2LJKA

Solution structure of the oncogenic-potential mien1 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
117
structure length
117
Chain Sequence
GSMSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein C17orf37
publication title Solution structure of the oncogenic-potential MIEN1 protein reveals a thioredoxin-like fold with redox potential
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ljkA01
3WT2A 5A5KA 1N2AA 1IYIA 2MMAA 3QD9A 2CA8A 1YF0A 4JR4A 2LNTA 1UC7A 2E2MA 3TKRA 1GSYA 1HNCA 2JZRA 4IQAA 4YQMA 3QCPA 4Q5QA 2AAWA 1X5CA 3QAVA 5IMZA 3HKRA 3VPTA 2LV3A 3CTGA 4GXZA 2GQLA 2RUFA 2QC7A 4QQ7A 4GSTA 4JBBA 4MMMA 2B5YA 5ECOB 1WWJA 3ZL5A 1X5DA 5DQYA 5F0GA 3TJKA 1M2BA 4HJ2A 2JSYA 2H6YA 4Q5FA 4POMA 1XWCA 1UA5A 3IHQA 1MD4A 2HRNA 3ZRDA 3SWLA 4N0VA 1GTUA 3O6TA 2K8SA 2FY6A 4LL1B 4J2FA 3FYGA 3RBTA 2HLSA 3KMOA 3L0HA 5DCHA 4DSRA 4MH2A 3TOUA 3BBYA 4HOJA 4TXVA 3WD6A 3HHVA 3UJ1A 2O8VB 3VPQA 2HZFA 4KAEA 1XWBA 3FR9A 2YOIA 3JCML 1TU7A 3HXSA 3GX8A 2RM5A 4ML1A 3FK8A 4LMVA 4HEA2 1G0TA 4XHMA 5F06A 4ECBA 5D93A 3DIEA 1B4QA 3GN3A 5ECNB 1EWXA 3D0ZA 2O7KA 4ID0A 4MCUA 4MK3A 4MZWA 1BJXA 3F9UA 3GL5A 2H74A 3G7IA 3G9BA 2C3QA 2B1KA 2PWJA 4PNFA 3PR8A 4RI6A 3ZMKA 2GZPA 4HUAA 2YV7A 1ERTA 3BD2A 4NV5A 6GSSA 3KCMA 1SJZA 5JCGA 2NBSA 11GSA 2CAIA 4E8HA 5EY6A 1YY7A 3WGEA 2CZ3A 1M9AA 3ZREA 2EC4A 4MJCA 5ECMB 1O8WA 1OC9B 1M2DA 1THXA 2GVPA 4HZ2A 2VL2C 1F2EA 4JEDA 1DBYA 1THOA 6GSWA 5INYA 2FLSA 3D5JA 3GNJA 3RDWA 1V2AA 1EV4A 4KH7A 1ZL9A 2H6XA 3SBCA 3GKKA 2X8CA 4KSOA 1O85A 1ILOA 4NHWA 1ERVA 4JRRA 1NHOA 1GSQA 3L78A 2FWGA 4K0NA 4XRAA 4NHZA 2I9HA 3KTBA 3U5RE 4AF2A 2H72A 2PVOC 3L9UA 3WYWA 4ZBAA 1O7UA 2IL3A 1H4OA 4X43A 4JE1A 5HQPA 1K0MA 2IN3A 4OFMA 2DC5A 1V40A 5CRHA 5DCGA 4PGTA 2L5OA 3GSSA 5G2ZA 4F0BA 2JACA 3CSHA 4RUVA 1NSWA 5CRWA 6GSUA 2IMIA 1ZYQB 1GSEA 2IPAA 1YEPA 5KN1A 1WE0A 2FA8A 4IELA 4GQFA 2G0FA 3UVTA 5B6MA 2R5GA 5COHA 3GH9A 1A2MA 1EP7A 1AC1A 5ECKB 2I3YA 1PX7A 2IMDA 2H66A 4P3YB 3EU3A 4K9ZA 3Q18A 1BX9A 5D9XA 3E3EA 2H73A 4BVYA 2O87A 5D8IA 4PX1A 3TOTA 1OC8A 2OE1A 1U87A 1LU4A 2H0GA 2YANA 1WP0A 3GX0A 3W8JA 1QUWA 2IMKA 2WZ9A 4ML6A 3A5WA 4HU7A 4L5OA 4GF0A 4ECJA 1O8XA 1QXHA 1ACVA 5EPFA 3TCOA 4IQ1A 1K3YA 2X64A 5J41A 2M80A 5LD0A 2FWHA 2OACA 4F03A 5B8AA 4AJ6A 5KN2A 1Q4JA 3KXOA 3C8EA 2HRFA 5FT3A 1EOHA 1PN9A 5IO2A 3WGXA 3H93A 4K7OA 3ZIVA 3F63A 3CTFA 1GLQA 2NDOA 3TKSE 4MPGA 2HXKA 1H75A 1PX6A 1K3OA 3FY7A 2CT6A 3HYPA 1K0OA 1TOFA 4YQUA 1X9WB 4O7HA 5H5QA 5IMDA 1CQHA 1XPVA 1XW6A 4FYBA 1TJDA 4EDZA 4YH2A 5DALB 2YJ7A 4HJMA 3IAM2 3F4SA 2HT9A 2F51A 2G2QA 3IA1A 2GSTA 5FWGA 2EIOA 3GTUB 2PGTA 3V1WA 3ME7A 2LRNA 3TKQA 5A4WA 1EGOA 5DDLA 2BMXA 3HD5A 4CDOA 7GSSA 3QAWA 3EWLA 1TI3A 1A8LA 3IDVA 5KN3A 1FAAA 3TJJA 3MNGA 2R37A 3LGCA 1AQVA 2KOKA 2P31A 1GUMA 2OKAA 2QSIA 4V1Ag 2PVQA 1JZOA 1K0CA 2GZZA 1Z6NA 3UEMA 1Y25A 1BQ7A 2YWOA 3ZVJD 2YWMA 4YQVA 4V2MA 1GSFA 2GQMA 2PU9C 4IBPA 3IK9A 5CO3A 2YPMA 5DAKB 6GSXA 3UIWA 1PL1A 3I69A 1NW2A 5IOWA 4TW5A 3GH6A 3VURA 1I5GA 5D9VA 4CHSA 2L6DA 2PBJA 2QGVA 4ZBDA 3P90A 1GTBA 3ME8A 2BJXA 1LBKA 5B7CA 4BPYA 1F9MA 5CREA 1M0UA 5DVBA 1SL1B 3HZ8A 1E2YA 4MZBA 4MDCA 2CAQA 2FGXA 1FVJA 1ML6A 2HE3A 8GSSA 1UN2A 4XIHA 2V6KA 4FH8A 4EE0A 1B4PA 1KTEA 2RM6A 2VUPA 2LNSA 2PMTA 1GTAA 2VCVA 2GLRA 4OD7A 3ERWA 1AXDA 4ZBBA 6GSVA 22GSA 3I43A 2DJJA 3LORA 1ZOFA 1DSBA 2GZYA 2MMOA 1SD8A 4RI7A 1JLVA 3QPMA 4K0GA 3FEUA 1JHBA 5CAXA 1YF1A 2LJAA 3ZYWA 1KNGA 1AQWA 3EU4A 4GWRA 2HSYA 4N30A 3VWUA 4TR3A 3CMIA 6GSTA 1B9YC 3U6VA 2ON7A 1T4YA 5L71A 1PKWA 1CQGA 4AGSA 3W6GA 3DXBA 13GSA 2YZHA 2J9HA 3ZFLA 1ST9A 2H0HA 5HR2A 4YAVA 1SD9A 2HI7A 4ILFA 4O32A 3UBKA 5DJLA 3QAGA 2MBSA 3IV4A 3VI7A 4TKYA 2LRTA 3CSIA 2FHEA 4EO3A 1KBNA 4KUNA 4MH3A 1YKAA 2EIQA 1S3AA 5D73A 2VCXA 3DVXA 1K3LA 3DD3A 4EUYA 1F6MC 2N5FA 3APQA 5GZZB 2I81A 3FKFA 2A4VA 2AHEA 2B5XA 2DIYA 1SL2B 2VLVA 3GKMA 5HFGA 3UBLA 3PH9A 1B8XA 2K6VA 2ON5A 3F4TA 1URMA 1GUHA 2K9FA 4ISDA 2CQ9A 3DEXA 1U3AA 19GSA 3UAPA 4V2NA 2B1LA 5IMAA 4MABA 3A3TA 3Q74A 2L6CA 5DALA 1GSDA 1MDKA 4WKWA 2K8VA 4IJIA 2WDUA 5B8BA 2H6ZA 1EEJA 2QKEA 2LQOA 2IIYA 3GTUA 2LUSA 1TI1A 1EGRA 18GSA 3Q19A 2AJQB 4NV2A 5A4UA 2GS3A 5ELAA 1GNWA 3MSZA 4O5RA 3RHCA 1S3CA 2FA4A 4AJ7A 1ZZYA 3VWWA 2LJKA 2GSRA 4PNGA 1M99A 1UVZA 2DJ1A 5G1LA 1PGTA 2AB6A 3DYRA 1V57A 4TOPA 1OVNA 2GGTA 2KUCA 1FVKA 5JWQB 2WFCA 2DMLA 1WMJA 3CYNA 3KH9A 1Z7RA 3KH7A 2X8HA 3IAS2 3GKXA 5C00A 3GKNA 5A4VA 3K8NA 4TN8A 4OMVA 2MMNA 1DE1A 4I2TA 5IMFA 3DGQA 4V1Ap 2AV4A 2OADA 4BL7A 4H86A 5DAKA 2VCZA 3D4TA 1YEXA 4I8BA 2AYTA 5EVOA 3TJFA 2GTUA 1MDJA 3EC3A 5B6NA 4EDYA 1U88A 3UVHA 1XCCA 2L57A 4FYUA 3D21A 2C3TA 2WGRA 1Z3EA 4HU9A 4WR5A 2YN1A 4WF4A 5ECIB 5G5FA 2IMEA 1YKCA 1EEMA 4IP6A 4OFNA 3RAZA 4PXOA 5D9WA 1ZGNA 3KTLA 2CV4A 1TXXA 2HZEB 2TIRA 1PMTA 5IMVA 1MTCA 5IIZA 1XWKA 4HQZA 2JL4A 4DSQA 5G31A 4FO5A 3PGTA 4L5LA 3QFBC 4RQXA 2K18A 4PURA 2E7PA 4PQHA 4DVCA 5IM9A 3VLNA 4L0WA 3H8QA 3C73A 1GWCA 1RK4A 1W4VA 4EVMA 1BAYA 2R4VA 1OE8A 3TGZA 4F0CA 5GAPD 4Q5RA 1MD3A 3N9JA 1SJIA 5LCZA 4IW9A 1GTIA 1A24A 2KHPA 5ECQB 4GSNA 1QGVA 4K8MA 5IPGA 1K0NA 3EVIA 4WR4A 3L9VA 1XBSA 2JADA 3FRCA 2LTKA 2JZSA 4BWQA 3ISOA 1K0BA 1TRVA 4POLA 4G19A 3HVXA 4PQ1A 5ECRB 2YWIA 3DMLA 3M1GA 1I9DA 2KP2A 3IE3A 1TRWA 5J9BA 4PUFC 3KD0A 5AISA 3ZITA 5GAND 2HFDA 3IR4A 3QDNA 3QMXA 4K7IA 2WS2A 5JCWA 2LEGA 1F37A 3TJBA 3ZLPA 4J56E 3C1SA 1OKTA 4IS0A 4ZL9A 2RLIA 1YJ6A 5E4WA 2L4CA 4GQCA 2NTOA 1G7EA 4ZIJA 3O3TA 1V9WA 2LQQA 4IP1A 4ZB8A 4TXOB 2GSQA 4IKHA 2KLXA 2H70A 2VAFA 1MEKA 2RIIA 4XTSA 1R26A 1GP1A 4O92A 4OCEA 5ELGA 2OA7A 4KB3A 2XPEA 5ABRA 1Z5YE 5ECHB 1F3BA 5ID2B 4N0ZA 5G30A 4WEYA 2H75A 2AUVA 2V41A 2MBTA 2C0DA 3ZZXA 3MWHA 1VF3A 2VCTA 2YWNA 2VD1A 3H79A 1X9MB 3EMXA 4I6XA 3KZQA 2E0QA 5J3RA 3IRAA 1QK8A 3J7Yb 2O85A 2DLXA 1OYJA 1M7TA 3LYKA 1S3DA 3Q6OA 4Z7XA 1FW1A 4QL7A 2L4QA 5ECPB 4EXJA 1JZDA 3QFAC 4N10A 2H0IA 2PN8A 3VI5A 1A23A 5JWRB 4IGJA 1RQMA 1DUGA 2DSAA 4PUAA 4ACSA 1V98A 3D22A 1XFLA 5G5EA 2XC2A 2VIMA 4JU5A 3D6IA 1VF4A 1GLPA 1IYHA 3HDCA 3L9SA 1ZCPA 4KCAA 3FZ4A 4KDUA 2TRCP 2R3XA 2B6MA 2R2JA 1GUKA 3RPNA 3F8UA 3IK7A 1R5PA 4LA1A 4POKA 4EL1A 1XW9A 2HNLA 1OC3A 1VF2A 1VRSD 2HZEA 2XHFA 3DWVA 2DJ0A 3TB2A 2M72A 4TR0A 3I6AA 4HZ4A 2PUKC 4XCSA 3ZTLA 3MAKA 3WGDA 3LXZA 3FR3A 2LRCA 4TR4A 4AJ8A 2DJKA 2P0GA 2VO4A 2I1UA 3TRQA 4YAPA 3IPZA 2ALBA 2H1DA 4MZCA 5GSSA 1USBA 3IXRA 2WRTA 3AY8A 5C04A 3GA4A 3F4RA 5CRDA 3TRXA 1XWAA 1X5EA 4CW9A 1SU9A 1FHEA 5CNWA 4MPFA 2EIRA 2MYGA 1WPIA 2C4JA 1EV9A 3A2XA 1M9BA 2PPTA 2A2SA 3GUSA 4MF5A 3HY2A 2YZUA 3QOUA 1TP9A 1Z9HA 4K6XA 3HVVA 4PQIA 2I4AA 3NZNA 4TR1B 1SKWB 5GSTA 1GSUA 2REMA 4KSMA 2VCQA 1SENA 3ZMLA 1PKZA 3EE2A 2VM2A 3TDGA 4F82A 1SK2A 1NHYA 3TUEA 4OO4A 4OWYA 1Z7PA 2NPBA 2FWFA 1ABAA 1XOAA 1R7HA 2P5QA 2CVKA 2KP1A 3IBHA 3DVWA 2Z9SA 3LG6A 4V2LA 1SKSB 1R4WA 1ERUA 3QR6A 3ZIJA 4EF0A 4KDXA 4G9HA 3N5OA 1X0RA 3F6DA 4TXOA 4LL4B 4BA7A 2GSSA 2HSHA 4EKZA 4DEJA 1T7PB 4RQRA 1XVQA 2XBQA 3TJGA 2B5EA 2H1BA 3F0IA 5AN1A 3HA9A 2PERA 2VL3A 3FZ9A 1WOUA 4HDEA 3GSTA 1QQ2A 2DIZA 5CRGA 3E9JB 1SYRA 3GURA 5ID2A 1HNBA 3FW2A 2F9SA 2XBIA 3A2WA 2VD0A 3UARA 3H4KA 4IVFA 2FNOA 3C1RA 5J9CA 2VCWA 3GL3A 4HQSA 4N11A 1T1VA 4K7NA 1AAZA 2WULA 5JWOB 2X8GA 2HYXA 1GL8A 1ERWA 3FR6A 1XVWA 20GSA 2VL9A 5ENUA 4MJBA 2V2GA 2C3NA 1Q98A 2H01A 5CP1A 1GULA 4BWSA 1XWGA 3L4NA 1VF1A 3CRUA 2A2RA 1GRXA 2YCDA 2CX3A 1XW5A 3ZFBA 2WJUA 4GLTA 1AQXA 1PRXA 4OCFA 4KCEA 2H76A 3P2AA 6GSYA 1TK8B 4I97A 5EL8A 1BYEA 1JLWA 4KW6A 4F2IA 4L0UA 3F3RA 4K2DA 3KMNA 1ON4A 2FD3A 4IN0A 1J08A 3M9JA 3KP9A 3APSA 3DKSA 1FG4A 1O81A 2YV9A 5IOXA 2X99A 2DMMA 4KNDA 3E0UA 3W8SA 1C72A 3CXGA 1PA3A 3BJ5A 1XIYA 4EC0A 3J7Yk 4DSSB 10GSA 4OO5A 3ERGA 4MJEA 3APOA 2NVLA 2VLTA 3C71A 3GFKA 1BEDA 1TRUA 1W89A 3G7JA 1HYUA 1YZXA 4XS4B 4ULXA 3M0FA 2IMFA 5HFIA 2N5AA 3EMPA 3BOAA 5HFKA 5F8BA 3KP8A 5D9TA 4K1FA 5DBQA 3R2QA 3ERFA 3EYTA 1R5AA 4E8EA 4NMUA 4LLRA 5D96A 5ECSA 2L5LA 1A8YA 3P7XA 3TKSA 1E6BA 3M8NA 3HJPA 3PINA 1A2JA 3LWAA 2YNXA 4D73B 1EP8A 1G7OA 1SYXA 2C0EA 1GH2A 2JZTA 2C1YA 3IC4A 5G1KA 4TR1A 3RPPA 4ZL7A 4FIWA 3WT1A 1A0RP 5J5NA 1T3BA 2V6OA 2LSTA 3CBUA 2H1GA 3LFLA 3UL3A 2WB9A 4WF5A 3BCKA 1G6YA 3FZAA 4GCIA 1RW1A 1JZWA 2N5BA 1KEBA 1FB0A 2OBKA 1QFNA 1TU8A 1TKDB 1X9SB 1T4ZA 1J0FA 3VFIA 4G10A 3EURA 3LJRA 1G6WA 5HR0A 2ZNMA 3UOMA 1XXUA 5IPHA 1TTZA 1PSQA 3FZ5A 2D2ZA 4HI7A 3HZ4A 2OBIA 2IFQB 1O6JA 2H8LA 2F8FA 2MMZA 2C0GA 4G2EA 2E2GA 1WIKA 2CZ2A 1PD21 1F3AA 2VOCA 5F07A 5JCUA 3GHAA 3US3A 5E59A 4MJAA 3CSJA 1DE2A 1HQOA 2TRXA 3I9V2 3HVSA 4WBJA 3F3QA 3FHKA 4I5QA 2C80A 4OFTA 9GSSA 2YP6A 2DJ3A 4ZILA 3F6FA 3BCIA 1ZYEA 5DQSA 1QMVA 4POBA 5KN0A 4WXTA 4GRFA 3HJOA 2O89A 2IWTA 3KM6A 4JR6A 1WJKA 4F9ZA 4IJ3A 3OR5A 2VLUA 3C7MA 4MP4A 2P5RA 1JFUA 1SKRB 1TW9A 2L59A 2B3SA 3GV1A 5AGYA 4KE3A 1U6TA 1SK0A 4KDYA 5IMCA 1TK0B 5F05A 5AIVA 1TRSA 5HR3A 1ZMAA 4J57E 1Y6EA 2WCIA 3GIXA 4IHUA 5IQYA 4ECCA 4DSSA 1GSSA 1LJRA 2JU5A 3A2VA 2H71A 1FOVA 1YQ1A 4WETA 1J9BA 4WBRD 3LQ7A 3EINA 3M3MA 4L8EA 2RUEA 4JZQA 3GYKA 1AUCA 1T00A 5J4UA 2B7JA 2LJRA 4LMWA 5H5SA 4XS4A 3LEFA 4NAXA 2LS5A 2F3MA 2B7KA 2F8AA 2H19A 2H30A 1K0DA 1SK1A 3UMAA 1EOGA 1GNEA 1N8JA 3M9KA 1A2LA 2ZUPA 5HR1A 2M46A 4NXIA 4Q5NA 1T8EB 2GT6A 1U3IA 4ZL8A 1MDIA 3TKSC 3H1NA 5KEJA 2OE3A 4MF7A 4GSSA 1FO5A 2GT5A 5CYYA 2ES7A 4ZB9A 2ZCTA 3KGKA 3HJMA 3RHBA 2R6KA 4D73A 1V58A 4XRDA 1WRYA 3NOFA 1FB6A 4TVEA 4NPBA 2FCHA 4XS1A 14GSA 3DRNA 3ED3A 3NIVA 3VWVA 1EZKA 1XOBA 1OC9A 3CRTA 1NM3A 3TRPA 2GQKA 2YJHA 1O73A 4GTUA 4KX4A 3O76A 1YDKA 3S9FA 3IOSA 1Z6MA 2JSZA 4I2UA 1OAZA 2CVDA 1K0AA 2V1MA 3P8WA 12GSA 4KA0A 4MLYA 1OE7A 3KIJA 4QL9A 2FUG2 4FYCA 2LKUA 1A0FA 3LSZA 2VM1A 1M2AA 1AIUA 1XZOA 16GSA 2GDRA 5H5RA 2VL2A 4X0XA 4NWYA 3HCZA 2XPDA 2IFQA 5DJMA 1VGLA 1B9XC 4ECIA 3GRXA 4MF6A 1TDIA 3TKPA 2BTOT 3MDKA 1HD2A 3D4MA 1HNAA 3G7YA 5ECLB 3ZVJA 4XS6A 4HS1A 2CVBA 1BG5A 1PL2A 2H1AA 1SJ6A 2V32A 2DJ2A 2CX4A 4TRXA 3LYPA 5IO0A 4ZXGA 1OKDA 2OJLA 3KJYA 1B48A 3KEBA 4ZB6A 2MZCA 2OE0A 4KGIA 4MA9A 17GSA 3LXTA 1PQNA 5AIXA 3GMFA 3VWXA 1AW9A 1TK5B 2FWEA 5LNKe 4X1UA 1JZRA 4BVXA 2DBCA 3VK9A 2IJYA 2C0FA 2C8UA 2J23A 1SL0B 5FHIA
