3RDWA

Putative arsenate reductase from yersinia pestis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
DVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKELLQQLGFSDARQLMRTKEDLYKTLNLDDRGLTQDQLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative arsenate reductase
publication title Putative arsenate reductase from Yersinia pestis.
rcsb
source organism Yersinia pestis
total genus 35
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3rdwA00
2L4QA 2WFCA 3U6VA 1LJRA 2K8SA 2PBJA 5IMCA 1AUCA 2WRTA 4GF0A 2IMDA 1A0RP 5IMAA 3D5JA 2X8GA 2N5FA 2L5LA 1NSWA 1TRWA 2P31A 4LLRA 2X8CA 5F05A 5A4VA 1OVNA 2VO4A 5J5NA 6GSYA 5ECMB 4F2IA 3R2QA 3TUEA 3EMXA 4DEJA 3N5OA 2ES7A 2VLVA 1TP9A 2WJUA 2CZ3A 3FY7A 2KHPA 4K0GA 3C1RA 4LL4B 4N10A 4N0ZA 2XHFA 3DWVA 4N0VA 5COHA 2MBTA 2LS5A 1Y25A 1LU4A 3M3MA 5F8BA 4PUAA 5ECOB 4POBA 2K9FA 5D9WA 2ZNMA 2KOKA 5JWRB 1FG4A 2V2GA 1ERTA 2HZEA 4JU5A 2GTUA 5G31A 3WGXA 2VIMA 1GH2A 3GV1A 4KDUA 4LL1B 2C3QA 1U88A 3KP8A 4AGSA 3HCZA 2LSTA 2JSZA 2FLSA 4XTSA 3RDWA 4RQRA 1GSFA 2V6KA 2CX3A 3M1GA 3GIXA 5ECIB 5EVOA 3DXBA 1IYHA 1WIKA 2FWFA 2YJHA 1TDIA 1XW6A 2CVDA 4J56E 1A2MA 3F4RA 1GSEA 1A8LA 3ZMKA 2JL4A 3TKPA 4MJCA 4MLYA 3KH9A 1O81A 2R2JA 1RQMA 3HDCA 2DJ3A 3GKXA 4P3YB 13GSA 1BJXA 2OACA 1ERWA 2O85A 1XOAA 2WGRA 2E2MA 3NZNA 1E2YA 3ERWA 2B5YA 3K8NA 2QGVA 4IHUA 3IOSA 3MNGA 2AB6A 3F3QA 4ZL9A 2NDOA 3GL5A 3CYNA 1K0NA 1WOUA 6GSVA 4DVCA 4X0XA 3LGCA 2V32A 2RUFA 4IP1A 2D2ZA 2DMLA 4FYCA 4F9ZA 1PQNA 4EDZA 4EKZA 5ID2B 3UVTA 16GSA 1Z5YE 3ERGA 2VLTA 2F8FA 1XW9A 2ON5A 3QOUA 1A2JA 1EOHA 4POMA 2NBSA 1EGRA 2Z9SA 3HY2A 1M0UA 1B9YC 1SYRA 2R3XA 2B3SA 3M0FA 2YCDA 2MMZA 3TOUA 3VPQA 3ZMLA 3H4KA 2C0FA 3FR9A 3UIWA 5CAXA 2H73A 4ZL7A 4HDEA 3DGQA 3UOMA 1GUHA 4YAPA 3QFAC 4ULXA 3GHAA 4WETA 1G6WA 1F6MC 2C0GA 2KP1A 2OE1A 1DSBA 2DMMA 3P2AA 4EC0A 2VCVA 4XRDA 3ERFA 4NXIA 4CDOA 3V1WA 4ZBAA 1SJIA 4TVEA 4K8MA 2AUVA 5GZZB 1MDJA 4KCAA 4CW9A 5G30A 4K0NA 2H1BA 2HZEB 3D4TA 3KTLA 4FH8A 3ZYWA 4GXZA 5DJLA 5CRGA 4E8HA 1I5GA 1O7UA 2IL3A 6GSUA 3J7Yk 3ZRDA 3FYGA 3KXOA 4G9HA 2P5RA 1AQXA 3EURA 1XWAA 6GSTA 3TJFA 1F2EA 1A0FA 3KZQA 3BBYA 3C71A 2E2GA 2KLXA 3GUSA 3H1NA 3AY8A 4HU7A 4MPGA 1VF3A 2GSTA 5ECLB 3PR8A 2H1DA 2GSRA 1GLQA 3APQA 2O7KA 5AGYA 5LNKe 1K0CA 2VCWA 3S9FA 2VCXA 1SENA 5KN0A 1M2DA 3L4NA 3MAKA 3I43A 4IS0A 5A4WA 2PMTA 4ZILA 4XS6A 1FB0A 2GQKA 4ZB6A 3VFIA 5J3RA 3CXGA 1GL8A 1FHEA 1U3AA 3QFBC 1U6TA 2ALBA 3GTUA 4HOJA 1XBSA 1EP7A 2VCQA 2GQMA 3IDVA 3WGDA 2LQOA 4WF4A 5G2ZA 2H71A 2PGTA 3QDNA 1X0RA 1O8WA 9GSSA 1PMTA 1ZYEA 5DBQA 3GFKA 4E8EA 3M9KA 4ZB9A 2YZHA 2H19A 5D9XA 5DQYA 1W89A 1JLVA 1XWBA 5AN1A 3LORA 5B8AA 1KTEA 2XPDA 4ML6A 5IMDA 2PVOC 2IMIA 2JU5A 3F6DA 1SL2B 3QPMA 2VM2A 5J9CA 1Z6NA 1K3LA 4IJ3A 1THOA 2FWHA 2QSIA 1FAAA 1J9BA 2H0GA 3CRTA 3L9VA 1EZKA 1GTUA 4BA7A 2H76A 4PUFC 4WR5A 3EINA 1ILOA 3TKSC 1YF1A 4EF0A 3MDKA 1ABAA 2QKEA 3FEUA 1OC9B 2HNLA 3EMPA 1AIUA 4TN8A 3UBLA 1V40A 5IO0A 2X64A 1DUGA 4JZQA 1SL0B 2MMNA 2FUG2 3O3TA 5DAKB 1PRXA 3G7YA 1ERUA 3ZVJD 1O8XA 5E59A 2N5BA 1SKSB 4Q5QA 3LSZA 1TI1A 1R5PA 1WP0A 2B7KA 1V58A 1YQ1A 3VURA 2PVQA 1GRXA 2JADA 2FWEA 1HNAA 2E7PA 4BWQA 2H6XA 3LJRA 2EC4A 1DBYA 3GA4A 5FHIA 1G0TA 3FZ9A 4ZXGA 5GAPD 1ERVA 1T1VA 1SD9A 1ZOFA 1UA5A 5KN1A 2P0GA 1HNCA 2NPBA 2H30A 2CQ9A 5D73A 2CT6A 5JCUA 4FO5A 2IIYA 1OC8A 5ELGA 1XVWA 3G7JA 2O89A 2TRXA 4QL7A 1FVKA 4HI7A 4ZBDA 3FK8A 3NIVA 5B8BA 3GL3A 1BX9A 2LNTA 2YP6A 4O5RA 2H8LA 3KD0A 4NPBA 3A2VA 1PD21 2DJ0A 2JSYA 2L59A 2OBKA 2VM1A 3LQ7A 6GSWA 2LUSA 2QC7A 3GTUB 5H5QA 1UN2A 3EVIA 4HZ4A 3IA1A 5CRHA 2H72A 5IPGA 5ECKB 5H5SA 1B8XA 3D6IA 3RHCA 1TK8B 5ID2A 3MSZA 4HJMA 3VI5A 2VL2A 4OD7A 2DIYA 2YANA 1PA3A 1ACVA 3GN3A 2I9HA 3VLNA 2LQQA 4KUNA 4D73B 1AC1A 4AJ8A 3HD5A 1XVQA 1XFLA 1V57A 5B7CA 4TXVA 5ABRA 3TCOA 5FWGA 4TXOA 6GSSA 4JEDA 4GRFA 3IV4A 2WCIA 2HI7A 5LD0A 3CMIA 4V1Ap 4J2FA 1JFUA 1S3CA 4AJ7A 2AHEA 4ZIJA 2HSYA 5DQSA 1XCCA 1A2LA 4ECCA 5DJMA 3DRNA 3PH9A 4WXTA 1TXXA 1SJ6A 4AJ6A 2GDRA 1GP1A 4XHMA 5A5KA 2K8VA 3FZ5A 3H93A 1K3OA 4KB3A 1OYJA 2M72A 3G9BA 3ZL5A 5IOXA 1EV9A 1OAZA 3PINA 1G7EA 2DIZA 1ZCPA 2TIRA 2IFQB 1XWGA 2J9HA 2L57A 2VCZA 3IAS2 1JLWA 2GT5A 1A24A 3KGKA 4ZBBA 2WULA 1B48A 3E9JB 4ECBA 1YZXA 1ZZYA 5EPFA 3IK9A 3U5RE 3GSSA 1HNBA 4K2DA 1PSQA 3CTGA 1TOFA 3I6AA 4IP6A 1ZL9A 1JZWA 2HLSA 5F07A 1V98A 1X5CA 4DSQA 4IKHA 4ZL8A 1E6BA 3VK9A 4V2NA 4EUYA 1JZRA 1FW1A 2K6VA 1HD2A 3D21A 1GSQA 2CAIA 1OKDA 5G5FA 2JZTA 2C3TA 4I6XA 4EXJA 4MH2A 1YKCA 4TR4A 1KBNA 1WE0A 4ZB8A 4XS4B 1GSSA 2LV3A 2GZYA 3CSHA 3FW2A 2FHEA 4EL1A 3H79A 4X1UA 5ECHB 3G7IA 1R26A 1MDKA 3GURA 4MCUA 2H0HA 2IWTA 5JWQB 2GZZA 4MK3A 2L5OA 2A2RA 4OO4A 5ECSA 1VF4A 1GSYA 2EIQA 3QMXA 4TXOB 3HVVA 2KP2A 5J9BA 3GKNA 1OC9A 1SJZA 4KGIA 4WKWA 1MD3A 2MBSA 4NV5A 3IHQA 4GCIA 2RM6A 1Q98A 3KP9A 3KCMA 3WYWA 2VL2C 1M99A 3GSTA 4I5QA 2ZUPA 1GTAA 5DAKA 1Z9HA 1LBKA 4NHWA 3WD6A 4XRAA 3F0IA 1BAYA 1K0MA 4V1Ag 1BQ7A 2FA8A 4F0BA 5D9VA 4KSMA 2H1GA 2B5EA 2CAQA 2HRFA 3LG6A 2OADA 1YY7A 2AYTA 3F6FA 1GLPA 2I1UA 2F3MA 3HVSA 3EYTA 4BL7A 3LYKA 3H8QA 3KH7A 4ECIA 3VI7A 1T4ZA 3DYRA 3EC3A 1R7HA 3QAGA 4L8EA 1ML6A 3GNJA 1EEMA 1RW1A 11GSA 5CRDA 1T7PB 5HFGA 3IR4A 1TRVA 3EE2A 5IPHA 4WF5A 1QGVA 1PL1A 1VRSD 3DIEA 2GLRA 1JZDA 3QCPA 5ECNB 1SK1A 4PQ1A 4OFNA 3Q74A 4GSTA 2IPAA 4OCFA 1EEJA 2MYGA 1NM3A 2IMFA 3HYPA 19GSA 5D8IA 1JHBA 1SKRB 4ML1A 4QQ7A 1TU8A 2LJAA 4LA1A 1O85A 2H0IA 3FHKA 1XOBA 4GWRA 2MMAA 4GTUA 1Z6MA 1TRUA 5F0GA 1KEBA 3DD3A 3GMFA 1XWCA 4GLTA 5AIXA 2YV9A 1X5DA 2H01A 4IW9A 2WS2A 3D22A 4FIWA 3GYKA 1FVJA 3C1SA 4IBPA 2PERA 2VD0A 2WZ9A 5IMVA 4NAXA 2GVPA 4D73A 2VL3A 2EIRA 2RIIA 4MJBA 1USBA 3IBHA 1F3BA 1SK2A 1SK0A 1SU9A 4FYBA 4AF2A 1T8EB 5F06A 1YEPA 5IO2A 2H6YA 2DLXA 2YWMA 1HQOA 4MH3A 4GQFA 1AQWA 2FGXA 2XBQA 3TJBA 2BMXA 2L4CA 5AIVA 4OFTA 3D0ZA 2V6OA 2HE3A 1XZOA 3JCML 2TRCP 2LNSA 3GKKA 1U3IA 1F37A 2A2SA 2FY6A 2V41A 1AW9A 3CSIA 1GUMA 2G0FA 3WT1A 4MF6A 3FRCA 2GT6A 1VF1A 4RUVA 3CRUA 3M9JA 2AAWA 1YF0A 1X9SB 5IOWA 1OKTA 4MABA 3CBUA 4BPYA 2DJJA 4TR1B 3Q18A 1UC7A 3GRXA 1UVZA 1ST9A 2YNXA 4N11A 4TR0A 1T4YA 2IFQA 5FT3A 5G1LA 4K9ZA 4PQHA 4TKYA 2M46A 2AJQB 1R5AA 3BD2A 2CVBA 3KMOA 4RI6A 2XBIA 4PXOA 1TKDB 5IMZA 2B6MA 4PNFA 3W6GA 2YPMA 3L0HA 3TB2A 5D9TA 5HFIA 1GTIA 4HUAA 1N8JA 2C4JA 2O87A 4YH2A 1Z7RA 3PGTA 4H86A 4I97A 2RLIA 5J4UA 2MMOA 3E0UA 1N2AA 3DVWA 2NVLA 4GQCA 3DKSA 1X9MB 3UAPA 2OE3A 3SWLA 3VWVA 3HZ8A 3IK7A 3TJGA 5INYA 3HXSA 1U87A 1PKZA 2REMA 3TRQA 2LTKA 2HRNA 4I8BA 3F63A 4YQMA 3BJ5A 4MZBA 2DJKA 3NOFA 4HS1A 5KN3A 4NWYA 2CA8A 1EV4A 4ID0A 2X99A 2JACA 1WRYA 1K0DA 4KDXA 3APSA 4MMMA 3ZVJA 4ECJA 1M9BA 4MZCA 4CHSA 4JE1A 3VWWA 1TU7A 4XS4A 2LJKA 2H75A 5G5EA 5CRWA 1OC3A 2AV4A 1EGOA 4G2EA 3UARA 3GKMA 1GSDA 4Q5RA 3QD9A 3W8SA 1ZYQB 4XIHA 5D96A 3WT2A 1ON4A 3HKRA 5HR0A 4RI7A 2CX4A 3KIJA 3RHBA 2YJ7A 4PURA 4EO3A 3Q6OA 3QAWA 1K0OA 4KH7A 3FR6A 2VCTA 2BTOT 4KX4A 1XXUA 2JZSA 1AXDA 3MWHA 5HR1A 2PU9C 4O92A 1PGTA 3A5WA 3IXRA 3TDGA 3HHVA 3TKRA 3ZTLA 1GNEA 1TJDA 5AISA 3UMAA 2C0DA 3GH9A 1I9DA 4DSSB 3F4TA 1TI3A 3GX0A 1GSUA 1OE8A 3F8UA 3I9V2 2F9SA 4IVFA 2RM5A 3ZFBA 4K7OA 1NHYA 2ON7A 4TRXA 5C04A 4L0UA 4LMWA 4HQZA 3RAZA 3TKSE 1ZGNA 3L9SA 2NTOA 3ZIJA 2ZCTA 2V1MA 4Q5FA 4IELA 5JWOB 1W4VA 20GSA 2HFDA 4OWYA 5DCGA 3ED3A 4L0WA 1XPVA 2MZCA 2B1KA 4IQAA 1O6JA 4ILFA 3TGZA 2C80A 2GGTA 4WEYA 5DDLA 3F4SA 2H6ZA 1C72A 1J08A 3C8EA 2LRNA 1XIYA 3ISOA 3Q19A 1Z7PA 3A3TA 4POKA 5CP1A 1T3BA 3UL3A 2E0QA 4Z7XA 5ECPB 1M2BA 4K7NA 2VLUA 2LJRA 3GH6A 4MF5A 4PQIA 12GSA 1DE1A 1MD4A 1FOVA 3QR6A 1GNWA 1T00A 4K7IA 1M2AA 1K0AA 3FZ4A 2VOCA 1TW9A 4O32A 1GULA 2OJLA 1NHOA 3M8NA 4V2LA 4POLA 3CTFA 3KEBA 3HVXA 5H5RA 1X5EA 1B4QA 1A8YA 4GSSA 2X8HA 1O73A 1GWCA 3EU4A 2R37A 3ZREA 2GSSA 1M9AA 4HEA2 2DBCA 1BG5A 2FA4A 1B9XC 4MP4A 3LWAA 3P8WA 2HT9A 5CO3A 2R5GA 4PX1A 4MJAA 1VGLA 1K0BA 4WBRD 4KSOA 1YEXA 3BCKA 1R4WA 2YV7A 1PL2A 1X9WB 4YQUA 4IQ1A 3TKQA 1MDIA 3TKSA 4KW6A 3HJMA 1WWJA 5HQPA 4PGTA 2HZFA 2IMKA 2BJXA 4NHZA 4YAVA 3ME8A 4OFMA 2XC2A 3IC4A 3FZAA 2P5QA 2PN8A 3L78A 5G1KA 1MTCA 3ZIVA 3APOA 4IJIA 4PNGA 3EWLA 3LFLA 2JZRA 22GSA 5D93A 3UEMA 2CV4A 2DJ2A 2OA7A 4V2MA 5KN2A 2DC5A 2GSQA 3QAVA 3RPPA 3EU3A 2PPTA 1QMVA 1XWKA 5A4UA 2KUCA 4MDCA 5DVBA 3IRAA 5IQYA 3TRXA 1WPIA 2YZUA 2C8UA 4KAEA 4TOPA 5ECRB 5DALA 3RPNA 4JR6A 4KE3A 4OO5A 1F3AA 1K3YA 2HYXA 18GSA 2YWNA 2LEGA 1PX7A 1GTBA 3BCIA 1Q4JA 2EIOA 2GZPA 1EWXA 5ENUA 4TR1A 4K1FA 3DVXA 1DE2A 2WB9A 2WDUA 3FR3A 1YJ6A 3P7XA 1QXHA 2LKUA 2GS3A 2YOIA 3US3A 4KA0A 4I2UA 1NW2A 3ZZXA 1FB6A 4MA9A 2CVKA 3LYPA 3ZFLA 3HJOA 1WMJA 1QUWA 4WR4A 2B5XA 1IYIA 1S3DA 2H66A 4YQVA 5IIZA 1SKWB 1FO5A 3E3EA 4DSRA 3L9UA 1A23A 1F9MA 3C7MA 4HU9A 1CQHA 2RUEA 2LRCA 3ZLPA 5HR3A 2I81A 3KJYA 1MEKA 2OBIA 4GSNA 8GSSA 1HYUA 4N30A 1M7TA 2M80A 3UVHA 5B6NA 1AAZA 3BOAA 5GAND 3GX8A 3LEFA 5JCWA 2GQLA 2OE0A 3N9JA 4IN0A 1H75A 5EL8A 4MZWA 2LRTA 1Z3EA 1H4OA 1YKAA 1QK8A 5CREA 4HZ2A 4LMVA 2YN1A 4K6XA 3J7Yb 4G10A 4TW5A 2FNOA 3ZITA 4ISDA 2CZ2A 2YWIA 5DCHA 2H74A 1QQ2A 4RQXA 2N5AA 1EP8A 3F9UA 2HSHA 3OR5A 2H1AA 2FD3A 4EDYA 1J0FA 4X43A 1TTZA 4XS1A 3IE3A 3KM6A 3TJKA 4WBJA 7GSSA 3TRPA 10GSA 17GSA 2A4VA 4L5OA 4MPFA 4BVXA 4F82A 2VL9A 1WJKA 4J57E 5CYYA 2I3YA 2IN3A 5EY6A 1PKWA 1G7OA 1BYEA 2R4VA 4HQSA 1URMA 3TJJA 5ECQB 2FCHA 4XCSA 4NMUA 4KCEA 4EVMA 4DSSA 2PUKC 4TR3A 2IMEA 4FYUA 3O76A 1XW5A 2PWJA 2J23A 5DALB 4OCEA 2G2QA 1THXA 6GSXA 4NV2A 1V9WA 2VUPA 2VAFA 4G19A 3IAM2 1JZOA 2I4AA 2C1YA 2K18A 2C0EA 1OE7A 3ME7A 5GSTA 3RBTA 2B7JA 4KNDA 3UJ1A 5B6MA 3D4MA 1B4PA 4Q5NA 2DSAA 2XPEA 5C00A 3A2XA 3IPZA 4EE0A 3LXTA 4I2TA 2OKAA 3WGEA 2B1LA 3UBKA 5IM9A 5CNWA 5JCGA 1VF2A 3HJPA 1ZMAA 2R6KA 3VWUA 3W8JA 2VD1A 2O8VB 4JR4A 1V2AA 1KNGA 4KDYA 4QL9A 4BWSA 4F03A 1SYXA 3I69A 4MJEA 3O6TA 3DMLA 5E4WA 4OMVA 1PX6A 2HXKA 1QFNA 2H70A 2YWOA 1SL1B 5J41A 3CSJA 3P90A 3VWXA 3KTBA 2DJ1A 3A2WA 3DEXA 4HJ2A 4O7HA 5ELAA 3HA9A 1YDKA 4L5LA 1TK0B 1RK4A 5IMFA 5HR2A 1BEDA 3TOTA 2FWGA 2C3NA 14GSA 3SBCA 3F3RA 5HFKA 4IGJA 4MF7A 3HZ4A 1G6YA 1GUKA 4F0CA 2L6CA 1EOGA 1S3AA 1TK5B 4JRRA 1SD8A 5GSSA 1CQGA 3VPTA 1AQVA 5KEJA 4JBBA 1Y6EA 5LCZA 4BVYA 2L6DA 3FKFA 1TRSA 2F8AA 4ACSA 3C73A 5L71A 2IJYA 1PN9A 3KMNA 3LXZA 2F51A
