2LJKA

Solution structure of the oncogenic-potential mien1 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
117
structure length
117
Chain Sequence
GSMSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein C17orf37
publication title Solution structure of the oncogenic-potential MIEN1 protein reveals a thioredoxin-like fold with redox potential
rcsb
source organism Homo sapiens
total genus 10
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ljkA01
1JZOA 3E0UA 2R2JA 1A2JA 4O32A 3UL3A 1FAAA 3ZL5A 4K7OA 2H30A 5JWOB 3L9SA 1SL1B 1KTEA 1ST9A 1RK4A 1XOBA 3LJRA 4EL1A 4JZQA 3FY7A 2OA7A 4V2NA 3HA9A 1X9MB 5ECRB 3F0IA 1DUGA 1PX6A 2AUVA 1GTAA 1ON4A 2KP1A 3MDKA 5D9VA 1PL1A 1EGOA 4ECIA 5D9TA 1SJIA 4JRRA 4Z7XA 3C73A 3VLNA 4BVYA 3QD9A 3GFKA 4EUYA 2ON5A 5GSSA 1O81A 4BA7A 1EOGA 3TJFA 4EKZA 4IBPA 3ZLPA 3CRUA 3D21A 4FIWA 1K0OA 4IGJA 2JSZA 3G7JA 4TR3A 2GZZA 1URMA 2WDUA 2LTKA 4F0CA 2PN8A 2BMXA 4POBA 5H5QA 3FZ9A 4WEYA 2ZNMA 3GTUB 3LFLA 2HZFA 2V32A 4ZB8A 4K0GA 2JL4A 2ES7A 3KTBA 1O85A 3DEXA 1A8YA 2K6VA 4KW6A 2YCDA 1YEXA 3FR9A 4N10A 3TUEA 4MH2A 2LRTA 4I8BA 5J41A 5CREA 2OACA 5KN2A 4OD7A 5INYA 1XXUA 4L0WA 3ZREA 3CSIA 1XFLA 3MAKA 1BG5A 3L0HA 3GTUA 2XC2A 5IMZA 2TRXA 3KMNA 4YQUA 4X43A 4HEA2 4KDXA 4TR1B 4D73B 1A24A 4IJIA 2IFQB 2PWJA 4K7NA 4AGSA 1AQXA 3HJPA 2MMAA 2YN1A 3KMOA 1PX7A 4F82A 2I9HA 5DCHA 3OR5A 4ZBAA 4MZBA 3I43A 4IKHA 5D9XA 1JZRA 5ECLB 3FEUA 4LLRA 4TR1A 5COHA 1J08A 1T4YA 1PN9A 5HR2A 3FHKA 4D73A 3C7MA 1S3AA 2OE1A 3PH9A 5G2ZA 3EWLA 1PSQA 2BJXA 2CX3A 3EMXA 4MP4A 5F07A 1GNEA 1KNGA 2H6YA 5LCZA 3EVIA 4PQIA 1J0FA 2AAWA 3W6GA 3F8UA 4K6XA 4PUAA 1ERTA 4AF2A 3GMFA 4MJCA 2VD1A 1MTCA 2DIYA 2IMIA 2VM1A 1GSYA 1UC7A 1Z6MA 12GSA 3FZ4A 3DRNA 1TK5B 3I69A 4DEJA 2NTOA 1V98A 1SK2A 1Y25A 2V6KA 3KH9A 1IYIA 4MZWA 3IAM2 1EV9A 1U3IA 2OE0A 2RLIA 4K1FA 4J57E 1JZWA 2QSIA 5IPGA 4AJ7A 2VOCA 3ZZXA 1AUCA 4ILFA 4PNGA 2R3XA 2VCWA 3BCKA 1SYXA 3TJBA 1SJZA 6GSSA 4MF5A 5H5SA 3GSSA 2NVLA 2YOIA 2WCIA 4PQHA 3CTFA 2H1DA 2H71A 2LUSA 2GT5A 3QAGA 1A23A 3F4SA 5DDLA 2VL9A 1F2EA 4HZ4A 1EOHA 4J2FA 14GSA 1ZGNA 2M80A 3LQ7A 2XPDA 2GSSA 1AXDA 3F4TA 3N5OA 4HQSA 2L6CA 2JZSA 4POMA 4CHSA 4RUVA 1V57A 2YJ7A 5IO0A 5A4WA 3J7Yk 3QOUA 3SWLA 4XCSA 2JZRA 2HXKA 4DSSA 1FG4A 1TRSA 2CZ2A 3QAVA 5DBQA 3HKRA 2LS5A 4WR5A 4KX4A 3G9BA 1EV4A 2RUFA 1N8JA 1OC8A 2B7KA 4HS1A 1DBYA 2LQOA 1ABAA 3G7IA 3IK7A 1GSFA 3ZMKA 3IBHA 1I9DA 1ZOFA 4OCFA 1EEJA 4JU5A 1A0FA 4KE3A 3APOA 2GGTA 2H75A 7GSSA 2GSQA 1SKWB 1O73A 2VLTA 2HE3A 3VFIA 1GRXA 4F03A 1VRSD 3IAS2 2LJRA 3KH7A 2YV7A 5DQSA 3GL3A 1M7TA 5ID2A 2VM2A 1JLWA 3DVXA 1FOVA 2CQ9A 3TDGA 2GSRA 5DAKA 3ZFLA 5IMDA 1AW9A 2I3YA 2C0GA 2F8FA 4TOPA 5C04A 2L59A 4FYBA 2N5BA 2L4CA 3VWUA 4ECBA 3ZYWA 4NV2A 2IPAA 1R5PA 1PGTA 3VI5A 2HRFA 4X1UA 2VUPA 3WGDA 2B5EA 5IMVA 2F9SA 2H76A 4LL1B 2C3NA 4V1Ag 2CVBA 1Y6EA 2LKUA 4GTUA 1J9BA 1GLPA 1F3BA 4H86A 3GKMA 4ISDA 3F9UA 1JZDA 3EU4A 1I5GA 1PKZA 3F4RA 6GSXA 4XS4A 3DIEA 5GAND 1V58A 2HRNA 2FHEA 1NM3A 2C0EA 4K8MA 1U6TA 1TU8A 5KN0A 16GSA 2GQKA 2B3SA 3K8NA 1EP8A 3FR6A 3MWHA 2PUKC 2G0FA 4TXVA 3M9JA 2HT9A 3UIWA 1FHEA 4WETA 3IV4A 1HNCA 4MABA 5B8AA 2XBIA 3DKSA 1WE0A 4BPYA 3HZ4A 2KP2A 5A4VA 2VCVA 2A4VA 4HQZA 1FVKA 2H66A 2Z9SA 5DCGA 1YDKA 4TXOB 1Z6NA 4EC0A 4FYCA 3M0FA 4NHZA 3GN3A 3QCPA 1SL0B 3WT2A 5D8IA 4TR0A 4G9HA 4KB3A 1AQWA 2IN3A 1WJKA 2H1AA 4TRXA 4N11A 1U87A 1R26A 4TVEA 1Q4JA 1PQNA 3DXBA 4ZXGA 1ML6A 2X8GA 3MNGA 5IOXA 5DQYA 2ZUPA 2VCXA 1K0BA 1H4OA 3GA4A 1OC9B 4TXOA 5ABRA 2VL3A 1EGRA 1C72A 2FLSA 3IK9A 4BWSA 3RHCA 3LYKA 3DVWA 1OAZA 2VCTA 1MDKA 2X8CA 1R7HA 2VIMA 5JCGA 4TKYA 2PGTA 5GSTA 4OFMA 4P3YB 5B8BA 3TGZA 1OE8A 2VCZA 4FYUA 5JCUA 2CA8A 1G7OA 1OYJA 11GSA 2C0FA 5ECIB 3APSA 4MJBA 3L4NA 1OC9A 2LJAA 3GKNA 4RI7A 3MSZA 2XBQA 2E2GA 4POKA 4ZL9A 4MZCA 4HUAA 1TJDA 1VF2A 2L5OA 4L8EA 5G30A 1SKSB 3BD2A 3C1SA 2X8HA 3AY8A 3TCOA 4IQ1A 2H72A 2D2ZA 3P90A 1NW2A 2I4AA 5DJMA 1G6WA 3CTGA 3KEBA 1FVJA 3CSHA 1G7EA 2B1KA 3TB2A 3HJOA 4LMWA 5D96A 2HSHA 2I1UA 