5J9BA

Crystal structure of peroxiredoxin asp f3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
163
Chain Sequence
GSGLKAGDSFPSDVVFSYIPWSEACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords peroxiredoxin Asp f3
publication title The Crystal Structure of Peroxiredoxin Asp f3 Provides Mechanistic Insight into Oxidative Stress Resistance and Virulence of Aspergillus fumigatus.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 46
structure length 163
sequence length 169
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j9bA00
1K0AA 3PGTA 2LS5A 4MCUA 1Z9HA 5F05A 3L0HA 1Q98A 1N2AA 1U3IA 2L57A 4WEYA 4KX4A 4XS6A 2FWGA 3D4MA 1A8LA 2IMEA 4OO5A 1FHEA 1AXDA 1PX7A 4RQXA 5HFGA 4IW9A 3L9UA 3N9JA 4MH3A 1EP7A 5IMFA 4K7NA 4K9ZA 3TRPA 2O89A 4TXOB 1V40A 2FNOA 4OFMA 3IC4A 5KN2A 1GTUA 4Q5RA 5KN0A 2FA4A 2O85A 5AN1A 4F2IA 2BMXA 1K3OA 3HJMA 1W89A 2QGVA 2GSQA 2PBJA 2XBIA 4KDUA 1OC3A 5IOXA 3VPQA 4K1FA 4NHZA 1R5AA 4IQAA 3GIXA 1YKCA 3IXRA 2R5GA 3ZFLA 1AQWA 3F6FA 4N11A 3ZLPA 4IGJA 4KCAA 3IDVA 1DUGA 2CZ3A 1LBKA 2VCQA 2VUPA 3VK9A 4FYBA 5KN3A 4O7HA 5G30A 3TOTA 4OD7A 3QFBC 4GSNA 4DVCA 3UJ1A 4EE0A 2V6OA 5FT3A 5JCWA 3AY8A 2I3YA 2YANA 4GLTA 4NPBA 1PN9A 3CTFA 2XPDA 3VWXA 1WP0A 1M2DA 4X0XA 3IK7A 3P7XA 4TR1A 1SD9A 5ECSA 4DSRA 2MZCA 4JRRA 2OACA 2DIYA 1GRXA 3CMIA 1JLWA 2XHFA 5DVBA 2PU9C 5HR0A 1DBYA 2HXKA 3GSSA 2KUCA 3F4SA 2A4VA 4PUAA 2DIZA 2GGTA 3UAPA 1SK1A 2B7KA 5IO2A 2EIRA 1V9WA 3QCPA 2HT9A 1K0BA 4GQCA 5GZZB 1HYUA 3A2WA 3UOMA 2MBSA 2GQMA 3MDKA 2H0GA 4KA0A 2K8VA 3G7JA 5CNWA 1VGLA 1YDKA 1PKWA 3GFKA 3LQ7A 1XIYA 4L5LA 2YPMA 4N0ZA 5KN1A 1WE0A 3DWVA 3QDNA 1FW1A 3GMFA 1Z6NA 2CAIA 2KLXA 2RLIA 2CA8A 5DBQA 3DVXA 3GN3A 2H30A 1AQVA 4KDYA 4MLYA 1O85A 2G0FA 3Q74A 1YY7A 4E8EA 2H8LA 3WT1A 11GSA 3UIWA 4IQ1A 5EL8A 16GSA 2GT5A 3O3TA 5B6NA 2E0QA 1SU9A 5IMZA 2H74A 1O7UA 5B8AA 3SWLA 1SYRA 5J41A 5IQYA 4POBA 3U6VA 1X9MB 3I43A 1UA5A 3KIJA 2B1LA 2LKUA 3KH9A 1GH2A 8GSSA 3GTUA 3VWWA 4V2MA 4MZBA 4O5RA 2JADA 4NXIA 1SYXA 5E59A 5J3RA 1QMVA 3QR6A 4MPGA 3RPNA 4ACSA 1KTEA 4DSSA 3GX8A 5F8BA 1O6JA 1U6TA 1YKAA 2HZEA 4ILFA 2OBIA 1QGVA 5ECOB 3ZVJD 1TJDA 3D6IA 3G9BA 1PGTA 1R4WA 5DJLA 1LJRA 2JSYA 3FR9A 3LG6A 4XRDA 3NZNA 3EWLA 1ERTA 4PQIA 1OKDA 5FWGA 2LQOA 4I97A 3TJJA 3W8SA 3FY7A 4ML1A 4WBRD 3HY2A 3JCML 2L6CA 2ON5A 1EEMA 1T7PB 3D4TA 5CYYA 3TCOA 1ZZYA 1GP1A 4QQ7A 4TXVA 4FYUA 1ILOA 3A5WA 2ZUPA 1T8EB 2LUSA 5AGYA 1TRWA 3PINA 3GL5A 3DRNA 2YP6A 2PGTA 2ZCTA 1XOAA 3GX0A 4MF6A 3LEFA 4LMVA 1KEBA 2EIOA 3GH6A 1AAZA 4JU5A 3TJFA 2GLRA 3ISOA 3HVSA 2YWOA 5IM9A 3TKSA 5ECNB 1MDIA 3F8UA 4TN8A 4XTSA 2L59A 2IN3A 2AB6A 1TI1A 2H6XA 3ERWA 1HNBA 1AC1A 2VLVA 4KDXA 2VM2A 1SL2B 3IAM2 1T4YA 4HUAA 5JWOB 2R3XA 2PVQA 2C0DA 3NIVA 4TR4A 3M9KA 1M9AA 2H1DA 1XFLA 2FUG2 2YJHA 4GWRA 2WS2A 3GYKA 4JE1A 2L6DA 1X5EA 3J7Yb 3IOSA 2H0IA 1FB0A 2GT6A 3C8EA 1T00A 4YH2A 1A0FA 1VF1A 1MD4A 3HD5A 3GKNA 4HDEA 3CYNA 4KW6A 2NPBA 2E2MA 4WF4A 2EIQA 2JZTA 1T4ZA 2FGXA 1SL0B 5D9VA 5DAKA 1T1VA 4RI6A 5ELAA 1M2BA 3ZZXA 4HI7A 1MDKA 1EV4A 2MMAA 4JEDA 2CT6A 3HJPA 4PQ1A 1WOUA 1GSUA 1SK2A 1NSWA 4JR4A 1OYJA 2BJXA 2C0FA 2DJ2A 2DMMA 2HYXA 2R2JA 3FEUA 5ECQB 5L71A 2J23A 5DAKB 1AUCA 1V98A 20GSA 4BWSA 4ULXA 2FWFA 2P5QA 4J57E 1OC9B 1V58A 2N5FA 3IPZA 4E8HA 1PL2A 3EVIA 5E4WA 2OE0A 3IR4A 3E9JB 2VCWA 2I81A 1ZGNA 1XW5A 4K0GA 2IWTA 1R26A 2X99A 3CTGA 3ZITA 3C71A 2LV3A 2JSZA 1OE8A 1M99A 2OKAA 5GSTA 2NBSA 5DQYA 1EOGA 1U3AA 3IRAA 1A2JA 4OO4A 1YEXA 2ALBA 1EOHA 2LSTA 3HKRA 1ABAA 4BL7A 4XS1A 2P31A 2K9FA 3C1RA 4ZL8A 1XCCA 4MPFA 5D9WA 2LJKA 3QAGA 2M72A 2CAQA 1XBSA 3RPPA 4YAPA 2LJAA 4NWYA 3TRXA 4ZB8A 2I1UA 4PQHA 1EEJA 4HQSA 3LYKA 2OBKA 4I8BA 2FCHA 4EUYA 4P3YB 3CSHA 1SKSB 4ECIA 1M2AA 2GZPA 4TXOA 3F3RA 2VM1A 4EDYA 2GSRA 3BBYA 2LNSA 3FRCA 3FR6A 4MK3A 2VD0A 5H5SA 1AQXA 1VF3A 3ZRDA 2X8HA 1B9YC 3LYPA 4IKHA 5A4UA 2RM6A 5LCZA 2VO4A 3APQA 1UVZA 3LXTA 3H8QA 1FOVA 4K2DA 4J2FA 2IIYA 1YEPA 3U5RE 4BPYA 3FR3A 1ZOFA 3IK9A 4JR6A 5IMCA 3VI5A 4KUNA 4IBPA 4FH8A 1GTIA 2CV4A 1EZKA 2IL3A 2C80A 4EDZA 1HNAA 2LNTA 3KTBA 3HHVA 3GKKA 5ECRB 1U87A 2JZRA 1S3AA 1ON4A 1XOBA 1BQ7A 5D9XA 1G7EA 4GXZA 2YZHA 4OMVA 1F6MC 3FZ4A 1PSQA 1HQOA 4MA9A 1CQHA 4KB3A 3L9VA 3VWUA 1TU7A 4OWYA 3GSTA 5AIVA 3CSJA 1YJ6A 3E0UA 1OVNA 3ZREA 2E7PA 4LL1B 3M9JA 2YNXA 5CAXA 5IPHA 4BVYA 1QXHA 3C1SA 10GSA 1XWCA 1K0OA 1ZMAA 5IIZA 3HVVA 5DALA 4EKZA 3D0ZA 5C04A 1RK4A 1UC7A 1URMA 4XHMA 3D22A 5HR3A 3EYTA 4PNGA 5JCUA 1V57A 3FKFA 3EMPA 1PKZA 2C3QA 2V2GA 3WD6A 1FB6A 3D21A 1Z7PA 2IPAA 6GSVA 1H75A 4TW5A 3EC3A 3P90A 3DKSA 3US3A 3EINA 5D73A 2GTUA 2WULA 4DEJA 4MDCA 4NHWA 2GZYA 5DALB 1GL8A 4AJ7A 4HS1A 1JZDA 3K8NA 2FWHA 2FWEA 1VRSD 4MH2A 5JCGA 1B48A 3KCMA 5DCHA 5F06A 1PX6A 1EV9A 1K0MA 2XPEA 3LFLA 3UEMA 1QK8A 2ZNMA 4WKWA 2KOKA 2TRXA 4PURA 3Q6OA 2WZ9A 3DVWA 3TOUA 3H1NA 4NV2A 4D73B 4OCFA 3QFAC 1SKWB 1GSDA 4G9HA 1XWGA 1UN2A 3GNJA 4V2LA 12GSA 1EGOA 2C3TA 1JHBA 3UARA 2VL2A 3PR8A 1O73A 2GQKA 3TKRA 4IELA 5G2ZA 4ECCA 2EC4A 4OFNA 3M0FA 2YOIA 1ERVA 2YCDA 3Q18A 1JZOA 2VCVA 4BA7A 2DJKA 1GULA 2GS3A 3ME7A 4Q5NA 3MWHA 2K18A 5CO3A 3M8NA 2FHEA 5F07A 3O6TA 5DJMA 3BCKA 3ZIJA 2B1KA 1USBA 1IYHA 2IMIA 3GKXA 1XPVA 1BJXA 3TKSC 4AF2A 3DMLA 3L4NA 3QD9A 2B5EA 1ML6A 4GSSA 5H5RA 3GKMA 4IJIA 5J9BA 1K3LA 1ERWA 4ZILA 1H4OA 2BTOT 2CQ9A 1TW9A 2GQLA 4Z7XA 2KP2A 2YWMA 2LTKA 3KJYA 4AGSA 4XCSA 2YWIA 2V6KA 1TRVA 3QPMA 4HEA2 4G19A 3TGZA 2B6MA 3M1GA 3FK8A 2A2RA 1I5GA 2FLSA 2VL9A 4V1Ap 2VLTA 4KAEA 4NV5A 2IMKA 1Z3EA 4MJEA 5FHIA 2D2ZA 4MMMA 1O81A 1JFUA 3KMOA 1O8WA 2WB9A 2H70A 3RHCA 4LA1A 4MABA 4LLRA 2GSSA 1SL1B 3GHAA 1TTZA 5G1LA 1YF0A 1SJZA 4N10A 6GSTA 1XVQA 2DJJA 2HZFA 2V41A 4HJ2A 3H4KA 3FZ5A 3LORA 3KZQA 4N0VA 4WETA 1XWAA 1OKTA 1K0NA 5IO0A 1KBNA 4MF5A 5CRDA 1BAYA 1T3BA 4YQVA 2VAFA 3BD2A 3HZ4A 3HJOA 5COHA 3OR5A 1F9MA 3DXBA 1VF2A 4MJAA 2VL3A 1OC8A 2QSIA 2MYGA 3TRQA 4AJ8A 1NM3A 3H93A 2GZZA 1EWXA 1BG5A 1W4VA 2N5AA 3VWVA 4RUVA 1M9BA 4IP6A 4IS0A 1XW9A 2FA8A 3KXOA 1TOFA 5D93A 1IYIA 1F3AA 2L5OA 3TKPA 1NW2A 5ENUA 1B9XC 2C8UA 1GTAA 2PMTA 4KSOA 3I9V2 4ECBA 3CRTA 3G7YA 4XRAA 4EO3A 2CVDA 1WMJA 3UBLA 1K0CA 1TP9A 3GUSA 3LSZA 2LRTA 3FW2A 2PUKC 2GSTA 5CREA 3Q19A 5INYA 4MJCA 2AAWA 2C3NA 2TIRA 3F0IA 2AJQB 2F51A 4K8MA 1TRSA 1A24A 2MMOA 4HZ2A 1G0TA 2L4CA 1KNGA 1TK8B 3IHQA 22GSA 1GUMA 3UVTA 3S9FA 1F2EA 4BVXA 4ZL7A 2H1GA 2IJYA 3VPTA 14GSA 1TK5B 1OC9A 4OCEA 3TB2A 5G1KA 2MMNA 2HNLA 2HSHA 1C72A 1X0RA 4WR4A 4X1UA 2LRNA 3N5OA 3FZ9A 2JACA 3NOFA 3C73A 5LNKe 3TJKA 2OJLA 1Y6EA 1THXA 2DJ0A 2JU5A 2VD1A 1F3BA 2QC7A 1PD21 5ECKB 4J56E 2YZUA 3CSIA 4WBJA 4TR3A 6GSWA 4L0UA 3O76A 3QAWA 3GH9A 3WGDA 5B6MA 2YN1A 3FYGA 2O7KA 4G2EA 1J0FA 2RIIA 5EPFA 1PA3A 3I6AA 4HQZA 2C0EA 1XW6A 3LXZA 4I2UA 4AJ6A 2PN8A 5G5FA 2Z9SA 5J5NA 3RDWA 2B3SA 1SJ6A 1GWCA 2X8CA 5AISA 3KEBA 3VLNA 18GSA 1BYEA 1Z5YE 5G31A 1YZXA 2P5RA 4K0NA 3VURA 4RQRA 3IBHA 6GSYA 1X9WB 4ZL9A 4EVMA 2IFQB 3ZFBA 1PQNA 4TVEA 3L9SA 1R7HA 3QAVA 4IN0A 2PPTA 4KNDA 3TJGA 2WJUA 3ED3A 1XWBA 4PX1A 3ZIVA 5ECIB 1QFNA 4BWQA 3ME8A 1N8JA 3F4RA 5IMAA 1A8YA 4ZXGA 5ID2B 2PVOC 1YF1A 4F82A 3EURA 5A4WA 2H75A 1THOA 4KSMA 1ERUA 2H0HA 4PXOA 3HCZA 2OA7A 1G6YA 3EE2A 6GSSA 4TKYA 2DBCA 4IHUA 2HLSA 1X9SB 4CDOA 2I4AA 5LD0A 1HNCA 3ERGA 2HE3A 3G7IA 3EU4A 2WDUA 1Y25A 5ECPB 5GSSA 4XIHA 2K6VA 3F6DA 4KE3A 1AW9A 3MAKA 5IMVA 4GCIA 4G10A 5IPGA 3ZL5A 3A3TA 1M0UA 5CP1A 4F0BA 4O92A 3HXSA 2VCZA 2O87A 4I5QA 4Q5FA 3CXGA 2DMLA 3DYRA 3KD0A 2NVLA 2PWJA 3DD3A 1NHOA 4QL9A 1MD3A 4EL1A 2B7JA 1OE7A 2VL2C 1X5CA 4HJMA 5ECHB 4ZBBA 1QUWA 2NDOA 1ZYQB 2XBQA 2XC2A 3HA9A 4NAXA 3APSA 3RBTA 4POLA 2OADA 1WRYA 3F4TA 2HI7A 4L8EA 4LMWA 2H73A 2IMDA 2C0GA 17GSA 2F8FA 1CQGA 4ZBDA 5EVOA 5IMDA 1DE1A 2MMZA 4TRXA 3IAS2 3FHKA 3A2XA 5KEJA 4FYCA 2RM5A 2LQQA 5ECLB 1J08A 1DSBA 4F03A 1FO5A 2AYTA 4D73A 3BOAA 4YQMA 2HRFA 1A2LA 1PL1A 1TRUA 2DJ3A 4PGTA 2DJ1A 2FD3A 2LJRA 3GURA 1MDJA 1G7OA 4GQFA 2AHEA 1Z7RA 3KP8A 4TR1B 2KP1A 4IP1A 1WWJA 2WFCA 2B5YA 2O8VB 5D8IA 5EY6A 1TXXA 2LRCA 1SD8A 4ZB6A 3CRUA 2B5XA 4CW9A 4K7IA 4WXTA 1JLVA 1EGRA 3HVXA 1GLPA 5J9CA 4L5OA 4JZQA 3L78A 1GTBA 3M3MA 3LJRA 1A0RP 3ZMKA 4K6XA 2H1AA 4DSQA 4X43A 3MNGA 4MZWA 3TDGA 4H86A 2P0GA 1V2AA 4KH7A 1TK0B 1FG4A 4WR5A 2JZSA 2V32A 3DEXA 2JL4A 2CVBA 2X64A 2VCTA 1WIKA 2L5LA 5JWQB 5DCGA 2HSYA 4PUFC 4I2TA 2K8SA 3QMXA 2REMA 4MF7A 2ES7A 5DDLA 3F63A 3W6GA 2CZ2A 2GVPA 4QL7A 5GAND 2WGRA 4ZIJA 1SENA 19GSA 3C7MA 3W8JA 2G2QA 2A2SA 4LL4B 5JWRB 5H5QA 5B7CA 1GSQA 3F9UA 3VFIA 2C1YA 4YAVA 5F0GA 3VI7A 1SK0A 5DQSA 2WCIA 2H76A 1J9BA 2VLUA 4ZB9A 1G6WA 1E2YA 4FO5A 2N5BA 4IVFA 1ST9A 4POKA 4OFTA 1GNEA 4KGIA 2H71A 2R37A 1TDIA 5CRHA 4ID0A 3GTUB 2YV7A 2F8AA 3R2QA 2AV4A 2YV9A 1GSYA 4MP4A 2H01A 1K0DA 2YJ7A 3IE3A 4IJ3A 4DSSB 4KCEA 4V2NA 2HZEB 4HOJA 3A2VA 4F9ZA 6GSUA 5CRGA 3BJ5A 2YWNA 3UVHA 3LGCA 6GSXA 2IMFA 7GSSA 1GUHA 4TOPA 5CRWA 2VIMA 3J7Yk 3GA4A 2OE1A 1FVJA 3MSZA 1B4QA 1E6BA 1TI3A 2X8GA 3GV1A 5G5EA 3ZMLA 1I9DA 1F37A 4POMA 1EP8A 3P8WA 3TJBA 4HU9A 2DSAA 1ZL9A 1FAAA 2ON7A 4WF5A 4XS4A 1S3DA 2R4VA 1XVWA 1K3YA 1U88A 3WYWA 4GF0A 4N30A 3KH7A 1ZCPA 3EMXA 1FVKA 9GSSA 1ACVA 4HZ4A 3DIEA 4ISDA 1AIUA 3ZTLA 1O8XA 1MEKA 3DGQA 2F9SA 2I9HA 4ECJA 1GSFA 4XS4B 1GSEA 2MBTA 2H66A 2VCXA 1RQMA 4GTUA 1YQ1A 3WT2A 4ML6A 5HFIA 3SBCA 3KTLA 4CHSA 3IV4A 1A23A 2WRTA 3H79A 5HR2A 1B8XA 2R6KA 1BEDA 2OE3A 4I6XA 3PH9A 3KP9A 4Q5QA 5A5KA 1B4PA 3ZVJA 3KM6A 1WJKA 2GDRA 2CX4A 1R5PA 2NTOA 1QQ2A 2DC5A 2FY6A 4JBBA 5D96A 5A4VA 3I69A 2J9HA 2H72A 4YQUA 3HYPA 3ZYWA 3RHBA 5GAPD 3HZ8A 4PNFA 3UL3A 3D5JA 4EF0A 3F3QA 1JZWA 3V1WA 1A2MA 3BCIA 3ERFA 2M80A 3E3EA 1PRXA 2HRNA 2QKEA 2AUVA 1ZYEA 1GUKA 3KGKA 5ECMB 1XZOA 3GL3A 1Q4JA 3KMNA 4F0CA 1GNWA 3TUEA 1TU8A 4K7OA 1HD2A 4EXJA 2F3MA 5HQPA 3EU3A 5J4UA 2CVKA 3WGXA 3APOA 3GRXA 3P2AA 1SKRB 3HDCA 4EC0A 1NHYA 1BX9A 13GSA 3FZAA 5C00A 5HR1A 1OAZA 2LEGA 3LWAA 2IFQA 4GRFA 1MTCA 4RI7A 4V1Ag 3QOUA 4MZCA 4HU7A 2V1MA 1XXUA 2E2GA 2H1BA 1VF4A 2RUEA 3CBUA 4ZBAA 2RUFA 2H6ZA 3WGEA 2H6YA 2C4JA 5ID2A 1JZRA 5B8BA 1X5DA 2VOCA 3IA1A 2L4QA 1GLQA 1RW1A 3UMAA 3TKSE 1WPIA 1PMTA 5D9TA 1LU4A 4L0WA 5IOWA 2KHPA 3TKQA 1TKDB 2CX3A 4FIWA 2TRCP 1S3CA 2M46A 4O32A 5ELGA 2H19A 1XWKA 1GSSA 1M7TA 4NMUA 5ABRA 5AIXA 2HFDA 4GSTA 2PERA 5HFKA 3RAZA 4MJBA 1SJIA 3UBKA 1DE2A 4TR0A 1Z6MA 2DLXA