chains in the Genus database with same CATH superfamily
2L4QA 2WFCA 3U6VA 1LJRA 2K8SA 2PBJA 5IMCA 1AUCA 2WRTA 4GF0A 4BVXB 2IMDA 1A0RP 5IMAA 3D5JA 2X8GA 2N5FA 2L5LA 1NSWA 1TRWA 2P31A 3PPUA 4LLRA 2X8CA 5F05A 5A4VA 1OVNA 2VO4A 5J5NA 6GSYA 2QA2A 5ECMB 4F2IA 3R2QA 3TUEA 3EMXA 4DEJA 3N5OA 2ES7A 2VLVA 1TP9A 2WJUA 2CZ3A 3FY7A 2KHPA 4K0GA 3C1RA 4LL4B 4N10A 4N0ZA 2XHFA 3DWVA 4N0VA 5COHA 2MBTA 2LS5A 1Y25A 1LU4A 3M3MA 5F8BA 4PUAA 5ECOB 4POBA 2K9FA 5D9WA 2ZNMA 2KOKA 5JWRB 1FG4A 5KOWA 2V2GA 1ERTA 2HZEA 4JU5A 2GTUA 5G31A 3WGXA 2VIMA 1GH2A 3GV1A 4KDUA 4LL1B 2C3QA 1U88A 3KP8A 4AGSA 3HCZA 2LSTA 2JSZA 2FLSA 4XTSA 3RDWA 4RQRA 1GSFA 2V6KA 2CX3A 3M1GA 3GIXA 5ECIB 5EVOA 3DXBA 2DKIA 2R0CA 1IYHA 4G0LA 1WIKA 2FWFA 2YJHA 1TDIA 1XW6A 2CVDA 4J56E 1A2MA 3F4RA 1GSEA 1A8LA 3ZMKA 2JL4A 3TKPA 4MJCA 4MLYA 3KH9A 1O81A 2R2JA 1RQMA 3HDCA 2DJ3A 3GKXA 4P3YB 13GSA 1BJXA 2OACA 1ERWA 2O85A 1XOAA 2WGRA 2E2MA 1M3JA 3NZNA 1E2YA 3ERWA 2B5YA 3K8NA 2QGVA 4IHUA 3IOSA 1FOHA 3MNGA 2AB6A 3F3QA 4ZL9A 2NDOA 3GL5A 3CYNA 1K0NA 1WOUA 6GSVA 4DVCA 4A5PA 4X0XA 3LGCA 2V32A 4BVYB 2RUFA 4IP1A 2D2ZA 2DMLA 4FYCA 4F9ZA 1PQNA 4EDZA 4EKZA 5ID2B 3UVTA 16GSA 1Z5YE 3ERGA 2VLTA 2F8FA 1XW9A 2ON5A 3QOUA 1A2JA 1EOHA 4POMA 2NBSA 1EGRA 2Z9SA 3HY2A 1M0UA 1B9YC 1SYRA 2R3XA 2B3SA 3M0FA 2YCDA 2MMZA 3TOUA 3VPQA 3ZMLA 4YKFA 3H4KA 2C0FA 3FR9A 3UIWA 5CAXA 2H73A 4ZL7A 4HDEA 3DGQA 3UOMA 1GUHA 4YAPA 3QFAC 4ULXA 3GHAA 4WETA 1G6WA 4G0IA 1F6MC 4EIPA 2C0GA 2KP1A 2OE1A 1DSBA 2DMMA 3P2AA 4EC0A 2VCVA 4XRDA 3ERFA 4NXIA 4CDOA 3V1WA 4ZBAA 1SJIA 4TVEA 4K8MA 2AUVA 5GZZB 1MDJA 4KCAA 4CW9A 5G30A 4K0NA 2H1BA 2HZEB 3D4TA 3KTLA 4FH8A 3ZYWA 4GXZA 5DJLA 5CRGA 4E8HA 1I5GA 1O7UA 2IL3A 6GSUA 3J7Yk 3ZRDA 3FYGA 3KXOA 4G9HA 2P5RA 1AQXA 3EURA 1XWAA 6GSTA 3TJFA 1F2EA 1A0FA 3KZQA 3BBYA 3C71A 2E2GA 2KLXA 3GUSA 3H1NA 3AY8A 4HU7A 4MPGA 1VF3A 2GSTA 3MYDA 5ECLB 3PR8A 2H1DA 2GSRA 1GLQA 3APQA 2O7KA 5AGYA 5LNKe 1K0CA 2VCWA 3S9FA 2VCXA 1SENA 5KN0A 1M2DA 3L4NA 3MAKA 3I43A 4IS0A 5A4WA 2PMTA 4ZILA 4XS6A 1FB0A 2GQKA 4ZB6A 3VFIA 5J3RA 3CXGA 1GL8A 1FHEA 1U3AA 3QFBC 1U6TA 2ALBA 3GTUA 4HOJA 1XBSA 1EP7A 2VCQA 2GQMA 3IDVA 3WGDA 2LQOA 4WF4A 5G2ZA 4CY8A 2H71A 2PGTA 3QDNA 1X0RA 1O8WA 9GSSA 1PMTA 1ZYEA 5DBQA 3GFKA 4E8EA 3M9KA 4ZB9A 2YZHA 2H19A 5D9XA 5DQYA 1W89A 1JLVA 1XWBA 3LORA 5AN1A 5B8AA 1KTEA 2XPDA 4ML6A 5IMDA 2PVOC 2IMIA 2JU5A 2UZ8A 3F6DA 1SL2B 3QPMA 2VM2A 5J9CA 1Z6NA 1K3LA 4IJ3A 1THOA 2FWHA 2QSIA 4YKGA 1FAAA 1J9BA 2H0GA 2DKHA 3CRTA 3L9VA 4BIKA 1EZKA 1GTUA 4BA7A 2H76A 4PUFC 4WR5A 3EINA 1ILOA 3TKSC 1YF1A 4EF0A 3MDKA 1ABAA 2QKEA 3FEUA 1OC9B 2HNLA 3EMPA 1AIUA 4TN8A 3UBLA 1V40A 5IO0A 2X64A 1DUGA 4JZQA 1SL0B 2MMNA 2FUG2 3O3TA 5DAKB 1PRXA 1ZYNA 3G7YA 1ERUA 3ZVJD 1O8XA 5E59A 2N5BA 1SKSB 4Q5QA 3LSZA 1TI1A 1R5PA 1WP0A 2B7KA 1V58A 1YQ1A 3VURA 2PVQA 1GRXA 2JADA 2FWEA 1HNAA 2E7PA 4BWQA 2H6XA 3LJRA 2EC4A 1DBYA 4BL7B 3GA4A 5FHIA 1G0TA 3FZ9A 4ZXGA 5GAPD 1ERVA 1T1VA 1SD9A 1ZOFA 1UA5A 5KN1A 2P0GA 1HNCA 2NPBA 2H30A 2CQ9A 5D73A 2CT6A 5JCUA 4FO5A 2IIYA 1OC8A 5ELGA 1XVWA 3G7JA 2O89A 2TRXA 4QL7A 1FVKA 4HI7A 4ZBDA 3FK8A 3NIVA 5B8BA 3GL3A 1BX9A 2LNTA 2YP6A 4O5RA 2H8LA 3KD0A 4NPBA 3A2VA 1PD21 2DJ0A 2JSYA 2L59A 2OBKA 2VM1A 3LQ7A 6GSWA 2LUSA 2QC7A 3GTUB 5H5QA 1UN2A 3EVIA 4HZ4A 3IA1A 5CRHA 2H72A 5IPGA 5ECKB 5H5SA 1B8XA 3D6IA 3RHCA 1TK8B 5ID2A 3MSZA 4HJMA 3VI5A 2VL2A 4OD7A 2DIYA 2YANA 1PA3A 1ACVA 3GN3A 2I9HA 3VLNA 2LQQA 4KUNA 4D73B 1AC1A 4AJ8A 3HD5A 1XVQA 1XFLA 1V57A 5B7CA 4G0KA 4TXVA 2A4HA 5ABRA 3TCOA 5FWGA 4TXOA 6GSSA 4JEDA 4GRFA 3IV4A 2WCIA 2HI7A 5LD0A 3CMIA 4V1Ap 4J2FA 1JFUA 1S3CA 4AJ7A 3IC8A 2AHEA 4ZIJA 2HSYA 5DQSA 2QA1A 1XCCA 1A2LA 4ECCA 5DJMA 3DRNA 3PH9A 4WXTA 1TXXA 1SJ6A 4AJ6A 2GDRA 1GP1A 3EPTA 4XHMA 5A5KA 2K8VA 3FZ5A 3H93A 1K3OA 4KB3A 1OYJA 2M72A 1S3RA 3G9BA 4CY6A 3ZL5A 5IOXA 1EV9A 1OAZA 3PINA 1G7EA 2DIZA 1ZCPA 2TIRA 2IFQB 1XWGA 2J9HA 2L57A 2VCZA 3IAS2 1JLWA 2GT5A 2HRAA 1A24A 3KGKA 4ZBBA 2WULA 3CQFA 1B48A 3E9JB 4ECBA 1YZXA 1ZZYA 5EPFA 3IK9A 3U5RE 3GSSA 1HNBA 4K2DA 1PSQA 3CTGA 1TOFA 3I6AA 3IHGA 4IP6A 1ZL9A 1JZWA 2HLSA 5F07A 1V98A 1X5CA 4DSQA 4IKHA 4ZL8A 1E6BA 3VK9A 4V2NA 4EUYA 1JZRA 1FW1A 2K6VA 1HD2A 2R0PA 3D21A 1GSQA 2CAIA 1OKDA 5G5FA 2JZTA 2C3TA 4I6XA 4EXJA 4MH2A 1YKCA 4TR4A 1KBNA 1WE0A 4ZB8A 4XS4B 1GSSA 2LV3A 2GZYA 3CSHA 3FW2A 2FHEA 4EL1A 3H79A 4X1UA 5ECHB 3G7IA 1R26A 1MDKA 3GURA 4MCUA 2H0HA 2IWTA 5JWQB 2GZZA 4MK3A 2L5OA 2A2RA 4OO4A 5ECSA 1VF4A 1GSYA 2EIQA 2R0GA 3QMXA 4TXOB 3HVVA 2KP2A 5J9BA 3GKNA 1OC9A 1SJZA 4KGIA 4WKWA 1MD3A 2MBSA 4NV5A 3IHQA 4GCIA 2RM6A 1Q98A 3KP9A 3KCMA 3WYWA 2VL2C 1M99A 3GSTA 4I5QA 2ZUPA 1GTAA 5DAKA 1Z9HA 1LBKA 4NHWA 3WD6A 4XRAA 3F0IA 1BAYA 1K0MA 4V1Ag 1BQ7A 2FA8A 4F0BA 5D9VA 4KSMA 2H1GA 2B5EA 4PTSA 2CAQA 2HRFA 3LG6A 2OADA 1YY7A 2AYTA 3F6FA 1GLPA 2I1UA 2F3MA 3HVSA 3EYTA 4BL7A 3LYKA 3H8QA 3KH7A 4ECIA 3VI7A 1T4ZA 4Z2TA 3DYRA 3EC3A 1R7HA 3QAGA 4L8EA 1ML6A 3GNJA 1EEMA 1RW1A 11GSA 5CRDA 1T7PB 5HFGA 3IR4A 1TRVA 3EE2A 5IPHA 4WF5A 1QGVA 1PL1A 1VRSD 3DIEA 2GLRA 1JZDA 3QCPA 5ECNB 1SK1A 4PQ1A 4OFNA 3Q74A 4GSTA 2IPAA 4OCFA 1EEJA 2MYGA 1NM3A 2IMFA 3HYPA 19GSA 5D8IA 1JHBA 1SKRB 4ML1A 4QQ7A 1TU8A 2LJAA 4LA1A 1O85A 2H0IA 3FHKA 1XOBA 4GWRA 2MMAA 4GTUA 4ICYA 1Z6MA 1TRUA 5F0GA 1KEBA 3DD3A 3GMFA 1XWCA 4GLTA 5AIXA 2YV9A 1X5DA 2H01A 4IW9A 2WS2A 3D22A 4FIWA 3GYKA 1FVJA 3C1SA 4IBPA 2PERA 2VD0A 2WZ9A 5IMVA 4NAXA 2GVPA 4K5SA 4D73A 2VL3A 2EIRA 2RIIA 4MJBA 1USBA 3IBHA 1F3BA 1SK2A 1SK0A 1SU9A 4FYBA 4AF2A 1T8EB 5F06A 1YEPA 5IO2A 2H6YA 2DLXA 2YWMA 1HQOA 4MH3A 4GQFA 1AQWA 2FGXA 2X4AA 2XBQA 3TJBA 2BMXA 2L4CA 5AIVA 4OFTA 3D0ZA 2V6OA 2HE3A 1XZOA 3JCML 2TRCP 2LNSA 3GKKA 1U3IA 1F37A 2A2SA 2FY6A 2V41A 1AW9A 3CSIA 1GUMA 2G0FA 3WT1A 4MF6A 3FRCA 2GT6A 1VF1A 4RUVA 3FMWA 3CRUA 3M9JA 2AAWA 1YF0A 4MNNA 1X9SB 5IOWA 4EIQA 1OKTA 4MABA 3CBUA 4BPYA 2DJJA 4TR1B 3Q18A 1UC7A 3GRXA 1UVZA 1ST9A 2YNXA 4N11A 4TR0A 1T4YA 2IFQA 5FT3A 5G1LA 4K9ZA 4PQHA 4TKYA 2M46A 2AJQB 1R5AA 3BD2A 2CVBA 3KMOA 4RI6A 2XBIA 4PXOA 1TKDB 5IMZA 2B6MA 4PNFA 3W6GA 2YPMA 3L0HA 3TB2A 5D9TA 5HFIA 1GTIA 4HUAA 1N8JA 2C4JA 2O87A 4YH2A 1Z7RA 3PGTA 4H86A 4I97A 2RLIA 5J4UA 2MMOA 3E0UA 1N2AA 3DVWA 2NVLA 3R3EA 4GQCA 3DKSA 1X9MB 3UAPA 2OE3A 3SWLA 3VWVA 3HZ8A 3IK7A 3TJGA 5INYA 3HXSA 1U87A 1PKZA 2REMA 3TRQA 2LTKA 2HRNA 4I8BA 3F63A 4YQMA 3BJ5A 4MZBA 2DJKA 3NOFA 4HS1A 5KN3A 4NWYA 2CA8A 1EV4A 4ID0A 2X99A 2JACA 1WRYA 1K0DA 4KDXA 3APSA 4X4JA 4MMMA 3ZVJA 4ECJA 1M9BA 4MZCA 4CHSA 4JE1A 3VWWA 1TU7A 4XS4A 2LJKA 2H75A 5G5EA 5BMUA 5CRWA 1OC3A 2AV4A 1EGOA 4G2EA 3UARA 3GKMA 1GSDA 4Q5RA 3QD9A 3W8SA 1ZYQB 4XIHA 5D96A 3WT2A 1ON4A 3HKRA 5HR0A 4RI7A 2CX4A 3KIJA 2HSMA 3RHBA 2YJ7A 4PURA 4EO3A 3Q6OA 2A2PA 3QAWA 1K0OA 4KH7A 3FR6A 2VCTA 4KX4A 2BTOT 1XXUA 2JZSA 1AXDA 3MWHA 5HR1A 2PU9C 4O92A 1PGTA 3A5WA 3IXRA 3TDGA 3HHVA 3TKRA 3ZTLA 1GNEA 1TJDA 5AISA 3UMAA 2C0DA 3GH9A 1I9DA 4DSSB 3F4TA 1TI3A 3GX0A 1GSUA 1OE8A 4O5QA 3F8UA 3I9V2 2F9SA 4IVFA 2RM5A 3ZFBA 4K7OA 1NHYA 2ON7A 4TRXA 5C04A 4L0UA 4K5RA 4LMWA 4HQZA 3RAZA 3TKSE 1ZGNA 3L9SA 2NTOA 3ZIJA 2ZCTA 2V1MA 4Q5FA 4IELA 5JWOB 1W4VA 20GSA 2HFDA 4OWYA 5DCGA 1PFOA 3ED3A 4L0WA 4FQUA 1XPVA 2MZCA 2B1KA 4IQAA 1O6JA 4ILFA 3TGZA 2C80A 2GGTA 4WEYA 5DDLA 3F4SA 2H6ZA 1C72A 1J08A 3C8EA 2LRNA 1XIYA 3ISOA 3Q19A 1Z7PA 4Z2UA 3A3TA 4POKA 5CP1A 1T3BA 3UL3A 2E0QA 4Z7XA 5ECPB 1M2BA 4K7NA 2VLUA 2LJRA 3GH6A 1ZYPA 4MF5A 4PQIA 12GSA 1DE1A 1MD4A 1FOVA 3QR6A 1GNWA 1T00A 4K7IA 1M2AA 1K0AA 3FZ4A 2VOCA 1TW9A 4O32A 1GULA 2OJLA 1NHOA 3M8NA 4V2LA 4POLA 3CTFA 3KEBA 4Z2RA 3HVXA 5H5RA 1X5EA 1B4QA 1A8YA 3MIXA 2X8HA 4GSSA 1O73A 1GWCA 1XG8A 2R37A 3EU4A 3ZREA 2GSSA 1M9AA 4HEA2 2DBCA 1BG5A 2FA4A 1B9XC 4MP4A 3LWAA 3P8WA 2HT9A 5CO3A 2R5GA 4PX1A 4MJAA 1VGLA 1K0BA 4WBRD 4KSOA 1YEXA 3BCKA 1R4WA 2YV7A 1PL2A 1X9WB 4YQUA 4IQ1A 3TKQA 1MDIA 3TKSA 4KW6A 3HJMA 4KF9A 1WWJA 5HQPA 1M3IA 4PGTA 2HZFA 2IMKA 2BJXA 4NHZA 4YAVA 3ME8A 4OFMA 2XC2A 3IC4A 3FZAA 2P5QA 2PN8A 3L78A 5G1KA 1MTCA 3ZIVA 3APOA 4IJIA 4PNGA 3EWLA 3LFLA 2JZRA 22GSA 5D93A 3UEMA 2CV4A 2DJ2A 2OA7A 4V2MA 5KN2A 2DC5A 2GSQA 3QAVA 3RPPA 3EU3A 2PPTA 1QMVA 1XWKA 5A4UA 2KUCA 4MDCA 5DVBA 3IRAA 5IQYA 3TRXA 1WPIA 2YZUA 2C8UA 4KAEA 4TOPA 5ECRB 5DALA 3RPNA 4JR6A 4KE3A 4OO5A 1F3AA 1K3YA 3LW9A 2HYXA 18GSA 2YWNA 2LEGA 1PX7A 1GTBA 3BCIA 1Q4JA 2EIOA 2GZPA 1EWXA 5ENUA 4TR1A 4K1FA 3DVXA 1DE2A 2WB9A 2WDUA 3FR3A 1YJ6A 3A5IA 3P7XA 1QXHA 2LKUA 2GS3A 2YOIA 3US3A 4KA0A 4I2UA 1NW2A 3ZZXA 1FB6A 4MA9A 2CVKA 3LYPA 3ZFLA 3HJOA 1WMJA 1QUWA 2HRKA 4WR4A 2B5XA 1IYIA 1S3DA 2H66A 4YQVA 5IIZA 1SKWB 1FO5A 3E3EA 4DSRA 3L9UA 1A23A 1F9MA 3C7MA 4HU9A 1CQHA 2RUEA 2LRCA 3ZLPA 5HR3A 2I81A 3KJYA 1MEKA 2OBIA 4GSNA 8GSSA 1HYUA 4N30A 1M7TA 