chains in the Genus database with same CATH superfamily
3WT2A 5A5KA 1N2AA 1IYIA 2MMAA 3QD9A 2CA8A 1YF0A 4JR4A 2LNTA 1UC7A 2E2MA 3TKRA 1GSYA 1HNCA 2JZRA 4IQAA 4YQMA 3QCPA 4Q5QA 2AAWA 1X5CA 3QAVA 5IMZA 3HKRA 3VPTA 2LV3A 4BVYB 3CTGA 4GXZA 2GQLA 2RUFA 2QC7A 4QQ7A 4GSTA 4JBBA 4MMMA 2B5YA 5ECOB 1WWJA 3ZL5A 1X5DA 5DQYA 5F0GA 3TJKA 1M2BA 4HJ2A 2JSYA 2H6YA 4Q5FA 4POMA 1XWCA 1UA5A 3IHQA 1MD4A 2HRNA 3ZRDA 3EPTA 3SWLA 4N0VA 1GTUA 3O6TA 2K8SA 2FY6A 4LL1B 4J2FA 3FYGA 3RBTA 2HLSA 3KMOA 3L0HA 5DCHA 4DSRA 4MH2A 3TOUA 3BBYA 4HOJA 2UZ8A 4TXVA 3WD6A 3HHVA 2R0PA 3UJ1A 2O8VB 3VPQA 2HZFA 4KAEA 1XWBA 2X4AA 3FR9A 2YOIA 5BRTA 3JCML 1TU7A 3HXSA 3GX8A 2RM5A 4ML1A 3FK8A 4LMVA 4HEA2 1G0TA 4XHMA 5F06A 4ECBA 3MYDA 5D93A 3DIEA 1B4QA 3GN3A 5ECNB 1EWXA 3D0ZA 2O7KA 4ID0A 4MCUA 4MK3A 4MZWA 1BJXA 3F9UA 4K5RA 3GL5A 2H74A 3G7IA 3G9BA 2C3QA 2B1KA 2PWJA 4PNFA 3PR8A 4RI6A 3ZMKA 2GZPA 4HUAA 5KOXA 2YV7A 1ERTA 3BD2A 4NV5A 6GSSA 3KCMA 1SJZA 5JCGA 2NBSA 11GSA 2CAIA 4E8HA 5EY6A 1YY7A 3WGEA 3CQFA 2CZ3A 1M9AA 3ZREA 2EC4A 4MJCA 5ECMB 1O8WA 1OC9B 1M2DA 1THXA 2GVPA 4HZ2A 2VL2C 1F2EA 4JEDA 1DBYA 1THOA 6GSWA 5INYA 4CY8A 2FLSA 3D5JA 3GNJA 3RDWA 1V2AA 1EV4A 4KH7A 1ZL9A 2H6XA 4YKFA 3SBCA 3GKKA 2X8CA 4KSOA 1O85A 1ILOA 4NHWA 1ERVA 4JRRA 1NHOA 1GSQA 3L78A 2FWGA 4K0NA 4XRAA 4NHZA 2I9HA 3KTBA 3U5RE 4AF2A 2H72A 2PVOC 3L9UA 3WYWA 4ZBAA 1O7UA 2IL3A 1H4OA 4X43A 4JE1A 5HQPA 1K0MA 2IN3A 4OFMA 2DC5A 1V40A 5CRHA 4O5UA 5DCGA 4PGTA 2L5OA 3GSSA 5G2ZA 4F0BA 2JACA 3CSHA 4RUVA 1NSWA 5CRWA 6GSUA 2IMIA 1ZYQB 1GSEA 5BMUA 2IPAA 1YEPA 5KN1A 1WE0A 2FA8A 4IELA 4GQFA 2G0FA 3UVTA 5B6MA 2R5GA 5COHA 3GH9A 1A2MA 1EP7A 1AC1A 2I3YA 5ECKB 1PX7A 2IMDA 2H66A 4P3YB 3EU3A 4K9ZA 3Q18A 1BX9A 5D9XA 4BIKA 3E3EA 2H73A 4BVYA 2O87A 5D8IA 4PX1A 3TOTA 1OC8A 2OE1A 1U87A 1LU4A 2H0GA 2YANA 1WP0A 3GX0A 3W8JA 1QUWA 2IMKA 2WZ9A 4ML6A 3A5WA 4HU7A 4L5OA 4GF0A 4ECJA 1O8XA 1QXHA 1ACVA 5EPFA 3TCOA 4IQ1A 1K3YA 2X64A 5J41A 2M80A 5LD0A 2FWHA 2OACA 4F03A 5B8AA 4AJ6A 5KN2A 1Q4JA 3KXOA 3C8EA 4X4JA 2HRFA 5FT3A 1EOHA 1PN9A 5IO2A 3WGXA 3H93A 4K7OA 3ZIVA 3F63A 3CTFA 1GLQA 2NDOA 3TKSE 4MPGA 2HXKA 1H75A 1PX6A 1K3OA 3FY7A 2CT6A 3HYPA 1K0OA 1TOFA 4YQUA 1X9WB 4O7HA 5H5QA 5IMDA 1CQHA 1XPVA 1XW6A 4FYBA 1TJDA 4EDZA 4YH2A 5DALB 2YJ7A 4HJMA 2DKIA 3IAM2 3F4SA 2HT9A 2F51A 2G2QA 3IA1A 2GSTA 5FWGA 2EIOA 3GTUB 2PGTA 3V1WA 3ME7A 2LRNA 3TKQA 5A4WA 1EGOA 5DDLA 2BMXA 3HD5A 4CDOA 7GSSA 3QAWA 3EWLA 1TI3A 1A8LA 3IDVA 5KN3A 1FAAA 5KOWA 3TJJA 3MNGA 2R37A 3LGCA 1AQVA 2KOKA 2P31A 1GUMA 2OKAA 2QSIA 4V1Ag 2PVQA 1JZOA 1K0CA 2GZZA 1Z6NA 3UEMA 1Y25A 1BQ7A 2YWOA 3ZVJD 2YWMA 4YQVA 4V2MA 1GSFA 2GQMA 4Z2RA 2PU9C 4IBPA 3IK9A 5CO3A 4BL7B 2YPMA 5DAKB 6GSXA 3UIWA 1PL1A 3I69A 1NW2A 5IOWA 4TW5A 4Z2TA 3GH6A 3VURA 1I5GA 5D9VA 4CHSA 2L6DA 2PBJA 2QGVA 4ZBDA 3P90A 1GTBA 3ME8A 2BJXA 1LBKA 5B7CA 4BPYA 4USSA 1F9MA 2DKHA 5CREA 1M0UA 5DVBA 4ICYA 1SL1B 3HZ8A 1E2YA 4MZBA 4MDCA 2CAQA 2FGXA 1FVJA 1ML6A 2HE3A 8GSSA 1UN2A 4XIHA 2V6KA 4FH8A 4EE0A 1B4PA 1KTEA 2RM6A 2VUPA 2LNSA 3LW9A 2PMTA 1GTAA 2VCVA 2GLRA 4OD7A 3ERWA 1AXDA 4ZBBA 6GSVA 22GSA 3I43A 2DJJA 3LORA 1ZOFA 1DSBA 2GZYA 2MMOA 1SD8A 4RI7A 1JLVA 3QPMA 4K0GA 3FEUA 1JHBA 5CAXA 1YF1A 2LJAA 3ZYWA 1KNGA 1AQWA 3EU4A 4GWRA 2HSYA 4N30A 3VWUA 4TR3A 3CMIA 6GSTA 1B9YC 3U6VA 2ON7A 1T4YA 5L71A 1PKWA 1CQGA 4AGSA 3W6GA 3DXBA 13GSA 2YZHA 2J9HA 3ZFLA 1ST9A 2H0HA 5HR2A 4YAVA 1SD9A 2HI7A 4ILFA 4O32A 3UBKA 5DJLA 3QAGA 2MBSA 3IV4A 3VI7A 4TKYA 2LRTA 3CSIA 2FHEA 4EO3A 1KBNA 4KUNA 4MH3A 1YKAA 2EIQA 1S3AA 5D73A 2VCXA 3DVXA 1K3LA 3DD3A 4EUYA 1F6MC 2N5FA 3APQA 5GZZB 2I81A 3FKFA 2A4VA 2AHEA 3FMWA 2B5XA 2DIYA 1SL2B 2VLVA 3GKMA 5HFGA 3PPUA 3UBLA 3PH9A 1B8XA 2K6VA 2ON5A 3F4TA 1URMA 1GUHA 2K9FA 4ISDA 2CQ9A 3DEXA 1U3AA 19GSA 3UAPA 4V2NA 2B1LA 5IMAA 1ZYNA 4MABA 3A3TA 3Q74A 2L6CA 5DALA 1GSDA 1MDKA 4WKWA 2K8VA 4IJIA 2WDUA 5B8BA 2H6ZA 1EEJA 2QKEA 2LQOA 2IIYA 3GTUA 2LUSA 1TI1A 1EGRA 18GSA 3Q19A 2AJQB 4NV2A 5A4UA 2GS3A 5ELAA 1GNWA 3MSZA 4O5RA 3RHCA 1S3CA 1M3JA 2FA4A 4AJ7A 1ZZYA 3VWWA 2LJKA 2GSRA 4PNGA 1M99A 1UVZA 2DJ1A 5G1LA 1PGTA 2AB6A 3DYRA 1V57A 4TOPA 1OVNA 2GGTA 2KUCA 1FVKA 5JWQB 2WFCA 2DMLA 1WMJA 3CYNA 3KH9A 1Z7RA 3KH7A 2X8HA 4Z2UA 3R3EA 3IAS2 3GKXA 5C00A 3GKNA 5A4VA 3K8NA 4TN8A 4OMVA 2MMNA 1DE1A 4I2TA 5IMFA 3DGQA 4V1Ap 2AV4A 2OADA 4BL7A 4H86A 5DAKA 2VCZA 3D4TA 1YEXA 4I8BA 2AYTA 5EVOA 3TJFA 2GTUA 1MDJA 3EC3A 5B6NA 4EDYA 1U88A 3UVHA 1XCCA 2L57A 4FYUA 3D21A 2C3TA 2WGRA 1Z3EA 4HU9A 4WR5A 2YN1A 4WF4A 5ECIB 5G5FA 2IMEA 1YKCA 1EEMA 4IP6A 2R0CA 4OFNA 3RAZA 4PXOA 5D9WA 1ZGNA 3KTLA 2CV4A 1TXXA 2HZEB 2TIRA 1PMTA 5IMVA 1MTCA 5IIZA 4K5SA 1XWKA 4HQZA 2JL4A 4DSQA 5G31A 4FO5A 3PGTA 4L5LA 3QFBC 4RQXA 2K18A 4PURA 2E7PA 4PQHA 4DVCA 5IM9A 3VLNA 4L0WA 3H8QA 3C73A 1GWCA 1RK4A 1W4VA 4EVMA 1BAYA 2R4VA 1OE8A 3TGZA 4F0CA 5GAPD 4Q5RA 1MD3A 3N9JA 1SJIA 5LCZA 4IW9A 1GTIA 1A24A 2KHPA 5ECQB 4GSNA 1QGVA 4K8MA 5IPGA 1K0NA 3EVIA 4WR4A 3L9VA 1XBSA 2JADA 3FRCA 2LTKA 2JZSA 4BWQA 3ISOA 1K0BA 1TRVA 4POLA 2HRAA 4G19A 3HVXA 4PQ1A 5ECRB 2YWIA 3DMLA 3M1GA 1I9DA 2KP2A 3IE3A 1TRWA 5J9BA 4PUFC 3KD0A 5AISA 3ZITA 5GAND 2HFDA 3IR4A 3QDNA 3QMXA 4K7IA 2WS2A 5JCWA 2LEGA 1F37A 3TJBA 3ZLPA 4J56E 3C1SA 1OKTA 4IS0A 4ZL9A 2RLIA 1YJ6A 5E4WA 3MIXA 2L4CA 4GQCA 2NTOA 1G7EA 4ZIJA 3O3TA 1V9WA 2LQQA 4IP1A 4O5QA 4ZB8A 4TXOB 2GSQA 4IKHA 2KLXA 2H70A 2VAFA 1MEKA 2RIIA 4XTSA 1R26A 1GP1A 4O92A 4OCEA 5ELGA 2OA7A 4KB3A 2XPEA 5ABRA 1Z5YE 5ECHB 1F3BA 5ID2B 4N0ZA 5G30A 4WEYA 2H75A 2AUVA 2V41A 2MBTA 2C0DA 3ZZXA 3MWHA 1VF3A 2VCTA 2YWNA 2VD1A 3H79A 1X9MB 3EMXA 4I6XA 3KZQA 2E0QA 5J3RA 3IRAA 1QK8A 3J7Yb 2O85A 2DLXA 1OYJA 1M7TA 3LYKA 1S3DA 3Q6OA 4Z7XA 1FW1A 4QL7A 2L4QA 5ECPB 4EXJA 1JZDA 3QFAC 4N10A 2H0IA 2PN8A 3VI5A 1A23A 5JWRB 4IGJA 1RQMA 1DUGA 2DSAA 4PUAA 4ACSA 1V98A 3D22A 1XFLA 5G5EA 2XC2A 2VIMA 4JU5A 1S3RA 3D6IA 1VF4A 1GLPA 1IYHA 3HDCA 3L9SA 2R0GA 1ZCPA 4K2XA 4KCAA 3FZ4A 4KDUA 2TRCP 2R3XA 2B6MA 2R2JA 1GUKA 3RPNA 3F8UA 3IK7A 1R5PA 4LA1A 4POKA 4EL1A 1XW9A 2HNLA 1OC3A 3A5IA 1VF2A 2A2PA 1VRSD 4FQUA 2HZEA 2XHFA 3DWVA 2DJ0A 3TB2A 2M72A 4TR0A 3I6AA 4HZ4A 2PUKC 4XCSA 3ZTLA 3MAKA 3WGDA 3LXZA 3FR3A 2LRCA 4TR4A 4AJ8A 2DJKA 2P0GA 2VO4A 3HVNA 2I1UA 3TRQA 4YAPA 3IPZA 2ALBA 2H1DA 4MZCA 5GSSA 1USBA 3IXRA 2WRTA 3AY8A 5C04A 3GA4A 3F4RA 5CRDA 3TRXA 1XWAA 1X5EA 4CW9A 1SU9A 1FHEA 4PTSA 5CNWA 4MPFA 2EIRA 2MYGA 1WPIA 2C4JA 1EV9A 3A2XA 1M9BA 2PPTA 2A2SA 4G0KA 3GUSA 4MF5A 3HY2A 2YZUA 3QOUA 1TP9A 1Z9HA 4K6XA 3HVVA 4PQIA 2I4AA 3NZNA 4TR1B 1PFOA 1SKWB 5GSTA 1GSUA 2REMA 4KSMA 2VCQA 1SENA 3ZMLA 1PKZA 3EE2A 2VM2A 3TDGA 4F82A 1SK2A 1NHYA 3TUEA 4OO4A 4OWYA 1Z7PA 2NPBA 2FWFA 4YKGA 1ABAA 1XOAA 1R7HA 2P5QA 1XG8A 2CVKA 2KP1A 3IBHA 3DVWA 2Z9SA 3LG6A 4V2LA 1SKSB 1R4WA 1ERUA 3QR6A 3ZIJA 4EF0A 4KDXA 4G9HA 3N5OA 1X0RA 3F6DA 4TXOA 4LL4B 4BA7A 2GSSA 2HSHA 4EKZA 4DEJA 1T7PB 4RQRA 1XVQA 2XBQA 3TJGA 2B5EA 2H1BA 3F0IA 5AN1A 3HA9A 2PERA 2VL3A 3FZ9A 1WOUA 4HDEA 3GSTA 1QQ2A 2DIZA 5CRGA 3E9JB 1SYRA 3GURA 5ID2A 1HNBA 3FW2A 2F9SA 2XBIA 3A2WA 2VD0A 3UARA 3H4KA 4IVFA 2FNOA 3C1RA 5J9CA 2VCWA 3GL3A 4HQSA 4N11A 1T1VA 4K7NA 1AAZA 2WULA 5JWOB 2X8GA 2HYXA 1GL8A 1ERWA 3FR6A 1XVWA 3IHGA 20GSA 2VL9A 5ENUA 4MJBA 2V2GA 2C3NA 1Q98A 2H01A 5CP1A 1GULA 4BWSA 1XWGA 3L4NA 1VF1A 3CRUA 2A2RA 1GRXA 2YCDA 2CX3A 1XW5A 3ZFBA 2WJUA 4GLTA 1AQXA 1PRXA 4OCFA 4KCEA 2H76A 3P2AA 6GSYA 1TK8B 4I97A 5EL8A 1BYEA 1JLWA 4KW6A 4F2IA 4L0UA 2QA2A 3F3RA 3KMNA 4K2DA 1ON4A 2FD3A 4IN0A 1J08A 3M9JA 3KP9A 3APSA 3DKSA 1FG4A 1O81A 2YV9A 5IOXA 2X99A 2DMMA 4KNDA 3E0UA 3W8SA 1C72A 3CXGA 1PA3A 3BJ5A 1XIYA 4EC0A 3J7Yk 4DSSB 10GSA 4OO5A 3IC8A 3ERGA 4G0LA 4MJEA 3APOA 2NVLA 2VLTA 3C71A 3GFKA 1BEDA 1TRUA 1W89A 3G7JA 2HRKA 1HYUA 1YZXA 4XS4B 4ULXA 3M0FA 2IMFA 5HFIA 2N5AA 3EMPA 3BOAA 5HFKA 5F8BA 3KP8A 5D9TA 4K1FA 5DBQA 3R2QA 3ERFA 3EYTA 1R5AA 4E8EA 4NMUA 4LLRA 5D96A 5ECSA 2L5LA 1A8YA 3P7XA 3TKSA 1E6BA 3M8NA 3HJPA 3PINA 1PN0A 1A2JA 3LWAA 2YNXA 4D73B 1EP8A 1G7OA 1SYXA 2C0EA 1GH2A 2JZTA 2C1YA 3IC4A 5G1KA 4TR1A 3RPPA 4ZL7A 4FIWA 3WT1A 1A0RP 5J5NA 1T3BA 2V6OA 2LSTA 3CBUA 2H1GA 3LFLA 3UL3A 2WB9A 4WF5A 3BCKA 1G6YA 3FZAA 4GCIA 1RW1A 1JZWA 2N5BA 1KEBA 1FB0A 2OBKA 1QFNA 1TU8A 1TKDB 1X9SB 1T4ZA 1J0FA 3VFIA 4G10A 3EURA 3LJRA 1G6WA 5HR0A 2ZNMA 3UOMA 1XXUA 5IPHA 1TTZA 1PSQA 3FZ5A 2D2ZA 4HI7A 3HZ4A 2OBIA 2IFQB 1O6JA 2H8LA 2F8FA 2MMZA 2C0GA 4G2EA 2E2GA 1WIKA 2CZ2A 1PD21 1F3AA 2VOCA 5F07A 5JCUA 3GHAA 3US3A 5E59A 4MJAA 3CSJA 1DE2A 4EIQA 1HQOA 2TRXA 3I9V2 3HVSA 4WBJA 3F3QA 3FHKA 4I5QA 2C80A 4OFTA 9GSSA 2YP6A 2DJ3A 4ZILA 3F6FA 3BCIA 1ZYEA 5DQSA 1QMVA 4POBA 5KN0A 4WXTA 4GRFA 4HSCX 3HJOA 2O89A 2IWTA 3KM6A 4CY6A 4JR6A 1WJKA 4F9ZA 4IJ3A 4BVXB 2HSMA 3OR5A 2VLUA 3C7MA 4MP4A 2P5RA 1JFUA 1SKRB 1TW9A 