chains in the Genus database with same CATH superfamily
1K0AA 3PGTA 2LS5A 4MCUA 1Z9HA 5F05A 3L0HA 1Q98A 1N2AA 1U3IA 2L57A 4WEYA 4KX4A 4XS6A 2FWGA 3D4MA 1A8LA 2IMEA 4OO5A 1FHEA 1AXDA 1PX7A 4RQXA 5HFGA 4IW9A 3L9UA 3N9JA 4MH3A 1EP7A 5IMFA 4K7NA 4K9ZA 3TRPA 2O89A 4TXOB 1V40A 2FNOA 4OFMA 3IC4A 5KN2A 1GTUA 4Q5RA 5KN0A 2FA4A 2O85A 5AN1A 4F2IA 2BMXA 1K3OA 4K2XA 3HJMA 1W89A 2QGVA 2GSQA 2PBJA 2XBIA 4KDUA 1OC3A 5IOXA 3VPQA 4K1FA 4NHZA 1R5AA 4IQAA 3GIXA 1YKCA 3IXRA 2R5GA 3ZFLA 1AQWA 5BRTA 3F6FA 4N11A 3ZLPA 4IGJA 1S3RA 4KCAA 3IDVA 1DUGA 2CZ3A 1LBKA 2VCQA 2VUPA 3VK9A 4FYBA 5KN3A 4O7HA 5G30A 3TOTA 4OD7A 3QFBC 4GSNA 4DVCA 3UJ1A 4EE0A 2V6OA 5FT3A 5JCWA 3AY8A 2I3YA 2YANA 4GLTA 4NPBA 1PN9A 3CTFA 2XPDA 3VWXA 1WP0A 1M2DA 4X0XA 3IK7A 3P7XA 4TR1A 1SD9A 5ECSA 4DSRA 2MZCA 4JRRA 2OACA 2DIYA 1GRXA 3CMIA 1JLWA 2XHFA 5DVBA 2PU9C 5HR0A 1DBYA 2HXKA 3GSSA 2KUCA 3F4SA 4BVYB 2A4VA 4PUAA 2DIZA 2GGTA 3UAPA 1SK1A 4ICYA 2B7KA 5IO2A 2EIRA 1V9WA 3QCPA 2HT9A 1K0BA 4GQCA 5GZZB 1HYUA 3A2WA 3UOMA 2MBSA 2GQMA 3MDKA 2H0GA 4KA0A 2K8VA 3G7JA 5CNWA 1VGLA 1YDKA 1PKWA 3GFKA 3LQ7A 1XIYA 4L5LA 2YPMA 4N0ZA 5KN1A 1WE0A 3DWVA 3QDNA 1FW1A 3GMFA 1Z6NA 2CAIA 2KLXA 2RLIA 2CA8A 5DBQA 3DVXA 3GN3A 2H30A 1AQVA 4KDYA 4MLYA 1O85A 2G0FA 3Q74A 4G0LA 1YY7A 4E8EA 2H8LA 3WT1A 11GSA 3UIWA 4IQ1A 5EL8A 16GSA 2GT5A 3A5IA 2HRAA 3O3TA 5B6NA 2E0QA 1SU9A 4YKFA 5IMZA 2H74A 1O7UA 5B8AA 3SWLA 1SYRA 5J41A 5IQYA 4POBA 3U6VA 1X9MB 3I43A 1UA5A 3KIJA 2B1LA 2LKUA 3KH9A 1GH2A 8GSSA 3GTUA 3VWWA 4V2MA 4MZBA 4O5RA 2JADA 4NXIA 5KOXA 1SYXA 5E59A 5J3RA 1QMVA 3QR6A 4MPGA 3RPNA 4ACSA 1KTEA 4DSSA 3GX8A 5F8BA 1O6JA 1U6TA 1YKAA 2HZEA 4ILFA 2OBIA 1QGVA 5ECOB 3ZVJD 1TJDA 3D6IA 3G9BA 1PGTA 1R4WA 5DJLA 1LJRA 2JSYA 3FR9A 3LG6A 4XRDA 3NZNA 3EWLA 1ERTA 4PQIA 1OKDA 5FWGA 2LQOA 4I97A 3TJJA 3W8SA 3FY7A 4ML1A 4WBRD 3HY2A 3JCML 2L6CA 2ON5A 1EEMA 1T7PB 3D4TA 5CYYA 3TCOA 1ZZYA 1GP1A 2DKIA 4QQ7A 4TXVA 4FYUA 1ILOA 3A5WA 2ZUPA 1T8EB 2LUSA 5AGYA 1TRWA 3PINA 3GL5A 3DRNA 2YP6A 2PGTA 2ZCTA 1XOAA 4HSCX 3GX0A 4MF6A 3LEFA 4LMVA 1KEBA 2EIOA 3GH6A 1AAZA 4JU5A 3TJFA 2GLRA 3ISOA 2QA1A 3HVSA 2YWOA 5IM9A 3TKSA 5ECNB 1MDIA 3F8UA 4TN8A 4XTSA 2L59A 2IN3A 2AB6A 1TI1A 2H6XA 3ERWA 1HNBA 1AC1A 2VLVA 4KDXA 2VM2A 1SL2B 3IAM2 1T4YA 4HUAA 5JWOB 2R3XA 2PVQA 2C0DA 3NIVA 3LW9A 4TR4A 3M9KA 3IHGA 1M9AA 2H1DA 1XFLA 2FUG2 2YJHA 4GWRA 2WS2A 3GYKA 4JE1A 2L6DA 1X5EA 3J7Yb 3IOSA 2H0IA 1FB0A 2GT6A 3C8EA 1T00A 4YH2A 1A0FA 1VF1A 1MD4A 3HD5A 3GKNA 4HDEA 3CYNA 4KW6A 2NPBA 2A2PA 2E2MA 4WF4A 2EIQA 2JZTA 1T4ZA 2FGXA 1SL0B 5D9VA 5DAKA 1T1VA 4RI6A 5ELAA 1M2BA 4X4JA 3ZZXA 4HI7A 1MDKA 1EV4A 2MMAA 4JEDA 2CT6A 3HJPA 4PQ1A 1WOUA 2A4HA 1GSUA 1SK2A 1NSWA 4JR4A 1OYJA 2BJXA 2C0FA 2DJ2A 5BMUA 2DMMA 2HYXA 2R2JA 3FEUA 5ECQB 5L71A 2J23A 5DAKB 4BIKA 1AUCA 1V98A 4BVXB 20GSA 4BWSA 4ULXA 2FWFA 2P5QA 4J57E 1OC9B 1V58A 2N5FA 3IPZA 4E8HA 1PL2A 3EVIA 5E4WA 2OE0A 3IR4A 3E9JB 2VCWA 2I81A 1ZGNA 2R0CA 1XW5A 4K0GA 2IWTA 1R26A 2X99A 3CTGA 3ZITA 3C71A 2LV3A 2JSZA 3FMWA 1OE8A 1M99A 2OKAA 5GSTA 2NBSA 3HVNA 5DQYA 1EOGA 1U3AA 3IRAA 1A2JA 4OO4A 1YEXA 2ALBA 1EOHA 2LSTA 3HKRA 1ABAA 4BL7A 4XS1A 2P31A 2K9FA 3C1RA 4ZL8A 1XCCA 4MPFA 5D9WA 2LJKA 3QAGA 2M72A 2CAQA 1XBSA 3RPPA 4YAPA 2LJAA 4NWYA 3TRXA 4ZB8A 2I1UA 4PQHA 1EEJA 4HQSA 3LYKA 2OBKA 4I8BA 2FCHA 4BL7B 4EUYA 4P3YB 3CSHA 1SKSB 4ECIA 1M2AA 2GZPA 4TXOA 3F3RA 2VM1A 4EDYA 2GSRA 3BBYA 2LNSA 3FRCA 3FR6A 4MK3A 2VD0A 5H5SA 1AQXA 1VF3A 3ZRDA 2X8HA 1B9YC 3LYPA 4IKHA 5A4UA 2RM6A 5LCZA 2VO4A 3APQA 1UVZA 3LXTA 3H8QA 4PTSA 1FOVA 4K2DA 4J2FA 2IIYA 1YEPA 3U5RE 4BPYA 3FR3A 1ZOFA 3IK9A 4JR6A 5IMCA 3VI5A 4KUNA 4IBPA 4FH8A 1GTIA 2CV4A 1EZKA 2IL3A 2C80A 4EDZA 1HNAA 2LNTA 3CQFA 3KTBA 3HHVA 2HSMA 3GKKA 5ECRB 2QA2A 1U87A 2JZRA 2R0GA 1S3AA 1ON4A 1XOBA 1BQ7A 5D9XA 1G7EA 4GXZA 2YZHA 4OMVA 1F6MC 3FZ4A 1PSQA 1HQOA 4MA9A 1CQHA 4KB3A 3L9VA 3VWUA 1TU7A 4OWYA 3GSTA 5AIVA 3CSJA 1YJ6A 3E0UA 1OVNA 3ZREA 2E7PA 4LL1B 3M9JA 2YNXA 5CAXA 5IPHA 4BVYA 1QXHA 3C1SA 10GSA 1XWCA 4Z2UA 1K0OA 1ZMAA 5IIZA 3HVVA 5DALA 4G0KA 4EKZA 3D0ZA 5C04A 1RK4A 1UC7A 1URMA 4XHMA 3D22A 5HR3A 3EYTA 4PNGA 5JCUA 1V57A 3FKFA 3EMPA 1PKZA 2C3QA 2V2GA 3WD6A 1FB6A 3D21A 1Z7PA 2IPAA 6GSVA 1H75A 4TW5A 3EC3A 3P90A 3DKSA 3US3A 3EINA 5D73A 2GTUA 2WULA 4DEJA 4MDCA 4NHWA 2GZYA 5DALB 1GL8A 4AJ7A 4HS1A 1JZDA 3K8NA 2FWHA 2FWEA 1VRSD 4MH2A 5JCGA 1B48A 3KCMA 5DCHA 5F06A 1PX6A 1EV9A 1K0MA 2XPEA 3LFLA 3UEMA 1QK8A 2ZNMA 4WKWA 2KOKA 2TRXA 4PURA 3Q6OA 2WZ9A 3DVWA 3TOUA 2HRKA 3H1NA 4NV2A 4D73B 4OCFA 3QFAC 1SKWB 1GSDA 4G9HA 1XWGA 1UN2A 3GNJA 3IC8A 12GSA 4V2LA 1EGOA 2C3TA 1JHBA 3UARA 2VL2A 3PR8A 1O73A 2GQKA 3TKRA 4IELA 5G2ZA 4ECCA 2EC4A 4OFNA 3M0FA 2YOIA 1ERVA 2YCDA 3Q18A 1JZOA 2VCVA 4BA7A 4KF9A 2DJKA 1GULA 2GS3A 3ME7A 4Q5NA 3MWHA 2K18A 5CO3A 3M8NA 2FHEA 5F07A 3O6TA 5DJMA 3BCKA 3ZIJA 2B1KA 1USBA 1IYHA 2IMIA 3GKXA 1XPVA 1BJXA 3TKSC 4AF2A 3MYDA 3DMLA 3L4NA 3QD9A 2B5EA 1ML6A 4GSSA 5H5RA 4FQUA 3GKMA 4IJIA 4K5SA 1K3LA 5J9BA 1ERWA 4ZILA 1H4OA 2BTOT 2CQ9A 1TW9A 2GQLA 4Z7XA 2KP2A 2YWMA 2LTKA 3KJYA 4AGSA 4XCSA 2YWIA 2V6KA 1TRVA 3QPMA 4HEA2 4G19A 4EIPA 3TGZA 2B6MA 3M1GA 3FK8A 2A2RA 1I5GA 2FLSA 2VL9A 4V1Ap 2UZ8A 2VLTA 4KAEA 4NV5A 2IMKA 1Z3EA 4MJEA 5FHIA 2D2ZA 4MMMA 1O81A 1JFUA 3KMOA 1O8WA 2WB9A 2H70A 3RHCA 4LA1A 4MABA 4LLRA 2GSSA 1SL1B 3GHAA 1TTZA 5G1LA 1YF0A 1SJZA 4N10A 6GSTA 1XVQA 2DJJA 2HZFA 2V41A 4HJ2A 3H4KA 3FZ5A 3LORA 3KZQA 4N0VA 4WETA 1XWAA 1OKTA 1K0NA 5IO0A 1KBNA 1PFOA 4MF5A 5CRDA 4O5QA 1BAYA 1T3BA 4YQVA 2VAFA 3BD2A 3HZ4A 5KOWA 3HJOA 5COHA 3OR5A 1F9MA 3DXBA 1VF2A 4MJAA 2VL3A 1OC8A 2DKHA 2QSIA 2MYGA 3TRQA 4AJ8A 1NM3A 3H93A 2GZZA 1EWXA 1BG5A 1W4VA 2N5AA 3VWVA 4RUVA 1M9BA 4IP6A 4IS0A 1XW9A 2FA8A 3KXOA 1TOFA 5D93A 1IYIA 1F3AA 2L5OA 3TKPA 1NW2A 5ENUA 1B9XC 2C8UA 1GTAA 2PMTA 4KSOA 3I9V2 4ECBA 3CRTA 3G7YA 4XRAA 4EO3A 2CVDA 1WMJA 3UBLA 1K0CA 1TP9A 3GUSA 3LSZA 2LRTA 3FW2A 2PUKC 2GSTA 5CREA 3Q19A 5INYA 4MJCA 2AAWA 2C3NA 2TIRA 3F0IA 2AJQB 2F51A 4K8MA 2X4AA 1TRSA 1A24A 2MMOA 4HZ2A 1G0TA 2L4CA 1KNGA 1TK8B 3IHQA 22GSA 1GUMA 3UVTA 3S9FA 1F2EA 4BVXA 4ZL7A 2H1GA 2IJYA 3VPTA 14GSA 1TK5B 1OC9A 4OCEA 3TB2A 5G1KA 2MMNA 2HNLA 2HSHA 1C72A 1X0RA 4WR4A 4X1UA 2LRNA 3N5OA 1FOHA 3FZ9A 2JACA 3NOFA 3C73A 5LNKe 3TJKA 2OJLA 1Y6EA 1THXA 2DJ0A 2JU5A 2VD1A 1F3BA 2QC7A 1PD21 5ECKB 4J56E 2YZUA 3CSIA 4WBJA 4TR3A 2X49A 6GSWA 4L0UA 3O76A 3QAWA 3GH9A 3WGDA 5B6MA 2YN1A 3FYGA 2O7KA 4G2EA 1J0FA 2RIIA 5EPFA 1PA3A 3I6AA 4HQZA 2C0EA 1XW6A 3LXZA 4I2UA 4AJ6A 2PN8A 5G5FA 2Z9SA 5J5NA 3RDWA 2B3SA 1SJ6A 1GWCA 2X8CA 3KEBA 5AISA 3VLNA 18GSA 1BYEA 1Z5YE 5G31A 1YZXA 2P5RA 4K0NA 3VURA 4RQRA 3IBHA 6GSYA 1X9WB 4ZL9A 4EVMA 2IFQB 3ZFBA 1PQNA 4TVEA 3L9SA 1R7HA 3QAVA 4Z2TA 4IN0A 2PPTA 4KNDA 3TJGA 2WJUA 3ED3A 1XWBA 4PX1A 3ZIVA 5ECIB 1QFNA 4BWQA 3ME8A 1N8JA 3F4RA 5IMAA 1A8YA 4ZXGA 5ID2B 2PVOC 1YF1A 4F82A 3EURA 5A4WA 2H75A 1THOA 4KSMA 1ERUA 2H0HA 4PXOA 3HCZA 2OA7A 1G6YA 3EE2A 6GSSA 4TKYA 2DBCA 4IHUA 2HLSA 1X9SB 4CDOA 4K5RA 2I4AA 5LD0A 1HNCA 3ERGA 2HE3A 3G7IA 3EU4A 2WDUA 1Y25A 5ECPB 5GSSA 4XIHA 2K6VA 3F6DA 4KE3A 1AW9A 3MAKA 5IMVA 4GCIA 4G10A 5IPGA 3ZL5A 3A3TA 1M0UA 5CP1A 4F0BA 4O92A 3HXSA 2VCZA 2O87A 4I5QA 4Q5FA 3CXGA 2DMLA 3DYRA 3KD0A 2NVLA 2PWJA 3DD3A 1NHOA 4QL9A 1MD3A 4EL1A 2B7JA 1OE7A 4G0IA 2VL2C 1X5CA 4HJMA 5ECHB 4ZBBA 1QUWA 2NDOA 1ZYQB 2XBQA 2XC2A 3HA9A 4NAXA 3APSA 3PPUA 3RBTA 4POLA 2OADA 1WRYA 3F4TA 2HI7A 4L8EA 4LMWA 2H73A 2IMDA 2C0GA 17GSA 2F8FA 1CQGA 4ZBDA 5EVOA 4O5UA 5IMDA 1DE1A 2MMZA 4TRXA 3IAS2 3FHKA 3A2XA 5KEJA 4FYCA 2RM5A 2LQQA 5ECLB 1J08A 1DSBA 4F03A 1FO5A 2AYTA 4D73A 3BOAA 4YQMA 2HRFA 1A2LA 1PL1A 1TRUA 2DJ3A 4PGTA 2DJ1A 2FD3A 2LJRA 3GURA 1MDJA 1G7OA 4GQFA 2AHEA 1Z7RA 3KP8A 4TR1B 2KP1A 4A5PA 4IP1A 1WWJA 2WFCA 2B5YA 2O8VB 5D8IA 5EY6A 1TXXA 2LRCA 1SD8A 4ZB6A 3R3EA 3CRUA 2B5XA 4CW9A 4K7IA 4WXTA 1JLVA 4YKGA 1EGRA 3HVXA 1GLPA 5J9CA 4L5OA 4JZQA 3L78A 1GTBA 3M3MA 3LJRA 1A0RP 3ZMKA 4K6XA 2H1AA 4DSQA 4X43A 3MNGA 4MZWA 3TDGA 4H86A 2P0GA 1V2AA 4KH7A 1TK0B 1FG4A 4WR5A 2JZSA 2V32A 3DEXA 2JL4A 2CVBA 2X64A 2VCTA 1WIKA 2L5LA 5JWQB 5DCGA 2HSYA 4PUFC 4I2TA 2K8SA 3QMXA 2REMA 4MF7A 2ES7A 5DDLA 3F63A 3W6GA 2CZ2A 2GVPA 4QL7A 5GAND 2WGRA 4ZIJA 1SENA 19GSA 3C7MA 3W8JA 2G2QA 2A2SA 4LL4B 5JWRB 5H5QA 5B7CA 1GSQA 3F9UA 3VFIA 2C1YA 4YAVA 5F0GA 3VI7A 1SK0A 5DQSA 2WCIA 2H76A 1J9BA 2VLUA 4ZB9A 1G6WA 1E2YA 4FO5A 2N5BA 4IVFA 1ZYNA 1ST9A 4POKA 4OFTA 1GNEA 4KGIA 2H71A 2R37A 1TDIA 5CRHA 4ID0A 3GTUB 2YV7A 2F8AA 3R2QA 2AV4A 2YV9A 1GSYA 4MP4A 2H01A 1K0DA 2YJ7A 3IE3A 1PN0A 4IJ3A 4DSSB 4KCEA 4V2NA 2HZEB 4HOJA 3A2VA 4F9ZA 6GSUA 5CRGA 3BJ5A 2YWNA 3UVHA 3LGCA 6GSXA 2IMFA 7GSSA 1GUHA 4TOPA 5CRWA 2VIMA 3J7Yk 4EIQA 3GA4A 2OE1A 1FVJA 3MSZA 1B4QA 1E6BA 1TI3A 2X8GA 3GV1A 5G5EA 3ZMLA 1I9DA 1F37A 4POMA 1EP8A 4CY6A 3P8WA 3TJBA 4MNNA 3EPTA 4HU9A 2DSAA 1ZL9A 1FAAA 2ON7A 4WF5A 4XS4A 3MIXA 1S3DA 1ZYPA 2R4VA 1XVWA 1K3YA 1U88A 3WYWA 4GF0A 4N30A 3KH7A 1ZCPA 3EMXA 1FVKA 9GSSA 1ACVA 4HZ4A 3DIEA 4ISDA 1AIUA 3ZTLA 1O8XA 1MEKA 3DGQA 2F9SA 2I9HA 4ECJA 1GSFA 4XS4B 1GSEA 2MBTA 2H66A 2VCXA 1RQMA 4GTUA 1YQ1A 3WT2A 4ML6A 5HFIA 3SBCA 3KTLA 4CHSA 3IV4A 1A23A 2WRTA 3H79A 5HR2A 1B8XA 2R6KA 1BEDA 2OE3A 4I6XA 3PH9A 3KP9A 4Q5QA 4CY8A 5A5KA 1B4PA 3ZVJA 3KM6A 1WJKA 2GDRA 2CX4A 1R5PA 2NTOA 1QQ2A 2DC5A 2FY6A 4JBBA 5D96A 5A4VA 3I69A 2J9HA 2H72A 4YQUA 3HYPA 3ZYWA 3RHBA 5GAPD 1XG8A 3HZ8A 4PNFA 3UL3A 3D5JA 4EF0A 3F3QA 1JZWA 3V1WA 1A2MA 3BCIA 3ERFA 2M80A 3E3EA 1PRXA 2HRNA 2QKEA 2AUVA 1ZYEA 1GUKA 3KGKA 5ECMB 1XZOA 3GL3A 1Q4JA 3KMNA 4F0CA 4USSA 1GNWA 3TUEA 1TU8A 4K7OA 1HD2A 4EXJA 2F3MA 5HQPA 3EU3A 5J4UA 2CVKA 3WGXA 3APOA 3GRXA 3P2AA 1SKRB 3HDCA 1M3JA 4EC0A 1NHYA 1BX9A 13GSA 3FZAA 5C00A 5HR1A 1OAZA 2LEGA 3LWAA 2IFQA 4GRFA 1MTCA 4RI7A 4V1Ag 3QOUA 4MZCA 4HU7A 2V1MA 1XXUA 2E2GA 2H1BA 1VF4A 2RUEA 3CBUA 4ZBAA 2R0PA 2RUFA 2H6ZA 3WGEA 2H6YA 2C4JA 5ID2A 1JZRA 5B8BA 1X5DA 2VOCA 3IA1A 2L4QA 1GLQA 1RW1A 3UMAA 3TKSE 1WPIA 1PMTA 5D9TA 1LU4A 4L0WA 5IOWA 2KHPA 4Z2RA 3TKQA 1TKDB 2CX3A 4FIWA 2TRCP 1S3CA 2M46A 4O32A 5ELGA 2H19A 1XWKA 1GSSA 1M7TA 4NMUA 5ABRA 1M3IA 5AIXA 2HFDA 4GSTA 2PERA 5HFKA 3RAZA 4MJBA 1SJIA 3UBKA 1DE2A 4TR0A 1Z6MA 2DLXA
chains in the Genus database with same CATH topology
1K0AA 3PGTA 2LS5A 4MCUA 1Z9HA 5F05A 3L0HA 1Q98A 1N2AA 1U3IA 2L57A 4WEYA 4KX4A 4XS6A 2FWGA 3D4MA 1A8LA 2IMEA 4OO5A 1FHEA 1AXDA 1PX7A 4RQXA 5HFGA 4IW9A 3L9UA 3N9JA 4MH3A 1EP7A 5IMFA 4K7NA 4K9ZA 3TRPA 2O89A 4TXOB 1V40A 2FNOA 4OFMA 3IC4A 5KN2A 1GTUA 4Q5RA 5KN0A 2FA4A 2O85A 5AN1A 4F2IA 2BMXA 1K3OA 4K2XA 3HJMA 1W89A 2QGVA 2GSQA 2PBJA 2XBIA 4KDUA 1OC3A 5IOXA 3VPQA 4K1FA 4NHZA 1R5AA 4IQAA 3GIXA 1YKCA 3IXRA 2R5GA 3ZFLA 1AQWA 5BRTA 3F6FA 4N11A 3ZLPA 4IGJA 4KCAA 3IDVA 1DUGA 2CZ3A 1LBKA 2VCQA 2VUPA 3VK9A 4FYBA 5KN3A 4O7HA 5G30A 3TOTA 4OD7A 3QFBC 4GSNA 4DVCA 3UJ1A 4EE0A 2V6OA 5FT3A 5JCWA 3AY8A 2I3YA 2YANA 4GLTA 4NPBA 1PN9A 3CTFA 2XPDA 3VWXA 1WP0A 1M2DA 4X0XA 3IK7A 3P7XA 4TR1A 1SD9A 5ECSA 4DSRA 2MZCA 4JRRA 2OACA 2DIYA 1GRXA 3CMIA 1JLWA 2XHFA 5DVBA 2PU9C 5HR0A 1DBYA 2HXKA 3GSSA 2KUCA 3F4SA 4BVYB 2A4VA 4PUAA 2DIZA 2GGTA 3UAPA 1SK1A 4ICYA 2B7KA 5IO2A 2EIRA 1V9WA 3QCPA 2HT9A 1K0BA 4GQCA 5GZZB 1HYUA 3A2WA 3UOMA 2MBSA 2GQMA 3MDKA 2H0GA 4KA0A 2K8VA 3G7JA 5CNWA 1VGLA 1YDKA 1PKWA 3GFKA 3LQ7A 1XIYA 4L5LA 2YPMA 4N0ZA 5KN1A 1WE0A 3DWVA 3QDNA 1FW1A 3GMFA 1Z6NA 2CAIA 2KLXA 2RLIA 2CA8A 5DBQA 3DVXA 3GN3A 2H30A 1AQVA 4KDYA 4MLYA 1O85A 2G0FA 3Q74A 4G0LA 1YY7A 4E8EA 2H8LA 3WT1A 11GSA 3UIWA 4IQ1A 5EL8A 16GSA 2GT5A 3A5IA 2HRAA 3O3TA 5B6NA 2E0QA 1SU9A 4YKFA 5IMZA 2H74A 1O7UA 5B8AA 3SWLA 1SYRA 5J41A 5IQYA 4POBA 3U6VA 1X9MB 3I43A 1UA5A 3KIJA 2B1LA 2LKUA 3KH9A 1GH2A 8GSSA 3GTUA 3VWWA 4V2MA 4MZBA 4O5RA 2JADA 4NXIA 5KOXA 1SYXA 5E59A 5J3RA 1QMVA 3QR6A 4MPGA 3RPNA 4ACSA 1KTEA 4DSSA 3GX8A 5F8BA 1O6JA 1U6TA 1YKAA 2HZEA 4ILFA 2OBIA 1QGVA 5ECOB 3ZVJD 1TJDA 3D6IA 3G9BA 1PGTA 1R4WA 5DJLA 1LJRA 2JSYA 3FR9A 3LG6A 4XRDA 3NZNA 3EWLA 1ERTA 4PQIA 1OKDA 5FWGA 2LQOA 4I97A 3TJJA 3W8SA 3FY7A 4ML1A 4WBRD 3HY2A 3JCML 2L6CA 2ON5A 1EEMA 1T7PB 3D4TA 5CYYA 3TCOA 1ZZYA 1GP1A 2DKIA 4QQ7A 4TXVA 4FYUA 1ILOA 3A5WA 2ZUPA 1T8EB 2LUSA 5AGYA 1TRWA 3PINA 3GL5A 3DRNA 2YP6A 2PGTA 2ZCTA 1XOAA 3GX0A 4MF6A 3LEFA 4LMVA 1KEBA 2EIOA 3GH6A 1AAZA 4JU5A 3TJFA 2GLRA 3ISOA 2QA1A 3HVSA 2YWOA 5IM9A 3TKSA 5ECNB 1MDIA 3F8UA 4TN8A 4XTSA 2L59A 2IN3A 2AB6A 1TI1A 2H6XA 3ERWA 1HNBA 1AC1A 2VLVA 4KDXA 2VM2A 1SL2B 3IAM2 1T4YA 4HUAA 5JWOB 2R3XA 2PVQA 2C0DA 3NIVA 3LW9A 4TR4A 3M9KA 3IHGA 1M9AA 2H1DA 1XFLA 2FUG2 2YJHA 4GWRA 2WS2A 3GYKA 4JE1A 2L6DA 1X5EA 3J7Yb 3IOSA 2H0IA 1FB0A 2GT6A 3C8EA 1T00A 4YH2A 1A0FA 1VF1A 1MD4A 3HD5A 3GKNA 4HDEA 3CYNA 4KW6A 2NPBA 2A2PA 2E2MA 4WF4A 2EIQA 2JZTA 1T4ZA 2FGXA 1SL0B 5D9VA 5DAKA 1T1VA 4RI6A 5ELAA 1M2BA 4X4JA 3ZZXA 4HI7A 1MDKA 1EV4A 2MMAA 4JEDA 2CT6A 3HJPA 4PQ1A 1WOUA 2A4HA 1GSUA 1SK2A 1NSWA 4JR4A 1OYJA 2BJXA 2C0FA 2DJ2A 5BMUA 2DMMA 2HYXA 2R2JA 3FEUA 5ECQB 5L71A 2J23A 5DAKB 1AUCA 1V98A 4BVXB 20GSA 4BWSA 4ULXA 2FWFA 2P5QA 4J57E 1OC9B 1V58A 2N5FA 3IPZA 4E8HA 1PL2A 3EVIA 5E4WA 2OE0A 3IR4A 3E9JB 2VCWA 2I81A 1ZGNA 2R0CA 1XW5A 4K0GA 2IWTA 1R26A 2X99A 3CTGA 3ZITA 3C71A 2LV3A 2JSZA 3FMWA 1OE8A 1M99A 2OKAA 5GSTA 2NBSA 5DQYA 1EOGA 1U3AA 3IRAA 1A2JA 4OO4A 1YEXA 2ALBA 1EOHA 2LSTA 3HKRA 1ABAA 4BL7A 4XS1A 2P31A 2K9FA 3C1RA 4ZL8A 1XCCA 4MPFA 5D9WA 2LJKA 3QAGA 2M72A 2CAQA 1XBSA 3RPPA 4YAPA 2LJAA 4NWYA 3TRXA 4ZB8A 2I1UA 4PQHA 1EEJA 4HQSA 3LYKA 2OBKA 4I8BA 2FCHA 4BL7B 4EUYA 4P3YB 3CSHA 1SKSB 4ECIA 1M2AA 2GZPA 4TXOA 3F3RA 2VM1A 4EDYA 2GSRA 3BBYA 2LNSA 3FRCA 3FR6A 4MK3A 2VD0A 5H5SA 1AQXA 1VF3A 3ZRDA 2X8HA 1B9YC 3LYPA 4IKHA 5A4UA 2RM6A 5LCZA 2VO4A 3APQA 1UVZA 3LXTA 3H8QA 4PTSA 1FOVA 4K2DA 4J2FA 2IIYA 1YEPA 3U5RE 4BPYA 3FR3A 1ZOFA 3IK9A 4JR6A 5IMCA 3VI5A 4KUNA 4IBPA 4FH8A 1GTIA 2CV4A 1EZKA 2IL3A 2C80A 4EDZA 1HNAA 2LNTA 3KTBA 3HHVA 2HSMA 3GKKA 5ECRB 2QA2A 1U87A 2JZRA 2R0GA 1S3AA 1ON4A 1XOBA 1BQ7A 5D9XA 1G7EA 4GXZA 2YZHA 4OMVA 1F6MC 3FZ4A 1PSQA 1HQOA 4MA9A 1CQHA 4KB3A 3L9VA 3VWUA 1TU7A 4OWYA 3GSTA 5AIVA 3CSJA 1YJ6A 3E0UA 1OVNA 3ZREA 2E7PA 4LL1B 3M9JA 2YNXA 5CAXA 5IPHA 4BVYA 1QXHA 3C1SA 10GSA 1XWCA 4Z2UA 1K0OA 1ZMAA 5IIZA 3HVVA 5DALA 4G0KA 4EKZA 3D0ZA 5C04A 1RK4A 1UC7A 1URMA 4XHMA 3D22A 5HR3A 3EYTA 4PNGA 5JCUA 1V57A 3FKFA 3EMPA 1PKZA 2C3QA 2V2GA 3WD6A 1FB6A 3D21A 1Z7PA 2IPAA 6GSVA 1H75A 4TW5A 3EC3A 3P90A 3DKSA 3US3A 3EINA 5D73A 2GTUA 2WULA 4DEJA 4MDCA 4NHWA 2GZYA 5DALB 1GL8A 4AJ7A 4HS1A 1JZDA 3K8NA 2FWHA 2FWEA 1VRSD 4MH2A 5JCGA 1B48A 3KCMA 5DCHA 5F06A 1PX6A 1EV9A 1K0MA 2XPEA 3LFLA 3UEMA 1QK8A 2ZNMA 4WKWA 2KOKA 2TRXA 4PURA 3Q6OA 2WZ9A 3DVWA 3TOUA 2HRKA 3H1NA 4NV2A 4D73B 4OCFA 3QFAC 1SKWB 1GSDA 4G9HA 1XWGA 1UN2A 3GNJA 3IC8A 12GSA 4V2LA 1EGOA 2C3TA 1JHBA 3UARA 2VL2A 3PR8A 1O73A 2GQKA 3TKRA 4IELA 5G2ZA 4ECCA 2EC4A 4OFNA 3M0FA 2YOIA 1ERVA 2YCDA 3Q18A 1JZOA 2VCVA 4BA7A 4KF9A 2DJKA 1GULA 2GS3A 3ME7A 4Q5NA 3MWHA 2K18A 5CO3A 3M8NA 2FHEA 5F07A 3O6TA 5DJMA 3BCKA 3ZIJA 2B1KA 1USBA 1IYHA 2IMIA 3GKXA 1XPVA 1BJXA 3TKSC 4AF2A 3MYDA 3DMLA 3L4NA 3QD9A 2B5EA 1ML6A 4GSSA 5H5RA 4FQUA 3GKMA 4IJIA 4K5SA 1K3LA 5J9BA 1ERWA 4ZILA 1H4OA 2BTOT 2CQ9A 1TW9A 2GQLA 4Z7XA 2KP2A 2YWMA 2LTKA 3KJYA 4AGSA 4XCSA 2YWIA 2V6KA 1TRVA 3QPMA 4HEA2 4G19A 4EIPA 3TGZA 2B6MA 3M1GA 3FK8A 2A2RA 1I5GA 2FLSA 2VL9A 4V1Ap 2UZ8A 2VLTA 4KAEA 4NV5A 2IMKA 1Z3EA 4MJEA 5FHIA 2D2ZA 4MMMA 1O81A 1JFUA 3KMOA 1O8WA 2WB9A 2H70A 3RHCA 4LA1A 4MABA 4LLRA 2GSSA 1SL1B 3GHAA 1TTZA 5G1LA 1YF0A 1SJZA 4N10A 6GSTA 1XVQA 2DJJA 2HZFA 2V41A 4HJ2A 3H4KA 3FZ5A 3LORA 3KZQA 4N0VA 4WETA 1XWAA 1OKTA 1K0NA 5IO0A 1KBNA 4MF5A 5CRDA 4O5QA 1BAYA 1T3BA 4YQVA 2VAFA 3BD2A 3HZ4A 5KOWA 3HJOA 5COHA 3OR5A 1F9MA 3DXBA 1VF2A 4MJAA 2VL3A 1OC8A 2DKHA 2QSIA 2MYGA 3TRQA 4AJ8A 1NM3A 3H93A 2GZZA 1EWXA 1BG5A 1W4VA 2N5AA 3VWVA 4RUVA 1M9BA 4IP6A 4IS0A 1XW9A 2FA8A 3KXOA 1TOFA 5D93A 1IYIA 1F3AA 2L5OA 3TKPA 1NW2A 5ENUA 1B9XC 2C8UA 1GTAA 2PMTA 4KSOA 3I9V2 4ECBA 3CRTA 3G7YA 4XRAA 4EO3A 2CVDA 1WMJA 3UBLA 1K0CA 1TP9A 3GUSA 3LSZA 2LRTA 3FW2A 2PUKC 2GSTA 5CREA 3Q19A 5INYA 4MJCA 2AAWA 2C3NA 2TIRA 3F0IA 2AJQB 2F51A 4K8MA 2X4AA 1TRSA 1A24A 2MMOA 4HZ2A 1G0TA 2L4CA 1KNGA 1TK8B 3IHQA 22GSA 1GUMA 3UVTA 3S9FA 1F2EA 4BVXA 4ZL7A 2H1GA 2IJYA 3VPTA 14GSA 1TK5B 1OC9A 4OCEA 3TB2A 5G1KA 2MMNA 2HNLA 2HSHA 1C72A 1X0RA 4WR4A 4X1UA 2LRNA 3N5OA 1FOHA 3FZ9A 2JACA 3NOFA 3C73A 5LNKe 3TJKA 2OJLA 1Y6EA 1THXA 2DJ0A 2JU5A 2VD1A 1F3BA 2QC7A 1PD21 5ECKB 4J56E 2YZUA 3CSIA 4WBJA 4TR3A 2X49A 6GSWA 4L0UA 3O76A 3QAWA 3GH9A 3WGDA 5B6MA 2YN1A 3FYGA 2O7KA 4G2EA 1J0FA 2RIIA 5EPFA 1PA3A 3I6AA 4HQZA 2C0EA 1XW6A 3LXZA 4I2UA 4AJ6A 2PN8A 5G5FA 2Z9SA 5J5NA 3RDWA 2B3SA 1SJ6A 1GWCA 2X8CA 5AISA 3KEBA 3VLNA 18GSA 1BYEA 1Z5YE 5G31A 1YZXA 2P5RA 4K0NA 3VURA 4RQRA 3IBHA 6GSYA 1X9WB 4ZL9A 4EVMA 2IFQB 3ZFBA 1PQNA 4TVEA 3L9SA 1R7HA 3QAVA 4Z2TA 4IN0A 2PPTA 4KNDA 3TJGA 2WJUA 3ED3A 1XWBA 4PX1A 3ZIVA 5ECIB 1QFNA 4BWQA 3ME8A 1N8JA 3F4RA 5IMAA 1A8YA 4ZXGA 5ID2B 2PVOC 1YF1A 4F82A 3EURA 5A4WA 2H75A 1THOA 4KSMA 1ERUA 2H0HA 4PXOA 3HCZA 2OA7A 1G6YA 3EE2A 6GSSA 4TKYA 2DBCA 4IHUA 2HLSA 1X9SB 4CDOA 4K5RA 2I4AA 5LD0A 1HNCA 3ERGA 2HE3A 3G7IA 3EU4A 2WDUA 1Y25A 5ECPB 5GSSA 4XIHA 2K6VA 3F6DA 4KE3A 1AW9A 3MAKA 5IMVA 4GCIA 4G10A 5IPGA 3ZL5A 3A3TA 1M0UA 5CP1A 4F0BA 4O92A 3HXSA 2VCZA 2O87A 4I5QA 4Q5FA 3CXGA 2DMLA 3DYRA 3KD0A 2NVLA 2PWJA 3DD3A 1NHOA 4QL9A 1MD3A 4EL1A 2B7JA 1OE7A 4G0IA 2VL2C 1X5CA 4HJMA 5ECHB 4ZBBA 1QUWA 2NDOA 1ZYQB 2XBQA 2XC2A 3HA9A 4NAXA 3APSA 3PPUA 3RBTA 4POLA 2OADA 1WRYA 3F4TA 2HI7A 4L8EA 4LMWA 2H73A 2IMDA 2C0GA 17GSA 2F8FA 1CQGA 4ZBDA 5EVOA 4O5UA 5IMDA 1DE1A 2MMZA 4TRXA 3IAS2 3FHKA 3A2XA 5KEJA 4FYCA 2RM5A 2LQQA 5ECLB 1J08A 1DSBA 4F03A 1FO5A 2AYTA 4D73A 3BOAA 4YQMA 2HRFA 1A2LA 1PL1A 1TRUA 2DJ3A 4PGTA 2DJ1A 2FD3A 2LJRA 3GURA 1MDJA 1G7OA 4GQFA 2AHEA 1Z7RA 3KP8A 4TR1B 2KP1A 4A5PA 4IP1A 1WWJA 2WFCA 2B5YA 2O8VB 5D8IA 5EY6A 1TXXA 2LRCA 1SD8A 4ZB6A 3R3EA 3CRUA 2B5XA 4CW9A 4K7IA 4WXTA 1JLVA 4YKGA 1EGRA 3HVXA 1GLPA 5J9CA 4L5OA 4JZQA 3L78A 1GTBA 3M3MA 3LJRA 1A0RP 3ZMKA 4K6XA 