2M80A 3UVHA 5B6NA 1AAZA 3BOAA 5GAND 3GX8A 3LEFA 5JCWA 2GQLA 2OE0A 3N9JA 4IN0A 1H75A 5EL8A 4MZWA 2LRTA 1Z3EA 1H4OA 1YKAA 1QK8A 5CREA 4HZ2A 4LMVA 2YN1A 4K6XA 3J7Yb 4G10A 4TW5A 2FNOA 3ZITA 4ISDA 2CZ2A 5KOXA 2YWIA 5DCHA 2H74A 1QQ2A 4RQXA 2N5AA 1EP8A 3F9UA 2HSHA 3OR5A 2H1AA 2FD3A 4EDYA 4K2XA 1J0FA 4X43A 1TTZA 4XS1A 3IE3A 3KM6A 4O5UA 3TJKA 4WBJA 7GSSA 3TRPA 10GSA 17GSA 2A4VA 4L5OA 4MPFA 4BVXA 4F82A 2VL9A 1WJKA 4J57E 5CYYA 2I3YA 2IN3A 5EY6A 1PKWA 1G7OA 1BYEA 2R4VA 4HQSA 1URMA 3TJJA 5ECQB 2FCHA 4XCSA 4NMUA 1PN0A 4KCEA 4EVMA 4DSSA 2PUKC 4TR3A 2IMEA 4FYUA 3O76A 1XW5A 2PWJA 3HVNA 5BRTA 2J23A 5DALB 4OCEA 2G2QA 1THXA 6GSXA 4NV2A 1V9WA 2VUPA 2VAFA 4HSCX 4G19A 3IAM2 1JZOA 2I4AA 2C1YA 2K18A 2C0EA 1OE7A 3ME7A 5GSTA 3RBTA 2B7JA 4KNDA 3UJ1A 4USSA 5B6MA 3D4MA 1B4PA 4Q5NA 2DSAA 2XPEA 5C00A 3A2XA 3IPZA 4EE0A 3LXTA 4I2TA 2OKAA 3WGEA 2B1LA 3UBKA 5IM9A 5CNWA 5JCGA 1VF2A 3HJPA 1ZMAA 2R6KA 3VWUA 3W8JA 2VD1A 2O8VB 4JR4A 1V2AA 1KNGA 4KDYA 4QL9A 4BWSA 4F03A 1SYXA 3I69A 4MJEA 3O6TA 3DMLA 5E4WA 4OMVA 1PX6A 2HXKA 1QFNA 2H70A 2YWOA 1SL1B 5J41A 3CSJA 3P90A 3VWXA 3KTBA 2DJ1A 3A2WA 3DEXA 4HJ2A 4O7HA 5ELAA 3HA9A 1YDKA 2X49A 4L5LA 1TK0B 1RK4A 5IMFA 5HR2A 1BEDA 3TOTA 2FWGA 2C3NA 14GSA 3SBCA 3F3RA 5HFKA 4IGJA 4MF7A 3HZ4A 1G6YA 1GUKA 4F0CA 2L6CA 1EOGA 1S3AA 1TK5B 4JRRA 1SD8A 5GSSA 1CQGA 3VPTA 1AQVA 5KEJA 4JBBA 1Y6EA 5LCZA 4BVYA 2L6DA 3FKFA 1TRSA 2F8AA 4ACSA 3C73A 5L71A 2IJYA 1PN9A 3KMNA 3LXZA 2F51A
chains in the Genus database with same CATH topology
2L4QA 2WFCA 3U6VA 1LJRA 2K8SA 2PBJA 5IMCA 1AUCA 2WRTA 4GF0A 4BVXB 2IMDA 1A0RP 5IMAA 3D5JA 2X8GA 2N5FA 2L5LA 1NSWA 1TRWA 2P31A 3PPUA 4LLRA 2X8CA 5F05A 5A4VA 1OVNA 2VO4A 5J5NA 6GSYA 2QA2A 5ECMB 4F2IA 3R2QA 3TUEA 3EMXA 4DEJA 3N5OA 2ES7A 2VLVA 1TP9A 2WJUA 2CZ3A 3FY7A 2KHPA 4K0GA 3C1RA 4LL4B 4N10A 4N0ZA 2XHFA 3DWVA 4N0VA 5COHA 2MBTA 2LS5A 1Y25A 1LU4A 3M3MA 5F8BA 4PUAA 5ECOB 4POBA 2K9FA 5D9WA 2ZNMA 2KOKA 5JWRB 1FG4A 5KOWA 2V2GA 1ERTA 2HZEA 4JU5A 2GTUA 5G31A 3WGXA 2VIMA 1GH2A 3GV1A 4KDUA 4LL1B 2C3QA 1U88A 3KP8A 4AGSA 3HCZA 2LSTA 2JSZA 2FLSA 4XTSA 3RDWA 4RQRA 1GSFA 2V6KA 2CX3A 3M1GA 3GIXA 5ECIB 5EVOA 3DXBA 2DKIA 2R0CA 1IYHA 4G0LA 1WIKA 2FWFA 2YJHA 1TDIA 1XW6A 2CVDA 4J56E 1A2MA 3F4RA 1GSEA 1A8LA 3ZMKA 2JL4A 3TKPA 4MJCA 4MLYA 3KH9A 1O81A 2R2JA 1RQMA 3HDCA 2DJ3A 3GKXA 4P3YB 13GSA 1BJXA 2OACA 1ERWA 2O85A 1XOAA 2WGRA 2E2MA 3NZNA 1E2YA 3ERWA 2B5YA 3K8NA 2QGVA 4IHUA 3IOSA 1FOHA 3MNGA 2AB6A 3F3QA 4ZL9A 2NDOA 3GL5A 3CYNA 1K0NA 1WOUA 6GSVA 4DVCA 4A5PA 4X0XA 3LGCA 2V32A 4BVYB 2RUFA 4IP1A 2D2ZA 2DMLA 4FYCA 4F9ZA 1PQNA 4EDZA 4EKZA 5ID2B 3UVTA 16GSA 1Z5YE 3ERGA 2VLTA 2F8FA 1XW9A 2ON5A 3QOUA 1A2JA 1EOHA 4POMA 2NBSA 1EGRA 2Z9SA 3HY2A 1M0UA 1B9YC 1SYRA 2R3XA 2B3SA 3M0FA 2YCDA 2MMZA 3TOUA 3VPQA 3ZMLA 4YKFA 3H4KA 2C0FA 3FR9A 3UIWA 5CAXA 2H73A 4ZL7A 4HDEA 3DGQA 3UOMA 1GUHA 4YAPA 3QFAC 4ULXA 3GHAA 4WETA 1G6WA 4G0IA 1F6MC 4EIPA 2C0GA 2KP1A 2OE1A 1DSBA 2DMMA 3P2AA 4EC0A 2VCVA 4XRDA 3ERFA 4NXIA 4CDOA 3V1WA 4ZBAA 1SJIA 4TVEA 4K8MA 2AUVA 5GZZB 1MDJA 4KCAA 4CW9A 5G30A 4K0NA 2H1BA 2HZEB 3D4TA 3KTLA 4FH8A 3ZYWA 4GXZA 5DJLA 5CRGA 4E8HA 1I5GA 1O7UA 2IL3A 6GSUA 3J7Yk 3ZRDA 3FYGA 3KXOA 4G9HA 2P5RA 1AQXA 3EURA 1XWAA 6GSTA 3TJFA 1F2EA 1A0FA 3KZQA 3BBYA 3C71A 2E2GA 2KLXA 3GUSA 3H1NA 3AY8A 4HU7A 4MPGA 1VF3A 2GSTA 3MYDA 5ECLB 3PR8A 2H1DA 2GSRA 1GLQA 3APQA 2O7KA 5AGYA 5LNKe 1K0CA 2VCWA 3S9FA 2VCXA 1SENA 5KN0A 1M2DA 3L4NA 3MAKA 3I43A 4IS0A 5A4WA 2PMTA 4ZILA 4XS6A 1FB0A 2GQKA 4ZB6A 3VFIA 5J3RA 3CXGA 1GL8A 1FHEA 1U3AA 3QFBC 1U6TA 2ALBA 3GTUA 4HOJA 1XBSA 1EP7A 2VCQA 2GQMA 3IDVA 3WGDA 2LQOA 4WF4A 5G2ZA 4CY8A 2H71A 2PGTA 3QDNA 1X0RA 1O8WA 9GSSA 1PMTA 1ZYEA 5DBQA 3GFKA 4E8EA 3M9KA 4ZB9A 2YZHA 2H19A 5D9XA 5DQYA 1W89A 1JLVA 1XWBA 3LORA 5AN1A 5B8AA 1KTEA 2XPDA 4ML6A 5IMDA 2PVOC 2IMIA 2JU5A 2UZ8A 3F6DA 1SL2B 3QPMA 2VM2A 5J9CA 1Z6NA 1K3LA 4IJ3A 1THOA 2FWHA 2QSIA 4YKGA 1FAAA 1J9BA 2H0GA 2DKHA 3CRTA 3L9VA 1EZKA 1GTUA 4BA7A 2H76A 4PUFC 4WR5A 3EINA 1ILOA 3TKSC 1YF1A 4EF0A 3MDKA 1ABAA 2QKEA 3FEUA 1OC9B 2HNLA 3EMPA 1AIUA 4TN8A 3UBLA 1V40A 5IO0A 2X64A 1DUGA 4JZQA 1SL0B 2MMNA 2FUG2 3O3TA 5DAKB 1PRXA 1ZYNA 3G7YA 1ERUA 3ZVJD 1O8XA 5E59A 2N5BA 1SKSB 4Q5QA 3LSZA 1TI1A 1R5PA 1WP0A 2B7KA 1V58A 1YQ1A 3VURA 2PVQA 1GRXA 2JADA 2FWEA 1HNAA 2E7PA 4BWQA 2H6XA 3LJRA 2EC4A 1DBYA 4BL7B 3GA4A 5FHIA 1G0TA 3FZ9A 4ZXGA 5GAPD 1ERVA 1T1VA 1SD9A 1ZOFA 1UA5A 5KN1A 2P0GA 1HNCA 2NPBA 2H30A 2CQ9A 5D73A 2CT6A 5JCUA 4FO5A 2IIYA 1OC8A 5ELGA 1XVWA 3G7JA 2O89A 2TRXA 4QL7A 1FVKA 4HI7A 4ZBDA 3FK8A 3NIVA 5B8BA 3GL3A 1BX9A 2LNTA 2YP6A 4O5RA 2H8LA 3KD0A 4NPBA 3A2VA 1PD21 2DJ0A 2JSYA 2L59A 2OBKA 2VM1A 3LQ7A 6GSWA 2LUSA 2QC7A 3GTUB 5H5QA 1UN2A 3EVIA 4HZ4A 3IA1A 5CRHA 2H72A 5IPGA 5ECKB 5H5SA 1B8XA 3D6IA 3RHCA 1TK8B 5ID2A 3MSZA 4HJMA 3VI5A 2VL2A 4OD7A 2DIYA 2YANA 1PA3A 1ACVA 3GN3A 2I9HA 3VLNA 2LQQA 4KUNA 4D73B 1AC1A 4AJ8A 3HD5A 1XVQA 1XFLA 1V57A 5B7CA 4G0KA 4TXVA 2A4HA 5ABRA 3TCOA 5FWGA 4TXOA 6GSSA 4JEDA 4GRFA 3IV4A 2WCIA 2HI7A 5LD0A 3CMIA 4V1Ap 4J2FA 1JFUA 1S3CA 4AJ7A 3IC8A 2AHEA 4ZIJA 2HSYA 5DQSA 2QA1A 1XCCA 1A2LA 4ECCA 5DJMA 3DRNA 3PH9A 4WXTA 1TXXA 1SJ6A 4AJ6A 2GDRA 1GP1A 3EPTA 4XHMA 5A5KA 2K8VA 3FZ5A 3H93A 1K3OA 4KB3A 1OYJA 2M72A 3G9BA 4CY6A 3ZL5A 5IOXA 1EV9A 1OAZA 3PINA 1G7EA 2DIZA 1ZCPA 2TIRA 2IFQB 1XWGA 2J9HA 2L57A 2VCZA 3IAS2 1JLWA 2GT5A 2HRAA 1A24A 3KGKA 4ZBBA 2WULA 1B48A 3E9JB 4ECBA 1YZXA 1ZZYA 5EPFA 3IK9A 3U5RE 3GSSA 1HNBA 4K2DA 1PSQA 3CTGA 1TOFA 3I6AA 3IHGA 4IP6A 1ZL9A 1JZWA 2HLSA 5F07A 1V98A 1X5CA 4DSQA 4IKHA 4ZL8A 1E6BA 3VK9A 4V2NA 4EUYA 1JZRA 1FW1A 2K6VA 1HD2A 2R0PA 3D21A 1GSQA 2CAIA 1OKDA 5G5FA 2JZTA 2C3TA 4I6XA 4EXJA 4MH2A 1YKCA 4TR4A 1KBNA 1WE0A 4ZB8A 4XS4B 1GSSA 2LV3A 2GZYA 3CSHA 3FW2A 2FHEA 4EL1A 3H79A 4X1UA 5ECHB 3G7IA 1R26A 1MDKA 3GURA 4MCUA 2H0HA 2IWTA 5JWQB 2GZZA 4MK3A 2L5OA 2A2RA 4OO4A 5ECSA 1VF4A 1GSYA 2EIQA 2R0GA 3QMXA 4TXOB 3HVVA 2KP2A 5J9BA 3GKNA 1OC9A 1SJZA 4KGIA 4WKWA 1MD3A 2MBSA 4NV5A 3IHQA 4GCIA 2RM6A 1Q98A 3KP9A 3KCMA 3WYWA 2VL2C 1M99A 3GSTA 4I5QA 2ZUPA 1GTAA 5DAKA 1Z9HA 1LBKA 4NHWA 3WD6A 4XRAA 3F0IA 1BAYA 1K0MA 4V1Ag 1BQ7A 2FA8A 4F0BA 5D9VA 4KSMA 2H1GA 2B5EA 4PTSA 2CAQA 2HRFA 3LG6A 2OADA 1YY7A 2AYTA 3F6FA 1GLPA 2I1UA 2F3MA 3HVSA 3EYTA 4BL7A 3LYKA 3H8QA 3KH7A 4ECIA 3VI7A 1T4ZA 4Z2TA 3DYRA 3EC3A 1R7HA 3QAGA 4L8EA 1ML6A 3GNJA 1EEMA 1RW1A 11GSA 5CRDA 1T7PB 5HFGA 3IR4A 1TRVA 3EE2A 5IPHA 4WF5A 1QGVA 1PL1A 1VRSD 3DIEA 2GLRA 1JZDA 3QCPA 5ECNB 1SK1A 4PQ1A 4OFNA 3Q74A 4GSTA 2IPAA 4OCFA 1EEJA 2MYGA 1NM3A 2IMFA 3HYPA 19GSA 5D8IA 1JHBA 1SKRB 4ML1A 4QQ7A 1TU8A 2LJAA 4LA1A 1O85A 2H0IA 3FHKA 1XOBA 4GWRA 2MMAA 4GTUA 4ICYA 1Z6MA 1TRUA 5F0GA 1KEBA 3DD3A 3GMFA 1XWCA 4GLTA 5AIXA 2YV9A 1X5DA 2H01A 4IW9A 2WS2A 3D22A 4FIWA 3GYKA 1FVJA 3C1SA 4IBPA 2PERA 2VD0A 2WZ9A 5IMVA 4NAXA 2GVPA 4K5SA 4D73A 2VL3A 2EIRA 2RIIA 4MJBA 1USBA 3IBHA 1F3BA 1SK2A 1SK0A 1SU9A 4FYBA 4AF2A 1T8EB 5F06A 1YEPA 5IO2A 2H6YA 2DLXA 2YWMA 1HQOA 4MH3A 4GQFA 1AQWA 2FGXA 2X4AA 2XBQA 3TJBA 2BMXA 2L4CA 5AIVA 4OFTA 3D0ZA 2V6OA 2HE3A 1XZOA 3JCML 2TRCP 2LNSA 3GKKA 1U3IA 1F37A 2A2SA 2FY6A 2V41A 1AW9A 3CSIA 1GUMA 2G0FA 3WT1A 4MF6A 3FRCA 2GT6A 1VF1A 4RUVA 3FMWA 3CRUA 3M9JA 2AAWA 1YF0A 4MNNA 1X9SB 5IOWA 4EIQA 1OKTA 4MABA 3CBUA 4BPYA 2DJJA 4TR1B 3Q18A 1UC7A 3GRXA 1UVZA 1ST9A 2YNXA 4N11A 4TR0A 1T4YA 2IFQA 5FT3A 5G1LA 4K9ZA 4PQHA 4TKYA 2M46A 2AJQB 1R5AA 3BD2A 2CVBA 3KMOA 4RI6A 2XBIA 4PXOA 1TKDB 5IMZA 2B6MA 4PNFA 3W6GA 2YPMA 3L0HA 3TB2A 5D9TA 5HFIA 1GTIA 4HUAA 1N8JA 2C4JA 2O87A 4YH2A 1Z7RA 3PGTA 4H86A 4I97A 2RLIA 5J4UA 2MMOA 3E0UA 1N2AA 3DVWA 2NVLA 3R3EA 4GQCA 3DKSA 1X9MB 3UAPA 2OE3A 3SWLA 3VWVA 3HZ8A 3IK7A 3TJGA 5INYA 3HXSA 1U87A 1PKZA 2REMA 3TRQA 2LTKA 2HRNA 4I8BA 3F63A 4YQMA 3BJ5A 4MZBA 2DJKA 3NOFA 4HS1A 5KN3A 4NWYA 2CA8A 1EV4A 4ID0A 2X99A 2JACA 1WRYA 1K0DA 4KDXA 3APSA 4X4JA 4MMMA 3ZVJA 4ECJA 1M9BA 4MZCA 4CHSA 4JE1A 3VWWA 1TU7A 4XS4A 2LJKA 2H75A 5G5EA 5BMUA 5CRWA 1OC3A 2AV4A 1EGOA 4G2EA 3UARA 3GKMA 1GSDA 4Q5RA 3QD9A 3W8SA 1ZYQB 4XIHA 5D96A 3WT2A 1ON4A 3HKRA 5HR0A 4RI7A 2CX4A 3KIJA 2HSMA 3RHBA 2YJ7A 4PURA 4EO3A 3Q6OA 2A2PA 3QAWA 1K0OA 4KH7A 3FR6A 2VCTA 4KX4A 2BTOT 1XXUA 2JZSA 1AXDA 3MWHA 5HR1A 2PU9C 4O92A 1PGTA 3A5WA 3IXRA 3TDGA 3HHVA 3TKRA 3ZTLA 1GNEA 1TJDA 5AISA 3UMAA 2C0DA 3GH9A 1I9DA 4DSSB 3F4TA 1TI3A 3GX0A 1GSUA 1OE8A 4O5QA 3F8UA 3I9V2 2F9SA 4IVFA 2RM5A 3ZFBA 4K7OA 1NHYA 2ON7A 4TRXA 5C04A 4L0UA 4K5RA 4LMWA 4HQZA 3RAZA 3TKSE 1ZGNA 3L9SA 2NTOA 3ZIJA 2ZCTA 2V1MA 4Q5FA 4IELA 5JWOB 1W4VA 20GSA 2HFDA 4OWYA 5DCGA 3ED3A 4L0WA 4FQUA 1XPVA 2MZCA 2B1KA 4IQAA 1O6JA 4ILFA 3TGZA 2C80A 2GGTA 4WEYA 5DDLA 3F4SA 2H6ZA 1C72A 1J08A 3C8EA 2LRNA 1XIYA 3ISOA 3Q19A 1Z7PA 4Z2UA 3A3TA 4POKA 5CP1A 1T3BA 3UL3A 2E0QA 4Z7XA 5ECPB 1M2BA 4K7NA 2VLUA 2LJRA 3GH6A 1ZYPA 4MF5A 4PQIA 12GSA 1DE1A 1MD4A 1FOVA 3QR6A 1GNWA 1T00A 4K7IA 1M2AA 1K0AA 3FZ4A 2VOCA 1TW9A 4O32A 1GULA 2OJLA 1NHOA 3M8NA 4V2LA 4POLA 3CTFA 3KEBA 4Z2RA 3HVXA 5H5RA 1X5EA 1B4QA 1A8YA 3MIXA 2X8HA 4GSSA 1O73A 1GWCA 3EU4A 2R37A 3ZREA 2GSSA 1M9AA 4HEA2 2DBCA 1BG5A 2FA4A 1B9XC 4MP4A 3LWAA 3P8WA 2HT9A 5CO3A 2R5GA 4PX1A 4MJAA 1VGLA 1K0BA 4WBRD 4KSOA 1YEXA 3BCKA 1R4WA 2YV7A 1PL2A 1X9WB 4YQUA 4IQ1A 3TKQA 1MDIA 3TKSA 4KW6A 3HJMA 4KF9A 1WWJA 5HQPA 4PGTA 2HZFA 2IMKA 2BJXA 4NHZA 4YAVA 3ME8A 4OFMA 2XC2A 3IC4A 3FZAA 2P5QA 2PN8A 3L78A 5G1KA 1MTCA 3ZIVA 3APOA 4IJIA 4PNGA 3EWLA 3LFLA 2JZRA 22GSA 5D93A 3UEMA 2CV4A 2DJ2A 2OA7A 4V2MA 5KN2A 2DC5A 2GSQA 3QAVA 3RPPA 3EU3A 2PPTA 1QMVA 1XWKA 5A4UA 2KUCA 4MDCA 5DVBA 3IRAA 5IQYA 3TRXA 1WPIA 2YZUA 2C8UA 4KAEA 4TOPA 5ECRB 5DALA 3RPNA 4JR6A 4KE3A 4OO5A 1F3AA 1K3YA 3LW9A 2HYXA 18GSA 2YWNA 2LEGA 1PX7A 1GTBA 3BCIA 1Q4JA 2EIOA 2GZPA 1EWXA 5ENUA 4TR1A 4K1FA 3DVXA 1DE2A 2WB9A 2WDUA 3FR3A 1YJ6A 3A5IA 3P7XA 1QXHA 2LKUA 2GS3A 2YOIA 3US3A 4KA0A 4I2UA 1NW2A 3ZZXA 1FB6A 4MA9A 2CVKA 3LYPA 3ZFLA 3HJOA 1WMJA 1QUWA 2HRKA 4WR4A 2B5XA 1IYIA 1S3DA 2H66A 4YQVA 5IIZA 1SKWB 1FO5A 3E3EA 4DSRA 3L9UA 1A23A 1F9MA 3C7MA 4HU9A 1CQHA 2RUEA 2LRCA 3ZLPA 5HR3A 2I81A 3KJYA 1MEKA 2OBIA 4GSNA 8GSSA 1HYUA 4N30A 1M7TA 2M80A 3UVHA 5B6NA 1AAZA 3BOAA 5GAND 3GX8A 3LEFA 5JCWA 2GQLA 2OE0A 3N9JA 4IN0A 1H75A 5EL8A 4MZWA 2LRTA 1Z3EA 1H4OA 1YKAA 1QK8A 5CREA 4HZ2A 4LMVA 2YN1A 4K6XA 3J7Yb 4G10A 4TW5A 2FNOA 3ZITA 4ISDA 2CZ2A 5KOXA 2YWIA 5DCHA 2H74A 1QQ2A 4RQXA 2N5AA 1EP8A 3F9UA 2HSHA 3OR5A 2H1AA 2FD3A 4EDYA 4K2XA 1J0FA 4X43A 1TTZA 4XS1A 3IE3A 3KM6A 4O5UA 3TJKA 4WBJA 7GSSA 3TRPA 10GSA 17GSA 2A4VA 4L5OA 4MPFA 4BVXA 4F82A 2VL9A 1WJKA 4J57E 5CYYA 2I3YA 2IN3A 5EY6A 1PKWA 1G7OA 1BYEA 2R4VA 4HQSA 1URMA 3TJJA 5ECQB 2FCHA 4XCSA 4NMUA 1PN0A 4KCEA 4EVMA 4DSSA 2PUKC 4TR3A 2IMEA 4FYUA 3O76A 1XW5A 2PWJA 5BRTA 2J23A 5DALB 4OCEA 2G2QA 1THXA 6GSXA 4NV2A 1V9WA 2VUPA 2VAFA 4G19A 3IAM2 1JZOA 2I4AA 2C1YA 2K18A 2C0EA 1OE7A 3ME7A 5GSTA 3RBTA 2B7JA 4KNDA 3UJ1A 4USSA 5B6MA 3D4MA 1B4PA 4Q5NA 2DSAA 2XPEA 5C00A 3A2XA 3IPZA 4EE0A 3LXTA 4I2TA 2OKAA 3WGEA 2B1LA 3UBKA 5IM9A 5CNWA 5JCGA 1VF2A 3HJPA 1ZMAA 2R6KA 3VWUA 3W8JA 2VD1A 2O8VB 4JR4A 1V2AA 1KNGA 4KDYA 4QL9A 4BWSA 4F03A 1SYXA 3I69A 4MJEA 3O6TA 3DMLA 5E4WA 4OMVA 1PX6A 2HXKA 1QFNA 2H70A 2YWOA 1SL1B 5J41A 3CSJA 3P90A 3VWXA 3KTBA 2DJ1A 3A2WA 3DEXA 4HJ2A 4O7HA 5ELAA 3HA9A 1YDKA 2X49A 4L5LA 1TK0B 1RK4A 5IMFA 5HR2A 1BEDA 3TOTA 2FWGA 2C3NA 14GSA 3SBCA 3F3RA 5HFKA 4IGJA 4MF7A 3HZ4A 1G6YA 1GUKA 4F0CA 2L6CA 1EOGA 1S3AA 1TK5B 4JRRA 1SD8A 5GSSA 1CQGA 3VPTA 1AQVA 5KEJA 4JBBA 1Y6EA 5LCZA 4BVYA 2L6DA 3FKFA 1TRSA 2F8AA 4ACSA 3C73A 5L71A 2IJYA 1PN9A 3KMNA 3LXZA 2F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4Q A;  2WFC A;  3U6V A;  1LJR A;  2K8S A;  2PBJ A;  5IMC A;  1AUC A;  2WRT A;  4GF0 A;  2IMD A;  1A0R P;  5IMA A;  3D5J A;  2X8G A;  2N5F A;  2L5L A;  1NSW A;  1TRW A;  2P31 A;  4LLR A;  2X8C A;  5F05 A;  5A4V A;  1OVN A;  2VO4 A;  5J5N A;  6GSY A;  5ECM B;  4F2I A;  3R2Q A;  3TUE A;  3EMX A;  4DEJ A;  3N5O A;  2ES7 A;  2VLV A;  1TP9 A;  2WJU A;  2CZ3 A;  3FY7 A;  2KHP A;  4K0G A;  3C1R A;  4LL4 B;  4N10 A;  4N0Z A;  2XHF A;  3DWV A;  4N0V A;  5COH A;  2MBT A;  2LS5 A;  1Y25 A;  1LU4 A;  3M3M A;  5F8B A;  4PUA A;  5ECO B;  4POB A;  2K9F A;  5D9W A;  2ZNM A;  2KOK A;  5JWR B;  1FG4 A;  2V2G A;  1ERT A;  2HZE A;  4JU5 A;  2GTU A;  5G31 A;  3WGX A;  2VIM A;  1GH2 A;  3GV1 A;  4KDU A;  4LL1 B;  2C3Q A;  1U88 A;  3KP8 A;  4AGS A;  3HCZ A;  2LST A;  2JSZ A;  2FLS A;  4XTS A;  3RDW A;  4RQR A;  1GSF A;  2V6K A;  2CX3 A;  3M1G A;  3GIX A;  5ECI B;  5EVO A;  3DXB A;  1IYH A;  1WIK A;  2FWF A;  2YJH A;  1TDI A;  1XW6 A;  2CVD A;  4J56 E;  1A2M A;  3F4R A;  1GSE A;  1A8L A;  3ZMK A;  2JL4 A;  3TKP A;  4MJC A;  4MLY A;  3KH9 A;  1O81 A;  2R2J A;  1RQM A;  3HDC A;  2DJ3 A;  3GKX A;  4P3Y B;  13GS A;  1BJX A;  2OAC A;  1ERW A;  2O85 A;  1XOA A;  2WGR A;  2E2M A;  3NZN A;  1E2Y A;  3ERW A;  2B5Y A;  3K8N A;  2QGV A;  4IHU A;  3IOS A;  3MNG A;  2AB6 A;  3F3Q A;  4ZL9 A;  2NDO A;  3GL5 A;  3CYN A;  1K0N A;  1WOU A;  6GSV A;  4DVC A;  4X0X A;  3LGC A;  2V32 A;  2RUF A;  4IP1 A;  2D2Z A;  2DML A;  4FYC A;  4F9Z A;  1PQN A;  4EDZ A;  4EKZ A;  5ID2 B;  3UVT A;  16GS A;  1Z5Y E;  3ERG A;  2VLT A;  2F8F A;  1XW9 A;  2ON5 A;  3QOU A;  1A2J A;  1EOH A;  4POM A;  2NBS A;  1EGR A;  2Z9S A;  3HY2 A;  1M0U A;  1B9Y C;  1SYR A;  2R3X A;  2B3S A;  3M0F A;  2YCD A;  2MMZ A;  3TOU A;  3VPQ A;  3ZML A;  3H4K A;  2C0F A;  3FR9 A;  3UIW A;  5CAX A;  2H73 A;  4ZL7 A;  4HDE A;  3DGQ A;  3UOM A;  1GUH A;  4YAP A;  3QFA C;  4ULX A;  3GHA A;  4WET A;  1G6W A;  1F6M C;  2C0G A;  2KP1 A;  2OE1 A;  1DSB A;  2DMM A;  3P2A A;  4EC0 A;  2VCV A;  4XRD A;  3ERF A;  4NXI A;  4CDO A;  3V1W A;  4ZBA A;  1SJI A;  4TVE A;  4K8M A;  2AUV A;  5GZZ B;  1MDJ A;  4KCA A;  4CW9 A;  5G30 A;  4K0N A;  2H1B A;  2HZE B;  3D4T A;  3KTL A;  4FH8 A;  3ZYW A;  4GXZ A;  5DJL A;  5CRG A;  4E8H A;  1I5G A;  1O7U A;  2IL3 A;  6GSU A;  3J7Y k;  3ZRD A;  3FYG A;  3KXO A;  4G9H A;  2P5R A;  1AQX A;  3EUR A;  1XWA A;  6GST A;  3TJF A;  1F2E A;  1A0F A;  3KZQ A;  3BBY A;  3C71 A;  2E2G A;  2KLX A;  3GUS A;  3H1N A;  3AY8 A;  4HU7 A;  4MPG A;  1VF3 A;  2GST A;  5ECL B;  3PR8 A;  2H1D A;  2GSR A;  1GLQ A;  3APQ A;  2O7K A;  5AGY A;  5LNK e;  1K0C A;  2VCW A;  3S9F A;  2VCX A;  1SEN A;  5KN0 A;  1M2D A;  3L4N A;  3MAK A;  3I43 A;  4IS0 A;  5A4W A;  2PMT A;  4ZIL A;  4XS6 A;  1FB0 A;  2GQK A;  4ZB6 A;  3VFI A;  5J3R A;  3CXG A;  1GL8 A;  1FHE A;  1U3A A;  3QFB C;  1U6T A;  2ALB A;  3GTU A;  4HOJ A;  1XBS A;  1EP7 A;  2VCQ A;  2GQM A;  3IDV A;  3WGD A;  2LQO A;  4WF4 A;  5G2Z A;  2H71 A;  2PGT A;  3QDN A;  1X0R A;  1O8W A;  9GSS A;  1PMT A;  1ZYE A;  5DBQ A;  3GFK A;  4E8E A;  3M9K A;  4ZB9 A;  2YZH A;  2H19 A;  5D9X A;  5DQY A;  1W89 A;  1JLV A;  1XWB A;  5AN1 A;  3LOR A;  5B8A A;  1KTE A;  2XPD A;  4ML6 A;  5IMD A;  2PVO C;  2IMI A;  2JU5 A;  3F6D A;  1SL2 B;  3QPM A;  2VM2 A;  5J9C A;  1Z6N A;  1K3L A;  4IJ3 A;  1THO A;  2FWH A;  2QSI A;  1FAA A;  1J9B A;  2H0G A;  3CRT A;  3L9V A;  1EZK A;  1GTU A;  4BA7 A;  2H76 A;  4PUF C;  4WR5 A;  3EIN A;  1ILO A;  3TKS C;  1YF1 A;  4EF0 A;  3MDK A;  1ABA A;  2QKE A;  3FEU A;  1OC9 B;  2HNL A;  3EMP A;  1AIU A;  4TN8 A;  3UBL A;  1V40 A;  5IO0 A;  2X64 A;  1DUG A;  4JZQ A;  1SL0 B;  2MMN A;  2FUG 2;  3O3T A;  5DAK B;  1PRX A;  3G7Y A;  1ERU A;  3ZVJ D;  1O8X A;  5E59 A;  2N5B A;  1SKS B;  4Q5Q A;  3LSZ A;  1TI1 A;  1R5P A;  1WP0 A;  2B7K A;  1V58 A;  1YQ1 A;  3VUR A;  2PVQ A;  1GRX A;  2JAD A;  2FWE A;  1HNA A;  2E7P A;  4BWQ A;  2H6X A;  3LJR A;  2EC4 A;  1DBY A;  3GA4 A;  5FHI A;  1G0T A;  3FZ9 A;  4ZXG A;  5GAP D;  1ERV A;  1T1V A;  1SD9 A;  1ZOF A;  1UA5 A;  5KN1 A;  2P0G A;  1HNC A;  2NPB A;  2H30 A;  2CQ9 A;  5D73 A;  2CT6 A;  5JCU A;  4FO5 A;  2IIY A;  1OC8 A;  5ELG A;  1XVW A;  3G7J A;  2O89 A;  2TRX A;  4QL7 A;  1FVK A;  4HI7 A;  4ZBD A;  3FK8 A;  3NIV A;  5B8B A;  3GL3 A;  1BX9 A;  2LNT A;  2YP6 A;  4O5R A;  2H8L A;  3KD0 A;  4NPB A;  3A2V A;  1PD2 1;  2DJ0 A;  2JSY A;  2L59 A;  2OBK A;  2VM1 A;  3LQ7 A;  6GSW A;  2LUS A;  2QC7 A;  3GTU B;  5H5Q A;  1UN2 A;  3EVI A;  4HZ4 A;  3IA1 A;  5CRH A;  2H72 A;  5IPG A;  5ECK B;  5H5S A;  1B8X A;  3D6I A;  3RHC A;  1TK8 B;  5ID2 A;  3MSZ A;  4HJM A;  3VI5 A;  2VL2 A;  4OD7 A;  2DIY A;  2YAN A;  1PA3 A;  1ACV A;  3GN3 A;  2I9H A;  3VLN A;  2LQQ A;  4KUN A;  4D73 B;  1AC1 A;  4AJ8 A;  3HD5 A;  1XVQ A;  1XFL A;  1V57 A;  5B7C A;  4TXV A;  5ABR A;  3TCO A;  5FWG A;  4TXO A;  6GSS A;  4JED A;  4GRF A;  3IV4 A;  2WCI A;  2HI7 A;  5LD0 A;  3CMI A;  4V1A p;  4J2F A;  1JFU A;  1S3C A;  4AJ7 A;  2AHE A;  4ZIJ A;  2HSY A;  5DQS A;  1XCC A;  1A2L A;  4ECC A;  5DJM A;  3DRN A;  3PH9 A;  4WXT A;  1TXX A;  1SJ6 A;  4AJ6 A;  2GDR A;  1GP1 A;  4XHM A;  5A5K A;  2K8V A;  3FZ5 A;  3H93 A;  1K3O A;  4KB3 A;  1OYJ A;  2M72 A;  3G9B A;  3ZL5 A;  5IOX A;  1EV9 A;  1OAZ A;  3PIN A;  1G7E A;  2DIZ A;  1ZCP A;  2TIR A;  2IFQ B;  1XWG A;  2J9H A;  2L57 A;  2VCZ A;  3IAS 2;  1JLW A;  2GT5 A;  1A24 A;  3KGK A;  4ZBB A;  2WUL A;  1B48 A;  3E9J B;  4ECB A;  1YZX A;  1ZZY A;  5EPF A;  3IK9 A;  3U5R E;  3GSS A;  1HNB A;  4K2D A;  1PSQ A;  3CTG A;  1TOF A;  3I6A A;  4IP6 A;  1ZL9 A;  1JZW A;  2HLS A;  5F07 A;  1V98 A;  1X5C A;  4DSQ A;  4IKH A;  4ZL8 A;  1E6B A;  3VK9 A;  4V2N A;  4EUY A;  1JZR A;  1FW1 A;  2K6V A;  1HD2 A;  3D21 A;  1GSQ A;  2CAI A;  1OKD A;  5G5F A;  2JZT A;  2C3T A;  4I6X A;  4EXJ A;  4MH2 A;  1YKC A;  4TR4 A;  1KBN A;  1WE0 A;  4ZB8 A;  4XS4 B;  1GSS A;  2LV3 A;  2GZY A;  3CSH A;  3FW2 A;  2FHE A;  4EL1 A;  3H79 A;  4X1U A;  5ECH B;  3G7I A;  1R26 A;  1MDK A;  3GUR A;  4MCU A;  2H0H A;  2IWT A;  5JWQ B;  2GZZ A;  4MK3 A;  2L5O A;  2A2R A;  4OO4 A;  5ECS A;  1VF4 A;  1GSY A;  2EIQ A;  3QMX A;  4TXO B;  3HVV A;  2KP2 A;  5J9B A;  3GKN A;  1OC9 A;  1SJZ A;  4KGI A;  4WKW A;  1MD3 A;  2MBS A;  4NV5 A;  3IHQ A;  4GCI A;  2RM6 A;  1Q98 A;  3KP9 A;  3KCM A;  3WYW A;  2VL2 C;  1M99 A;  3GST A;  4I5Q A;  2ZUP A;  1GTA A;  5DAK A;  1Z9H A;  1LBK A;  4NHW A;  3WD6 A;  4XRA A;  3F0I A;  1BAY A;  1K0M A;  4V1A g;  1BQ7 A;  2FA8 A;  4F0B A;  5D9V A;  4KSM A;  2H1G A;  2B5E A;  2CAQ A;  2HRF A;  3LG6 A;  2OAD A;  1YY7 A;  2AYT A;  3F6F A;  1GLP A;  2I1U A;  2F3M A;  3HVS A;  3EYT A;  4BL7 A;  3LYK A;  3H8Q A;  3KH7 A;  4ECI A;  3VI7 A;  1T4Z A;  3DYR A;  3EC3 A;  1R7H A;  3QAG A;  4L8E A;  1ML6 A;  3GNJ A;  1EEM A;  1RW1 A;  11GS A;  5CRD A;  1T7P B;  5HFG A;  3IR4 A;  1TRV A;  3EE2 A;  5IPH A;  4WF5 A;  1QGV A;  1PL1 A;  1VRS D;  3DIE A;  2GLR A;  1JZD A;  3QCP A;  5ECN B;  1SK1 A;  4PQ1 A;  4OFN A;  3Q74 A;  4GST A;  2IPA A;  4OCF A;  1EEJ A;  2MYG A;  1NM3 A;  2IMF A;  3HYP A;  19GS A;  5D8I A;  1JHB A;  1SKR B;  4ML1 A;  4QQ7 A;  1TU8 A;  2LJA A;  4LA1 A;  1O85 A;  2H0I A;  3FHK A;  1XOB A;  4GWR A;  2MMA A;  4GTU A;  1Z6M A;  1TRU A;  5F0G A;  1KEB A;  3DD3 A;  3GMF A;  1XWC A;  4GLT A;  5AIX A;  2YV9 A;  1X5D A;  2H01 A;  4IW9 A;  2WS2 A;  3D22 A;  4FIW A;  3GYK A;  1FVJ A;  3C1S A;  4IBP A;  2PER A;  2VD0 A;  2WZ9 A;  5IMV A;  4NAX A;  2GVP A;  4D73 A;  2VL3 A;  2EIR A;  2RII A;  4MJB A;  1USB A;  3IBH A;  1F3B A;  1SK2 A;  1SK0 A;  1SU9 A;  4FYB A;  4AF2 A;  1T8E B;  5F06 A;  1YEP A;  5IO2 A;  2H6Y A;  2DLX A;  2YWM A;  1HQO A;  4MH3 A;  4GQF A;  1AQW A;  2FGX A;  2XBQ A;  3TJB A;  2BMX A;  2L4C A;  5AIV A;  4OFT A;  3D0Z A;  2V6O A;  2HE3 A;  1XZO A;  3JCM L;  2TRC P;  2LNS A;  3GKK A;  1U3I A;  1F37 A;  2A2S A;  2FY6 A;  2V41 A;  1AW9 A;  3CSI A;  1GUM A;  2G0F A;  3WT1 A;  4MF6 A;  3FRC A;  2GT6 A;  1VF1 A;  4RUV A;  3CRU A;  3M9J A;  2AAW A;  1YF0 A;  1X9S B;  5IOW A;  1OKT A;  4MAB A;  3CBU A;  4BPY A;  2DJJ A;  4TR1 B;  3Q18 A;  1UC7 A;  3GRX A;  1UVZ A;  1ST9 A;  2YNX A;  4N11 A;  4TR0 A;  1T4Y A;  2IFQ A;  5FT3 A;  5G1L A;  4K9Z A;  4PQH A;  4TKY A;  2M46 A;  2AJQ B;  1R5A A;  3BD2 A;  2CVB A;  3KMO A;  4RI6 A;  2XBI A;  4PXO A;  1TKD B;  5IMZ A;  2B6M A;  4PNF A;  3W6G A;  2YPM A;  3L0H A;  3TB2 A;  5D9T A;  5HFI A;  1GTI A;  4HUA A;  1N8J A;  2C4J A;  2O87 A;  4YH2 A;  1Z7R A;  3PGT A;  4H86 A;  4I97 A;  2RLI A;  5J4U A;  2MMO A;  3E0U A;  1N2A A;  3DVW A;  2NVL A;  4GQC A;  3DKS A;  1X9M B;  3UAP A;  2OE3 A;  3SWL A;  3VWV A;  3HZ8 A;  3IK7 A;  3TJG A;  5INY A;  3HXS A;  1U87 A;  1PKZ A;  2REM A;  3TRQ A;  2LTK A;  2HRN A;  4I8B A;  3F63 A;  4YQM A;  3BJ5 A;  4MZB A;  2DJK A;  3NOF A;  4HS1 A;  5KN3 A;  4NWY A;  2CA8 A;  1EV4 A;  4ID0 A;  2X99 A;  2JAC A;  1WRY A;  1K0D A;  4KDX A;  3APS A;  4MMM A;  3ZVJ A;  4ECJ A;  1M9B A;  4MZC A;  4CHS A;  4JE1 A;  3VWW A;  1TU7 A;  4XS4 A;  2LJK A;  2H75 A;  5G5E A;  5CRW A;  1OC3 A;  2AV4 A;  1EGO A;  4G2E A;  3UAR A;  3GKM A;  1GSD A;  4Q5R A;  3QD9 A;  3W8S A;  1ZYQ B;  4XIH A;  5D96 A;  3WT2 A;  1ON4 A;  3HKR A;  5HR0 A;  4RI7 A;  2CX4 A;  3KIJ A;  3RHB A;  2YJ7 A;  4PUR A;  4EO3 A;  3Q6O A;  3QAW A;  1K0O A;  4KH7 A;  3FR6 A;  2VCT A;  2BTO T;  4KX4 A;  1XXU A;  2JZS A;  1AXD A;  3MWH A;  5HR1 A;  2PU9 C;  4O92 A;  1PGT A;  3A5W A;  3IXR A;  3TDG A;  3HHV A;  3TKR A;  3ZTL A;  1GNE A;  1TJD A;  5AIS A;  3UMA A;  2C0D A;  3GH9 A;  1I9D A;  4DSS B;  3F4T A;  1TI3 A;  3GX0 A;  1GSU A;  1OE8 A;  3F8U A;  3I9V 2;  2F9S A;  4IVF A;  2RM5 A;  3ZFB A;  4K7O A;  1NHY A;  2ON7 A;  4TRX A;  5C04 A;  4L0U A;  4LMW A;  4HQZ A;  3RAZ A;  3TKS E;  1ZGN A;  3L9S A;  2NTO A;  3ZIJ A;  2ZCT A;  2V1M A;  4Q5F A;  4IEL A;  5JWO B;  1W4V A;  20GS A;  2HFD A;  4OWY A;  5DCG A;  3ED3 A;  4L0W A;  1XPV A;  2MZC A;  2B1K A;  4IQA A;  1O6J A;  4ILF A;  3TGZ A;  2C80 A;  2GGT A;  4WEY A;  5DDL A;  3F4S A;  2H6Z A;  1C72 A;  1J08 A;  3C8E A;  2LRN A;  1XIY A;  3ISO A;  3Q19 A;  1Z7P A;  3A3T A;  4POK A;  5CP1 A;  1T3B A;  3UL3 A;  2E0Q A;  4Z7X A;  5ECP B;  1M2B A;  4K7N A;  2VLU A;  2LJR A;  3GH6 A;  4MF5 A;  4PQI A;  12GS A;  1DE1 A;  1MD4 A;  1FOV A;  3QR6 A;  1GNW A;  1T00 A;  4K7I A;  1M2A A;  1K0A A;  3FZ4 A;  2VOC A;  1TW9 A;  4O32 A;  1GUL A;  2OJL A;  1NHO A;  3M8N A;  4V2L A;  4POL A;  3CTF A;  3KEB A;  3HVX A;  5H5R A;  1X5E A;  1B4Q A;  1A8Y A;  4GSS A;  2X8H A;  1O73 A;  1GWC A;  3EU4 A;  2R37 A;  3ZRE A;  2GSS A;  1M9A A;  4HEA 2;  2DBC A;  1BG5 A;  2FA4 A;  1B9X C;  4MP4 A;  3LWA A;  3P8W A;  2HT9 A;  5CO3 A;  2R5G A;  4PX1 A;  4MJA A;  1VGL A;  1K0B A;  4WBR D;  4KSO A;  1YEX A;  3BCK A;  1R4W A;  2YV7 A;  1PL2 A;  1X9W B;  4YQU A;  4IQ1 A;  3TKQ A;  1MDI A;  3TKS A;  4KW6 A;  3HJM A;  1WWJ A;  5HQP A;  4PGT A;  2HZF A;  2IMK A;  2BJX A;  4NHZ A;  4YAV A;  3ME8 A;  4OFM A;  2XC2 A;  3IC4 A;  3FZA A;  2P5Q A;  2PN8 A;  3L78 A;  5G1K A;  1MTC A;  3ZIV A;  3APO A;  4IJI A;  4PNG A;  3EWL A;  3LFL A;  2JZR A;  22GS A;  5D93 A;  3UEM A;  2CV4 A;  2DJ2 A;  2OA7 A;  4V2M A;  5KN2 A;  2DC5 A;  2GSQ A;  3QAV A;  3RPP A;  3EU3 A;  2PPT A;  1QMV A;  1XWK A;  5A4U A;  2KUC A;  4MDC A;  5DVB A;  3IRA A;  5IQY A;  3TRX A;  1WPI A;  2YZU A;  2C8U A;  4KAE A;  4TOP A;  5ECR B;  5DAL A;  3RPN A;  4JR6 A;  4KE3 A;  4OO5 A;  1F3A A;  1K3Y A;  2HYX A;  18GS A;  2YWN A;  2LEG A;  1PX7 A;  1GTB A;  3BCI A;  1Q4J A;  2EIO A;  2GZP A;  1EWX A;  5ENU A;  4TR1 A;  4K1F A;  3DVX A;  1DE2 A;  2WB9 A;  2WDU A;  3FR3 A;  1YJ6 A;  3P7X A;  1QXH A;  2LKU A;  2GS3 A;  2YOI A;  3US3 A;  4KA0 A;  4I2U A;  1NW2 A;  3ZZX A;  1FB6 A;  4MA9 A;  2CVK A;  3LYP A;  3ZFL A;  3HJO A;  1WMJ A;  1QUW A;  4WR4 A;  2B5X A;  1IYI A;  1S3D A;  2H66 A;  4YQV A;  5IIZ A;  1SKW B;  1FO5 A;  3E3E A;  4DSR A;  3L9U A;  1A23 A;  1F9M A;  3C7M A;  4HU9 A;  1CQH A;  2RUE A;  2LRC A;  3ZLP A;  5HR3 A;  2I81 A;  3KJY A;  1MEK A;  2OBI A;  4GSN A;  8GSS A;  1HYU A;  4N30 A;  1M7T A;  2M80 A;  3UVH A;  5B6N A;  1AAZ A;  3BOA A;  5GAN D;  3GX8 A;  3LEF A;  5JCW A;  2GQL A;  2OE0 A;  3N9J A;  4IN0 A;  1H75 A;  5EL8 A;  4MZW A;  2LRT A;  1Z3E A;  1H4O A;  1YKA A;  1QK8 A;  5CRE A;  4HZ2 A;  4LMV A;  2YN1 A;  4K6X A;  3J7Y b;  4G10 A;  4TW5 A;  2FNO A;  3ZIT A;  4ISD A;  2CZ2 A;  2YWI A;  5DCH A;  2H74 A;  1QQ2 A;  4RQX A;  2N5A A;  1EP8 A;  3F9U A;  2HSH A;  3OR5 A;  2H1A A;  2FD3 A;  4EDY A;  1J0F A;  4X43 A;  1TTZ A;  4XS1 A;  3IE3 A;  3KM6 A;  3TJK A;  4WBJ A;  7GSS A;  3TRP A;  10GS A;  17GS A;  2A4V A;  4L5O A;  4MPF A;  4BVX A;  4F82 A;  2VL9 A;  1WJK A;  4J57 E;  5CYY A;  2I3Y A;  2IN3 A;  5EY6 A;  1PKW A;  1G7O A;  1BYE A;  2R4V A;  4HQS A;  1URM A;  3TJJ A;  5ECQ B;  2FCH A;  4XCS A;  4NMU A;  4KCE A;  4EVM A;  4DSS A;  2PUK C;  4TR3 A;  2IME A;  4FYU A;  3O76 A;  1XW5 A;  2PWJ A;  2J23 A;  5DAL B;  4OCE A;  2G2Q A;  1THX A;  6GSX A;  4NV2 A;  1V9W A;  2VUP A;  2VAF A;  4G19 A;  3IAM 2;  1JZO A;  2I4A A;  2C1Y A;  2K18 A;  2C0E A;  1OE7 A;  3ME7 A;  5GST A;  3RBT A;  2B7J A;  4KND A;  3UJ1 A;  5B6M A;  3D4M A;  1B4P A;  4Q5N A;  2DSA A;  2XPE A;  5C00 A;  3A2X A;  3IPZ A;  4EE0 A;  3LXT A;  4I2T A;  2OKA A;  3WGE A;  2B1L A;  3UBK A;  5IM9 A;  5CNW A;  5JCG A;  1VF2 A;  3HJP A;  1ZMA A;  2R6K A;  3VWU A;  3W8J A;  2VD1 A;  2O8V B;  4JR4 A;  1V2A A;  1KNG A;  4KDY A;  4QL9 A;  4BWS A;  4F03 A;  1SYX A;  3I69 A;  4MJE A;  3O6T A;  3DML A;  5E4W A;  4OMV A;  1PX6 A;  2HXK A;  1QFN A;  2H70 A;  2YWO A;  1SL1 B;  5J41 A;  3CSJ A;  3P90 A;  3VWX A;  3KTB A;  2DJ1 A;  3A2W A;  3DEX A;  4HJ2 A;  4O7H A;  5ELA A;  3HA9 A;  1YDK A;  4L5L A;  1TK0 B;  1RK4 A;  5IMF A;  5HR2 A;  1BED A;  3TOT A;  2FWG A;  2C3N A;  14GS A;  3SBC A;  3F3R A;  5HFK A;  4IGJ A;  4MF7 A;  3HZ4 A;  1G6Y A;  1GUK A;  4F0C A;  2L6C A;  1EOG A;  1S3A A;  1TK5 B;  4JRR A;  1SD8 A;  5GSS A;  1CQG A;  3VPT A;  1AQV A;  5KEJ A;  4JBB A;  1Y6E A;  5LCZ A;  4BVY A;  2L6D A;  3FKF A;  1TRS A;  2F8A A;  4ACS A;  3C73 A;  5L71 A;  2IJY A;  1PN9 A;  3KMN A;  3LXZ A;  2F51 A; 
#chains in the Genus database with same CATH topology
 2L4Q A;  2WFC A;  3U6V A;  1LJR A;  2K8S A;  2PBJ A;  5IMC A;  1AUC A;  2WRT A;  4GF0 A;  4BVX B;  2IMD A;  1A0R P;  5IMA A;  3D5J A;  2X8G A;  2N5F A;  2L5L A;  1NSW A;  1TRW A;  2P31 A;  3PPU A;  4LLR A;  2X8C A;  5F05 A;  5A4V A;  1OVN A;  2VO4 A;  5J5N A;  6GSY A;  2QA2 A;  5ECM B;  4F2I A;  3R2Q A;  3TUE A;  3EMX A;  4DEJ A;  3N5O A;  2ES7 A;  2VLV A;  1TP9 A;  2WJU A;  2CZ3 A;  3FY7 A;  2KHP A;  4K0G A;  3C1R A;  4LL4 B;  4N10 A;  4N0Z A;  2XHF A;  3DWV A;  4N0V A;  5COH A;  2MBT A;  2LS5 A;  1Y25 A;  1LU4 A;  3M3M A;  5F8B A;  4PUA A;  5ECO B;  4POB A;  2K9F A;  5D9W A;  2ZNM A;  2KOK A;  5JWR B;  1FG4 A;  5KOW A;  2V2G A;  1ERT A;  2HZE A;  4JU5 A;  2GTU A;  5G31 A;  3WGX A;  2VIM A;  1GH2 A;  3GV1 A;  4KDU A;  4LL1 B;  2C3Q A;  1U88 A;  3KP8 A;  4AGS A;  3HCZ A;  2LST A;  2JSZ A;  2FLS A;  4XTS A;  3RDW A;  4RQR A;  1GSF A;  2V6K A;  2CX3 A;  3M1G A;  3GIX A;  5ECI B;  5EVO A;  3DXB A;  2DKI A;  2R0C A;  1IYH A;  4G0L A;  1WIK A;  2FWF A;  2YJH A;  1TDI A;  1XW6 A;  2CVD A;  4J56 E;  1A2M A;  3F4R A;  1GSE A;  1A8L A;  3ZMK A;  2JL4 A;  3TKP A;  4MJC A;  4MLY A;  3KH9 A;  1O81 A;  2R2J A;  1RQM A;  3HDC A;  2DJ3 A;  3GKX A;  4P3Y B;  13GS A;  1BJX A;  2OAC A;  1ERW A;  2O85 A;  1XOA A;  2WGR A;  2E2M A;  1M3J A;  3NZN A;  1E2Y A;  3ERW A;  2B5Y A;  3K8N A;  2QGV A;  4IHU A;  3IOS A;  1FOH A;  3MNG A;  2AB6 A;  3F3Q A;  4ZL9 A;  2NDO A;  3GL5 A;  3CYN A;  1K0N A;  1WOU A;  6GSV A;  4DVC A;  4A5P A;  4X0X A;  3LGC A;  2V32 A;  4BVY B;  2RUF A;  4IP1 A;  2D2Z A;  2DML A;  4FYC A;  4F9Z A;  1PQN A;  4EDZ A;  4EKZ A;  5ID2 B;  3UVT A;  16GS A;  1Z5Y E;  3ERG A;  2VLT A;  2F8F A;  1XW9 A;  2ON5 A;  3QOU A;  1A2J A;  1EOH A;  4POM A;  2NBS A;  1EGR A;  2Z9S A;  3HY2 A;  1M0U A;  1B9Y C;  1SYR A;  2R3X A;  2B3S A;  3M0F A;  2YCD A;  2MMZ A;  3TOU A;  3VPQ A;  3ZML A;  4YKF A;  3H4K A;  2C0F A;  3FR9 A;  3UIW A;  5CAX A;  2H73 A;  4ZL7 A;  4HDE A;  3DGQ A;  3UOM A;  1GUH A;  4YAP A;  3QFA C;  4ULX A;  3GHA A;  4WET A;  