4PX1A 4JEDA 5IOWA 2E0QA 3F6DA 2XPEA 3I6AA 3H4KA 2K18A 5F06A 2WULA 3UVTA 1TU7A 1NHYA 3C8EA 2MMOA 3JCML 1XBSA 5J9CA 1K0DA 5B6MA 2JADA 2DIZA 2NDOA 4GSSA 3IC4A 1GH2A 3QPMA 1T7PB 2IMEA 2H6ZA 3LXZA 1G0TA 1B4QA 1GULA 1O8XA 2DJ1A 4GXZA 5JWQB 3O3TA 3KD0A 4ULXA 2YP6A 4IHUA 4MK3A 1EEMA 2P31A 3UVHA 2C0DA 1K3OA 1TI1A 2PVQA 5F8BA 3ZIVA 1GSUA 4IS0A 2XHFA 2AJQB 3GH9A 4ZBDA 1MD4A 3HDCA 1H75A 2JU5A 3KXOA 4AJ8A 5DALB 3LXTA 2EC4A 3TOTA 3UJ1A 1SK0A 1ZYEA 3PINA 4JBBA 2YWMA 2JZTA 4I5QA 2KHPA 1B4PA 4TW5A 2O7KA 2FA4A 1WIKA 5G1KA 4LL4B 4XS6A 3ZITA 5IQYA 1XWGA 4HU9A 4GRFA 4HJ2A 1O7UA 3DMLA 5IO2A 1F3AA 5IMFA 1GP1A 5DALA 4IN0A 3LGCA 2YANA 4EE0A 2JSYA 5H5RA 2OBKA 5HFIA 5HR1A 2HNLA 5KEJA 3EURA 1VF4A 17GSA 1A8LA 2DJKA 3FYGA 4I2UA 2H0HA 3P8WA 4WBRD 4Q5FA 4TR4A 1SENA 4RQXA 2AB6A 1Z7PA 1BYEA 1EP7A 1SYRA 4KSMA 2B1LA 3E3EA 5CRDA 4IP6A 2CVKA 1PD21 1BJXA 1X9WB 1KEBA 1XZOA 3ZIJA 3GX0A 2H0GA 3IDVA 5DVBA 4L5OA 1BAYA 4KH7A 3HZ8A 2E7PA 1A2LA 3UARA 3G7YA 2PBJA 2N5AA 4K2DA 5GAPD 2NPBA 4MPFA 3P2AA 2WFCA 2R37A 3U6VA 3F3RA 4K7IA 3L9VA 5CO3A 5IIZA 2H19A 3TKPA 1A0RP 4DSSB 4E8HA 4MMMA 1K0NA 3WT1A 2CAIA 3L9UA 1K0MA 1FB0A 3H8QA 3SBCA 2GT6A 1FW1A 1JFUA 1BQ7A 1YF0A 3GV1A 1TRVA 2DBCA 1X5CA 2FUG2 3CRTA 3H79A 1FB6A 3VPTA 2H0IA 1HD2A 4HZ2A 4XTSA 1YY7A 19GSA 2O87A 1AAZA 3LEFA 1O8WA 2OBIA 3QFAC 2CV4A 3RPPA 1TOFA 2DSAA 3V1WA 1WPIA 2L6DA 4JE1A 3ERWA 3QFBC 1X9SB 2IWTA 2WS2A 3KZQA 3Q18A 2C1YA 3IXRA 4IP1A 4NPBA 2J23A 5ID2B 2HSYA 1YEPA 4EVMA 1TK8B 3ZRDA 2FY6A 5J4UA 1SL2B 3EE2A 3M3MA 2YV9A 10GSA 4MF6A 4XS1A 2F8AA 5DAKB 4ECJA 1OVNA 5J9BA 2DMMA 3ED3A 4MJEA 1T4ZA 1M9BA 2LRCA 4OO5A 4WF5A 1R4WA 1VF1A 1USBA 1X5DA 4GSTA 1K0AA 1AQVA 1XWCA 1U88A 3FW2A 4CW9A 2B5YA 2CVDA 3HVXA 4HJMA 4IQAA 2C3QA 5FWGA 2LNTA 3KM6A 5A5KA 3KJYA 3TJJA 4V1Ap 4N30A 3CBUA 1XOAA 2P0GA 3C71A 4ZB9A 1S3DA 3J7Yb 2TRCP 1K3LA 2H8LA 5IPHA 1QK8A 4XS4B 2A2RA 2GDRA 5EVOA 4HDEA 3IOSA 2YZUA 1U3AA 2LNSA 2DLXA 4MJAA 3CMIA 5E59A 4I97A 4EXJA 3D5JA 2V41A 4FH8A 4L0UA 3EC3A 3GURA 3ME7A 2P5QA 4Q5NA 4WBJA 4ZBBA 2QGVA 2L57A 3WGEA 2JACA 3FK8A 3GKKA 1MDJA 5G5EA 13GSA 2HZEA 1N2AA 1GL8A 4ZL8A 3DD3A 2AYTA 3KTLA 2OJLA 1SKRB 1IYHA 2C8UA 1XPVA 3S9FA 2FWFA 1TTZA 4GQCA 4YQVA 2DJ2A 5HR0A 5IMAA 2YNXA 3HCZA 5ECMB 3R2QA 2FA8A 2ON7A 4I6XA 1HNBA 5ELGA 1ERWA 1SK1A 2O85A 4OMVA 3KIJA 5EL8A 1RW1A 3IR4A 2DC5A 3BBYA 5EPFA 2CAQA 3HXSA 3NIVA 1PA3A 2PERA 1WMJA 2QC7A 3LWAA 1GUHA 3TRPA 2H1BA 4HU7A 3ZMLA 3KGKA 4JR6A 1ZL9A 3TKRA 4ZIJA 3E9JB 5D93A 1M0UA 1SD8A 2OADA 1B9XC 4ECCA 1GLQA 1QMVA 4O7HA 1PKWA 3BCIA 3WYWA 2YWNA 3TKSA 2GS3A 2OE3A 3ME8A 3NZNA 2YWOA 4GWRA 2IJYA 2WRTA 1PRXA 5E4WA 1V40A 5AIXA 4IJ3A 2RM6A 4K0NA 1V2AA 2B5XA 4L5LA 3ERGA 1LU4A 2LSTA 1Z7RA 2N5FA 3DWVA 4YH2A 3US3A 1QFNA 2C3TA 1BX9A 1GWCA 3FR3A 2DJ0A 1M2BA 1OE7A 3VWVA 3IA1A 3UMAA 3UOMA 5ECHB 2K8VA 2IIYA 3UAPA 4V2MA 1T8EB 4MPGA 3D22A 3M8NA 4XHMA 1ILOA 1BEDA 1NSWA 3M1GA 4I2TA 1S3CA 3ZVJA 3O76A 4YAPA 3W8SA 3VURA 1YF1A 2BTOT 4WKWA 1AIUA 1YJ6A 1O6JA 3KP8A 4NAXA 2ALBA 2H74A 2EIOA 3GNJA 5IMCA 3DYRA 4KCAA 1X5EA 1ERUA 4N0ZA 3D0ZA 3TJGA 1GUKA 4ID0A 3C1RA 3QMXA 5F0GA 3GIXA 3O6TA 4OCEA 4XRDA 4QL9A 3UBLA 5ECKB 1ACVA 5HQPA 3TKSE 2MYGA 1TKDB 3F6FA 5ECQB 2NBSA 3HHVA 5G1LA 2O89A 1PMTA 4EDYA 1QQ2A 1SJ6A 3UBKA 4N0VA 2X64A 5EY6A 2H73A 1THOA 5HFKA 1UN2A 2FNOA 1T3BA 2PPTA 4OFNA 1E6BA 3GH6A 4RQRA 5D9WA 1GNWA 2YPMA 1WOUA 4OWYA 4GQFA 4F0BA 1WRYA 2FWEA 5CAXA 3HVVA 1LBKA 6GSVA 2GQMA 4ZB6A 2KUCA 2PU9C 5A4UA 4IELA 2B7JA 2VO4A 1YZXA 1A2MA 1QXHA 2G2QA 3IPZA 4DVCA 1WWJA 20GSA 5FHIA 1G6YA 2WZ9A 4NXIA 1VF3A 2V2GA 2FCHA 2GTUA 1M9AA 1ZCPA 6GSTA 3EINA 1UVZA 2AV4A 4GLTA 4BL7A 3FZ5A 3QDNA 1ZYQB 2HFDA 5J3RA 4RI6A 4ML6A 1T00A 1K0CA 1GUMA 5AISA 3FRCA 1TK0B 1B8XA 2LV3A 2LEGA 2FD3A 5CP1A 2F51A 1SD9A 2A2SA 3APQA 2WGRA 1EWXA 3A3TA 1DE2A 1TXXA 2PMTA 2GQLA 4DSQA 2R6KA 1MEKA 1Z5YE 2K8SA 4WF4A 1KBNA 2DMLA 8GSSA 2HYXA 3F3QA 1K3YA 5L71A 3CSJA 1GTUA 3A5WA 1GSSA 4GSNA 3QAWA 5CRWA 3I9V2 4WR4A 4JR4A 1GTIA 5AIVA 4KDUA 1GSEA 4G19A 3GSTA 5F05A 