2H1AA 4DSQA 4X43A 3MNGA 4MZWA 3TDGA 4H86A 2P0GA 1V2AA 4KH7A 1TK0B 1FG4A 4WR5A 2JZSA 2V32A 3DEXA 2JL4A 2CVBA 2X64A 2VCTA 1WIKA 2L5LA 5JWQB 5DCGA 2HSYA 4PUFC 4I2TA 2K8SA 3QMXA 2REMA 4MF7A 2ES7A 5DDLA 3F63A 3W6GA 2CZ2A 2GVPA 4QL7A 5GAND 2WGRA 4ZIJA 1SENA 19GSA 3C7MA 3W8JA 2G2QA 2A2SA 4LL4B 5JWRB 5H5QA 5B7CA 1GSQA 3F9UA 3VFIA 2C1YA 4YAVA 5F0GA 3VI7A 1SK0A 5DQSA 2WCIA 2H76A 1J9BA 2VLUA 4ZB9A 1G6WA 1E2YA 4FO5A 2N5BA 4IVFA 1ZYNA 1ST9A 4POKA 4OFTA 1GNEA 4KGIA 2H71A 2R37A 1TDIA 5CRHA 4ID0A 3GTUB 2YV7A 2F8AA 3R2QA 2AV4A 2YV9A 1GSYA 4MP4A 2H01A 1K0DA 2YJ7A 3IE3A 1PN0A 4IJ3A 4DSSB 4KCEA 4V2NA 2HZEB 4HOJA 3A2VA 4F9ZA 6GSUA 5CRGA 3BJ5A 2YWNA 3UVHA 3LGCA 6GSXA 2IMFA 7GSSA 1GUHA 4TOPA 5CRWA 2VIMA 3J7Yk 4EIQA 3GA4A 2OE1A 1FVJA 3MSZA 1B4QA 1E6BA 1TI3A 2X8GA 3GV1A 5G5EA 3ZMLA 1I9DA 1F37A 4POMA 1EP8A 4CY6A 3P8WA 3TJBA 4MNNA 3EPTA 4HU9A 2DSAA 1ZL9A 1FAAA 2ON7A 4WF5A 4XS4A 3MIXA 1S3DA 1ZYPA 2R4VA 1XVWA 1K3YA 1U88A 3WYWA 4GF0A 4N30A 3KH7A 1ZCPA 3EMXA 1FVKA 9GSSA 1ACVA 4HZ4A 3DIEA 4ISDA 1AIUA 3ZTLA 1O8XA 1MEKA 3DGQA 2F9SA 2I9HA 4ECJA 1GSFA 4XS4B 1GSEA 2MBTA 2H66A 2VCXA 1RQMA 4GTUA 1YQ1A 3WT2A 4ML6A 5HFIA 3SBCA 3KTLA 4CHSA 3IV4A 1A23A 2WRTA 3H79A 5HR2A 1B8XA 2R6KA 1BEDA 2OE3A 4I6XA 3PH9A 3KP9A 4Q5QA 4CY8A 5A5KA 1B4PA 3ZVJA 3KM6A 1WJKA 2GDRA 2CX4A 1R5PA 2NTOA 1QQ2A 2DC5A 2FY6A 4JBBA 5D96A 5A4VA 3I69A 2J9HA 2H72A 4YQUA 3HYPA 3ZYWA 3RHBA 5GAPD 3HZ8A 4PNFA 3UL3A 3D5JA 4EF0A 3F3QA 1JZWA 3V1WA 1A2MA 3BCIA 3ERFA 2M80A 3E3EA 1PRXA 2HRNA 2QKEA 2AUVA 1ZYEA 1GUKA 3KGKA 5ECMB 1XZOA 3GL3A 1Q4JA 3KMNA 4F0CA 4USSA 1GNWA 3TUEA 1TU8A 4K7OA 1HD2A 4EXJA 2F3MA 5HQPA 3EU3A 5J4UA 2CVKA 3WGXA 3APOA 3GRXA 3P2AA 1SKRB 3HDCA 4EC0A 1NHYA 1BX9A 13GSA 3FZAA 5C00A 5HR1A 1OAZA 2LEGA 3LWAA 2IFQA 4GRFA 1MTCA 4RI7A 4V1Ag 3QOUA 4MZCA 4HU7A 2V1MA 1XXUA 2E2GA 2H1BA 1VF4A 2RUEA 3CBUA 4ZBAA 2R0PA 2RUFA 2H6ZA 3WGEA 2H6YA 2C4JA 5ID2A 1JZRA 5B8BA 1X5DA 2VOCA 3IA1A 2L4QA 1GLQA 1RW1A 3UMAA 3TKSE 1WPIA 1PMTA 5D9TA 1LU4A 4L0WA 5IOWA 2KHPA 4Z2RA 3TKQA 1TKDB 2CX3A 4FIWA 2TRCP 1S3CA 2M46A 4O32A 5ELGA 2H19A 1XWKA 1GSSA 1M7TA 4NMUA 5ABRA 5AIXA 2HFDA 4GSTA 2PERA 5HFKA 3RAZA 4MJBA 1SJIA 3UBKA 1DE2A 4TR0A 1Z6MA 2DLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0A A;  3PGT A;  2LS5 A;  4MCU A;  1Z9H A;  5F05 A;  3L0H A;  1Q98 A;  1N2A A;  1U3I A;  2L57 A;  4WEY A;  4KX4 A;  4XS6 A;  2FWG A;  3D4M A;  1A8L A;  2IME A;  4OO5 A;  1FHE A;  1AXD A;  1PX7 A;  4RQX A;  5HFG A;  4IW9 A;  3L9U A;  3N9J A;  4MH3 A;  1EP7 A;  5IMF A;  4K7N A;  4K9Z A;  3TRP A;  2O89 A;  4TXO B;  1V40 A;  2FNO A;  4OFM A;  3IC4 A;  5KN2 A;  1GTU A;  4Q5R A;  5KN0 A;  2FA4 A;  2O85 A;  5AN1 A;  4F2I A;  2BMX A;  1K3O A;  3HJM A;  1W89 A;  2QGV A;  2GSQ A;  2PBJ A;  2XBI A;  4KDU A;  1OC3 A;  5IOX A;  3VPQ A;  4K1F A;  4NHZ A;  1R5A A;  4IQA A;  3GIX A;  1YKC A;  3IXR A;  2R5G A;  3ZFL A;  1AQW A;  3F6F A;  4N11 A;  3ZLP A;  4IGJ A;  4KCA A;  3IDV A;  1DUG A;  2CZ3 A;  1LBK A;  2VCQ A;  2VUP A;  3VK9 A;  4FYB A;  5KN3 A;  4O7H A;  5G30 A;  3TOT A;  4OD7 A;  3QFB C;  4GSN A;  4DVC A;  3UJ1 A;  4EE0 A;  2V6O A;  5FT3 A;  5JCW A;  3AY8 A;  2I3Y A;  2YAN A;  4GLT A;  4NPB A;  1PN9 A;  3CTF A;  2XPD A;  3VWX A;  1WP0 A;  1M2D A;  4X0X A;  3IK7 A;  3P7X A;  4TR1 A;  1SD9 A;  5ECS A;  4DSR A;  2MZC A;  4JRR A;  2OAC A;  2DIY A;  1GRX A;  3CMI A;  1JLW A;  2XHF A;  5DVB A;  2PU9 C;  5HR0 A;  1DBY A;  2HXK A;  3GSS A;  2KUC A;  3F4S A;  2A4V A;  4PUA A;  2DIZ A;  2GGT A;  3UAP A;  1SK1 A;  2B7K A;  5IO2 A;  2EIR A;  1V9W A;  3QCP A;  2HT9 A;  1K0B A;  4GQC A;  5GZZ B;  1HYU A;  3A2W A;  3UOM A;  2MBS A;  2GQM A;  3MDK A;  2H0G A;  4KA0 A;  2K8V A;  3G7J A;  5CNW A;  1VGL A;  1YDK A;  1PKW A;  3GFK A;  3LQ7 A;  1XIY A;  4L5L A;  2YPM A;  4N0Z A;  5KN1 A;  1WE0 A;  3DWV A;  3QDN A;  1FW1 A;  3GMF A;  1Z6N A;  2CAI A;  2KLX A;  2RLI A;  2CA8 A;  5DBQ A;  3DVX A;  3GN3 A;  2H30 A;  1AQV A;  4KDY A;  4MLY A;  1O85 A;  2G0F A;  3Q74 A;  1YY7 A;  4E8E A;  2H8L A;  3WT1 A;  11GS A;  3UIW A;  4IQ1 A;  5EL8 A;  16GS A;  2GT5 A;  3O3T A;  5B6N A;  2E0Q A;  1SU9 A;  5IMZ A;  2H74 A;  1O7U A;  5B8A A;  3SWL A;  1SYR A;  5J41 A;  5IQY A;  4POB A;  3U6V A;  1X9M B;  3I43 A;  1UA5 A;  3KIJ A;  2B1L A;  2LKU A;  3KH9 A;  1GH2 A;  8GSS A;  3GTU A;  3VWW A;  4V2M A;  4MZB A;  4O5R A;  2JAD A;  4NXI A;  1SYX A;  5E59 A;  5J3R A;  1QMV A;  3QR6 A;  4MPG A;  3RPN A;  4ACS A;  1KTE A;  4DSS A;  3GX8 A;  5F8B A;  1O6J A;  1U6T A;  1YKA A;  2HZE A;  4ILF A;  2OBI A;  1QGV A;  5ECO B;  3ZVJ D;  1TJD A;  3D6I A;  3G9B A;  1PGT A;  1R4W A;  5DJL A;  1LJR A;  2JSY A;  3FR9 A;  3LG6 A;  4XRD A;  3NZN A;  3EWL A;  1ERT A;  4PQI A;  1OKD A;  5FWG A;  2LQO A;  4I97 A;  3TJJ A;  3W8S A;  3FY7 A;  4ML1 A;  4WBR D;  3HY2 A;  3JCM L;  2L6C A;  2ON5 A;  1EEM A;  1T7P B;  3D4T A;  5CYY A;  3TCO A;  1ZZY A;  1GP1 A;  4QQ7 A;  4TXV A;  4FYU A;  1ILO A;  3A5W A;  2ZUP A;  1T8E B;  2LUS A;  5AGY A;  1TRW A;  3PIN A;  3GL5 A;  3DRN A;  2YP6 A;  2PGT A;  2ZCT A;  1XOA A;  3GX0 A;  4MF6 A;  3LEF A;  4LMV A;  1KEB A;  2EIO A;  3GH6 A;  1AAZ A;  4JU5 A;  3TJF A;  2GLR A;  3ISO A;  3HVS A;  2YWO A;  5IM9 A;  3TKS A;  5ECN B;  1MDI A;  3F8U A;  4TN8 A;  4XTS A;  2L59 A;  2IN3 A;  2AB6 A;  1TI1 A;  2H6X A;  3ERW A;  1HNB A;  1AC1 A;  2VLV A;  4KDX A;  2VM2 A;  1SL2 B;  3IAM 2;  1T4Y A;  4HUA A;  5JWO B;  2R3X A;  2PVQ A;  2C0D A;  3NIV A;  4TR4 A;  3M9K A;  1M9A A;  2H1D A;  1XFL A;  2FUG 2;  2YJH A;  4GWR A;  2WS2 A;  3GYK A;  4JE1 A;  2L6D A;  1X5E A;  3J7Y b;  3IOS A;  2H0I A;  1FB0 A;  2GT6 A;  3C8E A;  1T00 A;  4YH2 A;  1A0F A;  1VF1 A;  1MD4 A;  3HD5 A;  3GKN A;  4HDE A;  3CYN A;  4KW6 A;  2NPB A;  2E2M A;  4WF4 A;  2EIQ A;  2JZT A;  1T4Z A;  2FGX A;  1SL0 B;  5D9V A;  5DAK A;  1T1V A;  4RI6 A;  5ELA A;  1M2B A;  3ZZX A;  4HI7 A;  1MDK A;  1EV4 A;  2MMA A;  4JED A;  2CT6 A;  3HJP A;  4PQ1 A;  1WOU A;  1GSU A;  1SK2 A;  1NSW A;  4JR4 A;  1OYJ A;  2BJX A;  2C0F A;  2DJ2 A;  2DMM A;  2HYX A;  2R2J A;  3FEU A;  5ECQ B;  5L71 A;  2J23 A;  5DAK B;  1AUC A;  1V98 A;  20GS A;  4BWS A;  4ULX A;  2FWF A;  2P5Q A;  4J57 E;  1OC9 B;  1V58 A;  2N5F A;  3IPZ A;  4E8H A;  1PL2 A;  3EVI A;  5E4W A;  2OE0 A;  3IR4 A;  3E9J B;  2VCW A;  2I81 A;  1ZGN A;  1XW5 A;  4K0G A;  2IWT A;  1R26 A;  2X99 A;  3CTG A;  3ZIT A;  3C71 A;  2LV3 A;  2JSZ A;  1OE8 A;  1M99 A;  2OKA A;  5GST A;  2NBS A;  5DQY A;  1EOG A;  1U3A A;  3IRA A;  1A2J A;  4OO4 A;  1YEX A;  2ALB A;  1EOH A;  2LST A;  3HKR A;  1ABA A;  4BL7 A;  4XS1 A;  2P31 A;  2K9F A;  3C1R A;  4ZL8 A;  1XCC A;  4MPF A;  5D9W A;  2LJK A;  3QAG A;  2M72 A;  2CAQ A;  1XBS A;  3RPP A;  4YAP A;  2LJA A;  4NWY A;  3TRX A;  4ZB8 A;  2I1U A;  4PQH A;  1EEJ A;  4HQS A;  3LYK A;  2OBK A;  4I8B A;  2FCH A;  4EUY A;  4P3Y B;  3CSH A;  1SKS B;  4ECI A;  1M2A A;  2GZP A;  4TXO A;  3F3R A;  2VM1 A;  4EDY A;  2GSR A;  3BBY A;  2LNS A;  3FRC A;  3FR6 A;  4MK3 A;  2VD0 A;  5H5S A;  1AQX A;  1VF3 A;  3ZRD A;  2X8H A;  1B9Y C;  3LYP A;  4IKH A;  5A4U A;  2RM6 A;  5LCZ A;  2VO4 A;  3APQ A;  1UVZ A;  3LXT A;  3H8Q A;  1FOV A;  4K2D A;  4J2F A;  2IIY A;  1YEP A;  3U5R E;  4BPY A;  3FR3 A;  1ZOF A;  3IK9 A;  4JR6 A;  5IMC A;  3VI5 A;  4KUN A;  4IBP A;  4FH8 A;  1GTI A;  2CV4 A;  1EZK A;  2IL3 A;  2C80 A;  4EDZ A;  1HNA A;  2LNT A;  3KTB A;  3HHV A;  3GKK A;  5ECR B;  1U87 A;  2JZR A;  1S3A A;  1ON4 A;  1XOB A;  1BQ7 A;  5D9X A;  1G7E A;  4GXZ A;  2YZH A;  4OMV A;  1F6M C;  3FZ4 A;  1PSQ A;  1HQO A;  4MA9 A;  1CQH A;  4KB3 A;  3L9V A;  3VWU A;  1TU7 A;  4OWY A;  3GST A;  5AIV A;  3CSJ A;  1YJ6 A;  3E0U A;  1OVN A;  3ZRE A;  2E7P A;  4LL1 B;  3M9J A;  2YNX A;  5CAX A;  5IPH A;  4BVY A;  1QXH A;  3C1S A;  10GS A;  1XWC A;  1K0O A;  1ZMA A;  5IIZ A;  3HVV A;  5DAL A;  4EKZ A;  3D0Z A;  5C04 A;  1RK4 A;  1UC7 A;  1URM A;  4XHM A;  3D22 A;  5HR3 A;  3EYT A;  4PNG A;  5JCU A;  1V57 A;  3FKF A;  3EMP A;  1PKZ A;  2C3Q A;  2V2G A;  3WD6 A;  1FB6 A;  3D21 A;  1Z7P A;  2IPA A;  6GSV A;  1H75 A;  4TW5 A;  3EC3 A;  3P90 A;  3DKS A;  3US3 A;  3EIN A;  5D73 A;  2GTU A;  2WUL A;  4DEJ A;  4MDC A;  4NHW A;  2GZY A;  5DAL B;  1GL8 A;  4AJ7 A;  4HS1 A;  1JZD A;  3K8N A;  2FWH A;  2FWE A;  1VRS D;  4MH2 A;  5JCG A;  1B48 A;  3KCM A;  5DCH A;  5F06 A;  1PX6 A;  1EV9 A;  1K0M A;  2XPE A;  3LFL A;  3UEM A;  1QK8 A;  2ZNM A;  4WKW A;  2KOK A;  2TRX A;  4PUR A;  3Q6O A;  2WZ9 A;  3DVW A;  3TOU A;  3H1N A;  4NV2 A;  4D73 B;  4OCF A;  3QFA C;  1SKW B;  1GSD A;  4G9H A;  1XWG A;  1UN2 A;  3GNJ A;  4V2L A;  12GS A;  1EGO A;  2C3T A;  1JHB A;  3UAR A;  2VL2 A;  3PR8 A;  1O73 A;  2GQK A;  3TKR A;  4IEL A;  5G2Z A;  4ECC A;  2EC4 A;  4OFN A;  3M0F A;  2YOI A;  1ERV A;  2YCD A;  3Q18 A;  1JZO A;  2VCV A;  4BA7 A;  2DJK A;  1GUL A;  2GS3 A;  3ME7 A;  4Q5N A;  3MWH A;  2K18 A;  5CO3 A;  3M8N A;  2FHE A;  5F07 A;  3O6T A;  5DJM A;  3BCK A;  3ZIJ A;  2B1K A;  1USB A;  1IYH A;  2IMI A;  3GKX A;  1XPV A;  1BJX A;  3TKS C;  4AF2 A;  3DML A;  3L4N A;  3QD9 A;  2B5E A;  1ML6 A;  4GSS A;  5H5R A;  3GKM A;  4IJI A;  5J9B A;  1K3L A;  1ERW A;  4ZIL A;  1H4O A;  2BTO T;  2CQ9 A;  1TW9 A;  2GQL A;  4Z7X A;  2KP2 A;  2YWM A;  2LTK A;  3KJY A;  4AGS A;  4XCS A;  2YWI