2L59A 2B3SA 3GV1A 5AGYA 4KE3A 1U6TA 1SK0A 4KDYA 5IMCA 1TK0B 5F05A 5AIVA 1TRSA 5HR3A 1ZMAA 4J57E 1Y6EA 2WCIA 3GIXA 4IHUA 5IQYA 4ECCA 4DSSA 1GSSA 2QA1A 1LJRA 2JU5A 3A2VA 2H71A 1FOVA 1YQ1A 4EIPA 4WETA 1J9BA 4WBRD 3LQ7A 3EINA 3M3MA 4L8EA 2RUEA 4JZQA 3GYKA 1AUCA 1T00A 5J4UA 2B7JA 2LJRA 4LMWA 5H5SA 4XS4A 3LEFA 4NAXA 2LS5A 2F3MA 2B7KA 2F8AA 2H19A 2H30A 1K0DA 1SK1A 3UMAA 1EOGA 1ZYPA 1GNEA 1N8JA 3M9KA 1A2LA 2ZUPA 5HR1A 2M46A 4NXIA 4Q5NA 1T8EB 2GT6A 1U3IA 4ZL8A 1MDIA 3TKSC 3H1NA 5KEJA 2OE3A 4MF7A 4GSSA 1FO5A 2GT5A 5CYYA 2ES7A 4ZB9A 2ZCTA 3KGKA 3HJMA 3RHBA 2R6KA 4D73A 1V58A 4XRDA 1WRYA 3NOFA 1FB6A 4TVEA 4NPBA 2FCHA 4XS1A 14GSA 3DRNA 3ED3A 3NIVA 3VWVA 1EZKA 1XOBA 1OC9A 3CRTA 1NM3A 3TRPA 2GQKA 2YJHA 1O73A 4GTUA 4KX4A 3O76A 1YDKA 3S9FA 3IOSA 1Z6MA 2JSZA 4I2UA 1OAZA 2CVDA 1K0AA 2V1MA 3P8WA 12GSA 4KA0A 4MLYA 1OE7A 3KIJA 4QL9A 2FUG2 4FYCA 2LKUA 1A0FA 2VM1A 3LSZA 1M2AA 1AIUA 1M3IA 1XZOA 16GSA 2GDRA 5H5RA 2VL2A 4X0XA 2A4HA 4NWYA 3HCZA 2XPDA 4MNNA 2IFQA 5DJMA 1VGLA 1B9XC 4ECIA 3GRXA 4MF6A 1TDIA 3TKPA 2BTOT 3MDKA 4G0IA 1HD2A 3D4MA 1HNAA 3G7YA 5ECLB 3ZVJA 4XS6A 4HS1A 2CVBA 1BG5A 1PL2A 2H1AA 1SJ6A 2V32A 2DJ2A 4A5PA 2CX4A 4TRXA 3LYPA 5IO0A 4ZXGA 1OKDA 2OJLA 3KJYA 4KF9A 1B48A 2X49A 3KEBA 4ZB6A 2MZCA 2OE0A 4KGIA 4MA9A 17GSA 3LXTA 1PQNA 5AIXA 3GMFA 3VWXA 1AW9A 1TK5B 2FWEA 5LNKe 4X1UA 1JZRA 4BVXA 2DBCA 3VK9A 2IJYA 2C0FA 2C8UA 2J23A 1SL0B 5FHIA 1FOHA
chains in the Genus database with same CATH topology
3WT2A 5A5KA 1N2AA 1IYIA 2MMAA 3QD9A 2CA8A 1YF0A 4JR4A 2LNTA 1UC7A 2E2MA 3TKRA 1GSYA 1HNCA 2JZRA 4IQAA 4YQMA 3QCPA 4Q5QA 2AAWA 1X5CA 3QAVA 5IMZA 3HKRA 3VPTA 2LV3A 4BVYB 3CTGA 4GXZA 2GQLA 2RUFA 2QC7A 4QQ7A 4GSTA 4JBBA 4MMMA 2B5YA 5ECOB 1WWJA 3ZL5A 1X5DA 5DQYA 5F0GA 3TJKA 1M2BA 4HJ2A 2JSYA 2H6YA 4Q5FA 4POMA 1XWCA 1UA5A 3IHQA 1MD4A 2HRNA 3ZRDA 3EPTA 3SWLA 4N0VA 1GTUA 3O6TA 2K8SA 2FY6A 4LL1B 4J2FA 3FYGA 3RBTA 2HLSA 3KMOA 3L0HA 5DCHA 4DSRA 4MH2A 3TOUA 3BBYA 4HOJA 2UZ8A 4TXVA 3WD6A 3HHVA 2R0PA 3UJ1A 2O8VB 3VPQA 2HZFA 4KAEA 1XWBA 2X4AA 3FR9A 2YOIA 5BRTA 3JCML 1TU7A 3HXSA 3GX8A 2RM5A 4ML1A 3FK8A 4LMVA 4HEA2 1G0TA 4XHMA 5F06A 4ECBA 3MYDA 5D93A 3DIEA 1B4QA 3GN3A 5ECNB 1EWXA 3D0ZA 2O7KA 4ID0A 4MCUA 4MK3A 4MZWA 1BJXA 3F9UA 4K5RA 3GL5A 2H74A 3G7IA 3G9BA 2C3QA 2B1KA 2PWJA 4PNFA 3PR8A 4RI6A 3ZMKA 2GZPA 4HUAA 5KOXA 2YV7A 1ERTA 3BD2A 4NV5A 6GSSA 3KCMA 1SJZA 5JCGA 2NBSA 11GSA 2CAIA 4E8HA 5EY6A 1YY7A 3WGEA 2CZ3A 1M9AA 3ZREA 2EC4A 4MJCA 5ECMB 1O8WA 1OC9B 1M2DA 1THXA 2GVPA 4HZ2A 2VL2C 1F2EA 4JEDA 1DBYA 1THOA 6GSWA 5INYA 4CY8A 2FLSA 3D5JA 3GNJA 3RDWA 1V2AA 1EV4A 4KH7A 1ZL9A 2H6XA 4YKFA 3SBCA 3GKKA 2X8CA 4KSOA 1O85A 1ILOA 4NHWA 1ERVA 4JRRA 1NHOA 1GSQA 3L78A 2FWGA 4K0NA 4XRAA 4NHZA 2I9HA 3KTBA 3U5RE 4AF2A 2H72A 2PVOC 3L9UA 3WYWA 4ZBAA 1O7UA 2IL3A 1H4OA 4X43A 4JE1A 5HQPA 1K0MA 2IN3A 4OFMA 2DC5A 1V40A 5CRHA 4O5UA 5DCGA 4PGTA 2L5OA 3GSSA 5G2ZA 4F0BA 2JACA 3CSHA 4RUVA 1NSWA 5CRWA 6GSUA 2IMIA 1ZYQB 1GSEA 5BMUA 2IPAA 1YEPA 5KN1A 1WE0A 2FA8A 4IELA 4GQFA 2G0FA 3UVTA 5B6MA 2R5GA 5COHA 3GH9A 1A2MA 1EP7A 1AC1A 2I3YA 5ECKB 1PX7A 2IMDA 2H66A 4P3YB 3EU3A 4K9ZA 3Q18A 1BX9A 5D9XA 3E3EA 2H73A 4BVYA 2O87A 5D8IA 4PX1A 3TOTA 1OC8A 2OE1A 1U87A 1LU4A 2H0GA 2YANA 1WP0A 3GX0A 3W8JA 1QUWA 2IMKA 2WZ9A 4ML6A 3A5WA 4HU7A 4L5OA 4GF0A 4ECJA 1O8XA 1QXHA 1ACVA 5EPFA 3TCOA 4IQ1A 1K3YA 2X64A 5J41A 2M80A 5LD0A 2FWHA 2OACA 4F03A 5B8AA 4AJ6A 5KN2A 1Q4JA 3KXOA 3C8EA 4X4JA 2HRFA 5FT3A 1EOHA 1PN9A 5IO2A 3WGXA 3H93A 4K7OA 3ZIVA 3F63A 3CTFA 1GLQA 2NDOA 3TKSE 4MPGA 2HXKA 1H75A 1PX6A 1K3OA 3FY7A 2CT6A 3HYPA 1K0OA 1TOFA 4YQUA 1X9WB 4O7HA 5H5QA 5IMDA 1CQHA 1XPVA 1XW6A 4FYBA 1TJDA 4EDZA 4YH2A 5DALB 2YJ7A 4HJMA 2DKIA 3IAM2 3F4SA 2HT9A 2F51A 2G2QA 3IA1A 2GSTA 5FWGA 2EIOA 3GTUB 2PGTA 3V1WA 3ME7A 2LRNA 3TKQA 5A4WA 1EGOA 5DDLA 2BMXA 3HD5A 4CDOA 7GSSA 3QAWA 3EWLA 1TI3A 1A8LA 3IDVA 5KN3A 1FAAA 5KOWA 3TJJA 3MNGA 2R37A 3LGCA 1AQVA 2KOKA 2P31A 1GUMA 2OKAA 2QSIA 4V1Ag 2PVQA 1JZOA 1K0CA 2GZZA 1Z6NA 3UEMA 1Y25A 1BQ7A 2YWOA 3ZVJD 2YWMA 4YQVA 4V2MA 1GSFA 2GQMA 4Z2RA 2PU9C 4IBPA 3IK9A 5CO3A 4BL7B 2YPMA 5DAKB 6GSXA 3UIWA 1PL1A 3I69A 1NW2A 5IOWA 4TW5A 4Z2TA 3GH6A 3VURA 1I5GA 5D9VA 4CHSA 2L6DA 2PBJA 2QGVA 4ZBDA 3P90A 1GTBA 3ME8A 2BJXA 1LBKA 5B7CA 4BPYA 4USSA 1F9MA 2DKHA 5CREA 1M0UA 5DVBA 4ICYA 1SL1B 3HZ8A 1E2YA 4MZBA 4MDCA 2CAQA 2FGXA 1FVJA 1ML6A 2HE3A 8GSSA 1UN2A 4XIHA 2V6KA 4FH8A 4EE0A 1B4PA 1KTEA 2RM6A 2VUPA 2LNSA 3LW9A 2PMTA 1GTAA 2VCVA 2GLRA 4OD7A 3ERWA 1AXDA 4ZBBA 6GSVA 22GSA 3I43A 2DJJA 3LORA 1ZOFA 1DSBA 2GZYA 2MMOA 1SD8A 4RI7A 1JLVA 3QPMA 4K0GA 3FEUA 1JHBA 5CAXA 1YF1A 2LJAA 3ZYWA 1KNGA 1AQWA 3EU4A 4GWRA 2HSYA 4N30A 3VWUA 4TR3A 3CMIA 6GSTA 1B9YC 3U6VA 2ON7A 1T4YA 5L71A 1PKWA 1CQGA 4AGSA 3W6GA 3DXBA 13GSA 2YZHA 2J9HA 3ZFLA 1ST9A 2H0HA 5HR2A 4YAVA 1SD9A 2HI7A 4ILFA 4O32A 3UBKA 5DJLA 3QAGA 2MBSA 3IV4A 3VI7A 4TKYA 2LRTA 3CSIA 2FHEA 4EO3A 1KBNA 4KUNA 4MH3A 1YKAA 2EIQA 1S3AA 5D73A 2VCXA 3DVXA 1K3LA 3DD3A 4EUYA 1F6MC 2N5FA 3APQA 5GZZB 2I81A 3FKFA 2A4VA 2AHEA 3FMWA 2B5XA 2DIYA 1SL2B 2VLVA 3GKMA 5HFGA 3PPUA 3UBLA 3PH9A 1B8XA 2K6VA 2ON5A 3F4TA 1URMA 1GUHA 2K9FA 4ISDA 2CQ9A 3DEXA 1U3AA 19GSA 3UAPA 4V2NA 2B1LA 5IMAA 1ZYNA 4MABA 3A3TA 3Q74A 2L6CA 5DALA 1GSDA 1MDKA 4WKWA 2K8VA 4IJIA 2WDUA 5B8BA 2H6ZA 1EEJA 2QKEA 2LQOA 2IIYA 3GTUA 2LUSA 1TI1A 1EGRA 18GSA 3Q19A 2AJQB 4NV2A 5A4UA 2GS3A 5ELAA 1GNWA 3MSZA 4O5RA 3RHCA 1S3CA 2FA4A 4AJ7A 1ZZYA 3VWWA 2LJKA 2GSRA 4PNGA 1M99A 1UVZA 2DJ1A 5G1LA 1PGTA 2AB6A 3DYRA 1V57A 4TOPA 1OVNA 2GGTA 2KUCA 1FVKA 5JWQB 2WFCA 2DMLA 1WMJA 3CYNA 3KH9A 1Z7RA 3KH7A 2X8HA 4Z2UA 3R3EA 3IAS2 3GKXA 5C00A 3GKNA 5A4VA 3K8NA 4TN8A 4OMVA 2MMNA 1DE1A 4I2TA 5IMFA 3DGQA 4V1Ap 2AV4A 2OADA 4BL7A 4H86A 5DAKA 2VCZA 3D4TA 1YEXA 4I8BA 2AYTA 5EVOA 3TJFA 2GTUA 1MDJA 3EC3A 5B6NA 4EDYA 1U88A 3UVHA 1XCCA 2L57A 4FYUA 3D21A 2C3TA 2WGRA 1Z3EA 4HU9A 4WR5A 2YN1A 4WF4A 5ECIB 5G5FA 2IMEA 1YKCA 1EEMA 4IP6A 2R0CA 4OFNA 3RAZA 4PXOA 5D9WA 1ZGNA 3KTLA 2CV4A 1TXXA 2HZEB 2TIRA 1PMTA 5IMVA 1MTCA 5IIZA 4K5SA 1XWKA 4HQZA 2JL4A 4DSQA 5G31A 4FO5A 3PGTA 4L5LA 3QFBC 4RQXA 2K18A 4PURA 2E7PA 4PQHA 4DVCA 5IM9A 3VLNA 4L0WA 3H8QA 3C73A 1GWCA 1RK4A 1W4VA 4EVMA 1BAYA 2R4VA 1OE8A 3TGZA 4F0CA 5GAPD 4Q5RA 1MD3A 3N9JA 1SJIA 5LCZA 4IW9A 1GTIA 1A24A 2KHPA 5ECQB 4GSNA 1QGVA 4K8MA 5IPGA 1K0NA 3EVIA 4WR4A 3L9VA 1XBSA 2JADA 3FRCA 2LTKA 2JZSA 4BWQA 3ISOA 1K0BA 1TRVA 4POLA 2HRAA 4G19A 3HVXA 4PQ1A 5ECRB 2YWIA 3DMLA 3M1GA 1I9DA 2KP2A 3IE3A 1TRWA 5J9BA 4PUFC 3KD0A 5AISA 3ZITA 5GAND 2HFDA 3IR4A 3QDNA 3QMXA 4K7IA 2WS2A 5JCWA 2LEGA 1F37A 3TJBA 3ZLPA 4J56E 3C1SA 1OKTA 4IS0A 4ZL9A 2RLIA 1YJ6A 5E4WA 3MIXA 2L4CA 4GQCA 2NTOA 1G7EA 4ZIJA 3O3TA 1V9WA 2LQQA 4IP1A 4O5QA 4ZB8A 4TXOB 2GSQA 4IKHA 2KLXA 2H70A 2VAFA 1MEKA 2RIIA 4XTSA 1R26A 1GP1A 4O92A 4OCEA 5ELGA 2OA7A 4KB3A 2XPEA 5ABRA 1Z5YE 5ECHB 1F3BA 5ID2B 4N0ZA 5G30A 4WEYA 2H75A 2AUVA 2V41A 2MBTA 2C0DA 3ZZXA 3MWHA 1VF3A 2VCTA 2YWNA 2VD1A 3H79A 1X9MB 3EMXA 4I6XA 3KZQA 2E0QA 5J3RA 3IRAA 1QK8A 3J7Yb 2O85A 2DLXA 1OYJA 1M7TA 3LYKA 1S3DA 3Q6OA 4Z7XA 1FW1A 4QL7A 2L4QA 5ECPB 4EXJA 1JZDA 3QFAC 4N10A 2H0IA 2PN8A 3VI5A 1A23A 5JWRB 4IGJA 1RQMA 1DUGA 2DSAA 4PUAA 4ACSA 1V98A 3D22A 1XFLA 5G5EA 2XC2A 2VIMA 4JU5A 3D6IA 1VF4A 1GLPA 1IYHA 3HDCA 3L9SA 2R0GA 1ZCPA 4K2XA 4KCAA 3FZ4A 4KDUA 2TRCP 2R3XA 2B6MA 2R2JA 1GUKA 3RPNA 3F8UA 3IK7A 1R5PA 4LA1A 4POKA 4EL1A 1XW9A 2HNLA 1OC3A 3A5IA 1VF2A 2A2PA 1VRSD 4FQUA 2HZEA 2XHFA 3DWVA 2DJ0A 3TB2A 2M72A 4TR0A 3I6AA 4HZ4A 2PUKC 4XCSA 3ZTLA 3MAKA 3WGDA 3LXZA 3FR3A 2LRCA 4TR4A 4AJ8A 2DJKA 2P0GA 2VO4A 2I1UA 3TRQA 4YAPA 3IPZA 2ALBA 2H1DA 4MZCA 5GSSA 1USBA 3IXRA 2WRTA 3AY8A 5C04A 3GA4A 3F4RA 5CRDA 3TRXA 1XWAA 1X5EA 4CW9A 1SU9A 1FHEA 4PTSA 5CNWA 4MPFA 2EIRA 2MYGA 1WPIA 2C4JA 1EV9A 3A2XA 1M9BA 2PPTA 2A2SA 4G0KA 3GUSA 4MF5A 3HY2A 2YZUA 3QOUA 1TP9A 1Z9HA 4K6XA 3HVVA 4PQIA 2I4AA 3NZNA 4TR1B 1SKWB 5GSTA 1GSUA 2REMA 4KSMA 2VCQA 1SENA 3ZMLA 1PKZA 3EE2A 2VM2A 3TDGA 4F82A 1SK2A 1NHYA 3TUEA 4OO4A 4OWYA 1Z7PA 2NPBA 2FWFA 4YKGA 1ABAA 1XOAA 1R7HA 2P5QA 2CVKA 2KP1A 3IBHA 3DVWA 2Z9SA 3LG6A 4V2LA 1SKSB 1R4WA 1ERUA 3QR6A 3ZIJA 4EF0A 4KDXA 4G9HA 3N5OA 1X0RA 3F6DA 4TXOA 4LL4B 4BA7A 2GSSA 2HSHA 4EKZA 4DEJA 1T7PB 4RQRA 1XVQA 2XBQA 3TJGA 2B5EA 2H1BA 3F0IA 5AN1A 3HA9A 2PERA 2VL3A 3FZ9A 1WOUA 4HDEA 3GSTA 1QQ2A 2DIZA 5CRGA 3E9JB 1SYRA 3GURA 5ID2A 1HNBA 3FW2A 2F9SA 2XBIA 3A2WA 2VD0A 3UARA 3H4KA 4IVFA 2FNOA 3C1RA 5J9CA 2VCWA 3GL3A 4HQSA 4N11A 1T1VA 4K7NA 1AAZA 2WULA 5JWOB 2X8GA 2HYXA 1GL8A 1ERWA 3FR6A 1XVWA 3IHGA 20GSA 2VL9A 5ENUA 4MJBA 2V2GA 2C3NA 1Q98A 2H01A 5CP1A 1GULA 4BWSA 1XWGA 3L4NA 1VF1A 3CRUA 2A2RA 1GRXA 2YCDA 2CX3A 1XW5A 3ZFBA 2WJUA 4GLTA 1AQXA 1PRXA 4OCFA 4KCEA 2H76A 3P2AA 6GSYA 1TK8B 4I97A 5EL8A 1BYEA 1JLWA 4KW6A 4F2IA 4L0UA 2QA2A 3F3RA 3KMNA 4K2DA 1ON4A 2FD3A 4IN0A 1J08A 3M9JA 3KP9A 3APSA 3DKSA 1FG4A 1O81A 2YV9A 5IOXA 2X99A 2DMMA 4KNDA 3E0UA 3W8SA 1C72A 3CXGA 1PA3A 3BJ5A 1XIYA 4EC0A 3J7Yk 4DSSB 10GSA 4OO5A 3IC8A 3ERGA 4G0LA 4MJEA 3APOA 2NVLA 2VLTA 3C71A 3GFKA 1BEDA 1TRUA 1W89A 3G7JA 2HRKA 1HYUA 1YZXA 4XS4B 4ULXA 3M0FA 2IMFA 5HFIA 2N5AA 3EMPA 3BOAA 5HFKA 5F8BA 3KP8A 5D9TA 4K1FA 5DBQA 3R2QA 3ERFA 3EYTA 1R5AA 4E8EA 4NMUA 4LLRA 5D96A 5ECSA 2L5LA 1A8YA 3P7XA 3TKSA 1E6BA 3M8NA 3HJPA 3PINA 1PN0A 1A2JA 3LWAA 2YNXA 4D73B 1EP8A 1G7OA 1SYXA 2C0EA 1GH2A 2JZTA 2C1YA 3IC4A 5G1KA 4TR1A 3RPPA 4ZL7A 4FIWA 