 3F4SA 3LEFA 4L8EA 1ZCPA 1U6TA 5CNWA 4ZXGA 3LGCA 2FD3A 3PINA 1Z7PA 1SU9A 1OKDA 3D21A 4NV5A 3C73A 5CAXA 3TKPA 2CV4A 4N0VA 4PTSA 1WPIA 4KSOA 1I5GA 4K2XA 5IMAA 1DE2A 2X8HA 2RIIA 4G0LA 4MLYA 1NW2A 3EPTA 1CQHA 4BVXB 1EEJA 2IMFA 1WWJA 2FGXA 3O3TA 5L71A 4KNDA 1TOFA 5DALA 3H93A 4HEA2 5F05A 2JZSA 2DJ0A 2LJKA 3ZFBA 5AGYA 3V1WA 4BWSA 3VFIA 2IMEA 1T7PB 1XWGA 1F3BA 4NHWA 1WJKA 1T00A 1QQ2A 4CDOA 2GS3A 4IVFA 5ECRB 5G1LA 4ECIA 3F6FA 5GAPD 1SENA 2AHEA 3HVSA 5COHA 1DBYA 3TKSA 1M3IA 2YWNA 1EGRA 1F9MA 4MF5A 3GV1A 2D2ZA 3UL3A 2YCDA 2HT9A 5HQPA 4GF0A 3G7YA 1PD21 1Z6MA 1R4WA 3QAVA 2V6KA 2MBTA 3M8NA 3ED3A 1R7HA 1F3AA 2YWOA 5FHIA 1EEMA 2HXKA 2H6XA 1RQMA 5AIVA 1QUWA 4TXOA 3HKRA 2CT6A 2LTKA 2WDUA 4V2NA 2VCWA 3FY7A 2HZEA 5EVOA 5CO3A 2IN3A 2DJ2A 1T1VA 1PFOA 1M2DA 3VURA 1IYIA 1R26A 2P5QA 1FVJA 3KP9A 5IM9A 3QPMA 2JSZA 4TR1A 2JSYA 1GSYA 2EIRA 4IBPA 5B6NA 2OKAA 2WULA 2P0GA 4PUAA 1VF4A 2I4AA 1GP1A 3TKQA 3GIXA 4Z2TA 16GSA 3EURA 1AC1A 4EE0A 1TW9A 4ZB9A 2HRAA 3TJKA 2REMA 1K0OA 5F06A 4N11A 5JCUA 5B8AA 3HA9A 4MF6A 6GSWA 2B7JA 2L6DA 1S3DA 4V2MA 4IKHA 1V2AA 3KMNA 1PX6A 4LMWA 9GSSA 3E3EA 4PX1A 1A2MA 3UBLA 1M9AA 1OKTA 2K8SA 2LQOA 2WRTA 2WB9A 4O7HA 3J7Yb 2VLUA 2B7KA 2UZ8A 5FWGA 4V2LA 4HJ2A 1O7UA 5KN3A 5C00A 1MTCA 3VI5A 2X4AA 3QAWA 4YKFA 2J23A 1A0RP 3QFAC 1SKRB 3EE2A 2JU5A 5D73A 3JCML 2YV7A 5E4WA 3ISOA 1S3CA 4JE1A 3ZFLA 2OA7A 4OFMA 4WBJA 5CRWA 3DXBA 2GSQA 1V9WA 1PL1A 1I9DA 3H8QA 3UVTA 4P3YB 3I6AA 4NHZA 2F9SA 3RPNA 2LJAA 2O8VB 4X1UA 1YF0A 5JCGA 2H0IA 3DIEA 2MMOA 1EP8A 3AY8A 3M9JA 4XS6A 1W89A 5D9VA 1AIUA 2CVDA 1GWCA 4PURA 3ZL5A 13GSA 1WRYA 3GL3A 5IPGA 3A2WA 3W8SA 3LORA 1SK1A 1M3JA 5ECSA 4IJ3A 2QKEA 5DCGA 3HJOA 4O5QA 1EZKA 1JZWA 3GKXA 2KLXA 3MWHA 4ACSA 2HSMA 2B5XA 2DKHA 4XIHA 4IS0A 4IELA 5ENUA 2V32A 2GT6A 5ECMB 3LJRA 3SBCA 3TKSC 3GTUB 2PBJA 2OE1A 2H0HA 2WCIA
chains in the Genus database with same CATH topology
1M0UA 2M80A 2X8CA 5E59A 2E2MA 4HQZA 5H5RA 1GULA 7GSSA 2FNOA 2PUKC 5IQYA 3ZMKA 1GSSA 4I8BA 2MBSA 1G7OA 3FZ5A 1VF1A 5AN1A 1BG5A 3LWAA 2L4CA 4F82A 3TUEA 4K7IA 4I2UA 2LS5A 1KEBA 2AAWA 2O89A 4IGJA 3Q74A 3MDKA 1PKWA 1JLVA 1WMJA 1HD2A 10GSA 2CAIA 2F51A 4MZBA 5LCZA 4Z7XA 2HSYA 2CQ9A 3L9SA 2GDRA 4L5LA 4ZL9A 3GN3A 4ZB6A 1GUKA 1SL1B 4MJCA 1Z5YE 2YJHA 4ECCA 1M9BA 3C7MA 3HJPA 3I43A 2H8LA 4IP1A 2YWIA 3PH9A 1HQOA 2B3SA 3P2AA 2TRXA 4EC0A 2H66A 4DSSA 4GRFA 1S3AA 3HZ4A 1YF1A 4GSSA 1XOBA 4A5PA 5HFIA 1PN0A 5B7CA 4GQFA 5J41A 4F9ZA 4J57E 4KE3A 3APQA 1NHOA 1FHEA 1Y6EA 1ZGNA 2V6OA 2H74A 1YEXA 1AXDA 1ZMAA 3LQ7A 4FO5A 3S9FA 1V40A 2B6MA 4XS4A 3MIXA 2H75A 1K0NA 2GZZA 1GNWA 2FUG2 3GTUA 2H0GA 1XW6A 4X4JA 3IHGA 3P90A 2CX4A 4IQ1A 3HD5A 4MCUA 1O8WA 2B5YA 3I9V2 3DVXA 4PUFC 1TU7A 1NHYA 4FIWA 3BD2A 3FEUA 1QFNA 1XCCA 4MZWA 1MDKA 5J9BA 2YZHA 3GKMA 4MJBA 3DWVA 5G1KA 2H73A 5DALB 1FO5A 3N5OA 4IN0A 3IAS2 5F0GA 1O81A 2H1AA 4KF9A 2R2JA 1ON4A 2H70A 2VCZA 3IAM2 1YDKA 4MNNA 3ZIVA 4XRDA 2L5OA 3IC8A 1K0MA 2MMAA 5D9TA 3TJJA 5IMFA 3GX8A 4JRRA 4E8EA 2VCQA 5IOXA 3GNJA 2K8VA 2FLSA 4HZ4A 3RDWA 3G7IA 1K0DA 2ZNMA 1X9SB 1SK0A 1Y25A 2I3YA 4KSMA 3LYPA 4KDXA 2F3MA 3VI7A 2OJLA 2XHFA 1K3OA 3G7JA 2C0FA 3KEBA 5F07A 2I81A 1K0AA 1KBNA 2GVPA 2IFQA 1SL2B 2ZCTA 2GSSA 2YP6A 4BL7B 3DRNA 2YN1A 2C4JA 3IDVA 4K9ZA 4AF2A 3HY2A 1YKAA 3D4TA 2PWJA 4YQVA 2HZEB 3CSHA 2PPTA 4ML1A 4KCEA 1GSFA 3CRUA 2GQKA 3HDCA 4WETA 2H6YA 4ISDA 3P7XA 2GSRA 2VO4A 3GUSA 4TR1B 3L0HA 3Q19A 5D93A 1U87A 1SD8A 1GUHA 3EWLA 1M7TA 1K0CA 2G0FA 1FG4A 3IRAA 1XXUA 4PQ1A 4L0UA 5HR1A 1THOA 4Q5NA 3ZMLA 2H71A 1NM3A 2IMKA 5A4VA 3KCMA 2O85A 5IMCA 1B9XC 1VF2A 2VLVA 1B9YC 3ZIJA 1OYJA 2RUFA 4MPGA 1QGVA 2XPDA 1F37A 3LXTA 3EVIA 4ILFA 4K7NA 1GUMA 1SJ6A 1J9BA 2HSHA 5DJLA 3PR8A 1G0TA 4EIPA 4GCIA 1Z7RA 2R0CA 5AISA 1AAZA 3ERWA 2R4VA 3QFBC 1EV9A 2BJXA 2C0EA 4PXOA 1TK8B 3F9UA 1EWXA 3D4MA 4G2EA 3TRXA 3WT2A 3LW9A 4J56E 3ZTLA 4YQMA 3DKSA 3G9BA 4K0NA 4AJ8A 2LNTA 5IO0A 4LL4B 1MD3A 4ULXA 5CRDA 3E9JB 3FK8A 3KTBA 2C0DA 1E2YA 2DMLA 2XPEA 2VOCA 8GSSA 3VLNA 2KP2A 3M3MA 2X49A 5ECNB 4NV2A 2I1UA 1TU8A 3KM6A 1F6MC 2Z9SA 4EKZA 4GSNA 2DLXA 3TJGA 1SKSB 5HFGA 6GSUA 4FYUA 1JHBA 1FW1A 2CZ2A 3QR6A 4BL7A 2DJ3A 1FOVA 1PX7A 1PMTA 4AJ7A 1H75A 3QD9A 2MZCA 4G9HA 14GSA 2IL3A 5KN1A 2VLTA 3VPTA 3DVWA 3IA1A 6GSVA 1PRXA 3GSSA 4POMA 2X99A 3L4NA 3C8EA 4PNFA 2L59A 2EIQA 2R0PA 4RI7A 5CP1A 1XFLA 2HFDA 2TIRA 4GLTA 1MEKA 4MK3A 1TKDB 3GA4A 2LRTA 3FMWA 2LQQA 4ZL7A 1T3BA 4F2IA 3CMIA 1AW9A 4OWYA 4POLA 2LJRA 3ME7A 4F03A 3WT1A 1TDIA 1PGTA 4MJAA 3BBYA 12GSA 1OE7A 3WGDA 2V2GA 1ZYQB 1YJ6A 1C72A 2RM5A 1PQNA 1M2BA 3D6IA 1JZDA 1XIYA 5IOWA 3R2QA 1TTZA 4ZBDA 1GRXA 2ALBA 3KZQA 1TRWA 1DSBA 1VRSD 2VM2A 1SL0B 4O92A 3DEXA 1X5DA 4EVMA 3TGZA 3ZREA 2B1KA 4Q5RA 3CYNA 1T8EB 1CQGA 1M99A 3WGEA 4FYCA 2WGRA 4K2DA 3GHAA 2MMNA 3OR5A 3LYKA 2OBKA 2PN8A 3U5RE 2FY6A 5IMDA 2CVKA 4HJMA 3ZVJA 1EV4A 3EC3A 2L57A 3EYTA 2GQLA 4DSSB 5DCHA 5C04A 2CAQA 2H1GA 1GNEA 4NWYA 1GTAA 2MMZA 5DAKA 1T4ZA 1ERWA 4KGIA 4RUVA 2WFCA 5ABRA 5ECIB 2CA8A 2LUSA 5BMUA 3O6TA 4X43A 4JBBA 3WD6A 2YPMA 4PQIA 2VM1A 2H1DA 3L9UA 2FCHA 5DQSA 1U3AA 4IW9A 4LLRA 5J9CA 4GXZA 2I9HA 20GSA 4XS4B 5ECPB 4TW5A 2C3TA 2EIOA 3UOMA 4XS1A 2F8FA 1V57A 4YQUA 4I2TA 2DIZA 2V1MA 4G0KA 1YQ1A 4TRXA 5EL8A 4OO4A 2E7PA 5IIZA 1XWKA 1FAAA 1ZL9A 2QA2A 5DDLA 4TXVA 3ZVJD 3IK7A 2XC2A 3US3A 3TOUA 3KGKA 2GT5A 2KUCA 4F0CA 4X0XA 2FA4A 4OO5A 4PGTA 1M2AA 2C0GA 3QDNA 4ZL8A 2A2PA 5D8IA 5KOXA 3F63A 3F4RA 5GAND 3LFLA 4I97A 1X5CA 3EU3A 4MDCA 3CTGA 4Z2RA 2LRCA 3H79A 2MYGA 3BCIA 3RHCA 1AUCA 1V58A 3K8NA 3GFKA 1OC9B 2QSIA 3RHBA 3VK9A 4OD7A 1GSDA 4OMVA 3L9VA 5CRHA 4OCEA 5GSTA 1OC8A 3TRPA 1XVQA 3P8WA 2H30A 2LEGA 4J2FA 2DJ1A 3MYDA 1QK8A 3D0ZA 4L5OA 2H76A 4V1Ag 3Q6OA 3IPZA 3VWVA 2R37A 2OADA 1JZRA 3IOSA 4HI7A 5GZZB 22GSA 2YOIA 2WS2A 3FYGA 2JACA 1XWAA 1A0FA 1SD9A 3KXOA 4DSQA 2O7KA 1K3LA 4TN8A 1FVKA 2IFQB 3R3EA 2WZ9A 1Z9HA 6GSYA 3DD3A 1AQVA 2H6ZA 1ACVA 1U3IA 5DBQA 2YANA 1TK5B 1BYEA 4AGSA 3IBHA 2FWEA 3NIVA 2LSTA 1BJXA 1BQ7A 5GSSA 4EDYA 4O32A 1GTUA 3GKNA 1ILOA 4MABA 2YJ7A 3HZ8A 2A4VA 3M0FA 1SYRA 3IR4A 3J7Yk 1J0FA 4N0ZA 1GSUA 4PQHA 2AB6A 3H4KA 2RLIA 1XZOA 4ZBAA 2GLRA 1ZYNA 3F3QA 1GLPA 3F8UA 3LG6A 3PPUA 4F0BA 1J08A 4FYBA 2DBCA 4CY6A 2FHEA 2PERA 3BCKA 4HOJA 1HYUA 1O6JA 1SJZA 5ECHB 2DMMA 2KHPA 4BWQA 4HZ2A 3HVXA 5J5NA 3RPPA 1ZYPA 1MDIA 3KIJA 1MD4A 2LRNA 4MH3A 4TR4A 1SK2A 4BVYA 4I6XA 3EMXA 3RAZA 2R3XA 5J4UA 1OC9A 4HQSA 3A5IA 3CSJA 4POBA 1X9MB 2IMIA 4NPBA 2K6VA 1K0BA 3DYRA 4WR4A 4ZIJA 1GTIA 5H5QA 4EIQA 3BOAA 1XVWA 1TRVA 2FA8A 1PKZA 5A4UA 3WGXA 1USBA 4D73A 4V1Ap 3TB2A 2TRCP 1A8YA 1O8XA 3W8JA 3H1NA 2E0QA 2H19A 4HU7A 1SYXA 3LXZA 1JLWA 2NVLA 4HS1A 4IQAA 1FB0A 3IHQA 4MZCA 4QL9A 2KOKA 4EO3A 2OE0A 1OVNA 1K3YA 5ECLB 3QCPA 1BX9A 3W6GA 2K9FA 4Q5QA 2R5GA 1X0RA 6GSSA 3FR3A 4QL7A 4H86A 1VF3A 1XOAA 2DSAA 2OE3A 4GSTA 1ERVA 1O73A 3C71A 1Q98A 1KTEA 4KUNA 4K6XA 1WP0A 3KH7A 3NOFA 4WEYA 3FZAA 4MH2A 2LKUA 3ZZXA 5CRGA 4CHSA 5JWOB 4LA1A 4K5RA 4KB3A 2HI7A 2YV9A 5KEJA 2GZPA 4Z2UA 4TOPA 3GH9A 4WR5A 4LMVA 1OC3A 1A2LA 2O87A 2VD0A 2WJUA 1X5EA 4TR3A 2HRKA 4GWRA 1H4OA 2L4QA 3FKFA 4G19A 4YKGA 2H72A 4K5SA 5IO2A 3QOUA 