2JU5A

Dsbh oxidoreductase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
ARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHKPIGLFFTGSDWCMWCIKMQDQILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQELKAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVKSALKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin Disulfide Isomerase
publication title Insight into Disulfide Bond Catalysis in Chlamydia from the Structure and Function of DsbH, a Novel Oxidoreductase.
pubmed doi rcsb
source organism Chlamydophila pneumoniae
total genus 31
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ju5A01
1AW9A 2H75A 1BAYA 3ME8A 2PN8A 2DC5A 4PNGA 3GH9A 3LWAA 1BQ7A 2QKEA 4X0XA 2L4CA 5DAKA 1SJ6A 3APQA 5CRDA 1VRSD 1FG4A 3JCML 2YOIA 1JLVA 5ENUA 5ECMB 14GSA 2LTKA 3KH7A 5IMAA 3D22A 2A4VA 3GKNA 1WJKA 4PURA 1DE2A 3IK9A 3D21A 1PKZA 4KE3A 1PRXA 1O85A 3TKSC 3VLNA 2LRTA 2OBIA 3TKSE 2B7JA 3ED3A 4HQSA 4JRRA 3TJBA 1GNEA 3N5OA 4CDOA 1WPIA 1A8YA 2H01A 3GKMA 2AUVA 4IGJA 2C1YA 1G6WA 2YJHA 2O7KA 3MSZA 2VL3A 4OCFA 5CREA 3EURA 1R4WA 1FO5A 3IDVA 1UA5A 1ERTA 4PNFA 4RI6A 4CW9A 5ID2B 1EZKA 1JZRA 4NHZA 1YZXA 4NV2A 4EF0A 3NOFA 2MYGA 2I3YA 5EVOA 1F3AA 1GNWA 4K7OA 1PL2A 2PU9C 4FH8A 4XIHA 4K2DA 2YN1A 8GSSA 1M99A 4YQVA 2O89A 2CAQA 3RHCA 5AISA 1M9AA 3BBYA 5D9WA 3TDGA 3UL3A 3KJYA 5KN3A 2M46A 4PGTA 1KNGA 5HR2A 1WMJA 2C80A 4TOPA 2MZCA 4HS1A 4JR4A 1SK2A 3GA4A 3BCKA 3ZIJA 2J9HA 4MJBA 4WBJA 2C0DA 1K0DA 1MDJA 2YCDA 5FT3A 1SL0B 1E2YA 2HLSA 1AQVA 3GKKA 2ZCTA 1Y6EA 2M72A 5G1KA 2H73A 1SK1A 2TRXA 4JZQA 2LKUA 2VM2A 5CO3A 5HFKA 3O3TA 2O85A 1YF1A 1XWAA 2LRNA 4IELA 2B1LA 1PQNA 4POBA 5LNKe 1ZOFA 2J23A 2F3MA 2C0FA 1NW2A 3QD9A 1GL8A 4MH3A 3D4TA 1X5EA 4LMWA 3DWVA 2L6CA 1UC7A 1A2JA 1ERVA 3MDKA 1FB6A 7GSSA 4LLRA 3GSSA 2YP6A 5J4UA 2IPAA 3FR3A 1V40A 4HJMA 13GSA 4EXJA 4NWYA 2KLXA 3HY2A 4IHUA 4PQIA 2RM6A 2C3NA 4KB3A 5J9BA 3FR6A 4EVMA 3C71A 3L4NA 5LD0A 1O7UA 3ZFBA 3F3QA 2HZEB 1OE8A 4ULXA 3VFIA 3QAVA 1ZGNA 3ZLPA 3FYGA 2IMEA 2OE0A 1NHOA 4ACSA 3WGXA 1Z5YE 1I5GA 4XRAA 3EMXA 4YAPA 2TRCP 1ZCPA 4J56E 4XS4A 1F6MC 4HOJA 3ZIVA 5G31A 1EOGA 1EGRA 2K8SA 2QSIA 2JADA 4V2LA 3G7YA 1B9XC 3CYNA 2DLXA 3KD0A 5LCZA 2BJXA 4MP4A 1K3OA 1TDIA 3R2QA 1JHBA 3WGDA 2HSYA 2VD0A 3QMXA 4GQFA 1EV4A 3CSHA 3HZ8A 2X99A 3M9JA 1VGLA 1ON4A 1GSDA 1URMA 5ELAA 3RAZA 1U6TA 3E9JB 2JACA 2DJ1A 3LFLA 4NHWA 3FY7A 1GP1A 1ML6A 1FVKA 3KCMA 3VI5A 4EDYA 2YZHA 5DALB 4DSSA 5F07A 2IMIA 3TJKA 4EO3A 1GUMA 4DEJA 2N5FA 4F82A 4XTSA 2LJRA 1A0RP 1EEJA 3F6FA 3GL5A 1U3IA 1SJIA 4QL7A 1PSQA 4ID0A 5FWGA 1WWJA 4ECIA 1IYHA 3J7Yk 3EC3A 5JWRB 2CVKA 1KEBA 3C1RA 1XVQA 2JL4A 4F9ZA 3GX0A 1F9MA 5CNWA 4LA1A 2FA8A 3DVWA 2VAFA 4ML1A 2C0EA 1XW9A 5IOXA 1U87A 5AN1A 1C72A 22GSA 1PKWA 5ECQB 3IAM2 5B6NA 4XS6A 2VCWA 2MBSA 1QXHA 1ZZYA 1PA3A 5J9CA 3GV1A 6GSTA 2H6YA 2WGRA 3I9V2 4GCIA 1T1VA 1Q4JA 1OKTA 5D9XA 2L57A 2V1MA 4WEYA 3HZ4A 5ID2A 2F8AA 3F0IA 2PMTA 5JWOB 1HNAA 2VL2A 1PGTA 3NIVA 2HYXA 3M0FA 1PX7A 2R4VA 3US3A 3V1WA 4GRFA 2FWFA 2IN3A 3UVHA 3IAS2 4RQRA 1GSQA 3CRUA 5CYYA 1K3YA 2IWTA 4KGIA 4BWQA 4ILFA 4RUVA 4GXZA 3GYKA 1TW9A 2YWNA 1SU9A 3CBUA 3KGKA 3DVXA 2TIRA 3ZRDA 3UJ1A 1SL1B 2H19A 1YEPA 2I4AA 1W89A 1PMTA 1K0AA 3A2VA 3U6VA 4KDUA 4XS1A 2HXKA 2N5BA 4TXOB 3IOSA 3IR4A 2NVLA 3DEXA 2JZRA 3A3TA 4I97A 1PD21 4JR6A 4IN0A 2B3SA 5IMZA 2QGVA 1T00A 1YF0A 4I2UA 4K6XA 2AAWA 3F4RA 1G7EA 1XOBA 1WE0A 4KSMA 2JZTA 2HE3A 1M2DA 2K6VA 2B1KA 4MJCA 1M7TA 2IJYA 2L4QA 3TKRA 2Z9SA 4H86A 2WB9A 3GNJA 1O8WA 1GTBA 3IC4A 3PR8A 1TRSA 1LU4A 2IMFA 4MJEA 1H75A 4MZWA 5E59A 1CQGA 1ERUA 1Z9HA 2HSHA 4K7IA 4BPYA 2XC2A 4MZBA 1NHYA 4IJIA 4XHMA 3LYKA 4ML6A 4MDCA 2HZEA 2VIMA 1TJDA 2L5OA 2CVDA 4IBPA 2YZUA 1AAZA 3MAKA 2B5XA 3PGTA 1VF3A 1HQOA 3LXZA 2X8HA 4ECJA 3A5WA 3RHBA 2FA4A 2NBSA 1YKCA 3D5JA 1J9BA 2REMA 1WOUA 1EV9A 2CZ2A 1AC1A 4L0WA 1I9DA 3KIJA 1E6BA 4F03A 2ON7A 2PWJA 1OAZA 3IHQA 2VCTA 3GL3A 1HNCA 3F9UA 3HJOA 3TJGA 1YKAA 2IL3A 1Z3EA 3LEFA 1BYEA 4ZL8A 2AHEA 4PUFC 4DSSB 2EC4A 2OBKA 1DBYA 1TKDB 4OFNA 5DALA 1WP0A 3DD3A 2H74A 3DMLA 4BA7A 5DCGA 3IK7A 4I8BA 3BJ5A 1GTUA 6GSSA 1DUGA 2IMKA 2IFQB 3APOA 5ECRB 1GULA 3UBKA 2LS5A 2A2RA 3TKQA 5J3RA 2I81A 2PVOC 1OC9B 4O5RA 5CRWA 3D0ZA 4BL7A 2DJ0A 1B8XA 1NM3A 3E3EA 3RPNA 1R5PA 4IQ1A 3TB2A 5HFIA 3KEBA 3ZREA 3N9JA 2OA7A 5IQYA 1V9WA 3GN3A 2G2QA 4FYBA 12GSA 3F6DA 3NZNA 1YDKA 4HU7A 2XPEA 2KUCA 2GQMA 4F0CA 4GSTA 4MJAA 4NMUA 2IIYA 3HJPA 4ZL9A 4ZXGA 2FWGA 1X5CA 2VM1A 3AY8A 1XWBA 3VPTA 3TJFA 1FOVA 1XPVA 5D9VA 2VLTA 2D2ZA 5ECPB 3QPMA 3H79A 3TRQA 4L5OA 4ZBAA 1A24A 2PVQA 3WT1A 2H76A 4WBRD 1YY7A 2DJKA 1A2MA 3ZL5A 1GRXA 1ACVA 4OMVA 4BVYA 2P5QA 5A4VA 3A2XA 4KSOA 1GUKA 1RQMA 2FWHA 4TR4A 2ZNMA 4O7HA 1OVNA 5IMFA 5IMCA 3LYPA 2BMXA 5EPFA 3TJJA 2VCQA 5F05A 3FW2A 4E8EA 1Z6MA 1M9BA 5ECSA 4HI7A 3SWLA 1TK0B 3TKPA 1TI3A 5DDLA 3DGQA 3FZ9A 2HT9A 2XPDA 4EC0A 1HD2A 5AGYA 4OFTA 2LNSA 4TXOA 3KXOA 3HA9A 5HFGA 1XZOA 3HVVA 2YPMA 2FGXA 3QFAC 2GSRA 2V6KA 3C73A 4ECBA 1VF2A 1B4QA 3LGCA 5KN2A 2VCXA 2R37A 3QDNA 5ECHB 3UEMA 2I9HA 4AJ8A 4AJ6A 2X8GA 1OC3A 2GSQA 2K8VA 2ZUPA 2NDOA 5KN1A 4WKWA 4BWSA 1WRYA 3QCPA 2CZ3A 3TRPA 1V2AA 2EIOA 3M9KA 4K9ZA 3FR9A 3LORA 3G9BA 4YQUA 1TU8A 3FRCA 1LJRA 1LBKA 5EY6A 2CAIA 4O92A 2NTOA 3UOMA 1BG5A 2GZYA 3EYTA 3CTFA 5CRGA 2H0GA 5GSTA 1X5DA 5D8IA 1Q98A 4EUYA 1ZYQB 4IP6A 2YWIA 4KNDA 2AV4A 1A2LA 3L9VA 3KTLA 4P3YB 3TOUA 1J0FA 1Y25A 1ERWA 2WULA 5HR0A 1TK8B 3F8UA 3LSZA 3W6GA 4ISDA 2MMAA 1VF4A 4NPBA 2VL9A 2GZZA 4KA0A 2FHEA 2C4JA 4LMVA 1GSSA 2E2GA 1Z7RA 1OKDA 2LRCA 2AJQB 3HHVA 3EMPA 4IW9A 4V1Ap 5H5QA 1PL1A 3RDWA 2VCZA 1TRVA 4GLTA 5EL8A 3I69A 2DJJA 1TRWA 2IFQA 5G5EA 4TW5A 5FHIA 2LQOA 2R3XA 5ECIB 3TGZA 1XOAA 1EEMA 3KZQA 4E8HA 1R5AA 3H1NA 3VPQA 3TKSA 5IOWA 2PGTA 1WIKA 4FYCA 1OC9A 1T4YA 1ZL9A 2KP2A 3L9UA 4MCUA 5D93A 2JSZA 2G0FA 2GVPA 4MF6A 2H30A 3KP8A 1BX9A 2GT6A 2RUEA 6GSXA 1PN9A 2WJUA 1QMVA 2ES7A 3C7MA 1A8LA 2YWMA 4PUAA 3IA1A 3ZVJD 2DMLA 1QK8A 1EP7A 1FW1A 3K8NA 2CA8A 2H6XA 3D6IA 4PX1A 2GQLA 1BJXA 1Z6NA 3EU4A 2XBQA 2OADA 3TRXA 2DJ2A 3F63A 2MMZA 2H70A 2RLIA 4HU9A 4KUNA 1U3AA 4PQHA 2DBCA 3E0UA 3UIWA 2YV9A 3KMNA 1N2AA 2ON5A 4F2IA 1SKRB 2GDRA 2IMDA 2N5AA 2WDUA 1M2BA 3GTUB 2WCIA 3VWVA 4JE1A 3WT2A 5KEJA 1FAAA 4YH2A 4KDXA 4IS0A 2PPTA 4WF4A 5KN0A 1S3AA 2LEGA 4I5QA 3WYWA 4AF2A 3HKRA 5G1LA 1H4OA 2EIQA 1K0MA 3CRTA 2LSTA 3KP9A 4LL1B 4HDEA 4ZB6A 3HJMA 3P2AA 5DCHA 1JZDA 3DRNA 1GH2A 4D73B 5JWQB 5ABRA 3QAGA 2FD3A 3PH9A 3ZITA 3ZFLA 4DSRA 3M3MA 4RQXA 5IPHA 4N0ZA 3LQ7A 1MTCA 3EINA 5B8BA 4WR4A 1SJZA 2C3TA 3QOUA 1EGOA 5G5FA 4KCEA 3HVXA 5GZZB 1SD9A 3UARA 1GSYA 1OYJA 3Q19A 1J08A 2O8VB 2WFCA 1UN2A 3H93A 2H6ZA 2OE1A 3GFKA 1YQ1A 5J5NA 1AUCA 1Z7PA 3O6TA 1V58A 4TR0A 3TOTA 3KH9A 2GZPA 3FEUA 4GSNA 1SENA 5IM9A 4JU5A 4NXIA 1U88A 1MDKA 4Z7XA 4EE0A 3WD6A 3BOAA 3C8EA 1XBSA 2BTOT 5ELGA 1QUWA 5C04A 4EKZA 4FYUA 3BD2A 2H1AA 3O76A 4POMA 3I6AA 5J41A 3IXRA 1QQ2A 1B9YC 3P90A 3FZ4A 1ILOA 2ALBA 5A4UA 4F0BA 4AGSA 3OR5A 4WXTA 1X9MB 3HCZA 5ECNB 2YV7A 3DYRA 3KM6A 4QQ7A 1S3CA 3ISOA 3H4KA 4HZ2A 2CQ9A 1V98A 2B7KA 2OKAA 1XXUA 1OC8A 4DVCA 2GLRA 4TVEA 6GSYA 2H1DA 3CSIA 1K0OA 4ZIJA 5COHA 2B5EA 1SK0A 2C3QA 2FY6A 3EWLA 1M0UA 1A0FA 1T4ZA 20GSA 1JLWA 3F3RA 2HZFA 2MMNA 4Q5NA 5HR3A 2FCHA 3LXTA 1K3LA 4ZBDA 3F4SA 2L6DA 1UVZA 4LL4B 3MNGA 11GSA 4K0NA 5ECLB 3QFBC 4MA9A 2AB6A 5HR1A 4O32A 3Q18A 5INYA 2RM5A 1JZWA 1MD3A 4G19A 2WS2A 3VI7A 1B4PA 1X9WB 1VF1A 4Q5FA 1EP8A 3DXBA 2V41A 5JCGA 3VWUA 5GSSA 1GTIA 1HNBA 3FZAA 2GS3A 3TUEA 3W8SA 1V57A 2YANA 4L0UA 4ZILA 1SL2B 3IV4A 1AXDA 2HI7A 5B6MA 3BCIA 2E0QA 2GSSA 2H66A 3HVSA 4MZCA 3UAPA 5AIVA 1K0BA 4TKYA 5H5RA 4HJ2A 2H72A 5GAND 2DSAA 2KHPA 1JFUA 4L8EA 2R2JA 4POLA 2GTUA 2VLUA 1GSFA 3UVTA 1MEKA 2OE3A 4MMMA 5AIXA 4ZB8A 4QL9A 4MLYA 1TOFA 4WETA 4OCEA 4G2EA 1NSWA 2KOKA 3TCOA 1X9SB 2VL2C 1JZOA 1PX6A 1G7OA 4HUAA 2O87A 4EL1A 1G6YA 2VD1A 3MWHA 3GTUA 4Q5QA 2B5YA 4V2MA 2LJKA 4ECCA 4MABA 4OO4A 4V2NA 1TK5B 2QC7A 2VLVA 4X43A 4EDZA 2CX4A 2NPBA 3ZTLA 1TXXA 2AYTA 3IBHA 4I6XA 2FUG2 2PERA 4IP1A 3WGEA 2C8UA 1XW6A 4N11A 5HQPA 1XWCA 4ZB9A 4BVXA 2M80A 3EU3A 4RI7A 4G9HA 4HQZA 1FVJA 3IPZA 5DJLA 2RUFA 5G30A 2R6KA 4XRDA 1SYRA 1K0CA 3FZ5A 5DQYA 4D73A 2RIIA 2F8FA 2P31A 2DIZA 3S9FA 5CP1A 2HRFA 2GT5A 3C1SA 2VO4A 1YEXA 1G0TA 4GTUA 5L71A 1XWKA 1GSEA 4FO5A 3EVIA 4KX4A 4NAXA 4MF7A 1AQWA 4KH7A 5E4WA 1CQHA 1THXA 4WR5A 4AJ7A 2PUKC 3DKSA 1FB0A 4Q5RA 3Q74A 3SBCA 2K18A 4TR1B 2F51A 3ERGA 4JBBA 2JU5A 2H1GA 1O73A 1EOHA 2LQQA 3HDCA 2DJ3A 1S3DA 1XVWA 3GUSA 4TR3A 2GGTA 2X64A 3CTGA 4TN8A 3H8QA 1K0NA 3KMOA 5DQSA 3HYPA 1GUHA 1SKWB 2P0GA 3ZZXA 3GX8A 3APSA 4TXVA 2WRTA 4YQMA 4XCSA 1T8EB 4K7NA 5CAXA 1XIYA 2EIRA 4GSSA 1O8XA 3FKFA 4YAVA 4FIWA 2VUPA 4IJ3A 1R7HA 2KP1A 4K0GA 1T3BA 1TTZA 2F9SA 5IMVA 2V6OA 3ZYWA 5CRHA 1QGVA 4HEA2 1DSBA 3GRXA 1O6JA 1USBA 1YJ6A 4MH2A 5ECKB 6GSUA 5IIZA 1A23A 2WZ9A 2DIYA 2L59A 1ABAA 3QAWA 2FNOA 3GURA 3VURA 1IYIA 2JZSA 3VWXA 2OACA 5DAKB 3F4TA 2E7PA 18GSA 2X8CA 3EE2A 1GTAA 2VCVA 4PQ1A 4POKA 3A2WA 2V32A 4X1UA 2MBTA 1TU7A 3D4MA 2HFDA 4OD7A 1XW5A 5IO0A 1ZMAA 2H71A 1F2EA 2CX3A 4DSQA 1O81A 3QR6A 1B48A 4GQCA 3GSTA 3PINA 4HZ4A 4CHSA 3Q6OA 4GWRA 2E2MA 1XWGA 3J7Yb 2YWOA 2A2SA 1DE1A 1FHEA 2HRNA 2HNLA 1OE7A 1TRUA 1ZYEA 3DIEA 2FWEA 5G2ZA 4ZBBA 1EWXA 5B8AA 4ZL7A 3VK9A 3VWWA 2VOCA 4OFMA 3L78A 4OWYA 5IPGA 4KW6A 1THOA 2H0IA 2C0GA 1TI1A 3LG6A 4V1Ag 1XCCA 1SYXA 2GSTA 2LNTA 3IE3A 3IRAA 4K1FA 4KAEA 1AIUA 4MF5A 4WF5A 4N10A 4NV5A 3L0HA 3UMAA 5IMDA 1TP9A 2I1UA 3CSJA 1SKSB 5JCWA 9GSSA 3RPPA 3GH6A 5F0GA 2CVBA 4G10A 1F3BA 3GMFA 4N30A 3L9SA 1M2AA 3ZMLA 6GSVA 10GSA 1GLPA 2LJAA 3ME7A 3GIXA 5D73A 2L5LA 1QFNA 2XBIA 3P7XA 3ZMKA 1MDIA 3CMIA 5D9TA 4KCAA 2JSYA 5JCUA 1X0RA 4MPGA 2LUSA 5A4WA 2MMOA 2GQKA 3W8JA 1RK4A 2XHFA 4N0VA 1RW1A 4I2TA 2YNXA 1T7PB 2DMMA 17GSA 4TR1A 2R5GA 3G7JA 4K8MA 2K9FA 1KTEA 2H0HA 3HXSA 4L5LA 3M8NA 1GWCA 4TRXA 3LJRA 1GSUA 4IQAA 2YJ7A 1GLQA 1F37A 1ST9A 1SD8A 3KTBA 3ZVJA 3FHKA 3P8WA 3ERWA 5A5KA 5C00A 3HD5A 1W4VA 2LV3A 5DVBA 1KBNA 4J2FA 3I43A 1R26A 4GF0A 5DJMA 3G7IA 3UBLA 3GHAA 4MK3A 1BEDA 2PBJA 2P5RA 4XS4B 3CXGA 4MPFA 5DBQA 3U5RE 1XFLA 3GKXA 4OO5A 1HYUA 4IVFA 2FLSA 1AQXA 2H1BA 3RBTA 5GAPD 2CV4A 4J57E 16GSA 4IKHA 5F06A 5ECOB 4KDYA 5F8BA 2V2GA 4PXOA 3FK8A 5IO2A 2H8LA 5H5SA 3M1GA 19GSA 2CT6A 5D96A 2B6MA 1N8JA 4JEDA 2OJLA 5B7CA 1MD4A 6GSWA 3ERFA