3WT1A 1A0RP 5J5NA 1T3BA 2V6OA 2LSTA 3CBUA 2H1GA 3LFLA 3UL3A 2WB9A 4WF5A 3BCKA 1G6YA 3FZAA 4GCIA 1RW1A 1JZWA 2N5BA 1KEBA 1FB0A 2OBKA 1QFNA 1TU8A 1TKDB 1X9SB 1T4ZA 1J0FA 3VFIA 4G10A 3EURA 3LJRA 1G6WA 5HR0A 2ZNMA 3UOMA 1XXUA 5IPHA 1TTZA 1PSQA 3FZ5A 2D2ZA 4HI7A 3HZ4A 2OBIA 2IFQB 1O6JA 2H8LA 2F8FA 2MMZA 2C0GA 4G2EA 2E2GA 1WIKA 2CZ2A 1PD21 1F3AA 2VOCA 5F07A 5JCUA 3GHAA 3US3A 5E59A 4MJAA 3CSJA 1DE2A 4EIQA 1HQOA 2TRXA 3I9V2 3HVSA 4WBJA 3F3QA 3FHKA 4I5QA 2C80A 4OFTA 9GSSA 2YP6A 2DJ3A 4ZILA 3F6FA 3BCIA 1ZYEA 5DQSA 1QMVA 4POBA 5KN0A 4WXTA 4GRFA 3HJOA 2O89A 2IWTA 3KM6A 4CY6A 4JR6A 1WJKA 4F9ZA 4IJ3A 4BVXB 2HSMA 3OR5A 2VLUA 3C7MA 4MP4A 2P5RA 1JFUA 1SKRB 1TW9A 2L59A 2B3SA 3GV1A 5AGYA 4KE3A 1U6TA 1SK0A 4KDYA 5IMCA 1TK0B 5F05A 5AIVA 1TRSA 5HR3A 1ZMAA 4J57E 1Y6EA 2WCIA 3GIXA 4IHUA 5IQYA 4ECCA 4DSSA 1GSSA 2QA1A 1LJRA 2JU5A 3A2VA 2H71A 1FOVA 1YQ1A 4EIPA 4WETA 1J9BA 4WBRD 3LQ7A 3EINA 3M3MA 4L8EA 2RUEA 4JZQA 3GYKA 1AUCA 1T00A 5J4UA 2B7JA 2LJRA 4LMWA 5H5SA 4XS4A 3LEFA 4NAXA 2LS5A 2F3MA 2B7KA 2F8AA 2H19A 2H30A 1K0DA 1SK1A 3UMAA 1EOGA 1ZYPA 1GNEA 1N8JA 3M9KA 1A2LA 2ZUPA 5HR1A 2M46A 4NXIA 4Q5NA 1T8EB 2GT6A 1U3IA 4ZL8A 1MDIA 3TKSC 3H1NA 5KEJA 2OE3A 4MF7A 4GSSA 1FO5A 2GT5A 5CYYA 2ES7A 4ZB9A 2ZCTA 3KGKA 3HJMA 3RHBA 2R6KA 4D73A 1V58A 4XRDA 1WRYA 3NOFA 1FB6A 4TVEA 4NPBA 2FCHA 4XS1A 14GSA 3DRNA 3ED3A 3NIVA 3VWVA 1EZKA 1XOBA 1OC9A 3CRTA 1NM3A 3TRPA 2GQKA 2YJHA 1O73A 4GTUA 4KX4A 3O76A 1YDKA 3S9FA 3IOSA 1Z6MA 2JSZA 4I2UA 1OAZA 2CVDA 1K0AA 2V1MA 3P8WA 12GSA 4KA0A 4MLYA 1OE7A 3KIJA 4QL9A 2FUG2 4FYCA 2LKUA 1A0FA 3LSZA 2VM1A 1M2AA 1AIUA 1XZOA 16GSA 2GDRA 5H5RA 2VL2A 4X0XA 2A4HA 4NWYA 3HCZA 2XPDA 4MNNA 2IFQA 5DJMA 1VGLA 1B9XC 4ECIA 3GRXA 4MF6A 1TDIA 3TKPA 2BTOT 3MDKA 4G0IA 1HD2A 3D4MA 1HNAA 3G7YA 5ECLB 3ZVJA 4XS6A 4HS1A 2CVBA 1BG5A 1PL2A 2H1AA 1SJ6A 2V32A 2DJ2A 4A5PA 2CX4A 4TRXA 3LYPA 5IO0A 4ZXGA 1OKDA 2OJLA 3KJYA 4KF9A 1B48A 2X49A 3KEBA 4ZB6A 2MZCA 2OE0A 4KGIA 4MA9A 17GSA 3LXTA 1PQNA 5AIXA 3GMFA 3VWXA 1AW9A 1TK5B 2FWEA 5LNKe 4X1UA 1JZRA 4BVXA 2DBCA 3VK9A 2IJYA 2C0FA 2C8UA 2J23A 1SL0B 5FHIA 1FOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WT2 A;  5A5K A;  1N2A A;  1IYI A;  2MMA A;  3QD9 A;  2CA8 A;  1YF0 A;  4JR4 A;  2LNT A;  1UC7 A;  2E2M A;  3TKR A;  1GSY A;  1HNC A;  2JZR A;  4IQA A;  4YQM A;  3QCP A;  4Q5Q A;  2AAW A;  1X5C A;  3QAV A;  5IMZ A;  3HKR A;  3VPT A;  2LV3 A;  3CTG A;  4GXZ A;  2GQL A;  2RUF A;  2QC7 A;  4QQ7 A;  4GST A;  4JBB A;  4MMM A;  2B5Y A;  5ECO B;  1WWJ A;  3ZL5 A;  1X5D A;  5DQY A;  5F0G A;  3TJK A;  1M2B A;  4HJ2 A;  2JSY A;  2H6Y A;  4Q5F A;  4POM A;  1XWC A;  1UA5 A;  3IHQ A;  1MD4 A;  2HRN A;  3ZRD A;  3SWL A;  4N0V A;  1GTU A;  3O6T A;  2K8S A;  2FY6 A;  4LL1 B;  4J2F A;  3FYG A;  3RBT A;  2HLS A;  3KMO A;  3L0H A;  5DCH A;  4DSR A;  4MH2 A;  3TOU A;  3BBY A;  4HOJ A;  4TXV A;  3WD6 A;  3HHV A;  3UJ1 A;  2O8V B;  3VPQ A;  2HZF A;  4KAE A;  1XWB A;  3FR9 A;  2YOI A;  3JCM L;  1TU7 A;  3HXS A;  3GX8 A;  2RM5 A;  4ML1 A;  3FK8 A;  4LMV A;  4HEA 2;  1G0T A;  4XHM A;  5F06 A;  4ECB A;  5D93 A;  3DIE A;  1B4Q A;  3GN3 A;  5ECN B;  1EWX A;  3D0Z A;  2O7K A;  4ID0 A;  4MCU A;  4MK3 A;  4MZW A;  1BJX A;  3F9U A;  3GL5 A;  2H74 A;  3G7I A;  3G9B A;  2C3Q A;  2B1K A;  2PWJ A;  4PNF A;  3PR8 A;  4RI6 A;  3ZMK A;  2GZP A;  4HUA A;  2YV7 A;  1ERT A;  3BD2 A;  4NV5 A;  6GSS A;  3KCM A;  1SJZ A;  5JCG A;  2NBS A;  11GS A;  2CAI A;  4E8H A;  5EY6 A;  1YY7 A;  3WGE A;  2CZ3 A;  1M9A A;  3ZRE A;  2EC4 A;  4MJC A;  5ECM B;  1O8W A;  1OC9 B;  1M2D A;  1THX A;  2GVP A;  4HZ2 A;  2VL2 C;  1F2E A;  4JED A;  1DBY A;  1THO A;  6GSW A;  5INY A;  2FLS A;  3D5J A;  3GNJ A;  3RDW A;  1V2A A;  1EV4 A;  4KH7 A;  1ZL9 A;  2H6X A;  3SBC A;  3GKK A;  2X8C A;  4KSO A;  1O85 A;  1ILO A;  4NHW A;  1ERV A;  4JRR A;  1NHO A;  1GSQ A;  3L78 A;  2FWG A;  4K0N A;  4XRA A;  4NHZ A;  2I9H A;  3KTB A;  3U5R E;  4AF2 A;  2H72 A;  2PVO C;  3L9U A;  3WYW A;  4ZBA A;  1O7U A;  2IL3 A;  1H4O A;  4X43 A;  4JE1 A;  5HQP A;  1K0M A;  2IN3 A;  4OFM A;  2DC5 A;  1V40 A;  5CRH A;  5DCG A;  4PGT A;  2L5O A;  3GSS A;  5G2Z A;  4F0B A;  2JAC A;  3CSH A;  4RUV A;  1NSW A;  5CRW A;  6GSU A;  2IMI A;  1ZYQ B;  1GSE A;  2IPA A;  1YEP A;  5KN1 A;  1WE0 A;  2FA8 A;  4IEL A;  4GQF A;  2G0F A;  3UVT A;  5B6M A;  2R5G A;  5COH A;  3GH9 A;  1A2M A;  1EP7 A;  1AC1 A;  5ECK B;  2I3Y A;  1PX7 A;  2IMD A;  2H66 A;  4P3Y B;  3EU3 A;  4K9Z A;  3Q18 A;  1BX9 A;  5D9X A;  3E3E A;  2H73 A;  4BVY A;  2O87 A;  5D8I A;  4PX1 A;  3TOT A;  1OC8 A;  2OE1 A;  1U87 A;  1LU4 A;  2H0G A;  2YAN A;  1WP0 A;  3GX0 A;  3W8J A;  1QUW A;  2IMK A;  2WZ9 A;  4ML6 A;  3A5W A;  4HU7 A;  4L5O A;  4GF0 A;  4ECJ A;  1O8X A;  1QXH A;  1ACV A;  5EPF A;  3TCO A;  4IQ1 A;  1K3Y A;  2X64 A;  5J41 A;  2M80 A;  5LD0 A;  2FWH A;  2OAC A;  4F03 A;  5B8A A;  4AJ6 A;  5KN2 A;  1Q4J A;  3KXO A;  3C8E A;  2HRF A;  5FT3 A;  1EOH A;  1PN9 A;  5IO2 A;  3WGX A;  3H93 A;  4K7O A;  3ZIV A;  3F63 A;  3CTF A;  1GLQ A;  2NDO A;  3TKS E;  4MPG A;  2HXK A;  1H75 A;  1PX6 A;  1K3O A;  3FY7 A;  2CT6 A;  3HYP A;  1K0O A;  1TOF A;  4YQU A;  1X9W B;  4O7H A;  5H5Q A;  5IMD A;  1CQH A;  1XPV A;  1XW6 A;  4FYB A;  1TJD A;  4EDZ A;  4YH2 A;  5DAL B;  2YJ7 A;  4HJM A;  3IAM 2;  3F4S A;  2HT9 A;  2F51 A;  2G2Q A;  3IA1 A;  2GST A;  5FWG A;  2EIO A;  3GTU B;  2PGT A;  3V1W A;  3ME7 A;  2LRN A;  3TKQ A;  5A4W A;  1EGO A;  5DDL A;  2BMX A;  3HD5 A;  4CDO A;  7GSS A;  3QAW A;  3EWL A;  1TI3 A;  1A8L A;  3IDV A;  5KN3 A;  1FAA A;  3TJJ A;  3MNG A;  2R37 A;  3LGC A;  1AQV A;  2KOK A;  2P31 A;  1GUM A;  2OKA A;  2QSI A;  4V1A g;  2PVQ A;  1JZO A;  1K0C A;  2GZZ A;  1Z6N A;  3UEM A;  1Y25 A;  1BQ7 A;  2YWO A;  3ZVJ D;  2YWM A;  4YQV A;  4V2M A;  1GSF A;  2GQM A;  2PU9 C;  4IBP A;  3IK9 A;  5CO3 A;  2YPM A;  5DAK B;  6GSX A;  3UIW A;  1PL1 A;  3I69 A;  1NW2 A;  5IOW A;  4TW5 A;  3GH6 A;  3VUR A;  1I5G A;  5D9V A;  4CHS A;  2L6D A;  2PBJ A;  2QGV A;  4ZBD A;  3P90 A;  1GTB A;  3ME8 A;  2BJX A;  1LBK A;  5B7C A;  4BPY A;  1F9M A;  5CRE A;  1M0U A;  5DVB A;  1SL1 B;  3HZ8 A;  1E2Y A;  4MZB A;  4MDC A;  2CAQ A;  2FGX A;  1FVJ A;  1ML6 A;  2HE3 A;  8GSS A;  1UN2 A;  4XIH A;  2V6K A;  4FH8 A;  4EE0 A;  1B4P A;  1KTE A;  2RM6 A;  2VUP A;  2LNS A;  2PMT A;  1GTA A;  2VCV A;  2GLR A;  4OD7 A;  3ERW A;  1AXD A;  4ZBB A;  6GSV A;  22GS A;  3I43 A;  2DJJ A;  3LOR A;  1ZOF A;  1DSB A;  2GZY A;  2MMO A;  1SD8 A;  4RI7 A;  1JLV A;  3QPM A;  4K0G A;  3FEU A;  1JHB A;  5CAX A;  1YF1 A;  2LJA A;  3ZYW A;  1KNG A;  1AQW A;  3EU4 A;  4GWR A;  2HSY A;  4N30 A;  3VWU A;  4TR3 A;  3CMI A;  6GST A;  1B9Y C;  3U6V A;  2ON7 A;  1T4Y A;  5L71 A;  1PKW A;  1CQG A;  4AGS A;  3W6G A;  3DXB A;  13GS A;  2YZH A;  2J9H A;  3ZFL A;  1ST9 A;  2H0H A;  5HR2 A;  4YAV A;  1SD9 A;  2HI7 A;  4ILF A;  4O32 A;  3UBK A;  5DJL A;  3QAG A;  2MBS A;  3IV4 A;  3VI7 A;  4TKY A;  2LRT A;  3CSI A;  2FHE A;  4EO3 A;  1KBN A;  4KUN A;  4MH3 A;  1YKA A;  2EIQ A;  1S3A A;  5D73 A;  2VCX A;  3DVX A;  1K3L A;  3DD3 A;  4EUY A;  1F6M C;  2N5F A;  3APQ A;  5GZZ B;  2I81 A;  3FKF A;  2A4V A;  2AHE A;  2B5X A;  2DIY A;  1SL2 B;  2VLV A;  3GKM A;  5HFG A;  3UBL A;  3PH9 A;  1B8X A;  2K6V A;  2ON5 A;  3F4T A;  1URM A;  1GUH A;  2K9F A;  4ISD A;  2CQ9 A;  3DEX A;  1U3A A;  19GS A;  3UAP A;  4V2N A;  2B1L A;  5IMA A;  4MAB A;  3A3T A;  3Q74 A;  2L6C A;  5DAL A;  1GSD A;  1MDK A;  4WKW A;  2K8V A;  4IJI A;  2WDU A;  5B8B A;  2H6Z A;  1EEJ A;  2QKE A;  2LQO A;  2IIY A;  3GTU A;  2LUS A;  1TI1 A;  1EGR A;  18GS A;  3Q19 A;  2AJQ B;  4NV2 A;  5A4U A;  2GS3 A;  5ELA A;  1GNW A;  3MSZ A;  4O5R A;  3RHC A;  1S3C A;  2FA4 A;  4AJ7 A;  1ZZY A;  3VWW A;  2LJK A;  2GSR A;  4PNG A;  1M99 A;  1UVZ A;  2DJ1 A;  5G1L A;  1PGT A;  2AB6 A;  3DYR A;  1V57 A;  4TOP A;  1OVN A;  2GGT A;  2KUC A;  1FVK A;  5JWQ B;  2WFC A;  2DML A;  1WMJ A;  3CYN A;  3KH9 A;  1Z7R A;  3KH7 A;  2X8H A;  3IAS 2;  3GKX A;  5C00 A;  3GKN A;  5A4V A;  3K8N A;  4TN8 A;  4OMV A;  2MMN A;  1DE1 A;  4I2T A;  5IMF A;  3DGQ A;  4V1A p;  2AV4 A;  2OAD A;  4BL7 A;  4H86 A;  5DAK A;  2VCZ A;  3D4T A;  1YEX A;  4I8B A;  2AYT A;  5EVO A;  3TJF A;  2GTU A;  1MDJ A;  3EC3 A;  5B6N A;  4EDY A;  1U88 A;  3UVH A;  1XCC A;  2L57 A;  4FYU A;  3D21 A;  2C3T A;  2WGR A;  1Z3E A;  4HU9 A;  4WR5 A;  2YN1 A;  4WF4 A;  5ECI B;  5G5F A;  2IME A;  1YKC A;  1EEM A;  4IP6 A;  4OFN A;  3RAZ A;  4PXO A;  5D9W A;  1ZGN A;  3KTL A;  2CV4 A;  1TXX A;  2HZE B;  2TIR A;  1PMT A;  5IMV A;  1MTC A;  5IIZ A;  1XWK A;  4HQZ A;  2JL4 A;  4DSQ A;  5G31 A;  4FO5 A;  3PGT A;  4L5L A;  3QFB C;  4RQX A;  2K18 A;  4PUR A;  2E7P A;  4PQH A;  4DVC A;  5IM9 A;  3VLN A;  4L0W A;  3H8Q A;  3C73 A;  1GWC A;  1RK4 A;  1W4V A;  4EVM A;  1BAY A;  2R4V A;  1OE8 A;  3TGZ A;  4F0C A;  5GAP D;  4Q5R A;  1MD3 A;  3N9J A;  1SJI A;  5LCZ A;  4IW9 A;  1GTI A;  1A24 A;  2KHP A;  5ECQ B;  4GSN A;  1QGV A;  4K8M A;  5IPG A;  1K0N A;  3EVI A;  4WR4 A;  3L9V A;  1XBS A;  2JAD A;  3FRC A;  2LTK A;  2JZS A;  4BWQ A;  3ISO A;  1K0B A;  1TRV A;  4POL A;  4G19 A;  3HVX A;  4PQ1 A;  5ECR B;  2YWI A;  3DML A;  3M1G A;  1I9D A;  2KP2 A;  3IE3 A;  1TRW A;  5J9B A;  4PUF C;  