4KDUA 3UIWA 5AIXA 5G30A 1B48A 4O5UA 3QMXA 2N5BA 2R6KA 5G31A 4ECJA 2IJYA 1U88A 1R5PA 5JWQB 2VL2A 2ON5A 3D22A 2P5RA 4L0WA 3QAGA 2IMDA 2NPBA 2M72A 5A4WA 2BTOT 4FQUA 5CREA 5DVBA 6GSXA 3FW2A 2XBQA 4HDEA 4XTSA 1R5AA 1EGOA 1SJIA 2B1LA 5DAKB 1PL2A 3I69A 3SWLA 4EL1A 1BAYA 3L78A 2XBIA 4KCAA 2HE3A 2FWFA 4IHUA 1XW5A 5F8BA 5DJMA 5KN0A 5LNKe 1TI1A 2IPAA 2GZYA 3M1GA 4NXIA 5ID2A 1WOUA 2GTUA 2PVOC 3F0IA 2JZTA 1IYHA 5HFKA 3HXSA 2YWMA 1FB6A 5ELAA 3FR9A 5A5KA 2R0GA 1X9WB 3KMOA 2B5EA 3UEMA 3A3TA 2A2SA 3GSTA 3ZYWA 1F2EA 3EINA 4QQ7A 1TP9A 4TR0A 3GX0A 3TJFA 4MA9A 4N30A 3CXGA 3A5WA 5HR3A 2NTOA 2HRNA 3KJYA 2PMTA 2YZUA 5KOWA 4BVXA 2OACA 3TJBA 3TRQA 3GRXA 3CTFA 4ZBBA 4K7OA 2C8UA 2DJJA 2LV3A 4JEDA 4K0GA 1ST9A 3TOTA 1TXXA 4XCSA 3GL5A 4TVEA 3CRTA 2M46A 1A2JA 1TK0B 3FRCA 3UAPA 3HVVA 3HCZA 1DE1A 3BJ5A 2VCTA 1AQWA 1XW9A 3CSIA 1Z3EA 2A2RA 2HNLA 3ZLPA 2CZ3A 2F8AA 2C1YA 4Q5FA 3M9KA 2DJKA 5H5SA 5FT3A 3HYPA 3D5JA 5ELGA 1A8LA 1T4YA 2C3QA 4EF0A 2G2QA 1TRUA 2VL9A 2LNSA 1QXHA 2VAFA 4EUYA 3VWWA 3ZITA 1HNCA 5ECQB 3C1RA 4CY8A 1DUGA 3GH6A 1G7EA 3TCOA 5G5FA 1Q4JA 4YAPA 3UVHA 1WE0A 3CBUA 5B6MA 4IJIA 1AQXA 5G5EA 1XBSA 1RK4A 1THXA 4YAVA 1JZOA 3GKKA 2GGTA 4JZQA 5KN2A 2C3NA 2L6CA 2FWGA 1QMVA 1TI3A 1Z6NA 3KH9A 3IV4A 4EXJA 5CYYA 3MSZA 2VD1A 3VPQA 1VGLA 3MNGA 4OFTA 1YKCA 1YZXA 2JADA 4MPFA 5EPFA 3FZ4A 4USSA 2H1BA 2VL2C 5D96A 5EY6A 1O85A 6GSTA 2HYXA 2K18A 2H01A 1FOHA 2DKIA 1B4QA 3VWXA 1SKWB 1ERTA 2J9HA 2PVQA 3E0UA 4WXTA 1ZYEA 3GYKA 4HU9A 3DMLA 4N10A 4DVCA 2CVBA 3GURA 3TKSE 3GMFA 5D9WA 4KA0A 4XRAA 2GQMA 5DQYA 2EC4A 4BVYB 3KTLA 2OBIA 4GQCA 5IPHA 3ZRDA 3TKRA 1UN2A 3UJ1A 4K8MA 2AJQB 5BRTA 5IMZA 1ERUA 3C1SA 1EP7A 1GLQA 1TJDA 4ZILA 1A24A 1GH2A 4O5RA 2IWTA 4D73B 1URMA 3HHVA 1LU4A 2N5AA 4LL1B 1BEDA 4E8HA 2C80A 1A23A 4RQXA 4ML6A 3O76A 4JR4A 5HR0A 3VWUA 1UVZA 1PA3A 2QC7A 1JFUA 1GSQA 4WBRD 3F3RA 4KDYA 1E6BA 3NZNA 2NBSA 17GSA 5J3RA 4NAXA 4ICYA 4OFNA 1UA5A 4WKWA 2VUPA 2X8GA 5IMVA 1TRSA 4CW9A 4POKA 3IXRA 1G6WA 3ERGA 1XWBA 4ID0A 3IE3A 2GSTA 3FR6A 2VCXA 2FWHA 2AV4A 1HNAA 2HZFA 1V98A 4WF5A 3F4TA 3DGQA 5D9XA 1OAZA 5INYA 1GL8A 2BMXA 2ZUPA 4I5QA 3A2VA 4EDZA 4FH8A 3A2XA 2X64A 4DSRA 1RW1A 1EOHA 2VIMA 2A4HA 3UMAA 2IIYA 1LJRA 5B8BA 3IC4A 3FZ9A 4BPYA 3F6DA 4MF7A 5ECOB 4GTUA 1UC7A 3Q18A 11GSA 1KNGA 2VL3A 4G10A 1N8JA 4ZB8A 2ON7A 2HRFA 1GSEA 1HNBA 4HUAA 4MJEA 1EOGA 2YNXA 4WF4A 5JWRB 2CX3A 3RBTA 2PU9C 1NSWA 4BA7A 1ML6A 3ME8A 4XHMA 2E2GA 4G0IA 4KW6A 2PGTA 4KAEA 5ECKB 18GSA 4RQRA 3U6VA 1N2AA 3TDGA 1YY7A 2NDOA 2VCVA 1B8XA 3ERFA 2JZRA 4DEJA 2ES7A 4AJ6A 4YH2A 3WYWA 1B4PA 2KP1A 3HJMA 3FHKA 2JL4A 2RUEA 1ZZYA 2DIYA 1GTBA 3KD0A 3EU4A 4ECBA 3APSA 5JCWA 4JU5A 2AYTA 1WIKA 3IK9A 3APOA 4TKYA 2QGVA 4RI6A 4JR6A 2P31A 2DC5A 2RM6A 4PNGA 4MP4A 4K1FA 4TXOB 5G2ZA 2AUVA 1PN9A 5HR2A 19GSA 2V41A 2N5FA 1ABAA 4IP6A 1ZOFA 5LD0A 1XPVA 3KP8A 4KH7A 2HLSA 4NMUA 1OE8A 4MMMA 3UBKA 2QA1A 4KX4A 3MAKA 5ID2B 3LSZA 1G6YA 1LBKA 1YEPA 1MDJA 3PGTA 4OCFA 3N9JA 3EMPA 2L5LA 1XWCA 3UARA 1W4VA 1PSQA 3F4SA 3LEFA 4L8EA 1ZCPA 1U6TA 5CNWA 4ZXGA 3LGCA 2FD3A 3PINA 1Z7PA 1SU9A 1OKDA 3D21A 4NV5A 3C73A 5CAXA 3TKPA 2CV4A 4N0VA 4PTSA 1WPIA 4KSOA 1I5GA 4K2XA 5IMAA 1DE2A 2X8HA 2RIIA 4G0LA 4MLYA 1NW2A 3EPTA 1CQHA 4BVXB 1EEJA 2IMFA 1WWJA 2FGXA 3O3TA 5L71A 4KNDA 1TOFA 5DALA 3H93A 4HEA2 5F05A 2JZSA 2DJ0A 2LJKA 3ZFBA 5AGYA 3V1WA 4BWSA 3VFIA 2IMEA 1T7PB 1XWGA 1F3BA 4NHWA 1WJKA 1T00A 1QQ2A 4CDOA 2GS3A 4IVFA 5ECRB 5G1LA 4ECIA 3F6FA 5GAPD 1SENA 2AHEA 3HVSA 5COHA 1DBYA 3TKSA 2YWNA 1EGRA 1F9MA 4MF5A 3GV1A 2D2ZA 3UL3A 2YCDA 2HT9A 5HQPA 4GF0A 3G7YA 1PD21 1Z6MA 1R4WA 3QAVA 2V6KA 2MBTA 3M8NA 3ED3A 1R7HA 1F3AA 2YWOA 5FHIA 1EEMA 2HXKA 2H6XA 1RQMA 5AIVA 1QUWA 4TXOA 3HKRA 2CT6A 2LTKA 2WDUA 4V2NA 2VCWA 3FY7A 2HZEA 5EVOA 5CO3A 2IN3A 2DJ2A 1T1VA 1M2DA 3VURA 1IYIA 1R26A 2P5QA 1FVJA 3KP9A 5IM9A 3QPMA 2JSZA 4TR1A 2JSYA 1GSYA 2EIRA 4IBPA 5B6NA 2OKAA 2WULA 2P0GA 4PUAA 1VF4A 2I4AA 1GP1A 3TKQA 3GIXA 4Z2TA 16GSA 3EURA 1AC1A 4EE0A 1TW9A 4ZB9A 2HRAA 3TJKA 2REMA 1K0OA 5F06A 4N11A 5JCUA 5B8AA 3HA9A 4MF6A 6GSWA 2B7JA 2L6DA 1S3DA 4V2MA 4IKHA 1V2AA 3KMNA 1PX6A 4LMWA 9GSSA 3E3EA 4PX1A 1A2MA 3UBLA 1M9AA 1OKTA 2K8SA 2LQOA 2WRTA 2WB9A 4O7HA 3J7Yb 2VLUA 2B7KA 2UZ8A 5FWGA 4V2LA 4HJ2A 1O7UA 5KN3A 5C00A 1MTCA 3VI5A 2X4AA 3QAWA 4YKFA 2J23A 1A0RP 3QFAC 1SKRB 3EE2A 2JU5A 5D73A 3JCML 2YV7A 5E4WA 3ISOA 1S3CA 4JE1A 3ZFLA 2OA7A 4OFMA 4WBJA 5CRWA 3DXBA 2GSQA 1V9WA 1PL1A 1I9DA 3H8QA 3UVTA 4P3YB 3I6AA 4NHZA 2F9SA 3RPNA 2LJAA 2O8VB 4X1UA 1YF0A 5JCGA 2H0IA 3DIEA 2MMOA 1EP8A 3AY8A 3M9JA 4XS6A 1W89A 5D9VA 1AIUA 2CVDA 1GWCA 4PURA 3ZL5A 13GSA 1WRYA 3GL3A 5IPGA 3A2WA 3W8SA 3LORA 1SK1A 5ECSA 4IJ3A 2QKEA 5DCGA 3HJOA 4O5QA 1EZKA 1JZWA 3GKXA 2KLXA 3MWHA 4ACSA 2HSMA 2B5XA 2DKHA 4XIHA 4IS0A 4IELA 5ENUA 2V32A 2GT6A 5ECMB 3LJRA 3SBCA 3TKSC 3GTUB 2PBJA 2OE1A 2H0HA 2WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M0U A;  2M80 A;  2X8C A;  5E59 A;  2E2M A;  4HQZ A;  5H5R A;  1GUL A;  7GSS A;  2FNO A;  2PUK C;  5IQY A;  3ZMK A;  1GSS A;  4I8B A;  2MBS A;  1G7O A;  3FZ5 A;  1VF1 A;  5AN1 A;  1BG5 A;  3LWA A;  2L4C A;  4F82 A;  3TUE A;  4K7I A;  4I2U A;  2LS5 A;  1KEB A;  2AAW A;  2O89 A;  4IGJ A;  3Q74 A;  3MDK A;  1PKW A;  1JLV A;  1WMJ A;  1HD2 A;  10GS A;  2CAI A;  2F51 A;  4MZB A;  5LCZ A;  4Z7X A;  2HSY A;  2CQ9 A;  3L9S A;  2GDR A;  4L5L A;  4ZL9 A;  3GN3 A;  4ZB6 A;  1GUK A;  1SL1 B;  4MJC A;  1Z5Y E;  2YJH A;  4ECC A;  1M9B A;  3C7M A;  3HJP A;  3I43 A;  2H8L A;  4IP1 A;  2YWI A;  3PH9 A;  1HQO A;  2B3S A;  3P2A A;  2TRX A;  4EC0 A;  2H66 A;  4DSS A;  4GRF A;  1S3A A;  3HZ4 A;  1YF1 A;  4GSS A;  1XOB A;  5HFI A;  5B7C A;  4GQF A;  5J41 A;  4F9Z A;  4J57 E;  4KE3 A;  3APQ A;  1NHO A;  1FHE A;  1Y6E A;  1ZGN A;  2V6O A;  2H74 A;  1YEX A;  1AXD A;  1ZMA A;  3LQ7 A;  4FO5 A;  3S9F A;  1V40 A;  2B6M A;  4XS4 A;  2H75 A;  1K0N A;  2GZZ A;  1GNW A;  2FUG 2;  3GTU A;  2H0G A;  1XW6 A;  3P90 A;  2CX4 A;  4IQ1 A;  3HD5 A;  4MCU A;  1O8W A;  2B5Y A;  3I9V 2;  3DVX A;  4PUF C;  1TU7 A;  1NHY A;  4FIW A;  3BD2 A;  3FEU A;  1QFN A;  1XCC A;  4MZW A;  1MDK A;  5J9B A;  2YZH A;  3GKM A;  4MJB A;  3DWV A;  5G1K A;  2H73 A;  5DAL B;  1FO5 A;  3N5O A;  4IN0 A;  3IAS 2;  5F0G A;  1O81 A;  2H1A A;  2R2J A;  1ON4 A;  2H70 A;  2VCZ A;  3IAM 2;  1YDK A;  3ZIV A;  4XRD A;  2L5O A;  1K0M A;  2MMA A;  5D9T A;  3TJJ A;  5IMF A;  3GX8 A;  4JRR A;  4E8E A;  2VCQ A;  5IOX A;  3GNJ A;  2K8V A;  2FLS A;  4HZ4 A;  3RDW A;  3G7I A;  1K0D A;  2ZNM A;  1X9S B;  1SK0 A;  1Y25 A;  2I3Y A;  4KSM A;  3LYP A;  4KDX A;  2F3M A;  3VI7 A;  2OJL A;  2XHF A;  1K3O A;  3G7J A;  2C0F A;  3KEB A;  5F07 A;  2I81 A;  1K0A A;  1KBN A;  2GVP A;  2IFQ A;  1SL2 B;  2ZCT A;  2GSS A;  2YP6 A;  3DRN A;  2YN1 A;  2C4J A;  3IDV A;  4K9Z A;  4AF2 A;  3HY2 A;  1YKA A;  3D4T A;  2PWJ A;  4YQV A;  2HZE B;  3CSH A;  2PPT A;  4ML1 A;  4KCE A;  1GSF A;  3CRU A;  2GQK A;  3HDC A;  4WET A;  2H6Y A;  4ISD A;  3P7X A;  2GSR A;  2VO4 A;  3GUS A;  4TR1 B;  3L0H A;  3Q19 A;  5D93 A;  1U87 A;  1SD8 A;  1GUH A;  