3HVSA 2C4JA 4NHWA 3EU3A 1XVWA 4CDOA 3F63A 2YWIA 3GHAA 2IFQA 4WXTA 2J9HA 2HI7A 2R4VA 2DJJA 5J5NA 3EMPA 1NHOA 1OKTA 4KAEA 3A2XA 4ML1A 1THXA 2EIQA 4YQMA 1XW9A 2H1GA 1W4VA 1F37A 2HLSA 3P7XA 2X99A 3ZFBA 3LORA 4PNFA 2CZ3A 4BWQA 4Q5QA 5JCWA 1TW9A 5ECPB 2LJKA 2PVOC 1HQOA 4XIHA 1TP9A 3BOAA 2ZCTA 2MMNA 1OC3A 2FWGA 4V2LA 4ACSA 3UEMA 3IRAA 2RIIA 1GSDA 5D73A 1XIYA 2MZCA 3LYPA 1YKCA 2WB9A 1T1VA 1ZZYA 3U5RE 2VAFA 3HD5A 3H93A 1B9YC 5KN3A 3VI7A 4TN8A 2GLRA 2M72A 3WGXA 3CYNA 4GF0A 2C80A 3GL5A 1TI3A 4EF0A 3KP9A 2VCQA 5LD0A 3H1NA 1XVQA 2IL3A 1WP0A 1EZKA 4O5RA 2O8VB 4MDCA 3CXGA 5CRGA 5C00A 1LJRA 3GRXA 3HY2A 4MH3A 2VLUA 6GSYA 3A2VA 4MCUA 1E2YA 3A2WA 1XCCA 1TDIA 9GSSA 1TRWA 1XW5A 4J56E 5GZZB 3Q19A 1M99A 3WD6A 4PUFC 22GSA 3ERFA 2LRNA 4LMVA 1CQHA 2CX4A 1PL2A 5AGYA 2R5GA 4OFTA 2E2MA 3PR8A 4LA1A 4ZILA 2TIRA 1QGVA 2MBTA 3NOFA 2H01A 3HYPA 4G10A 2M46A 4KNDA 5G31A 5CNWA 1AC1A 2LQQA 1SU9A 5IM9A 3M9KA 3PGTA 1JLVA 1F9MA 1UA5A 3VPQA 3GUSA 4YAVA 1W89A 3QR6A 2K9FA 3Q6OA 1ZMAA 4PQ1A 1MD3A 2FWHA 2KOKA 5ENUA 5ECSA 1YKAA 5JWRB 3IE3A 4HOJA 4KA0A 5AN1A 1Z9HA 2EIRA 2DJ3A 3Q74A 2FGXA 3RHBA 1XWBA 5KN1A 6GSUA 4NWYA 1FO5A 2I81A 3TRQA 3N9JA 5LNKe 3RBTA 2YJHA 1F6MC 4DSRA 2HZEB 1HYUA 1RQMA 4OO4A 3D4MA 4PGTA 1DSBA 2V1MA 4E8EA 3HJMA 1OKDA 4IVFA 1CQGA 3VK9A 3KCMA 4O92A 2IMDA 1VGLA 3ZVJD 2H70A 4MF7A 4K9ZA 4PXOA 3ZTLA 2MBSA 4IW9A 5DJLA 4KGIA 2H6XA 3W8JA 3BJ5A 5ECOB 3VWXA 2B6MA 3TKSC 3IHQA 3EYTA 2MMZA 2RUEA 5B6NA 1B48A 3GX8A 1V9WA 2VLVA 2IMFA 4ZL7A 4Q5RA 4AJ6A 1XWAA 5CYYA 3RAZA 1MDIA 1R5AA 4BVXA 1JHBA 4EO3A 2OKAA 3FKFA 1YQ1A 3GKXA 2VD0A 4X0XA 1DE1A 4MLYA 1XWKA 5G5FA 1M2DA 2L4QA 2WJUA 5HFGA 3TOUA 3DGQA 1GTBA 2GZYA 4KSOA 1GSQA 3GYKA 5FT3A 3TRXA 4PURA 3D6IA 3L78A 18GSA 1XW6A 1TRUA 5CRHA 2YZHA 3ISOA 3RDWA 2F3MA 2P5RA 4F9ZA 1QUWA 1ERVA 4QL7A 1Z3EA 2VL2C 5ELAA 4NV5A 1X0RA 4QQ7A 2QKEA 4F2IA 4POLA 4XRAA 3TKQA 3RPNA 2GSTA 4FO5A 2KLXA 2GVPA 3D4TA 3LG6A 2AHEA 4KDYA 3FZAA 2REMA 3LSZA 4G2EA 5HR3A 1HNAA 4KUNA 5ECNB 4KCEA 4MA9A 2L5LA 4EDZA 6GSWA 2IMKA 1Q98A 5B7CA 3VWWA 2GZPA 1M2AA 2RM5A 3TJKA 2CT6A 4NMUA 4HI7A 2VL2A 4GCIA 2V6OA
chains in the Genus database with same CATH superfamily
1JZOA 3E0UA 2R2JA 1A2JA 4O32A 3UL3A 1FAAA 3ZL5A 4K7OA 2H30A 5JWOB 3L9SA 1SL1B 1KTEA 1ST9A 1RK4A 1XOBA 3LJRA 4EL1A 4JZQA 3FY7A 2OA7A 4V2NA 3HA9A 1X9MB 5ECRB 3F0IA 1DUGA 1PX6A 2AUVA 1GTAA 1ON4A 2KP1A 3MDKA 5D9VA 1PL1A 1EGOA 4ECIA 5D9TA 1SJIA 4JRRA 4Z7XA 3C73A 3VLNA 4BVYA 3QD9A 3GFKA 4EUYA 2ON5A 5GSSA 1O81A 4BA7A 1EOGA 3TJFA 4EKZA 4IBPA 3ZLPA 3CRUA 3D21A 4FIWA 4BL7B 1K0OA 4IGJA 2JSZA 3G7JA 4TR3A 2GZZA 1URMA 2WDUA 2LTKA 4F0CA 2PN8A 2BMXA 4POBA 5H5QA 3FZ9A 2HRKA 4WEYA 2ZNMA 3GTUB 3LFLA 2HZFA 2V32A 4ZB8A 4K0GA 2JL4A 2ES7A 3KTBA 1O85A 3DEXA 1A8YA 2K6VA 4O5UA 4KW6A 2YCDA 1YEXA 3FR9A 2QA2A 4N10A 3LW9A 3TUEA 4MH2A 2LRTA 4Z2TA 4I8BA 5J41A 5CREA 2OACA 5KN2A 4OD7A 5INYA 1XXUA 4L0WA 3ZREA 3CSIA 1XFLA 3MAKA 1BG5A 3L0HA 3GTUA 2XC2A 5IMZA 2TRXA 3KMNA 4YQUA 4X43A 4HEA2 4KDXA 4TR1B 4D73B 1A24A 4IJIA 2IFQB 2PWJA 4K7NA 4AGSA 1AQXA 3HJPA 2MMAA 2YN1A 3KMOA 1PX7A 4F82A 2I9HA 5DCHA 3OR5A 4ZBAA 4MZBA 3I43A 4IKHA 5D9XA 1JZRA 5ECLB 3FEUA 4LLRA 4TR1A 5COHA 1J08A 1T4YA 1PN9A 5HR2A 3FHKA 4D73A 3C7MA 2UZ8A 1S3AA 2OE1A 3PH9A 5G2ZA 3EWLA 1PSQA 2BJXA 2CX3A 3EMXA 4MP4A 5F07A 1GNEA 1KNGA 2H6YA 5LCZA 3EVIA 4PQIA 1J0FA 2AAWA 3W6GA 3F8UA 4K6XA 4PUAA 1ERTA 4AF2A 3GMFA 4MJCA 2VD1A 1MTCA 2DIYA 2IMIA 2VM1A 1GSYA 1UC7A 1Z6MA 12GSA 3FZ4A 3FMWA 3DRNA 1TK5B 3I69A 4DEJA 2NTOA 1V98A 1SK2A 1Y25A 2V6KA 3KH9A 1IYIA 4MZWA 3IAM2 1EV9A 1U3IA 2OE0A 2RLIA 4K1FA 4J57E 1JZWA 2QSIA 5IPGA 4AJ7A 2VOCA 3ZZXA 1AUCA 4ILFA 3EPTA 4PNGA 2R3XA 2VCWA 3BCKA 1SYXA 3TJBA 1SJZA 6GSSA 4MF5A 5H5SA 3GSSA 2NVLA 2YOIA 2WCIA 4PQHA 3CTFA 2H1DA 2H71A 2LUSA 2GT5A 3QAGA 1A23A 3F4SA 5DDLA 2VL9A 1F2EA 4HZ4A 1EOHA 4J2FA 14GSA 1ZGNA 2M80A 3LQ7A 2XPDA 2GSSA 1AXDA 3F4TA 3N5OA 4HQSA 2L6CA 2JZSA 4POMA 4CHSA 4RUVA 1V57A 2YJ7A 5IO0A 5A4WA 3J7Yk 3QOUA 3SWLA 4XCSA 2JZRA 2HXKA 