3KD0 A;  5AIS A;  3ZIT A;  5GAN D;  2HFD A;  3IR4 A;  3QDN A;  3QMX A;  4K7I A;  2WS2 A;  5JCW A;  2LEG A;  1F37 A;  3TJB A;  3ZLP A;  4J56 E;  3C1S A;  1OKT A;  4IS0 A;  4ZL9 A;  2RLI A;  1YJ6 A;  5E4W A;  2L4C A;  4GQC A;  2NTO A;  1G7E A;  4ZIJ A;  3O3T A;  1V9W A;  2LQQ A;  4IP1 A;  4ZB8 A;  4TXO B;  2GSQ A;  4IKH A;  2KLX A;  2H70 A;  2VAF A;  1MEK A;  2RII A;  4XTS A;  1R26 A;  1GP1 A;  4O92 A;  4OCE A;  5ELG A;  2OA7 A;  4KB3 A;  2XPE A;  5ABR A;  1Z5Y E;  5ECH B;  1F3B A;  5ID2 B;  4N0Z A;  5G30 A;  4WEY A;  2H75 A;  2AUV A;  2V41 A;  2MBT A;  2C0D A;  3ZZX A;  3MWH A;  1VF3 A;  2VCT A;  2YWN A;  2VD1 A;  3H79 A;  1X9M B;  3EMX A;  4I6X A;  3KZQ A;  2E0Q A;  5J3R A;  3IRA A;  1QK8 A;  3J7Y b;  2O85 A;  2DLX A;  1OYJ A;  1M7T A;  3LYK A;  1S3D A;  3Q6O A;  4Z7X A;  1FW1 A;  4QL7 A;  2L4Q A;  5ECP B;  4EXJ A;  1JZD A;  3QFA C;  4N10 A;  2H0I A;  2PN8 A;  3VI5 A;  1A23 A;  5JWR B;  4IGJ A;  1RQM A;  1DUG A;  2DSA A;  4PUA A;  4ACS A;  1V98 A;  3D22 A;  1XFL A;  5G5E A;  2XC2 A;  2VIM A;  4JU5 A;  3D6I A;  1VF4 A;  1GLP A;  1IYH A;  3HDC A;  3L9S A;  1ZCP A;  4KCA A;  3FZ4 A;  4KDU A;  2TRC P;  2R3X A;  2B6M A;  2R2J A;  1GUK A;  3RPN A;  3F8U A;  3IK7 A;  1R5P A;  4LA1 A;  4POK A;  4EL1 A;  1XW9 A;  2HNL A;  1OC3 A;  1VF2 A;  1VRS D;  2HZE A;  2XHF A;  3DWV A;  2DJ0 A;  3TB2 A;  2M72 A;  4TR0 A;  3I6A A;  4HZ4 A;  2PUK C;  4XCS A;  3ZTL A;  3MAK A;  3WGD A;  3LXZ A;  3FR3 A;  2LRC A;  4TR4 A;  4AJ8 A;  2DJK A;  2P0G A;  2VO4 A;  2I1U A;  3TRQ A;  4YAP A;  3IPZ A;  2ALB A;  2H1D A;  4MZC A;  5GSS A;  1USB A;  3IXR A;  2WRT A;  3AY8 A;  5C04 A;  3GA4 A;  3F4R A;  5CRD A;  3TRX A;  1XWA A;  1X5E A;  4CW9 A;  1SU9 A;  1FHE A;  5CNW A;  4MPF A;  2EIR A;  2MYG A;  1WPI A;  2C4J A;  1EV9 A;  3A2X A;  1M9B A;  2PPT A;  2A2S A;  3GUS A;  4MF5 A;  3HY2 A;  2YZU A;  3QOU A;  1TP9 A;  1Z9H A;  4K6X A;  3HVV A;  4PQI A;  2I4A A;  3NZN A;  4TR1 B;  1SKW B;  5GST A;  1GSU A;  2REM A;  4KSM A;  2VCQ A;  1SEN A;  3ZML A;  1PKZ A;  3EE2 A;  2VM2 A;  3TDG A;  4F82 A;  1SK2 A;  1NHY A;  3TUE A;  4OO4 A;  4OWY A;  1Z7P A;  2NPB A;  2FWF A;  1ABA A;  1XOA A;  1R7H A;  2P5Q A;  2CVK A;  2KP1 A;  3IBH A;  3DVW A;  2Z9S A;  3LG6 A;  4V2L A;  1SKS B;  1R4W A;  1ERU A;  3QR6 A;  3ZIJ A;  4EF0 A;  4KDX A;  4G9H A;  3N5O A;  1X0R A;  3F6D A;  4TXO A;  4LL4 B;  4BA7 A;  2GSS A;  2HSH A;  4EKZ A;  4DEJ A;  1T7P B;  4RQR A;  1XVQ A;  2XBQ A;  3TJG A;  2B5E A;  2H1B A;  3F0I A;  5AN1 A;  3HA9 A;  2PER A;  2VL3 A;  3FZ9 A;  1WOU A;  4HDE A;  3GST A;  1QQ2 A;  2DIZ A;  5CRG A;  3E9J B;  1SYR A;  3GUR A;  5ID2 A;  1HNB A;  3FW2 A;  2F9S A;  2XBI A;  3A2W A;  2VD0 A;  3UAR A;  3H4K A;  4IVF A;  2FNO A;  3C1R A;  5J9C A;  2VCW A;  3GL3 A;  4HQS A;  4N11 A;  1T1V A;  4K7N A;  1AAZ A;  2WUL A;  5JWO B;  2X8G A;  2HYX A;  1GL8 A;  1ERW A;  3FR6 A;  1XVW A;  20GS A;  2VL9 A;  5ENU A;  4MJB A;  2V2G A;  2C3N A;  1Q98 A;  2H01 A;  5CP1 A;  1GUL A;  4BWS A;  1XWG A;  3L4N A;  1VF1 A;  3CRU A;  2A2R A;  1GRX A;  2YCD A;  2CX3 A;  1XW5 A;  3ZFB A;  2WJU A;  4GLT A;  1AQX A;  1PRX A;  4OCF A;  4KCE A;  2H76 A;  3P2A A;  6GSY A;  1TK8 B;  4I97 A;  5EL8 A;  1BYE A;  1JLW A;  4KW6 A;  4F2I A;  4L0U A;  3F3R A;  4K2D A;  3KMN A;  1ON4 A;  2FD3 A;  4IN0 A;  1J08 A;  3M9J A;  3KP9 A;  3APS A;  3DKS A;  1FG4 A;  1O81 A;  2YV9 A;  5IOX A;  2X99 A;  2DMM A;  4KND A;  3E0U A;  3W8S A;  1C72 A;  3CXG A;  1PA3 A;  3BJ5 A;  1XIY A;  4EC0 A;  3J7Y k;  4DSS B;  10GS A;  4OO5 A;  3ERG A;  4MJE A;  3APO A;  2NVL A;  2VLT A;  3C71 A;  3GFK A;  1BED A;  1TRU A;  1W89 A;  3G7J A;  1HYU A;  1YZX A;  4XS4 B;  4ULX A;  3M0F A;  2IMF A;  5HFI A;  2N5A A;  3EMP A;  3BOA A;  5HFK A;  5F8B A;  3KP8 A;  5D9T A;  4K1F A;  5DBQ A;  3R2Q A;  3ERF A;  3EYT A;  1R5A A;  4E8E A;  4NMU A;  4LLR A;  5D96 A;  5ECS A;  2L5L A;  1A8Y A;  3P7X A;  3TKS A;  1E6B A;  3M8N A;  3HJP A;  3PIN A;  1A2J A;  3LWA A;  2YNX A;  4D73 B;  1EP8 A;  1G7O A;  1SYX A;  2C0E A;  1GH2 A;  2JZT A;  2C1Y A;  3IC4 A;  5G1K A;  4TR1 A;  3RPP A;  4ZL7 A;  4FIW A;  3WT1 A;  1A0R P;  5J5N A;  1T3B A;  2V6O A;  2LST A;  3CBU A;  2H1G A;  3LFL A;  3UL3 A;  2WB9 A;  4WF5 A;  3BCK A;  1G6Y A;  3FZA A;  4GCI A;  1RW1 A;  1JZW A;  2N5B A;  1KEB A;  1FB0 A;  2OBK A;  1QFN A;  1TU8 A;  1TKD B;  1X9S B;  1T4Z A;  1J0F A;  3VFI A;  4G10 A;  3EUR A;  3LJR A;  1G6W A;  5HR0 A;  2ZNM A;  3UOM A;  1XXU A;  5IPH A;  1TTZ A;  1PSQ A;  3FZ5 A;  2D2Z A;  4HI7 A;  3HZ4 A;  2OBI A;  2IFQ B;  1O6J A;  2H8L A;  2F8F A;  2MMZ A;  2C0G A;  4G2E A;  2E2G A;  1WIK A;  2CZ2 A;  1PD2 1;  1F3A A;  2VOC A;  5F07 A;  5JCU A;  3GHA A;  3US3 A;  5E59 A;  4MJA A;  3CSJ A;  1DE2 A;  1HQO A;  2TRX A;  3I9V 2;  3HVS A;  4WBJ A;  3F3Q A;  3FHK A;  4I5Q A;  2C80 A;  4OFT A;  9GSS A;  2YP6 A;  2DJ3 A;  4ZIL A;  3F6F A;  3BCI A;  1ZYE A;  5DQS A;  1QMV A;  4POB A;  5KN0 A;  4WXT A;  4GRF A;  3HJO A;  2O89 A;  2IWT A;  3KM6 A;  4JR6 A;  1WJK A;  4F9Z A;  4IJ3 A;  3OR5 A;  2VLU A;  3C7M A;  4MP4 A;  2P5R A;  1JFU A;  1SKR B;  1TW9 A;  2L59 A;  2B3S A;  3GV1 A;  5AGY A;  4KE3 A;  1U6T A;  1SK0 A;  4KDY A;  5IMC A;  1TK0 B;  5F05 A;  5AIV A;  1TRS A;  5HR3 A;  1ZMA A;  4J57 E;  1Y6E A;  2WCI A;  3GIX A;  4IHU A;  5IQY A;  4ECC A;  4DSS A;  1GSS A;  1LJR A;  2JU5 A;  3A2V A;  2H71 A;  1FOV A;  1YQ1 A;  4WET A;  1J9B A;  4WBR D;  3LQ7 A;  3EIN A;  3M3M A;  4L8E A;  2RUE A;  4JZQ A;  3GYK A;  1AUC A;  1T00 A;  5J4U A;  2B7J A;  2LJR A;  4LMW A;  5H5S A;  4XS4 A;  3LEF A;  4NAX A;  2LS5 A;  2F3M A;  2B7K A;  2F8A A;  2H19 A;  2H30 A;  1K0D A;  1SK1 A;  3UMA A;  1EOG A;  1GNE A;  1N8J A;  3M9K A;  1A2L A;  2ZUP A;  5HR1 A;  2M46 A;  4NXI A;  4Q5N A;  1T8E B;  2GT6 A;  1U3I A;  4ZL8 A;  1MDI A;  3TKS C;  3H1N A;  5KEJ A;  2OE3 A;  4MF7 A;  4GSS A;  1FO5 A;  2GT5 A;  5CYY A;  2ES7 A;  4ZB9 A;  2ZCT A;  3KGK A;  3HJM A;  3RHB A;  2R6K A;  4D73 A;  1V58 A;  4XRD A;  1WRY A;  3NOF A;  1FB6 A;  4TVE A;  4NPB A;  2FCH A;  4XS1 A;  14GS A;  3DRN A;  3ED3 A;  3NIV A;  3VWV A;  1EZK A;  1XOB A;  1OC9 A;  3CRT A;  1NM3 A;  3TRP A;  2GQK A;  2YJH A;  1O73 A;  4GTU A;  4KX4 A;  3O76 A;  1YDK A;  3S9F A;  3IOS A;  1Z6M A;  2JSZ A;  4I2U A;  1OAZ A;  2CVD A;  1K0A A;  2V1M A;  3P8W A;  12GS A;  4KA0 A;  4MLY A;  1OE7 A;  3KIJ A;  4QL9 A;  2FUG 2;  4FYC A;  2LKU A;  1A0F A;  3LSZ A;  2VM1 A;  1M2A A;  1AIU A;  1XZO A;  16GS A;  2GDR A;  5H5R A;  2VL2 A;  4X0X A;  4NWY A;  3HCZ A;  2XPD A;  2IFQ A;  5DJM A;  1VGL A;  1B9X C;  4ECI A;  3GRX A;  4MF6 A;  1TDI A;  3TKP A;  2BTO T;  3MDK A;  1HD2 A;  3D4M A;  1HNA A;  3G7Y A;  5ECL B;  3ZVJ A;  4XS6 A;  4HS1 A;  2CVB A;  1BG5 A;  1PL2 A;  2H1A A;  1SJ6 A;  2V32 A;  2DJ2 A;  2CX4 A;  4TRX A;  3LYP A;  5IO0 A;  4ZXG A;  1OKD A;  2OJL A;  3KJY A;  1B48 A;  3KEB A;  4ZB6 A;  2MZC A;  2OE0 A;  4KGI A;  4MA9 A;  17GS A;  3LXT A;  1PQN A;  5AIX A;  3GMF A;  3VWX A;  1AW9 A;  1TK5 B;  2FWE A;  5LNK e;  4X1U A;  1JZR A;  4BVX A;  2DBC A;  3VK9 A;  2IJY A;  2C0F A;  2C8U A;  2J23 A;  1SL0 B;  5FHI A; 
#chains in the Genus database with same CATH topology
 3WT2 A;  5A5K A;  1N2A A;  1IYI A;  2MMA A;  3QD9 A;  2CA8 A;  1YF0 A;  4JR4 A;  2LNT A;  1UC7 A;  2E2M A;  3TKR A;  1GSY A;  1HNC A;  2JZR A;  4IQA A;  4YQM A;  3QCP A;  4Q5Q A;  2AAW A;  1X5C A;  3QAV A;  5IMZ A;  3HKR A;  3VPT A;  2LV3 A;  4BVY B;  3CTG A;  4GXZ A;  2GQL A;  2RUF A;  2QC7 A;  4QQ7 A;  4GST A;  4JBB A;  4MMM A;  2B5Y A;  5ECO B;  1WWJ A;  3ZL5 A;  1X5D A;  5DQY A;  5F0G A;  3TJK A;  1M2B A;  4HJ2 A;  2JSY A;  2H6Y A;  4Q5F A;  4POM A;  1XWC A;  1UA5 A;  3IHQ A;  1MD4 A;  2HRN A;  3ZRD A;  3EPT A;  3SWL A;  4N0V A;  1GTU A;  3O6T A;  2K8S A;  2FY6 A;  4LL1 B;  4J2F A;  3FYG A;  3RBT A;  2HLS A;  3KMO A;  3L0H A;  5DCH A;  4DSR A;  4MH2 A;  3TOU A;  3BBY A;  4HOJ A;  2UZ8 A;  4TXV A;  3WD6 A;  3HHV A;  2R0P A;  3UJ1 A;  2O8V B;  3VPQ A;  2HZF A;  4KAE A;  1XWB A;  2X4A A;  3FR9 A;  2YOI A;  5BRT A;  3JCM L;  1TU7 A;  3HXS A;  3GX8 A;  2RM5 A;  4ML1 A;  3FK8 A;  4LMV A;  4HEA 2;  1G0T A;  4XHM A;  5F06 A;  4ECB A;  3MYD A;  5D93 A;  3DIE A;  1B4Q A;  3GN3 A;  5ECN B;  1EWX A;  3D0Z A;  2O7K A;  4ID0 A;  4MCU A;  4MK3 A;  4MZW A;  1BJX A;  3F9U A;  4K5R A;  3GL5 A;  2H74 A;  3G7I A;  3G9B A;  2C3Q A;  2B1K A;  2PWJ A;  4PNF A;  3PR8 A;  4RI6 A;  3ZMK A;  2GZP A;  4HUA A;  5KOX A;  2YV7 A;  1ERT A;  3BD2 A;  4NV5 A;  6GSS A;  3KCM A;  1SJZ A;  5JCG A;  2NBS A;  11GS A;  2CAI A;  4E8H A;  5EY6 A;  1YY7 A;  3WGE A;  3CQF A;  2CZ3 A;  1M9A A;  3ZRE A;  2EC4 A;  4MJC A;  5ECM B;  1O8W A;  1OC9 B;  1M2D A;  1THX A;  2GVP A;  4HZ2 A;  2VL2 C;  1F2E A;  4JED A;  1DBY A;  1THO A;  6GSW A;  5INY A;  4CY8 A;  2FLS A;  3D5J A;  3GNJ A;  3RDW A;  1V2A A;  1EV4 A;  4KH7 A;  1ZL9 A;  2H6X A;  4YKF A;  3SBC A;  3GKK A;  2X8C A;  4KSO A;  1O85 A;  1ILO A;  4NHW A;  1ERV A;  4JRR A;  1NHO A;  1GSQ A;  3L78 A;  2FWG A;  4K0N A;  4XRA A;  4NHZ A;  2I9H A;  3KTB A;  3U5R E;  4AF2 A;  2H72 A;  2PVO C;  3L9U A;  3WYW A;  4ZBA A;  1O7U A;  2IL3 A;  1H4O A;  4X43 A;  4JE1 A;  5HQP A;  1K0M A;  2IN3 A;  4OFM A;  2DC5 A;  1V40 A;  5CRH A;  4O5U A;  