1G6W A;  4G0I A;  1F6M C;  4EIP A;  2C0G A;  2KP1 A;  2OE1 A;  1DSB A;  2DMM A;  3P2A A;  4EC0 A;  2VCV A;  4XRD A;  3ERF A;  4NXI A;  4CDO A;  3V1W A;  4ZBA A;  1SJI A;  4TVE A;  4K8M A;  2AUV A;  5GZZ B;  1MDJ A;  4KCA A;  4CW9 A;  5G30 A;  4K0N A;  2H1B A;  2HZE B;  3D4T A;  3KTL A;  4FH8 A;  3ZYW A;  4GXZ A;  5DJL A;  5CRG A;  4E8H A;  1I5G A;  1O7U A;  2IL3 A;  6GSU A;  3J7Y k;  3ZRD A;  3FYG A;  3KXO A;  4G9H A;  2P5R A;  1AQX A;  3EUR A;  1XWA A;  6GST A;  3TJF A;  1F2E A;  1A0F A;  3KZQ A;  3BBY A;  3C71 A;  2E2G A;  2KLX A;  3GUS A;  3H1N A;  3AY8 A;  4HU7 A;  4MPG A;  1VF3 A;  2GST A;  3MYD A;  5ECL B;  3PR8 A;  2H1D A;  2GSR A;  1GLQ A;  3APQ A;  2O7K A;  5AGY A;  5LNK e;  1K0C A;  2VCW A;  3S9F A;  2VCX A;  1SEN A;  5KN0 A;  1M2D A;  3L4N A;  3MAK A;  3I43 A;  4IS0 A;  5A4W A;  2PMT A;  4ZIL A;  4XS6 A;  1FB0 A;  2GQK A;  4ZB6 A;  3VFI A;  5J3R A;  3CXG A;  1GL8 A;  1FHE A;  1U3A A;  3QFB C;  1U6T A;  2ALB A;  3GTU A;  4HOJ A;  1XBS A;  1EP7 A;  2VCQ A;  2GQM A;  3IDV A;  3WGD A;  2LQO A;  4WF4 A;  5G2Z A;  4CY8 A;  2H71 A;  2PGT A;  3QDN A;  1X0R A;  1O8W A;  9GSS A;  1PMT A;  1ZYE A;  5DBQ A;  3GFK A;  4E8E A;  3M9K A;  4ZB9 A;  2YZH A;  2H19 A;  5D9X A;  5DQY A;  1W89 A;  1JLV A;  1XWB A;  3LOR A;  5AN1 A;  5B8A A;  1KTE A;  2XPD A;  4ML6 A;  5IMD A;  2PVO C;  2IMI A;  2JU5 A;  2UZ8 A;  3F6D A;  1SL2 B;  3QPM A;  2VM2 A;  5J9C A;  1Z6N A;  1K3L A;  4IJ3 A;  1THO A;  2FWH A;  2QSI A;  4YKG A;  1FAA A;  1J9B A;  2H0G A;  2DKH A;  3CRT A;  3L9V A;  4BIK A;  1EZK A;  1GTU A;  4BA7 A;  2H76 A;  4PUF C;  4WR5 A;  3EIN A;  1ILO A;  3TKS C;  1YF1 A;  4EF0 A;  3MDK A;  1ABA A;  2QKE A;  3FEU A;  1OC9 B;  2HNL A;  3EMP A;  1AIU A;  4TN8 A;  3UBL A;  1V40 A;  5IO0 A;  2X64 A;  1DUG A;  4JZQ A;  1SL0 B;  2MMN A;  2FUG 2;  3O3T A;  5DAK B;  1PRX A;  1ZYN A;  3G7Y A;  1ERU A;  3ZVJ D;  1O8X A;  5E59 A;  2N5B A;  1SKS B;  4Q5Q A;  3LSZ A;  1TI1 A;  1R5P A;  1WP0 A;  2B7K A;  1V58 A;  1YQ1 A;  3VUR A;  2PVQ A;  1GRX A;  2JAD A;  2FWE A;  1HNA A;  2E7P A;  4BWQ A;  2H6X A;  3LJR A;  2EC4 A;  1DBY A;  4BL7 B;  3GA4 A;  5FHI A;  1G0T A;  3FZ9 A;  4ZXG A;  5GAP D;  1ERV A;  1T1V A;  1SD9 A;  1ZOF A;  1UA5 A;  5KN1 A;  2P0G A;  1HNC A;  2NPB A;  2H30 A;  2CQ9 A;  5D73 A;  2CT6 A;  5JCU A;  4FO5 A;  2IIY A;  1OC8 A;  5ELG A;  1XVW A;  3G7J A;  2O89 A;  2TRX A;  4QL7 A;  1FVK A;  4HI7 A;  4ZBD A;  3FK8 A;  3NIV A;  5B8B A;  3GL3 A;  1BX9 A;  2LNT A;  2YP6 A;  4O5R A;  2H8L A;  3KD0 A;  4NPB A;  3A2V A;  1PD2 1;  2DJ0 A;  2JSY A;  2L59 A;  2OBK A;  2VM1 A;  3LQ7 A;  6GSW A;  2LUS A;  2QC7 A;  3GTU B;  5H5Q A;  1UN2 A;  3EVI A;  4HZ4 A;  3IA1 A;  5CRH A;  2H72 A;  5IPG A;  5ECK B;  5H5S A;  1B8X A;  3D6I A;  3RHC A;  1TK8 B;  5ID2 A;  3MSZ A;  4HJM A;  3VI5 A;  2VL2 A;  4OD7 A;  2DIY A;  2YAN A;  1PA3 A;  1ACV A;  3GN3 A;  2I9H A;  3VLN A;  2LQQ A;  4KUN A;  4D73 B;  1AC1 A;  4AJ8 A;  3HD5 A;  1XVQ A;  1XFL A;  1V57 A;  5B7C A;  4G0K A;  4TXV A;  2A4H A;  5ABR A;  3TCO A;  5FWG A;  4TXO A;  6GSS A;  4JED A;  4GRF A;  3IV4 A;  2WCI A;  2HI7 A;  5LD0 A;  3CMI A;  4V1A p;  4J2F A;  1JFU A;  1S3C A;  4AJ7 A;  3IC8 A;  2AHE A;  4ZIJ A;  2HSY A;  5DQS A;  2QA1 A;  1XCC A;  1A2L A;  4ECC A;  5DJM A;  3DRN A;  3PH9 A;  4WXT A;  1TXX A;  1SJ6 A;  4AJ6 A;  2GDR A;  1GP1 A;  3EPT A;  4XHM A;  5A5K A;  2K8V A;  3FZ5 A;  3H93 A;  1K3O A;  4KB3 A;  1OYJ A;  2M72 A;  1S3R A;  3G9B A;  4CY6 A;  3ZL5 A;  5IOX A;  1EV9 A;  1OAZ A;  3PIN A;  1G7E A;  2DIZ A;  1ZCP A;  2TIR A;  2IFQ B;  1XWG A;  2J9H A;  2L57 A;  2VCZ A;  3IAS 2;  1JLW A;  2GT5 A;  2HRA A;  1A24 A;  3KGK A;  4ZBB A;  2WUL A;  3CQF A;  1B48 A;  3E9J B;  4ECB A;  1YZX A;  1ZZY A;  5EPF A;  3IK9 A;  3U5R E;  3GSS A;  1HNB A;  4K2D A;  1PSQ A;  3CTG A;  1TOF A;  3I6A A;  3IHG A;  4IP6 A;  1ZL9 A;  1JZW A;  2HLS A;  5F07 A;  1V98 A;  1X5C A;  4DSQ A;  4IKH A;  4ZL8 A;  1E6B A;  3VK9 A;  4V2N A;  4EUY A;  1JZR A;  1FW1 A;  2K6V A;  1HD2 A;  2R0P A;  3D21 A;  1GSQ A;  2CAI A;  1OKD A;  5G5F A;  2JZT A;  2C3T A;  4I6X A;  4EXJ A;  4MH2 A;  1YKC A;  4TR4 A;  1KBN A;  1WE0 A;  4ZB8 A;  4XS4 B;  1GSS A;  2LV3 A;  2GZY A;  3CSH A;  3FW2 A;  2FHE A;  4EL1 A;  3H79 A;  4X1U A;  5ECH B;  3G7I A;  1R26 A;  1MDK A;  3GUR A;  4MCU A;  2H0H A;  2IWT A;  5JWQ B;  2GZZ A;  4MK3 A;  2L5O A;  2A2R A;  4OO4 A;  5ECS A;  1VF4 A;  1GSY A;  2EIQ A;  2R0G A;  3QMX A;  4TXO B;  3HVV A;  2KP2 A;  5J9B A;  3GKN A;  1OC9 A;  1SJZ A;  4KGI A;  4WKW A;  1MD3 A;  2MBS A;  4NV5 A;  3IHQ A;  4GCI A;  2RM6 A;  1Q98 A;  3KP9 A;  3KCM A;  3WYW A;  2VL2 C;  1M99 A;  3GST A;  4I5Q A;  2ZUP A;  1GTA A;  5DAK A;  1Z9H A;  1LBK A;  4NHW A;  3WD6 A;  4XRA A;  3F0I A;  1BAY A;  1K0M A;  4V1A g;  1BQ7 A;  2FA8 A;  4F0B A;  5D9V A;  4KSM A;  2H1G A;  2B5E A;  4PTS A;  2CAQ A;  2HRF A;  3LG6 A;  2OAD A;  1YY7 A;  2AYT A;  3F6F A;  1GLP A;  2I1U A;  2F3M A;  3HVS A;  3EYT A;  4BL7 A;  3LYK A;  3H8Q A;  3KH7 A;  4ECI A;  3VI7 A;  1T4Z A;  4Z2T A;  3DYR A;  3EC3 A;  1R7H A;  3QAG A;  4L8E A;  1ML6 A;  3GNJ A;  1EEM A;  1RW1 A;  11GS A;  5CRD A;  1T7P B;  5HFG A;  3IR4 A;  1TRV A;  3EE2 A;  5IPH A;  4WF5 A;  1QGV A;  1PL1 A;  1VRS D;  3DIE A;  2GLR A;  1JZD A;  3QCP A;  5ECN B;  1SK1 A;  4PQ1 A;  4OFN A;  3Q74 A;  4GST A;  2IPA A;  4OCF A;  1EEJ A;  2MYG A;  1NM3 A;  2IMF A;  3HYP A;  19GS A;  5D8I A;  1JHB A;  1SKR B;  4ML1 A;  4QQ7 A;  1TU8 A;  2LJA A;  4LA1 A;  1O85 A;  2H0I A;  3FHK A;  1XOB A;  4GWR A;  2MMA A;  4GTU A;  4ICY A;  1Z6M A;  1TRU A;  5F0G A;  1KEB A;  3DD3 A;  3GMF A;  1XWC A;  4GLT A;  5AIX A;  2YV9 A;  1X5D A;  2H01 A;  4IW9 A;  2WS2 A;  3D22 A;  4FIW A;  3GYK A;  1FVJ A;  3C1S A;  4IBP A;  2PER A;  2VD0 A;  2WZ9 A;  5IMV A;  4NAX A;  2GVP A;  4K5S A;  4D73 A;  2VL3 A;  2EIR A;  2RII A;  4MJB A;  1USB A;  3IBH A;  1F3B A;  1SK2 A;  1SK0 A;  1SU9 A;  4FYB A;  4AF2 A;  1T8E B;  5F06 A;  1YEP A;  5IO2 A;  2H6Y A;  2DLX A;  2YWM A;  1HQO A;  4MH3 A;  4GQF A;  1AQW A;  2FGX A;  2X4A A;  2XBQ A;  3TJB A;  2BMX A;  2L4C A;  5AIV A;  4OFT A;  3D0Z A;  2V6O A;  2HE3 A;  1XZO A;  3JCM L;  2TRC P;  2LNS A;  3GKK A;  1U3I A;  1F37 A;  2A2S A;  2FY6 A;  2V41 A;  1AW9 A;  3CSI A;  1GUM A;  2G0F A;  3WT1 A;  4MF6 A;  3FRC A;  2GT6 A;  1VF1 A;  4RUV A;  3FMW A;  3CRU A;  3M9J A;  2AAW A;  1YF0 A;  4MNN A;  1X9S B;  5IOW A;  4EIQ A;  1OKT A;  4MAB A;  3CBU A;  4BPY A;  2DJJ A;  4TR1 B;  3Q18 A;  1UC7 A;  3GRX A;  1UVZ A;  1ST9 A;  2YNX A;  4N11 A;  4TR0 A;  1T4Y A;  2IFQ A;  5FT3 A;  5G1L A;  4K9Z A;  4PQH A;  4TKY A;  2M46 A;  2AJQ B;  1R5A A;  3BD2 A;  2CVB A;  3KMO A;  4RI6 A;  2XBI A;  4PXO A;  1TKD B;  5IMZ A;  2B6M A;  4PNF A;  3W6G A;  2YPM A;  3L0H A;  3TB2 A;  5D9T A;  5HFI A;  1GTI A;  4HUA A;  1N8J A;  2C4J A;  2O87 A;  4YH2 A;  1Z7R A;  3PGT A;  4H86 A;  4I97 A;  2RLI A;  5J4U A;  2MMO A;  3E0U A;  1N2A A;  3DVW A;  2NVL A;  3R3E A;  4GQC A;  3DKS A;  1X9M B;  3UAP A;  2OE3 A;  3SWL A;  3VWV A;  3HZ8 A;  3IK7 A;  3TJG A;  5INY A;  3HXS A;  1U87 A;  1PKZ A;  2REM A;  3TRQ A;  2LTK A;  2HRN A;  4I8B A;  3F63 A;  4YQM A;  3BJ5 A;  4MZB A;  2DJK A;  3NOF A;  4HS1 A;  5KN3 A;  4NWY A;  2CA8 A;  1EV4 A;  4ID0 A;  2X99 A;  2JAC A;  1WRY A;  1K0D A;  4KDX A;  3APS A;  4X4J A;  4MMM A;  3ZVJ A;  4ECJ A;  1M9B A;  4MZC A;  4CHS A;  4JE1 A;  3VWW A;  1TU7 A;  4XS4 A;  2LJK A;  2H75 A;  5G5E A;  5BMU A;  5CRW A;  1OC3 A;  2AV4 A;  1EGO A;  4G2E A;  3UAR A;  3GKM A;  1GSD A;  4Q5R A;  3QD9 A;  3W8S A;  1ZYQ B;  4XIH A;  5D96 A;  3WT2 A;  1ON4 A;  3HKR A;  5HR0 A;  4RI7 A;  2CX4 A;  3KIJ A;  2HSM A;  3RHB A;  2YJ7 A;  4PUR A;  4EO3 A;  3Q6O A;  2A2P A;  3QAW A;  1K0O A;  4KH7 A;  3FR6 A;  2VCT A;  4KX4 A;  2BTO T;  1XXU A;  2JZS A;  1AXD A;  3MWH A;  5HR1 A;  2PU9 C;  4O92 A;  1PGT A;  3A5W A;  3IXR A;  3TDG A;  3HHV A;  3TKR A;  3ZTL A;  1GNE A;  1TJD A;  5AIS A;  3UMA A;  2C0D A;  3GH9 A;  1I9D A;  4DSS B;  3F4T A;  1TI3 A;  3GX0 A;  1GSU A;  1OE8 A;  4O5Q A;  3F8U A;  3I9V 2;  2F9S A;  4IVF A;  2RM5 A;  3ZFB A;  4K7O A;  1NHY A;  2ON7 A;  4TRX A;  5C04 A;  4L0U A;  4K5R A;  4LMW A;  4HQZ A;  3RAZ A;  3TKS E;  1ZGN A;  3L9S A;  2NTO A;  3ZIJ A;  2ZCT A;  2V1M A;  4Q5F A;  4IEL A;  5JWO B;  1W4V A;  20GS A;  2HFD A;  4OWY A;  5DCG A;  1PFO A;  3ED3 A;  4L0W A;  4FQU A;  1XPV A;  2MZC A;  2B1K A;  4IQA A;  1O6J A;  4ILF A;  3TGZ A;  2C80 A;  2GGT A;  4WEY A;  5DDL A;  3F4S A;  2H6Z A;  1C72 A;  1J08 A;  3C8E A;  2LRN A;  1XIY A;  3ISO A;  3Q19 A;  1Z7P A;  4Z2U A;  3A3T A;  4POK A;  5CP1 A;  1T3B A;  3UL3 A;  2E0Q A;  4Z7X A;  5ECP B;  1M2B A;  4K7N A;  2VLU A;  2LJR A;  3GH6 A;  1ZYP A;  4MF5 A;  4PQI A;  12GS A;  1DE1 A;  1MD4 A;  1FOV A;  3QR6 A;  1GNW A;  1T00 A;  4K7I A;  1M2A A;  1K0A A;  3FZ4 A;  2VOC A;  1TW9 A;  4O32 A;  1GUL A;  2OJL A;  1NHO A;  3M8N A;  4V2L A;  4POL A;  3CTF A;  3KEB A;  4Z2R A;  3HVX A;  5H5R A;  1X5E A;  1B4Q A;  1A8Y A;  3MIX A;  2X8H A;  4GSS A;  1O73 A;  1GWC A;  1XG8 A;  2R37 A;  3EU4 A;  3ZRE A;  2GSS A;  1M9A A;  4HEA 2;  2DBC A;  1BG5 A;  2FA4 A;  1B9X C;  4MP4 A;  3LWA A;  3P8W A;  2HT9 A;  5CO3 A;  2R5G A;  4PX1 A;  4MJA A;  1VGL