4DSSA 1FG4A 1TRSA 2CZ2A 3QAVA 5DBQA 3HKRA 2LS5A 4WR5A 4KX4A 3G9BA 1EV4A 2RUFA 1N8JA 1OC8A 2B7KA 4HS1A 1DBYA 2LQOA 1ABAA 3G7IA 3IK7A 1GSFA 3ZMKA 3IBHA 1I9DA 1ZOFA 4OCFA 1EEJA 4JU5A 1A0FA 4KE3A 3APOA 2HSMA 2GGTA 2H75A 7GSSA 2GSQA 1SKWB 1O73A 2VLTA 2HE3A 3VFIA 1GRXA 4BIKA 4F03A 4ICYA 1VRSD 3IAS2 2LJRA 3KH7A 2YV7A 5DQSA 3GL3A 1M7TA 5ID2A 4O5QA 2VM2A 1JLWA 3DVXA 1FOVA 2CQ9A 3TDGA 2GSRA 5DAKA 3ZFLA 5IMDA 1AW9A 2I3YA 2C0GA 2F8FA 4TOPA 5C04A 2L59A 4FYBA 2N5BA 2L4CA 1PN0A 3VWUA 4ECBA 3ZYWA 4NV2A 2IPAA 1R5PA 1PGTA 3VI5A 2HRFA 4X1UA 2VUPA 3WGDA 2B5EA 5IMVA 4BVXB 2F9SA 2H76A 4LL1B 2C3NA 4V1Ag 2CVBA 1Y6EA 2LKUA 4GTUA 1J9BA 1GLPA 1F3BA 4H86A 3GKMA 4ISDA 3F9UA 1JZDA 3EU4A 1I5GA 1PKZA 3F4RA 4K5RA 6GSXA 4XS4A 3DIEA 5GAND 1V58A 2HRNA 2FHEA 1NM3A 2C0EA 4K8MA 1U6TA 1TU8A 4G0KA 5KN0A 16GSA 2GQKA 2B3SA 4CY6A 3K8NA 1EP8A 3FR6A 3MWHA 2PUKC 2G0FA 4TXVA 4YKFA 3M9JA 2HT9A 3UIWA 1FHEA 4WETA 3IV4A 1HNCA 4MABA 5B8AA 2XBIA 3DKSA 1WE0A 4BPYA 3HZ4A 2KP2A 5A4VA 2VCVA 2A4VA 4HQZA 1FVKA 5KOXA 2H66A 2Z9SA 5DCGA 1YDKA 4TXOB 1Z6NA 4EC0A 4FYCA 3M0FA 4NHZA 3GN3A 3QCPA 1SL0B 3WT2A 5D8IA 4TR0A 4G9HA 4KB3A 1AQWA 2IN3A 1WJKA 2H1AA 4TRXA 4N11A 4G0LA 1U87A 1R26A 4TVEA 1Q4JA 1PQNA 3DXBA 4ZXGA 1ML6A 1FOHA 2X8GA 3MNGA 5DQYA 5IOXA 2ZUPA 2VCXA 1K0BA 1H4OA 3GA4A 1OC9B 4TXOA 5ABRA 2VL3A 1EGRA 1C72A 2DKHA 2FLSA 3IK9A 4BWSA 3RHCA 3LYKA 3DVWA 1OAZA 2VCTA 1MDKA 2X8CA 1R7HA 2VIMA 5JCGA 4TKYA 2PGTA 5GSTA 4OFMA 4P3YB 5B8BA 3TGZA 1OE8A 2VCZA 4FYUA 5JCUA 2CA8A 1G7OA 1OYJA 11GSA 2C0FA 5ECIB 3APSA 4MJBA 3L4NA 1OC9A 2LJAA 3GKNA 4BVYB 4RI7A 3MSZA 2XBQA 2QA1A 2E2GA 4POKA 4Z2UA 2A2PA 4MZCA 4ZL9A 4HUAA 1TJDA 1VF2A 2L5OA 4L8EA 5G30A 1SKSB 3BD2A 3C1SA 2X8HA 3AY8A 3TCOA 4IQ1A 2H72A 2D2ZA 3P90A 1NW2A 2I4AA 5DJMA 4X4JA 1G6WA 3CTGA 3KEBA 1FVJA 3CSHA 1G7EA 2B1KA 3TB2A 3HJOA 4LMWA 5D96A 2HSHA 2I1UA 4PX1A 4JEDA 5IOWA 2E0QA 3F6DA 2XPEA 3I6AA 3H4KA 2K18A 5F06A 2WULA 1XG8A 3UVTA 1TU7A 1NHYA 3C8EA 2MMOA 3JCML 1XBSA 5J9CA 1K0DA 5B6MA 2JADA 2DIZA 2NDOA 4GSSA 3IC4A 1GH2A 3QPMA 1T7PB 2X49A 2IMEA 2H6ZA 3LXZA 1G0TA 1B4QA 1M3JA 1GULA 1O8XA 2DJ1A 4GXZA 5JWQB 3O3TA 3KD0A 4ULXA 2YP6A 4IHUA 4MK3A 1EEMA 2P31A 3UVHA 2C0DA 1K3OA 1TI1A 2PVQA 5F8BA 3ZIVA 1GSUA 5BRTA 4IS0A 2XHFA 2AJQB 3GH9A 4ZBDA 1MD4A 3HDCA 1H75A 2JU5A 3KXOA 4AJ8A 5DALB 3LXTA 2EC4A 3TOTA 3UJ1A 1SK0A 1ZYEA 3PINA 4JBBA 2YWMA 2JZTA 4I5QA 2KHPA 1B4PA 4TW5A 2O7KA 2FA4A 1WIKA 5G1KA 4LL4B 4XS6A 3ZITA 5IQYA 1XWGA 4HU9A 4GRFA 4HJ2A 1O7UA 3DMLA 5IO2A 1F3AA 5IMFA 1GP1A 5DALA 4IN0A 3LGCA 2YANA 4EE0A 2JSYA 5H5RA 2OBKA 5HFIA 5HR1A 2HNLA 5KEJA 3EURA 1VF4A 17GSA 1A8LA 2DJKA 3FYGA 4I2UA 4K5SA 2H0HA 3P8WA 4WBRD 4Q5FA 4TR4A 1SENA 4RQXA 2AB6A 1Z7PA 1BYEA 1EP7A 1SYRA 4KSMA 2B1LA 3E3EA 5CRDA 4IP6A 2CVKA 1PD21 1BJXA 3HVNA 1X9WB 1KEBA 1XZOA 3ZIJA 3GX0A 2H0GA 3IDVA 5DVBA 4L5OA 3MYDA 1BAYA 4KH7A 3HZ8A 1M3IA 2E7PA 1A2LA 3UARA 3G7YA 4KF9A 3CQFA 2PBJA 2N5AA 4K2DA 5GAPD 3IC8A 2NPBA 4MPFA 3P2AA 2WFCA 2R37A 3U6VA 3F3RA 4K7IA 3L9VA 5CO3A 5IIZA 2H19A 3TKPA 1A0RP 4DSSB 4E8HA 4MMMA 1K0NA 3WT1A 2CAIA 3L9UA 1K0MA 1FB0A 3H8QA 3SBCA 2GT6A 1FW1A 1JFUA 1BQ7A 1YF0A 3GV1A 1TRVA 2DBCA 1X5CA 2FUG2 3CRTA 3H79A 1FB6A 3VPTA 2H0IA 1HD2A 4HZ2A 4XTSA 1YY7A 19GSA 2O87A 1AAZA 3LEFA 1O8WA 2OBIA 3QFAC 2CV4A 3RPPA 1TOFA 2DSAA 3V1WA 1WPIA 2L6DA 4JE1A 3ERWA 3QFBC 1X9SB 2IWTA 2WS2A 3KZQA 3Q18A 2C1YA 3IXRA 4IP1A 4NPBA 2J23A 5ID2B 2HSYA 1YEPA 4EVMA 1TK8B 3ZRDA 2FY6A 5J4UA 1SL2B 3EE2A 3M3MA 2YV9A 10GSA 4MF6A 4XS1A 2F8AA 5DAKB 4ECJA 1OVNA 5J9BA 2DMMA 2DKIA 3ED3A 4MJEA 1T4ZA 1M9BA 2LRCA 4OO5A 4WF5A 1R4WA 1VF1A 1USBA 3R3EA 1X5DA 4GSTA 1K0AA 1AQVA 1XWCA 1U88A 3FW2A 4CW9A 2B5YA 2CVDA 3HVXA 4HJMA 4IQAA 2C3QA 5FWGA 2LNTA 3KM6A 5A5KA 3KJYA 3TJJA 2R0CA 4V1Ap 4N30A 3CBUA 1XOAA 2P0GA 3C71A 4ZB9A 1S3DA 3J7Yb 2TRCP 4EIPA 1K3LA 2H8LA 5IPHA 1QK8A 2X4AA 4XS4B 2A2RA 2GDRA 5EVOA 4HDEA 3IOSA 2YZUA 1U3AA 2LNSA 2DLXA 4MJAA 3CMIA 5E59A 4I97A 4EXJA 3D5JA 2V41A 4FH8A 4L0UA 3EC3A 3GURA 3ME7A 2P5QA 4Q5NA 4WBJA 