5DCG A;  4PGT A;  2L5O A;  3GSS A;  5G2Z A;  4F0B A;  2JAC A;  3CSH A;  4RUV A;  1NSW A;  5CRW A;  6GSU A;  2IMI A;  1ZYQ B;  1GSE A;  5BMU A;  2IPA A;  1YEP A;  5KN1 A;  1WE0 A;  2FA8 A;  4IEL A;  4GQF A;  2G0F A;  3UVT A;  5B6M A;  2R5G A;  5COH A;  3GH9 A;  1A2M A;  1EP7 A;  1AC1 A;  2I3Y A;  5ECK B;  1PX7 A;  2IMD A;  2H66 A;  4P3Y B;  3EU3 A;  4K9Z A;  3Q18 A;  1BX9 A;  5D9X A;  4BIK A;  3E3E A;  2H73 A;  4BVY A;  2O87 A;  5D8I A;  4PX1 A;  3TOT A;  1OC8 A;  2OE1 A;  1U87 A;  1LU4 A;  2H0G A;  2YAN A;  1WP0 A;  3GX0 A;  3W8J A;  1QUW A;  2IMK A;  2WZ9 A;  4ML6 A;  3A5W A;  4HU7 A;  4L5O A;  4GF0 A;  4ECJ A;  1O8X A;  1QXH A;  1ACV A;  5EPF A;  3TCO A;  4IQ1 A;  1K3Y A;  2X64 A;  5J41 A;  2M80 A;  5LD0 A;  2FWH A;  2OAC A;  4F03 A;  5B8A A;  4AJ6 A;  5KN2 A;  1Q4J A;  3KXO A;  3C8E A;  4X4J A;  2HRF A;  5FT3 A;  1EOH A;  1PN9 A;  5IO2 A;  3WGX A;  3H93 A;  4K7O A;  3ZIV A;  3F63 A;  3CTF A;  1GLQ A;  2NDO A;  3TKS E;  4MPG A;  2HXK A;  1H75 A;  1PX6 A;  1K3O A;  3FY7 A;  2CT6 A;  3HYP A;  1K0O A;  1TOF A;  4YQU A;  1X9W B;  4O7H A;  5H5Q A;  5IMD A;  1CQH A;  1XPV A;  1XW6 A;  4FYB A;  1TJD A;  4EDZ A;  4YH2 A;  5DAL B;  2YJ7 A;  4HJM A;  2DKI A;  3IAM 2;  3F4S A;  2HT9 A;  2F51 A;  2G2Q A;  3IA1 A;  2GST A;  5FWG A;  2EIO A;  3GTU B;  2PGT A;  3V1W A;  3ME7 A;  2LRN A;  3TKQ A;  5A4W A;  1EGO A;  5DDL A;  2BMX A;  3HD5 A;  4CDO A;  7GSS A;  3QAW A;  3EWL A;  1TI3 A;  1A8L A;  3IDV A;  5KN3 A;  1FAA A;  5KOW A;  3TJJ A;  3MNG A;  2R37 A;  3LGC A;  1AQV A;  2KOK A;  2P31 A;  1GUM A;  2OKA A;  2QSI A;  4V1A g;  2PVQ A;  1JZO A;  1K0C A;  2GZZ A;  1Z6N A;  3UEM A;  1Y25 A;  1BQ7 A;  2YWO A;  3ZVJ D;  2YWM A;  4YQV A;  4V2M A;  1GSF A;  2GQM A;  4Z2R A;  2PU9 C;  4IBP A;  3IK9 A;  5CO3 A;  4BL7 B;  2YPM A;  5DAK B;  6GSX A;  3UIW A;  1PL1 A;  3I69 A;  1NW2 A;  5IOW A;  4TW5 A;  4Z2T A;  3GH6 A;  3VUR A;  1I5G A;  5D9V A;  4CHS A;  2L6D A;  2PBJ A;  2QGV A;  4ZBD A;  3P90 A;  1GTB A;  3ME8 A;  2BJX A;  1LBK A;  5B7C A;  4BPY A;  4USS A;  1F9M A;  2DKH A;  5CRE A;  1M0U A;  5DVB A;  4ICY A;  1SL1 B;  3HZ8 A;  1E2Y A;  4MZB A;  4MDC A;  2CAQ A;  2FGX A;  1FVJ A;  1ML6 A;  2HE3 A;  8GSS A;  1UN2 A;  4XIH A;  2V6K A;  4FH8 A;  4EE0 A;  1B4P A;  1KTE A;  2RM6 A;  2VUP A;  2LNS A;  3LW9 A;  2PMT A;  1GTA A;  2VCV A;  2GLR A;  4OD7 A;  3ERW A;  1AXD A;  4ZBB A;  6GSV A;  22GS A;  3I43 A;  2DJJ A;  3LOR A;  1ZOF A;  1DSB A;  2GZY A;  2MMO A;  1SD8 A;  4RI7 A;  1JLV A;  3QPM A;  4K0G A;  3FEU A;  1JHB A;  5CAX A;  1YF1 A;  2LJA A;  3ZYW A;  1KNG A;  1AQW A;  3EU4 A;  4GWR A;  2HSY A;  4N30 A;  3VWU A;  4TR3 A;  3CMI A;  6GST A;  1B9Y C;  3U6V A;  2ON7 A;  1T4Y A;  5L71 A;  1PKW A;  1CQG A;  4AGS A;  3W6G A;  3DXB A;  13GS A;  2YZH A;  2J9H A;  3ZFL A;  1ST9 A;  2H0H A;  5HR2 A;  4YAV A;  1SD9 A;  2HI7 A;  4ILF A;  4O32 A;  3UBK A;  5DJL A;  3QAG A;  2MBS A;  3IV4 A;  3VI7 A;  4TKY A;  2LRT A;  3CSI A;  2FHE A;  4EO3 A;  1KBN A;  4KUN A;  4MH3 A;  1YKA A;  2EIQ A;  1S3A A;  5D73 A;  2VCX A;  3DVX A;  1K3L A;  3DD3 A;  4EUY A;  1F6M C;  2N5F A;  3APQ A;  5GZZ B;  2I81 A;  3FKF A;  2A4V A;  2AHE A;  3FMW A;  2B5X A;  2DIY A;  1SL2 B;  2VLV A;  3GKM A;  5HFG A;  3PPU A;  3UBL A;  3PH9 A;  1B8X A;  2K6V A;  2ON5 A;  3F4T A;  1URM A;  1GUH A;  2K9F A;  4ISD A;  2CQ9 A;  3DEX A;  1U3A A;  19GS A;  3UAP A;  4V2N A;  2B1L A;  5IMA A;  1ZYN A;  4MAB A;  3A3T A;  3Q74 A;  2L6C A;  5DAL A;  1GSD A;  1MDK A;  4WKW A;  2K8V A;  4IJI A;  2WDU A;  5B8B A;  2H6Z A;  1EEJ A;  2QKE A;  2LQO A;  2IIY A;  3GTU A;  2LUS A;  1TI1 A;  1EGR A;  18GS A;  3Q19 A;  2AJQ B;  4NV2 A;  5A4U A;  2GS3 A;  5ELA A;  1GNW A;  3MSZ A;  4O5R A;  3RHC A;  1S3C A;  1M3J A;  2FA4 A;  4AJ7 A;  1ZZY A;  3VWW A;  2LJK A;  2GSR A;  4PNG A;  1M99 A;  1UVZ A;  2DJ1 A;  5G1L A;  1PGT A;  2AB6 A;  3DYR A;  1V57 A;  4TOP A;  1OVN A;  2GGT A;  2KUC A;  1FVK A;  5JWQ B;  2WFC A;  2DML A;  1WMJ A;  3CYN A;  3KH9 A;  1Z7R A;  3KH7 A;  2X8H A;  4Z2U A;  3R3E A;  3IAS 2;  3GKX A;  5C00 A;  3GKN A;  5A4V A;  3K8N A;  4TN8 A;  4OMV A;  2MMN A;  1DE1 A;  4I2T A;  5IMF A;  3DGQ A;  4V1A p;  2AV4 A;  2OAD A;  4BL7 A;  4H86 A;  5DAK A;  2VCZ A;  3D4T A;  1YEX A;  4I8B A;  2AYT A;  5EVO A;  3TJF A;  2GTU A;  1MDJ A;  3EC3 A;  5B6N A;  4EDY A;  1U88 A;  3UVH A;  1XCC A;  2L57 A;  4FYU A;  3D21 A;  2C3T A;  2WGR A;  1Z3E A;  4HU9 A;  4WR5 A;  2YN1 A;  4WF4 A;  5ECI B;  5G5F A;  2IME A;  1YKC A;  1EEM A;  4IP6 A;  2R0C A;  4OFN A;  3RAZ A;  4PXO A;  5D9W A;  1ZGN A;  3KTL A;  2CV4 A;  1TXX A;  2HZE B;  2TIR A;  1PMT A;  5IMV A;  1MTC A;  5IIZ A;  4K5S A;  1XWK A;  4HQZ A;  2JL4 A;  4DSQ A;  5G31 A;  4FO5 A;  3PGT A;  4L5L A;  3QFB C;  4RQX A;  2K18 A;  4PUR A;  2E7P A;  4PQH A;  4DVC A;  5IM9 A;  3VLN A;  4L0W A;  3H8Q A;  3C73 A;  1GWC A;  1RK4 A;  1W4V A;  4EVM A;  1BAY A;  2R4V A;  1OE8 A;  3TGZ A;  4F0C A;  5GAP D;  4Q5R A;  1MD3 A;  3N9J A;  1SJI A;  5LCZ A;  4IW9 A;  1GTI A;  1A24 A;  2KHP A;  5ECQ B;  4GSN A;  1QGV A;  4K8M A;  5IPG A;  1K0N A;  3EVI A;  4WR4 A;  3L9V A;  1XBS A;  2JAD A;  3FRC A;  2LTK A;  2JZS A;  4BWQ A;  3ISO A;  1K0B A;  1TRV A;  4POL A;  2HRA A;  4G19 A;  3HVX A;  4PQ1 A;  5ECR B;  2YWI A;  3DML A;  3M1G A;  1I9D A;  2KP2 A;  3IE3 A;  1TRW A;  5J9B A;  4PUF C;  3KD0 A;  5AIS A;  3ZIT A;  5GAN D;  2HFD A;  3IR4 A;  3QDN A;  3QMX A;  4K7I A;  2WS2 A;  5JCW A;  2LEG A;  1F37 A;  3TJB A;  3ZLP A;  4J56 E;  3C1S A;  1OKT A;  4IS0 A;  4ZL9 A;  2RLI A;  1YJ6 A;  5E4W A;  3MIX A;  2L4C A;  4GQC A;  2NTO A;  1G7E A;  4ZIJ A;  3O3T A;  1V9W A;  2LQQ A;  4IP1 A;  4O5Q A;  4ZB8 A;  4TXO B;  2GSQ A;  4IKH A;  2KLX A;  2H70 A;  2VAF A;  1MEK A;  2RII A;  4XTS A;  1R26 A;  1GP1 A;  4O92 A;  4OCE A;  5ELG A;  2OA7 A;  4KB3 A;  2XPE A;  5ABR A;  1Z5Y E;  5ECH B;  1F3B A;  5ID2 B;  4N0Z A;  5G30 A;  4WEY A;  2H75 A;  2AUV A;  2V41 A;  2MBT A;  2C0D A;  3ZZX A;  3MWH A;  1VF3 A;  2VCT A;  2YWN A;  2VD1 A;  3H79 A;  1X9M B;  3EMX A;  4I6X A;  3KZQ A;  2E0Q A;  5J3R A;  3IRA A;  1QK8 A;  3J7Y b;  2O85 A;  2DLX A;  1OYJ A;  1M7T A;  3LYK A;  1S3D A;  3Q6O A;  4Z7X A;  1FW1 A;  4QL7 A;  2L4Q A;  5ECP B;  4EXJ A;  1JZD A;  3QFA C;  4N10 A;  2H0I A;  2PN8 A;  3VI5 A;  1A23 A;  5JWR B;  4IGJ A;  1RQM A;  1DUG A;  2DSA A;  4PUA A;  4ACS A;  1V98 A;  3D22 A;  1XFL A;  5G5E A;  2XC2 A;  2VIM A;  4JU5 A;  1S3R A;  3D6I A;  1VF4 A;  1GLP A;  1IYH A;  3HDC A;  3L9S A;  2R0G A;  1ZCP A;  4K2X A;  4KCA A;  3FZ4 A;  4KDU A;  2TRC P;  2R3X A;  2B6M A;  2R2J A;  1GUK A;  3RPN A;  3F8U A;  3IK7 A;  1R5P A;  4LA1 A;  4POK A;  4EL1 A;  1XW9 A;  2HNL A;  1OC3 A;  3A5I A;  1VF2 A;  2A2P A;  1VRS D;  4FQU A;  2HZE A;  2XHF A;  3DWV A;  2DJ0 A;  3TB2 A;  2M72 A;  4TR0 A;  3I6A A;  4HZ4 A;  2PUK C;  4XCS A;  3ZTL A;  3MAK A;  3WGD A;  3LXZ A;  3FR3 A;  2LRC A;  4TR4 A;  4AJ8 A;  2DJK A;  2P0G A;  2VO4 A;  3HVN A;  2I1U A;  3TRQ A;  4YAP A;  3IPZ A;  2ALB A;  2H1D A;  4MZC A;  5GSS A;  1USB A;  3IXR A;  2WRT A;  3AY8 A;  5C04 A;  3GA4 A;  3F4R A;  5CRD A;  3TRX A;  1XWA A;  1X5E A;  4CW9 A;  1SU9 A;  1FHE A;  4PTS A;  5CNW A;  4MPF A;  2EIR A;  2MYG A;  1WPI A;  2C4J A;  1EV9 A;  3A2X A;  1M9B A;  2PPT A;  2A2S A;  4G0K A;  3GUS A;  4MF5 A;  3HY2 A;  2YZU A;  3QOU A;  1TP9 A;  1Z9H A;  4K6X A;  3HVV A;  4PQI A;  2I4A A;  3NZN A;  4TR1 B;  1PFO A;  1SKW B;  5GST A;  1GSU A;  2REM A;  4KSM A;  2VCQ A;  1SEN A;  3ZML A;  1PKZ A;  3EE2 A;  2VM2 A;  3TDG A;  4F82 A;  1SK2 A;  1NHY A;  3TUE A;  4OO4 A;  4OWY A;  1Z7P A;  2NPB A;  2FWF A;  4YKG A;  1ABA A;  1XOA A;  1R7H A;  2P5Q A;  1XG8 A;  2CVK A;  2KP1 A;  3IBH A;  3DVW A;  2Z9S A;  3LG6 A;  4V2L A;  1SKS B;  1R4W A;  1ERU A;  3QR6 A;  3ZIJ A;  4EF0 A;  4KDX A;  4G9H A;  3N5O A;  1X0R A;  3F6D A;  4TXO A;  4LL4 B;  4BA7 A;  2GSS A;  2HSH A;  4EKZ A;  4DEJ A;  1T7P B;  4RQR A;  1XVQ A;  2XBQ A;  3TJG A;  2B5E A;  2H1B A;  3F0I A;  5AN1 A;  3HA9 A;  2PER A;  2VL3 A;  3FZ9 A;  1WOU A;  4HDE A;  3GST A;  1QQ2 A;  2DIZ A;  5CRG A;  3E9J B;  1SYR A;  3GUR A;  5ID2 A;  1HNB A;  3FW2 A;  2F9S A;  2XBI A;  3A2W A;  2VD0 A;  3UAR A;  3H4K A;  4IVF A;  2FNO A;  3C1R A;  5J9C A;  2VCW A;  3GL3 A;  4HQS A;  4N11 A;  1T1V A;  4K7N A;  1AAZ A;  2WUL A;  5JWO B;  2X8G A;  2HYX A;  1GL8 A;  1ERW A;  3FR6 A;  1XVW A;  3IHG A;  20GS A;  2VL9 A;  5ENU A;  4MJB A;  2V2G A;  2C3N A;  1Q98 A;  2H01 A;  5CP1 A;  1GUL A;  4BWS A;  1XWG A;  3L4N A;  1VF1 A;  3CRU A;  2A2R A;  1GRX A;  2YCD A;  2CX3 A;  1XW5 A;  3ZFB A;  2WJU A;  4GLT A;  1AQX A;  1PRX A;  4OCF A;  4KCE A;  2H76 A;  3P2A A;  6GSY A;  1TK8 B;  4I97 A;  5EL8 A;  1BYE A;  1JLW A;  4KW6 A;  4F2I A;  4L0U A;  2QA2 A;  3F3R A;  3KMN A;  4K2D A;  1ON4 A;  2FD3 A;  4IN0 A;  1J08 A;  3M9J A;  3KP9 A;  3APS A;  3DKS A;  1FG4 A;  1O81 A;  2YV9 A;  5IOX A;  2X99 A;  2DMM A;  4KND A;  3E0U A;  3W8S A;  1C72 A;  3CXG A;  1PA3 A;  3BJ5 A;  1XIY A;  4EC0 A;  3J7Y k;  4DSS B;  10GS A;  4OO5 A;  3IC8 A;  3ERG A;  4G0L A;  4MJE A;  3APO A;  2NVL A;  2VLT A;  3C71 A;  3GFK A;  1BED A;  1TRU A;  1W89 A;  3G7J A;  2HRK A;  1HYU A;  1YZX A;  4XS4 B;  4ULX A;  3M0F A;  2IMF