3EWL A;  1M7T A;  1K0C A;  2G0F A;  1FG4 A;  3IRA A;  1XXU A;  4PQ1 A;  4L0U A;  5HR1 A;  1THO A;  4Q5N A;  3ZML A;  2H71 A;  1NM3 A;  2IMK A;  5A4V A;  3KCM A;  2O85 A;  5IMC A;  1B9X C;  1VF2 A;  2VLV A;  1B9Y C;  3ZIJ A;  1OYJ A;  2RUF A;  4MPG A;  1QGV A;  2XPD A;  1F37 A;  3LXT A;  3EVI A;  4ILF A;  4K7N A;  1GUM A;  1SJ6 A;  1J9B A;  2HSH A;  5DJL A;  3PR8 A;  1G0T A;  4GCI A;  1Z7R A;  5AIS A;  1AAZ A;  3ERW A;  2R4V A;  3QFB C;  1EV9 A;  2BJX A;  2C0E A;  4PXO A;  1TK8 B;  3F9U A;  1EWX A;  3D4M A;  4G2E A;  3TRX A;  3WT2 A;  4J56 E;  3ZTL A;  4YQM A;  3DKS A;  3G9B A;  4K0N A;  4AJ8 A;  2LNT A;  5IO0 A;  4LL4 B;  1MD3 A;  4ULX A;  5CRD A;  3E9J B;  3FK8 A;  3KTB A;  2C0D A;  1E2Y A;  2DML A;  2XPE A;  2VOC A;  8GSS A;  3VLN A;  2KP2 A;  3M3M A;  5ECN B;  4NV2 A;  2I1U A;  1TU8 A;  3KM6 A;  1F6M C;  2Z9S A;  4EKZ A;  4GSN A;  2DLX A;  3TJG A;  1SKS B;  5HFG A;  6GSU A;  4FYU A;  1JHB A;  1FW1 A;  2CZ2 A;  3QR6 A;  4BL7 A;  2DJ3 A;  1FOV A;  1PX7 A;  1PMT A;  4AJ7 A;  1H75 A;  3QD9 A;  2MZC A;  4G9H A;  14GS A;  2IL3 A;  5KN1 A;  2VLT A;  3VPT A;  3DVW A;  3IA1 A;  6GSV A;  1PRX A;  3GSS A;  4POM A;  2X99 A;  3L4N A;  3C8E A;  4PNF A;  2L59 A;  2EIQ A;  4RI7 A;  5CP1 A;  1XFL A;  2HFD A;  2TIR A;  4GLT A;  1MEK A;  4MK3 A;  1TKD B;  3GA4 A;  2LRT A;  2LQQ A;  4ZL7 A;  1T3B A;  4F2I A;  3CMI A;  1AW9 A;  4OWY A;  4POL A;  2LJR A;  3ME7 A;  4F03 A;  3WT1 A;  1TDI A;  1PGT A;  4MJA A;  3BBY A;  12GS A;  1OE7 A;  3WGD A;  2V2G A;  1ZYQ B;  1YJ6 A;  1C72 A;  2RM5 A;  1PQN A;  1M2B A;  3D6I A;  1JZD A;  1XIY A;  5IOW A;  3R2Q A;  1TTZ A;  4ZBD A;  1GRX A;  2ALB A;  3KZQ A;  1TRW A;  1DSB A;  1VRS D;  2VM2 A;  1SL0 B;  4O92 A;  3DEX A;  1X5D A;  4EVM A;  3TGZ A;  3ZRE A;  2B1K A;  4Q5R A;  3CYN A;  1T8E B;  1CQG A;  1M99 A;  3WGE A;  4FYC A;  2WGR A;  4K2D A;  3GHA A;  2MMN A;  3OR5 A;  3LYK A;  2OBK A;  2PN8 A;  3U5R E;  2FY6 A;  5IMD A;  2CVK A;  4HJM A;  3ZVJ A;  1EV4 A;  3EC3 A;  2L57 A;  3EYT A;  2GQL A;  4DSS B;  5DCH A;  5C04 A;  2CAQ A;  2H1G A;  1GNE A;  4NWY A;  1GTA A;  2MMZ A;  5DAK A;  1T4Z A;  1ERW A;  4KGI A;  4RUV A;  2WFC A;  5ABR A;  5ECI B;  2CA8 A;  2LUS A;  3O6T A;  4X43 A;  4JBB A;  3WD6 A;  2YPM A;  4PQI A;  2VM1 A;  2H1D A;  3L9U A;  2FCH A;  5DQS A;  1U3A A;  4IW9 A;  4LLR A;  5J9C A;  4GXZ A;  2I9H A;  20GS A;  4XS4 B;  5ECP B;  4TW5 A;  2C3T A;  2EIO A;  3UOM A;  4XS1 A;  2F8F A;  1V57 A;  4YQU A;  4I2T A;  2DIZ A;  2V1M A;  1YQ1 A;  4TRX A;  5EL8 A;  4OO4 A;  2E7P A;  5IIZ A;  1XWK A;  1FAA A;  1ZL9 A;  5DDL A;  4TXV A;  3ZVJ D;  3IK7 A;  2XC2 A;  3US3 A;  3TOU A;  3KGK A;  2GT5 A;  2KUC A;  4F0C A;  4X0X A;  2FA4 A;  4OO5 A;  4PGT A;  1M2A A;  2C0G A;  3QDN A;  4ZL8 A;  5D8I A;  3F63 A;  3F4R A;  5GAN D;  3LFL A;  4I97 A;  1X5C A;  3EU3 A;  3CTG A;  4MDC A;  2LRC A;  3H79 A;  2MYG A;  3BCI A;  3RHC A;  1AUC A;  1V58 A;  3K8N A;  3GFK A;  1OC9 B;  2QSI A;  3RHB A;  3VK9 A;  4OD7 A;  1GSD A;  4OMV A;  3L9V A;  5CRH A;  4OCE A;  5GST A;  1OC8 A;  3TRP A;  1XVQ A;  3P8W A;  2H30 A;  2LEG A;  4J2F A;  2DJ1 A;  1QK8 A;  3D0Z A;  4L5O A;  2H76 A;  4V1A g;  3Q6O A;  3IPZ A;  3VWV A;  2R37 A;  2OAD A;  1JZR A;  3IOS A;  4HI7 A;  5GZZ B;  22GS A;  2YOI A;  2WS2 A;  3FYG A;  2JAC A;  1XWA A;  1A0F A;  1SD9 A;  3KXO A;  4DSQ A;  2O7K A;  1K3L A;  4TN8 A;  1FVK A;  2IFQ B;  2WZ9 A;  1Z9H A;  6GSY A;  3DD3 A;  1AQV A;  2H6Z A;  1ACV A;  1U3I A;  5DBQ A;  2YAN A;  1TK5 B;  1BYE A;  4AGS A;  3IBH A;  2FWE A;  3NIV A;  2LST A;  1BJX A;  1BQ7 A;  5GSS A;  4EDY A;  4O32 A;  1GTU A;  3GKN A;  1ILO A;  4MAB A;  2YJ7 A;  3HZ8 A;  2A4V A;  3M0F A;  1SYR A;  3IR4 A;  3J7Y k;  1J0F A;  4N0Z A;  1GSU A;  4PQH A;  2AB6 A;  3H4K A;  2RLI A;  1XZO A;  4ZBA A;  2GLR A;  3F3Q A;  1GLP A;  3F8U A;  3LG6 A;  4F0B A;  1J08 A;  4FYB A;  2DBC A;  2FHE A;  2PER A;  3BCK A;  4HOJ A;  1HYU A;  1O6J A;  1SJZ A;  5ECH B;  2DMM A;  2KHP A;  4BWQ A;  4HZ2 A;  3HVX A;  5J5N A;  3RPP A;  1MDI A;  3KIJ A;  1MD4 A;  2LRN A;  4MH3 A;  4TR4 A;  1SK2 A;  4BVY A;  4I6X A;  3EMX A;  3RAZ A;  2R3X A;  5J4U A;  1OC9 A;  4HQS A;  3CSJ A;  4POB A;  1X9M B;  2IMI A;  4NPB A;  2K6V A;  1K0B A;  3DYR A;  4WR4 A;  4ZIJ A;  1GTI A;  5H5Q A;  3BOA A;  1XVW A;  1TRV A;  2FA8 A;  1PKZ A;  5A4U A;  3WGX A;  1USB A;  4D73 A;  4V1A p;  3TB2 A;  2TRC P;  1A8Y A;  1O8X A;  3W8J A;  3H1N A;  2E0Q A;  2H19 A;  4HU7 A;  1SYX A;  3LXZ A;  1JLW A;  2NVL A;  4HS1 A;  4IQA A;  1FB0 A;  3IHQ A;  4MZC A;  4QL9 A;  2KOK A;  4EO3 A;  2OE0 A;  1OVN A;  1K3Y A;  5ECL B;  3QCP A;  1BX9 A;  3W6G A;  2K9F A;  4Q5Q A;  2R5G A;  1X0R A;  6GSS A;  3FR3 A;  4QL7 A;  4H86 A;  1VF3 A;  1XOA A;  2DSA A;  2OE3 A;  4GST A;  1ERV A;  1O73 A;  3C71 A;  1Q98 A;  1KTE A;  4KUN A;  4K6X A;  1WP0 A;  3KH7 A;  3NOF A;  4WEY A;  3FZA A;  4MH2 A;  2LKU A;  3ZZX A;  5CRG A;  4CHS A;  5JWO B;  4LA1 A;  4KB3 A;  2HI7 A;  2YV9 A;  5KEJ A;  2GZP A;  4TOP A;  3GH9 A;  4WR5 A;  4LMV A;  1OC3 A;  1A2L A;  2O87 A;  2VD0 A;  2WJU A;  1X5E A;  4TR3 A;  4GWR A;  1H4O A;  2L4Q A;  3FKF A;  4G19 A;  2H72 A;  5IO2 A;  3QOU A;  4KDU A;  3UIW A;  5AIX A;  5G30 A;  1B48 A;  3QMX A;  2N5B A;  2R6K A;  5G31 A;  4ECJ A;  2IJY A;  1U88 A;  1R5P A;  5JWQ B;  2VL2 A;  2ON5 A;  3D22 A;  2P5R A;  4L0W A;  3QAG A;  2IMD A;  2NPB A;  2M72 A;  5A4W A;  2BTO T;  5CRE A;  5DVB A;  6GSX A;  3FW2 A;  2XBQ A;  4HDE A;  4XTS A;  1R5A A;  1EGO A;  1SJI A;  2B1L A;  5DAK B;  1PL2 A;  3I69 A;  3SWL A;  4EL1 A;  1BAY A;  3L78 A;  2XBI A;  4KCA A;  2HE3 A;  2FWF A;  4IHU A;  1XW5 A;  5F8B A;  5DJM A;  5KN0 A;  5LNK e;  1TI1 A;  2IPA A;  2GZY A;  3M1G A;  4NXI A;  5ID2 A;  1WOU A;  2GTU A;  2PVO C;  3F0I A;  2JZT A;  1IYH A;  5HFK A;  3HXS A;  2YWM A;  1FB6 A;  5ELA A;  3FR9 A;  5A5K A;  1X9W B;  3KMO A;  2B5E A;  3UEM A;  3A3T A;  2A2S A;  3GST A;  3ZYW A;  1F2E A;  3EIN A;  4QQ7 A;  1TP9 A;  4TR0 A;  3GX0 A;  3TJF A;  4MA9 A;  4N30 A;  3CXG A;  3A5W A;  5HR3 A;  2NTO A;  2HRN A;  3KJY A;  2PMT A;  2YZU A;  4BVX A;  2OAC A;  3TJB A;  3TRQ A;  3GRX A;  3CTF A;  4ZBB A;  4K7O A;  2C8U A;  2DJJ A;  2LV3 A;  4JED A;  4K0G A;  1ST9 A;  3TOT A;  1TXX A;  4XCS A;  3GL5 A;  4TVE A;  3CRT A;  2M46 A;  1A2J A;  1TK0 B;  3FRC A;  3UAP A;  3HVV A;  3HCZ A;  1DE1 A;  3BJ5 A;  2VCT A;  1AQW A;  1XW9 A;  3CSI A;  1Z3E A;  2A2R A;  2HNL A;  3ZLP A;  2CZ3 A;  2F8A A;  2C1Y A;  4Q5F A;  3M9K A;  2DJK A;  5H5S A;  5FT3 A;  3HYP A;  3D5J A;  5ELG A;  1A8L A;  1T4Y A;  2C3Q A;  4EF0 A;  2G2Q A;  1TRU A;  2VL9 A;  2LNS A;  1QXH A;  2VAF A;  4EUY A;  3VWW A;  3ZIT A;  1HNC A;  5ECQ B;  3C1R A;  1DUG A;  3GH6 A;  1G7E A;  3TCO A;  5G5F A;  1Q4J A;  4YAP A;  3UVH A;  1WE0 A;  3CBU A;  5B6M A;  4IJI A;  1AQX A;  5G5E A;  1XBS A;  1RK4 A;  1THX A;  4YAV A;  1JZO A;  3GKK A;  2GGT A;  4JZQ A;  5KN2 A;  2C3N A;  2L6C A;  2FWG A;  1QMV A;  1TI3 A;  1Z6N A;  3KH9 A;  3IV4 A;  4EXJ A;  5CYY A;  3MSZ A;  2VD1 A;  3VPQ A;  1VGL A;  3MNG A;  4OFT A;  1YKC A;  1YZX A;  2JAD A;  4MPF A;  5EPF A;  3FZ4 A;  2H1B A;  2VL2 C;  5D96 A;  5EY6 A;  1O85 A;  6GST A;  2HYX A;  2K18 A;  2H01 A;  1B4Q A;  3VWX A;  1SKW B;  1ERT A;  2J9H A;  2PVQ A;  3E0U A;  4WXT A;  1ZYE A;  3GYK A;  4HU9 A;  3DML A;  4N10 A;  4DVC A;  2CVB A;  3GUR A;  3TKS E;  3GMF A;  5D9W A;  4KA0 A;  4XRA A;  2GQM A;  5DQY A;  2EC4 A;  3KTL A;  2OBI A;  4GQC A;  5IPH A;  3ZRD A;  3TKR A;  1UN2 A;  3UJ1 A;  4K8M A;  2AJQ B;  5IMZ A;  1ERU A;  3C1S A;  1EP7 A;  1GLQ A;  1TJD A;  4ZIL A;  1A24 A;  1GH2 A;  4O5R A;  2IWT A;  4D73 B;  1URM A;  3HHV A;  1LU4 A;  2N5A A;  4LL1 B;  1BED A;  4E8H A;  2C80 A;  1A23 A;  4RQX A;  4ML6 A;  3O76 A;  4JR4 A;  5HR0 A;  3VWU A;  1UVZ A;  1PA3 A;  2QC7 A;  1JFU A;  1GSQ A;  4WBR D;  3F3R A;  4KDY A;  1E6B A;  3NZN A;  2NBS A;  17GS A;  5J3R A;  4NAX A;  4OFN A;  1UA5 A;  4WKW A;  2VUP A;  2X8G A;  5IMV A;  1TRS A;  4CW9 A;  4POK A;  3IXR A;  1G6W A;  3ERG A;  1XWB A;  4ID0 A;  3IE3 A;  2GST A;  3FR6 A;  2VCX A;  2FWH A;  2AV4 A;  1HNA A;  2HZF A;  1V98 A;  4WF5 A;  3F4T A;  3DGQ A;  5D9X A;  1OAZ A;  5INY A;  1GL8 A;  2BMX A;  2ZUP A;  4I5Q A;  3A2V A;  4EDZ A;  4FH8 A;  3A2X A;  2X64 A;  4DSR A;  1RW1 A;  1EOH A;  2VIM A;  3UMA A;  2IIY A;  1LJR A;  5B8B A;  3IC4 A;  3FZ9 A;  4BPY A;  3F6D A;  4MF7 A;  5ECO B;  4GTU A;  1UC7 A;  3Q18 A;  11GS A;  1KNG A;  2VL3 A;  4G10 A;  1N8J A;  4ZB8 A;  2ON7 A;  2HRF A;  1GSE A;  1HNB A;  4HUA A;  4MJE A;  1EOG A;  2YNX A;  4WF4 A;  5JWR B;  2CX3 A;  3RBT A;  2PU9 C;  1NSW A;  4BA7 A;  1ML6 A;  3ME8 A;  4XHM A;  2E2G A;  4KW6 A;  2PGT A;  4KAE A;  5ECK B;  18GS A;  4RQR A;  3U6V A;  1N2A A;  3TDG A;  1YY7 A;  2NDO A;  2VCV A;  1B8X A;  3ERF A;  2JZR A;  4DEJ A;  2ES7 A;  4AJ6 A;  4YH2 A;  3WYW A;  1B4P A;  2KP1 A;  3HJM A;  3FHK A;  2JL4 A;  2RUE A;  1ZZY A;  2DIY A;  1GTB A;  3KD0 A;  3EU4 A;  4ECB A;  3APS A;  5JCW A;  4JU5 A;  2AYT A;  1WIK A;  3IK9 A;  3APO A;  4TKY A;  2QGV A;  4RI6 A;  4JR6 A;  2P31 A;  2DC5 A;  2RM6 A;  4PNG A;  4MP4 A;  4K1F A;  4TXO B;  5G2Z A;  2AUV A;  1PN9 A;  5HR2 A;  19GS A;  2V41 A;  2N5F A;  1ABA A;  4IP6 A;  1ZOF A;  5LD0 A;  1XPV A;  3KP8 A;  4KH7 A;  2HLS A;  4NMU A;  1OE8 A;  4MMM A;  3UBK A;  4KX4 A;  3MAK A;  5ID2 B;  3LSZ A;  1G6Y A;  1LBK A;  1YEP A;  1MDJ A;  3PGT A;  4OCF A;  3N9J A;  3EMP A;  2L5L A;  1XWC A;  3UAR A;  1W4V A;  1PSQ A;  3F4S A;  3LEF A;  4L8E A;  1ZCP A;  1U6T A;  5CNW A;  4ZXG A;  3LGC A;  2FD3 A;  3PIN A;  1Z7P A;  1SU9 A;  1OKD A;  3D21 A;  4NV5 A;  3C73 A;  5CAX A;  3TKP A;  2CV4 A;  4N0V A;  1WPI A;  4KSO A;  1I5G A;  5IMA A;  1DE2 A;  2X8H A;  2RII A;  4MLY A;  1NW2 A;  1CQH A;  1EEJ A;  2IMF A;  1WWJ A;  2FGX A;  3O3T A;  5L71 A;  4KND A;  1TOF A;  5DAL A;  3H93 A;  4HEA 2;  5F05 A;  2JZS A;  2DJ0 A;  2LJK A;  3ZFB A;  5AGY A;  3V1W A;  4BWS A;  3VFI A;  2IME A;  1T7P B;  1XWG A;  1F3B A;  4NHW A;  1WJK A;  1T00 A;  1QQ2 A;  4CDO A;  2GS3 A;  4IVF A;  5ECR B;  5G1L A;  4ECI A;  3F6F A;  5GAP D;  1SEN A;  2AHE A;  3HVS A;  5COH A;  1DBY A;  3TKS A;  2YWN A;  1EGR A;  1F9M A;  4MF5 A;  3GV1 A;  2D2Z A;  3UL3 A;  2YCD A;  2HT9 A;  5HQP A;  4GF0 A;  3G7Y A;  1PD2 1;  1Z6M A;  1R4W A;  3QAV A;  2V6K A;  2MBT A;  3M8N A;  3ED3 A;  1R7H A;  1F3A A;  2YWO A;  5FHI A;  1EEM A;  2HXK A;  2H6X A;  1RQM A;  5AIV A;  1QUW A;  4TXO A;  3HKR A;  2CT6 A;  2LTK A;  2WDU A;  4V2N A;  2VCW A;  3FY7 A;  2HZE A;  5EVO A;  5CO3 A;  2IN3 A;  2DJ2 A;  1T1V A;  1M2D A;  3VUR A;  1IYI A;  1R26 A;  2P5Q A;  1FVJ A;  3KP9 A;  5IM9 A;  3QPM A;  2JSZ A;  4TR1 A;  2JSY A;  1GSY A;  2EIR A;  4IBP A;  5B6N A;  2OKA A;  2WUL A;  2P0G A;  4PUA A;  1VF4 A;  2I4A A;  1GP1 A;  3TKQ A;  3GIX A;  16GS A;  3EUR A;  1AC1 A;  4EE0 A;  1TW9 A;  4ZB9 A;  3TJK A;  2REM A;  1K0O A;  5F06 A;  4N11 A;  5JCU A;  5B8A A;  3HA9 A;  4MF6 A;  6GSW A;  2B7J A;  2L6D A;  1S3D A;  4V2M A;  4IKH A;  1V2A A;  3KMN A;  1PX6 A;  4LMW A;  9GSS A;  3E3E A;  4PX1 A;  1A2M A;  3UBL A;  1M9A A;  1OKT A;  2K8S A;  2LQO A;  2WRT A;  2WB9 A;  4O7H A;  3J7Y b;  2VLU A;  2B7K A;  5FWG A;  4V2L A;  4HJ2 A;  1O7U A;  5KN3 A;  5C00 A;  1MTC A;  3VI5 A;  3QAW A;  2J23 A;  1A0R P;  3QFA C;  1SKR B;  3EE2 A;  2JU5 A;  5D73 A;  3JCM L;  2YV7 A;  5E4W A;  3ISO A;  1S3C A;  4JE1 A;  3ZFL A;  2OA7 A;  4OFM A;  4WBJ A;  5CRW A;  3DXB A;  2GSQ A;  1V9W A;  1PL1 A;  1I9D A;  3H8Q A;  3UVT A;  4P3Y B;  3I6A A;  4NHZ A;  2F9S A;  3RPN A;  2LJA A;  2O8V B;  4X1U A;  1YF0 A;  5JCG A;  2H0I A;  3DIE A;  2MMO A;  1EP8 A;  3AY8 A;  3M9J A;  4XS6 A;  1W89 A;  5D9V A;  1AIU A;  2CVD A;  1GWC A;  4PUR A;  3ZL5 A;  13GS A;  1WRY A;  3GL3 A;  5IPG A;  3A2W A;  3W8S A;  3LOR A;  1SK1 A;  5ECS A;  4IJ3 A;  2QKE A;  5DCG A;  3HJO A;  1EZK A;  1JZW A;  3GKX A;  2KLX A;  3MWH A;  4ACS A;  2B5X A;  4XIH A;  4IS0 A;  4IEL A;  5ENU A;  2V32 A;  2GT6 A;  5ECM B;  3LJR A;  3SBC A;  3TKS C;  3GTU B;  2PBJ A;  2OE1 A;  2H0H A;  2WCI A; 
#chains in the Genus database with same CATH topology
 1M0U A;  2M80 A;  2X8C A;  5E59 A;  2E2M A;  4HQZ A;  5H5R A;  1GUL A;  7GSS A;  2FNO A;  2PUK C;  5IQY A;  3ZMK A;  1GSS A;  4I8B A;  2MBS A;  1G7O A;  3FZ5 A;  1VF1 A;  5AN1 A;  1BG5 A;  3LWA A;  2L4C A;  4F82 A;  3TUE A;  4K7I A;  4I2U A;  2LS5 A;  1KEB A;  2AAW A;  2O89 A;  4IGJ A;  3Q74 A;  3MDK A;  1PKW A;  1JLV A;  1WMJ A;  1HD2 A;  10GS A;  2CAI A;  2F51 A;  4MZB A;  5LCZ A;  4Z7X A;  2HSY A;  2CQ9 A;  3L9S A;  2GDR A;  4L5L A;  4ZL9 A;  3GN3 A;  4ZB6 A;  1GUK A;  1SL1 B;  4MJC A;  1Z5Y E;  2YJH A;  4ECC A;  1M9B A;  3C7M A;  3HJP A;  3I43 A;  2H8L A;  4IP1 A;  2YWI A;  3PH9 A;  1HQO A;  2B3S A;  3P2A A;  2TRX A;  4EC0 A;  2H66 A;  4DSS A;  4GRF A;  1S3A A;  3HZ4 A;  1YF1 A;  4GSS A;  1XOB A;  4A5P A;  5HFI A;  1PN0 A;  5B7C A;  4GQF A;  5J41 A;  4F9Z A;  4J57 E;  4KE3 A;  3APQ A;  1NHO A;  1FHE A;  1Y6E A;  1ZGN A;  2V6O A;  2H74 A;  1YEX A;  1AXD A;  1ZMA A;  3LQ7 A;  4FO5 A;  3S9F A;  1V40 A;  3CQF A;  2B6M A;  4XS4 A;  3MIX A;  2H75 A;  1K0N A;  2GZZ A;  1GNW A;  2FUG 2;  3GTU A;  2H0G A;  1XW6 A;  4X4J A;  3IHG A;  3P90 A;  2CX4 A;  4IQ1 A;  3HD5 A;  4MCU A;  1O8W A;  2B5Y A;  3I9V 2;  3DVX A;  4PUF C;  1TU7 A;  1NHY A;  4FIW A;  3BD2 A;  3FEU A;  1QFN A;  1XCC A;  4MZW A;  1MDK A;  5J9B A;  2YZH A;  3GKM A;  4MJB A;  3DWV A;  5G1K A;  2H73 A;  5DAL B;  1FO5 A;  3N5O A;  4IN0 A;  3IAS 2;  5F0G A;  1O81 A;  2H1A A;  4KF9 A;  2R2J A;  1ON4 A;  2H70 A;  2VCZ A;  3IAM 2;  1YDK A;  4MNN A;  3ZIV A;  4XRD A;  2L5O A;  3IC8 A;  1K0M A;  2MMA A;  5D9T A;  3TJJ A;  5IMF A;  3GX8 A;  4JRR A;  4E8E A;  2VCQ A;  5IOX A;  3GNJ A;  2K8V A;  2FLS A;  4HZ4 A;  3RDW A;  3G7I A;  1K0D A;  2ZNM A;  1X9S B;  1SK0 A;  1Y25 A;  2I3Y A;  4KSM A;  3LYP A;  4KDX A;  2F3M A;  3VI7 A;  2OJL A;  2XHF A;  1K3O A;  3G7J A;  2C0F A;  3KEB A;  5F07 A;  2I81 A;  