4ZBBA 2QGVA 2L57A 3WGEA 2JACA 3FK8A 3GKKA 1MDJA 5G5EA 13GSA 3IHGA 2HZEA 1N2AA 1GL8A 4ZL8A 3DD3A 2AYTA 3KTLA 2OJLA 1SKRB 1IYHA 2C8UA 1XPVA 3S9FA 2FWFA 1TTZA 4GQCA 4YQVA 2DJ2A 5HR0A 5IMAA 2YNXA 3HCZA 5ECMB 3R2QA 2FA8A 2ON7A 4I6XA 5KOWA 1HNBA 5ELGA 1ERWA 1SK1A 2O85A 4OMVA 3KIJA 5EL8A 1RW1A 3IR4A 2DC5A 3BBYA 5EPFA 2CAQA 3HXSA 4EIQA 3NIVA 1PA3A 2PERA 1WMJA 2QC7A 3LWAA 1GUHA 3TRPA 2H1BA 4FQUA 4HU7A 3ZMLA 3KGKA 4JR6A 1ZL9A 3TKRA 4ZIJA 3E9JB 5D93A 4Z2RA 1M0UA 1SD8A 4MNNA 2OADA 1B9XC 4ECCA 1GLQA 1QMVA 4O7HA 1PKWA 3BCIA 3WYWA 2YWNA 3TKSA 2GS3A 2OE3A 3ME8A 3NZNA 2YWOA 4GWRA 2IJYA 2WRTA 1PRXA 3MIXA 5E4WA 1V40A 5AIXA 4IJ3A 2RM6A 4K0NA 1V2AA 2B5XA 4L5LA 3ERGA 1LU4A 2LSTA 1Z7RA 2N5FA 3DWVA 4YH2A 3US3A 1QFNA 2C3TA 1BX9A 1GWCA 3FR3A 2DJ0A 1M2BA 1OE7A 3VWVA 3IA1A 3UMAA 3UOMA 5ECHB 2K8VA 2IIYA 3UAPA 4V2MA 1T8EB 4MPGA 3D22A 3M8NA 4XHMA 1ILOA 1BEDA 1NSWA 3M1GA 4I2TA 1S3CA 3ZVJA 3O76A 4YAPA 3W8SA 3VURA 1YF1A 2BTOT 4WKWA 1AIUA 2R0GA 1YJ6A 1O6JA 3KP8A 4NAXA 2ALBA 2H74A 2EIOA 3GNJA 5IMCA 3DYRA 4KCAA 1X5EA 1ERUA 4N0ZA 3D0ZA 3TJGA 1GUKA 4ID0A 3C1RA 3QMXA 5F0GA 3A5IA 3GIXA 3O6TA 4OCEA 4XRDA 4QL9A 3UBLA 5ECKB 1ACVA 5HQPA 3TKSE 2MYGA 1TKDB 3F6FA 5ECQB 2NBSA 3HHVA 5G1LA 2O89A 1PMTA 4EDYA 1QQ2A 2A4HA 1SJ6A 3UBKA 4N0VA 2X64A 5EY6A 2H73A 1THOA 5HFKA 1UN2A 2FNOA 1T3BA 2PPTA 4OFNA 1E6BA 3GH6A 4RQRA 5D9WA 1GNWA 2YPMA 1WOUA 4OWYA 4GQFA 4F0BA 1WRYA 1ZYNA 2FWEA 5CAXA 4HSCX 3HVVA 1LBKA 6GSVA 2GQMA 4ZB6A 2KUCA 2PU9C 5A4UA 4IELA 2B7JA 2VO4A 1YZXA 1A2MA 1QXHA 2G2QA 3IPZA 4DVCA 1WWJA 20GSA 5FHIA 1G6YA 2WZ9A 4NXIA 1VF3A 2V2GA 2FCHA 2GTUA 1M9AA 1ZCPA 6GSTA 3EINA 1UVZA 2AV4A 4GLTA 4BL7A 3FZ5A 3QDNA 1ZYQB 2HFDA 5J3RA 4RI6A 4ML6A 1T00A 1K0CA 1GUMA 5AISA 3FRCA 1TK0B 1B8XA 2LV3A 2LEGA 2FD3A 5CP1A 2F51A 1SD9A 2A2SA 3APQA 3PPUA 2WGRA 1EWXA 3A3TA 1DE2A 1TXXA 1PFOA 2PMTA 2GQLA 4DSQA 2R6KA 1MEKA 1Z5YE 2K8SA 4WF4A 1KBNA 2DMLA 8GSSA 2HYXA 3F3QA 1K3YA 5L71A 3CSJA 1GTUA 3A5WA 1GSSA 4GSNA 3QAWA 5CRWA 3I9V2 4WR4A 4JR4A 1GTIA 5AIVA 4KDUA 1GSEA 4PTSA 4G19A 3GSTA 5F05A 3HVSA 2C4JA 4NHWA 3EU3A 1XVWA 4CDOA 3F63A 2YWIA 3GHAA 2IFQA 4WXTA 2J9HA 2HI7A 2HRAA 2R4VA 2DJJA 5J5NA 3EMPA 1NHOA 1OKTA 4KAEA 3A2XA 4ML1A 1THXA 2EIQA 4YQMA 1XW9A 2H1GA 1W4VA 1F37A 2HLSA 3P7XA 2X99A 3ZFBA 3LORA 4PNFA 2CZ3A 4BWQA 4Q5QA 5JCWA 1TW9A 5ECPB 2LJKA 2PVOC 1HQOA 4XIHA 1TP9A 3BOAA 2ZCTA 2MMNA 1OC3A 2FWGA 4V2LA 4ACSA 3UEMA 3IRAA 2RIIA 1GSDA 5D73A 1XIYA 2MZCA 3LYPA 1YKCA 2WB9A 1T1VA 1ZZYA 3U5RE 2VAFA 3HD5A 3H93A 1B9YC 5KN3A 3VI7A 4TN8A 2GLRA 2M72A 3WGXA 3CYNA 4GF0A 2C80A 3GL5A 1TI3A 4EF0A 3KP9A 2VCQA 5LD0A 3H1NA 1XVQA 2IL3A 1WP0A 1EZKA 4O5RA 2O8VB 4MDCA 3CXGA 5CRGA 5C00A 1LJRA 3GRXA 3HY2A 4MH3A 2VLUA 6GSYA 3A2VA 4MCUA 1E2YA 3A2WA 1XCCA 1TDIA 4A5PA 9GSSA 1TRWA 1XW5A 4J56E 5GZZB 3Q19A 1M99A 3WD6A 4PUFC 22GSA 3ERFA 2LRNA 4LMVA 1CQHA 2CX4A 1PL2A 5AGYA 2R5GA 4OFTA 2E2MA 3PR8A 4LA1A 4ZILA 2TIRA 1QGVA 2MBTA 3NOFA 2H01A 3HYPA 4G10A 2M46A 4KNDA 5G31A 5CNWA 1AC1A 2LQQA 1SU9A 5IM9A 3M9KA 3PGTA 4CY8A 1JLVA 1F9MA 1UA5A 3VPQA 3GUSA 4YAVA 1W89A 3QR6A 2K9FA 3Q6OA 1ZMAA 4PQ1A 1MD3A 2FWHA 2KOKA 5ENUA 5ECSA 1YKAA 5JWRB 3IE3A 4HOJA 4KA0A 5AN1A 1Z9HA 2EIRA 2DJ3A 3Q74A 2FGXA 3RHBA 1XWBA 5KN1A 6GSUA 4NWYA 1FO5A 2I81A 3TRQA 3N9JA 5LNKe 3RBTA 2YJHA 1F6MC 4DSRA 2HZEB 1HYUA 1RQMA 4OO4A 4G0IA 3D4MA 4PGTA 1DSBA 2V1MA 4E8EA 3HJMA 1OKDA 4IVFA 1CQGA 3VK9A 3KCMA 4O92A 2IMDA 1VGLA 3ZVJD 2H70A 4MF7A 4K9ZA 4PXOA 3ZTLA 2MBSA 4IW9A 5DJLA 4KGIA 2H6XA 3W8JA 3BJ5A 5ECOB 3VWXA 2B6MA 3TKSC 4YKGA 3IHQA 3EYTA 2MMZA 2RUEA 5B6NA 1B48A 3GX8A 1V9WA 2VLVA 2IMFA 4ZL7A 4Q5RA 4AJ6A 1XWAA 5CYYA 3RAZA 1MDIA 1R5AA 4BVXA 1JHBA 4EO3A 2OKAA 3FKFA 1YQ1A 3GKXA 2VD0A 4X0XA 1DE1A 4MLYA 1XWKA 5G5FA 1M2DA 2L4QA 2WJUA 5HFGA 3TOUA 3DGQA 1GTBA 2GZYA 4KSOA 1GSQA 3GYKA 2R0PA 5FT3A 3TRXA 4PURA 3D6IA 3L78A 18GSA 1XW6A 1TRUA 5CRHA 5BMUA 2YZHA 3ISOA 3RDWA 2F3MA 2P5RA 4F9ZA 1QUWA 1ERVA 4QL7A 1Z3EA 2VL2C 5ELAA 4NV5A 1X0RA 4QQ7A 2QKEA 4F2IA 4POLA 4XRAA 3TKQA 3RPNA 2GSTA 4K2XA 4USSA 4FO5A 2KLXA 2GVPA 3D4TA 3LG6A 2AHEA 4KDYA 3FZAA 2REMA 1ZYPA 3LSZA 4G2EA 5HR3A 1HNAA 4KUNA 5ECNB 4KCEA 1S3RA 4MA9A 2L5LA 4EDZA 6GSWA 2IMKA 1Q98A 5B7CA 3VWWA 2GZPA 1M2AA 2RM5A 3TJKA 2CT6A 4NMUA 4HI7A 2VL2A 4GCIA 2V6OA