A;  1K0B A;  4WBR D;  4KSO A;  1YEX A;  3BCK A;  1R4W A;  2YV7 A;  1PL2 A;  1X9W B;  4YQU A;  4IQ1 A;  3TKQ A;  1MDI A;  3TKS A;  4KW6 A;  3HJM A;  4KF9 A;  1WWJ A;  5HQP A;  1M3I A;  4PGT A;  2HZF A;  2IMK A;  2BJX A;  4NHZ A;  4YAV A;  3ME8 A;  4OFM A;  2XC2 A;  3IC4 A;  3FZA A;  2P5Q A;  2PN8 A;  3L78 A;  5G1K A;  1MTC A;  3ZIV A;  3APO A;  4IJI A;  4PNG A;  3EWL A;  3LFL A;  2JZR A;  22GS A;  5D93 A;  3UEM A;  2CV4 A;  2DJ2 A;  2OA7 A;  4V2M A;  5KN2 A;  2DC5 A;  2GSQ A;  3QAV A;  3RPP A;  3EU3 A;  2PPT A;  1QMV A;  1XWK A;  5A4U A;  2KUC A;  4MDC A;  5DVB A;  3IRA A;  5IQY A;  3TRX A;  1WPI A;  2YZU A;  2C8U A;  4KAE A;  4TOP A;  5ECR B;  5DAL A;  3RPN A;  4JR6 A;  4KE3 A;  4OO5 A;  1F3A A;  1K3Y A;  3LW9 A;  2HYX A;  18GS A;  2YWN A;  2LEG A;  1PX7 A;  1GTB A;  3BCI A;  1Q4J A;  2EIO A;  2GZP A;  1EWX A;  5ENU A;  4TR1 A;  4K1F A;  3DVX A;  1DE2 A;  2WB9 A;  2WDU A;  3FR3 A;  1YJ6 A;  3A5I A;  3P7X A;  1QXH A;  2LKU A;  2GS3 A;  2YOI A;  3US3 A;  4KA0 A;  4I2U A;  1NW2 A;  3ZZX A;  1FB6 A;  4MA9 A;  2CVK A;  3LYP A;  3ZFL A;  3HJO A;  1WMJ A;  1QUW A;  2HRK A;  4WR4 A;  2B5X A;  1IYI A;  1S3D A;  2H66 A;  4YQV A;  5IIZ A;  1SKW B;  1FO5 A;  3E3E A;  4DSR A;  3L9U A;  1A23 A;  1F9M A;  3C7M A;  4HU9 A;  1CQH A;  2RUE A;  2LRC A;  3ZLP A;  5HR3 A;  2I81 A;  3KJY A;  1MEK A;  2OBI A;  4GSN A;  8GSS A;  1HYU A;  4N30 A;  1M7T A;  2M80 A;  3UVH A;  5B6N A;  1AAZ A;  3BOA A;  5GAN D;  3GX8 A;  3LEF A;  5JCW A;  2GQL A;  2OE0 A;  3N9J A;  4IN0 A;  1H75 A;  5EL8 A;  4MZW A;  2LRT A;  1Z3E A;  1H4O A;  1YKA A;  1QK8 A;  5CRE A;  4HZ2 A;  4LMV A;  2YN1 A;  4K6X A;  3J7Y b;  4G10 A;  4TW5 A;  2FNO A;  3ZIT A;  4ISD A;  2CZ2 A;  5KOX A;  2YWI A;  5DCH A;  2H74 A;  1QQ2 A;  4RQX A;  2N5A A;  1EP8 A;  3F9U A;  2HSH A;  3OR5 A;  2H1A A;  2FD3 A;  4EDY A;  4K2X A;  1J0F A;  4X43 A;  1TTZ A;  4XS1 A;  3IE3 A;  3KM6 A;  4O5U A;  3TJK A;  4WBJ A;  7GSS A;  3TRP A;  10GS A;  17GS A;  2A4V A;  4L5O A;  4MPF A;  4BVX A;  4F82 A;  2VL9 A;  1WJK A;  4J57 E;  5CYY A;  2I3Y A;  2IN3 A;  5EY6 A;  1PKW A;  1G7O A;  1BYE A;  2R4V A;  4HQS A;  1URM A;  3TJJ A;  5ECQ B;  2FCH A;  4XCS A;  4NMU A;  1PN0 A;  4KCE A;  4EVM A;  4DSS A;  2PUK C;  4TR3 A;  2IME A;  4FYU A;  3O76 A;  1XW5 A;  2PWJ A;  3HVN A;  5BRT A;  2J23 A;  5DAL B;  4OCE A;  2G2Q A;  1THX A;  6GSX A;  4NV2 A;  1V9W A;  2VUP A;  2VAF A;  4HSC X;  4G19 A;  3IAM 2;  1JZO A;  2I4A A;  2C1Y A;  2K18 A;  2C0E A;  1OE7 A;  3ME7 A;  5GST A;  3RBT A;  2B7J A;  4KND A;  3UJ1 A;  4USS A;  5B6M A;  3D4M A;  1B4P A;  4Q5N A;  2DSA A;  2XPE A;  5C00 A;  3A2X A;  3IPZ A;  4EE0 A;  3LXT A;  4I2T A;  2OKA A;  3WGE A;  2B1L A;  3UBK A;  5IM9 A;  5CNW A;  5JCG A;  1VF2 A;  3HJP A;  1ZMA A;  2R6K A;  3VWU A;  3W8J A;  2VD1 A;  2O8V B;  4JR4 A;  1V2A A;  1KNG A;  4KDY A;  4QL9 A;  4BWS A;  4F03 A;  1SYX A;  3I69 A;  4MJE A;  3O6T A;  3DML A;  5E4W A;  4OMV A;  1PX6 A;  2HXK A;  1QFN A;  2H70 A;  2YWO A;  1SL1 B;  5J41 A;  3CSJ A;  3P90 A;  3VWX A;  3KTB A;  2DJ1 A;  3A2W A;  3DEX A;  4HJ2 A;  4O7H A;  5ELA A;  3HA9 A;  1YDK A;  2X49 A;  4L5L A;  1TK0 B;  1RK4 A;  5IMF A;  5HR2 A;  1BED A;  3TOT A;  2FWG A;  2C3N A;  14GS A;  3SBC A;  3F3R A;  5HFK A;  4IGJ A;  4MF7 A;  3HZ4 A;  1G6Y A;  1GUK A;  4F0C A;  2L6C A;  1EOG A;  1S3A A;  1TK5 B;  4JRR A;  1SD8 A;  5GSS A;  1CQG A;  3VPT A;  1AQV A;  5KEJ A;  4JBB A;  1Y6E A;  5LCZ A;  4BVY A;  2L6D A;  3FKF A;  1TRS A;  2F8A A;  4ACS A;  3C73 A;  5L71 A;  2IJY A;  1PN9 A;  3KMN A;  3LXZ A;  2F51 A; 
#chains in the Genus database with same CATH homology
 2L4Q A;  2WFC A;  3U6V A;  1LJR A;  2K8S A;  2PBJ A;  5IMC A;  1AUC A;  2WRT A;  4GF0 A;  4BVX B;  2IMD A;  1A0R P;  5IMA A;  3D5J A;  2X8G A;  2N5F A;  2L5L A;  1NSW A;  1TRW A;  2P31 A;  3PPU A;  4LLR A;  2X8C A;  5F05 A;  5A4V A;  1OVN A;  2VO4 A;  5J5N A;  6GSY A;  2QA2 A;  5ECM B;  4F2I A;  3R2Q A;  3TUE A;  3EMX A;  4DEJ A;  3N5O A;  2ES7 A;  2VLV A;  1TP9 A;  2WJU A;  2CZ3 A;  3FY7 A;  2KHP A;  4K0G A;  3C1R A;  4LL4 B;  4N10 A;  4N0Z A;  2XHF A;  3DWV A;  4N0V A;  5COH A;  2MBT A;  2LS5 A;  1Y25 A;  1LU4 A;  3M3M A;  5F8B A;  4PUA A;  5ECO B;  4POB A;  2K9F A;  5D9W A;  2ZNM A;  2KOK A;  5JWR B;  1FG4 A;  5KOW A;  2V2G A;  1ERT A;  2HZE A;  4JU5 A;  2GTU A;  5G31 A;  3WGX A;  2VIM A;  1GH2 A;  3GV1 A;  4KDU A;  4LL1 B;  2C3Q A;  1U88 A;  3KP8 A;  4AGS A;  3HCZ A;  2LST A;  2JSZ A;  2FLS A;  4XTS A;  3RDW A;  4RQR A;  1GSF A;  2V6K A;  2CX3 A;  3M1G A;  3GIX A;  5ECI B;  5EVO A;  3DXB A;  2DKI A;  2R0C A;  1IYH A;  4G0L A;  1WIK A;  2FWF A;  2YJH A;  1TDI A;  1XW6 A;  2CVD A;  4J56 E;  1A2M A;  3F4R A;  1GSE A;  1A8L A;  3ZMK A;  2JL4 A;  3TKP A;  4MJC A;  4MLY A;  3KH9 A;  1O81 A;  2R2J A;  1RQM A;  3HDC A;  2DJ3 A;  3GKX A;  4P3Y B;  13GS A;  1BJX A;  2OAC A;  1ERW A;  2O85 A;  1XOA A;  2WGR A;  2E2M A;  3NZN A;  1E2Y A;  3ERW A;  2B5Y A;  3K8N A;  2QGV A;  4IHU A;  3IOS A;  1FOH A;  3MNG A;  2AB6 A;  3F3Q A;  4ZL9 A;  2NDO A;  3GL5 A;  3CYN A;  1K0N A;  1WOU A;  6GSV A;  4DVC A;  4A5P A;  4X0X A;  3LGC A;  2V32 A;  4BVY B;  2RUF A;  4IP1 A;  2D2Z A;  2DML A;  4FYC A;  4F9Z A;  1PQN A;  4EDZ A;  4EKZ A;  5ID2 B;  3UVT A;  16GS A;  1Z5Y E;  3ERG A;  2VLT A;  2F8F A;  1XW9 A;  2ON5 A;  3QOU A;  1A2J A;  1EOH A;  4POM A;  2NBS A;  1EGR A;  2Z9S A;  3HY2 A;  1M0U A;  1B9Y C;  1SYR A;  2R3X A;  2B3S A;  3M0F A;  2YCD A;  2MMZ A;  3TOU A;  3VPQ A;  3ZML A;  4YKF A;  3H4K A;  2C0F A;  3FR9 A;  3UIW A;  5CAX A;  2H73 A;  4ZL7 A;  4HDE A;  3DGQ A;  3UOM A;  1GUH A;  4YAP A;  3QFA C;  4ULX A;  3GHA A;  4WET A;  1G6W A;  4G0I A;  1F6M C;  4EIP A;  2C0G A;  2KP1 A;  2OE1 A;  1DSB A;  2DMM A;  3P2A A;  4EC0 A;  2VCV A;  4XRD A;  3ERF A;  4NXI A;  4CDO A;  3V1W A;  4ZBA A;  1SJI A;  4TVE A;  4K8M A;  2AUV A;  5GZZ B;  1MDJ A;  4KCA A;  4CW9 A;  5G30 A;  4K0N A;  2H1B A;  2HZE B;  3D4T A;  3KTL A;  4FH8 A;  3ZYW A;  4GXZ A;  5DJL A;  5CRG A;  4E8H A;  1I5G A;  1O7U A;  2IL3 A;  6GSU A;  3J7Y k;  3ZRD A;  3FYG A;  3KXO A;  4G9H A;  2P5R A;  1AQX A;  3EUR A;  1XWA A;  6GST A;  3TJF A;  1F2E A;  1A0F A;  3KZQ A;  3BBY A;  3C71 A;  2E2G A;  2KLX A;  3GUS A;  3H1N A;  3AY8 A;  4HU7 A;  4MPG A;  1VF3 A;  2GST A;  3MYD A;  5ECL B;  3PR8 A;  2H1D A;  2GSR A;  1GLQ A;  3APQ A;  2O7K A;  5AGY A;  5LNK e;  1K0C A;  2VCW A;  3S9F A;  2VCX A;  1SEN A;  5KN0 A;  1M2D A;  3L4N A;  3MAK A;  3I43 A;  4IS0 A;  5A4W A;  2PMT A;  4ZIL A;  4XS6 A;  1FB0 A;  2GQK A;  4ZB6 A;  3VFI A;  5J3R A;  3CXG A;  1GL8 A;  1FHE A;  1U3A A;  3QFB C;  1U6T A;  2ALB A;  3GTU A;  4HOJ A;  1XBS A;  1EP7 A;  2VCQ A;  2GQM A;  3IDV A;  3WGD A;  2LQO A;  4WF4 A;  5G2Z A;  4CY8 A;  2H71 A;  2PGT A;  3QDN A;  1X0R A;  1O8W A;  9GSS A;  1PMT A;  1ZYE A;  5DBQ A;  3GFK A;  4E8E A;  3M9K A;  4ZB9 A;  2YZH A;  2H19 A;  5D9X A;  5DQY A;  1W89 A;  1JLV A;  1XWB A;  3LOR A;  5AN1 A;  5B8A A;  1KTE A;  2XPD A;  4ML6 A;  5IMD A;  2PVO C;  2IMI A;  2JU5 A;  2UZ8 A;  3F6D A;  1SL2 B;  3QPM A;  2VM2 A;  5J9C A;  1Z6N A;  1K3L A;  4IJ3 A;  1THO A;  2FWH A;  2QSI A;  4YKG A;  1FAA A;  1J9B A;  2H0G A;  2DKH A;  3CRT A;  3L9V A;  1EZK A;  1GTU A;  4BA7 A;  2H76 A;  4PUF C;  4WR5 A;  3EIN A;  1ILO A;  3TKS C;  1YF1 A;  4EF0 A;  3MDK A;  1ABA A;  2QKE A;  3FEU A;  1OC9 B;  2HNL A;  3EMP A;  1AIU A;  4TN8 A;  3UBL A;  1V40 A;  5IO0 A;  2X64 A;  1DUG A;  4JZQ A;  1SL0 B;  2MMN A;  2FUG 2;  3O3T A;  5DAK B;  1PRX A;  1ZYN A;  3G7Y A;  1ERU A;  3ZVJ D;  1O8X A;  5E59 A;  2N5B A;  1SKS B;  4Q5Q A;  3LSZ A;  1TI1 A;  1R5P A;  1WP0 A;  2B7K A;  1V58 A;  1YQ1 A;  3VUR A;  2PVQ A;  1GRX A;  2JAD A;  2FWE A;  1HNA A;  2E7P A;  4BWQ A;  2H6X A;  3LJR A;  2EC4 A;  1DBY A;  4BL7 B;  3GA4 A;  5FHI A;  1G0T A;  3FZ9 A;  4ZXG A;  5GAP D;  1ERV A;  1T1V A;  1SD9 A;  1ZOF A;  1UA5 A;  5KN1 A;  2P0G A;  1HNC A;  2NPB A;  2H30 A;  2CQ9 A;  5D73 A;  2CT6 A;  5JCU A;  4FO5 A;  2IIY A;  1OC8 A;  5ELG A;  1XVW A;  3G7J A;  2O89 A;  2TRX A;  4QL7 A;  1FVK A;  4HI7 A;  4ZBD A;  3FK8 A;  3NIV A;  5B8B A;  3GL3 A;  1BX9 A;  2LNT A;  2YP6 A;  4O5R A;  2H8L A;  3KD0 A;  4NPB A;  3A2V A;  1PD2 1;  2DJ0 A;  2JSY A;  2L59 A;  2OBK A;  2VM1 A;  3LQ7 A;  6GSW A;  2LUS A;  2QC7 A;  3GTU B;  5H5Q A;  1UN2 A;  3EVI A;  4HZ4 A;  3IA1 A;  5CRH A;  2H72 A;  5IPG A;  5ECK B;  5H5S A;  1B8X A;  3D6I A;  3RHC A;  1TK8 B;  5ID2 A;  3MSZ A;  4HJM A;  3VI5 A;  2VL2 A;  4OD7 A;  2DIY A;  2YAN A;  1PA3 A;  1ACV A;  3GN3 A;  2I9H A;  3VLN A;  2LQQ A;  4KUN A;  4D73 B;  1AC1 A;  4AJ8 A;  3HD5 A;  1XVQ A;  1XFL A;  1V57 A;  5B7C A;  4G0K A;  4TXV A;  2A4H A;  5ABR A;  3TCO A;  5FWG A;  4TXO A;  6GSS A;  4JED A;  4GRF A;  3IV4 A;  2WCI A;  2HI7 A;  5LD0 A;  3CMI A;  4V1A p;  4J2F A;  1JFU A;  1S3C A;  4AJ7 A;  3IC8 A;  2AHE A;  4ZIJ A;  2HSY A;  5DQS A;  2QA1 A;  1XCC A;  1A2L A;  4ECC A;  5DJM A;  3DRN A;  3PH9 A;  4WXT A;  1TXX A;  1SJ6 A;  4AJ6 A;  2GDR A;  1GP1 A;  3EPT A;  4XHM A;  5A5K A;  2K8V A;  3FZ5 A;  3H93 A;  1K3O A;  4KB3 A;  1OYJ A;  2M72 A;  3G9B A;  4CY6 A;  3ZL5 A;  5IOX A;  1EV9 A;  1OAZ A;  3PIN A;  1G7E A;  2DIZ A;  1ZCP A;  2TIR A;  2IFQ B;  