1K0A A;  1KBN A;  2GVP A;  2IFQ A;  1SL2 B;  2ZCT A;  2GSS A;  2YP6 A;  4BL7 B;  3DRN A;  2YN1 A;  2C4J A;  3IDV A;  4K9Z A;  4AF2 A;  3HY2 A;  1YKA A;  3D4T A;  2PWJ A;  4YQV A;  2HZE B;  3CSH A;  2PPT A;  4ML1 A;  4KCE A;  1GSF A;  3CRU A;  2GQK A;  3HDC A;  4WET A;  2H6Y A;  4ISD A;  3P7X A;  2GSR A;  2VO4 A;  3GUS A;  4TR1 B;  3L0H A;  3Q19 A;  5D93 A;  1U87 A;  1SD8 A;  1GUH A;  3EWL A;  1M7T A;  1K0C A;  2G0F A;  1FG4 A;  3IRA A;  1XXU A;  4PQ1 A;  4L0U A;  5HR1 A;  1THO A;  4Q5N A;  3ZML A;  2H71 A;  1NM3 A;  2IMK A;  5A4V A;  3KCM A;  2O85 A;  5IMC A;  1B9X C;  1VF2 A;  2VLV A;  1B9Y C;  3ZIJ A;  1OYJ A;  2RUF A;  4MPG A;  3HVN A;  1QGV A;  2XPD A;  1F37 A;  3LXT A;  3EVI A;  4ILF A;  4K7N A;  1GUM A;  1SJ6 A;  1J9B A;  2HSH A;  5DJL A;  3PR8 A;  1G0T A;  4EIP A;  4GCI A;  1Z7R A;  2R0C A;  5AIS A;  1AAZ A;  3ERW A;  2R4V A;  3QFB C;  1EV9 A;  2BJX A;  2C0E A;  4PXO A;  1TK8 B;  3F9U A;  1EWX A;  3D4M A;  4G2E A;  3TRX A;  3WT2 A;  3LW9 A;  4J56 E;  3ZTL A;  4YQM A;  3DKS A;  4HSC X;  3G9B A;  4K0N A;  4AJ8 A;  2LNT A;  5IO0 A;  4LL4 B;  1MD3 A;  4ULX A;  5CRD A;  3E9J B;  3FK8 A;  3KTB A;  2C0D A;  1E2Y A;  2DML A;  2XPE A;  2VOC A;  8GSS A;  3VLN A;  2KP2 A;  3M3M A;  2X49 A;  5ECN B;  4NV2 A;  2I1U A;  1TU8 A;  3KM6 A;  1F6M C;  2Z9S A;  4EKZ A;  4GSN A;  2DLX A;  3TJG A;  1SKS B;  5HFG A;  6GSU A;  4FYU A;  1JHB A;  1FW1 A;  2CZ2 A;  3QR6 A;  4BL7 A;  2DJ3 A;  1FOV A;  1PX7 A;  1PMT A;  4AJ7 A;  1H75 A;  3QD9 A;  2MZC A;  4G9H A;  14GS A;  2IL3 A;  5KN1 A;  2VLT A;  3VPT A;  3DVW A;  3IA1 A;  6GSV A;  1PRX A;  3GSS A;  4POM A;  2X99 A;  3L4N A;  3C8E A;  4PNF A;  2L59 A;  2EIQ A;  2R0P A;  4RI7 A;  5CP1 A;  1XFL A;  2HFD A;  2TIR A;  4GLT A;  1MEK A;  4MK3 A;  1TKD B;  3GA4 A;  2LRT A;  3FMW A;  2LQQ A;  4ZL7 A;  1T3B A;  4F2I A;  3CMI A;  1AW9 A;  4OWY A;  4POL A;  2LJR A;  3ME7 A;  4F03 A;  3WT1 A;  1TDI A;  1PGT A;  4MJA A;  3BBY A;  12GS A;  1OE7 A;  3WGD A;  2V2G A;  1ZYQ B;  1YJ6 A;  1C72 A;  2RM5 A;  1PQN A;  1M2B A;  3D6I A;  1JZD A;  1XIY A;  5IOW A;  3R2Q A;  1TTZ A;  4ZBD A;  1GRX A;  2ALB A;  3KZQ A;  1XG8 A;  1TRW A;  1DSB A;  1VRS D;  2VM2 A;  1SL0 B;  4O92 A;  3DEX A;  1X5D A;  4EVM A;  3TGZ A;  3ZRE A;  2B1K A;  4Q5R A;  3CYN A;  1T8E B;  1CQG A;  1M99 A;  3WGE A;  4FYC A;  2WGR A;  4K2D A;  3GHA A;  2MMN A;  3OR5 A;  3LYK A;  2OBK A;  2PN8 A;  3U5R E;  2FY6 A;  5IMD A;  2CVK A;  4HJM A;  3ZVJ A;  1EV4 A;  3EC3 A;  2L57 A;  3EYT A;  2GQL A;  4DSS B;  5DCH A;  5C04 A;  2CAQ A;  2H1G A;  1GNE A;  4NWY A;  1GTA A;  2MMZ A;  5DAK A;  1T4Z A;  1ERW A;  4KGI A;  4RUV A;  2WFC A;  5ABR A;  5ECI B;  2CA8 A;  2LUS A;  5BMU A;  3O6T A;  4X43 A;  4JBB A;  3WD6 A;  2YPM A;  4PQI A;  2VM1 A;  2H1D A;  3L9U A;  2FCH A;  5DQS A;  1U3A A;  4IW9 A;  4LLR A;  5J9C A;  4GXZ A;  2I9H A;  20GS A;  4XS4 B;  5ECP B;  4TW5 A;  2C3T A;  2EIO A;  3UOM A;  4XS1 A;  2F8F A;  1V57 A;  4YQU A;  4I2T A;  2DIZ A;  2V1M A;  4G0K A;  1YQ1 A;  4TRX A;  5EL8 A;  4OO4 A;  2E7P A;  5IIZ A;  1XWK A;  1FAA A;  1ZL9 A;  2QA2 A;  5DDL A;  4TXV A;  3ZVJ D;  3IK7 A;  2XC2 A;  3US3 A;  3TOU A;  3KGK A;  2GT5 A;  2KUC A;  4F0C A;  4X0X A;  2FA4 A;  4OO5 A;  4PGT A;  1M2A A;  2C0G A;  3QDN A;  4ZL8 A;  2A2P A;  5D8I A;  5KOX A;  3F63 A;  3F4R A;  5GAN D;  3LFL A;  4I97 A;  1X5C A;  3EU3 A;  4MDC A;  3CTG A;  4Z2R A;  2LRC A;  3H79 A;  2MYG A;  3BCI A;  3RHC A;  1AUC A;  1V58 A;  3K8N A;  3GFK A;  1OC9 B;  2QSI A;  3RHB A;  3VK9 A;  4OD7 A;  1GSD A;  4OMV A;  3L9V A;  5CRH A;  4OCE A;  5GST A;  1OC8 A;  3TRP A;  1XVQ A;  3P8W A;  2H30 A;  2LEG A;  4J2F A;  2DJ1 A;  3MYD A;  1QK8 A;  3D0Z A;  4L5O A;  2H76 A;  4V1A g;  3Q6O A;  3IPZ A;  3VWV A;  2R37 A;  2OAD A;  1JZR A;  3IOS A;  4HI7 A;  5GZZ B;  22GS A;  2YOI A;  2WS2 A;  3FYG A;  2JAC A;  1XWA A;  1A0F A;  1SD9 A;  3KXO A;  4DSQ A;  2O7K A;  1K3L A;  4TN8 A;  1FVK A;  2IFQ B;  3R3E A;  2WZ9 A;  1Z9H A;  6GSY A;  3DD3 A;  1AQV A;  2H6Z A;  1ACV A;  1U3I A;  5DBQ A;  2YAN A;  1TK5 B;  1BYE A;  4AGS A;  3IBH A;  2FWE A;  3NIV A;  2LST A;  1BJX A;  1BQ7 A;  5GSS A;  4EDY A;  4O32 A;  1GTU A;  3GKN A;  1ILO A;  4MAB A;  2YJ7 A;  3HZ8 A;  2A4V A;  3M0F A;  1SYR A;  3IR4 A;  3J7Y k;  1J0F A;  4N0Z A;  1GSU A;  4PQH A;  2AB6 A;  3H4K A;  2RLI A;  1XZO A;  4ZBA A;  2GLR A;  1ZYN A;  3F3Q A;  1GLP A;  3F8U A;  3LG6 A;  3PPU A;  4F0B A;  1J08 A;  4FYB A;  2DBC A;  4CY6 A;  2FHE A;  2PER A;  3BCK A;  4HOJ A;  1HYU A;  1O6J A;  1SJZ A;  5ECH B;  2DMM A;  2KHP A;  4BWQ A;  4HZ2 A;  3HVX A;  5J5N A;  3RPP A;  1ZYP A;  1MDI A;  3KIJ A;  1MD4 A;  2LRN A;  4MH3 A;  4TR4 A;  1SK2 A;  4BVY A;  4I6X A;  3EMX A;  3RAZ A;  2R3X A;  5J4U A;  1OC9 A;  4HQS A;  3A5I A;  3CSJ A;  4POB A;  1X9M B;  2IMI A;  4NPB A;  2K6V A;  1K0B A;  3DYR A;  4WR4 A;  4ZIJ A;  1GTI A;  5H5Q A;  4EIQ A;  3BOA A;  1XVW A;  1TRV A;  2FA8 A;  1PKZ A;  5A4U A;  3WGX A;  1USB A;  4D73 A;  4V1A p;  3TB2 A;  2TRC P;  1A8Y A;  1O8X A;  3W8J A;  3H1N A;  2E0Q A;  2H19 A;  4HU7 A;  1SYX A;  3LXZ A;  1JLW A;  2NVL A;  4HS1 A;  4IQA A;  1FB0 A;  3IHQ A;  4MZC A;  4QL9 A;  2KOK A;  4EO3 A;  2OE0 A;  1OVN A;  1K3Y A;  5ECL B;  3QCP A;  1BX9 A;  3W6G A;  2K9F A;  4Q5Q A;  2R5G A;  1X0R A;  6GSS A;  3FR3 A;  4QL7 A;  4H86 A;  1VF3 A;  1XOA A;  2DSA A;  2OE3 A;  4GST A;  1ERV A;  1O73 A;  3C71 A;  1Q98 A;  1KTE A;  4KUN A;  4K6X A;  1WP0 A;  3KH7 A;  3NOF A;  4WEY A;  3FZA A;  4MH2 A;  2LKU A;  3ZZX A;  5CRG A;  4CHS A;  5JWO B;  4LA1 A;  4K5R A;  4KB3 A;  2HI7 A;  2YV9 A;  5KEJ A;  2GZP A;  4Z2U A;  4TOP A;  3GH9 A;  4WR5 A;  4LMV A;  1OC3 A;  1A2L A;  2O87 A;  2VD0 A;  2WJU A;  1X5E A;  4TR3 A;  2HRK A;  4GWR A;  1H4O A;  2L4Q A;  3FKF A;  4G19 A;  4YKG A;  2H72 A;  4K5S A;  5IO2 A;  3QOU A;  4KDU A;  3UIW A;  5AIX A;  5G30 A;  1B48 A;  4O5U A;  3QMX A;  2N5B A;  2R6K A;  5G31 A;  4ECJ A;  2IJY A;  1U88 A;  1R5P A;  5JWQ B;  2VL2 A;  2ON5 A;  3D22 A;  2P5R A;  4L0W A;  1S3R A;  3QAG A;  2IMD A;  2NPB A;  4BIK A;  2M72 A;  5A4W A;  2BTO T;  4FQU A;  5CRE A;  5DVB A;  6GSX A;  3FW2 A;  2XBQ A;  4HDE A;  4XTS A;  1R5A A;  1EGO A;  1SJI A;  2B1L A;  5DAK B;  1PL2 A;  3I69 A;  3SWL A;  4EL1 A;  1BAY A;  3L78 A;  2XBI A;  4KCA A;  2HE3 A;  2FWF A;  4IHU A;  1XW5 A;  5F8B A;  5DJM A;  5KN0 A;  5LNK e;  1TI1 A;  2IPA A;  2GZY A;  3M1G A;  4NXI A;  5ID2 A;  1WOU A;  2GTU A;  2PVO C;  3F0I A;  2JZT A;  1IYH A;  5HFK A;  3HXS A;  2YWM A;  1FB6 A;  5ELA A;  3FR9 A;  5A5K A;  2R0G A;  1X9W B;  3KMO A;  2B5E A;  3UEM A;  3A3T A;  2A2S A;  3GST A;  3ZYW A;  1F2E A;  3EIN A;  4QQ7 A;  1TP9 A;  4TR0 A;  3GX0 A;  3TJF A;  4MA9 A;  4N30 A;  3CXG A;  3A5W A;  5HR3 A;  2NTO A;  2HRN A;  3KJY A;  2PMT A;  2YZU A;  5KOW A;  4BVX A;  2OAC A;  3TJB A;  3TRQ A;  3GRX A;  3CTF A;  4ZBB A;  4K7O A;  2C8U A;  2DJJ A;  2LV3 A;  4JED A;  4K0G A;  1ST9 A;  3TOT A;  1TXX A;  4XCS A;  3GL5 A;  4TVE