chains in the Genus database with same CATH topology
1JZOA 3E0UA 2R2JA 1A2JA 4O32A 3UL3A 1FAAA 3ZL5A 4K7OA 2H30A 5JWOB 3L9SA 1SL1B 1KTEA 1ST9A 1RK4A 1XOBA 3LJRA 4EL1A 4JZQA 3FY7A 2OA7A 4V2NA 3HA9A 1X9MB 5ECRB 3F0IA 1DUGA 1PX6A 2AUVA 1GTAA 1ON4A 2KP1A 3MDKA 5D9VA 1PL1A 1EGOA 4ECIA 5D9TA 1SJIA 4JRRA 4Z7XA 3C73A 3VLNA 4BVYA 3QD9A 3GFKA 4EUYA 2ON5A 5GSSA 1O81A 4BA7A 1EOGA 3TJFA 4EKZA 4IBPA 3ZLPA 3CRUA 3D21A 4FIWA 4BL7B 1K0OA 4IGJA 2JSZA 3G7JA 4TR3A 2GZZA 1URMA 2WDUA 2LTKA 4F0CA 2PN8A 2BMXA 4POBA 5H5QA 3FZ9A 2HRKA 4WEYA 2ZNMA 3GTUB 3LFLA 2HZFA 2V32A 4ZB8A 4K0GA 2JL4A 2ES7A 3KTBA 1O85A 3DEXA 1A8YA 2K6VA 4O5UA 4KW6A 2YCDA 1YEXA 3FR9A 2QA2A 4N10A 3LW9A 3TUEA 4MH2A 2LRTA 4Z2TA 4I8BA 5J41A 5CREA 2OACA 5KN2A 4OD7A 5INYA 1XXUA 4L0WA 3ZREA 3CSIA 1XFLA 3MAKA 1BG5A 3L0HA 3GTUA 2XC2A 5IMZA 2TRXA 3KMNA 4YQUA 4X43A 4HEA2 4KDXA 4TR1B 4D73B 1A24A 4IJIA 2IFQB 2PWJA 4K7NA 4AGSA 1AQXA 3HJPA 2MMAA 2YN1A 3KMOA 1PX7A 4F82A 2I9HA 5DCHA 3OR5A 4ZBAA 4MZBA 3I43A 4IKHA 5D9XA 1JZRA 5ECLB 3FEUA 4LLRA 4TR1A 5COHA 1J08A 1T4YA 1PN9A 5HR2A 3FHKA 4D73A 3C7MA 2UZ8A 1S3AA 2OE1A 3PH9A 5G2ZA 3EWLA 1PSQA 2BJXA 2CX3A 3EMXA 4MP4A 5F07A 1GNEA 1KNGA 2H6YA 5LCZA 3EVIA 4PQIA 1J0FA 2AAWA 3W6GA 3F8UA 4K6XA 4PUAA 1ERTA 4AF2A 3GMFA 4MJCA 2VD1A 1MTCA 2DIYA 2IMIA 2VM1A 1GSYA 1UC7A 1Z6MA 12GSA 3FZ4A 3FMWA 3DRNA 1TK5B 3I69A 4DEJA 2NTOA 1V98A 1SK2A 1Y25A 2V6KA 3KH9A 1IYIA 4MZWA 3IAM2 1EV9A 1U3IA 2OE0A 2RLIA 4K1FA 4J57E 1JZWA 2QSIA 5IPGA 4AJ7A 2VOCA 3ZZXA 1AUCA 4ILFA 3EPTA 4PNGA 2R3XA 2VCWA 3BCKA 1SYXA 3TJBA 1SJZA 6GSSA 4MF5A 5H5SA 3GSSA 2NVLA 2YOIA 2WCIA 4PQHA 3CTFA 2H1DA 2H71A 2LUSA 2GT5A 3QAGA 1A23A 3F4SA 5DDLA 2VL9A 1F2EA 4HZ4A 1EOHA 4J2FA 14GSA 1ZGNA 2M80A 3LQ7A 2XPDA 2GSSA 1AXDA 3F4TA 3N5OA 4HQSA 2L6CA 2JZSA 4POMA 4CHSA 4RUVA 1V57A 2YJ7A 5IO0A 5A4WA 3J7Yk 3QOUA 3SWLA 4XCSA 2JZRA 2HXKA 4DSSA 1FG4A 1TRSA 2CZ2A 3QAVA 5DBQA 3HKRA 2LS5A 4WR5A 4KX4A 3G9BA 1EV4A 2RUFA 1N8JA 1OC8A 2B7KA 4HS1A 1DBYA 2LQOA 1ABAA 3G7IA 3IK7A 1GSFA 3ZMKA 3IBHA 1I9DA 1ZOFA 4OCFA 1EEJA 4JU5A 1A0FA 4KE3A 3APOA 2HSMA 2GGTA 2H75A 7GSSA 2GSQA 1SKWB 1O73A 2VLTA 2HE3A 3VFIA 1GRXA 4F03A 4ICYA 1VRSD 3IAS2 2LJRA 3KH7A 2YV7A 5DQSA 3GL3A 1M7TA 5ID2A 4O5QA 2VM2A 1JLWA 3DVXA 1FOVA 2CQ9A 3TDGA 2GSRA 5DAKA 3ZFLA 5IMDA 1AW9A 2I3YA 2C0GA 2F8FA 4TOPA 5C04A 2L59A 4FYBA 2N5BA 2L4CA 1PN0A 3VWUA 4ECBA 3ZYWA 4NV2A 2IPAA 1R5PA 1PGTA 3VI5A 2HRFA 4X1UA 2VUPA 3WGDA 2B5EA 5IMVA 4BVXB 2F9SA 2H76A 4LL1B 2C3NA 4V1Ag 2CVBA 1Y6EA 2LKUA 4GTUA 1J9BA 1GLPA 1F3BA 4H86A 3GKMA 4ISDA 3F9UA 1JZDA 3EU4A 1I5GA 1PKZA 3F4RA 4K5RA 6GSXA 4XS4A 3DIEA 5GAND 1V58A 2HRNA 2FHEA 1NM3A 2C0EA 4K8MA 1U6TA 1TU8A 4G0KA 5KN0A 16GSA 2GQKA 2B3SA 4CY6A 3K8NA 1EP8A 3FR6A 3MWHA 2PUKC 2G0FA 4TXVA 4YKFA 3M9JA 2HT9A 3UIWA 1FHEA 4WETA 3IV4A 1HNCA 4MABA 5B8AA 2XBIA 3DKSA 1WE0A 4BPYA 3HZ4A 2KP2A 5A4VA 2VCVA 2A4VA 4HQZA 1FVKA 5KOXA 2H66A 2Z9SA 5DCGA 1YDKA 4TXOB 1Z6NA 4EC0A 4FYCA 3M0FA 4NHZA 3GN3A 3QCPA 1SL0B 3WT2A 5D8IA 4TR0A 4G9HA 4KB3A 1AQWA 2IN3A 1WJKA 2H1AA 4TRXA 4N11A 4G0LA 1U87A 1R26A 4TVEA 1Q4JA 1PQNA 3DXBA 4ZXGA 1ML6A 1FOHA 2X8GA 3MNGA 5DQYA 5IOXA 2ZUPA 2VCXA 1K0BA 1H4OA 3GA4A 1OC9B 4TXOA 5ABRA 2VL3A 1EGRA 1C72A 2DKHA 2FLSA 3IK9A 4BWSA 3RHCA 3LYKA 3DVWA 1OAZA 2VCTA 1MDKA 2X8CA 1R7HA 2VIMA 5JCGA 4TKYA 2PGTA 5GSTA 4OFMA 4P3YB 5B8BA 3TGZA 1OE8A 2VCZA 4FYUA 5JCUA 2CA8A 1G7OA 1OYJA 11GSA 2C0FA 5ECIB 3APSA 4MJBA 3L4NA 1OC9A 2LJAA 3GKNA 4BVYB 4RI7A 3MSZA 2XBQA 2QA1A 2E2GA 4POKA 4Z2UA 2A2PA 4MZCA 4ZL9A 4HUAA 1TJDA 1VF2A 2L5OA 4L8EA 5G30A 1SKSB 3BD2A 3C1SA 2X8HA 3AY8A 3TCOA 4IQ1A 2H72A 2D2ZA 3P90A 1NW2A 2I4AA 5DJMA 4X4JA 1G6WA 3CTGA 3KEBA 1FVJA 3CSHA 1G7EA 2B1KA 3TB2A 3HJOA 4LMWA 5D96A 2HSHA 2I1UA 4PX1A 4JEDA 