chains in the Genus database with same CATH superfamily
1AW9A 2H75A 1BAYA 3ME8A 2PN8A 2DC5A 4PNGA 2HSMA 3GH9A 3LWAA 1BQ7A 2QKEA 4X0XA 2L4CA 5DAKA 1ZYNA 1SJ6A 3APQA 5CRDA 1VRSD 1FG4A 3JCML 2YOIA 1JLVA 5ENUA 5ECMB 14GSA 2LTKA 3KH7A 5IMAA 3D22A 2A4VA 3GKNA 1WJKA 4PURA 1DE2A 3IK9A 3D21A 1PKZA 4KE3A 1PRXA 1O85A 3TKSC 3VLNA 2A4HA 2LRTA 2OBIA 3TKSE 2B7JA 3ED3A 4HQSA 4JRRA 3TJBA 1GNEA 3N5OA 4CDOA 1WPIA 1A8YA 2H01A 3GKMA 2AUVA 4IGJA 2C1YA 1G6WA 2YJHA 2O7KA 3MSZA 2VL3A 4OCFA 5CREA 3EURA 1R4WA 1FO5A 3IDVA 1UA5A 1ERTA 4PNFA 4RI6A 4CW9A 5ID2B 1EZKA 1JZRA 4NHZA 1YZXA 4NV2A 4EF0A 3NOFA 4USSA 2MYGA 2I3YA 5EVOA 1F3AA 1GNWA 4K7OA 1PL2A 2PU9C 4FH8A 4XIHA 4K2DA 2YN1A 1PN0A 8GSSA 1M99A 4YQVA 2O89A 2CAQA 3RHCA 5AISA 1M9AA 3BBYA 5D9WA 3TDGA 3UL3A 3KJYA 5KN3A 2M46A 4PGTA 1KNGA 5HR2A 1WMJA 2C80A 4TOPA 2MZCA 4HS1A 4JR4A 1SK2A 2X49A 3GA4A 3BCKA 3ZIJA 2J9HA 4MJBA 4WBJA 2C0DA 1K0DA 1MDJA 2YCDA 5FT3A 1SL0B 1E2YA 2HLSA 1AQVA 3GKKA 2ZCTA 1Y6EA 2M72A 5G1KA 2H73A 1SK1A 2TRXA 4JZQA 2LKUA 2VM2A 5CO3A 5HFKA 3O3TA 2O85A 1YF1A 1XWAA 2LRNA 4IELA 2B1LA 1PQNA 4POBA 5LNKe 1ZOFA 2J23A 2F3MA 2C0FA 1NW2A 3QD9A 1GL8A 4MH3A 3D4TA 1X5EA 4LMWA 3DWVA 2L6CA 1UC7A 4HSCX 1A2JA 1ERVA 3MDKA 1FB6A 7GSSA 4LLRA 3GSSA 2YP6A 5J4UA 2IPAA 3FR3A 1V40A 4HJMA 13GSA 4EXJA 4NWYA 2KLXA 3HY2A 3MIXA 4IHUA 4PQIA 2RM6A 2C3NA 4KB3A 5J9BA 3FR6A 4K2XA 4EVMA 3C71A 3L4NA 5LD0A 1O7UA 3ZFBA 3F3QA 2HZEB 1OE8A 4ULXA 3VFIA 3QAVA 1ZGNA 3ZLPA 3FYGA 2IMEA 2OE0A 1NHOA 4ACSA 3WGXA 1Z5YE 1I5GA 4XRAA 3EMXA 4YAPA 2TRCP 1ZCPA 4J56E 4XS4A 1F6MC 4G0LA 4HOJA 3ZIVA 3EPTA 5G31A 1EOGA 1EGRA 2K8SA 2QSIA 2JADA 4V2LA 3G7YA 1B9XC 2QA1A 3CYNA 2DLXA 3KD0A 5LCZA 2BJXA 4MP4A 1K3OA 1TDIA 3R2QA 1JHBA 3WGDA 2HSYA 2VD0A 3QMXA 4GQFA 1EV4A 3CSHA 3HZ8A 2X99A 3M9JA 1VGLA 1ON4A 1GSDA 1URMA 5ELAA 3RAZA 1U6TA 3E9JB 2JACA 2DJ1A 3LFLA 4NHWA 3FY7A 1GP1A 1ML6A 1FVKA 3KCMA 3VI5A 4EDYA 2YZHA 5DALB 4DSSA 5F07A 2IMIA 3TJKA 1FOHA 4EO3A 1GUMA 4DEJA 2N5FA 4F82A 4XTSA 2LJRA 1A0RP 1EEJA 3F6FA 3GL5A 1U3IA 1SJIA 4QL7A 1PSQA 4ID0A 5FWGA 1WWJA 4ECIA 1IYHA 3J7Yk 3EC3A 5JWRB 2CVKA 1KEBA 3C1RA 4BL7B 1XVQA 2JL4A 4F9ZA 3GX0A 1F9MA 5CNWA 4LA1A 2FA8A 3DVWA 4EIPA 2VAFA 4ML1A 2C0EA 1XW9A 5IOXA 1U87A 5AN1A 1C72A 22GSA 1M3IA 1PKWA 5ECQB 3IAM2 5B6NA 4XS6A 2VCWA 2MBSA 1QXHA 1ZZYA 1PA3A 5J9CA 3GV1A 6GSTA 2H6YA 2WGRA 3I9V2 4GCIA 1T1VA 1Q4JA 1OKTA 5D9XA 2L57A 2V1MA 4WEYA 3HZ4A 5ID2A 2F8AA 3F0IA 2PMTA 5JWOB 1HNAA 2VL2A 1PGTA 3NIVA 2HYXA 3M0FA 1PX7A 2R4VA 3US3A 3V1WA 4GRFA 4KF9A 2FWFA 2IN3A 3UVHA 3IAS2 4RQRA 4BVYB 1GSQA 3CRUA 5CYYA 1K3YA 2IWTA 4KGIA 4BWQA 4ILFA 4RUVA 4GXZA 3GYKA 1TW9A 4CY8A 2YWNA 1SU9A 3CBUA 3KGKA 3DVXA 2TIRA 3ZRDA 3UJ1A 1SL1B 2H19A 1YEPA 2I4AA 1W89A 1PMTA 1K0AA 3A2VA 3U6VA 4KDUA 4XS1A 2HXKA 2N5BA 4TXOB 3IOSA 4FQUA 3IR4A 2NVLA 3DEXA 2JZRA 3A3TA 4I97A 1PD21 4JR6A 4IN0A 2B3SA 5IMZA 2QGVA 1T00A 1YF0A 4I2UA 4K6XA 2AAWA 3F4RA 1G7EA 1XOBA 1WE0A 4KSMA 2JZTA 4ICYA 2HE3A 1M2DA 2K6VA 2B1KA 4MJCA 1M7TA 2IJYA 2L4QA 3TKRA 2Z9SA 4H86A 2WB9A 3GNJA 1O8WA 1GTBA 3IC4A 3PR8A 1TRSA 1LU4A 2IMFA 4MJEA 1H75A 4MZWA 5E59A 1CQGA 1ERUA 1Z9HA 2HSHA 4K7IA 4BPYA 2XC2A 4MZBA 1NHYA 4IJIA 4XHMA 3LYKA 4ML6A 4MDCA 2HZEA 2VIMA 1TJDA 2L5OA 2CVDA 4IBPA 2YZUA 1AAZA 3MAKA 2B5XA 3PGTA 1VF3A 1HQOA 3LXZA 2X8HA 4ECJA 4G0KA 3A5WA 3RHBA 2FA4A 2NBSA 1YKCA 3D5JA 1J9BA 2REMA 1WOUA 1EV9A 2CZ2A 1AC1A 4L0WA 1I9DA 3KIJA 1E6BA 4F03A 2ON7A 2PWJA 1OAZA 3IHQA 2VCTA 3GL3A 1HNCA 3F9UA 3HJOA 3TJGA 1YKAA 2DKIA 2IL3A 1Z3EA 2X4AA 3LEFA 1BYEA 4ZL8A 2AHEA 4PUFC 4DSSB 2EC4A 2OBKA 1DBYA 1TKDB 4OFNA 5DALA 1WP0A 3DD3A 2H74A 3DMLA 4BA7A 5DCGA 3IK7A 4I8BA 3BJ5A 1GTUA 5BMUA 6GSSA 1DUGA 2IMKA 3LW9A 2IFQB 3APOA 5ECRB 1GULA 3UBKA 2LS5A 2R0CA 2A2RA 3TKQA 5J3RA 2I81A 2PVOC 1OC9B 4O5RA 5CRWA 3D0ZA 4BL7A 2DJ0A 1B8XA 1NM3A 3E3EA 3RPNA 1R5PA 2HRKA 4IQ1A 3TB2A 5HFIA 3KEBA 3ZREA 3N9JA 2OA7A 5IQYA 1V9WA 3GN3A 2G2QA 4FYBA 12GSA 3F6DA 3NZNA 1YDKA 4HU7A 2XPEA 2KUCA 2GQMA 4F0CA 4GSTA 4MJAA 4NMUA 2IIYA 3HJPA 4ZL9A 4ZXGA 2FWGA 1X5CA 2VM1A 3AY8A 1XWBA 3VPTA 3TJFA 1FOVA 1XPVA 5D9VA 2VLTA 2D2ZA 5ECPB 3QPMA 3H79A 3TRQA 4L5OA 4ZBAA 1A24A 2PVQA 4Z2TA 3WT1A 2H76A 4WBRD 1YY7A 2DJKA 1A2MA 3ZL5A 1GRXA 1ACVA 4OMVA 4BVYA 2P5QA 5A4VA 3A2XA 4KSOA 1GUKA 1RQMA 2FWHA 4TR4A 2ZNMA 4O7HA 1OVNA 5IMFA 5IMCA 3LYPA 2BMXA 5EPFA 3TJJA 2VCQA 5F05A 3FW2A 1M3JA 4E8EA 1Z6MA 1M9BA 5ECSA 4HI7A 3SWLA 1TK0B 3TKPA 1TI3A 5DDLA 3DGQA 3FZ9A 2HT9A 2XPDA 4EC0A 1HD2A 5AGYA 4OFTA 2LNSA 4TXOA 3KXOA 3HA9A 5HFGA 1XZOA 3HVVA 2YPMA 2FGXA 3QFAC 2GSRA 2V6KA 3C73A 4ECBA 1VF2A 1B4QA 3LGCA 5KN2A 2VCXA 2R37A 3QDNA 5ECHB 3UEMA 2I9HA 4AJ8A 4AJ6A 4O5UA 2X8GA 1OC3A 2GSQA 2K8VA 2ZUPA 2NDOA 5KN1A 4WKWA 4BWSA 1WRYA 3QCPA 2CZ3A 3TRPA 1V2AA 2EIOA 3M9KA 4K9ZA 3FR9A 3LORA 3G9BA 4YQUA 1TU8A 3FRCA 1LJRA 1LBKA 5EY6A 2CAIA 4O92A 2NTOA 3UOMA 1BG5A 2GZYA 3EYTA 3CTFA 5CRGA 2H0GA 5GSTA 1X5DA 5D8IA 1Q98A 4EUYA 1ZYQB 4IP6A 2YWIA 3IHGA 3A5IA 4KNDA 2AV4A 1A2LA 3L9VA 3KTLA 4P3YB 3TOUA 1J0FA 1Y25A 1ERWA 2WULA 2UZ8A 5HR0A 1TK8B 3F8UA 3LSZA 3W6GA 4ISDA 4PTSA 2MMAA 1VF4A 4NPBA 2VL9A 2GZZA 4KA0A 2FHEA 2C4JA 4LMVA 1GSSA 2E2GA 1Z7RA 1OKDA 2LRCA 2AJQB 3HHVA 3EMPA 4IW9A 4V1Ap 5H5QA 1PL1A 3RDWA 2VCZA 1TRVA 4GLTA 5EL8A 2DKHA 3I69A 2DJJA 1TRWA 2IFQA 5G5EA 4TW5A 5FHIA 2LQOA 2R3XA 5ECIB 3TGZA 1XOAA 1EEMA 3KZQA 4E8HA 1R5AA 3H1NA 3VPQA 3TKSA 5IOWA 2PGTA 1WIKA 4FYCA 1OC9A 1T4YA 1ZL9A 2KP2A 3L9UA 4MCUA 5D93A 2JSZA 2G0FA 2GVPA 2R0GA 4MF6A 2H30A 3KP8A 3HVNA 4K5RA 1BX9A 2GT6A 2RUEA 6GSXA 1PN9A 2WJUA 1QMVA 2ES7A 3C7MA 1A8LA 2YWMA 4PUAA 3IA1A 3ZVJD 2DMLA 1QK8A 1EP7A 1FW1A 3K8NA 2CA8A 2H6XA 3D6IA 4PX1A 2GQLA 1BJXA 1Z6NA 3EU4A 2XBQA 2OADA 3TRXA 2DJ2A 3F63A 2MMZA 2H70A 2RLIA 4HU9A 4KUNA 1U3AA 4PQHA 2DBCA 3E0UA 3UIWA 2YV9A 3KMNA 1N2AA 2ON5A 4F2IA 1SKRB 2GDRA 2IMDA 2N5AA 2WDUA 1M2BA 3GTUB 2R0PA 2WCIA 3VWVA 4JE1A 3WT2A 5KEJA 1FAAA 4YH2A 4KDXA 4IS0A 3IC8A 2PPTA 2QA2A 4WF4A 3MYDA 5KN0A 1S3AA 2LEGA 4I5QA 3WYWA 4AF2A 3HKRA 5G1LA 4BVXB 1H4OA 2EIQA 1K0MA 3CRTA 2LSTA 3KP9A 4LL1B 4HDEA 4ZB6A 3HJMA 3P2AA 5DCHA 1JZDA 3DRNA 1GH2A 4D73B 5JWQB 5ABRA 3QAGA 2FD3A 3PH9A 3ZITA 3ZFLA 4DSRA 3M3MA 4RQXA 5IPHA 4N0ZA 3LQ7A 1MTCA 3EINA 5B8BA 4WR4A 1SJZA 2C3TA 3QOUA 1EGOA 5G5FA 4KCEA 3HVXA 5GZZB 4MNNA 1SD9A 3UARA 1GSYA 1OYJA 3Q19A 1J08A 2O8VB 2WFCA 1UN2A 3H93A 2H6ZA 2OE1A 3GFKA 1YQ1A 5J5NA 1AUCA 1Z7PA 3O6TA 1V58A 4TR0A 3TOTA 3KH9A 2GZPA 3FEUA 4GSNA 1SENA 3FMWA 5IM9A 4JU5A 4NXIA 1U88A 1MDKA 4Z7XA 4EE0A 3WD6A 3BOAA 1XG8A 3C8EA 1XBSA 2BTOT 5ELGA 1QUWA 5C04A 4EKZA 4FYUA 3BD2A 2H1AA 3O76A 4POMA 3I6AA 5J41A 3IXRA 1QQ2A 1B9YC 3P90A 3FZ4A 1ILOA 2ALBA 5A4UA 4F0BA 4AGSA 3OR5A 4WXTA 1X9MB 3HCZA 5ECNB 2YV7A 3DYRA 3KM6A 4QQ7A 1S3CA 3ISOA 3H4KA 4HZ2A 2CQ9A 1V98A 2B7KA 2OKAA 1XXUA 1OC8A 4DVCA 2GLRA 4TVEA 6GSYA 2H1DA 3CSIA 1K0OA 4ZIJA 5COHA 2B5EA 1SK0A 2C3QA 2FY6A 3EWLA 1M0UA 1A0FA 1T4ZA 20GSA 1JLWA 3F3RA 2HZFA 2MMNA 4Q5NA 5HR3A 2FCHA 3LXTA 4O5QA 1K3LA 4Z2UA 4ZBDA 3F4SA 2L6DA 1UVZA 4LL4B 3MNGA 11GSA 4K0NA 5ECLB 3QFBC 4MA9A 2AB6A 5HR1A 4O32A 3Q18A 5INYA 2RM5A 1JZWA 1MD3A 4G19A 2WS2A 3VI7A 1B4PA 1X9WB 1VF1A 4Q5FA 1EP8A 3DXBA 2V41A 5JCGA 3VWUA 5GSSA 1GTIA 1HNBA 3FZAA 2GS3A 3TUEA 3W8SA 1V57A 2YANA 4L0UA 4ZILA 1SL2B 3IV4A 1AXDA 2HI7A 5B6MA 3BCIA 1PFOA 2E0QA 2GSSA 2H66A 3HVSA 4MZCA 3UAPA 5AIVA 1K0BA 4TKYA 5H5RA 3PPUA 4HJ2A 2H72A 5GAND 2DSAA 2KHPA 1JFUA 4L8EA 2R2JA 4POLA 2GTUA 2VLUA 1GSFA 3UVTA 1MEKA 2OE3A 4MMMA 5AIXA 4ZB8A 4QL9A 4MLYA 1TOFA 4WETA 4OCEA 3R3EA 4G2EA 1NSWA 2KOKA 3TCOA 1X9SB 2VL2C 1JZOA 1PX6A 1G7OA 4HUAA 2O87A 4EL1A 1G6YA 2VD1A 4A5PA 3MWHA 3GTUA 4Q5QA 2B5YA 4V2MA 2LJKA 4ECCA 4MABA 4OO4A 4V2NA 1TK5B 2QC7A 2VLVA 4X43A 4EDZA 2CX4A 2NPBA 3ZTLA 4YKGA 1TXXA 2AYTA 3IBHA 4I6XA 2FUG2 2PERA 4IP1A 3WGEA 2C8UA 1XW6A 4N11A 5HQPA 1XWCA 4ZB9A 4BVXA 5KOWA 4BIKA 2M80A 3EU3A 4RI7A 4G9HA 4HQZA 1FVJA 3IPZA 5DJLA 2RUFA 5G30A 2R6KA 4XRDA 1SYRA 1K0CA 3FZ5A 5DQYA 4D73A 2RIIA 2F8FA 2P31A 2DIZA 3S9FA 5CP1A 2HRFA 2GT5A 3C1SA 2VO4A 1YEXA 1G0TA 4GTUA 5L71A 1XWKA 1GSEA 4FO5A 3EVIA 4KX4A 4NAXA 4MF7A 1AQWA 4KH7A 5E4WA 1CQHA 1THXA 4WR5A 4AJ7A 2PUKC 3DKSA 1FB0A 4Q5RA 3Q74A 3SBCA 2K18A 4TR1B 2F51A 3ERGA 4JBBA 2JU5A 2H1GA 4K5SA 1O73A 1EOHA 2LQQA 3HDCA 2DJ3A 1S3DA 1XVWA 3GUSA 4TR3A 2GGTA 2X64A 3CTGA 4TN8A 3H8QA 1K0NA 3KMOA 5DQSA 3HYPA 1GUHA 1SKWB 2P0GA 4G0IA 3ZZXA 3GX8A 3APSA 4TXVA 2WRTA 4YQMA 4XCSA 1T8EB 4K7NA 5CAXA 1XIYA 2EIRA 4GSSA 1O8XA 3FKFA 4YAVA 4FIWA 2VUPA 4IJ3A 1R7HA 2KP1A 4K0GA 1T3BA 1TTZA 2F9SA 5IMVA 2V6OA 3ZYWA 5CRHA 1QGVA 4HEA2 1DSBA 3GRXA 1O6JA 1USBA 