A;  3CRT A;  2M46 A;  1A2J A;  1TK0 B;  3FRC A;  3UAP A;  3HVV A;  3HCZ A;  1DE1 A;  3BJ5 A;  2VCT A;  1AQW A;  1XW9 A;  3CSI A;  1Z3E A;  2A2R A;  2HNL A;  3ZLP A;  2CZ3 A;  2F8A A;  2C1Y A;  4Q5F A;  3M9K A;  2DJK A;  5H5S A;  5FT3 A;  3HYP A;  3D5J A;  5ELG A;  1A8L A;  1T4Y A;  2C3Q A;  4EF0 A;  2G2Q A;  1TRU A;  2VL9 A;  2LNS A;  1QXH A;  2VAF A;  4EUY A;  3VWW A;  3ZIT A;  1HNC A;  5ECQ B;  3C1R A;  4CY8 A;  1DUG A;  3GH6 A;  1G7E A;  3TCO A;  5G5F A;  1Q4J A;  4YAP A;  3UVH A;  1WE0 A;  3CBU A;  5B6M A;  4IJI A;  1AQX A;  5G5E A;  1XBS A;  1RK4 A;  1THX A;  4YAV A;  1JZO A;  3GKK A;  2GGT A;  4JZQ A;  5KN2 A;  2C3N A;  2L6C A;  2FWG A;  1QMV A;  1TI3 A;  1Z6N A;  3KH9 A;  3IV4 A;  4EXJ A;  5CYY A;  3MSZ A;  2VD1 A;  3VPQ A;  1VGL A;  3MNG A;  4OFT A;  1YKC A;  1YZX A;  2JAD A;  4MPF A;  5EPF A;  3FZ4 A;  4USS A;  2H1B A;  2VL2 C;  5D96 A;  5EY6 A;  1O85 A;  6GST A;  2HYX A;  2K18 A;  2H01 A;  1FOH A;  2DKI A;  1B4Q A;  3VWX A;  1SKW B;  1ERT A;  2J9H A;  2PVQ A;  3E0U A;  4WXT A;  1ZYE A;  3GYK A;  4HU9 A;  3DML A;  4N10 A;  4DVC A;  2CVB A;  3GUR A;  3TKS E;  3GMF A;  5D9W A;  4KA0 A;  4XRA A;  2GQM A;  5DQY A;  2EC4 A;  4BVY B;  3KTL A;  2OBI A;  4GQC A;  5IPH A;  3ZRD A;  3TKR A;  1UN2 A;  3UJ1 A;  4K8M A;  2AJQ B;  5BRT A;  5IMZ A;  1ERU A;  3C1S A;  1EP7 A;  1GLQ A;  1TJD A;  4ZIL A;  1A24 A;  1GH2 A;  4O5R A;  2IWT A;  4D73 B;  1URM A;  3HHV A;  1LU4 A;  2N5A A;  4LL1 B;  1BED A;  4E8H A;  2C80 A;  1A23 A;  4RQX A;  4ML6 A;  3O76 A;  4JR4 A;  5HR0 A;  3VWU A;  1UVZ A;  1PA3 A;  2QC7 A;  1JFU A;  1GSQ A;  4WBR D;  3F3R A;  4KDY A;  1E6B A;  3NZN A;  2NBS A;  17GS A;  5J3R A;  4NAX A;  4ICY A;  4OFN A;  1UA5 A;  4WKW A;  2VUP A;  2X8G A;  5IMV A;  1TRS A;  4CW9 A;  4POK A;  3IXR A;  1G6W A;  3ERG A;  1XWB A;  4ID0 A;  3IE3 A;  2GST A;  3FR6 A;  2VCX A;  2FWH A;  2AV4 A;  1HNA A;  2HZF A;  1V98 A;  4WF5 A;  3F4T A;  3DGQ A;  5D9X A;  1OAZ A;  5INY A;  1GL8 A;  2BMX A;  2ZUP A;  4I5Q A;  3A2V A;  4EDZ A;  4FH8 A;  3A2X A;  2X64 A;  4DSR A;  1RW1 A;  1EOH A;  2VIM A;  2A4H A;  3UMA A;  2IIY A;  1LJR A;  5B8B A;  3IC4 A;  3FZ9 A;  4BPY A;  3F6D A;  4MF7 A;  5ECO B;  4GTU A;  1UC7 A;  3Q18 A;  11GS A;  1KNG A;  2VL3 A;  4G10 A;  1N8J A;  4ZB8 A;  2ON7 A;  2HRF A;  1GSE A;  1HNB A;  4HUA A;  4MJE A;  1EOG A;  2YNX A;  4WF4 A;  5JWR B;  2CX3 A;  3RBT A;  2PU9 C;  1NSW A;  4BA7 A;  1ML6 A;  3ME8 A;  4XHM A;  2E2G A;  4G0I A;  4KW6 A;  2PGT A;  4KAE A;  5ECK B;  18GS A;  4RQR A;  3U6V A;  1N2A A;  3TDG A;  1YY7 A;  2NDO A;  2VCV A;  1B8X A;  3ERF A;  2JZR A;  4DEJ A;  2ES7 A;  4AJ6 A;  4YH2 A;  3WYW A;  1B4P A;  2KP1 A;  3HJM A;  3FHK A;  2JL4 A;  2RUE A;  1ZZY A;  2DIY A;  1GTB A;  3KD0 A;  3EU4 A;  4ECB A;  3APS A;  5JCW A;  4JU5 A;  2AYT A;  1WIK A;  3IK9 A;  3APO A;  4TKY A;  2QGV A;  4RI6 A;  4JR6 A;  2P31 A;  2DC5 A;  2RM6 A;  4PNG A;  4MP4 A;  4K1F A;  4TXO B;  5G2Z A;  2AUV A;  1PN9 A;  5HR2 A;  19GS A;  2V41 A;  2N5F A;  1ABA A;  4IP6 A;  1ZOF A;  5LD0 A;  1XPV A;  3KP8 A;  4KH7 A;  2HLS A;  4NMU A;  1OE8 A;  4MMM A;  3UBK A;  2QA1 A;  4KX4 A;  3MAK A;  5ID2 B;  3LSZ A;  1G6Y A;  1LBK A;  1YEP A;  1MDJ A;  3PGT A;  4OCF A;  3N9J A;  3EMP A;  2L5L A;  1XWC A;  3UAR A;  1W4V A;  1PSQ A;  3F4S A;  3LEF A;  4L8E A;  1ZCP A;  1U6T A;  5CNW A;  4ZXG A;  3LGC A;  2FD3 A;  3PIN A;  1Z7P A;  1SU9 A;  1OKD A;  3D21 A;  4NV5 A;  3C73 A;  5CAX A;  3TKP A;  2CV4 A;  4N0V A;  4PTS A;  1WPI A;  4KSO A;  1I5G A;  4K2X A;  5IMA A;  1DE2 A;  2X8H A;  2RII A;  4G0L A;  4MLY A;  1NW2 A;  3EPT A;  1CQH A;  4BVX B;  1EEJ A;  2IMF A;  1WWJ A;  2FGX A;  3O3T A;  5L71 A;  4KND A;  1TOF A;  5DAL A;  3H93 A;  4HEA 2;  5F05 A;  2JZS A;  2DJ0 A;  2LJK A;  3ZFB A;  5AGY A;  3V1W A;  4BWS A;  3VFI A;  2IME A;  1T7P B;  1XWG A;  1F3B A;  4NHW A;  1WJK A;  1T00 A;  1QQ2 A;  4CDO A;  2GS3 A;  4IVF A;  5ECR B;  5G1L A;  4ECI A;  3F6F A;  5GAP D;  1SEN A;  2AHE A;  3HVS A;  5COH A;  1DBY A;  3TKS A;  1M3I A;  2YWN A;  1EGR A;  1F9M A;  4MF5 A;  3GV1 A;  2D2Z A;  3UL3 A;  2YCD A;  2HT9 A;  5HQP A;  4GF0 A;  3G7Y A;  1PD2 1;  1Z6M A;  1R4W A;  3QAV A;  2V6K A;  2MBT A;  3M8N A;  3ED3 A;  1R7H A;  1F3A A;  2YWO A;  5FHI A;  1EEM A;  2HXK A;  2H6X A;  1RQM A;  5AIV A;  1QUW A;  4TXO A;  3HKR A;  2CT6 A;  2LTK A;  2WDU A;  4V2N A;  2VCW A;  3FY7 A;  2HZE A;  5EVO A;  5CO3 A;  2IN3 A;  2DJ2 A;  1T1V A;  1PFO A;  1M2D A;  3VUR A;  1IYI A;  1R26 A;  2P5Q A;  1FVJ A;  3KP9 A;  5IM9 A;  3QPM A;  2JSZ A;  4TR1 A;  2JSY A;  1GSY A;  2EIR A;  4IBP A;  5B6N A;  2OKA A;  2WUL A;  2P0G A;  4PUA A;  1VF4 A;  2I4A A;  1GP1 A;  3TKQ A;  3GIX A;  4Z2T A;  16GS A;  3EUR A;  1AC1 A;  4EE0 A;  1TW9 A;  4ZB9 A;  2HRA A;  3TJK A;  2REM A;  1K0O A;  5F06 A;  4N11 A;  5JCU A;  5B8A A;  3HA9 A;  4MF6 A;  6GSW A;  2B7J A;  2L6D A;  1S3D A;  4V2M A;  4IKH A;  1V2A A;  3KMN A;  1PX6 A;  4LMW A;  9GSS A;  3E3E A;  4PX1 A;  1A2M A;  3UBL A;  1M9A A;  1OKT A;  2K8S A;  2LQO A;  2WRT A;  2WB9 A;  4O7H A;  3J7Y b;  2VLU A;  2B7K A;  2UZ8 A;  5FWG A;  4V2L A;  4HJ2 A;  1O7U A;  5KN3 A;  5C00 A;  1MTC A;  3VI5 A;  2X4A A;  3QAW A;  4YKF A;  2J23 A;  1A0R P;  3QFA C;  1SKR B;  3EE2 A;  2JU5 A;  5D73 A;  3JCM L;  2YV7 A;  5E4W A;  3ISO A;  1S3C A;  4JE1 A;  3ZFL A;  2OA7 A;  4OFM A;  4WBJ A;  5CRW A;  3DXB A;  2GSQ A;  1V9W A;  1PL1 A;  1I9D A;  3H8Q A;  3UVT A;  4P3Y B;  3I6A A;  4NHZ A;  2F9S A;  3RPN A;  2LJA A;  2O8V B;  4X1U A;  1YF0 A;  5JCG A;  2H0I A;  3DIE A;  2MMO A;  1EP8 A;  3AY8 A;  3M9J A;  4XS6 A;  1W89 A;  5D9V A;  1AIU A;  2CVD A;  1GWC A;  4PUR A;  3ZL5 A;  13GS A;  1WRY A;  3GL3 A;  5IPG A;  3A2W A;  3W8S A;  3LOR A;  1SK1 A;  1M3J A;  5ECS A;  4IJ3 A;  2QKE A;  5DCG A;  3HJO A;  4O5Q A;  1EZK A;  1JZW A;  3GKX A;  2KLX A;  3MWH A;  4ACS A;  2HSM A;  2B5X A;  2DKH A;  4XIH A;  4IS0 A;  4IEL A;  5ENU A;  2V32 A;  2GT6 A;  5ECM B;  3LJR A;  3SBC A;  3TKS C;  3GTU B;  2PBJ A;  2OE1 A;  2H0H A;  2WCI A; 
#chains in the Genus database with same CATH homology