5IOWA 2E0QA 3F6DA 2XPEA 3I6AA 3H4KA 2K18A 5F06A 2WULA 3UVTA 1TU7A 1NHYA 3C8EA 2MMOA 3JCML 1XBSA 5J9CA 1K0DA 5B6MA 2JADA 2DIZA 2NDOA 4GSSA 3IC4A 1GH2A 3QPMA 1T7PB 2X49A 2IMEA 2H6ZA 3LXZA 1G0TA 1B4QA 1GULA 1O8XA 2DJ1A 4GXZA 5JWQB 3O3TA 3KD0A 4ULXA 2YP6A 4IHUA 4MK3A 1EEMA 2P31A 3UVHA 2C0DA 1K3OA 1TI1A 2PVQA 5F8BA 3ZIVA 1GSUA 5BRTA 4IS0A 2XHFA 2AJQB 3GH9A 4ZBDA 1MD4A 3HDCA 1H75A 2JU5A 3KXOA 4AJ8A 5DALB 3LXTA 2EC4A 3TOTA 3UJ1A 1SK0A 1ZYEA 3PINA 4JBBA 2YWMA 2JZTA 4I5QA 2KHPA 1B4PA 4TW5A 2O7KA 2FA4A 1WIKA 5G1KA 4LL4B 4XS6A 3ZITA 5IQYA 1XWGA 4HU9A 4GRFA 4HJ2A 1O7UA 3DMLA 5IO2A 1F3AA 5IMFA 1GP1A 5DALA 4IN0A 3LGCA 2YANA 4EE0A 2JSYA 5H5RA 2OBKA 5HFIA 5HR1A 2HNLA 5KEJA 3EURA 1VF4A 17GSA 1A8LA 2DJKA 3FYGA 4I2UA 4K5SA 2H0HA 3P8WA 4WBRD 4Q5FA 4TR4A 1SENA 4RQXA 2AB6A 1Z7PA 1BYEA 1EP7A 1SYRA 4KSMA 2B1LA 3E3EA 5CRDA 4IP6A 2CVKA 1PD21 1BJXA 1X9WB 1KEBA 1XZOA 3ZIJA 3GX0A 2H0GA 3IDVA 5DVBA 4L5OA 3MYDA 1BAYA 4KH7A 3HZ8A 2E7PA 1A2LA 3UARA 3G7YA 4KF9A 2PBJA 2N5AA 4K2DA 5GAPD 3IC8A 2NPBA 4MPFA 3P2AA 2WFCA 2R37A 3U6VA 3F3RA 4K7IA 3L9VA 5CO3A 5IIZA 2H19A 3TKPA 1A0RP 4DSSB 4E8HA 4MMMA 1K0NA 3WT1A 2CAIA 3L9UA 1K0MA 1FB0A 3H8QA 3SBCA 2GT6A 1FW1A 1JFUA 1BQ7A 1YF0A 3GV1A 1TRVA 2DBCA 1X5CA 2FUG2 3CRTA 3H79A 1FB6A 3VPTA 2H0IA 1HD2A 4HZ2A 4XTSA 1YY7A 19GSA 2O87A 1AAZA 3LEFA 1O8WA 2OBIA 3QFAC 2CV4A 3RPPA 1TOFA 2DSAA 3V1WA 1WPIA 2L6DA 4JE1A 3ERWA 3QFBC 1X9SB 2IWTA 2WS2A 3KZQA 3Q18A 2C1YA 3IXRA 4IP1A 4NPBA 2J23A 5ID2B 2HSYA 1YEPA 4EVMA 1TK8B 3ZRDA 2FY6A 5J4UA 1SL2B 3EE2A 3M3MA 2YV9A 10GSA 4MF6A 4XS1A 2F8AA 5DAKB 4ECJA 1OVNA 5J9BA 2DMMA 2DKIA 3ED3A 4MJEA 1T4ZA 1M9BA 2LRCA 4OO5A 4WF5A 1R4WA 1VF1A 1USBA 3R3EA 1X5DA 4GSTA 1K0AA 1AQVA 1XWCA 1U88A 3FW2A 4CW9A 2B5YA 2CVDA 3HVXA 4HJMA 4IQAA 2C3QA 5FWGA 2LNTA 3KM6A 5A5KA 3KJYA 3TJJA 2R0CA 4V1Ap 4N30A 3CBUA 1XOAA 2P0GA 3C71A 4ZB9A 1S3DA 3J7Yb 2TRCP 4EIPA 1K3LA 2H8LA 5IPHA 1QK8A 2X4AA 4XS4B 2A2RA 2GDRA 5EVOA 4HDEA 3IOSA 2YZUA 1U3AA 2LNSA 2DLXA 4MJAA 3CMIA 5E59A 4I97A 4EXJA 3D5JA 2V41A 4FH8A 4L0UA 3EC3A 3GURA 3ME7A 2P5QA 4Q5NA 4WBJA 4ZBBA 2QGVA 2L57A 3WGEA 2JACA 3FK8A 3GKKA 1MDJA 5G5EA 13GSA 3IHGA 2HZEA 1N2AA 1GL8A 4ZL8A 3DD3A 2AYTA 3KTLA 2OJLA 1SKRB 1IYHA 2C8UA 1XPVA 3S9FA 2FWFA 1TTZA 4GQCA 4YQVA 2DJ2A 5HR0A 5IMAA 2YNXA 3HCZA 5ECMB 3R2QA 2FA8A 2ON7A 4I6XA 5KOWA 1HNBA 5ELGA 1ERWA 1SK1A 2O85A 4OMVA 3KIJA 5EL8A 1RW1A 3IR4A 2DC5A 3BBYA 5EPFA 2CAQA 3HXSA 4EIQA 3NIVA 1PA3A 2PERA 1WMJA 2QC7A 3LWAA 1GUHA 3TRPA 2H1BA 4FQUA 4HU7A 3ZMLA 3KGKA 4JR6A 1ZL9A 3TKRA 4ZIJA 3E9JB 5D93A 4Z2RA 1M0UA 1SD8A 4MNNA 2OADA 1B9XC 4ECCA 1GLQA 1QMVA 4O7HA 1PKWA 3BCIA 3WYWA 2YWNA 3TKSA 2GS3A 2OE3A 3ME8A 3NZNA 2YWOA 4GWRA 2IJYA 2WRTA 1PRXA 3MIXA 5E4WA 1V40A 5AIXA 4IJ3A 2RM6A 4K0NA 1V2AA 2B5XA 4L5LA 3ERGA 1LU4A 2LSTA 1Z7RA 2N5FA 3DWVA 4YH2A 3US3A 1QFNA 2C3TA 1BX9A 1GWCA 3FR3A 2DJ0A 1M2BA 1OE7A 3VWVA 3IA1A 3UMAA 3UOMA 5ECHB 2K8VA 2IIYA 3UAPA 4V2MA 1T8EB 4MPGA 3D22A 3M8NA 4XHMA 1ILOA 1BEDA 1NSWA 3M1GA 4I2TA 1S3CA 3ZVJA 3O76A 4YAPA 3W8SA 3VURA 1YF1A 2BTOT 4WKWA 1AIUA 2R0GA 1YJ6A 1O6JA 3KP8A 4NAXA 2ALBA 2H74A 2EIOA 3GNJA 5IMCA 3DYRA 4KCAA 1X5EA 1ERUA 4N0ZA 3D0ZA 3TJGA 1GUKA 4ID0A 3C1RA 3QMXA 5F0GA 3A5IA 3GIXA 3O6TA 4OCEA 4XRDA 4QL9A 3UBLA 5ECKB 1ACVA 5HQPA 3TKSE 2MYGA 1TKDB 3F6FA 5ECQB 2NBSA 3HHVA 5G1LA 2O89A 1PMTA 4EDYA 1QQ2A 2A4HA 1SJ6A 3UBKA 4N0VA 2X64A 5EY6A 2H73A 1THOA 5HFKA 1UN2A 2FNOA 1T3BA 2PPTA 4OFNA 1E6BA 3GH6A 4RQRA 5D9WA 1GNWA 2YPMA 1WOUA 4OWYA 4GQFA 4F0BA 1WRYA 1ZYNA 2FWEA 5CAXA 3HVVA 1LBKA 6GSVA 2GQMA 4ZB6A 2KUCA 2PU9C 5A4UA 4IELA 2B7JA 2VO4A 1YZXA 1A2MA 1QXHA 2G2QA 3IPZA 4DVCA 1WWJA 20GSA 5FHIA 1G6YA 2WZ9A 4NXIA 1VF3A 2V2GA 2FCHA 2GTUA 1M9AA 1ZCPA 6GSTA 3EINA 1UVZA 2AV4A 4GLTA 4BL7A 3FZ5A 3QDNA 1ZYQB 2HFDA 5J3RA 4RI6A 4ML6A 1T00A 1K0CA 1GUMA 5AISA 3FRCA 1TK0B 1B8XA 2LV3A 2LEGA 2FD3A 5CP1A 2F51A 1SD9A 2A2SA 3APQA 3PPUA 2WGRA 1EWXA 3A3TA 1DE2A 1TXXA 2PMTA 2GQLA 4DSQA 2R6KA 1MEKA 1Z5YE 2K8SA 4WF4A 1KBNA 2DMLA 8GSSA 