1YJ6A 4MH2A 5ECKB 6GSUA 5IIZA 1A23A 2WZ9A 3CQFA 2DIYA 2L59A 1ABAA 3QAWA 2FNOA 3GURA 3VURA 1IYIA 2JZSA 3VWXA 2OACA 5DAKB 4EIQA 3F4TA 2E7PA 5BRTA 18GSA 4YKFA 2X8CA 3EE2A 1GTAA 2VCVA 4PQ1A 4POKA 3A2WA 2V32A 4X1UA 2MBTA 1TU7A 3D4MA 2HFDA 4OD7A 1XW5A 5IO0A 1S3RA 1ZMAA 2H71A 1F2EA 2CX3A 4DSQA 1O81A 3QR6A 1B48A 4GQCA 3GSTA 3PINA 4HZ4A 4CHSA 3Q6OA 4GWRA 2E2MA 1XWGA 3J7Yb 2YWOA 2A2SA 1DE1A 1FHEA 2HRNA 2HNLA 1OE7A 1TRUA 1ZYEA 3DIEA 2FWEA 5G2ZA 4ZBBA 1EWXA 5B8AA 4ZL7A 3VK9A 3VWWA 2VOCA 4OFMA 3L78A 4OWYA 5IPGA 4KW6A 1THOA 2H0IA 2C0GA 1TI1A 4CY6A 3LG6A 4V1Ag 1XCCA 1SYXA 2GSTA 2LNTA 3IE3A 3IRAA 4K1FA 4KAEA 1AIUA 4MF5A 4WF5A 4N10A 4NV5A 3L0HA 3UMAA 5IMDA 1TP9A 2I1UA 3CSJA 1SKSB 5JCWA 9GSSA 3RPPA 3GH6A 5F0GA 2CVBA 4G10A 1F3BA 3GMFA 4N30A 3L9SA 1M2AA 3ZMLA 6GSVA 10GSA 1GLPA 2LJAA 5KOXA 3ME7A 3GIXA 5D73A 2L5LA 1QFNA 1ZYPA 2XBIA 4X4JA 3P7XA 3ZMKA 1MDIA 3CMIA 5D9TA 4KCAA 2JSYA 5JCUA 1X0RA 4MPGA 2LUSA 5A4WA 2MMOA 2GQKA 3W8JA 1RK4A 2XHFA 4N0VA 1RW1A 4I2TA 2YNXA 1T7PB 2DMMA 17GSA 4TR1A 2R5GA 3G7JA 4K8MA 2K9FA 1KTEA 2H0HA 3HXSA 4L5LA 3M8NA 1GWCA 4TRXA 2HRAA 3LJRA 1GSUA 4IQAA 2YJ7A 1GLQA 1F37A 1ST9A 1SD8A 3KTBA 3ZVJA 3FHKA 3P8WA 3ERWA 5A5KA 5C00A 3HD5A 4Z2RA 1W4VA 2LV3A 5DVBA 1KBNA 4J2FA 3I43A 1R26A 4GF0A 5DJMA 3G7IA 3UBLA 3GHAA 4MK3A 1BEDA 2PBJA 2P5RA 4XS4B 3CXGA 4MPFA 5DBQA 3U5RE 2A2PA 1XFLA 3GKXA 4OO5A 1HYUA 4IVFA 2FLSA 1AQXA 2H1BA 3RBTA 5GAPD 2CV4A 4J57E 16GSA 4IKHA 5F06A 5ECOB 4KDYA 5F8BA 2V2GA 4PXOA 3FK8A 5IO2A 2H8LA 5H5SA 3M1GA 19GSA 2CT6A 2B6MA 1N8JA 5D96A 4JEDA 2OJLA 5B7CA 1MD4A 6GSWA 3ERFA
chains in the Genus database with same CATH topology
1AW9A 2H75A 1BAYA 3ME8A 2PN8A 2DC5A 4PNGA 2HSMA 3GH9A 3LWAA 1BQ7A 2QKEA 4X0XA 2L4CA 5DAKA 1ZYNA 1SJ6A 3APQA 5CRDA 1VRSD 1FG4A 3JCML 2YOIA 1JLVA 5ENUA 5ECMB 14GSA 2LTKA 3KH7A 5IMAA 3D22A 2A4VA 3GKNA 1WJKA 4PURA 1DE2A 3IK9A 3D21A 1PKZA 4KE3A 1PRXA 1O85A 3TKSC 3VLNA 2A4HA 2LRTA 2OBIA 3TKSE 2B7JA 3ED3A 4HQSA 4JRRA 3TJBA 1GNEA 3N5OA 4CDOA 1WPIA 1A8YA 2H01A 3GKMA 2AUVA 4IGJA 2C1YA 1G6WA 2YJHA 2O7KA 3MSZA 2VL3A 4OCFA 5CREA 3EURA 1R4WA 1FO5A 3IDVA 1UA5A 1ERTA 4PNFA 4RI6A 4CW9A 5ID2B 1EZKA 1JZRA 4NHZA 1YZXA 4NV2A 4EF0A 3NOFA 4USSA 2MYGA 2I3YA 5EVOA 1F3AA 1GNWA 4K7OA 1PL2A 2PU9C 4FH8A 4XIHA 4K2DA 2YN1A 1PN0A 8GSSA 1M99A 4YQVA 2O89A 2CAQA 3RHCA 5AISA 1M9AA 3BBYA 5D9WA 3TDGA 3UL3A 3KJYA 5KN3A 2M46A 4PGTA 1KNGA 5HR2A 1WMJA 2C80A 4TOPA 2MZCA 4HS1A 4JR4A 1SK2A 2X49A 3GA4A 3BCKA 3ZIJA 2J9HA 4MJBA 4WBJA 2C0DA 1K0DA 1MDJA 2YCDA 5FT3A 1SL0B 1E2YA 2HLSA 1AQVA 3GKKA 2ZCTA 1Y6EA 2M72A 5G1KA 2H73A 1SK1A 2TRXA 4JZQA 2LKUA 2VM2A 5CO3A 5HFKA 3O3TA 2O85A 1YF1A 1XWAA 2LRNA 4IELA 2B1LA 1PQNA 4POBA 5LNKe 1ZOFA 2J23A 2F3MA 2C0FA 1NW2A 3QD9A 1GL8A 4MH3A 3D4TA 1X5EA 4LMWA 3DWVA 2L6CA 1UC7A 1A2JA 1ERVA 3MDKA 1FB6A 7GSSA 4LLRA 3GSSA 2YP6A 5J4UA 2IPAA 3FR3A 1V40A 4HJMA 13GSA 4EXJA 4NWYA 2KLXA 3HY2A 3MIXA 4IHUA 4PQIA 2RM6A 2C3NA 4KB3A 5J9BA 3FR6A 4K2XA 4EVMA 3C71A 3L4NA 5LD0A 1O7UA 3ZFBA 3F3QA 2HZEB 1OE8A 4ULXA 3VFIA 3QAVA 1ZGNA 3ZLPA 3FYGA 2IMEA 2OE0A 1NHOA 4ACSA 3WGXA 1Z5YE 1I5GA 4XRAA 3EMXA 4YAPA 2TRCP 1ZCPA 4J56E 4XS4A 1F6MC 4G0LA 4HOJA 3ZIVA 3EPTA 5G31A 1EOGA 1EGRA 2K8SA 2QSIA 2JADA 4V2LA 3G7YA 1B9XC 2QA1A 3CYNA 2DLXA 3KD0A 5LCZA 2BJXA 4MP4A 1K3OA 1TDIA 3R2QA 1JHBA 3WGDA 2HSYA 2VD0A 3QMXA 4GQFA 1EV4A 3CSHA 3HZ8A 2X99A 3M9JA 1VGLA 1ON4A 1GSDA 1URMA 5ELAA 3RAZA 1U6TA 3E9JB 2JACA 2DJ1A 3LFLA 4NHWA 3FY7A 1GP1A 1ML6A 1FVKA 3KCMA 3VI5A 4EDYA 2YZHA 5DALB 4DSSA 5F07A 2IMIA 3TJKA 1FOHA 4EO3A 1GUMA 4DEJA 2N5FA 4F82A 4XTSA 2LJRA 1A0RP 1EEJA 3F6FA 3GL5A 1U3IA 1SJIA 4QL7A 1PSQA 4ID0A 5FWGA 1WWJA 4ECIA 1IYHA 3J7Yk 3EC3A 5JWRB 2CVKA 1KEBA 3C1RA 4BL7B 1XVQA 2JL4A 4F9ZA 3GX0A 1F9MA 5CNWA 4LA1A 2FA8A 3DVWA 4EIPA 2VAFA 4ML1A 2C0EA 1XW9A 5IOXA 1U87A 5AN1A 1C72A 22GSA 1PKWA 5ECQB 3IAM2 5B6NA 4XS6A 2VCWA 2MBSA 1QXHA 1ZZYA 1PA3A 5J9CA 3GV1A 6GSTA 2H6YA 2WGRA 3I9V2 4GCIA 1T1VA 1Q4JA 1OKTA 5D9XA 2L57A 2V1MA 4WEYA 3HZ4A 5ID2A 2F8AA 3F0IA 2PMTA 5JWOB 1HNAA 2VL2A 1PGTA 3NIVA 2HYXA 3M0FA 1PX7A 2R4VA 3US3A 3V1WA 4GRFA 4KF9A 2FWFA 2IN3A 3UVHA 3IAS2 4RQRA 4BVYB 1GSQA 3CRUA 5CYYA 1K3YA 2IWTA 4KGIA 4BWQA 4ILFA 4RUVA 4GXZA 3GYKA 1TW9A 4CY8A 2YWNA 1SU9A 3CBUA 3KGKA 3DVXA 2TIRA 3ZRDA 3UJ1A 1SL1B 2H19A 1YEPA 2I4AA 1W89A 1PMTA 1K0AA 3A2VA 3U6VA 4KDUA 4XS1A 2HXKA 2N5BA 4TXOB 3IOSA 4FQUA 3IR4A 2NVLA 3DEXA 2JZRA 3A3TA 4I97A 1PD21 4JR6A 4IN0A 2B3SA 5IMZA 2QGVA 1T00A 1YF0A 4I2UA 4K6XA 2AAWA 3F4RA 1G7EA 1XOBA 1WE0A 4KSMA 2JZTA 4ICYA 2HE3A 1M2DA 2K6VA 2B1KA 4MJCA 1M7TA 2IJYA 2L4QA 3TKRA 2Z9SA 4H86A 2WB9A 3GNJA 1O8WA 1GTBA 3IC4A 3PR8A 1TRSA 1LU4A 2IMFA 4MJEA 1H75A 4MZWA 5E59A 1CQGA 1ERUA 1Z9HA 2HSHA 4K7IA 4BPYA 2XC2A 4MZBA 1NHYA 4IJIA 4XHMA 3LYKA 4ML6A 4MDCA 2HZEA 2VIMA 1TJDA 2L5OA 2CVDA 4IBPA 2YZUA 1AAZA 3MAKA 2B5XA 3PGTA 1VF3A 1HQOA 3LXZA 2X8HA 4ECJA 4G0KA 3A5WA 3RHBA 2FA4A 2NBSA 1YKCA 3D5JA 1J9BA 2REMA 1WOUA 1EV9A 2CZ2A 1AC1A 4L0WA 1I9DA 3KIJA 1E6BA 4F03A 2ON7A 2PWJA 1OAZA 3IHQA 2VCTA 3GL3A 1HNCA 3F9UA 3HJOA 3TJGA 1YKAA 2DKIA 2IL3A 1Z3EA 2X4AA 3LEFA 1BYEA 4ZL8A 2AHEA 4PUFC 4DSSB 2EC4A 2OBKA 1DBYA 1TKDB 4OFNA 5DALA 1WP0A 3DD3A 2H74A 3DMLA 4BA7A 5DCGA 3IK7A 4I8BA 3BJ5A 1GTUA 5BMUA 6GSSA 1DUGA 2IMKA 3LW9A 2IFQB 3APOA 5ECRB 1GULA 3UBKA 2LS5A 2R0CA 2A2RA 3TKQA 5J3RA 2I81A 2PVOC 1OC9B 4O5RA 5CRWA 3D0ZA 4BL7A 2DJ0A 1B8XA 1NM3A 3E3EA 3RPNA 1R5PA 2HRKA 4IQ1A 3TB2A 5HFIA 3KEBA 3ZREA 3N9JA 2OA7A 5IQYA 1V9WA 3GN3A 2G2QA 4FYBA 12GSA 3F6DA 3NZNA 1YDKA 4HU7A 2XPEA 2KUCA 2GQMA 4F0CA 4GSTA 4MJAA 4NMUA 2IIYA 3HJPA 4ZL9A 4ZXGA 2FWGA 1X5CA 2VM1A 3AY8A 1XWBA 3VPTA 3TJFA 1FOVA 1XPVA 5D9VA 2VLTA 2D2ZA 5ECPB 3QPMA 3H79A 3TRQA 4L5OA 4ZBAA 1A24A 2PVQA 4Z2TA 3WT1A 2H76A 4WBRD 1YY7A 2DJKA 1A2MA 3ZL5A 1GRXA 1ACVA 4OMVA 4BVYA 2P5QA 5A4VA 3A2XA 4KSOA 1GUKA 1RQMA 2FWHA 4TR4A 2ZNMA 4O7HA 1OVNA 5IMFA 5IMCA 3LYPA 2BMXA 5EPFA 3TJJA 2VCQA 5F05A 3FW2A 4E8EA 1Z6MA 1M9BA 5ECSA 4HI7A 3SWLA 1TK0B 3TKPA 1TI3A 5DDLA 3DGQA 3FZ9A 2HT9A 2XPDA 4EC0A 1HD2A 5AGYA 4OFTA 2LNSA 4TXOA 3KXOA 3HA9A 5HFGA 1XZOA 3HVVA 2YPMA 2FGXA 3QFAC 2GSRA 2V6KA 3C73A 4ECBA 1VF2A 1B4QA 3LGCA 5KN2A 2VCXA 2R37A 3QDNA 5ECHB 3UEMA 2I9HA 4AJ8A 4AJ6A 4O5UA 2X8GA 1OC3A 2GSQA 2K8VA 2ZUPA 2NDOA 5KN1A 4WKWA 4BWSA 1WRYA 3QCPA 2CZ3A 3TRPA 1V2AA 2EIOA 3M9KA 4K9ZA 3FR9A 3LORA 3G9BA 4YQUA 1TU8A 3FRCA 1LJRA 1LBKA 5EY6A 2CAIA 4O92A 2NTOA 3UOMA 1BG5A 2GZYA 3EYTA 3CTFA 5CRGA 2H0GA 5GSTA 1X5DA 5D8IA 1Q98A 4EUYA 1ZYQB 4IP6A 2YWIA 3IHGA 3A5IA 4KNDA 2AV4A 1A2LA 3L9VA 3KTLA 4P3YB 3TOUA 1J0FA 1Y25A 1ERWA 2WULA 2UZ8A 5HR0A 1TK8B 3F8UA 3LSZA 3W6GA 4ISDA 4PTSA 2MMAA 1VF4A 4NPBA 2VL9A 2GZZA 4KA0A 2FHEA 2C4JA 4LMVA 1GSSA 2E2GA 1Z7RA 1OKDA 2LRCA 2AJQB 3HHVA 3EMPA 4IW9A 4V1Ap 5H5QA 1PL1A 3RDWA 2VCZA 1TRVA 4GLTA 5EL8A 2DKHA 3I69A 2DJJA 1TRWA 2IFQA 5G5EA 4TW5A 5FHIA 2LQOA 2R3XA 5ECIB 3TGZA 1XOAA 1EEMA 3KZQA 4E8HA 1R5AA 3H1NA 3VPQA 3TKSA 5IOWA 2PGTA 1WIKA 4FYCA 1OC9A 1T4YA 1ZL9A 2KP2A 3L9UA 4MCUA 5D93A 2JSZA 2G0FA 2GVPA 2R0GA 4MF6A 2H30A 3KP8A 4K5RA 1BX9A 2GT6A 2RUEA 6GSXA 1PN9A 2WJUA 1QMVA 2ES7A 3C7MA 1A8LA 2YWMA 4PUAA 3IA1A 3ZVJD 2DMLA 1QK8A 1EP7A 1FW1A 3K8NA 2CA8A 2H6XA 3D6IA 4PX1A 2GQLA 1BJXA 1Z6NA 3EU4A 2XBQA 2OADA 3TRXA 2DJ2A 3F63A 2MMZA 2H70A 2RLIA 4HU9A 4KUNA 1U3AA 4PQHA 2DBCA 3E0UA 3UIWA 2YV9A 3KMNA 1N2AA 2ON5A 4F2IA 1SKRB 2GDRA 2IMDA 2N5AA 2WDUA 1M2BA 3GTUB 2R0PA 2WCIA 3VWVA 4JE1A 3WT2A 5KEJA 1FAAA 4YH2A 4KDXA 4IS0A 3IC8A 2PPTA 2QA2A 4WF4A 3MYDA 5KN0A 1S3AA 2LEGA 4I5QA 3WYWA 4AF2A 3HKRA 5G1LA 4BVXB 1H4OA 2EIQA 1K0MA 3CRTA 2LSTA 3KP9A 4LL1B 4HDEA 4ZB6A 3HJMA 3P2AA 5DCHA 1JZDA 3DRNA 1GH2A 4D73B 5JWQB 5ABRA 3QAGA 2FD3A 3PH9A 3ZITA 3ZFLA 4DSRA 3M3MA 4RQXA 5IPHA 4N0ZA 3LQ7A 1MTCA 3EINA 5B8BA 4WR4A 1SJZA 2C3TA 3QOUA 1EGOA 5G5FA 4KCEA 3HVXA 5GZZB 4MNNA 1SD9A 3UARA 1GSYA 1OYJA 3Q19A 1J08A 2O8VB 2WFCA 1UN2A 3H93A 2H6ZA 2OE1A 3GFKA 1YQ1A 5J5NA 1AUCA 1Z7PA 3O6TA 1V58A 4TR0A 3TOTA 3KH9A 2GZPA 3FEUA 4GSNA 1SENA 3FMWA 5IM9A 4JU5A 4NXIA 1U88A 1MDKA 4Z7XA 4EE0A 3WD6A 3BOAA 3C8EA 1XBSA 2BTOT 5ELGA 1QUWA 5C04A 4EKZA 4FYUA 3BD2A 2H1AA 3O76A 4POMA 3I6AA 5J41A 3IXRA 1QQ2A 1B9YC 3P90A 3FZ4A 1ILOA 2ALBA 5A4UA 4F0BA 4AGSA 3OR5A 4WXTA 1X9MB 3HCZA 5ECNB 2YV7A 3DYRA 3KM6A 4QQ7A 1S3CA 3ISOA 3H4KA 4HZ2A 2CQ9A 1V98A 2B7KA 2OKAA 1XXUA 1OC8A 4DVCA 2GLRA 4TVEA 6GSYA 2H1DA 3CSIA 1K0OA 4ZIJA 5COHA 2B5EA 1SK0A 2C3QA 2FY6A 3EWLA 1M0UA 1A0FA 1T4ZA 20GSA 1JLWA 3F3RA 2HZFA 2MMNA 4Q5NA 5HR3A 2FCHA 3LXTA 4O5QA 1K3LA 4Z2UA 4ZBDA 3F4SA 2L6DA 1UVZA 4LL4B 3MNGA 11GSA 4K0NA 5ECLB 3QFBC 4MA9A 2AB6A 5HR1A 4O32A 3Q18A 5INYA 2RM5A 1JZWA 1MD3A 4G19A 2WS2A 3VI7A 1B4PA 1X9WB 1VF1A 4Q5FA 1EP8A 3DXBA 2V41A 5JCGA 3VWUA 5GSSA 1GTIA 1HNBA 3FZAA 2GS3A 3TUEA 3W8SA 1V57A 2YANA 4L0UA 4ZILA 1SL2B 3IV4A 1AXDA 2HI7A 5B6MA 3BCIA 2E0QA 2GSSA 2H66A 3HVSA 4MZCA 3UAPA 5AIVA 1K0BA 4TKYA 5H5RA 3PPUA 4HJ2A 2H72A 5GAND 2DSAA 2KHPA 1JFUA 4L8EA 2R2JA 4POLA 2GTUA 2VLUA 1GSFA 3UVTA 1MEKA 2OE3A 4MMMA 5AIXA 4ZB8A 4QL9A 4MLYA 1TOFA 4WETA 4OCEA 3R3EA 4G2EA 1NSWA 2KOKA 3TCOA 1X9SB 2VL2C 1JZOA 1PX6A 1G7OA 4HUAA 2O87A 4EL1A 1G6YA 2VD1A 4A5PA 3MWHA 3GTUA 4Q5QA 2B5YA 4V2MA 2LJKA 4ECCA 4MABA 4OO4A 4V2NA 1TK5B 2QC7A 2VLVA 4X43A 4EDZA 2CX4A 2NPBA 3ZTLA 4YKGA 1TXXA 2AYTA 3IBHA 4I6XA 2FUG2 2PERA 4IP1A 3WGEA 2C8UA 1XW6A 4N11A 5HQPA 1XWCA 4ZB9A 4BVXA 5KOWA 2M80A 3EU3A 4RI7A 4G9HA 4HQZA 1FVJA 3IPZA 5DJLA 2RUFA 5G30A 