A;  2V6K A;  1TRV A;  3QPM A;  4HEA 2;  4G19 A;  3TGZ A;  2B6M A;  3M1G A;  3FK8 A;  2A2R A;  1I5G A;  2FLS A;  2VL9 A;  4V1A p;  2VLT A;  4KAE A;  4NV5 A;  2IMK A;  1Z3E A;  4MJE A;  5FHI A;  2D2Z A;  4MMM A;  1O81 A;  1JFU A;  3KMO A;  1O8W A;  2WB9 A;  2H70 A;  3RHC A;  4LA1 A;  4MAB A;  4LLR A;  2GSS A;  1SL1 B;  3GHA A;  1TTZ A;  5G1L A;  1YF0 A;  1SJZ A;  4N10 A;  6GST A;  1XVQ A;  2DJJ A;  2HZF A;  2V41 A;  4HJ2 A;  3H4K A;  3FZ5 A;  3LOR A;  3KZQ A;  4N0V A;  4WET A;  1XWA A;  1OKT A;  1K0N A;  5IO0 A;  1KBN A;  4MF5 A;  5CRD A;  1BAY A;  1T3B A;  4YQV A;  2VAF A;  3BD2 A;  3HZ4 A;  3HJO A;  5COH A;  3OR5 A;  1F9M A;  3DXB A;  1VF2 A;  4MJA A;  2VL3 A;  1OC8 A;  2QSI A;  2MYG A;  3TRQ A;  4AJ8 A;  1NM3 A;  3H93 A;  2GZZ A;  1EWX A;  1BG5 A;  1W4V A;  2N5A A;  3VWV A;  4RUV A;  1M9B A;  4IP6 A;  4IS0 A;  1XW9 A;  2FA8 A;  3KXO A;  1TOF A;  5D93 A;  1IYI A;  1F3A A;  2L5O A;  3TKP A;  1NW2 A;  5ENU A;  1B9X C;  2C8U A;  1GTA A;  2PMT A;  4KSO A;  3I9V 2;  4ECB A;  3CRT A;  3G7Y A;  4XRA A;  4EO3 A;  2CVD A;  1WMJ A;  3UBL A;  1K0C A;  1TP9 A;  3GUS A;  3LSZ A;  2LRT A;  3FW2 A;  2PUK C;  2GST A;  5CRE A;  3Q19 A;  5INY A;  4MJC A;  2AAW A;  2C3N A;  2TIR A;  3F0I A;  2AJQ B;  2F51 A;  4K8M A;  1TRS A;  1A24 A;  2MMO A;  4HZ2 A;  1G0T A;  2L4C A;  1KNG A;  1TK8 B;  3IHQ A;  22GS A;  1GUM A;  3UVT A;  3S9F A;  1F2E A;  4BVX A;  4ZL7 A;  2H1G A;  2IJY A;  3VPT A;  14GS A;  1TK5 B;  1OC9 A;  4OCE A;  3TB2 A;  5G1K A;  2MMN A;  2HNL A;  2HSH A;  1C72 A;  1X0R A;  4WR4 A;  4X1U A;  2LRN A;  3N5O A;  3FZ9 A;  2JAC A;  3NOF A;  3C73 A;  5LNK e;  3TJK A;  2OJL A;  1Y6E A;  1THX A;  2DJ0 A;  2JU5 A;  2VD1 A;  1F3B A;  2QC7 A;  1PD2 1;  5ECK B;  4J56 E;  2YZU A;  3CSI A;  4WBJ A;  4TR3 A;  6GSW A;  4L0U A;  3O76 A;  3QAW A;  3GH9 A;  3WGD A;  5B6M A;  2YN1 A;  3FYG A;  2O7K A;  4G2E A;  1J0F A;  2RII A;  5EPF A;  1PA3 A;  3I6A A;  4HQZ A;  2C0E A;  1XW6 A;  3LXZ A;  4I2U A;  4AJ6 A;  2PN8 A;  5G5F A;  2Z9S A;  5J5N A;  3RDW A;  2B3S A;  1SJ6 A;  1GWC A;  2X8C A;  5AIS A;  3KEB A;  3VLN A;  18GS A;  1BYE A;  1Z5Y E;  5G31 A;  1YZX A;  2P5R A;  4K0N A;  3VUR A;  4RQR A;  3IBH A;  6GSY A;  1X9W B;  4ZL9 A;  4EVM A;  2IFQ B;  3ZFB A;  1PQN A;  4TVE A;  3L9S A;  1R7H A;  3QAV A;  4IN0 A;  2PPT A;  4KND A;  3TJG A;  2WJU A;  3ED3 A;  1XWB A;  4PX1 A;  3ZIV A;  5ECI B;  1QFN A;  4BWQ A;  3ME8 A;  1N8J A;  3F4R A;  5IMA A;  1A8Y A;  4ZXG A;  5ID2 B;  2PVO C;  1YF1 A;  4F82 A;  3EUR A;  5A4W A;  2H75 A;  1THO A;  4KSM A;  1ERU A;  2H0H A;  4PXO A;  3HCZ A;  2OA7 A;  1G6Y A;  3EE2 A;  6GSS A;  4TKY A;  2DBC A;  4IHU A;  2HLS A;  1X9S B;  4CDO A;  2I4A A;  5LD0 A;  1HNC A;  3ERG A;  2HE3 A;  3G7I A;  3EU4 A;  2WDU A;  1Y25 A;  5ECP B;  5GSS A;  4XIH A;  2K6V A;  3F6D A;  4KE3 A;  1AW9 A;  3MAK A;  5IMV A;  4GCI A;  4G10 A;  5IPG A;  3ZL5 A;  3A3T A;  1M0U A;  5CP1 A;  4F0B A;  4O92 A;  3HXS A;  2VCZ A;  2O87 A;  4I5Q A;  4Q5F A;  3CXG A;  2DML A;  3DYR A;  3KD0 A;  2NVL A;  2PWJ A;  3DD3 A;  1NHO A;  4QL9 A;  1MD3 A;  4EL1 A;  2B7J A;  1OE7 A;  2VL2 C;  1X5C A;  4HJM A;  5ECH B;  4ZBB A;  1QUW A;  2NDO A;  1ZYQ B;  2XBQ A;  2XC2 A;  3HA9 A;  4NAX A;  3APS A;  3RBT A;  4POL A;  2OAD A;  1WRY A;  3F4T A;  2HI7 A;  4L8E A;  4LMW A;  2H73 A;  2IMD A;  2C0G A;  17GS A;  2F8F A;  1CQG A;  4ZBD A;  5EVO A;  5IMD A;  1DE1 A;  2MMZ A;  4TRX A;  3IAS 2;  3FHK A;  3A2X A;  5KEJ A;  4FYC A;  2RM5 A;  2LQQ A;  5ECL B;  1J08 A;  1DSB A;  4F03 A;  1FO5 A;  2AYT A;  4D73 A;  3BOA A;  4YQM A;  2HRF A;  1A2L A;  1PL1 A;  1TRU A;  2DJ3 A;  4PGT A;  2DJ1 A;  2FD3 A;  2LJR A;  3GUR A;  1MDJ A;  1G7O A;  4GQF A;  2AHE A;  1Z7R A;  3KP8 A;  4TR1 B;  2KP1 A;  4IP1 A;  1WWJ A;  2WFC A;  2B5Y A;  2O8V B;  5D8I A;  5EY6 A;  1TXX A;  2LRC A;  1SD8 A;  4ZB6 A;  3CRU A;  2B5X A;  4CW9 A;  4K7I A;  4WXT A;  1JLV A;  1EGR A;  3HVX A;  1GLP A;  5J9C A;  4L5O A;  4JZQ A;  3L78 A;  1GTB A;  3M3M A;  3LJR A;  1A0R P;  3ZMK A;  4K6X A;  2H1A A;  4DSQ A;  4X43 A;  3MNG A;  4MZW A;  3TDG A;  4H86 A;  2P0G A;  1V2A A;  4KH7 A;  1TK0 B;  1FG4 A;  4WR5 A;  2JZS A;  2V32 A;  3DEX A;  2JL4 A;  2CVB A;  2X64 A;  2VCT A;  1WIK A;  2L5L A;  5JWQ B;  5DCG A;  2HSY A;  4PUF C;  4I2T A;  2K8S A;  3QMX A;  2REM A;  4MF7 A;  2ES7 A;  5DDL A;  3F63 A;  3W6G A;  2CZ2 A;  2GVP A;  4QL7 A;  5GAN D;  2WGR A;  4ZIJ A;  1SEN A;  19GS A;  3C7M A;  3W8J A;  2G2Q A;  2A2S A;  4LL4 B;  5JWR B;  5H5Q A;  5B7C A;  1GSQ A;  3F9U A;  3VFI A;  2C1Y A;  4YAV A;  5F0G A;  3VI7 A;  1SK0 A;  5DQS A;  2WCI A;  2H76 A;  1J9B A;  2VLU A;  4ZB9 A;  1G6W A;  1E2Y A;  4FO5 A;  2N5B A;  4IVF A;  1ST9 A;  4POK A;  4OFT A;  1GNE A;  4KGI A;  2H71 A;  2R37 A;  1TDI A;  5CRH A;  4ID0 A;  3GTU B;  2YV7 A;  2F8A A;  3R2Q A;  2AV4 A;  2YV9 A;  1GSY A;  4MP4 A;  2H01 A;  1K0D A;  2YJ7 A;  3IE3 A;  4IJ3 A;  4DSS B;  4KCE A;  4V2N A;  2HZE B;  4HOJ A;  3A2V A;  4F9Z A;  6GSU A;  5CRG A;  3BJ5 A;  2YWN A;  3UVH A;  3LGC A;  6GSX A;  2IMF A;  7GSS A;  1GUH A;  4TOP A;  5CRW A;  2VIM A;  3J7Y k;  3GA4 A;  2OE1 A;  1FVJ A;  3MSZ A;  1B4Q A;  1E6B A;  1TI3 A;  2X8G A;  3GV1 A;  5G5E A;  3ZML A;  1I9D A;  1F37 A;  4POM A;  1EP8 A;  3P8W A;  3TJB A;  4HU9 A;  2DSA A;  1ZL9 A;  1FAA A;  2ON7 A;  4WF5 A;  4XS4 A;  1S3D A;  2R4V A;  1XVW A;  1K3Y A;  1U88 A;  3WYW A;  4GF0 A;  4N30 A;  3KH7 A;  1ZCP A;  3EMX A;  1FVK A;  9GSS A;  1ACV A;  4HZ4 A;  3DIE A;  4ISD A;  1AIU A;  3ZTL A;  1O8X A;  1MEK A;  3DGQ A;  2F9S A;  2I9H A;  4ECJ A;  1GSF A;  4XS4 B;  1GSE A;  2MBT A;  2H66 A;  2VCX A;  1RQM A;  4GTU A;  1YQ1 A;  3WT2 A;  4ML6 A;  5HFI A;  3SBC A;  3KTL A;  4CHS A;  3IV4 A;  1A23 A;  2WRT A;  3H79 A;  5HR2 A;  1B8X A;  2R6K A;  1BED A;  2OE3 A;  4I6X A;  3PH9 A;  3KP9 A;  4Q5Q A;  5A5K A;  1B4P A;  3ZVJ A;  3KM6 A;  1WJK A;  2GDR A;  2CX4 A;  1R5P A;  2NTO A;  1QQ2 A;  2DC5 A;  2FY6 A;  4JBB A;  5D96 A;  5A4V A;  3I69 A;  2J9H A;  2H72 A;  4YQU A;  3HYP A;  3ZYW A;  3RHB A;  5GAP D;  3HZ8 A;  4PNF A;  3UL3 A;  3D5J A;  4EF0 A;  3F3Q A;  1JZW A;  3V1W A;  1A2M A;  3BCI A;  3ERF A;  2M80 A;  3E3E A;  1PRX A;  2HRN A;  2QKE A;  2AUV A;  1ZYE A;  1GUK A;  3KGK A;  5ECM B;  1XZO A;  3GL3 A;  1Q4J A;  3KMN A;  4F0C A;  1GNW A;  3TUE A;  1TU8 A;  4K7O A;  1HD2 A;  4EXJ A;  2F3M A;  5HQP A;  3EU3 A;  5J4U A;  2CVK A;  3WGX A;  3APO A;  3GRX A;  3P2A A;  1SKR B;  3HDC A;  4EC0 A;  1NHY A;  1BX9 A;  13GS A;  3FZA A;  5C00 A;  5HR1 A;  1OAZ A;  2LEG A;  3LWA A;  2IFQ A;  4GRF A;  1MTC A;  4RI7 A;  4V1A g;  3QOU A;  4MZC A;  4HU7 A;  2V1M A;  1XXU A;  2E2G A;  2H1B A;  1VF4 A;  2RUE A;  3CBU A;  4ZBA A;  2RUF A;  2H6Z A;  3WGE A;  2H6Y A;  2C4J A;  5ID2 A;  1JZR A;  5B8B A;  1X5D A;  2VOC A;  3IA1 A;  2L4Q A;  1GLQ A;  1RW1 A;  3UMA A;  3TKS E;  1WPI A;  1PMT A;  5D9T A;  1LU4 A;  4L0W A;  5IOW A;  2KHP A;  3TKQ A;  1TKD B;  2CX3 A;  4FIW A;  2TRC P;  1S3C A;  2M46 A;  4O32 A;  5ELG A;  2H19 A;  1XWK A;  1GSS A;  1M7T A;  4NMU A;  5ABR A;  5AIX A;  2HFD A;  4GST A;  2PER A;  5HFK A;  3RAZ A;  4MJB A;  1SJI A;  3UBK A;  1DE2 A;  4TR0 A;  1Z6M A;  2DLX A; 
#chains in the Genus database with same CATH topology
 1K0A A;  3PGT A;  2LS5 A;  4MCU A;  1Z9H A;  5F05 A;  3L0H A;  1Q98 A;  1N2A A;  1U3I A;  2L57 A;  4WEY A;  4KX4 A;  4XS6 A;  2FWG A;  3D4M A;  1A8L A;  2IME A;  4OO5 A;  1FHE A;  1AXD A;  1PX7 A;  4RQX A;  5HFG A;  4IW9 A;  3L9U A;  3N9J A;  4MH3 A;  1EP7 A;  5IMF A;  4K7N A;  4K9Z A;  3TRP A;  2O89 A;  4TXO B;  1V40 A;  2FNO A;  4OFM A;  3IC4 A;  5KN2 A;  1GTU A;  4Q5R A;  5KN0 A;  2FA4 A;  2O85 A;  5AN1 A;  4F2I A;  2BMX A;  1K3O A;  4K2X A;  3HJM A;  1W89 A;  2QGV A;  2GSQ A;  2PBJ A;  2XBI A;  4KDU A;  1OC3 A;  5IOX A;  3VPQ A;  4K1F A;  4NHZ A;  1R5A A;  4IQA A;  3GIX A;  1YKC A;  3IXR A;  2R5G A;  3ZFL A;  1AQW A;  5BRT A;  3F6F A;  4N11 A;  3ZLP A;  4IGJ A;  1S3R A;  4KCA A;  3IDV A;  1DUG A;  2CZ3 A;  1LBK A;  2VCQ A;  2VUP A;  3VK9 A;  4FYB A;  5KN3 A;  4O7H A;  5G30 A;  3TOT A;  4OD7 A;  3QFB C;  4GSN A;  4DVC A;  3UJ1 A;  4EE0 A;  2V6O A;  5FT3 A;  5JCW A;  3AY8 A;  2I3Y A;  2YAN A;  4GLT A;  4NPB A;  1PN9 A;  3CTF A;  2XPD A;  3VWX A;  1WP0 A;  1M2D A;  4X0X A;  3IK7 A;  3P7X A;  4TR1 A;  1SD9 A;  5ECS A;  4DSR A;  2MZC A;  4JRR A;  2OAC A;  2DIY A;  1GRX A;  3CMI A;  1JLW A;  2XHF A;  5DVB A;  2PU9 C;  5HR0 A;  1DBY A;  2HXK A;  3GSS A;  2KUC A;  3F4S A;  4BVY B;  2A4V A;  4PUA A;  2DIZ A;  2GGT A;  3UAP A;  1SK1 A;  4ICY A;  2B7K A;  5IO2 A;  2EIR A;  1V9W A;  3QCP A;  2HT9 A;  1K0B A;  4GQC A;  5GZZ B;  1HYU A;  3A2W A;  3UOM A;  2MBS A;  2GQM A;  3MDK A;  2H0G A;  4KA0 A;  2K8V A;  3G7J A;  5CNW A;  1VGL A;  1YDK A;  1PKW A;  3GFK A;  3LQ7 A;  1XIY A;  4L5L A;  2YPM A;  4N0Z A;  5KN1 A;  1WE0 A;  3DWV A;  3QDN A;  1FW1 A;  3GMF A;  1Z6N A;  2CAI A;  2KLX A;  2RLI A;  2CA8 A;  5DBQ A;  3DVX A;  3GN3 A;  2H30 A;  1AQV A;  4KDY A;  4MLY A;  1O85 A;  2G0F A;  3Q74 A;  4G0L A;  1YY7 A;  4E8E A;  2H8L A;  3WT1 A;  11GS A;  3UIW A;  4IQ1 A;  5EL8 A;  16GS A;  2GT5 A;  3A5I A;  2HRA A;  3O3T A;  5B6N A;  2E0Q A;  1SU9 A;  4YKF A;  5IMZ A;  2H74 A;  1O7U A;  5B8A A;  3SWL A;  