A;  5HFI A;  2N5A A;  3EMP A;  3BOA A;  5HFK A;  5F8B A;  3KP8 A;  5D9T A;  4K1F A;  5DBQ A;  3R2Q A;  3ERF A;  3EYT A;  1R5A A;  4E8E A;  4NMU A;  4LLR A;  5D96 A;  5ECS A;  2L5L A;  1A8Y A;  3P7X A;  3TKS A;  1E6B A;  3M8N A;  3HJP A;  3PIN A;  1PN0 A;  1A2J A;  3LWA A;  2YNX A;  4D73 B;  1EP8 A;  1G7O A;  1SYX A;  2C0E A;  1GH2 A;  2JZT A;  2C1Y A;  3IC4 A;  5G1K A;  4TR1 A;  3RPP A;  4ZL7 A;  4FIW A;  3WT1 A;  1A0R P;  5J5N A;  1T3B A;  2V6O A;  2LST A;  3CBU A;  2H1G A;  3LFL A;  3UL3 A;  2WB9 A;  4WF5 A;  3BCK A;  1G6Y A;  3FZA A;  4GCI A;  1RW1 A;  1JZW A;  2N5B A;  1KEB A;  1FB0 A;  2OBK A;  1QFN A;  1TU8 A;  1TKD B;  1X9S B;  1T4Z A;  1J0F A;  3VFI A;  4G10 A;  3EUR A;  3LJR A;  1G6W A;  5HR0 A;  2ZNM A;  3UOM A;  1XXU A;  5IPH A;  1TTZ A;  1PSQ A;  3FZ5 A;  2D2Z A;  4HI7 A;  3HZ4 A;  2OBI A;  2IFQ B;  1O6J A;  2H8L A;  2F8F A;  2MMZ A;  2C0G A;  4G2E A;  2E2G A;  1WIK A;  2CZ2 A;  1PD2 1;  1F3A A;  2VOC A;  5F07 A;  5JCU A;  3GHA A;  3US3 A;  5E59 A;  4MJA A;  3CSJ A;  1DE2 A;  4EIQ A;  1HQO A;  2TRX A;  3I9V 2;  3HVS A;  4WBJ A;  3F3Q A;  3FHK A;  4I5Q A;  2C80 A;  4OFT A;  9GSS A;  2YP6 A;  2DJ3 A;  4ZIL A;  3F6F A;  3BCI A;  1ZYE A;  5DQS A;  1QMV A;  4POB A;  5KN0 A;  4WXT A;  4GRF A;  4HSC X;  3HJO A;  2O89 A;  2IWT A;  3KM6 A;  4CY6 A;  4JR6 A;  1WJK A;  4F9Z A;  4IJ3 A;  4BVX B;  2HSM A;  3OR5 A;  2VLU A;  3C7M A;  4MP4 A;  2P5R A;  1JFU A;  1SKR B;  1TW9 A;  2L59 A;  2B3S A;  3GV1 A;  5AGY A;  4KE3 A;  1U6T A;  1SK0 A;  4KDY A;  5IMC A;  1TK0 B;  5F05 A;  5AIV A;  1TRS A;  5HR3 A;  1ZMA A;  4J57 E;  1Y6E A;  2WCI A;  3GIX A;  4IHU A;  5IQY A;  4ECC A;  4DSS A;  1GSS A;  2QA1 A;  1LJR A;  2JU5 A;  3A2V A;  2H71 A;  1FOV A;  1YQ1 A;  4EIP A;  4WET A;  1J9B A;  4WBR D;  3LQ7 A;  3EIN A;  3M3M A;  4L8E A;  2RUE A;  4JZQ A;  3GYK A;  1AUC A;  1T00 A;  5J4U A;  2B7J A;  2LJR A;  4LMW A;  5H5S A;  4XS4 A;  3LEF A;  4NAX A;  2LS5 A;  2F3M A;  2B7K A;  2F8A A;  2H19 A;  2H30 A;  1K0D A;  1SK1 A;  3UMA A;  1EOG A;  1ZYP A;  1GNE A;  1N8J A;  3M9K A;  1A2L A;  2ZUP A;  5HR1 A;  2M46 A;  4NXI A;  4Q5N A;  1T8E B;  2GT6 A;  1U3I A;  4ZL8 A;  1MDI A;  3TKS C;  3H1N A;  5KEJ A;  2OE3 A;  4MF7 A;  4GSS A;  1FO5 A;  2GT5 A;  5CYY A;  2ES7 A;  4ZB9 A;  2ZCT A;  3KGK A;  3HJM A;  3RHB A;  2R6K A;  4D73 A;  1V58 A;  4XRD A;  1WRY A;  3NOF A;  1FB6 A;  4TVE A;  4NPB A;  2FCH A;  4XS1 A;  14GS A;  3DRN A;  3ED3 A;  3NIV A;  3VWV A;  1EZK A;  1XOB A;  1OC9 A;  3CRT A;  1NM3 A;  3TRP A;  2GQK A;  2YJH A;  1O73 A;  4GTU A;  4KX4 A;  3O76 A;  1YDK A;  3S9F A;  3IOS A;  1Z6M A;  2JSZ A;  4I2U A;  1OAZ A;  2CVD A;  1K0A A;  2V1M A;  3P8W A;  12GS A;  4KA0 A;  4MLY A;  1OE7 A;  3KIJ A;  4QL9 A;  2FUG 2;  4FYC A;  2LKU A;  1A0F A;  2VM1 A;  3LSZ A;  1M2A A;  1AIU A;  1M3I A;  1XZO A;  16GS A;  2GDR A;  5H5R A;  2VL2 A;  4X0X A;  2A4H A;  4NWY A;  3HCZ A;  2XPD A;  4MNN A;  2IFQ A;  5DJM A;  1VGL A;  1B9X C;  4ECI A;  3GRX A;  4MF6 A;  1TDI A;  3TKP A;  2BTO T;  3MDK A;  4G0I A;  1HD2 A;  3D4M A;  1HNA A;  3G7Y A;  5ECL B;  3ZVJ A;  4XS6 A;  4HS1 A;  2CVB A;  1BG5 A;  1PL2 A;  2H1A A;  1SJ6 A;  2V32 A;  2DJ2 A;  4A5P A;  2CX4 A;  4TRX A;  3LYP A;  5IO0 A;  4ZXG A;  1OKD A;  2OJL A;  3KJY A;  4KF9 A;  1B48 A;  2X49 A;  3KEB A;  4ZB6 A;  2MZC A;  2OE0 A;  4KGI A;  4MA9 A;  17GS A;  3LXT A;  1PQN A;  5AIX A;  3GMF A;  3VWX A;  1AW9 A;  1TK5 B;  2FWE A;  5LNK e;  4X1U A;  1JZR A;  4BVX A;  2DBC A;  3VK9 A;  2IJY A;  2C0F A;  2C8U A;  2J23 A;  1SL0 B;  5FHI A;  1FOH A; 
#chains in the Genus database with same CATH homology
 3WT2 A;  5A5K A;  1N2A A;  1IYI A;  2MMA A;  3QD9 A;  2CA8 A;  1YF0 A;  4JR4 A;  2LNT A;  1UC7 A;  2E2M A;  3TKR A;  1GSY A;  1HNC A;  2JZR A;  4IQA A;  4YQM A;  3QCP A;  4Q5Q A;  2AAW A;  1X5C A;  3QAV A;  5IMZ A;  3HKR A;  3VPT A;  2LV3 A;  4BVY B;  3CTG A;  4GXZ A;  2GQL A;  2RUF A;  2QC7 A;  4QQ7 A;  4GST A;  4JBB A;  4MMM A;  2B5Y A;  5ECO B;  1WWJ A;  3ZL5 A;  1X5D A;  5DQY A;  5F0G A;  3TJK A;  1M2B A;  4HJ2 A;  2JSY A;  2H6Y A;  4Q5F A;  4POM A;  1XWC A;  1UA5 A;  3IHQ A;  1MD4 A;  2HRN A;  3ZRD A;  3EPT A;  3SWL A;  4N0V A;  1GTU A;  3O6T A;  2K8S A;  2FY6 A;  4LL1 B;  4J2F A;  3FYG A;  3RBT A;  2HLS A;  3KMO A;  3L0H A;  5DCH A;  4DSR A;  4MH2 A;  3TOU A;  3BBY A;  4HOJ A;  2UZ8 A;  4TXV A;  3WD6 A;  3HHV A;  2R0P A;  3UJ1 A;  2O8V B;  3VPQ A;  2HZF A;  4KAE A;  1XWB A;  2X4A A;  3FR9 A;  2YOI A;  5BRT A;  3JCM L;  1TU7 A;  3HXS A;  3GX8 A;  2RM5 A;  4ML1 A;  3FK8 A;  4LMV A;  4HEA 2;  1G0T A;  4XHM A;  5F06 A;  4ECB A;  3MYD A;  5D93 A;  3DIE A;  1B4Q A;  3GN3 A;  5ECN B;  1EWX A;  3D0Z A;  2O7K A;  4ID0 A;  4MCU A;  4MK3 A;  4MZW A;  1BJX A;  3F9U A;  4K5R A;  3GL5 A;  2H74 A;  3G7I A;  3G9B A;  2C3Q A;  2B1K A;  2PWJ A;  4PNF A;  3PR8 A;  4RI6 A;  3ZMK A;  2GZP A;  4HUA A;  5KOX A;  2YV7 A;  1ERT A;  3BD2 A;  4NV5 A;  6GSS A;  3KCM A;  1SJZ A;  5JCG A;  2NBS A;  11GS A;  2CAI A;  4E8H A;  5EY6 A;  1YY7 A;  3WGE A;  2CZ3 A;  1M9A A;  3ZRE A;  2EC4 A;  4MJC A;  5ECM B;  1O8W A;  1OC9 B;  1M2D A;  1THX A;  2GVP A;  4HZ2 A;  2VL2 C;  1F2E A;  4JED A;  1DBY A;  1THO A;  6GSW A;  5INY A;  4CY8 A;  2FLS A;  3D5J A;  3GNJ A;  3RDW A;  1V2A A;  1EV4 A;  4KH7 A;  1ZL9 A;  2H6X A;  4YKF A;  3SBC A;  3GKK A;  2X8C A;  4KSO A;  1O85 A;  1ILO A;  4NHW A;  1ERV A;  4JRR A;  1NHO A;  1GSQ A;  3L78 A;  2FWG A;  4K0N A;  4XRA A;  4NHZ A;  2I9H A;  3KTB A;  3U5R E;  4AF2 A;  2H72 A;  2PVO C;  3L9U A;  3WYW A;  4ZBA A;  1O7U A;  2IL3 A;  1H4O A;  4X43 A;  4JE1 A;  5HQP A;  1K0M A;  2IN3 A;  4OFM A;  2DC5 A;  1V40 A;  5CRH A;  4O5U A;  5DCG A;  4PGT A;  2L5O A;  3GSS A;  5G2Z A;  4F0B A;  2JAC A;  3CSH A;  4RUV A;  1NSW A;  5CRW A;  6GSU A;  2IMI A;  1ZYQ B;  1GSE A;  5BMU A;  2IPA A;  1YEP A;  5KN1 A;  1WE0 A;  2FA8 A;  4IEL A;  4GQF A;  2G0F A;  3UVT A;  5B6M A;  2R5G A;  5COH A;  3GH9 A;  1A2M A;  1EP7 A;  1AC1 A;  2I3Y A;  5ECK B;  1PX7 A;  2IMD A;  2H66 A;  4P3Y B;  3EU3 A;  4K9Z A;  3Q18 A;  1BX9 A;  5D9X A;  3E3E A;  2H73 A;  4BVY A;  2O87 A;  5D8I A;  4PX1 A;  3TOT A;  1OC8 A;  2OE1 A;  1U87 A;  1LU4 A;  2H0G A;  2YAN A;  1WP0 A;  3GX0 A;  3W8J A;  1QUW A;  2IMK A;  2WZ9 A;  4ML6 A;  3A5W A;  4HU7 A;  4L5O A;  4GF0 A;  4ECJ A;  1O8X A;  1QXH A;  1ACV A;  5EPF A;  3TCO A;  4IQ1 A;  1K3Y A;  2X64 A;  5J41 A;  2M80 A;  5LD0 A;  2FWH A;  2OAC A;  4F03 A;  5B8A A;  4AJ6 A;  5KN2 A;  1Q4J A;  3KXO A;  3C8E A;  4X4J A;  2HRF A;  5FT3 A;  1EOH A;  1PN9 A;  5IO2 A;  3WGX A;  3H93 A;  4K7O A;  3ZIV A;  3F63 A;  3CTF A;  1GLQ A;  2NDO A;  3TKS E;  4MPG A;  2HXK A;  1H75 A;  1PX6 A;  1K3O A;  3FY7 A;  2CT6 A;  3HYP A;  1K0O A;  1TOF A;  4YQU A;  1X9W B;  4O7H A;  5H5Q A;  5IMD A;  1CQH A;  1XPV A;  1XW6 A;  4FYB A;  1TJD A;  4EDZ A;  4YH2 A;  5DAL B;  2YJ7 A;  4HJM A;  2DKI A;  3IAM 2;  3F4S A;  2HT9 A;  2F51 A;  2G2Q A;  3IA1 A;  2GST A;  5FWG A;  2EIO A;  3GTU B;  2PGT A;  3V1W A;  3ME7 A;  2LRN A;  3TKQ A;  5A4W A;  1EGO A;  5DDL A;  2BMX A;  3HD5 A;  4CDO A;  7GSS A;  3QAW A;  3EWL A;  1TI3 A;  1A8L A;  3IDV A;  5KN3 A;  1FAA A;  5KOW A;  3TJJ A;  3MNG A;  2R37 A;  3LGC A;  1AQV A;  2KOK A;  2P31 A;  1GUM A;  2OKA A;  2QSI A;  4V1A g;  2PVQ A;  1JZO A;  1K0C A;  2GZZ A;  1Z6N A;  3UEM A;  1Y25 A;  1BQ7 A;  2YWO A;  3ZVJ D;  2YWM A;  4YQV A;  4V2M A;  1GSF A;  2GQM A;  4Z2R A;  2PU9 C;  4IBP A;  3IK9 A;  5CO3 A;  4BL7 B;  2YPM A;  5DAK B;  6GSX A;  3UIW A;  1PL1 A;  3I69 A;  1NW2 A;  5IOW A;  4TW5 A;  4Z2T A;  3GH6 A;  3VUR A;  1I5G A;  5D9V A;  4CHS A;  2L6D A;  2PBJ A;  2QGV A;  4ZBD A;  3P90 A;  1GTB A;  3ME8 A;  2BJX A;  1LBK A;  5B7C A;  4BPY A;  4USS A;  1F9M A;  2DKH A;  5CRE A;  1M0U A;  5DVB A;  4ICY A;  1SL1 B;  3HZ8 A;  1E2Y A;  4MZB A;  4MDC A;  2CAQ A;  2FGX A;  1FVJ A;  1ML6 A;  2HE3 A;  8GSS A;  1UN2 A;  4XIH A;  2V6K A;  4FH8 A;  4EE0 A;  1B4P A;  1KTE A;  2RM6 A;  2VUP A;  2LNS A;  3LW9 A;  2PMT A;  1GTA A;  2VCV A;  2GLR A;  4OD7 A;  3ERW A;  1AXD A;  4ZBB A;  6GSV A;  22GS A;  3I43 A;  2DJJ A;  3LOR A;  1ZOF A;  1DSB A;  2GZY A;  2MMO A;  1SD8 A;  4RI7 A;  1JLV A;  3QPM A;  4K0G A;  3FEU A;  1JHB A;  5CAX A;  1YF1 A;  2LJA A;  3ZYW A;  1KNG A;  1AQW A;  3EU4 A;  4GWR A;  2HSY A;  4N30 A;  3VWU A;  4TR3 A;  3CMI A;  6GST A;  1B9Y C;  3U6V A;  2ON7 A;  1T4Y A;  5L71 A;  1PKW A;  1CQG A;  4AGS A;  3W6G A;  3DXB A;  13GS A;  2YZH A;  2J9H A;  3ZFL A;  1ST9 A;  2H0H A;  5HR2 A;  4YAV A;  1SD9 A;  2HI7 A;  4ILF A;  4O32 A;  3UBK A;  5DJL A;  3QAG A;  2MBS A;  3IV4 A;  3VI7 A;  4TKY A;  2LRT A;  3CSI A;  2FHE A;  4EO3 A;  1KBN A;  4KUN A;  4MH3 A;  1YKA A;  2EIQ A;  1S3A A;  5D73 A;  2VCX A;  3DVX A;  1K3L A;  3DD3 A;  4EUY A;  1F6M C;  2N5F A;  3APQ A;  5GZZ B;  2I81 A;  3FKF A;  2A4V A;  2AHE A;  3FMW A;  2B5X A;  2DIY A;  1SL2 B;  2VLV A;  3GKM A;  5HFG A;  3PPU A;  3UBL A;  3PH9 A;  1B8X A;  2K6V A;  2ON5 A;  3F4T A;  1URM A;  1GUH A;  2K9F A;  4ISD A;  2CQ9 A;  3DEX A;  1U3A A;  19GS A;  3UAP A;  4V2N A;  2B1L A;  5IMA A;  1ZYN A;  4MAB A;  3A3T A;  3Q74 A;  2L6C A;  5DAL A;  1GSD A;  1MDK A;  4WKW A;  2K8V A;  4IJI A;  2WDU A;  5B8B A;  2H6Z