2R6KA 4XRDA 1SYRA 1K0CA 3FZ5A 5DQYA 4D73A 2RIIA 2F8FA 2P31A 2DIZA 3S9FA 5CP1A 2HRFA 2GT5A 3C1SA 2VO4A 1YEXA 1G0TA 4GTUA 5L71A 1XWKA 1GSEA 4FO5A 3EVIA 4KX4A 4NAXA 4MF7A 1AQWA 4KH7A 5E4WA 1CQHA 1THXA 4WR5A 4AJ7A 2PUKC 3DKSA 1FB0A 4Q5RA 3Q74A 3SBCA 2K18A 4TR1B 2F51A 3ERGA 4JBBA 2JU5A 2H1GA 4K5SA 1O73A 1EOHA 2LQQA 3HDCA 2DJ3A 1S3DA 1XVWA 3GUSA 4TR3A 2GGTA 2X64A 3CTGA 4TN8A 3H8QA 1K0NA 3KMOA 5DQSA 3HYPA 1GUHA 1SKWB 2P0GA 4G0IA 3ZZXA 3GX8A 3APSA 4TXVA 2WRTA 4YQMA 4XCSA 1T8EB 4K7NA 5CAXA 1XIYA 2EIRA 4GSSA 1O8XA 3FKFA 4YAVA 4FIWA 2VUPA 4IJ3A 1R7HA 2KP1A 4K0GA 1T3BA 1TTZA 2F9SA 5IMVA 2V6OA 3ZYWA 5CRHA 1QGVA 4HEA2 1DSBA 3GRXA 1O6JA 1USBA 1YJ6A 4MH2A 5ECKB 6GSUA 5IIZA 1A23A 2WZ9A 2DIYA 2L59A 1ABAA 3QAWA 2FNOA 3GURA 3VURA 1IYIA 2JZSA 3VWXA 2OACA 5DAKB 4EIQA 3F4TA 2E7PA 5BRTA 18GSA 4YKFA 2X8CA 3EE2A 1GTAA 2VCVA 4PQ1A 4POKA 3A2WA 2V32A 4X1UA 2MBTA 1TU7A 3D4MA 2HFDA 4OD7A 1XW5A 5IO0A 1ZMAA 2H71A 1F2EA 2CX3A 4DSQA 1O81A 3QR6A 1B48A 4GQCA 3GSTA 3PINA 4HZ4A 4CHSA 3Q6OA 4GWRA 2E2MA 1XWGA 3J7Yb 2YWOA 2A2SA 1DE1A 1FHEA 2HRNA 2HNLA 1OE7A 1TRUA 1ZYEA 3DIEA 2FWEA 5G2ZA 4ZBBA 1EWXA 5B8AA 4ZL7A 3VK9A 3VWWA 2VOCA 4OFMA 3L78A 4OWYA 5IPGA 4KW6A 1THOA 2H0IA 2C0GA 1TI1A 4CY6A 3LG6A 4V1Ag 1XCCA 1SYXA 2GSTA 2LNTA 3IE3A 3IRAA 4K1FA 4KAEA 1AIUA 4MF5A 4WF5A 4N10A 4NV5A 3L0HA 3UMAA 5IMDA 1TP9A 2I1UA 3CSJA 1SKSB 5JCWA 9GSSA 3RPPA 3GH6A 5F0GA 2CVBA 4G10A 1F3BA 3GMFA 4N30A 3L9SA 1M2AA 3ZMLA 6GSVA 10GSA 1GLPA 2LJAA 5KOXA 3ME7A 3GIXA 5D73A 2L5LA 1QFNA 1ZYPA 2XBIA 4X4JA 3P7XA 3ZMKA 1MDIA 3CMIA 5D9TA 4KCAA 2JSYA 5JCUA 1X0RA 4MPGA 2LUSA 5A4WA 2MMOA 2GQKA 3W8JA 1RK4A 2XHFA 4N0VA 1RW1A 4I2TA 2YNXA 1T7PB 2DMMA 17GSA 4TR1A 2R5GA 3G7JA 4K8MA 2K9FA 1KTEA 2H0HA 3HXSA 4L5LA 3M8NA 1GWCA 4TRXA 2HRAA 3LJRA 1GSUA 4IQAA 2YJ7A 1GLQA 1F37A 1ST9A 1SD8A 3KTBA 3ZVJA 3FHKA 3P8WA 3ERWA 5A5KA 5C00A 3HD5A 4Z2RA 1W4VA 2LV3A 5DVBA 1KBNA 4J2FA 3I43A 1R26A 4GF0A 5DJMA 3G7IA 3UBLA 3GHAA 4MK3A 1BEDA 2PBJA 2P5RA 4XS4B 3CXGA 4MPFA 5DBQA 3U5RE 2A2PA 1XFLA 3GKXA 4OO5A 1HYUA 4IVFA 2FLSA 1AQXA 2H1BA 3RBTA 5GAPD 2CV4A 4J57E 16GSA 4IKHA 5F06A 5ECOB 4KDYA 5F8BA 2V2GA 4PXOA 3FK8A 5IO2A 2H8LA 5H5SA 3M1GA 19GSA 2CT6A 5D96A 2B6MA 1N8JA 4JEDA 2OJLA 5B7CA 1MD4A 6GSWA 3ERFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AW9 A;  2H75 A;  1BAY A;  3ME8 A;  2PN8 A;  2DC5 A;  4PNG A;  3GH9 A;  3LWA A;  1BQ7 A;  2QKE A;  4X0X A;  2L4C A;  5DAK A;  1SJ6 A;  3APQ A;  5CRD A;  1VRS D;  1FG4 A;  3JCM L;  2YOI A;  1JLV A;  5ENU A;  5ECM B;  14GS A;  2LTK A;  3KH7 A;  5IMA A;  3D22 A;  2A4V A;  3GKN A;  1WJK A;  4PUR A;  1DE2 A;  3IK9 A;  3D21 A;  1PKZ A;  4KE3 A;  1PRX A;  1O85 A;  3TKS C;  3VLN A;  2LRT A;  2OBI A;  3TKS E;  2B7J A;  3ED3 A;  4HQS A;  4JRR A;  3TJB A;  1GNE A;  3N5O A;  4CDO A;  1WPI A;  1A8Y A;  2H01 A;  3GKM A;  2AUV A;  4IGJ A;  2C1Y A;  1G6W A;  2YJH A;  2O7K A;  3MSZ A;  2VL3 A;  4OCF A;  5CRE A;  3EUR A;  1R4W A;  1FO5 A;  3IDV A;  1UA5 A;  1ERT A;  4PNF A;  4RI6 A;  4CW9 A;  5ID2 B;  1EZK A;  1JZR A;  4NHZ A;  1YZX A;  4NV2 A;  4EF0 A;  3NOF A;  2MYG A;  2I3Y A;  5EVO A;  1F3A A;  1GNW A;  4K7O A;  1PL2 A;  2PU9 C;  4FH8 A;  4XIH A;  4K2D A;  2YN1 A;  8GSS A;  1M99 A;  4YQV A;  2O89 A;  2CAQ A;  3RHC A;  5AIS A;  1M9A A;  3BBY A;  5D9W A;  3TDG A;  3UL3 A;  3KJY A;  5KN3 A;  2M46 A;  4PGT A;  1KNG A;  5HR2 A;  1WMJ A;  2C80 A;  4TOP A;  2MZC A;  4HS1 A;  4JR4 A;  1SK2 A;  3GA4 A;  3BCK A;  3ZIJ A;  2J9H A;  4MJB A;  4WBJ A;  2C0D A;  1K0D A;  1MDJ A;  2YCD A;  5FT3 A;  1SL0 B;  1E2Y A;  2HLS A;  1AQV A;  3GKK A;  2ZCT A;  1Y6E A;  2M72 A;  5G1K A;  2H73 A;  1SK1 A;  2TRX A;  4JZQ A;  2LKU A;  2VM2 A;  5CO3 A;  5HFK A;  3O3T A;  2O85 A;  1YF1 A;  1XWA A;  2LRN A;  4IEL A;  2B1L A;  1PQN A;  4POB A;  5LNK e;  1ZOF A;  2J23 A;  2F3M A;  2C0F A;  1NW2 A;  3QD9 A;  1GL8 A;  4MH3 A;  3D4T A;  1X5E A;  4LMW A;  3DWV A;  2L6C A;  1UC7 A;  1A2J A;  1ERV A;  3MDK A;  1FB6 A;  7GSS A;  4LLR A;  3GSS A;  2YP6 A;  5J4U A;  2IPA A;  3FR3 A;  1V40 A;  4HJM A;  13GS A;  4EXJ A;  4NWY A;  2KLX A;  3HY2 A;  4IHU A;  4PQI A;  2RM6 A;  2C3N A;  4KB3 A;  5J9B A;  3FR6 A;  4EVM A;  3C71 A;  3L4N A;  5LD0 A;  1O7U A;  3ZFB A;  3F3Q A;  2HZE B;  1OE8 A;  4ULX A;  3VFI A;  3QAV A;  1ZGN A;  3ZLP A;  3FYG A;  2IME A;  2OE0 A;  1NHO A;  4ACS A;  3WGX A;  1Z5Y E;  1I5G A;  4XRA A;  3EMX A;  4YAP A;  2TRC P;  1ZCP A;  4J56 E;  4XS4 A;  1F6M C;  4HOJ A;  3ZIV A;  5G31 A;  1EOG A;  1EGR A;  2K8S A;  2QSI A;  2JAD A;  4V2L A;  3G7Y A;  1B9X C;  3CYN A;  2DLX A;  3KD0 A;  5LCZ A;  2BJX A;  4MP4 A;  1K3O A;  1TDI A;  3R2Q A;  1JHB A;  3WGD A;  2HSY A;  2VD0 A;  3QMX A;  4GQF A;  1EV4 A;  3CSH A;  3HZ8 A;  2X99 A;  3M9J A;  1VGL A;  1ON4 A;  1GSD A;  1URM A;  5ELA A;  3RAZ A;  1U6T A;  3E9J B;  2JAC A;  2DJ1 A;  3LFL A;  4NHW A;  3FY7 A;  1GP1 A;  1ML6 A;  1FVK A;  3KCM A;  3VI5 A;  4EDY A;  2YZH A;  5DAL B;  4DSS A;  5F07 A;  2IMI A;  3TJK A;  4EO3 A;  1GUM A;  4DEJ A;  2N5F A;  4F82 A;  4XTS A;  2LJR A;  1A0R P;  1EEJ A;  3F6F A;  3GL5 A;  1U3I A;  1SJI A;  4QL7 A;  1PSQ A;  4ID0 A;  5FWG A;  1WWJ A;  4ECI A;  1IYH A;  3J7Y k;  3EC3 A;  5JWR B;  2CVK A;  1KEB A;  3C1R A;  1XVQ A;  2JL4 A;  4F9Z A;  3GX0 A;  1F9M A;  5CNW A;  4LA1 A;  2FA8 A;  3DVW A;  2VAF A;  4ML1 A;  2C0E A;  1XW9 A;  5IOX A;  1U87 A;  5AN1 A;  1C72 A;  22GS A;  1PKW A;  5ECQ B;  3IAM 2;  5B6N A;  4XS6 A;  2VCW A;  2MBS A;  1QXH A;  1ZZY A;  1PA3 A;  5J9C A;  3GV1 A;  6GST A;  2H6Y A;  2WGR A;  3I9V 2;  4GCI A;  1T1V A;  1Q4J A;  1OKT A;  5D9X A;  2L57 A;  2V1M A;  4WEY A;  3HZ4 A;  5ID2 A;  2F8A A;  3F0I A;  2PMT A;  5JWO B;  1HNA A;  2VL2 A;  1PGT A;  3NIV A;  2HYX A;  3M0F A;  1PX7 A;  2R4V A;  3US3 A;  3V1W A;  4GRF A;  2FWF A;  2IN3 A;  3UVH A;  3IAS 2;  4RQR A;  1GSQ A;  3CRU A;  5CYY A;  1K3Y A;  2IWT A;  4KGI A;  4BWQ A;  4ILF A;  4RUV A;  4GXZ A;  3GYK A;  1TW9 A;  2YWN A;  1SU9 A;  3CBU A;  3KGK A;  3DVX A;  2TIR A;  3ZRD A;  3UJ1 A;  1SL1 B;  2H19 A;  1YEP A;  2I4A A;  1W89 A;  1PMT A;  1K0A A;  3A2V A;  3U6V A;  4KDU A;  4XS1 A;  2HXK A;  2N5B A;  4TXO B;  3IOS A;  3IR4 A;  2NVL A;  3DEX A;  2JZR A;  3A3T A;  4I97 A;  1PD2 1;  4JR6 A;  4IN0 A;  2B3S A;  5IMZ A;  2QGV A;  1T00 A;  1YF0 A;  4I2U A;  4K6X A;  2AAW A;  3F4R A;  1G7E A;  1XOB A;  1WE0 A;  4KSM A;  2JZT A;  2HE3 A;  1M2D A;  2K6V A;  2B1K A;  4MJC A;  1M7T A;  2IJY A;  2L4Q A;  3TKR A;  2Z9S A;  4H86 A;  2WB9 A;  3GNJ A;  1O8W A;  1GTB A;  3IC4 A;  3PR8 A;  1TRS A;  1LU4 A;  2IMF A;  4MJE A;  1H75 A;  4MZW A;  5E59 A;  1CQG A;  1ERU A;  1Z9H A;  2HSH A;  4K7I A;  4BPY A;  2XC2 A;  4MZB A;  1NHY A;  4IJI A;  4XHM A;  3LYK A;  4ML6 A;  4MDC A;  2HZE A;  2VIM A;  1TJD A;  2L5O A;  2CVD A;  4IBP A;  2YZU A;  1AAZ A;  3MAK A;  2B5X A;  3PGT A;  1VF3 A;  1HQO A;  3LXZ A;  2X8H A;  4ECJ A;  3A5W A;  3RHB A;  2FA4 A;  2NBS A;  1YKC A;  3D5J A;  1J9B A;  2REM A;  1WOU A;  1EV9 A;  2CZ2 A;  1AC1 A;  4L0W A;  1I9D A;  3KIJ A;  1E6B A;  4F03 A;  2ON7 A;  2PWJ A;  1OAZ A;  3IHQ A;  2VCT A;  3GL3 A;  1HNC A;  3F9U A;  3HJO A;  3TJG A;  1YKA A;  2IL3 A;  1Z3E A;  3LEF A;  1BYE A;  4ZL8 A;  2AHE A;  4PUF C;  4DSS B;  2EC4 A;  2OBK A;  1DBY A;  1TKD B;  4OFN A;  5DAL A;  1WP0 A;  3DD3 A;  2H74 A;  3DML A;  4BA7 A;  5DCG A;  3IK7 A;  4I8B A;  3BJ5 A;  1GTU A;  6GSS A;  1DUG A;  2IMK A;  2IFQ B;  3APO A;  5ECR B;  1GUL A;  3UBK A;  2LS5 A;  2A2R A;  3TKQ A;  5J3R A;  2I81 A;  2PVO C;  1OC9 B;  4O5R A;  5CRW A;  3D0Z A;  4BL7 A;  2DJ0 A;  1B8X A;  1NM3 A;  3E3E A;  3RPN A;  1R5P A;  4IQ1 A;  3TB2 A;  5HFI A;  3KEB A;  3ZRE A;  3N9J A;  2OA7 A;  5IQY A;  1V9W A;  3GN3 A;  2G2Q A;  4FYB A;  12GS A;  3F6D A;  3NZN A;  1YDK A;  4HU7 A;  2XPE A;  2KUC A;  2GQM A;  4F0C A;  4GST A;  4MJA A;  4NMU A;  2IIY A;  3HJP A;  4ZL9 A;  4ZXG A;  2FWG A;  1X5C A;  2VM1 A;  3AY8 A;  1XWB A;  3VPT A;  3TJF A;  1FOV A;  1XPV A;  5D9V A;  2VLT A;  2D2Z A;  5ECP B;  3QPM A;  3H79 A;  3TRQ A;  4L5O A;  4ZBA A;  1A24 A;  2PVQ A;  3WT1 A;  2H76 A;  4WBR D;  1YY7 A;  2DJK A;  1A2M A;  3ZL5 A;  1GRX A;  1ACV A;  4OMV A;  4BVY A;  2P5Q A;  5A4V A;  3A2X A;  4KSO A;  1GUK A;  1RQM A;  2FWH A;  4TR4 A;  2ZNM A;  4O7H A;  1OVN A;  5IMF A;  5IMC A;  3LYP A;  2BMX A;  5EPF A;  3TJJ A;  2VCQ A;  5F05 A;  3FW2 A;  4E8E A;  1Z6M A;  1M9B A;  5ECS A;  4HI7 A;  3SWL A;  1TK0 B;  3TKP A;  1TI3 A;  5DDL A;  3DGQ A;  3FZ9 A;  2HT9 A;  2XPD A;  4EC0 A;  1HD2 A;  5AGY A;  4OFT A;  2LNS A;  4TXO A;  3KXO A;  3HA9 A;  5HFG A;  1XZO A;  3HVV A;  2YPM A;  2FGX A;  3QFA C;  2GSR A;  2V6K A;  3C73 A;  4ECB A;  1VF2 A;  1B4Q A;  3LGC A;  5KN2 A;  2VCX A;  2R37 A;  3QDN A;  5ECH B;  3UEM A;  2I9H A;  4AJ8 A;  4AJ6 A;  2X8G A;  1OC3 A;  2GSQ A;  2K8V A;  2ZUP A;  2NDO A;  5KN1 A;  4WKW A;  4BWS A;  1WRY A;  3QCP A;  2CZ3 A;  3TRP A;  1V2A A;  2EIO A;  3M9K A;  4K9Z A;  3FR9 A;  3LOR A;  3G9B A;  4YQU A;  1TU8 A;  3FRC A;  1LJR A;  1LBK A;  5EY6 A;  2CAI A;  4O92 A;  2NTO A;  3UOM A;  1BG5 A;  2GZY A;  3EYT A;  3CTF A;  5CRG A;  2H0G A;  5GST A;  1X5D A;  5D8I A;  1Q98 A;  4EUY A;  1ZYQ B;  4IP6 A;  2YWI A;  4KND A;  2AV4 A;  1A2L A;  3L9V A;  3KTL A;  4P3Y B;  3TOU A;  1J0F A;  1Y25 A;  1ERW A;  2WUL A;  5HR0 