1SYR A;  5J41 A;  5IQY A;  4POB A;  3U6V A;  1X9M B;  3I43 A;  1UA5 A;  3KIJ A;  2B1L A;  2LKU A;  3KH9 A;  1GH2 A;  8GSS A;  3GTU A;  3VWW A;  4V2M A;  4MZB A;  4O5R A;  2JAD A;  4NXI A;  5KOX A;  1SYX A;  5E59 A;  5J3R A;  1QMV A;  3QR6 A;  4MPG A;  3RPN A;  4ACS A;  1KTE A;  4DSS A;  3GX8 A;  5F8B A;  1O6J A;  1U6T A;  1YKA A;  2HZE A;  4ILF A;  2OBI A;  1QGV A;  5ECO B;  3ZVJ D;  1TJD A;  3D6I A;  3G9B A;  1PGT A;  1R4W A;  5DJL A;  1LJR A;  2JSY A;  3FR9 A;  3LG6 A;  4XRD A;  3NZN A;  3EWL A;  1ERT A;  4PQI A;  1OKD A;  5FWG A;  2LQO A;  4I97 A;  3TJJ A;  3W8S A;  3FY7 A;  4ML1 A;  4WBR D;  3HY2 A;  3JCM L;  2L6C A;  2ON5 A;  1EEM A;  1T7P B;  3D4T A;  5CYY A;  3TCO A;  1ZZY A;  1GP1 A;  2DKI A;  4QQ7 A;  4TXV A;  4FYU A;  1ILO A;  3A5W A;  2ZUP A;  1T8E B;  2LUS A;  5AGY A;  1TRW A;  3PIN A;  3GL5 A;  3DRN A;  2YP6 A;  2PGT A;  2ZCT A;  1XOA A;  4HSC X;  3GX0 A;  4MF6 A;  3LEF A;  4LMV A;  1KEB A;  2EIO A;  3GH6 A;  1AAZ A;  4JU5 A;  3TJF A;  2GLR A;  3ISO A;  2QA1 A;  3HVS A;  2YWO A;  5IM9 A;  3TKS A;  5ECN B;  1MDI A;  3F8U A;  4TN8 A;  4XTS A;  2L59 A;  2IN3 A;  2AB6 A;  1TI1 A;  2H6X A;  3ERW A;  1HNB A;  1AC1 A;  2VLV A;  4KDX A;  2VM2 A;  1SL2 B;  3IAM 2;  1T4Y A;  4HUA A;  5JWO B;  2R3X A;  2PVQ A;  2C0D A;  3NIV A;  3LW9 A;  4TR4 A;  3M9K A;  3IHG A;  1M9A A;  2H1D A;  1XFL A;  2FUG 2;  2YJH A;  4GWR A;  2WS2 A;  3GYK A;  4JE1 A;  2L6D A;  1X5E A;  3J7Y b;  3IOS A;  2H0I A;  1FB0 A;  2GT6 A;  3C8E A;  1T00 A;  4YH2 A;  1A0F A;  1VF1 A;  1MD4 A;  3HD5 A;  3GKN A;  4HDE A;  3CYN A;  4KW6 A;  2NPB A;  2A2P A;  2E2M A;  4WF4 A;  2EIQ A;  2JZT A;  1T4Z A;  2FGX A;  1SL0 B;  5D9V A;  5DAK A;  1T1V A;  4RI6 A;  5ELA A;  1M2B A;  4X4J A;  3ZZX A;  4HI7 A;  1MDK A;  1EV4 A;  2MMA A;  4JED A;  2CT6 A;  3HJP A;  4PQ1 A;  1WOU A;  2A4H A;  1GSU A;  1SK2 A;  1NSW A;  4JR4 A;  1OYJ A;  2BJX A;  2C0F A;  2DJ2 A;  5BMU A;  2DMM A;  2HYX A;  2R2J A;  3FEU A;  5ECQ B;  5L71 A;  2J23 A;  5DAK B;  4BIK A;  1AUC A;  1V98 A;  4BVX B;  20GS A;  4BWS A;  4ULX A;  2FWF A;  2P5Q A;  4J57 E;  1OC9 B;  1V58 A;  2N5F A;  3IPZ A;  4E8H A;  1PL2 A;  3EVI A;  5E4W A;  2OE0 A;  3IR4 A;  3E9J B;  2VCW A;  2I81 A;  1ZGN A;  2R0C A;  1XW5 A;  4K0G A;  2IWT A;  1R26 A;  2X99 A;  3CTG A;  3ZIT A;  3C71 A;  2LV3 A;  2JSZ A;  3FMW A;  1OE8 A;  1M99 A;  2OKA A;  5GST A;  2NBS A;  3HVN A;  5DQY A;  1EOG A;  1U3A A;  3IRA A;  1A2J A;  4OO4 A;  1YEX A;  2ALB A;  1EOH A;  2LST A;  3HKR A;  1ABA A;  4BL7 A;  4XS1 A;  2P31 A;  2K9F A;  3C1R A;  4ZL8 A;  1XCC A;  4MPF A;  5D9W A;  2LJK A;  3QAG A;  2M72 A;  2CAQ A;  1XBS A;  3RPP A;  4YAP A;  2LJA A;  4NWY A;  3TRX A;  4ZB8 A;  2I1U A;  4PQH A;  1EEJ A;  4HQS A;  3LYK A;  2OBK A;  4I8B A;  2FCH A;  4BL7 B;  4EUY A;  4P3Y B;  3CSH A;  1SKS B;  4ECI A;  1M2A A;  2GZP A;  4TXO A;  3F3R A;  2VM1 A;  4EDY A;  2GSR A;  3BBY A;  2LNS A;  3FRC A;  3FR6 A;  4MK3 A;  2VD0 A;  5H5S A;  1AQX A;  1VF3 A;  3ZRD A;  2X8H A;  1B9Y C;  3LYP A;  4IKH A;  5A4U A;  2RM6 A;  5LCZ A;  2VO4 A;  3APQ A;  1UVZ A;  3LXT A;  3H8Q A;  4PTS A;  1FOV A;  4K2D A;  4J2F A;  2IIY A;  1YEP A;  3U5R E;  4BPY A;  3FR3 A;  1ZOF A;  3IK9 A;  4JR6 A;  5IMC A;  3VI5 A;  4KUN A;  4IBP A;  4FH8 A;  1GTI A;  2CV4 A;  1EZK A;  2IL3 A;  2C80 A;  4EDZ A;  1HNA A;  2LNT A;  3CQF A;  3KTB A;  3HHV A;  2HSM A;  3GKK A;  5ECR B;  2QA2 A;  1U87 A;  2JZR A;  2R0G A;  1S3A A;  1ON4 A;  1XOB A;  1BQ7 A;  5D9X A;  1G7E A;  4GXZ A;  2YZH A;  4OMV A;  1F6M C;  3FZ4 A;  1PSQ A;  1HQO A;  4MA9 A;  1CQH A;  4KB3 A;  3L9V A;  3VWU A;  1TU7 A;  4OWY A;  3GST A;  5AIV A;  3CSJ A;  1YJ6 A;  3E0U A;  1OVN A;  3ZRE A;  2E7P A;  4LL1 B;  3M9J A;  2YNX A;  5CAX A;  5IPH A;  4BVY A;  1QXH A;  3C1S A;  10GS A;  1XWC A;  4Z2U A;  1K0O A;  1ZMA A;  5IIZ A;  3HVV A;  5DAL A;  4G0K A;  4EKZ A;  3D0Z A;  5C04 A;  1RK4 A;  1UC7 A;  1URM A;  4XHM A;  3D22 A;  5HR3 A;  3EYT A;  4PNG A;  5JCU A;  1V57 A;  3FKF A;  3EMP A;  1PKZ A;  2C3Q A;  2V2G A;  3WD6 A;  1FB6 A;  3D21 A;  1Z7P A;  2IPA A;  6GSV A;  1H75 A;  4TW5 A;  3EC3 A;  3P90 A;  3DKS A;  3US3 A;  3EIN A;  5D73 A;  2GTU A;  2WUL A;  4DEJ A;  4MDC A;  4NHW A;  2GZY A;  5DAL B;  1GL8 A;  4AJ7 A;  4HS1 A;  1JZD A;  3K8N A;  2FWH A;  2FWE A;  1VRS D;  4MH2 A;  5JCG A;  1B48 A;  3KCM A;  5DCH A;  5F06 A;  1PX6 A;  1EV9 A;  1K0M A;  2XPE A;  3LFL A;  3UEM A;  1QK8 A;  2ZNM A;  4WKW A;  2KOK A;  2TRX A;  4PUR A;  3Q6O A;  2WZ9 A;  3DVW A;  3TOU A;  2HRK A;  3H1N A;  4NV2 A;  4D73 B;  4OCF A;  3QFA C;  1SKW B;  1GSD A;  4G9H A;  1XWG A;  1UN2 A;  3GNJ A;  3IC8 A;  12GS A;  4V2L A;  1EGO A;  2C3T A;  1JHB A;  3UAR A;  2VL2 A;  3PR8 A;  1O73 A;  2GQK A;  3TKR A;  4IEL A;  5G2Z A;  4ECC A;  2EC4 A;  4OFN A;  3M0F A;  2YOI A;  1ERV A;  2YCD A;  3Q18 A;  1JZO A;  2VCV A;  4BA7 A;  4KF9 A;  2DJK A;  1GUL A;  2GS3 A;  3ME7 A;  4Q5N A;  3MWH A;  2K18 A;  5CO3 A;  3M8N A;  2FHE A;  5F07 A;  3O6T A;  5DJM A;  3BCK A;  3ZIJ A;  2B1K A;  1USB A;  1IYH A;  2IMI A;  3GKX A;  1XPV A;  1BJX A;  3TKS C;  4AF2 A;  3MYD A;  3DML A;  3L4N A;  3QD9 A;  2B5E A;  1ML6 A;  4GSS A;  5H5R A;  4FQU A;  3GKM A;  4IJI A;  4K5S A;  1K3L A;  5J9B A;  1ERW A;  4ZIL A;  1H4O A;  2BTO T;  2CQ9 A;  1TW9 A;  2GQL A;  4Z7X A;  2KP2 A;  2YWM A;  2LTK A;  3KJY A;  4AGS A;  4XCS A;  2YWI A;  2V6K A;  1TRV A;  3QPM A;  4HEA 2;  4G19 A;  4EIP A;  3TGZ A;  2B6M A;  3M1G A;  3FK8 A;  2A2R A;  1I5G A;  2FLS A;  2VL9 A;  4V1A p;  2UZ8 A;  2VLT A;  4KAE A;  4NV5 A;  2IMK A;  1Z3E A;  4MJE A;  5FHI A;  2D2Z A;  4MMM A;  1O81 A;  1JFU A;  3KMO A;  1O8W A;  2WB9 A;  2H70 A;  3RHC A;  4LA1 A;  4MAB A;  4LLR A;  2GSS A;  1SL1 B;  3GHA A;  1TTZ A;  5G1L A;  1YF0 A;  1SJZ A;  4N10 A;  6GST A;  1XVQ A;  2DJJ A;  2HZF A;  2V41 A;  4HJ2 A;  3H4K A;  3FZ5 A;  3LOR A;  3KZQ A;  4N0V A;  4WET A;  1XWA A;  1OKT A;  1K0N A;  5IO0 A;  1KBN A;  1PFO A;  4MF5 A;  5CRD A;  4O5Q A;  1BAY A;  1T3B A;  4YQV A;  2VAF A;  3BD2 A;  3HZ4 A;  5KOW A;  3HJO A;  5COH A;  3OR5 A;  1F9M A;  3DXB A;  1VF2 A;  4MJA A;  2VL3 A;  1OC8 A;  2DKH A;  2QSI A;  2MYG A;  3TRQ A;  4AJ8 A;  1NM3 A;  3H93 A;  2GZZ A;  1EWX A;  1BG5 A;  1W4V A;  2N5A A;  3VWV A;  4RUV A;  1M9B A;  4IP6 A;  4IS0 A;  1XW9 A;  2FA8 A;  3KXO A;  1TOF A;  5D93 A;  1IYI A;  1F3A A;  2L5O A;  3TKP A;  1NW2 A;  5ENU A;  1B9X C;  2C8U A;  1GTA A;  2PMT A;  4KSO A;  3I9V 2;  4ECB A;  3CRT A;  3G7Y A;  4XRA A;  4EO3 A;  2CVD A;  1WMJ A;  3UBL A;  1K0C A;  1TP9 A;  3GUS A;  3LSZ A;  2LRT A;  3FW2 A;  2PUK C;  2GST A;  5CRE A;  3Q19 A;  5INY A;  4MJC A;  2AAW A;  2C3N A;  2TIR A;  3F0I A;  2AJQ B;  2F51 A;  4K8M A;  2X4A A;  1TRS A;  1A24 A;  2MMO A;  4HZ2 A;  1G0T A;  2L4C A;  1KNG A;  1TK8 B;  3IHQ A;  22GS A;  1GUM A;  3UVT A;  3S9F A;  1F2E A;  4BVX A;  4ZL7 A;  2H1G A;  2IJY A;  3VPT A;  14GS A;  1TK5 B;  1OC9 A;  4OCE A;  3TB2 A;  5G1K A;  2MMN A;  2HNL A;  2HSH A;  1C72 A;  1X0R A;  4WR4 A;  4X1U A;  2LRN A;  3N5O A;  1FOH A;  3FZ9 A;  2JAC A;  3NOF A;  3C73 A;  5LNK e;  3TJK A;  2OJL A;  1Y6E A;  1THX A;  2DJ0 A;  2JU5 A;  2VD1 A;  1F3B A;  2QC7 A;  1PD2 1;  5ECK B;  4J56 E;  2YZU A;  3CSI A;  4WBJ A;  4TR3 A;  2X49 A;  6GSW A;  4L0U A;  3O76 A;  3QAW A;  3GH9 A;  3WGD A;  5B6M A;  2YN1 A;  3FYG A;  2O7K A;  4G2E A;  1J0F A;  2RII A;  5EPF A;  1PA3 A;  3I6A A;  4HQZ A;  2C0E A;  1XW6 A;  3LXZ A;  4I2U A;  4AJ6 A;  2PN8 A;  5G5F A;  2Z9S A;  5J5N A;  3RDW A;  2B3S A;  1SJ6 A;  1GWC A;  2X8C A;  3KEB A;  5AIS A;  3VLN A;  18GS A;  1BYE A;  1Z5Y E;  5G31 A;  1YZX A;  2P5R A;  4K0N A;  3VUR A;  4RQR A;  3IBH A;  6GSY A;  1X9W B;  4ZL9 A;  4EVM A;  2IFQ B;  3ZFB A;  1PQN A;  4TVE A;  3L9S A;  1R7H A;  3QAV A;  4Z2T A;  4IN0 A;  2PPT A;  4KND A;  3TJG A;  2WJU A;  3ED3 A;  1XWB A;  4PX1 A;  3ZIV A;  5ECI B;  1QFN A;  4BWQ A;  3ME8 A;  1N8J A;  3F4R A;  5IMA A;  1A8Y A;  4ZXG A;  5ID2 B;  2PVO C;  1YF1 A;  4F82 A;  3EUR A;  5A4W A;  2H75 A;  1THO A;  4KSM A;  1ERU A;  2H0H A;  4PXO A;  3HCZ A;  2OA7 A;  1G6Y A;  3EE2 A;  6GSS A;  4TKY A;  2DBC A;  4IHU A;  2HLS A;  1X9S B;  4CDO A;  4K5R A;  2I4A A;  5LD0 A;  1HNC A;  3ERG A;  2HE3 A;  3G7I A;  3EU4 A;  2WDU A;  1Y25 A;  5ECP B;  5GSS A;  4XIH A;  2K6V A;  3F6D A;  4KE3 A;  1AW9 A;  3MAK A;  5IMV A;  4GCI A;  4G10 A;  5IPG A;  3ZL5 A;  3A3T A;  1M0U A;  5CP1 A;  4F0B A;  4O92 A;  3HXS A;  2VCZ A;  2O87 A;  4I5Q A;  4Q5F A;  3CXG A;  2DML A;  3DYR A;  3KD0 A;  2NVL A;  2PWJ A;  3DD3 A;  1NHO A;  4QL9 A;  1MD3 A;  4EL1 A;  2B7J A;  1OE7 A;  4G0I A;  2VL2 C;  1X5C A;  4HJM A;  5ECH B;  4ZBB A;  1QUW A;  2NDO A;  1ZYQ B;  2XBQ A;  2XC2 A;  3HA9 A;  4NAX A;  3APS A;  3PPU A;  3RBT A;  4POL A;  2OAD A;  1WRY A;  3F4T A;  2HI7 A;  4L8E A;  4LMW A;  2H73 A;  2IMD A;  2C0G A;  17GS A;  2F8F A;  1CQG A;  4ZBD A;  5EVO A;  4O5U A;  5IMD A;  1DE1 A;  2MMZ A;  4TRX A;  3IAS 2;  3FHK A;  3A2X A;  5KEJ A;  4FYC A;  2RM5 A;  2LQQ A;  5ECL B;  1J08 A;  1DSB A;  4F03 A;  1FO5 A;  2AYT A;  4D73 A;  3BOA A;  4YQM A;  2HRF A;  1A2L A;  1PL1 A;  1TRU A;  2DJ3 A;  4PGT A;  2DJ1 A;  2FD3 A;  2LJR A;  3GUR A;  1MDJ A;  1G7O A;  4GQF A;  2AHE A;  1Z7R A;  3KP8 A;  4TR1 B;  