A;  1EEJ A;  2QKE A;  2LQO A;  2IIY A;  3GTU A;  2LUS A;  1TI1 A;  1EGR A;  18GS A;  3Q19 A;  2AJQ B;  4NV2 A;  5A4U A;  2GS3 A;  5ELA A;  1GNW A;  3MSZ A;  4O5R A;  3RHC A;  1S3C A;  2FA4 A;  4AJ7 A;  1ZZY A;  3VWW A;  2LJK A;  2GSR A;  4PNG A;  1M99 A;  1UVZ A;  2DJ1 A;  5G1L A;  1PGT A;  2AB6 A;  3DYR A;  1V57 A;  4TOP A;  1OVN A;  2GGT A;  2KUC A;  1FVK A;  5JWQ B;  2WFC A;  2DML A;  1WMJ A;  3CYN A;  3KH9 A;  1Z7R A;  3KH7 A;  2X8H A;  4Z2U A;  3R3E A;  3IAS 2;  3GKX A;  5C00 A;  3GKN A;  5A4V A;  3K8N A;  4TN8 A;  4OMV A;  2MMN A;  1DE1 A;  4I2T A;  5IMF A;  3DGQ A;  4V1A p;  2AV4 A;  2OAD A;  4BL7 A;  4H86 A;  5DAK A;  2VCZ A;  3D4T A;  1YEX A;  4I8B A;  2AYT A;  5EVO A;  3TJF A;  2GTU A;  1MDJ A;  3EC3 A;  5B6N A;  4EDY A;  1U88 A;  3UVH A;  1XCC A;  2L57 A;  4FYU A;  3D21 A;  2C3T A;  2WGR A;  1Z3E A;  4HU9 A;  4WR5 A;  2YN1 A;  4WF4 A;  5ECI B;  5G5F A;  2IME A;  1YKC A;  1EEM A;  4IP6 A;  2R0C A;  4OFN A;  3RAZ A;  4PXO A;  5D9W A;  1ZGN A;  3KTL A;  2CV4 A;  1TXX A;  2HZE B;  2TIR A;  1PMT A;  5IMV A;  1MTC A;  5IIZ A;  4K5S A;  1XWK A;  4HQZ A;  2JL4 A;  4DSQ A;  5G31 A;  4FO5 A;  3PGT A;  4L5L A;  3QFB C;  4RQX A;  2K18 A;  4PUR A;  2E7P A;  4PQH A;  4DVC A;  5IM9 A;  3VLN A;  4L0W A;  3H8Q A;  3C73 A;  1GWC A;  1RK4 A;  1W4V A;  4EVM A;  1BAY A;  2R4V A;  1OE8 A;  3TGZ A;  4F0C A;  5GAP D;  4Q5R A;  1MD3 A;  3N9J A;  1SJI A;  5LCZ A;  4IW9 A;  1GTI A;  1A24 A;  2KHP A;  5ECQ B;  4GSN A;  1QGV A;  4K8M A;  5IPG A;  1K0N A;  3EVI A;  4WR4 A;  3L9V A;  1XBS A;  2JAD A;  3FRC A;  2LTK A;  2JZS A;  4BWQ A;  3ISO A;  1K0B A;  1TRV A;  4POL A;  2HRA A;  4G19 A;  3HVX A;  4PQ1 A;  5ECR B;  2YWI A;  3DML A;  3M1G A;  1I9D A;  2KP2 A;  3IE3 A;  1TRW A;  5J9B A;  4PUF C;  3KD0 A;  5AIS A;  3ZIT A;  5GAN D;  2HFD A;  3IR4 A;  3QDN A;  3QMX A;  4K7I A;  2WS2 A;  5JCW A;  2LEG A;  1F37 A;  3TJB A;  3ZLP A;  4J56 E;  3C1S A;  1OKT A;  4IS0 A;  4ZL9 A;  2RLI A;  1YJ6 A;  5E4W A;  3MIX A;  2L4C A;  4GQC A;  2NTO A;  1G7E A;  4ZIJ A;  3O3T A;  1V9W A;  2LQQ A;  4IP1 A;  4O5Q A;  4ZB8 A;  4TXO B;  2GSQ A;  4IKH A;  2KLX A;  2H70 A;  2VAF A;  1MEK A;  2RII A;  4XTS A;  1R26 A;  1GP1 A;  4O92 A;  4OCE A;  5ELG A;  2OA7 A;  4KB3 A;  2XPE A;  5ABR A;  1Z5Y E;  5ECH B;  1F3B A;  5ID2 B;  4N0Z A;  5G30 A;  4WEY A;  2H75 A;  2AUV A;  2V41 A;  2MBT A;  2C0D A;  3ZZX A;  3MWH A;  1VF3 A;  2VCT A;  2YWN A;  2VD1 A;  3H79 A;  1X9M B;  3EMX A;  4I6X A;  3KZQ A;  2E0Q A;  5J3R A;  3IRA A;  1QK8 A;  3J7Y b;  2O85 A;  2DLX A;  1OYJ A;  1M7T A;  3LYK A;  1S3D A;  3Q6O A;  4Z7X A;  1FW1 A;  4QL7 A;  2L4Q A;  5ECP B;  4EXJ A;  1JZD A;  3QFA C;  4N10 A;  2H0I A;  2PN8 A;  3VI5 A;  1A23 A;  5JWR B;  4IGJ A;  1RQM A;  1DUG A;  2DSA A;  4PUA A;  4ACS A;  1V98 A;  3D22 A;  1XFL A;  5G5E A;  2XC2 A;  2VIM A;  4JU5 A;  3D6I A;  1VF4 A;  1GLP A;  1IYH A;  3HDC A;  3L9S A;  2R0G A;  1ZCP A;  4K2X A;  4KCA A;  3FZ4 A;  4KDU A;  2TRC P;  2R3X A;  2B6M A;  2R2J A;  1GUK A;  3RPN A;  3F8U A;  3IK7 A;  1R5P A;  4LA1 A;  4POK A;  4EL1 A;  1XW9 A;  2HNL A;  1OC3 A;  3A5I A;  1VF2 A;  2A2P A;  1VRS D;  4FQU A;  2HZE A;  2XHF A;  3DWV A;  2DJ0 A;  3TB2 A;  2M72 A;  4TR0 A;  3I6A A;  4HZ4 A;  2PUK C;  4XCS A;  3ZTL A;  3MAK A;  3WGD A;  3LXZ A;  3FR3 A;  2LRC A;  4TR4 A;  4AJ8 A;  2DJK A;  2P0G A;  2VO4 A;  2I1U A;  3TRQ A;  4YAP A;  3IPZ A;  2ALB A;  2H1D A;  4MZC A;  5GSS A;  1USB A;  3IXR A;  2WRT A;  3AY8 A;  5C04 A;  3GA4 A;  3F4R A;  5CRD A;  3TRX A;  1XWA A;  1X5E A;  4CW9 A;  1SU9 A;  1FHE A;  4PTS A;  5CNW A;  4MPF A;  2EIR A;  2MYG A;  1WPI A;  2C4J A;  1EV9 A;  3A2X A;  1M9B A;  2PPT A;  2A2S A;  4G0K A;  3GUS A;  4MF5 A;  3HY2 A;  2YZU A;  3QOU A;  1TP9 A;  1Z9H A;  4K6X A;  3HVV A;  4PQI A;  2I4A A;  3NZN A;  4TR1 B;  1SKW B;  5GST A;  1GSU A;  2REM A;  4KSM A;  2VCQ A;  1SEN A;  3ZML A;  1PKZ A;  3EE2 A;  2VM2 A;  3TDG A;  4F82 A;  1SK2 A;  1NHY A;  3TUE A;  4OO4 A;  4OWY A;  1Z7P A;  2NPB A;  2FWF A;  4YKG A;  1ABA A;  1XOA A;  1R7H A;  2P5Q A;  2CVK A;  2KP1 A;  3IBH A;  3DVW A;  2Z9S A;  3LG6 A;  4V2L A;  1SKS B;  1R4W A;  1ERU A;  3QR6 A;  3ZIJ A;  4EF0 A;  4KDX A;  4G9H A;  3N5O A;  1X0R A;  3F6D A;  4TXO A;  4LL4 B;  4BA7 A;  2GSS A;  2HSH A;  4EKZ A;  4DEJ A;  1T7P B;  4RQR A;  1XVQ A;  2XBQ A;  3TJG A;  2B5E A;  2H1B A;  3F0I A;  5AN1 A;  3HA9 A;  2PER A;  2VL3 A;  3FZ9 A;  1WOU A;  4HDE A;  3GST A;  1QQ2 A;  2DIZ A;  5CRG A;  3E9J B;  1SYR A;  3GUR A;  5ID2 A;  1HNB A;  3FW2 A;  2F9S A;  2XBI A;  3A2W A;  2VD0 A;  3UAR A;  3H4K A;  4IVF A;  2FNO A;  3C1R A;  5J9C A;  2VCW A;  3GL3 A;  4HQS A;  4N11 A;  1T1V A;  4K7N A;  1AAZ A;  2WUL A;  5JWO B;  2X8G A;  2HYX A;  1GL8 A;  1ERW A;  3FR6 A;  1XVW A;  3IHG A;  20GS A;  2VL9 A;  5ENU A;  4MJB A;  2V2G A;  2C3N A;  1Q98 A;  2H01 A;  5CP1 A;  1GUL A;  4BWS A;  1XWG A;  3L4N A;  1VF1 A;  3CRU A;  2A2R A;  1GRX A;  2YCD A;  2CX3 A;  1XW5 A;  3ZFB A;  2WJU A;  4GLT A;  1AQX A;  1PRX A;  4OCF A;  4KCE A;  2H76 A;  3P2A A;  6GSY A;  1TK8 B;  4I97 A;  5EL8 A;  1BYE A;  1JLW A;  4KW6 A;  4F2I A;  4L0U A;  2QA2 A;  3F3R A;  3KMN A;  4K2D A;  1ON4 A;  2FD3 A;  4IN0 A;  1J08 A;  3M9J A;  3KP9 A;  3APS A;  3DKS A;  1FG4 A;  1O81 A;  2YV9 A;  5IOX A;  2X99 A;  2DMM A;  4KND A;  3E0U A;  3W8S A;  1C72 A;  3CXG A;  1PA3 A;  3BJ5 A;  1XIY A;  4EC0 A;  3J7Y k;  4DSS B;  10GS A;  4OO5 A;  3IC8 A;  3ERG A;  4G0L A;  4MJE A;  3APO A;  2NVL A;  2VLT A;  3C71 A;  3GFK A;  1BED A;  1TRU A;  1W89 A;  3G7J A;  2HRK A;  1HYU A;  1YZX A;  4XS4 B;  4ULX A;  3M0F A;  2IMF A;  5HFI A;  2N5A A;  3EMP A;  3BOA A;  5HFK A;  5F8B A;  3KP8 A;  5D9T A;  4K1F A;  5DBQ A;  3R2Q A;  3ERF A;  3EYT A;  1R5A A;  4E8E A;  4NMU A;  4LLR A;  5D96 A;  5ECS A;  2L5L A;  1A8Y A;  3P7X A;  3TKS A;  1E6B A;  3M8N A;  3HJP A;  3PIN A;  1PN0 A;  1A2J A;  3LWA A;  2YNX A;  4D73 B;  1EP8 A;  1G7O A;  1SYX A;  2C0E A;  1GH2 A;  2JZT A;  2C1Y A;  3IC4 A;  5G1K A;  4TR1 A;  3RPP A;  4ZL7 A;  4FIW A;  3WT1 A;  1A0R P;  5J5N A;  1T3B A;  2V6O A;  2LST A;  3CBU A;  2H1G A;  3LFL A;  3UL3 A;  2WB9 A;  4WF5 A;  3BCK A;  1G6Y A;  3FZA A;  4GCI A;  1RW1 A;  1JZW A;  2N5B A;  1KEB A;  1FB0 A;  2OBK A;  1QFN A;  1TU8 A;  1TKD B;  1X9S B;  1T4Z A;  1J0F A;  3VFI A;  4G10 A;  3EUR A;  3LJR A;  1G6W A;  5HR0 A;  2ZNM A;  3UOM A;  1XXU A;  5IPH A;  1TTZ A;  1PSQ A;  3FZ5 A;  2D2Z A;  4HI7 A;  3HZ4 A;  2OBI A;  2IFQ B;  1O6J A;  2H8L A;  2F8F A;  2MMZ A;  2C0G A;  4G2E A;  2E2G A;  1WIK A;  2CZ2 A;  1PD2 1;  1F3A A;  2VOC A;  5F07 A;  5JCU A;  3GHA A;  3US3 A;  5E59 A;  4MJA A;  3CSJ A;  1DE2 A;  4EIQ A;  1HQO A;  2TRX A;  3I9V 2;  3HVS A;  4WBJ A;  3F3Q A;  3FHK A;  4I5Q A;  2C80 A;  4OFT A;  9GSS A;  2YP6 A;  2DJ3 A;  4ZIL A;  3F6F A;  3BCI A;  1ZYE A;  5DQS A;  1QMV A;  4POB A;  5KN0 A;  4WXT A;  4GRF A;  3HJO A;  2O89 A;  2IWT A;  3KM6 A;  4CY6 A;  4JR6 A;  1WJK A;  4F9Z A;  4IJ3 A;  4BVX B;  2HSM A;  3OR5 A;  2VLU A;  3C7M A;  4MP4 A;  2P5R A;  1JFU A;  1SKR B;  1TW9 A;  2L59 A;  2B3S A;  3GV1 A;  5AGY A;  4KE3 A;  1U6T A;  1SK0 A;  4KDY A;  5IMC A;  1TK0 B;  5F05 A;  5AIV A;  1TRS A;  5HR3 A;  1ZMA A;  4J57 E;  1Y6E A;  2WCI A;  3GIX A;  4IHU A;  5IQY A;  4ECC A;  4DSS A;  1GSS A;  2QA1 A;  1LJR A;  2JU5 A;  3A2V A;  2H71 A;  1FOV A;  1YQ1 A;  4EIP A;  4WET A;  1J9B A;  4WBR D;  3LQ7 A;  3EIN A;  3M3M A;  4L8E A;  2RUE A;  4JZQ A;  3GYK A;  1AUC A;  1T00 A;  5J4U A;  2B7J A;  2LJR A;  4LMW A;  5H5S A;  4XS4 A;  3LEF A;  4NAX A;  2LS5 A;  2F3M A;  2B7K A;  2F8A A;  2H19 A;  2H30 A;  1K0D A;  1SK1 A;  3UMA A;  1EOG A;  1ZYP A;  1GNE A;  1N8J A;  3M9K A;  1A2L A;  2ZUP A;  5HR1 A;  2M46 A;  4NXI A;  4Q5N A;  1T8E B;  2GT6 A;  1U3I A;  4ZL8 A;  1MDI A;  3TKS C;  3H1N A;  5KEJ A;  2OE3 A;  4MF7 A;  4GSS A;  1FO5 A;  2GT5 A;  5CYY A;  2ES7 A;  4ZB9 A;  2ZCT A;  3KGK A;  3HJM A;  3RHB A;  2R6K A;  4D73 A;  1V58 A;  4XRD A;  1WRY A;  3NOF A;  1FB6 A;  4TVE A;  4NPB A;  2FCH A;  4XS1 A;  14GS A;  3DRN A;  3ED3 A;  3NIV A;  3VWV A;  1EZK A;  1XOB A;  1OC9 A;  3CRT A;  1NM3 A;  3TRP A;  2GQK A;  2YJH A;  1O73 A;  4GTU A;  4KX4 A;  3O76 A;  1YDK A;  3S9F A;  3IOS A;  1Z6M A;  2JSZ A;  4I2U A;  1OAZ A;  2CVD A;  1K0A A;  2V1M A;  3P8W A;  12GS A;  4KA0 A;  4MLY A;  1OE7 A;  3KIJ A;  4QL9 A;  2FUG 2;  4FYC A;  2LKU A;  1A0F A;  3LSZ A;  2VM1 A;  1M2A A;  1AIU A;  1XZO A;  16GS A;  2GDR A;  5H5R A;  2VL2 A;  4X0X A;  2A4H A;  4NWY A;  3HCZ A;  2XPD A;  4MNN A;  2IFQ A;  5DJM A;  1VGL A;  1B9X C;  4ECI A;  3GRX A;  4MF6 A;  1TDI A;  3TKP A;  2BTO T;  3MDK A;  4G0I A;  1HD2 A;  3D4M A;  1HNA A;  3G7Y A;  5ECL B;  3ZVJ A;  4XS6 A;  4HS1 A;  2CVB A;  1BG5 A;  1PL2 A;  2H1A A;  1SJ6 A;  2V32 A;  2DJ2 A;  4A5P A;  2CX4 A;  4TRX A;  3LYP A;  5IO0 A;  4ZXG A;  1OKD A;  2OJL A;  3KJY A;  4KF9 A;  1B48 A;  2X49 A;  3KEB A;  4ZB6 A;  2MZC A;  2OE0 A;  4KGI A;  4MA9 A;  17GS A;  3LXT A;  1PQN A;  5AIX A;  3GMF A;  3VWX A;  1AW9 A;  1TK5 B;  2FWE A;  5LNK e;  4X1U A;  1JZR A;  4BVX A;  2DBC A;  3VK9 A;  2IJY A;  2C0F A;  2C8U A;  2J23 A;  1SL0 B;  5FHI A;  1FOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...