A;  1TK8 B;  3F8U A;  3LSZ A;  3W6G A;  4ISD A;  2MMA A;  1VF4 A;  4NPB A;  2VL9 A;  2GZZ A;  4KA0 A;  2FHE A;  2C4J A;  4LMV A;  1GSS A;  2E2G A;  1Z7R A;  1OKD A;  2LRC A;  2AJQ B;  3HHV A;  3EMP A;  4IW9 A;  4V1A p;  5H5Q A;  1PL1 A;  3RDW A;  2VCZ A;  1TRV A;  4GLT A;  5EL8 A;  3I69 A;  2DJJ A;  1TRW A;  2IFQ A;  5G5E A;  4TW5 A;  5FHI A;  2LQO A;  2R3X A;  5ECI B;  3TGZ A;  1XOA A;  1EEM A;  3KZQ A;  4E8H A;  1R5A A;  3H1N A;  3VPQ A;  3TKS A;  5IOW A;  2PGT A;  1WIK A;  4FYC A;  1OC9 A;  1T4Y A;  1ZL9 A;  2KP2 A;  3L9U A;  4MCU A;  5D93 A;  2JSZ A;  2G0F A;  2GVP A;  4MF6 A;  2H30 A;  3KP8 A;  1BX9 A;  2GT6 A;  2RUE A;  6GSX A;  1PN9 A;  2WJU A;  1QMV A;  2ES7 A;  3C7M A;  1A8L A;  2YWM A;  4PUA A;  3IA1 A;  3ZVJ D;  2DML A;  1QK8 A;  1EP7 A;  1FW1 A;  3K8N A;  2CA8 A;  2H6X A;  3D6I A;  4PX1 A;  2GQL A;  1BJX A;  1Z6N A;  3EU4 A;  2XBQ A;  2OAD A;  3TRX A;  2DJ2 A;  3F63 A;  2MMZ A;  2H70 A;  2RLI A;  4HU9 A;  4KUN A;  1U3A A;  4PQH A;  2DBC A;  3E0U A;  3UIW A;  2YV9 A;  3KMN A;  1N2A A;  2ON5 A;  4F2I A;  1SKR B;  2GDR A;  2IMD A;  2N5A A;  2WDU A;  1M2B A;  3GTU B;  2WCI A;  3VWV A;  4JE1 A;  3WT2 A;  5KEJ A;  1FAA A;  4YH2 A;  4KDX A;  4IS0 A;  2PPT A;  4WF4 A;  5KN0 A;  1S3A A;  2LEG A;  4I5Q A;  3WYW A;  4AF2 A;  3HKR A;  5G1L A;  1H4O A;  2EIQ A;  1K0M A;  3CRT A;  2LST A;  3KP9 A;  4LL1 B;  4HDE A;  4ZB6 A;  3HJM A;  3P2A A;  5DCH A;  1JZD A;  3DRN A;  1GH2 A;  4D73 B;  5JWQ B;  5ABR A;  3QAG A;  2FD3 A;  3PH9 A;  3ZIT A;  3ZFL A;  4DSR A;  3M3M A;  4RQX A;  5IPH A;  4N0Z A;  3LQ7 A;  1MTC A;  3EIN A;  5B8B A;  4WR4 A;  1SJZ A;  2C3T A;  3QOU A;  1EGO A;  5G5F A;  4KCE A;  3HVX A;  5GZZ B;  1SD9 A;  3UAR A;  1GSY A;  1OYJ A;  3Q19 A;  1J08 A;  2O8V B;  2WFC A;  1UN2 A;  3H93 A;  2H6Z A;  2OE1 A;  3GFK A;  1YQ1 A;  5J5N A;  1AUC A;  1Z7P A;  3O6T A;  1V58 A;  4TR0 A;  3TOT A;  3KH9 A;  2GZP A;  3FEU A;  4GSN A;  1SEN A;  5IM9 A;  4JU5 A;  4NXI A;  1U88 A;  1MDK A;  4Z7X A;  4EE0 A;  3WD6 A;  3BOA A;  3C8E A;  1XBS A;  2BTO T;  5ELG A;  1QUW A;  5C04 A;  4EKZ A;  4FYU A;  3BD2 A;  2H1A A;  3O76 A;  4POM A;  3I6A A;  5J41 A;  3IXR A;  1QQ2 A;  1B9Y C;  3P90 A;  3FZ4 A;  1ILO A;  2ALB A;  5A4U A;  4F0B A;  4AGS A;  3OR5 A;  4WXT A;  1X9M B;  3HCZ A;  5ECN B;  2YV7 A;  3DYR A;  3KM6 A;  4QQ7 A;  1S3C A;  3ISO A;  3H4K A;  4HZ2 A;  2CQ9 A;  1V98 A;  2B7K A;  2OKA A;  1XXU A;  1OC8 A;  4DVC A;  2GLR A;  4TVE A;  6GSY A;  2H1D A;  3CSI A;  1K0O A;  4ZIJ A;  5COH A;  2B5E A;  1SK0 A;  2C3Q A;  2FY6 A;  3EWL A;  1M0U A;  1A0F A;  1T4Z A;  20GS A;  1JLW A;  3F3R A;  2HZF A;  2MMN A;  4Q5N A;  5HR3 A;  2FCH A;  3LXT A;  1K3L A;  4ZBD A;  3F4S A;  2L6D A;  1UVZ A;  4LL4 B;  3MNG A;  11GS A;  4K0N A;  5ECL B;  3QFB C;  4MA9 A;  2AB6 A;  5HR1 A;  4O32 A;  3Q18 A;  5INY A;  2RM5 A;  1JZW A;  1MD3 A;  4G19 A;  2WS2 A;  3VI7 A;  1B4P A;  1X9W B;  1VF1 A;  4Q5F A;  1EP8 A;  3DXB A;  2V41 A;  5JCG A;  3VWU A;  5GSS A;  1GTI A;  1HNB A;  3FZA A;  2GS3 A;  3TUE A;  3W8S A;  1V57 A;  2YAN A;  4L0U A;  4ZIL A;  1SL2 B;  3IV4 A;  1AXD A;  2HI7 A;  5B6M A;  3BCI A;  2E0Q A;  2GSS A;  2H66 A;  3HVS A;  4MZC A;  3UAP A;  5AIV A;  1K0B A;  4TKY A;  5H5R A;  4HJ2 A;  2H72 A;  5GAN D;  2DSA A;  2KHP A;  1JFU A;  4L8E A;  2R2J A;  4POL A;  2GTU A;  2VLU A;  1GSF A;  3UVT A;  1MEK A;  2OE3 A;  4MMM A;  5AIX A;  4ZB8 A;  4QL9 A;  4MLY A;  1TOF A;  4WET A;  4OCE A;  4G2E A;  1NSW A;  2KOK A;  3TCO A;  1X9S B;  2VL2 C;  1JZO A;  1PX6 A;  1G7O A;  4HUA A;  2O87 A;  4EL1 A;  1G6Y A;  2VD1 A;  3MWH A;  3GTU A;  4Q5Q A;  2B5Y A;  4V2M A;  2LJK A;  4ECC A;  4MAB A;  4OO4 A;  4V2N A;  1TK5 B;  2QC7 A;  2VLV A;  4X43 A;  4EDZ A;  2CX4 A;  2NPB A;  3ZTL A;  1TXX A;  2AYT A;  3IBH A;  4I6X A;  2FUG 2;  2PER A;  4IP1 A;  3WGE A;  2C8U A;  1XW6 A;  4N11 A;  5HQP A;  1XWC A;  4ZB9 A;  4BVX A;  2M80 A;  3EU3 A;  4RI7 A;  4G9H A;  4HQZ A;  1FVJ A;  3IPZ A;  5DJL A;  2RUF A;  5G30 A;  2R6K A;  4XRD A;  1SYR A;  1K0C A;  3FZ5 A;  5DQY A;  4D73 A;  2RII A;  2F8F A;  2P31 A;  2DIZ A;  3S9F A;  5CP1 A;  2HRF A;  2GT5 A;  3C1S A;  2VO4 A;  1YEX A;  1G0T A;  4GTU A;  5L71 A;  1XWK A;  1GSE A;  4FO5 A;  3EVI A;  4KX4 A;  4NAX A;  4MF7 A;  1AQW A;  4KH7 A;  5E4W A;  1CQH A;  1THX A;  4WR5 A;  4AJ7 A;  2PUK C;  3DKS A;  1FB0 A;  4Q5R A;  3Q74 A;  3SBC A;  2K18 A;  4TR1 B;  2F51 A;  3ERG A;  4JBB A;  2JU5 A;  2H1G A;  1O73 A;  1EOH A;  2LQQ A;  3HDC A;  2DJ3 A;  1S3D A;  1XVW A;  3GUS A;  4TR3 A;  2GGT A;  2X64 A;  3CTG A;  4TN8 A;  3H8Q A;  1K0N A;  3KMO A;  5DQS A;  3HYP A;  1GUH A;  1SKW B;  2P0G A;  3ZZX A;  3GX8 A;  3APS A;  4TXV A;  2WRT A;  4YQM A;  4XCS A;  1T8E B;  4K7N A;  5CAX A;  1XIY A;  2EIR A;  4GSS A;  1O8X A;  3FKF A;  4YAV A;  4FIW A;  2VUP A;  4IJ3 A;  1R7H A;  2KP1 A;  4K0G A;  1T3B A;  1TTZ A;  2F9S A;  5IMV A;  2V6O A;  3ZYW A;  5CRH A;  1QGV A;  4HEA 2;  1DSB A;  3GRX A;  1O6J A;  1USB A;  1YJ6 A;  4MH2 A;  5ECK B;  6GSU A;  5IIZ A;  1A23 A;  2WZ9 A;  2DIY A;  2L59 A;  1ABA A;  3QAW A;  2FNO A;  3GUR A;  3VUR A;  1IYI A;  2JZS A;  3VWX A;  2OAC A;  5DAK B;  3F4T A;  2E7P A;  18GS A;  2X8C A;  3EE2 A;  1GTA A;  2VCV A;  4PQ1 A;  4POK A;  3A2W A;  2V32 A;  4X1U A;  2MBT A;  1TU7 A;  3D4M A;  2HFD A;  4OD7 A;  1XW5 A;  5IO0 A;  1ZMA A;  2H71 A;  1F2E A;  2CX3 A;  4DSQ A;  1O81 A;  3QR6 A;  1B48 A;  4GQC A;  3GST A;  3PIN A;  4HZ4 A;  4CHS A;  3Q6O A;  4GWR A;  2E2M A;  1XWG A;  3J7Y b;  2YWO A;  2A2S A;  1DE1 A;  1FHE A;  2HRN A;  2HNL A;  1OE7 A;  1TRU A;  1ZYE A;  3DIE A;  2FWE A;  5G2Z A;  4ZBB A;  1EWX A;  5B8A A;  4ZL7 A;  3VK9 A;  3VWW A;  2VOC A;  4OFM A;  3L78 A;  4OWY A;  5IPG A;  4KW6 A;  1THO A;  2H0I A;  2C0G A;  1TI1 A;  3LG6 A;  4V1A g;  1XCC A;  1SYX A;  2GST A;  2LNT A;  3IE3 A;  3IRA A;  4K1F A;  4KAE A;  1AIU A;  4MF5 A;  4WF5 A;  4N10 A;  4NV5 A;  3L0H A;  3UMA A;  5IMD A;  1TP9 A;  2I1U A;  3CSJ A;  1SKS B;  5JCW A;  9GSS A;  3RPP A;  3GH6 A;  5F0G A;  2CVB A;  4G10 A;  1F3B A;  3GMF A;  4N30 A;  3L9S A;  1M2A A;  3ZML A;  6GSV A;  10GS A;  1GLP A;  2LJA A;  3ME7 A;  3GIX A;  5D73 A;  2L5L A;  1QFN A;  2XBI A;  3P7X A;  3ZMK A;  1MDI A;  3CMI A;  5D9T A;  4KCA A;  2JSY A;  5JCU A;  1X0R A;  4MPG A;  2LUS A;  5A4W A;  2MMO A;  2GQK A;  3W8J A;  1RK4 A;  2XHF A;  4N0V A;  1RW1 A;  4I2T A;  2YNX A;  1T7P B;  2DMM A;  17GS A;  4TR1 A;  2R5G A;  3G7J A;  4K8M A;  2K9F A;  1KTE A;  2H0H A;  3HXS A;  4L5L A;  3M8N A;  1GWC A;  4TRX A;  3LJR A;  1GSU A;  4IQA A;  2YJ7 A;  1GLQ A;  1F37 A;  1ST9 A;  1SD8 A;  3KTB A;  3ZVJ A;  3FHK A;  3P8W A;  3ERW A;  5A5K A;  5C00 A;  3HD5 A;  1W4V A;  2LV3 A;  5DVB A;  1KBN A;  4J2F A;  3I43 A;  1R26 A;  4GF0 A;  5DJM A;  3G7I A;  3UBL A;  3GHA A;  4MK3 A;  1BED A;  2PBJ A;  2P5R A;  4XS4 B;  3CXG A;  4MPF A;  5DBQ A;  3U5R E;  1XFL A;  3GKX A;  4OO5 A;  1HYU A;  4IVF A;  2FLS A;  1AQX A;  2H1B A;  3RBT A;  5GAP D;  2CV4 A;  4J57 E;  16GS A;  4IKH A;  5F06 A;  5ECO B;  4KDY A;  5F8B A;  2V2G A;  4PXO A;  3FK8 A;  5IO2 A;  2H8L A;  5H5S A;  3M1G A;  19GS A;  2CT6 A;  5D96 A;  2B6M A;  1N8J A;  4JED A;  2OJL A;  5B7C A;  1MD4 A;  6GSW A;  3ERF A; 
#chains in the Genus database with same CATH topology
 1AW9 A;  2H75 A;  1BAY A;  3ME8 A;  2PN8 A;  2DC5 A;  4PNG A;  2HSM A;  3GH9 A;  3LWA A;  1BQ7 A;  2QKE A;  4X0X A;  2L4C A;  5DAK A;  1ZYN A;  1SJ6 A;  3APQ A;  5CRD A;  1VRS D;  1FG4 A;  3JCM L;  2YOI A;  1JLV A;  5ENU A;  5ECM B;  14GS A;  2LTK A;  3KH7 A;  5IMA A;  3D22 A;  2A4V A;  3GKN A;  1WJK A;  4PUR A;  1DE2 A;  3IK9 A;  3D21 A;  1PKZ A;  4KE3 A;  1PRX A;  1O85 A;  3TKS C;  3VLN A;  2A4H A;  2LRT A;  2OBI A;  3TKS E;  2B7J A;  3ED3 A;  4HQS A;  4JRR A;  3TJB A;  1GNE A;  3N5O A;  4CDO A;  1WPI A;  1A8Y A;  2H01 A;  3GKM A;  2AUV A;  4IGJ A;  2C1Y A;  1G6W A;  2YJH A;  2O7K A;  3MSZ A;  2VL3 A;  4OCF A;  5CRE A;  3EUR A;  1R4W A;  1FO5 A;  3IDV A;  1UA5 A;  1ERT A;  4PNF A;  4RI6 A;  4CW9 A;  5ID2 B;  1EZK A;  1JZR A;  4NHZ A;  1YZX A;  4NV2 A;  4EF0 A;  3NOF A;  4USS A;  2MYG A;  2I3Y A;  5EVO A;  1F3A A;  1GNW A;  4K7O A;  1PL2 A;  2PU9 C;  4FH8 A;  4XIH A;  4K2D A;  2YN1 A;  1PN0 A;  8GSS A;  1M99 A;  4YQV A;  2O89 A;  2CAQ A;  3RHC A;  5AIS A;  1M9A A;  3BBY A;  5D9W A;  3TDG A;  3UL3 A;  3KJY A;  5KN3 A;  2M46 A;  4PGT A;  1KNG A;  5HR2 A;  1WMJ A;  2C80 A;  4TOP A;  2MZC A;  4HS1 A;  4JR4 A;  1SK2 A;  2X49 A;  3GA4 A;  3BCK A;  3ZIJ A;  2J9H A;  4MJB A;  4WBJ A;  2C0D A;  1K0D A;  1MDJ A;  2YCD A;  5FT3 A;  1SL0 B;  1E2Y A;  2HLS A;  1AQV A;  3GKK A;  2ZCT A;  1Y6E A;  2M72 A;  5G1K A;  2H73 A;  1SK1 A;  2TRX A;  4JZQ A;  2LKU A;  2VM2 A;  5CO3 A;  5HFK A;  3O3T A;  2O85 A;  1YF1 A;  1XWA A;  2LRN A;  4IEL A;  2B1L A;  1PQN A;  4POB A;  5LNK e;  1ZOF A;  2J23 A;  2F3M A;  2C0F A;  1NW2 A;  3QD9 A;  1GL8 A;  4MH3 A;  3D4T A;  1X5E A;  4LMW A;  3DWV A;  2L6C A;  1UC7 A;  4HSC X;  1A2J A;  1ERV A;  3MDK A;  1FB6 A;  7GSS A;  4LLR A;  3GSS A;  2YP6 A;  5J4U A;  2IPA A;  3FR3 A;  1V40 A;  4HJM A;  13GS A;  4EXJ A;  4NWY A;  2KLX A;  3HY2 A;  3MIX A;  4IHU A;  4PQI A;  2RM6 A;  2C3N A;  4KB3 A;  5J9B A;  3FR6 A;  4K2X A;  4EVM A;  3C71 A;  3L4N A;  