2KP1 A;  4A5P A;  4IP1 A;  1WWJ A;  2WFC A;  2B5Y A;  2O8V B;  5D8I A;  5EY6 A;  1TXX A;  2LRC A;  1SD8 A;  4ZB6 A;  3R3E A;  3CRU A;  2B5X A;  4CW9 A;  4K7I A;  4WXT A;  1JLV A;  4YKG A;  1EGR A;  3HVX A;  1GLP A;  5J9C A;  4L5O A;  4JZQ A;  3L78 A;  1GTB A;  3M3M A;  3LJR A;  1A0R P;  3ZMK A;  4K6X A;  2H1A A;  4DSQ A;  4X43 A;  3MNG A;  4MZW A;  3TDG A;  4H86 A;  2P0G A;  1V2A A;  4KH7 A;  1TK0 B;  1FG4 A;  4WR5 A;  2JZS A;  2V32 A;  3DEX A;  2JL4 A;  2CVB A;  2X64 A;  2VCT A;  1WIK A;  2L5L A;  5JWQ B;  5DCG A;  2HSY A;  4PUF C;  4I2T A;  2K8S A;  3QMX A;  2REM A;  4MF7 A;  2ES7 A;  5DDL A;  3F63 A;  3W6G A;  2CZ2 A;  2GVP A;  4QL7 A;  5GAN D;  2WGR A;  4ZIJ A;  1SEN A;  19GS A;  3C7M A;  3W8J A;  2G2Q A;  2A2S A;  4LL4 B;  5JWR B;  5H5Q A;  5B7C A;  1GSQ A;  3F9U A;  3VFI A;  2C1Y A;  4YAV A;  5F0G A;  3VI7 A;  1SK0 A;  5DQS A;  2WCI A;  2H76 A;  1J9B A;  2VLU A;  4ZB9 A;  1G6W A;  1E2Y A;  4FO5 A;  2N5B A;  4IVF A;  1ZYN A;  1ST9 A;  4POK A;  4OFT A;  1GNE A;  4KGI A;  2H71 A;  2R37 A;  1TDI A;  5CRH A;  4ID0 A;  3GTU B;  2YV7 A;  2F8A A;  3R2Q A;  2AV4 A;  2YV9 A;  1GSY A;  4MP4 A;  2H01 A;  1K0D A;  2YJ7 A;  3IE3 A;  1PN0 A;  4IJ3 A;  4DSS B;  4KCE A;  4V2N A;  2HZE B;  4HOJ A;  3A2V A;  4F9Z A;  6GSU A;  5CRG A;  3BJ5 A;  2YWN A;  3UVH A;  3LGC A;  6GSX A;  2IMF A;  7GSS A;  1GUH A;  4TOP A;  5CRW A;  2VIM A;  3J7Y k;  4EIQ A;  3GA4 A;  2OE1 A;  1FVJ A;  3MSZ A;  1B4Q A;  1E6B A;  1TI3 A;  2X8G A;  3GV1 A;  5G5E A;  3ZML A;  1I9D A;  1F37 A;  4POM A;  1EP8 A;  4CY6 A;  3P8W A;  3TJB A;  4MNN A;  3EPT A;  4HU9 A;  2DSA A;  1ZL9 A;  1FAA A;  2ON7 A;  4WF5 A;  4XS4 A;  3MIX A;  1S3D A;  1ZYP A;  2R4V A;  1XVW A;  1K3Y A;  1U88 A;  3WYW A;  4GF0 A;  4N30 A;  3KH7 A;  1ZCP A;  3EMX A;  1FVK A;  9GSS A;  1ACV A;  4HZ4 A;  3DIE A;  4ISD A;  1AIU A;  3ZTL A;  1O8X A;  1MEK A;  3DGQ A;  2F9S A;  2I9H A;  4ECJ A;  1GSF A;  4XS4 B;  1GSE A;  2MBT A;  2H66 A;  2VCX A;  1RQM A;  4GTU A;  1YQ1 A;  3WT2 A;  4ML6 A;  5HFI A;  3SBC A;  3KTL A;  4CHS A;  3IV4 A;  1A23 A;  2WRT A;  3H79 A;  5HR2 A;  1B8X A;  2R6K A;  1BED A;  2OE3 A;  4I6X A;  3PH9 A;  3KP9 A;  4Q5Q A;  4CY8 A;  5A5K A;  1B4P A;  3ZVJ A;  3KM6 A;  1WJK A;  2GDR A;  2CX4 A;  1R5P A;  2NTO A;  1QQ2 A;  2DC5 A;  2FY6 A;  4JBB A;  5D96 A;  5A4V A;  3I69 A;  2J9H A;  2H72 A;  4YQU A;  3HYP A;  3ZYW A;  3RHB A;  5GAP D;  1XG8 A;  3HZ8 A;  4PNF A;  3UL3 A;  3D5J A;  4EF0 A;  3F3Q A;  1JZW A;  3V1W A;  1A2M A;  3BCI A;  3ERF A;  2M80 A;  3E3E A;  1PRX A;  2HRN A;  2QKE A;  2AUV A;  1ZYE A;  1GUK A;  3KGK A;  5ECM B;  1XZO A;  3GL3 A;  1Q4J A;  3KMN A;  4F0C A;  4USS A;  1GNW A;  3TUE A;  1TU8 A;  4K7O A;  1HD2 A;  4EXJ A;  2F3M A;  5HQP A;  3EU3 A;  5J4U A;  2CVK A;  3WGX A;  3APO A;  3GRX A;  3P2A A;  1SKR B;  3HDC A;  1M3J A;  4EC0 A;  1NHY A;  1BX9 A;  13GS A;  3FZA A;  5C00 A;  5HR1 A;  1OAZ A;  2LEG A;  3LWA A;  2IFQ A;  4GRF A;  1MTC A;  4RI7 A;  4V1A g;  3QOU A;  4MZC A;  4HU7 A;  2V1M A;  1XXU A;  2E2G A;  2H1B A;  1VF4 A;  2RUE A;  3CBU A;  4ZBA A;  2R0P A;  2RUF A;  2H6Z A;  3WGE A;  2H6Y A;  2C4J A;  5ID2 A;  1JZR A;  5B8B A;  1X5D A;  2VOC A;  3IA1 A;  2L4Q A;  1GLQ A;  1RW1 A;  3UMA A;  3TKS E;  1WPI A;  1PMT A;  5D9T A;  1LU4 A;  4L0W A;  5IOW A;  2KHP A;  4Z2R A;  3TKQ A;  1TKD B;  2CX3 A;  4FIW A;  2TRC P;  1S3C A;  2M46 A;  4O32 A;  5ELG A;  2H19 A;  1XWK A;  1GSS A;  1M7T A;  4NMU A;  5ABR A;  1M3I A;  5AIX A;  2HFD A;  4GST A;  2PER A;  5HFK A;  3RAZ A;  4MJB A;  1SJI A;  3UBK A;  1DE2 A;  4TR0 A;  1Z6M A;  2DLX A; 
#chains in the Genus database with same CATH homology
 1K0A A;  3PGT A;  2LS5 A;  4MCU A;  1Z9H A;  5F05 A;  3L0H A;  1Q98 A;  1N2A A;  1U3I A;  2L57 A;  4WEY A;  4KX4 A;  4XS6 A;  2FWG A;  3D4M A;  1A8L A;  2IME A;  4OO5 A;  1FHE A;  1AXD A;  1PX7 A;  4RQX A;  5HFG A;  4IW9 A;  3L9U A;  3N9J A;  4MH3 A;  1EP7 A;  5IMF A;  4K7N A;  4K9Z A;  3TRP A;  2O89 A;  4TXO B;  1V40 A;  2FNO A;  4OFM A;  3IC4 A;  5KN2 A;  1GTU A;  4Q5R A;  5KN0 A;  2FA4 A;  2O85 A;  5AN1 A;  4F2I A;  2BMX A;  1K3O A;  4K2X A;  3HJM A;  1W89 A;  2QGV A;  2GSQ A;  2PBJ A;  2XBI A;  4KDU A;  1OC3 A;  5IOX A;  3VPQ A;  4K1F A;  4NHZ A;  1R5A A;  4IQA A;  3GIX A;  1YKC A;  3IXR A;  2R5G A;  3ZFL A;  1AQW A;  5BRT A;  3F6F A;  4N11 A;  3ZLP A;  4IGJ A;  4KCA A;  3IDV A;  1DUG A;  2CZ3 A;  1LBK A;  2VCQ A;  2VUP A;  3VK9 A;  4FYB A;  5KN3 A;  4O7H A;  5G30 A;  3TOT A;  4OD7 A;  3QFB C;  4GSN A;  4DVC A;  3UJ1 A;  4EE0 A;  2V6O A;  5FT3 A;  5JCW A;  3AY8 A;  2I3Y A;  2YAN A;  4GLT A;  4NPB A;  1PN9 A;  3CTF A;  2XPD A;  3VWX A;  1WP0 A;  1M2D A;  4X0X A;  3IK7 A;  3P7X A;  4TR1 A;  1SD9 A;  5ECS A;  4DSR A;  2MZC A;  4JRR A;  2OAC A;  2DIY A;  1GRX A;  3CMI A;  1JLW A;  2XHF A;  5DVB A;  2PU9 C;  5HR0 A;  1DBY A;  2HXK A;  3GSS A;  2KUC A;  3F4S A;  4BVY B;  2A4V A;  4PUA A;  2DIZ A;  2GGT A;  3UAP A;  1SK1 A;  4ICY A;  2B7K A;  5IO2 A;  2EIR A;  1V9W A;  3QCP A;  2HT9 A;  1K0B A;  4GQC A;  5GZZ B;  1HYU A;  3A2W A;  3UOM A;  2MBS A;  2GQM A;  3MDK A;  2H0G A;  4KA0 A;  2K8V A;  3G7J A;  5CNW A;  1VGL A;  1YDK A;  1PKW A;  3GFK A;  3LQ7 A;  1XIY A;  4L5L A;  2YPM A;  4N0Z A;  5KN1 A;  1WE0 A;  3DWV A;  3QDN A;  1FW1 A;  3GMF A;  1Z6N A;  2CAI A;  2KLX A;  2RLI A;  2CA8 A;  5DBQ A;  3DVX A;  3GN3 A;  2H30 A;  1AQV A;  4KDY A;  4MLY A;  1O85 A;  2G0F A;  3Q74 A;  4G0L A;  1YY7 A;  4E8E A;  2H8L A;  3WT1 A;  11GS A;  3UIW A;  4IQ1 A;  5EL8 A;  16GS A;  2GT5 A;  3A5I A;  2HRA A;  3O3T A;  5B6N A;  2E0Q A;  1SU9 A;  4YKF A;  5IMZ A;  2H74 A;  1O7U A;  5B8A A;  3SWL A;  1SYR A;  5J41 A;  5IQY A;  4POB A;  3U6V A;  1X9M B;  3I43 A;  1UA5 A;  3KIJ A;  2B1L A;  2LKU A;  3KH9 A;  1GH2 A;  8GSS A;  3GTU A;  3VWW A;  4V2M A;  4MZB A;  4O5R A;  2JAD A;  4NXI A;  5KOX A;  1SYX A;  5E59 A;  5J3R A;  1QMV A;  3QR6 A;  4MPG A;  3RPN A;  4ACS A;  1KTE A;  4DSS A;  3GX8 A;  5F8B A;  1O6J A;  1U6T A;  1YKA A;  2HZE A;  4ILF A;  2OBI A;  1QGV A;  5ECO B;  3ZVJ D;  1TJD A;  3D6I A;  3G9B A;  1PGT A;  1R4W A;  5DJL A;  1LJR A;  2JSY A;  3FR9 A;  3LG6 A;  4XRD A;  3NZN A;  3EWL A;  1ERT A;  4PQI A;  1OKD A;  5FWG A;  2LQO A;  4I97 A;  3TJJ A;  3W8S A;  3FY7 A;  4ML1 A;  4WBR D;  3HY2 A;  3JCM L;  2L6C A;  2ON5 A;  1EEM A;  1T7P B;  3D4T A;  5CYY A;  3TCO A;  1ZZY A;  1GP1 A;  2DKI A;  4QQ7 A;  4TXV A;  4FYU A;  1ILO A;  3A5W A;  2ZUP A;  1T8E B;  2LUS A;  5AGY A;  1TRW A;  3PIN A;  3GL5 A;  3DRN A;  2YP6 A;  2PGT A;  2ZCT A;  1XOA A;  3GX0 A;  4MF6 A;  3LEF A;  4LMV A;  1KEB A;  2EIO A;  3GH6 A;  1AAZ A;  4JU5 A;  3TJF A;  2GLR A;  3ISO A;  2QA1 A;  3HVS A;  2YWO A;  5IM9 A;  3TKS A;  5ECN B;  1MDI A;  3F8U A;  4TN8 A;  4XTS A;  2L59 A;  2IN3 A;  2AB6 A;  1TI1 A;  2H6X A;  3ERW A;  1HNB A;  1AC1 A;  2VLV A;  4KDX A;  2VM2 A;  1SL2 B;  3IAM 2;  1T4Y A;  4HUA A;  5JWO B;  2R3X A;  2PVQ A;  2C0D A;  3NIV A;  3LW9 A;  4TR4 A;  3M9K A;  3IHG A;  1M9A A;  2H1D A;  1XFL A;  2FUG 2;  2YJH A;  4GWR A;  2WS2 A;  3GYK A;  4JE1 A;  2L6D A;  1X5E A;  3J7Y b;  3IOS A;  2H0I A;  1FB0 A;  2GT6 A;  3C8E A;  1T00 A;  4YH2 A;  1A0F A;  1VF1 A;  1MD4 A;  3HD5 A;  3GKN A;  4HDE A;  3CYN A;  4KW6 A;  2NPB A;  2A2P A;  2E2M A;  4WF4 A;  2EIQ A;  2JZT A;  1T4Z A;  2FGX A;  1SL0 B;  5D9V A;  5DAK A;  1T1V A;  4RI6 A;  5ELA A;  1M2B A;  4X4J A;  3ZZX A;  4HI7 A;  1MDK A;  1EV4 A;  2MMA A;  4JED A;  2CT6 A;  3HJP A;  4PQ1 A;  1WOU A;  2A4H A;  1GSU A;  1SK2 A;  1NSW A;  4JR4 A;  1OYJ A;  2BJX A;  2C0F A;  2DJ2 A;  5BMU A;  2DMM A;  2HYX A;  2R2J A;  3FEU A;  5ECQ B;  5L71 A;  2J23 A;  5DAK B;  1AUC A;  1V98 A;  4BVX B;  20GS A;  4BWS A;  4ULX A;  2FWF A;  2P5Q A;  4J57 E;  1OC9 B;  1V58 A;  2N5F A;  3IPZ A;  4E8H A;  1PL2 A;  3EVI A;  5E4W A;  2OE0 A;  3IR4 A;  3E9J B;  2VCW A;  2I81 A;  1ZGN A;  2R0C A;  1XW5 A;  4K0G A;  2IWT A;  1R26 A;  2X99 A;  3CTG A;  3ZIT A;  3C71 A;  2LV3 A;  2JSZ A;  3FMW A;  1OE8 A;  1M99 A;  2OKA A;  5GST A;  2NBS A;  5DQY A;  1EOG A;  1U3A A;  3IRA A;  1A2J A;  4OO4 A;  1YEX A;  2ALB A;  1EOH A;  2LST A;  3HKR A;  1ABA A;  4BL7 A;  4XS1 A;  2P31 A;  2K9F A;  3C1R A;  4ZL8 A;  1XCC A;  4MPF A;  5D9W A;  2LJK A;  3QAG A;  2M72 A;  2CAQ A;  1XBS A;  3RPP A;  4YAP A;  2LJA A;  4NWY A;  3TRX A;  4ZB8 A;  2I1U A;  4PQH A;  1EEJ A;  4HQS A;  3LYK A;  2OBK A;  4I8B A;  2FCH A;  4BL7 B;  4EUY A;  4P3Y B;  3CSH A;  1SKS B;  4ECI A;  1M2A A;  2GZP A;  4TXO A;  3F3R A;  2VM1 A;  4EDY A;  2GSR A;  3BBY A;  2LNS A;  3FRC A;  3FR6 A;  4MK3 A;  2VD0 A;  5H5S A;  1AQX A;  1VF3 A;  3ZRD A;  2X8H A;  1B9Y C;  3LYP A;  4IKH A;  5A4U A;  2RM6 A;  5LCZ A;  2VO4 A;  3APQ A;  1UVZ A;  3LXT A;  3H8Q A;  4PTS A;  1FOV A;  4K2D A;  4J2F A;  2IIY A;  1YEP A;  3U5R E;  4BPY A;  3FR3 A;  1ZOF A;  3IK9 A;  4JR6 A;  5IMC A;  3VI5 A;  4KUN A;  4IBP A;  4FH8 A;  1GTI A;  2CV4 A;  1EZK A;  2IL3 A;  2C80 A;  4EDZ A;  1HNA A;  2LNT A;  3KTB A;  3HHV A;  2HSM A;  3GKK A;  5ECR B;  2QA2 A;  1U87 A;  2JZR A;  2R0G A;  1S3A A;  1ON4 A;  1XOB A;  1BQ7 A;  5D9X A;  1G7E A;  4GXZ A;  2YZH A;  4OMV A;  1F6M C;  3FZ4 A;  1PSQ A;  1HQO A;  4MA9 A;  1CQH A;  4KB3 A;  3L9V A;  3VWU A;  1TU7 