 1M0U A;  2M80 A;  2X8C A;  5E59 A;  2E2M A;  4HQZ A;  5H5R A;  1GUL A;  7GSS A;  2FNO A;  2PUK C;  5IQY A;  3ZMK A;  1GSS A;  4I8B A;  2MBS A;  1G7O A;  3FZ5 A;  1VF1 A;  5AN1 A;  1BG5 A;  3LWA A;  2L4C A;  4F82 A;  3TUE A;  4K7I A;  4I2U A;  2LS5 A;  1KEB A;  2AAW A;  2O89 A;  4IGJ A;  3Q74 A;  3MDK A;  1PKW A;  1JLV A;  1WMJ A;  1HD2 A;  10GS A;  2CAI A;  2F51 A;  4MZB A;  5LCZ A;  4Z7X A;  2HSY A;  2CQ9 A;  3L9S A;  2GDR A;  4L5L A;  4ZL9 A;  3GN3 A;  4ZB6 A;  1GUK A;  1SL1 B;  4MJC A;  1Z5Y E;  2YJH A;  4ECC A;  1M9B A;  3C7M A;  3HJP A;  3I43 A;  2H8L A;  4IP1 A;  2YWI A;  3PH9 A;  1HQO A;  2B3S A;  3P2A A;  2TRX A;  4EC0 A;  2H66 A;  4DSS A;  4GRF A;  1S3A A;  3HZ4 A;  1YF1 A;  4GSS A;  1XOB A;  4A5P A;  5HFI A;  1PN0 A;  5B7C A;  4GQF A;  5J41 A;  4F9Z A;  4J57 E;  4KE3 A;  3APQ A;  1NHO A;  1FHE A;  1Y6E A;  1ZGN A;  2V6O A;  2H74 A;  1YEX A;  1AXD A;  1ZMA A;  3LQ7 A;  4FO5 A;  3S9F A;  1V40 A;  2B6M A;  4XS4 A;  3MIX A;  2H75 A;  1K0N A;  2GZZ A;  1GNW A;  2FUG 2;  3GTU A;  2H0G A;  1XW6 A;  4X4J A;  3IHG A;  3P90 A;  2CX4 A;  4IQ1 A;  3HD5 A;  4MCU A;  1O8W A;  2B5Y A;  3I9V 2;  3DVX A;  4PUF C;  1TU7 A;  1NHY A;  4FIW A;  3BD2 A;  3FEU A;  1QFN A;  1XCC A;  4MZW A;  1MDK A;  5J9B A;  2YZH A;  3GKM A;  4MJB A;  3DWV A;  5G1K A;  2H73 A;  5DAL B;  1FO5 A;  3N5O A;  4IN0 A;  3IAS 2;  5F0G A;  1O81 A;  2H1A A;  4KF9 A;  2R2J A;  1ON4 A;  2H70 A;  2VCZ A;  3IAM 2;  1YDK A;  4MNN A;  3ZIV A;  4XRD A;  2L5O A;  3IC8 A;  1K0M A;  2MMA A;  5D9T A;  3TJJ A;  5IMF A;  3GX8 A;  4JRR A;  4E8E A;  2VCQ A;  5IOX A;  3GNJ A;  2K8V A;  2FLS A;  4HZ4 A;  3RDW A;  3G7I A;  1K0D A;  2ZNM A;  1X9S B;  1SK0 A;  1Y25 A;  2I3Y A;  4KSM A;  3LYP A;  4KDX A;  2F3M A;  3VI7 A;  2OJL A;  2XHF A;  1K3O A;  3G7J A;  2C0F A;  3KEB A;  5F07 A;  2I81 A;  1K0A A;  1KBN A;  2GVP A;  2IFQ A;  1SL2 B;  2ZCT A;  2GSS A;  2YP6 A;  4BL7 B;  3DRN A;  2YN1 A;  2C4J A;  3IDV A;  4K9Z A;  4AF2 A;  3HY2 A;  1YKA A;  3D4T A;  2PWJ A;  4YQV A;  2HZE B;  3CSH A;  2PPT A;  4ML1 A;  4KCE A;  1GSF A;  3CRU A;  2GQK A;  3HDC A;  4WET A;  2H6Y A;  4ISD A;  3P7X A;  2GSR A;  2VO4 A;  3GUS A;  4TR1 B;  3L0H A;  3Q19 A;  5D93 A;  1U87 A;  1SD8 A;  1GUH A;  3EWL A;  1M7T A;  1K0C A;  2G0F A;  1FG4 A;  3IRA A;  1XXU A;  4PQ1 A;  4L0U A;  5HR1 A;  1THO A;  4Q5N A;  3ZML A;  2H71 A;  1NM3 A;  2IMK A;  5A4V A;  3KCM A;  2O85 A;  5IMC A;  1B9X C;  1VF2 A;  2VLV A;  1B9Y C;  3ZIJ A;  1OYJ A;  2RUF A;  4MPG A;  1QGV A;  2XPD A;  1F37 A;  3LXT A;  3EVI A;  4ILF A;  4K7N A;  1GUM A;  1SJ6 A;  1J9B A;  2HSH A;  5DJL A;  3PR8 A;  1G0T A;  4EIP A;  4GCI A;  1Z7R A;  2R0C A;  5AIS A;  1AAZ A;  3ERW A;  2R4V A;  3QFB C;  1EV9 A;  2BJX A;  2C0E A;  4PXO A;  1TK8 B;  3F9U A;  1EWX A;  3D4M A;  4G2E A;  3TRX A;  3WT2 A;  3LW9 A;  4J56 E;  3ZTL A;  4YQM A;  3DKS A;  3G9B A;  4K0N A;  4AJ8 A;  2LNT A;  5IO0 A;  4LL4 B;  1MD3 A;  4ULX A;  5CRD A;  3E9J B;  3FK8 A;  3KTB A;  2C0D A;  1E2Y A;  2DML A;  2XPE A;  2VOC A;  8GSS A;  3VLN A;  2KP2 A;  3M3M A;  2X49 A;  5ECN B;  4NV2 A;  2I1U A;  1TU8 A;  3KM6 A;  1F6M C;  2Z9S A;  4EKZ A;  4GSN A;  2DLX A;  3TJG A;  1SKS B;  5HFG A;  6GSU A;  4FYU A;  1JHB A;  1FW1 A;  2CZ2 A;  3QR6 A;  4BL7 A;  2DJ3 A;  1FOV A;  1PX7 A;  1PMT A;  4AJ7 A;  1H75 A;  3QD9 A;  2MZC A;  4G9H A;  14GS A;  2IL3 A;  5KN1 A;  2VLT A;  3VPT A;  3DVW A;  3IA1 A;  6GSV A;  1PRX A;  3GSS A;  4POM A;  2X99 A;  3L4N A;  3C8E A;  4PNF A;  2L59 A;  2EIQ A;  2R0P A;  4RI7 A;  5CP1 A;  1XFL A;  2HFD A;  2TIR A;  4GLT A;  1MEK A;  4MK3 A;  1TKD B;  3GA4 A;  2LRT A;  3FMW A;  2LQQ A;  4ZL7 A;  1T3B A;  4F2I A;  3CMI A;  1AW9 A;  4OWY A;  4POL A;  2LJR A;  3ME7 A;  4F03 A;  3WT1 A;  1TDI A;  1PGT A;  4MJA A;  3BBY A;  12GS A;  1OE7 A;  3WGD A;  2V2G A;  1ZYQ B;  1YJ6 A;  1C72 A;  2RM5 A;  1PQN A;  1M2B A;  3D6I A;  1JZD A;  1XIY A;  5IOW A;  3R2Q A;  1TTZ A;  4ZBD A;  1GRX A;  2ALB A;  3KZQ A;  1TRW A;  1DSB A;  1VRS D;  2VM2 A;  1SL0 B;  4O92 A;  3DEX A;  1X5D A;  4EVM A;  3TGZ A;  3ZRE A;  2B1K A;  4Q5R A;  3CYN A;  1T8E B;  1CQG A;  1M99 A;  3WGE A;  4FYC A;  2WGR A;  4K2D A;  3GHA A;  2MMN A;  3OR5 A;  3LYK A;  2OBK A;  2PN8 A;  3U5R E;  2FY6 A;  5IMD A;  2CVK A;  4HJM A;  3ZVJ A;  1EV4 A;  3EC3 A;  2L57 A;  3EYT A;  2GQL A;  4DSS B;  5DCH A;  5C04 A;  2CAQ A;  2H1G A;  1GNE A;  4NWY A;  1GTA A;  2MMZ A;  5DAK A;  1T4Z A;  1ERW A;  4KGI A;  4RUV A;  2WFC A;  5ABR A;  5ECI B;  2CA8 A;  2LUS A;  5BMU A;  3O6T A;  4X43 A;  4JBB A;  3WD6 A;  2YPM A;  4PQI A;  2VM1 A;  2H1D A;  3L9U A;  2FCH A;  5DQS A;  1U3A A;  4IW9 A;  4LLR A;  5J9C A;  4GXZ A;  2I9H A;  20GS A;  4XS4 B;  5ECP B;  4TW5 A;  2C3T A;  2EIO A;  3UOM A;  4XS1 A;  2F8F A;  1V57 A;  4YQU A;  4I2T A;  2DIZ A;  2V1M A;  4G0K A;  1YQ1 A;  4TRX A;  5EL8 A;  4OO4 A;  2E7P A;  5IIZ A;  1XWK A;  1FAA A;  1ZL9 A;  2QA2 A;  5DDL A;  4TXV A;  3ZVJ D;  3IK7 A;  2XC2 A;  3US3 A;  3TOU A;  3KGK A;  2GT5 A;  2KUC A;  4F0C A;  4X0X A;  2FA4 A;  4OO5 A;  4PGT A;  1M2A A;  2C0G A;  3QDN A;  4ZL8 A;  2A2P A;  5D8I A;  5KOX A;  3F63 A;  3F4R A;  5GAN D;  3LFL A;  4I97 A;  1X5C A;  3EU3 A;  4MDC A;  3CTG A;  4Z2R A;  2LRC A;  3H79 A;  2MYG A;  3BCI A;  3RHC A;  1AUC A;  1V58 A;  3K8N A;  3GFK A;  1OC9 B;  2QSI A;  3RHB A;  3VK9 A;  4OD7 A;  1GSD A;  4OMV A;  3L9V A;  5CRH A;  4OCE A;  5GST A;  1OC8 A;  3TRP A;  1XVQ A;  3P8W A;  2H30 A;  2LEG A;  4J2F A;  2DJ1 A;  3MYD A;  1QK8 A;  3D0Z A;  4L5O A;  2H76 A;  4V1A g;  3Q6O A;  3IPZ A;  3VWV A;  2R37 A;  2OAD A;  1JZR A;  3IOS A;  4HI7 A;  5GZZ B;  22GS A;  2YOI A;  2WS2 A;  3FYG A;  2JAC A;  1XWA A;  1A0F A;  1SD9 A;  3KXO A;  4DSQ A;  2O7K A;  1K3L A;  4TN8 A;  1FVK A;  2IFQ B;  3R3E A;  2WZ9 A;  1Z9H A;  6GSY A;  3DD3 A;  1AQV A;  2H6Z A;  1ACV A;  1U3I A;  5DBQ A;  2YAN A;  1TK5 B;  1BYE A;  4AGS A;  3IBH A;  2FWE A;  3NIV A;  2LST A;  1BJX A;  1BQ7 A;  5GSS A;  4EDY A;  4O32 A;  1GTU A;  3GKN A;  1ILO A;  4MAB A;  2YJ7 A;  3HZ8 A;  2A4V A;  3M0F A;  1SYR A;  3IR4 A;  3J7Y k;  1J0F A;  4N0Z A;  1GSU A;  4PQH A;  2AB6 A;  3H4K A;  2RLI A;  1XZO A;  4ZBA A;  2GLR A;  1ZYN A;  3F3Q A;  1GLP A;  3F8U A;  3LG6 A;  3PPU A;  4F0B A;  1J08 A;  4FYB A;  2DBC A;  4CY6 A;  2FHE A;  2PER A;  3BCK A;  4HOJ A;  1HYU A;  1O6J A;  1SJZ A;  5ECH B;  2DMM A;  2KHP A;  4BWQ A;  4HZ2 A;  3HVX A;  5J5N A;  3RPP A;  1ZYP A;  1MDI A;  3KIJ A;  1MD4 A;  2LRN A;  4MH3 A;  4TR4 A;  1SK2 A;  4BVY A;  4I6X A;  3EMX A;  3RAZ A;  2R3X A;  5J4U A;  1OC9 A;  4HQS A;  3A5I A;  3CSJ A;  4POB A;  1X9M B;  2IMI A;  4NPB A;  2K6V A;  1K0B A;  3DYR A;  4WR4 A;  4ZIJ A;  1GTI A;  5H5Q A;  4EIQ A;  3BOA A;  1XVW A;  1TRV A;  2FA8 A;  1PKZ A;  5A4U A;  3WGX A;  1USB A;  4D73 A;  4V1A p;  3TB2 A;  2TRC P;  1A8Y A;  1O8X A;  3W8J A;  3H1N A;  2E0Q A;  2H19 A;  4HU7 A;  1SYX A;  3LXZ A;  1JLW A;  2NVL A;  4HS1 A;  4IQA A;  1FB0 A;  3IHQ A;  4MZC A;  4QL9 A;  2KOK A;  4EO3 A;  2OE0 A;  1OVN A;  1K3Y A;  5ECL B;  3QCP A;  1BX9 A;  3W6G A;  2K9F A;  4Q5Q A;  2R5G A;  1X0R A;  6GSS A;  3FR3 A;  4QL7 A;  4H86 A;  1VF3 A;  1XOA A;  2DSA A;  2OE3 A;  4GST A;  1ERV A;  1O73 A;  3C71 A;  1Q98 A;  1KTE A;  4KUN A;  4K6X A;  1WP0 A;  3KH7 A;  3NOF A;  4WEY A;  3FZA A;  4MH2 A;  2LKU A;  3ZZX A;  5CRG A;  4CHS A;  5JWO B;  4LA1 A;  4K5R A;  4KB3 A;  2HI7 A;  2YV9 A;  5KEJ A;  2GZP A;  4Z2U A;  4TOP A;  3GH9 A;  4WR5 A;  4LMV A;  1OC3 A;  1A2L A;  2O87 A;  2VD0 A;  2WJU A;  1X5E A;  4TR3 A;  2HRK A;  4GWR A;  1H4O A;  2L4Q A;  3FKF A;  4G19 A;  4YKG A;  2H72 A;  4K5S A;  5IO2 A;  3QOU A;  4KDU A;  3UIW A;  5AIX A;  5G30 A;  1B48 A;  4O5U A;  3QMX A;  2N5B A;  2R6K A;  5G31 A;  4ECJ A;  2IJY A;  1U88 A;  1R5P A;  5JWQ B;  2VL2 A;  2ON5 A;  3D22 A;  2P5R A;  4L0W A;  3QAG A;  2IMD A;  