5LD0 A;  1O7U A;  3ZFB A;  3F3Q A;  2HZE B;  1OE8 A;  4ULX A;  3VFI A;  3QAV A;  1ZGN A;  3ZLP A;  3FYG A;  2IME A;  2OE0 A;  1NHO A;  4ACS A;  3WGX A;  1Z5Y E;  1I5G A;  4XRA A;  3EMX A;  4YAP A;  2TRC P;  1ZCP A;  4J56 E;  4XS4 A;  1F6M C;  4G0L A;  4HOJ A;  3ZIV A;  3EPT A;  5G31 A;  1EOG A;  1EGR A;  2K8S A;  2QSI A;  2JAD A;  4V2L A;  3G7Y A;  1B9X C;  2QA1 A;  3CYN A;  2DLX A;  3KD0 A;  5LCZ A;  2BJX A;  4MP4 A;  1K3O A;  1TDI A;  3R2Q A;  1JHB A;  3WGD A;  2HSY A;  2VD0 A;  3QMX A;  4GQF A;  1EV4 A;  3CSH A;  3HZ8 A;  2X99 A;  3M9J A;  1VGL A;  1ON4 A;  1GSD A;  1URM A;  5ELA A;  3RAZ A;  1U6T A;  3E9J B;  2JAC A;  2DJ1 A;  3LFL A;  4NHW A;  3FY7 A;  1GP1 A;  1ML6 A;  1FVK A;  3KCM A;  3VI5 A;  4EDY A;  2YZH A;  5DAL B;  4DSS A;  5F07 A;  2IMI A;  3TJK A;  1FOH A;  4EO3 A;  1GUM A;  4DEJ A;  2N5F A;  4F82 A;  4XTS A;  2LJR A;  1A0R P;  1EEJ A;  3F6F A;  3GL5 A;  1U3I A;  1SJI A;  4QL7 A;  1PSQ A;  4ID0 A;  5FWG A;  1WWJ A;  4ECI A;  1IYH A;  3J7Y k;  3EC3 A;  5JWR B;  2CVK A;  1KEB A;  3C1R A;  4BL7 B;  1XVQ A;  2JL4 A;  4F9Z A;  3GX0 A;  1F9M A;  5CNW A;  4LA1 A;  2FA8 A;  3DVW A;  4EIP A;  2VAF A;  4ML1 A;  2C0E A;  1XW9 A;  5IOX A;  1U87 A;  5AN1 A;  1C72 A;  22GS A;  1M3I A;  1PKW A;  5ECQ B;  3IAM 2;  5B6N A;  4XS6 A;  2VCW A;  2MBS A;  1QXH A;  1ZZY A;  1PA3 A;  5J9C A;  3GV1 A;  6GST A;  2H6Y A;  2WGR A;  3I9V 2;  4GCI A;  1T1V A;  1Q4J A;  1OKT A;  5D9X A;  2L57 A;  2V1M A;  4WEY A;  3HZ4 A;  5ID2 A;  2F8A A;  3F0I A;  2PMT A;  5JWO B;  1HNA A;  2VL2 A;  1PGT A;  3NIV A;  2HYX A;  3M0F A;  1PX7 A;  2R4V A;  3US3 A;  3V1W A;  4GRF A;  4KF9 A;  2FWF A;  2IN3 A;  3UVH A;  3IAS 2;  4RQR A;  4BVY B;  1GSQ A;  3CRU A;  5CYY A;  1K3Y A;  2IWT A;  4KGI A;  4BWQ A;  4ILF A;  4RUV A;  4GXZ A;  3GYK A;  1TW9 A;  4CY8 A;  2YWN A;  1SU9 A;  3CBU A;  3KGK A;  3DVX A;  2TIR A;  3ZRD A;  3UJ1 A;  1SL1 B;  2H19 A;  1YEP A;  2I4A A;  1W89 A;  1PMT A;  1K0A A;  3A2V A;  3U6V A;  4KDU A;  4XS1 A;  2HXK A;  2N5B A;  4TXO B;  3IOS A;  4FQU A;  3IR4 A;  2NVL A;  3DEX A;  2JZR A;  3A3T A;  4I97 A;  1PD2 1;  4JR6 A;  4IN0 A;  2B3S A;  5IMZ A;  2QGV A;  1T00 A;  1YF0 A;  4I2U A;  4K6X A;  2AAW A;  3F4R A;  1G7E A;  1XOB A;  1WE0 A;  4KSM A;  2JZT A;  4ICY A;  2HE3 A;  1M2D A;  2K6V A;  2B1K A;  4MJC A;  1M7T A;  2IJY A;  2L4Q A;  3TKR A;  2Z9S A;  4H86 A;  2WB9 A;  3GNJ A;  1O8W A;  1GTB A;  3IC4 A;  3PR8 A;  1TRS A;  1LU4 A;  2IMF A;  4MJE A;  1H75 A;  4MZW A;  5E59 A;  1CQG A;  1ERU A;  1Z9H A;  2HSH A;  4K7I A;  4BPY A;  2XC2 A;  4MZB A;  1NHY A;  4IJI A;  4XHM A;  3LYK A;  4ML6 A;  4MDC A;  2HZE A;  2VIM A;  1TJD A;  2L5O A;  2CVD A;  4IBP A;  2YZU A;  1AAZ A;  3MAK A;  2B5X A;  3PGT A;  1VF3 A;  1HQO A;  3LXZ A;  2X8H A;  4ECJ A;  4G0K A;  3A5W A;  3RHB A;  2FA4 A;  2NBS A;  1YKC A;  3D5J A;  1J9B A;  2REM A;  1WOU A;  1EV9 A;  2CZ2 A;  1AC1 A;  4L0W A;  1I9D A;  3KIJ A;  1E6B A;  4F03 A;  2ON7 A;  2PWJ A;  1OAZ A;  3IHQ A;  2VCT A;  3GL3 A;  1HNC A;  3F9U A;  3HJO A;  3TJG A;  1YKA A;  2DKI A;  2IL3 A;  1Z3E A;  2X4A A;  3LEF A;  1BYE A;  4ZL8 A;  2AHE A;  4PUF C;  4DSS B;  2EC4 A;  2OBK A;  1DBY A;  1TKD B;  4OFN A;  5DAL A;  1WP0 A;  3DD3 A;  2H74 A;  3DML A;  4BA7 A;  5DCG A;  3IK7 A;  4I8B A;  3BJ5 A;  1GTU A;  5BMU A;  6GSS A;  1DUG A;  2IMK A;  3LW9 A;  2IFQ B;  3APO A;  5ECR B;  1GUL A;  3UBK A;  2LS5 A;  2R0C A;  2A2R A;  3TKQ A;  5J3R A;  2I81 A;  2PVO C;  1OC9 B;  4O5R A;  5CRW A;  3D0Z A;  4BL7 A;  2DJ0 A;  1B8X A;  1NM3 A;  3E3E A;  3RPN A;  1R5P A;  2HRK A;  4IQ1 A;  3TB2 A;  5HFI A;  3KEB A;  3ZRE A;  3N9J A;  2OA7 A;  5IQY A;  1V9W A;  3GN3 A;  2G2Q A;  4FYB A;  12GS A;  3F6D A;  3NZN A;  1YDK A;  4HU7 A;  2XPE A;  2KUC A;  2GQM A;  4F0C A;  4GST A;  4MJA A;  4NMU A;  2IIY A;  3HJP A;  4ZL9 A;  4ZXG A;  2FWG A;  1X5C A;  2VM1 A;  3AY8 A;  1XWB A;  3VPT A;  3TJF A;  1FOV A;  1XPV A;  5D9V A;  2VLT A;  2D2Z A;  5ECP B;  3QPM A;  3H79 A;  3TRQ A;  4L5O A;  4ZBA A;  1A24 A;  2PVQ A;  4Z2T A;  3WT1 A;  2H76 A;  4WBR D;  1YY7 A;  2DJK A;  1A2M A;  3ZL5 A;  1GRX A;  1ACV A;  4OMV A;  4BVY A;  2P5Q A;  5A4V A;  3A2X A;  4KSO A;  1GUK A;  1RQM A;  2FWH A;  4TR4 A;  2ZNM A;  4O7H A;  1OVN A;  5IMF A;  5IMC A;  3LYP A;  2BMX A;  5EPF A;  3TJJ A;  2VCQ A;  5F05 A;  3FW2 A;  1M3J A;  4E8E A;  1Z6M A;  1M9B A;  5ECS A;  4HI7 A;  3SWL A;  1TK0 B;  3TKP A;  1TI3 A;  5DDL A;  3DGQ A;  3FZ9 A;  2HT9 A;  2XPD A;  4EC0 A;  1HD2 A;  5AGY A;  4OFT A;  2LNS A;  4TXO A;  3KXO A;  3HA9 A;  5HFG A;  1XZO A;  3HVV A;  2YPM A;  2FGX A;  3QFA C;  2GSR A;  2V6K A;  3C73 A;  4ECB A;  1VF2 A;  1B4Q A;  3LGC A;  5KN2 A;  2VCX A;  2R37 A;  3QDN A;  5ECH B;  3UEM A;  2I9H A;  4AJ8 A;  4AJ6 A;  4O5U A;  2X8G A;  1OC3 A;  2GSQ A;  2K8V A;  2ZUP A;  2NDO A;  5KN1 A;  4WKW A;  4BWS A;  1WRY A;  3QCP A;  2CZ3 A;  3TRP A;  1V2A A;  2EIO A;  3M9K A;  4K9Z A;  3FR9 A;  3LOR A;  3G9B A;  4YQU A;  1TU8 A;  3FRC A;  1LJR A;  1LBK A;  5EY6 A;  2CAI A;  4O92 A;  2NTO A;  3UOM A;  1BG5 A;  2GZY A;  3EYT A;  3CTF A;  5CRG A;  2H0G A;  5GST A;  1X5D A;  5D8I A;  1Q98 A;  4EUY A;  1ZYQ B;  4IP6 A;  2YWI A;  3IHG A;  3A5I A;  4KND A;  2AV4 A;  1A2L A;  3L9V A;  3KTL A;  4P3Y B;  3TOU A;  1J0F A;  1Y25 A;  1ERW A;  2WUL A;  2UZ8 A;  5HR0 A;  1TK8 B;  3F8U A;  3LSZ A;  3W6G A;  4ISD A;  4PTS A;  2MMA A;  1VF4 A;  4NPB A;  2VL9 A;  2GZZ A;  4KA0 A;  2FHE A;  2C4J A;  4LMV A;  1GSS A;  2E2G A;  1Z7R A;  1OKD A;  2LRC A;  2AJQ B;  3HHV A;  3EMP A;  4IW9 A;  4V1A p;  5H5Q A;  1PL1 A;  3RDW A;  2VCZ A;  1TRV A;  4GLT A;  5EL8 A;  2DKH A;  3I69 A;  2DJJ A;  1TRW A;  2IFQ A;  5G5E A;  4TW5 A;  5FHI A;  2LQO A;  2R3X A;  5ECI B;  3TGZ A;  1XOA A;  1EEM A;  3KZQ A;  4E8H A;  1R5A A;  3H1N A;  3VPQ A;  3TKS A;  5IOW A;  2PGT A;  1WIK A;  4FYC A;  1OC9 A;  1T4Y A;  1ZL9 A;  2KP2 A;  3L9U A;  4MCU A;  5D93 A;  2JSZ A;  2G0F A;  2GVP A;  2R0G A;  4MF6 A;  2H30 A;  3KP8 A;  3HVN A;  4K5R A;  1BX9 A;  2GT6 A;  2RUE A;  6GSX A;  1PN9 A;  2WJU A;  1QMV A;  2ES7 A;  3C7M A;  1A8L A;  2YWM A;  4PUA A;  3IA1 A;  3ZVJ D;  2DML A;  1QK8 A;  1EP7 A;  1FW1 A;  3K8N A;  2CA8 A;  2H6X A;  3D6I A;  4PX1 A;  2GQL A;  1BJX A;  1Z6N A;  3EU4 A;  2XBQ A;  2OAD A;  3TRX A;  2DJ2 A;  3F63 A;  2MMZ A;  2H70 A;  2RLI A;  4HU9 A;  4KUN A;  1U3A A;  4PQH A;  2DBC A;  3E0U A;  3UIW A;  2YV9 A;  3KMN A;  1N2A A;  2ON5 A;  4F2I A;  1SKR B;  2GDR A;  2IMD A;  2N5A A;  2WDU A;  1M2B A;  3GTU B;  2R0P A;  2WCI A;  3VWV A;  4JE1 A;  3WT2 A;  5KEJ A;  1FAA A;  4YH2 A;  4KDX A;  4IS0 A;  3IC8 A;  2PPT A;  2QA2 A;  4WF4 A;  3MYD A;  5KN0 A;  1S3A A;  2LEG A;  4I5Q A;  3WYW A;  4AF2 A;  3HKR A;  5G1L A;  4BVX B;  1H4O A;  2EIQ A;  1K0M A;  3CRT A;  2LST A;  3KP9 A;  4LL1 B;  4HDE A;  4ZB6 A;  3HJM A;  3P2A A;  5DCH A;  1JZD A;  3DRN A;  1GH2 A;  4D73 B;  5JWQ B;  5ABR A;  3QAG A;  2FD3 A;  3PH9 A;  3ZIT A;  3ZFL A;  4DSR A;  3M3M A;  4RQX A;  5IPH A;  4N0Z A;  3LQ7 A;  1MTC A;  3EIN A;  5B8B A;  4WR4 A;  1SJZ A;  2C3T A;  3QOU A;  1EGO A;  5G5F A;  4KCE A;  3HVX A;  5GZZ B;  4MNN A;  1SD9 A;  3UAR A;  1GSY A;  1OYJ A;  3Q19 A;  1J08 A;  2O8V B;  2WFC A;  1UN2 A;  3H93 A;  2H6Z A;  2OE1 A;  3GFK A;  1YQ1 A;  5J5N A;  1AUC A;  1Z7P A;  3O6T A;  1V58 A;  4TR0 A;  3TOT A;  3KH9 A;  2GZP A;  3FEU A;  4GSN A;  1SEN A;  3FMW A;  5IM9 A;  4JU5 A;  4NXI A;  1U88 A;  1MDK A;  4Z7X A;  4EE0 A;  3WD6 A;  3BOA A;  1XG8 A;  3C8E A;  1XBS A;  2BTO T;  5ELG A;  1QUW A;  5C04 A;  4EKZ A;  4FYU A;  3BD2 A;  2H1A A;  3O76 A;  4POM A;  3I6A A;  5J41 A;  3IXR A;  1QQ2 A;  1B9Y C;  3P90 A;  3FZ4 A;  1ILO A;  2ALB A;  5A4U A;  4F0B A;  4AGS A;  3OR5 A;  4WXT A;  1X9M B;  3HCZ A;  5ECN B;  2YV7 A;  3DYR A;  3KM6 A;  4QQ7 A;  1S3C A;  3ISO A;  3H4K A;  4HZ2 A;  2CQ9 A;  1V98 A;  2B7K A;  2OKA A;  1XXU A;  1OC8 A;  4DVC A;  2GLR A;  4TVE A;  6GSY A;  2H1D A;  3CSI A;  1K0O A;  4ZIJ A;  5COH A;  2B5E A;  1SK0 A;  2C3Q A;  2FY6 A;  3EWL A;  1M0U A;  1A0F A;  1T4Z A;  20GS A;  1JLW A;  3F3R A;  2HZF A;  2MMN A;  4Q5N A;  5HR3 A;  2FCH A;  3LXT A;  4O5Q A;  1K3L A;  4Z2U A;  4ZBD A;  3F4S A;  2L6D A;  1UVZ A;  4LL4 B;  3MNG A;  11GS A;  4K0N A;  5ECL B;  3QFB C;  4MA9 A;  2AB6 A;  5HR1 A;  4O32 A;  3Q18 A;  5INY A;  2RM5 A;  1JZW A;  1MD3 A;  4G19 A;  2WS2 A;  3VI7 A;  1B4P A;  1X9W B;  1VF1 A;  4Q5F A;  1EP8 A;  3DXB A;  2V41 A;  5JCG A;  3VWU A;  5GSS A;  1GTI A;  1HNB A;  3FZA A;  2GS3 A;  3TUE A;  3W8S A;  1V57 A;  2YAN A;  4L0U A;  4ZIL A;  1SL2 B;  3IV4 A;  1AXD A;  2HI7 A;  5B6M A;  3BCI A;  1PFO A;  2E0Q A;  2GSS A;  2H66 A;  3HVS A;  4MZC A;  3UAP A;  5AIV A;  1K0B A;  4TKY A;  5H5R A;  3PPU A;  4HJ2 A;  2H72 A;  5GAN D;  2DSA A;  2KHP A;  1JFU A;  4L8E A;  2R2J A;  4POL A;  2GTU A;  2VLU A;  1GSF A;  3UVT A;  1MEK A;  2OE3 A;  4MMM A;  5AIX A;  4ZB8 A;  4QL9 A;  4MLY A;  1TOF A;  4WET A;  4OCE A;  3R3E A;  4G2E A;  1NSW A;  2KOK A;  3TCO A;  1X9S B;  2VL2 C;  1JZO A;  1PX6 A;  1G7O A;  4HUA A;  2O87 A;  4EL1 A;  1G6Y A;  2VD1 A;  4A5P A;  3MWH A;  3GTU A;  4Q5Q A;  2B5Y A;  4V2M A;  2LJK A;  4ECC A;  4MAB A;  4OO4 A;  4V2N A;  1TK5 B;  2QC7 A;  2VLV A;  4X43 A;  4EDZ A;  2CX4 A;  2NPB A;  