A;  4OWY A;  3GST A;  5AIV A;  3CSJ A;  1YJ6 A;  3E0U A;  1OVN A;  3ZRE A;  2E7P A;  4LL1 B;  3M9J A;  2YNX A;  5CAX A;  5IPH A;  4BVY A;  1QXH A;  3C1S A;  10GS A;  1XWC A;  4Z2U A;  1K0O A;  1ZMA A;  5IIZ A;  3HVV A;  5DAL A;  4G0K A;  4EKZ A;  3D0Z A;  5C04 A;  1RK4 A;  1UC7 A;  1URM A;  4XHM A;  3D22 A;  5HR3 A;  3EYT A;  4PNG A;  5JCU A;  1V57 A;  3FKF A;  3EMP A;  1PKZ A;  2C3Q A;  2V2G A;  3WD6 A;  1FB6 A;  3D21 A;  1Z7P A;  2IPA A;  6GSV A;  1H75 A;  4TW5 A;  3EC3 A;  3P90 A;  3DKS A;  3US3 A;  3EIN A;  5D73 A;  2GTU A;  2WUL A;  4DEJ A;  4MDC A;  4NHW A;  2GZY A;  5DAL B;  1GL8 A;  4AJ7 A;  4HS1 A;  1JZD A;  3K8N A;  2FWH A;  2FWE A;  1VRS D;  4MH2 A;  5JCG A;  1B48 A;  3KCM A;  5DCH A;  5F06 A;  1PX6 A;  1EV9 A;  1K0M A;  2XPE A;  3LFL A;  3UEM A;  1QK8 A;  2ZNM A;  4WKW A;  2KOK A;  2TRX A;  4PUR A;  3Q6O A;  2WZ9 A;  3DVW A;  3TOU A;  2HRK A;  3H1N A;  4NV2 A;  4D73 B;  4OCF A;  3QFA C;  1SKW B;  1GSD A;  4G9H A;  1XWG A;  1UN2 A;  3GNJ A;  3IC8 A;  12GS A;  4V2L A;  1EGO A;  2C3T A;  1JHB A;  3UAR A;  2VL2 A;  3PR8 A;  1O73 A;  2GQK A;  3TKR A;  4IEL A;  5G2Z A;  4ECC A;  2EC4 A;  4OFN A;  3M0F A;  2YOI A;  1ERV A;  2YCD A;  3Q18 A;  1JZO A;  2VCV A;  4BA7 A;  4KF9 A;  2DJK A;  1GUL A;  2GS3 A;  3ME7 A;  4Q5N A;  3MWH A;  2K18 A;  5CO3 A;  3M8N A;  2FHE A;  5F07 A;  3O6T A;  5DJM A;  3BCK A;  3ZIJ A;  2B1K A;  1USB A;  1IYH A;  2IMI A;  3GKX A;  1XPV A;  1BJX A;  3TKS C;  4AF2 A;  3MYD A;  3DML A;  3L4N A;  3QD9 A;  2B5E A;  1ML6 A;  4GSS A;  5H5R A;  4FQU A;  3GKM A;  4IJI A;  4K5S A;  1K3L A;  5J9B A;  1ERW A;  4ZIL A;  1H4O A;  2BTO T;  2CQ9 A;  1TW9 A;  2GQL A;  4Z7X A;  2KP2 A;  2YWM A;  2LTK A;  3KJY A;  4AGS A;  4XCS A;  2YWI A;  2V6K A;  1TRV A;  3QPM A;  4HEA 2;  4G19 A;  4EIP A;  3TGZ A;  2B6M A;  3M1G A;  3FK8 A;  2A2R A;  1I5G A;  2FLS A;  2VL9 A;  4V1A p;  2UZ8 A;  2VLT A;  4KAE A;  4NV5 A;  2IMK A;  1Z3E A;  4MJE A;  5FHI A;  2D2Z A;  4MMM A;  1O81 A;  1JFU A;  3KMO A;  1O8W A;  2WB9 A;  2H70 A;  3RHC A;  4LA1 A;  4MAB A;  4LLR A;  2GSS A;  1SL1 B;  3GHA A;  1TTZ A;  5G1L A;  1YF0 A;  1SJZ A;  4N10 A;  6GST A;  1XVQ A;  2DJJ A;  2HZF A;  2V41 A;  4HJ2 A;  3H4K A;  3FZ5 A;  3LOR A;  3KZQ A;  4N0V A;  4WET A;  1XWA A;  1OKT A;  1K0N A;  5IO0 A;  1KBN A;  4MF5 A;  5CRD A;  4O5Q A;  1BAY A;  1T3B A;  4YQV A;  2VAF A;  3BD2 A;  3HZ4 A;  5KOW A;  3HJO A;  5COH A;  3OR5 A;  1F9M A;  3DXB A;  1VF2 A;  4MJA A;  2VL3 A;  1OC8 A;  2DKH A;  2QSI A;  2MYG A;  3TRQ A;  4AJ8 A;  1NM3 A;  3H93 A;  2GZZ A;  1EWX A;  1BG5 A;  1W4V A;  2N5A A;  3VWV A;  4RUV A;  1M9B A;  4IP6 A;  4IS0 A;  1XW9 A;  2FA8 A;  3KXO A;  1TOF A;  5D93 A;  1IYI A;  1F3A A;  2L5O A;  3TKP A;  1NW2 A;  5ENU A;  1B9X C;  2C8U A;  1GTA A;  2PMT A;  4KSO A;  3I9V 2;  4ECB A;  3CRT A;  3G7Y A;  4XRA A;  4EO3 A;  2CVD A;  1WMJ A;  3UBL A;  1K0C A;  1TP9 A;  3GUS A;  3LSZ A;  2LRT A;  3FW2 A;  2PUK C;  2GST A;  5CRE A;  3Q19 A;  5INY A;  4MJC A;  2AAW A;  2C3N A;  2TIR A;  3F0I A;  2AJQ B;  2F51 A;  4K8M A;  2X4A A;  1TRS A;  1A24 A;  2MMO A;  4HZ2 A;  1G0T A;  2L4C A;  1KNG A;  1TK8 B;  3IHQ A;  22GS A;  1GUM A;  3UVT A;  3S9F A;  1F2E A;  4BVX A;  4ZL7 A;  2H1G A;  2IJY A;  3VPT A;  14GS A;  1TK5 B;  1OC9 A;  4OCE A;  3TB2 A;  5G1K A;  2MMN A;  2HNL A;  2HSH A;  1C72 A;  1X0R A;  4WR4 A;  4X1U A;  2LRN A;  3N5O A;  1FOH A;  3FZ9 A;  2JAC A;  3NOF A;  3C73 A;  5LNK e;  3TJK A;  2OJL A;  1Y6E A;  1THX A;  2DJ0 A;  2JU5 A;  2VD1 A;  1F3B A;  2QC7 A;  1PD2 1;  5ECK B;  4J56 E;  2YZU A;  3CSI A;  4WBJ A;  4TR3 A;  2X49 A;  6GSW A;  4L0U A;  3O76 A;  3QAW A;  3GH9 A;  3WGD A;  5B6M A;  2YN1 A;  3FYG A;  2O7K A;  4G2E A;  1J0F A;  2RII A;  5EPF A;  1PA3 A;  3I6A A;  4HQZ A;  2C0E A;  1XW6 A;  3LXZ A;  4I2U A;  4AJ6 A;  2PN8 A;  5G5F A;  2Z9S A;  5J5N A;  3RDW A;  2B3S A;  1SJ6 A;  1GWC A;  2X8C A;  5AIS A;  3KEB A;  3VLN A;  18GS A;  1BYE A;  1Z5Y E;  5G31 A;  1YZX A;  2P5R A;  4K0N A;  3VUR A;  4RQR A;  3IBH A;  6GSY A;  1X9W B;  4ZL9 A;  4EVM A;  2IFQ B;  3ZFB A;  1PQN A;  4TVE A;  3L9S A;  1R7H A;  3QAV A;  4Z2T A;  4IN0 A;  2PPT A;  4KND A;  3TJG A;  2WJU A;  3ED3 A;  1XWB A;  4PX1 A;  3ZIV A;  5ECI B;  1QFN A;  4BWQ A;  3ME8 A;  1N8J A;  3F4R A;  5IMA A;  1A8Y A;  4ZXG A;  5ID2 B;  2PVO C;  1YF1 A;  4F82 A;  3EUR A;  5A4W A;  2H75 A;  1THO A;  4KSM A;  1ERU A;  2H0H A;  4PXO A;  3HCZ A;  2OA7 A;  1G6Y A;  3EE2 A;  6GSS A;  4TKY A;  2DBC A;  4IHU A;  2HLS A;  1X9S B;  4CDO A;  4K5R A;  2I4A A;  5LD0 A;  1HNC A;  3ERG A;  2HE3 A;  3G7I A;  3EU4 A;  2WDU A;  1Y25 A;  5ECP B;  5GSS A;  4XIH A;  2K6V A;  3F6D A;  4KE3 A;  1AW9 A;  3MAK A;  5IMV A;  4GCI A;  4G10 A;  5IPG A;  3ZL5 A;  3A3T A;  1M0U A;  5CP1 A;  4F0B A;  4O92 A;  3HXS A;  2VCZ A;  2O87 A;  4I5Q A;  4Q5F A;  3CXG A;  2DML A;  3DYR A;  3KD0 A;  2NVL A;  2PWJ A;  3DD3 A;  1NHO A;  4QL9 A;  1MD3 A;  4EL1 A;  2B7J A;  1OE7 A;  4G0I A;  2VL2 C;  1X5C A;  4HJM A;  5ECH B;  4ZBB A;  1QUW A;  2NDO A;  1ZYQ B;  2XBQ A;  2XC2 A;  3HA9 A;  4NAX A;  3APS A;  3PPU A;  3RBT A;  4POL A;  2OAD A;  1WRY A;  3F4T A;  2HI7 A;  4L8E A;  4LMW A;  2H73 A;  2IMD A;  2C0G A;  17GS A;  2F8F A;  1CQG A;  4ZBD A;  5EVO A;  4O5U A;  5IMD A;  1DE1 A;  2MMZ A;  4TRX A;  3IAS 2;  3FHK A;  3A2X A;  5KEJ A;  4FYC A;  2RM5 A;  2LQQ A;  5ECL B;  1J08 A;  1DSB A;  4F03 A;  1FO5 A;  2AYT A;  4D73 A;  3BOA A;  4YQM A;  2HRF A;  1A2L A;  1PL1 A;  1TRU A;  2DJ3 A;  4PGT A;  2DJ1 A;  2FD3 A;  2LJR A;  3GUR A;  1MDJ A;  1G7O A;  4GQF A;  2AHE A;  1Z7R A;  3KP8 A;  4TR1 B;  2KP1 A;  4A5P A;  4IP1 A;  1WWJ A;  2WFC A;  2B5Y A;  2O8V B;  5D8I A;  5EY6 A;  1TXX A;  2LRC A;  1SD8 A;  4ZB6 A;  3R3E A;  3CRU A;  2B5X A;  4CW9 A;  4K7I A;  4WXT A;  1JLV A;  4YKG A;  1EGR A;  3HVX A;  1GLP A;  5J9C A;  4L5O A;  4JZQ A;  3L78 A;  1GTB A;  3M3M A;  3LJR A;  1A0R P;  3ZMK A;  4K6X A;  2H1A A;  4DSQ A;  4X43 A;  3MNG A;  4MZW A;  3TDG A;  4H86 A;  2P0G A;  1V2A A;  4KH7 A;  1TK0 B;  1FG4 A;  4WR5 A;  2JZS A;  2V32 A;  3DEX A;  2JL4 A;  2CVB A;  2X64 A;  2VCT A;  1WIK A;  2L5L A;  5JWQ B;  5DCG A;  2HSY A;  4PUF C;  4I2T A;  2K8S A;  3QMX A;  2REM A;  4MF7 A;  2ES7 A;  5DDL A;  3F63 A;  3W6G A;  2CZ2 A;  2GVP A;  4QL7 A;  5GAN D;  2WGR A;  4ZIJ A;  1SEN A;  19GS A;  3C7M A;  3W8J A;  2G2Q A;  2A2S A;  4LL4 B;  5JWR B;  5H5Q A;  5B7C A;  1GSQ A;  3F9U A;  3VFI A;  2C1Y A;  4YAV A;  5F0G A;  3VI7 A;  1SK0 A;  5DQS A;  2WCI A;  2H76 A;  1J9B A;  2VLU A;  4ZB9 A;  1G6W A;  1E2Y A;  4FO5 A;  2N5B A;  4IVF A;  1ZYN A;  1ST9 A;  4POK A;  4OFT A;  1GNE A;  4KGI A;  2H71 A;  2R37 A;  1TDI A;  5CRH A;  4ID0 A;  3GTU B;  2YV7 A;  2F8A A;  3R2Q A;  2AV4 A;  2YV9 A;  1GSY A;  4MP4 A;  2H01 A;  1K0D A;  2YJ7 A;  3IE3 A;  1PN0 A;  4IJ3 A;  4DSS B;  4KCE A;  4V2N A;  2HZE B;  4HOJ A;  3A2V A;  4F9Z A;  6GSU A;  5CRG A;  3BJ5 A;  2YWN A;  3UVH A;  3LGC A;  6GSX A;  2IMF A;  7GSS A;  1GUH A;  4TOP A;  5CRW A;  2VIM A;  3J7Y k;  4EIQ A;  3GA4 A;  2OE1 A;  1FVJ A;  3MSZ A;  1B4Q A;  1E6B A;  1TI3 A;  2X8G A;  3GV1 A;  5G5E A;  3ZML A;  1I9D A;  1F37 A;  4POM A;  1EP8 A;  4CY6 A;  3P8W A;  3TJB A;  4MNN A;  3EPT A;  4HU9 A;  2DSA A;  1ZL9 A;  1FAA A;  2ON7 A;  4WF5 A;  4XS4 A;  3MIX A;  1S3D A;  1ZYP A;  2R4V A;  1XVW A;  1K3Y A;  1U88 A;  3WYW A;  4GF0 A;  4N30 A;  3KH7 A;  1ZCP A;  3EMX A;  1FVK A;  9GSS A;  1ACV A;  4HZ4 A;  3DIE A;  4ISD A;  1AIU A;  3ZTL A;  1O8X A;  1MEK A;  3DGQ A;  2F9S A;  2I9H A;  4ECJ A;  1GSF A;  4XS4 B;  1GSE A;  2MBT A;  2H66 A;  2VCX A;  1RQM A;  4GTU A;  1YQ1 A;  3WT2 A;  4ML6 A;  5HFI A;  3SBC A;  3KTL A;  4CHS A;  3IV4 A;  1A23 A;  2WRT A;  3H79 A;  5HR2 A;  1B8X A;  2R6K A;  1BED A;  2OE3 A;  4I6X A;  3PH9 A;  3KP9 A;  4Q5Q A;  4CY8 A;  5A5K A;  1B4P A;  3ZVJ A;  3KM6 A;  1WJK A;  2GDR A;  2CX4 A;  1R5P A;  2NTO A;  1QQ2 A;  2DC5 A;  2FY6 A;  4JBB A;  5D96 A;  5A4V A;  3I69 A;  2J9H A;  2H72 A;  4YQU A;  3HYP A;  3ZYW A;  3RHB A;  5GAP D;  3HZ8 A;  4PNF A;  3UL3 A;  3D5J A;  4EF0 A;  3F3Q A;  1JZW A;  3V1W A;  1A2M A;  3BCI A;  3ERF A;  2M80 A;  3E3E A;  1PRX A;  2HRN A;  2QKE A;  2AUV A;  1ZYE A;  1GUK A;  3KGK A;  5ECM B;  1XZO A;  3GL3 A;  1Q4J A;  3KMN A;  4F0C A;  4USS A;  1GNW A;  3TUE A;  1TU8 A;  4K7O A;  1HD2 A;  4EXJ A;  2F3M A;  5HQP A;  3EU3 A;  5J4U A;  2CVK A;  3WGX A;  3APO A;  3GRX A;  3P2A A;  1SKR B;  3HDC A;  4EC0 A;  1NHY A;  1BX9 A;  13GS A;  3FZA A;  5C00 A;  5HR1 A;  1OAZ A;  2LEG A;  3LWA A;  2IFQ A;  4GRF A;  1MTC A;  4RI7 A;  4V1A g;  3QOU A;  4MZC A;  4HU7 A;  2V1M A;  1XXU A;  2E2G A;  2H1B A;  1VF4 A;  2RUE A;  3CBU A;  4ZBA A;  2R0P A;  2RUF A;  2H6Z A;  3WGE A;  2H6Y A;  2C4J A;  5ID2 A;  1JZR A;  5B8B A;  1X5D A;  2VOC A;  3IA1 A;  2L4Q A;  1GLQ A;  1RW1 A;  3UMA A;  3TKS E;  1WPI A;  1PMT A;  5D9T A;  1LU4 A;  4L0W A;  5IOW A;  2KHP A;  4Z2R A;  3TKQ A;  1TKD B;  2CX3 A;  4FIW A;  2TRC P;  1S3C A;  2M46 A;  4O32 A;  5ELG A;  2H19 A;  1XWK A;  1GSS A;  1M7T A;  4NMU A;  5ABR A;  5AIX A;  2HFD A;  4GST A;  2PER A;  5HFK A;  3RAZ A;  4MJB A;  1SJI A;  3UBK A;  1DE2 A;  4TR0 A;  1Z6M A;  2DLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...