1XWG A;  2J9H A;  2L57 A;  2VCZ A;  3IAS 2;  1JLW A;  2GT5 A;  2HRA A;  1A24 A;  3KGK A;  4ZBB A;  2WUL A;  1B48 A;  3E9J B;  4ECB A;  1YZX A;  1ZZY A;  5EPF A;  3IK9 A;  3U5R E;  3GSS A;  1HNB A;  4K2D A;  1PSQ A;  3CTG A;  1TOF A;  3I6A A;  3IHG A;  4IP6 A;  1ZL9 A;  1JZW A;  2HLS A;  5F07 A;  1V98 A;  1X5C A;  4DSQ A;  4IKH A;  4ZL8 A;  1E6B A;  3VK9 A;  4V2N A;  4EUY A;  1JZR A;  1FW1 A;  2K6V A;  1HD2 A;  2R0P A;  3D21 A;  1GSQ A;  2CAI A;  1OKD A;  5G5F A;  2JZT A;  2C3T A;  4I6X A;  4EXJ A;  4MH2 A;  1YKC A;  4TR4 A;  1KBN A;  1WE0 A;  4ZB8 A;  4XS4 B;  1GSS A;  2LV3 A;  2GZY A;  3CSH A;  3FW2 A;  2FHE A;  4EL1 A;  3H79 A;  4X1U A;  5ECH B;  3G7I A;  1R26 A;  1MDK A;  3GUR A;  4MCU A;  2H0H A;  2IWT A;  5JWQ B;  2GZZ A;  4MK3 A;  2L5O A;  2A2R A;  4OO4 A;  5ECS A;  1VF4 A;  1GSY A;  2EIQ A;  2R0G A;  3QMX A;  4TXO B;  3HVV A;  2KP2 A;  5J9B A;  3GKN A;  1OC9 A;  1SJZ A;  4KGI A;  4WKW A;  1MD3 A;  2MBS A;  4NV5 A;  3IHQ A;  4GCI A;  2RM6 A;  1Q98 A;  3KP9 A;  3KCM A;  3WYW A;  2VL2 C;  1M99 A;  3GST A;  4I5Q A;  2ZUP A;  1GTA A;  5DAK A;  1Z9H A;  1LBK A;  4NHW A;  3WD6 A;  4XRA A;  3F0I A;  1BAY A;  1K0M A;  4V1A g;  1BQ7 A;  2FA8 A;  4F0B A;  5D9V A;  4KSM A;  2H1G A;  2B5E A;  4PTS A;  2CAQ A;  2HRF A;  3LG6 A;  2OAD A;  1YY7 A;  2AYT A;  3F6F A;  1GLP A;  2I1U A;  2F3M A;  3HVS A;  3EYT A;  4BL7 A;  3LYK A;  3H8Q A;  3KH7 A;  4ECI A;  3VI7 A;  1T4Z A;  4Z2T A;  3DYR A;  3EC3 A;  1R7H A;  3QAG A;  4L8E A;  1ML6 A;  3GNJ A;  1EEM A;  1RW1 A;  11GS A;  5CRD A;  1T7P B;  5HFG A;  3IR4 A;  1TRV A;  3EE2 A;  5IPH A;  4WF5 A;  1QGV A;  1PL1 A;  1VRS D;  3DIE A;  2GLR A;  1JZD A;  3QCP A;  5ECN B;  1SK1 A;  4PQ1 A;  4OFN A;  3Q74 A;  4GST A;  2IPA A;  4OCF A;  1EEJ A;  2MYG A;  1NM3 A;  2IMF A;  3HYP A;  19GS A;  5D8I A;  1JHB A;  1SKR B;  4ML1 A;  4QQ7 A;  1TU8 A;  2LJA A;  4LA1 A;  1O85 A;  2H0I A;  3FHK A;  1XOB A;  4GWR A;  2MMA A;  4GTU A;  4ICY A;  1Z6M A;  1TRU A;  5F0G A;  1KEB A;  3DD3 A;  3GMF A;  1XWC A;  4GLT A;  5AIX A;  2YV9 A;  1X5D A;  2H01 A;  4IW9 A;  2WS2 A;  3D22 A;  4FIW A;  3GYK A;  1FVJ A;  3C1S A;  4IBP A;  2PER A;  2VD0 A;  2WZ9 A;  5IMV A;  4NAX A;  2GVP A;  4K5S A;  4D73 A;  2VL3 A;  2EIR A;  2RII A;  4MJB A;  1USB A;  3IBH A;  1F3B A;  1SK2 A;  1SK0 A;  1SU9 A;  4FYB A;  4AF2 A;  1T8E B;  5F06 A;  1YEP A;  5IO2 A;  2H6Y A;  2DLX A;  2YWM A;  1HQO A;  4MH3 A;  4GQF A;  1AQW A;  2FGX A;  2X4A A;  2XBQ A;  3TJB A;  2BMX A;  2L4C A;  5AIV A;  4OFT A;  3D0Z A;  2V6O A;  2HE3 A;  1XZO A;  3JCM L;  2TRC P;  2LNS A;  3GKK A;  1U3I A;  1F37 A;  2A2S A;  2FY6 A;  2V41 A;  1AW9 A;  3CSI A;  1GUM A;  2G0F A;  3WT1 A;  4MF6 A;  3FRC A;  2GT6 A;  1VF1 A;  4RUV A;  3FMW A;  3CRU A;  3M9J A;  2AAW A;  1YF0 A;  4MNN A;  1X9S B;  5IOW A;  4EIQ A;  1OKT A;  4MAB A;  3CBU A;  4BPY A;  2DJJ A;  4TR1 B;  3Q18 A;  1UC7 A;  3GRX A;  1UVZ A;  1ST9 A;  2YNX A;  4N11 A;  4TR0 A;  1T4Y A;  2IFQ A;  5FT3 A;  5G1L A;  4K9Z A;  4PQH A;  4TKY A;  2M46 A;  2AJQ B;  1R5A A;  3BD2 A;  2CVB A;  3KMO A;  4RI6 A;  2XBI A;  4PXO A;  1TKD B;  5IMZ A;  2B6M A;  4PNF A;  3W6G A;  2YPM A;  3L0H A;  3TB2 A;  5D9T A;  5HFI A;  1GTI A;  4HUA A;  1N8J A;  2C4J A;  2O87 A;  4YH2 A;  1Z7R A;  3PGT A;  4H86 A;  4I97 A;  2RLI A;  5J4U A;  2MMO A;  3E0U A;  1N2A A;  3DVW A;  2NVL A;  3R3E A;  4GQC A;  3DKS A;  1X9M B;  3UAP A;  2OE3 A;  3SWL A;  3VWV A;  3HZ8 A;  3IK7 A;  3TJG A;  5INY A;  3HXS A;  1U87 A;  1PKZ A;  2REM A;  3TRQ A;  2LTK A;  2HRN A;  4I8B A;  3F63 A;  4YQM A;  3BJ5 A;  4MZB A;  2DJK A;  3NOF A;  4HS1 A;  5KN3 A;  4NWY A;  2CA8 A;  1EV4 A;  4ID0 A;  2X99 A;  2JAC A;  1WRY A;  1K0D A;  4KDX A;  3APS A;  4X4J A;  4MMM A;  3ZVJ A;  4ECJ A;  1M9B A;  4MZC A;  4CHS A;  4JE1 A;  3VWW A;  1TU7 A;  4XS4 A;  2LJK A;  2H75 A;  5G5E A;  5BMU A;  5CRW A;  1OC3 A;  2AV4 A;  1EGO A;  4G2E A;  3UAR A;  3GKM A;  1GSD A;  4Q5R A;  3QD9 A;  3W8S A;  1ZYQ B;  4XIH A;  5D96 A;  3WT2 A;  1ON4 A;  3HKR A;  5HR0 A;  4RI7 A;  2CX4 A;  3KIJ A;  2HSM A;  3RHB A;  2YJ7 A;  4PUR A;  4EO3 A;  3Q6O A;  2A2P A;  3QAW A;  1K0O A;  4KH7 A;  3FR6 A;  2VCT A;  4KX4 A;  2BTO T;  1XXU A;  2JZS A;  1AXD A;  3MWH A;  5HR1 A;  2PU9 C;  4O92 A;  1PGT A;  3A5W A;  3IXR A;  3TDG A;  3HHV A;  3TKR A;  3ZTL A;  1GNE A;  1TJD A;  5AIS A;  3UMA A;  2C0D A;  3GH9 A;  1I9D A;  4DSS B;  3F4T A;  1TI3 A;  3GX0 A;  1GSU A;  1OE8 A;  4O5Q A;  3F8U A;  3I9V 2;  2F9S A;  4IVF A;  2RM5 A;  3ZFB A;  4K7O A;  1NHY A;  2ON7 A;  4TRX A;  5C04 A;  4L0U A;  4K5R A;  4LMW A;  4HQZ A;  3RAZ A;  3TKS E;  1ZGN A;  3L9S A;  2NTO A;  3ZIJ A;  2ZCT A;  2V1M A;  4Q5F A;  4IEL A;  5JWO B;  1W4V A;  20GS A;  2HFD A;  4OWY A;  5DCG A;  3ED3 A;  4L0W A;  4FQU A;  1XPV A;  2MZC A;  2B1K A;  4IQA A;  1O6J A;  4ILF A;  3TGZ A;  2C80 A;  2GGT A;  4WEY A;  5DDL A;  3F4S A;  2H6Z A;  1C72 A;  1J08 A;  3C8E A;  2LRN A;  1XIY A;  3ISO A;  3Q19 A;  1Z7P A;  4Z2U A;  3A3T A;  4POK A;  5CP1 A;  1T3B A;  3UL3 A;  2E0Q A;  4Z7X A;  5ECP B;  1M2B A;  4K7N A;  2VLU A;  2LJR A;  3GH6 A;  1ZYP A;  4MF5 A;  4PQI A;  12GS A;  1DE1 A;  1MD4 A;  1FOV A;  3QR6 A;  1GNW A;  1T00 A;  4K7I A;  1M2A A;  1K0A A;  3FZ4 A;  2VOC A;  1TW9 A;  4O32 A;  1GUL A;  2OJL A;  1NHO A;  3M8N A;  4V2L A;  4POL A;  3CTF A;  3KEB A;  4Z2R A;  3HVX A;  5H5R A;  1X5E A;  1B4Q A;  1A8Y A;  3MIX A;  2X8H A;  4GSS A;  1O73 A;  1GWC A;  3EU4 A;  2R37 A;  3ZRE A;  2GSS A;  1M9A A;  4HEA 2;  2DBC A;  1BG5 A;  2FA4 A;  1B9X C;  4MP4 A;  3LWA A;  3P8W A;  2HT9 A;  5CO3 A;  2R5G A;  4PX1 A;  4MJA A;  1VGL A;  1K0B A;  4WBR D;  4KSO A;  1YEX A;  3BCK A;  1R4W A;  2YV7 A;  1PL2 A;  1X9W B;  4YQU A;  4IQ1 A;  3TKQ A;  1MDI A;  3TKS A;  4KW6 A;  3HJM A;  4KF9 A;  1WWJ A;  5HQP A;  4PGT A;  2HZF A;  2IMK A;  2BJX A;  4NHZ A;  4YAV A;  3ME8 A;  4OFM A;  2XC2 A;  3IC4 A;  3FZA A;  2P5Q A;  2PN8 A;  3L78 A;  5G1K A;  1MTC A;  3ZIV A;  3APO A;  4IJI A;  4PNG A;  3EWL A;  3LFL A;  2JZR A;  22GS A;  5D93 A;  3UEM A;  2CV4 A;  2DJ2 A;  2OA7 A;  4V2M A;  5KN2 A;  2DC5 A;  2GSQ A;  3QAV A;  3RPP A;  3EU3 A;  2PPT A;  1QMV A;  1XWK A;  5A4U A;  2KUC A;  4MDC A;  5DVB A;  3IRA A;  5IQY A;  3TRX A;  1WPI A;  2YZU A;  2C8U A;  4KAE A;  4TOP A;  5ECR B;  5DAL A;  3RPN A;  4JR6 A;  4KE3 A;  4OO5 A;  1F3A A;  1K3Y A;  3LW9 A;  2HYX A;  18GS A;  2YWN A;  2LEG A;  1PX7 A;  1GTB A;  3BCI A;  1Q4J A;  2EIO A;  2GZP A;  1EWX A;  5ENU A;  4TR1 A;  4K1F A;  3DVX A;  1DE2 A;  2WB9 A;  2WDU A;  3FR3 A;  1YJ6 A;  3A5I A;  3P7X A;  1QXH A;  2LKU A;  2GS3 A;  2YOI A;  3US3 A;  4KA0 A;  4I2U A;  1NW2 A;  3ZZX A;  1FB6 A;  4MA9 A;  2CVK A;  3LYP A;  3ZFL A;  3HJO A;  1WMJ A;  1QUW A;  2HRK A;  4WR4 A;  2B5X A;  1IYI A;  1S3D A;  2H66 A;  4YQV A;  5IIZ A;  1SKW B;  1FO5 A;  3E3E A;  4DSR A;  3L9U A;  1A23 A;  1F9M A;  3C7M A;  4HU9 A;  1CQH A;  2RUE A;  2LRC A;  3ZLP A;  5HR3 A;  2I81 A;  3KJY A;  1MEK A;  2OBI A;  4GSN A;  8GSS A;  1HYU A;  4N30 A;  1M7T A;  2M80 A;  3UVH A;  5B6N A;  1AAZ A;  3BOA A;  5GAN D;  3GX8 A;  3LEF A;  5JCW A;  2GQL A;  2OE0 A;  3N9J A;  4IN0 A;  1H75 A;  5EL8 A;  4MZW A;  2LRT A;  1Z3E A;  1H4O A;  1YKA A;  1QK8 A;  5CRE A;  4HZ2 A;  4LMV A;  2YN1 A;  4K6X A;  3J7Y b;  4G10 A;  4TW5 A;  2FNO A;  3ZIT A;  4ISD A;  2CZ2 A;  5KOX A;  2YWI A;  5DCH A;  2H74 A;  1QQ2 A;  4RQX A;  2N5A A;  1EP8 A;  3F9U A;  2HSH A;  3OR5 A;  2H1A A;  2FD3 A;  4EDY A;  4K2X A;  1J0F A;  4X43 A;  1TTZ A;  4XS1 A;  3IE3 A;  3KM6 A;  4O5U A;  3TJK A;  4WBJ A;  7GSS A;  3TRP A;  10GS A;  17GS A;  2A4V A;  4L5O A;  4MPF A;  4BVX A;  4F82 A;  2VL9 A;  1WJK A;  4J57 E;  5CYY A;  2I3Y A;  2IN3 A;  5EY6 A;  1PKW A;  1G7O A;  1BYE A;  2R4V A;  4HQS A;  1URM A;  3TJJ A;  5ECQ B;  2FCH A;  4XCS A;  4NMU A;  1PN0 A;  4KCE A;  4EVM A;  4DSS A;  2PUK C;  4TR3 A;  2IME A;  4FYU A;  3O76 A;  1XW5 A;  2PWJ A;  5BRT A;  2J23 A;  5DAL B;  4OCE A;  2G2Q A;  1THX A;  6GSX A;  4NV2 A;  1V9W A;  2VUP A;  2VAF A;  4G19 A;  3IAM 2;  1JZO A;  2I4A A;  2C1Y A;  2K18 A;  2C0E A;  1OE7 A;  3ME7 A;  5GST A;  3RBT A;  2B7J A;  4KND A;  3UJ1 A;  4USS A;  5B6M A;  3D4M A;  1B4P A;  4Q5N A;  2DSA A;  2XPE A;  5C00 A;  3A2X A;  3IPZ A;  4EE0 A;  3LXT A;  4I2T A;  2OKA A;  3WGE A;  2B1L A;  3UBK A;  5IM9 A;  5CNW A;  5JCG A;  1VF2 A;  3HJP A;  1ZMA A;  2R6K A;  3VWU A;  3W8J A;  2VD1 A;  2O8V B;  4JR4 A;  1V2A A;  1KNG A;  4KDY A;  4QL9 A;  4BWS A;  4F03 A;  1SYX A;  3I69 A;  4MJE A;  3O6T A;  3DML A;  5E4W A;  4OMV A;  1PX6 A;  2HXK A;  1QFN A;  2H70 A;  2YWO A;  1SL1 B;  5J41 A;  3CSJ A;  3P90 A;  3VWX A;  3KTB A;  2DJ1 A;  3A2W A;  3DEX A;  4HJ2 A;  4O7H A;  5ELA A;  3HA9 A;  1YDK A;  2X49 A;  4L5L A;  1TK0 B;  1RK4 A;  5IMF A;  5HR2 A;  1BED A;  3TOT A;  2FWG A;  2C3N A;  14GS A;  3SBC A;  3F3R A;  5HFK A;  4IGJ A;  4MF7 A;  3HZ4 A;  1G6Y A;  1GUK A;  4F0C A;  2L6C A;  1EOG A;  1S3A A;  1TK5 B;  4JRR A;  1SD8 A;  5GSS A;  1CQG A;  3VPT A;  1AQV A;  5KEJ A;  4JBB A;  1Y6E A;  5LCZ A;  4BVY A;  2L6D A;  3FKF A;  1TRS A;  2F8A A;  4ACS A;  3C73 A;  5L71 A;  2IJY A;  1PN9 A;  3KMN A;  3LXZ A;  2F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...