3ZTL A;  4YKG A;  1TXX A;  2AYT A;  3IBH A;  4I6X A;  2FUG 2;  2PER A;  4IP1 A;  3WGE A;  2C8U A;  1XW6 A;  4N11 A;  5HQP A;  1XWC A;  4ZB9 A;  4BVX A;  5KOW A;  4BIK A;  2M80 A;  3EU3 A;  4RI7 A;  4G9H A;  4HQZ A;  1FVJ A;  3IPZ A;  5DJL A;  2RUF A;  5G30 A;  2R6K A;  4XRD A;  1SYR A;  1K0C A;  3FZ5 A;  5DQY A;  4D73 A;  2RII A;  2F8F A;  2P31 A;  2DIZ A;  3S9F A;  5CP1 A;  2HRF A;  2GT5 A;  3C1S A;  2VO4 A;  1YEX A;  1G0T A;  4GTU A;  5L71 A;  1XWK A;  1GSE A;  4FO5 A;  3EVI A;  4KX4 A;  4NAX A;  4MF7 A;  1AQW A;  4KH7 A;  5E4W A;  1CQH A;  1THX A;  4WR5 A;  4AJ7 A;  2PUK C;  3DKS A;  1FB0 A;  4Q5R A;  3Q74 A;  3SBC A;  2K18 A;  4TR1 B;  2F51 A;  3ERG A;  4JBB A;  2JU5 A;  2H1G A;  4K5S A;  1O73 A;  1EOH A;  2LQQ A;  3HDC A;  2DJ3 A;  1S3D A;  1XVW A;  3GUS A;  4TR3 A;  2GGT A;  2X64 A;  3CTG A;  4TN8 A;  3H8Q A;  1K0N A;  3KMO A;  5DQS A;  3HYP A;  1GUH A;  1SKW B;  2P0G A;  4G0I A;  3ZZX A;  3GX8 A;  3APS A;  4TXV A;  2WRT A;  4YQM A;  4XCS A;  1T8E B;  4K7N A;  5CAX A;  1XIY A;  2EIR A;  4GSS A;  1O8X A;  3FKF A;  4YAV A;  4FIW A;  2VUP A;  4IJ3 A;  1R7H A;  2KP1 A;  4K0G A;  1T3B A;  1TTZ A;  2F9S A;  5IMV A;  2V6O A;  3ZYW A;  5CRH A;  1QGV A;  4HEA 2;  1DSB A;  3GRX A;  1O6J A;  1USB A;  1YJ6 A;  4MH2 A;  5ECK B;  6GSU A;  5IIZ A;  1A23 A;  2WZ9 A;  3CQF A;  2DIY A;  2L59 A;  1ABA A;  3QAW A;  2FNO A;  3GUR A;  3VUR A;  1IYI A;  2JZS A;  3VWX A;  2OAC A;  5DAK B;  4EIQ A;  3F4T A;  2E7P A;  5BRT A;  18GS A;  4YKF A;  2X8C A;  3EE2 A;  1GTA A;  2VCV A;  4PQ1 A;  4POK A;  3A2W A;  2V32 A;  4X1U A;  2MBT A;  1TU7 A;  3D4M A;  2HFD A;  4OD7 A;  1XW5 A;  5IO0 A;  1S3R A;  1ZMA A;  2H71 A;  1F2E A;  2CX3 A;  4DSQ A;  1O81 A;  3QR6 A;  1B48 A;  4GQC A;  3GST A;  3PIN A;  4HZ4 A;  4CHS A;  3Q6O A;  4GWR A;  2E2M A;  1XWG A;  3J7Y b;  2YWO A;  2A2S A;  1DE1 A;  1FHE A;  2HRN A;  2HNL A;  1OE7 A;  1TRU A;  1ZYE A;  3DIE A;  2FWE A;  5G2Z A;  4ZBB A;  1EWX A;  5B8A A;  4ZL7 A;  3VK9 A;  3VWW A;  2VOC A;  4OFM A;  3L78 A;  4OWY A;  5IPG A;  4KW6 A;  1THO A;  2H0I A;  2C0G A;  1TI1 A;  4CY6 A;  3LG6 A;  4V1A g;  1XCC A;  1SYX A;  2GST A;  2LNT A;  3IE3 A;  3IRA A;  4K1F A;  4KAE A;  1AIU A;  4MF5 A;  4WF5 A;  4N10 A;  4NV5 A;  3L0H A;  3UMA A;  5IMD A;  1TP9 A;  2I1U A;  3CSJ A;  1SKS B;  5JCW A;  9GSS A;  3RPP A;  3GH6 A;  5F0G A;  2CVB A;  4G10 A;  1F3B A;  3GMF A;  4N30 A;  3L9S A;  1M2A A;  3ZML A;  6GSV A;  10GS A;  1GLP A;  2LJA A;  5KOX A;  3ME7 A;  3GIX A;  5D73 A;  2L5L A;  1QFN A;  1ZYP A;  2XBI A;  4X4J A;  3P7X A;  3ZMK A;  1MDI A;  3CMI A;  5D9T A;  4KCA A;  2JSY A;  5JCU A;  1X0R A;  4MPG A;  2LUS A;  5A4W A;  2MMO A;  2GQK A;  3W8J A;  1RK4 A;  2XHF A;  4N0V A;  1RW1 A;  4I2T A;  2YNX A;  1T7P B;  2DMM A;  17GS A;  4TR1 A;  2R5G A;  3G7J A;  4K8M A;  2K9F A;  1KTE A;  2H0H A;  3HXS A;  4L5L A;  3M8N A;  1GWC A;  4TRX A;  2HRA A;  3LJR A;  1GSU A;  4IQA A;  2YJ7 A;  1GLQ A;  1F37 A;  1ST9 A;  1SD8 A;  3KTB A;  3ZVJ A;  3FHK A;  3P8W A;  3ERW A;  5A5K A;  5C00 A;  3HD5 A;  4Z2R A;  1W4V A;  2LV3 A;  5DVB A;  1KBN A;  4J2F A;  3I43 A;  1R26 A;  4GF0 A;  5DJM A;  3G7I A;  3UBL A;  3GHA A;  4MK3 A;  1BED A;  2PBJ A;  2P5R A;  4XS4 B;  3CXG A;  4MPF A;  5DBQ A;  3U5R E;  2A2P A;  1XFL A;  3GKX A;  4OO5 A;  1HYU A;  4IVF A;  2FLS A;  1AQX A;  2H1B A;  3RBT A;  5GAP D;  2CV4 A;  4J57 E;  16GS A;  4IKH A;  5F06 A;  5ECO B;  4KDY A;  5F8B A;  2V2G A;  4PXO A;  3FK8 A;  5IO2 A;  2H8L A;  5H5S A;  3M1G A;  19GS A;  2CT6 A;  2B6M A;  1N8J A;  5D96 A;  4JED A;  2OJL A;  5B7C A;  1MD4 A;  6GSW A;  3ERF A; 
#chains in the Genus database with same CATH homology
 1AW9 A;  2H75 A;  1BAY A;  3ME8 A;  2PN8 A;  2DC5 A;  4PNG A;  2HSM A;  3GH9 A;  3LWA A;  1BQ7 A;  2QKE A;  4X0X A;  2L4C A;  5DAK A;  1ZYN A;  1SJ6 A;  3APQ A;  5CRD A;  1VRS D;  1FG4 A;  3JCM L;  2YOI A;  1JLV A;  5ENU A;  5ECM B;  14GS A;  2LTK A;  3KH7 A;  5IMA A;  3D22 A;  2A4V A;  3GKN A;  1WJK A;  4PUR A;  1DE2 A;  3IK9 A;  3D21 A;  1PKZ A;  4KE3 A;  1PRX A;  1O85 A;  3TKS C;  3VLN A;  2A4H A;  2LRT A;  2OBI A;  3TKS E;  2B7J A;  3ED3 A;  4HQS A;  4JRR A;  3TJB A;  1GNE A;  3N5O A;  4CDO A;  1WPI A;  1A8Y A;  2H01 A;  3GKM A;  2AUV A;  4IGJ A;  2C1Y A;  1G6W A;  2YJH A;  2O7K A;  3MSZ A;  2VL3 A;  4OCF A;  5CRE A;  3EUR A;  1R4W A;  1FO5 A;  3IDV A;  1UA5 A;  1ERT A;  4PNF A;  4RI6 A;  4CW9 A;  5ID2 B;  1EZK A;  1JZR A;  4NHZ A;  1YZX A;  4NV2 A;  4EF0 A;  3NOF A;  4USS A;  2MYG A;  2I3Y A;  5EVO A;  1F3A A;  1GNW A;  4K7O A;  1PL2 A;  2PU9 C;  4FH8 A;  4XIH A;  4K2D A;  2YN1 A;  1PN0 A;  8GSS A;  1M99 A;  4YQV A;  2O89 A;  2CAQ A;  3RHC A;  5AIS A;  1M9A A;  3BBY A;  5D9W A;  3TDG A;  3UL3 A;  3KJY A;  5KN3 A;  2M46 A;  4PGT A;  1KNG A;  5HR2 A;  1WMJ A;  2C80 A;  4TOP A;  2MZC A;  4HS1 A;  4JR4 A;  1SK2 A;  2X49 A;  3GA4 A;  3BCK A;  3ZIJ A;  2J9H A;  4MJB A;  4WBJ A;  2C0D A;  1K0D A;  1MDJ A;  2YCD A;  5FT3 A;  1SL0 B;  1E2Y A;  2HLS A;  1AQV A;  3GKK A;  2ZCT A;  1Y6E A;  2M72 A;  5G1K A;  2H73 A;  1SK1 A;  2TRX A;  4JZQ A;  2LKU A;  2VM2 A;  5CO3 A;  5HFK A;  3O3T A;  2O85 A;  1YF1 A;  1XWA A;  2LRN A;  4IEL A;  2B1L A;  1PQN A;  4POB A;  5LNK e;  1ZOF A;  2J23 A;  2F3M A;  2C0F A;  1NW2 A;  3QD9 A;  1GL8 A;  4MH3 A;  3D4T A;  1X5E A;  4LMW A;  3DWV A;  2L6C A;  1UC7 A;  1A2J A;  1ERV A;  3MDK A;  1FB6 A;  7GSS A;  4LLR A;  3GSS A;  2YP6 A;  5J4U A;  2IPA A;  3FR3 A;  1V40 A;  4HJM A;  13GS A;  4EXJ A;  4NWY A;  2KLX A;  3HY2 A;  3MIX A;  4IHU A;  4PQI A;  2RM6 A;  2C3N A;  4KB3 A;  5J9B A;  3FR6 A;  4K2X A;  4EVM A;  3C71 A;  3L4N A;  5LD0 A;  1O7U A;  3ZFB A;  3F3Q A;  2HZE B;  1OE8 A;  4ULX A;  3VFI A;  3QAV A;  1ZGN A;  3ZLP A;  3FYG A;  2IME A;  2OE0 A;  1NHO A;  4ACS A;  3WGX A;  1Z5Y E;  1I5G A;  4XRA A;  3EMX A;  4YAP A;  2TRC P;  1ZCP A;  4J56 E;  4XS4 A;  1F6M C;  4G0L A;  4HOJ A;  3ZIV A;  3EPT A;  5G31 A;  1EOG A;  1EGR A;  2K8S A;  2QSI A;  2JAD A;  4V2L A;  3G7Y A;  1B9X C;  2QA1 A;  3CYN A;  2DLX A;  3KD0 A;  5LCZ A;  2BJX A;  4MP4 A;  1K3O A;  1TDI A;  3R2Q A;  1JHB A;  3WGD A;  2HSY A;  2VD0 A;  3QMX A;  4GQF A;  1EV4 A;  3CSH A;  3HZ8 A;  2X99 A;  3M9J A;  1VGL A;  1ON4 A;  1GSD A;  1URM A;  5ELA A;  3RAZ A;  1U6T A;  3E9J B;  2JAC A;  2DJ1 A;  3LFL A;  4NHW A;  3FY7 A;  1GP1 A;  1ML6 A;  1FVK A;  3KCM A;  3VI5 A;  4EDY A;  2YZH A;  5DAL B;  4DSS A;  5F07 A;  2IMI A;  3TJK A;  1FOH A;  4EO3 A;  1GUM A;  4DEJ A;  2N5F A;  4F82 A;  4XTS A;  2LJR A;  1A0R P;  1EEJ A;  3F6F A;  3GL5 A;  1U3I A;  1SJI A;  4QL7 A;  1PSQ A;  4ID0 A;  5FWG A;  1WWJ A;  4ECI A;  1IYH A;  3J7Y k;  3EC3 A;  5JWR B;  2CVK A;  1KEB A;  3C1R A;  4BL7 B;  1XVQ A;  2JL4 A;  4F9Z A;  3GX0 A;  1F9M A;  5CNW A;  4LA1 A;  2FA8 A;  3DVW A;  4EIP A;  2VAF A;  4ML1 A;  2C0E A;  1XW9 A;  5IOX A;  1U87 A;  5AN1 A;  1C72 A;  22GS A;  1PKW A;  5ECQ B;  3IAM 2;  5B6N A;  4XS6 A;  2VCW A;  2MBS A;  1QXH A;  1ZZY A;  1PA3 A;  5J9C A;  3GV1 A;  6GST A;  2H6Y A;  2WGR A;  3I9V 2;  4GCI A;  1T1V A;  1Q4J A;  1OKT A;  5D9X A;  2L57 A;  2V1M A;  4WEY A;  3HZ4 A;  5ID2 A;  2F8A A;  3F0I A;  2PMT A;  5JWO B;  1HNA A;  2VL2 A;  1PGT A;  3NIV A;  2HYX A;  3M0F A;  1PX7 A;  2R4V A;  3US3 A;  3V1W A;  4GRF A;  4KF9 A;  2FWF A;  2IN3 A;  3UVH A;  3IAS 2;  4RQR A;  4BVY B;  1GSQ A;  3CRU A;  5CYY A;  1K3Y A;  2IWT A;  4KGI A;  4BWQ A;  4ILF A;  4RUV A;  4GXZ A;  3GYK A;  1TW9 A;  4CY8 A;  2YWN A;  1SU9 A;  3CBU A;  3KGK A;  3DVX A;  2TIR A;  3ZRD A;  3UJ1 A;  1SL1 B;  2H19 A;  1YEP A;  2I4A A;  1W89 A;  1PMT A;  1K0A A;  3A2V A;  3U6V A;  4KDU A;  4XS1 A;  2HXK A;  2N5B A;  4TXO B;  3IOS A;  4FQU A;  3IR4 A;  2NVL A;  3DEX A;  2JZR A;  3A3T A;  4I97 A;  1PD2 1;  4JR6 A;  4IN0 A;  2B3S A;  5IMZ A;  2QGV A;  1T00 A;  1YF0 A;  4I2U A;  4K6X A;  2AAW A;  3F4R A;  1G7E A;  1XOB A;  1WE0 A;  4KSM A;  2JZT A;  4ICY A;  2HE3 A;  1M2D A;  2K6V A;  2B1K A;  4MJC A;  1M7T A;  2IJY A;  2L4Q A;  3TKR A;  2Z9S A;  4H86 A;  2WB9 A;  3GNJ A;  1O8W A;  1GTB A;  3IC4 A;  3PR8 A;  1TRS A;  1LU4 A;  2IMF A;  4MJE A;  1H75 A;  4MZW A;  5E59 A;  1CQG A;  1ERU A;  1Z9H A;  2HSH A;  4K7I A;  4BPY A;  2XC2 A;  4MZB A;  1NHY A;  4IJI A;  4XHM A;  3LYK A;  4ML6 A;  4MDC A;  2HZE A;  2VIM A;  1TJD A;  2L5O A;  2CVD A;  4IBP A;  2YZU A;  1AAZ A;  3MAK A;  2B5X A;  3PGT A;  1VF3 A;  1HQO A;  3LXZ A;  2X8H A;  4ECJ A;  4G0K A;  3A5W A;  3RHB A;  2FA4 A;  2NBS A;  1YKC A;  3D5J A;  1J9B A;  2REM A;  1WOU A;  1EV9 A;  2CZ2 A;  1AC1 A;  4L0W A;  1I9D A;  3KIJ A;  1E6B A;  4F03 A;  2ON7 A;  2PWJ A;  1OAZ A;  3IHQ A;  2VCT A;  3GL3 A;  1HNC A;  3F9U A;  3HJO A;  3TJG A;  1YKA A;  2DKI A;  2IL3 A;  1Z3E A;  2X4A A;  3LEF A;  1BYE A;  4ZL8 A;  2AHE A;  4PUF C;  4DSS B;  2EC4 A;  2OBK A;  1DBY A;  1TKD B;  4OFN A;  5DAL A;  1WP0 A;  3DD3 A;  2H74 A;  3DML A;  4BA7 A;  5DCG A;  3IK7 A;  4I8B A;  3BJ5 A;  1GTU A;  5BMU A;  6GSS A;  1DUG A;  2IMK A;  3LW9 A;  2IFQ B;  3APO A;  5ECR B;  1GUL A;  3UBK A;  2LS5 A;  2R0C A;  2A2R A;  3TKQ A;  5J3R A;  2I81 A;  2PVO C;  1OC9 B;  4O5R A;  5CRW A;  3D0Z A;  4BL7 A;  2DJ0 A;  1B8X A;  1NM3 A;  3E3E A;  3RPN A;  1R5P A;  2HRK A;  4IQ1 A;  3TB2 A;  5HFI A;  