2NPB A;  2M72 A;  5A4W A;  2BTO T;  4FQU A;  5CRE A;  5DVB A;  6GSX A;  3FW2 A;  2XBQ A;  4HDE A;  4XTS A;  1R5A A;  1EGO A;  1SJI A;  2B1L A;  5DAK B;  1PL2 A;  3I69 A;  3SWL A;  4EL1 A;  1BAY A;  3L78 A;  2XBI A;  4KCA A;  2HE3 A;  2FWF A;  4IHU A;  1XW5 A;  5F8B A;  5DJM A;  5KN0 A;  5LNK e;  1TI1 A;  2IPA A;  2GZY A;  3M1G A;  4NXI A;  5ID2 A;  1WOU A;  2GTU A;  2PVO C;  3F0I A;  2JZT A;  1IYH A;  5HFK A;  3HXS A;  2YWM A;  1FB6 A;  5ELA A;  3FR9 A;  5A5K A;  2R0G A;  1X9W B;  3KMO A;  2B5E A;  3UEM A;  3A3T A;  2A2S A;  3GST A;  3ZYW A;  1F2E A;  3EIN A;  4QQ7 A;  1TP9 A;  4TR0 A;  3GX0 A;  3TJF A;  4MA9 A;  4N30 A;  3CXG A;  3A5W A;  5HR3 A;  2NTO A;  2HRN A;  3KJY A;  2PMT A;  2YZU A;  5KOW A;  4BVX A;  2OAC A;  3TJB A;  3TRQ A;  3GRX A;  3CTF A;  4ZBB A;  4K7O A;  2C8U A;  2DJJ A;  2LV3 A;  4JED A;  4K0G A;  1ST9 A;  3TOT A;  1TXX A;  4XCS A;  3GL5 A;  4TVE A;  3CRT A;  2M46 A;  1A2J A;  1TK0 B;  3FRC A;  3UAP A;  3HVV A;  3HCZ A;  1DE1 A;  3BJ5 A;  2VCT A;  1AQW A;  1XW9 A;  3CSI A;  1Z3E A;  2A2R A;  2HNL A;  3ZLP A;  2CZ3 A;  2F8A A;  2C1Y A;  4Q5F A;  3M9K A;  2DJK A;  5H5S A;  5FT3 A;  3HYP A;  3D5J A;  5ELG A;  1A8L A;  1T4Y A;  2C3Q A;  4EF0 A;  2G2Q A;  1TRU A;  2VL9 A;  2LNS A;  1QXH A;  2VAF A;  4EUY A;  3VWW A;  3ZIT A;  1HNC A;  5ECQ B;  3C1R A;  4CY8 A;  1DUG A;  3GH6 A;  1G7E A;  3TCO A;  5G5F A;  1Q4J A;  4YAP A;  3UVH A;  1WE0 A;  3CBU A;  5B6M A;  4IJI A;  1AQX A;  5G5E A;  1XBS A;  1RK4 A;  1THX A;  4YAV A;  1JZO A;  3GKK A;  2GGT A;  4JZQ A;  5KN2 A;  2C3N A;  2L6C A;  2FWG A;  1QMV A;  1TI3 A;  1Z6N A;  3KH9 A;  3IV4 A;  4EXJ A;  5CYY A;  3MSZ A;  2VD1 A;  3VPQ A;  1VGL A;  3MNG A;  4OFT A;  1YKC A;  1YZX A;  2JAD A;  4MPF A;  5EPF A;  3FZ4 A;  4USS A;  2H1B A;  2VL2 C;  5D96 A;  5EY6 A;  1O85 A;  6GST A;  2HYX A;  2K18 A;  2H01 A;  1FOH A;  2DKI A;  1B4Q A;  3VWX A;  1SKW B;  1ERT A;  2J9H A;  2PVQ A;  3E0U A;  4WXT A;  1ZYE A;  3GYK A;  4HU9 A;  3DML A;  4N10 A;  4DVC A;  2CVB A;  3GUR A;  3TKS E;  3GMF A;  5D9W A;  4KA0 A;  4XRA A;  2GQM A;  5DQY A;  2EC4 A;  4BVY B;  3KTL A;  2OBI A;  4GQC A;  5IPH A;  3ZRD A;  3TKR A;  1UN2 A;  3UJ1 A;  4K8M A;  2AJQ B;  5BRT A;  5IMZ A;  1ERU A;  3C1S A;  1EP7 A;  1GLQ A;  1TJD A;  4ZIL A;  1A24 A;  1GH2 A;  4O5R A;  2IWT A;  4D73 B;  1URM A;  3HHV A;  1LU4 A;  2N5A A;  4LL1 B;  1BED A;  4E8H A;  2C80 A;  1A23 A;  4RQX A;  4ML6 A;  3O76 A;  4JR4 A;  5HR0 A;  3VWU A;  1UVZ A;  1PA3 A;  2QC7 A;  1JFU A;  1GSQ A;  4WBR D;  3F3R A;  4KDY A;  1E6B A;  3NZN A;  2NBS A;  17GS A;  5J3R A;  4NAX A;  4ICY A;  4OFN A;  1UA5 A;  4WKW A;  2VUP A;  2X8G A;  5IMV A;  1TRS A;  4CW9 A;  4POK A;  3IXR A;  1G6W A;  3ERG A;  1XWB A;  4ID0 A;  3IE3 A;  2GST A;  3FR6 A;  2VCX A;  2FWH A;  2AV4 A;  1HNA A;  2HZF A;  1V98 A;  4WF5 A;  3F4T A;  3DGQ A;  5D9X A;  1OAZ A;  5INY A;  1GL8 A;  2BMX A;  2ZUP A;  4I5Q A;  3A2V A;  4EDZ A;  4FH8 A;  3A2X A;  2X64 A;  4DSR A;  1RW1 A;  1EOH A;  2VIM A;  2A4H A;  3UMA A;  2IIY A;  1LJR A;  5B8B A;  3IC4 A;  3FZ9 A;  4BPY A;  3F6D A;  4MF7 A;  5ECO B;  4GTU A;  1UC7 A;  3Q18 A;  11GS A;  1KNG A;  2VL3 A;  4G10 A;  1N8J A;  4ZB8 A;  2ON7 A;  2HRF A;  1GSE A;  1HNB A;  4HUA A;  4MJE A;  1EOG A;  2YNX A;  4WF4 A;  5JWR B;  2CX3 A;  3RBT A;  2PU9 C;  1NSW A;  4BA7 A;  1ML6 A;  3ME8 A;  4XHM A;  2E2G A;  4G0I A;  4KW6 A;  2PGT A;  4KAE A;  5ECK B;  18GS A;  4RQR A;  3U6V A;  1N2A A;  3TDG A;  1YY7 A;  2NDO A;  2VCV A;  1B8X A;  3ERF A;  2JZR A;  4DEJ A;  2ES7 A;  4AJ6 A;  4YH2 A;  3WYW A;  1B4P A;  2KP1 A;  3HJM A;  3FHK A;  2JL4 A;  2RUE A;  1ZZY A;  2DIY A;  1GTB A;  3KD0 A;  3EU4 A;  4ECB A;  3APS A;  5JCW A;  4JU5 A;  2AYT A;  1WIK A;  3IK9 A;  3APO A;  4TKY A;  2QGV A;  4RI6 A;  4JR6 A;  2P31 A;  2DC5 A;  2RM6 A;  4PNG A;  4MP4 A;  4K1F A;  4TXO B;  5G2Z A;  2AUV A;  1PN9 A;  5HR2 A;  19GS A;  2V41 A;  2N5F A;  1ABA A;  4IP6 A;  1ZOF A;  5LD0 A;  1XPV A;  3KP8 A;  4KH7 A;  2HLS A;  4NMU A;  1OE8 A;  4MMM A;  3UBK A;  2QA1 A;  4KX4 A;  3MAK A;  5ID2 B;  3LSZ A;  1G6Y A;  1LBK A;  1YEP A;  1MDJ A;  3PGT A;  4OCF A;  3N9J A;  3EMP A;  2L5L A;  1XWC A;  3UAR A;  1W4V A;  1PSQ A;  3F4S A;  3LEF A;  4L8E A;  1ZCP A;  1U6T A;  5CNW A;  4ZXG A;  3LGC A;  2FD3 A;  3PIN A;  1Z7P A;  1SU9 A;  1OKD A;  3D21 A;  4NV5 A;  3C73 A;  5CAX A;  3TKP A;  2CV4 A;  4N0V A;  4PTS A;  1WPI A;  4KSO A;  1I5G A;  4K2X A;  5IMA A;  1DE2 A;  2X8H A;  2RII A;  4G0L A;  4MLY A;  1NW2 A;  3EPT A;  1CQH A;  4BVX B;  1EEJ A;  2IMF A;  1WWJ A;  2FGX A;  3O3T A;  5L71 A;  4KND A;  1TOF A;  5DAL A;  3H93 A;  4HEA 2;  5F05 A;  2JZS A;  2DJ0 A;  2LJK A;  3ZFB A;  5AGY A;  3V1W A;  4BWS A;  3VFI A;  2IME A;  1T7P B;  1XWG A;  1F3B A;  4NHW A;  1WJK A;  1T00 A;  1QQ2 A;  4CDO A;  2GS3 A;  4IVF A;  5ECR B;  5G1L A;  4ECI A;  3F6F A;  5GAP D;  1SEN A;  2AHE A;  3HVS A;  5COH A;  1DBY A;  3TKS A;  2YWN A;  1EGR A;  1F9M A;  4MF5 A;  3GV1 A;  2D2Z A;  3UL3 A;  2YCD A;  2HT9 A;  5HQP A;  4GF0 A;  3G7Y A;  1PD2 1;  1Z6M A;  1R4W A;  3QAV A;  2V6K A;  2MBT A;  3M8N A;  3ED3 A;  1R7H A;  1F3A A;  2YWO A;  5FHI A;  1EEM A;  2HXK A;  2H6X A;  1RQM A;  5AIV A;  1QUW A;  4TXO A;  3HKR A;  2CT6 A;  2LTK A;  2WDU A;  4V2N A;  2VCW A;  3FY7 A;  2HZE A;  5EVO A;  5CO3 A;  2IN3 A;  2DJ2 A;  1T1V A;  1M2D A;  3VUR A;  1IYI A;  1R26 A;  2P5Q A;  1FVJ A;  3KP9 A;  5IM9 A;  3QPM A;  2JSZ A;  4TR1 A;  2JSY A;  1GSY A;  2EIR A;  4IBP A;  5B6N A;  2OKA A;  2WUL A;  2P0G A;  4PUA A;  1VF4 A;  2I4A A;  1GP1 A;  3TKQ A;  3GIX A;  4Z2T A;  16GS A;  3EUR A;  1AC1 A;  4EE0 A;  1TW9 A;  4ZB9 A;  2HRA A;  3TJK A;  2REM A;  1K0O A;  5F06 A;  4N11 A;  5JCU A;  5B8A A;  3HA9 A;  4MF6 A;  6GSW A;  2B7J A;  2L6D A;  1S3D A;  4V2M A;  4IKH A;  1V2A A;  3KMN A;  1PX6 A;  4LMW A;  9GSS A;  3E3E A;  4PX1 A;  1A2M A;  3UBL A;  1M9A A;  1OKT A;  2K8S A;  2LQO A;  2WRT A;  2WB9 A;  4O7H A;  3J7Y b;  2VLU A;  2B7K A;  2UZ8 A;  5FWG A;  4V2L A;  4HJ2 A;  1O7U A;  5KN3 A;  5C00 A;  1MTC A;  3VI5 A;  2X4A A;  3QAW A;  4YKF A;  2J23 A;  1A0R P;  3QFA C;  1SKR B;  3EE2 A;  2JU5 A;  5D73 A;  3JCM L;  2YV7 A;  5E4W A;  3ISO A;  1S3C A;  4JE1 A;  3ZFL A;  2OA7 A;  4OFM A;  4WBJ A;  5CRW A;  3DXB A;  2GSQ A;  1V9W A;  1PL1 A;  1I9D A;  3H8Q A;  3UVT A;  4P3Y B;  3I6A A;  4NHZ A;  2F9S A;  3RPN A;  2LJA A;  2O8V B;  4X1U A;  1YF0 A;  5JCG A;  2H0I A;  3DIE A;  2MMO A;  1EP8 A;  3AY8 A;  3M9J A;  4XS6 A;  1W89 A;  5D9V A;  1AIU A;  2CVD A;  1GWC A;  4PUR A;  3ZL5 A;  13GS A;  1WRY A;  3GL3 A;  5IPG A;  3A2W A;  3W8S A;  3LOR A;  1SK1 A;  5ECS A;  4IJ3 A;  2QKE A;  5DCG A;  3HJO A;  4O5Q A;  1EZK A;  1JZW A;  3GKX A;  2KLX A;  3MWH A;  4ACS A;  2HSM A;  2B5X A;  2DKH A;  4XIH A;  4IS0 A;  4IEL A;  5ENU A;  2V32 A;  2GT6 A;  5ECM B;  3LJR A;  3SBC A;  3TKS C;  3GTU B;  2PBJ A;  2OE1 A;  2H0H A;  2WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...