3KEB A;  3ZRE A;  3N9J A;  2OA7 A;  5IQY A;  1V9W A;  3GN3 A;  2G2Q A;  4FYB A;  12GS A;  3F6D A;  3NZN A;  1YDK A;  4HU7 A;  2XPE A;  2KUC A;  2GQM A;  4F0C A;  4GST A;  4MJA A;  4NMU A;  2IIY A;  3HJP A;  4ZL9 A;  4ZXG A;  2FWG A;  1X5C A;  2VM1 A;  3AY8 A;  1XWB A;  3VPT A;  3TJF A;  1FOV A;  1XPV A;  5D9V A;  2VLT A;  2D2Z A;  5ECP B;  3QPM A;  3H79 A;  3TRQ A;  4L5O A;  4ZBA A;  1A24 A;  2PVQ A;  4Z2T A;  3WT1 A;  2H76 A;  4WBR D;  1YY7 A;  2DJK A;  1A2M A;  3ZL5 A;  1GRX A;  1ACV A;  4OMV A;  4BVY A;  2P5Q A;  5A4V A;  3A2X A;  4KSO A;  1GUK A;  1RQM A;  2FWH A;  4TR4 A;  2ZNM A;  4O7H A;  1OVN A;  5IMF A;  5IMC A;  3LYP A;  2BMX A;  5EPF A;  3TJJ A;  2VCQ A;  5F05 A;  3FW2 A;  4E8E A;  1Z6M A;  1M9B A;  5ECS A;  4HI7 A;  3SWL A;  1TK0 B;  3TKP A;  1TI3 A;  5DDL A;  3DGQ A;  3FZ9 A;  2HT9 A;  2XPD A;  4EC0 A;  1HD2 A;  5AGY A;  4OFT A;  2LNS A;  4TXO A;  3KXO A;  3HA9 A;  5HFG A;  1XZO A;  3HVV A;  2YPM A;  2FGX A;  3QFA C;  2GSR A;  2V6K A;  3C73 A;  4ECB A;  1VF2 A;  1B4Q A;  3LGC A;  5KN2 A;  2VCX A;  2R37 A;  3QDN A;  5ECH B;  3UEM A;  2I9H A;  4AJ8 A;  4AJ6 A;  4O5U A;  2X8G A;  1OC3 A;  2GSQ A;  2K8V A;  2ZUP A;  2NDO A;  5KN1 A;  4WKW A;  4BWS A;  1WRY A;  3QCP A;  2CZ3 A;  3TRP A;  1V2A A;  2EIO A;  3M9K A;  4K9Z A;  3FR9 A;  3LOR A;  3G9B A;  4YQU A;  1TU8 A;  3FRC A;  1LJR A;  1LBK A;  5EY6 A;  2CAI A;  4O92 A;  2NTO A;  3UOM A;  1BG5 A;  2GZY A;  3EYT A;  3CTF A;  5CRG A;  2H0G A;  5GST A;  1X5D A;  5D8I A;  1Q98 A;  4EUY A;  1ZYQ B;  4IP6 A;  2YWI A;  3IHG A;  3A5I A;  4KND A;  2AV4 A;  1A2L A;  3L9V A;  3KTL A;  4P3Y B;  3TOU A;  1J0F A;  1Y25 A;  1ERW A;  2WUL A;  2UZ8 A;  5HR0 A;  1TK8 B;  3F8U A;  3LSZ A;  3W6G A;  4ISD A;  4PTS A;  2MMA A;  1VF4 A;  4NPB A;  2VL9 A;  2GZZ A;  4KA0 A;  2FHE A;  2C4J A;  4LMV A;  1GSS A;  2E2G A;  1Z7R A;  1OKD A;  2LRC A;  2AJQ B;  3HHV A;  3EMP A;  4IW9 A;  4V1A p;  5H5Q A;  1PL1 A;  3RDW A;  2VCZ A;  1TRV A;  4GLT A;  5EL8 A;  2DKH A;  3I69 A;  2DJJ A;  1TRW A;  2IFQ A;  5G5E A;  4TW5 A;  5FHI A;  2LQO A;  2R3X A;  5ECI B;  3TGZ A;  1XOA A;  1EEM A;  3KZQ A;  4E8H A;  1R5A A;  3H1N A;  3VPQ A;  3TKS A;  5IOW A;  2PGT A;  1WIK A;  4FYC A;  1OC9 A;  1T4Y A;  1ZL9 A;  2KP2 A;  3L9U A;  4MCU A;  5D93 A;  2JSZ A;  2G0F A;  2GVP A;  2R0G A;  4MF6 A;  2H30 A;  3KP8 A;  4K5R A;  1BX9 A;  2GT6 A;  2RUE A;  6GSX A;  1PN9 A;  2WJU A;  1QMV A;  2ES7 A;  3C7M A;  1A8L A;  2YWM A;  4PUA A;  3IA1 A;  3ZVJ D;  2DML A;  1QK8 A;  1EP7 A;  1FW1 A;  3K8N A;  2CA8 A;  2H6X A;  3D6I A;  4PX1 A;  2GQL A;  1BJX A;  1Z6N A;  3EU4 A;  2XBQ A;  2OAD A;  3TRX A;  2DJ2 A;  3F63 A;  2MMZ A;  2H70 A;  2RLI A;  4HU9 A;  4KUN A;  1U3A A;  4PQH A;  2DBC A;  3E0U A;  3UIW A;  2YV9 A;  3KMN A;  1N2A A;  2ON5 A;  4F2I A;  1SKR B;  2GDR A;  2IMD A;  2N5A A;  2WDU A;  1M2B A;  3GTU B;  2R0P A;  2WCI A;  3VWV A;  4JE1 A;  3WT2 A;  5KEJ A;  1FAA A;  4YH2 A;  4KDX A;  4IS0 A;  3IC8 A;  2PPT A;  2QA2 A;  4WF4 A;  3MYD A;  5KN0 A;  1S3A A;  2LEG A;  4I5Q A;  3WYW A;  4AF2 A;  3HKR A;  5G1L A;  4BVX B;  1H4O A;  2EIQ A;  1K0M A;  3CRT A;  2LST A;  3KP9 A;  4LL1 B;  4HDE A;  4ZB6 A;  3HJM A;  3P2A A;  5DCH A;  1JZD A;  3DRN A;  1GH2 A;  4D73 B;  5JWQ B;  5ABR A;  3QAG A;  2FD3 A;  3PH9 A;  3ZIT A;  3ZFL A;  4DSR A;  3M3M A;  4RQX A;  5IPH A;  4N0Z A;  3LQ7 A;  1MTC A;  3EIN A;  5B8B A;  4WR4 A;  1SJZ A;  2C3T A;  3QOU A;  1EGO A;  5G5F A;  4KCE A;  3HVX A;  5GZZ B;  4MNN A;  1SD9 A;  3UAR A;  1GSY A;  1OYJ A;  3Q19 A;  1J08 A;  2O8V B;  2WFC A;  1UN2 A;  3H93 A;  2H6Z A;  2OE1 A;  3GFK A;  1YQ1 A;  5J5N A;  1AUC A;  1Z7P A;  3O6T A;  1V58 A;  4TR0 A;  3TOT A;  3KH9 A;  2GZP A;  3FEU A;  4GSN A;  1SEN A;  3FMW A;  5IM9 A;  4JU5 A;  4NXI A;  1U88 A;  1MDK A;  4Z7X A;  4EE0 A;  3WD6 A;  3BOA A;  3C8E A;  1XBS A;  2BTO T;  5ELG A;  1QUW A;  5C04 A;  4EKZ A;  4FYU A;  3BD2 A;  2H1A A;  3O76 A;  4POM A;  3I6A A;  5J41 A;  3IXR A;  1QQ2 A;  1B9Y C;  3P90 A;  3FZ4 A;  1ILO A;  2ALB A;  5A4U A;  4F0B A;  4AGS A;  3OR5 A;  4WXT A;  1X9M B;  3HCZ A;  5ECN B;  2YV7 A;  3DYR A;  3KM6 A;  4QQ7 A;  1S3C A;  3ISO A;  3H4K A;  4HZ2 A;  2CQ9 A;  1V98 A;  2B7K A;  2OKA A;  1XXU A;  1OC8 A;  4DVC A;  2GLR A;  4TVE A;  6GSY A;  2H1D A;  3CSI A;  1K0O A;  4ZIJ A;  5COH A;  2B5E A;  1SK0 A;  2C3Q A;  2FY6 A;  3EWL A;  1M0U A;  1A0F A;  1T4Z A;  20GS A;  1JLW A;  3F3R A;  2HZF A;  2MMN A;  4Q5N A;  5HR3 A;  2FCH A;  3LXT A;  4O5Q A;  1K3L A;  4Z2U A;  4ZBD A;  3F4S A;  2L6D A;  1UVZ A;  4LL4 B;  3MNG A;  11GS A;  4K0N A;  5ECL B;  3QFB C;  4MA9 A;  2AB6 A;  5HR1 A;  4O32 A;  3Q18 A;  5INY A;  2RM5 A;  1JZW A;  1MD3 A;  4G19 A;  2WS2 A;  3VI7 A;  1B4P A;  1X9W B;  1VF1 A;  4Q5F A;  1EP8 A;  3DXB A;  2V41 A;  5JCG A;  3VWU A;  5GSS A;  1GTI A;  1HNB A;  3FZA A;  2GS3 A;  3TUE A;  3W8S A;  1V57 A;  2YAN A;  4L0U A;  4ZIL A;  1SL2 B;  3IV4 A;  1AXD A;  2HI7 A;  5B6M A;  3BCI A;  2E0Q A;  2GSS A;  2H66 A;  3HVS A;  4MZC A;  3UAP A;  5AIV A;  1K0B A;  4TKY A;  5H5R A;  3PPU A;  4HJ2 A;  2H72 A;  5GAN D;  2DSA A;  2KHP A;  1JFU A;  4L8E A;  2R2J A;  4POL A;  2GTU A;  2VLU A;  1GSF A;  3UVT A;  1MEK A;  2OE3 A;  4MMM A;  5AIX A;  4ZB8 A;  4QL9 A;  4MLY A;  1TOF A;  4WET A;  4OCE A;  3R3E A;  4G2E A;  1NSW A;  2KOK A;  3TCO A;  1X9S B;  2VL2 C;  1JZO A;  1PX6 A;  1G7O A;  4HUA A;  2O87 A;  4EL1 A;  1G6Y A;  2VD1 A;  4A5P A;  3MWH A;  3GTU A;  4Q5Q A;  2B5Y A;  4V2M A;  2LJK A;  4ECC A;  4MAB A;  4OO4 A;  4V2N A;  1TK5 B;  2QC7 A;  2VLV A;  4X43 A;  4EDZ A;  2CX4 A;  2NPB A;  3ZTL A;  4YKG A;  1TXX A;  2AYT A;  3IBH A;  4I6X A;  2FUG 2;  2PER A;  4IP1 A;  3WGE A;  2C8U A;  1XW6 A;  4N11 A;  5HQP A;  1XWC A;  4ZB9 A;  4BVX A;  5KOW A;  2M80 A;  3EU3 A;  4RI7 A;  4G9H A;  4HQZ A;  1FVJ A;  3IPZ A;  5DJL A;  2RUF A;  5G30 A;  2R6K A;  4XRD A;  1SYR A;  1K0C A;  3FZ5 A;  5DQY A;  4D73 A;  2RII A;  2F8F A;  2P31 A;  2DIZ A;  3S9F A;  5CP1 A;  2HRF A;  2GT5 A;  3C1S A;  2VO4 A;  1YEX A;  1G0T A;  4GTU A;  5L71 A;  1XWK A;  1GSE A;  4FO5 A;  3EVI A;  4KX4 A;  4NAX A;  4MF7 A;  1AQW A;  4KH7 A;  5E4W A;  1CQH A;  1THX A;  4WR5 A;  4AJ7 A;  2PUK C;  3DKS A;  1FB0 A;  4Q5R A;  3Q74 A;  3SBC A;  2K18 A;  4TR1 B;  2F51 A;  3ERG A;  4JBB A;  2JU5 A;  2H1G A;  4K5S A;  1O73 A;  1EOH A;  2LQQ A;  3HDC A;  2DJ3 A;  1S3D A;  1XVW A;  3GUS A;  4TR3 A;  2GGT A;  2X64 A;  3CTG A;  4TN8 A;  3H8Q A;  1K0N A;  3KMO A;  5DQS A;  3HYP A;  1GUH A;  1SKW B;  2P0G A;  4G0I A;  3ZZX A;  3GX8 A;  3APS A;  4TXV A;  2WRT A;  4YQM A;  4XCS A;  1T8E B;  4K7N A;  5CAX A;  1XIY A;  2EIR A;  4GSS A;  1O8X A;  3FKF A;  4YAV A;  4FIW A;  2VUP A;  4IJ3 A;  1R7H A;  2KP1 A;  4K0G A;  1T3B A;  1TTZ A;  2F9S A;  5IMV A;  2V6O A;  3ZYW A;  5CRH A;  1QGV A;  4HEA 2;  1DSB A;  3GRX A;  1O6J A;  1USB A;  1YJ6 A;  4MH2 A;  5ECK B;  6GSU A;  5IIZ A;  1A23 A;  2WZ9 A;  2DIY A;  2L59 A;  1ABA A;  3QAW A;  2FNO A;  3GUR A;  3VUR A;  1IYI A;  2JZS A;  3VWX A;  2OAC A;  5DAK B;  4EIQ A;  3F4T A;  2E7P A;  5BRT A;  18GS A;  4YKF A;  2X8C A;  3EE2 A;  1GTA A;  2VCV A;  4PQ1 A;  4POK A;  3A2W A;  2V32 A;  4X1U A;  2MBT A;  1TU7 A;  3D4M A;  2HFD A;  4OD7 A;  1XW5 A;  5IO0 A;  1ZMA A;  2H71 A;  1F2E A;  2CX3 A;  4DSQ A;  1O81 A;  3QR6 A;  1B48 A;  4GQC A;  3GST A;  3PIN A;  4HZ4 A;  4CHS A;  3Q6O A;  4GWR A;  2E2M A;  1XWG A;  3J7Y b;  2YWO A;  2A2S A;  1DE1 A;  1FHE A;  2HRN A;  2HNL A;  1OE7 A;  1TRU A;  1ZYE A;  3DIE A;  2FWE A;  5G2Z A;  4ZBB A;  1EWX A;  5B8A A;  4ZL7 A;  3VK9 A;  3VWW A;  2VOC A;  4OFM A;  3L78 A;  4OWY A;  5IPG A;  4KW6 A;  1THO A;  2H0I A;  2C0G A;  1TI1 A;  4CY6 A;  3LG6 A;  4V1A g;  1XCC A;  1SYX A;  2GST A;  2LNT A;  3IE3 A;  3IRA A;  4K1F A;  4KAE A;  1AIU A;  4MF5 A;  4WF5 A;  4N10 A;  4NV5 A;  3L0H A;  3UMA A;  5IMD A;  1TP9 A;  2I1U A;  3CSJ A;  1SKS B;  5JCW A;  9GSS A;  3RPP A;  3GH6 A;  5F0G A;  2CVB A;  4G10 A;  1F3B A;  3GMF A;  4N30 A;  3L9S A;  1M2A A;  3ZML A;  6GSV A;  10GS A;  1GLP A;  2LJA A;  5KOX A;  3ME7 A;  3GIX A;  5D73 A;  2L5L A;  1QFN A;  1ZYP A;  2XBI A;  4X4J A;  3P7X A;  3ZMK A;  1MDI A;  3CMI A;  5D9T A;  4KCA A;  2JSY A;  5JCU A;  1X0R A;  4MPG A;  2LUS A;  5A4W A;  2MMO A;  2GQK A;  3W8J A;  1RK4 A;  2XHF A;  4N0V A;  1RW1 A;  4I2T A;  2YNX A;  1T7P B;  2DMM A;  17GS A;  4TR1 A;  2R5G A;  3G7J A;  4K8M A;  2K9F A;  1KTE A;  2H0H A;  3HXS A;  4L5L A;  3M8N A;  1GWC A;  4TRX A;  2HRA A;  3LJR A;  1GSU A;  4IQA A;  2YJ7 A;  1GLQ A;  1F37 A;  1ST9 A;  1SD8 A;  3KTB A;  3ZVJ A;  3FHK A;  3P8W A;  3ERW A;  5A5K A;  5C00 A;  3HD5 A;  4Z2R A;  1W4V A;  2LV3 A;  5DVB A;  1KBN A;  4J2F A;  3I43 A;  1R26 A;  4GF0 A;  5DJM A;  3G7I A;  3UBL A;  3GHA A;  4MK3 A;  1BED A;  2PBJ A;  2P5R A;  4XS4 B;  3CXG A;  4MPF A;  5DBQ A;  3U5R E;  2A2P A;  1XFL A;  3GKX A;  4OO5 A;  1HYU A;  4IVF A;  2FLS A;  1AQX A;  2H1B A;  3RBT A;  5GAP D;  2CV4 A;  4J57 E;  16GS A;  4IKH A;  5F06 A;  5ECO B;  4KDY A;  5F8B A;  2V2G A;  4PXO A;  3FK8 A;  5IO2 A;  2H8L A;  5H5S A;  3M1G A;  19GS A;  2CT6 A;  5D96 A;  2B6M A;  1N8J A;  4JED A;  2OJL A;  5B7C A;  1MD4 A;  6GSW A;  3ERF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...