2HYXA 3F3QA 1K3YA 5L71A 3CSJA 1GTUA 3A5WA 1GSSA 4GSNA 3QAWA 5CRWA 3I9V2 4WR4A 4JR4A 1GTIA 5AIVA 4KDUA 1GSEA 4PTSA 4G19A 3GSTA 5F05A 3HVSA 2C4JA 4NHWA 3EU3A 1XVWA 4CDOA 3F63A 2YWIA 3GHAA 2IFQA 4WXTA 2J9HA 2HI7A 2HRAA 2R4VA 2DJJA 5J5NA 3EMPA 1NHOA 1OKTA 4KAEA 3A2XA 4ML1A 1THXA 2EIQA 4YQMA 1XW9A 2H1GA 1W4VA 1F37A 2HLSA 3P7XA 2X99A 3ZFBA 3LORA 4PNFA 2CZ3A 4BWQA 4Q5QA 5JCWA 1TW9A 5ECPB 2LJKA 2PVOC 1HQOA 4XIHA 1TP9A 3BOAA 2ZCTA 2MMNA 1OC3A 2FWGA 4V2LA 4ACSA 3UEMA 3IRAA 2RIIA 1GSDA 5D73A 1XIYA 2MZCA 3LYPA 1YKCA 2WB9A 1T1VA 1ZZYA 3U5RE 2VAFA 3HD5A 3H93A 1B9YC 5KN3A 3VI7A 4TN8A 2GLRA 2M72A 3WGXA 3CYNA 4GF0A 2C80A 3GL5A 1TI3A 4EF0A 3KP9A 2VCQA 5LD0A 3H1NA 1XVQA 2IL3A 1WP0A 1EZKA 4O5RA 2O8VB 4MDCA 3CXGA 5CRGA 5C00A 1LJRA 3GRXA 3HY2A 4MH3A 2VLUA 6GSYA 3A2VA 4MCUA 1E2YA 3A2WA 1XCCA 1TDIA 4A5PA 9GSSA 1TRWA 1XW5A 4J56E 5GZZB 3Q19A 1M99A 3WD6A 4PUFC 22GSA 3ERFA 2LRNA 4LMVA 1CQHA 2CX4A 1PL2A 5AGYA 2R5GA 4OFTA 2E2MA 3PR8A 4LA1A 4ZILA 2TIRA 1QGVA 2MBTA 3NOFA 2H01A 3HYPA 4G10A 2M46A 4KNDA 5G31A 5CNWA 1AC1A 2LQQA 1SU9A 5IM9A 3M9KA 3PGTA 4CY8A 1JLVA 1F9MA 1UA5A 3VPQA 3GUSA 4YAVA 1W89A 3QR6A 2K9FA 3Q6OA 1ZMAA 4PQ1A 1MD3A 2FWHA 2KOKA 5ENUA 5ECSA 1YKAA 5JWRB 3IE3A 4HOJA 4KA0A 5AN1A 1Z9HA 2EIRA 2DJ3A 3Q74A 2FGXA 3RHBA 1XWBA 5KN1A 6GSUA 4NWYA 1FO5A 2I81A 3TRQA 3N9JA 5LNKe 3RBTA 2YJHA 1F6MC 4DSRA 2HZEB 1HYUA 1RQMA 4OO4A 4G0IA 3D4MA 4PGTA 1DSBA 2V1MA 4E8EA 3HJMA 1OKDA 4IVFA 1CQGA 3VK9A 3KCMA 4O92A 2IMDA 1VGLA 3ZVJD 2H70A 4MF7A 4K9ZA 4PXOA 3ZTLA 2MBSA 4IW9A 5DJLA 4KGIA 2H6XA 3W8JA 3BJ5A 5ECOB 3VWXA 2B6MA 3TKSC 4YKGA 3IHQA 3EYTA 2MMZA 2RUEA 5B6NA 1B48A 3GX8A 1V9WA 2VLVA 2IMFA 4ZL7A 4Q5RA 4AJ6A 1XWAA 5CYYA 3RAZA 1MDIA 1R5AA 4BVXA 1JHBA 4EO3A 2OKAA 3FKFA 1YQ1A 3GKXA 2VD0A 4X0XA 1DE1A 4MLYA 1XWKA 5G5FA 1M2DA 2L4QA 2WJUA 5HFGA 3TOUA 3DGQA 1GTBA 2GZYA 4KSOA 1GSQA 3GYKA 2R0PA 5FT3A 3TRXA 4PURA 3D6IA 3L78A 18GSA 1XW6A 1TRUA 5CRHA 5BMUA 2YZHA 3ISOA 3RDWA 2F3MA 2P5RA 4F9ZA 1QUWA 1ERVA 4QL7A 1Z3EA 2VL2C 5ELAA 4NV5A 1X0RA 4QQ7A 2QKEA 4F2IA 4POLA 4XRAA 3TKQA 3RPNA 2GSTA 4K2XA 4USSA 4FO5A 2KLXA 2GVPA 3D4TA 3LG6A 2AHEA 4KDYA 3FZAA 2REMA 1ZYPA 3LSZA 4G2EA 5HR3A 1HNAA 4KUNA 5ECNB 4KCEA 4MA9A 2L5LA 4EDZA 6GSWA 2IMKA 1Q98A 5B7CA 3VWWA 2GZPA 1M2AA 2RM5A 3TJKA 2CT6A 4NMUA 4HI7A 2VL2A 4GCIA 2V6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZO A;  3E0U A;  2R2J A;  1A2J A;  4O32 A;  3UL3 A;  1FAA A;  3ZL5 A;  4K7O A;  2H30 A;  5JWO B;  3L9S A;  1SL1 B;  1KTE A;  1ST9 A;  1RK4 A;  1XOB A;  3LJR A;  4EL1 A;  4JZQ A;  3FY7 A;  2OA7 A;  4V2N A;  3HA9 A;  1X9M B;  5ECR B;  3F0I A;  1DUG A;  1PX6 A;  2AUV A;  1GTA A;  1ON4 A;  2KP1 A;  3MDK A;  5D9V A;  1PL1 A;  1EGO A;  4ECI A;  5D9T A;  1SJI A;  4JRR A;  4Z7X A;  3C73 A;  3VLN A;  4BVY A;  3QD9 A;  3GFK A;  4EUY A;  2ON5 A;  5GSS A;  1O81 A;  4BA7 A;  1EOG A;  3TJF A;  4EKZ A;  4IBP A;  3ZLP A;  3CRU A;  3D21 A;  4FIW A;  1K0O A;  4IGJ A;  2JSZ A;  3G7J A;  4TR3 A;  2GZZ A;  1URM A;  2WDU A;  2LTK A;  4F0C A;  2PN8 A;  2BMX A;  4POB A;  5H5Q A;  3FZ9 A;  4WEY A;  2ZNM A;  3GTU B;  3LFL A;  2HZF A;  2V32 A;  4ZB8 A;  4K0G A;  2JL4 A;  2ES7 A;  3KTB A;  1O85 A;  3DEX A;  1A8Y A;  2K6V A;  4KW6 A;  2YCD A;  1YEX A;  3FR9 A;  4N10 A;  3TUE A;  4MH2 A;  2LRT A;  4I8B A;  5J41 A;  5CRE A;  2OAC A;  5KN2 A;  4OD7 A;  5INY A;  1XXU A;  4L0W A;  3ZRE A;  3CSI A;  1XFL A;  3MAK A;  1BG5 A;  3L0H A;  3GTU A;  2XC2 A;  5IMZ A;  2TRX A;  3KMN A;  4YQU A;  4X43 A;  4HEA 2;  4KDX A;  4TR1 B;  4D73 B;  1A24 A;  4IJI A;  2IFQ B;  2PWJ A;  4K7N A;  4AGS A;  1AQX A;  3HJP A;  2MMA A;  2YN1 A;  3KMO A;  1PX7 A;  4F82 A;  2I9H A;  5DCH A;  3OR5 A;  4ZBA A;  4MZB A;  3I43 A;  4IKH A;  5D9X A;  1JZR A;  5ECL B;  3FEU A;  4LLR A;  4TR1 A;  5COH A;  1J08 A;  1T4Y A;  1PN9 A;  5HR2 A;  3FHK A;  4D73 A;  3C7M A;  1S3A A;  2OE1 A;  3PH9 A;  5G2Z A;  3EWL A;  1PSQ A;  2BJX A;  2CX3 A;  3EMX A;  4MP4 A;  5F07 A;  1GNE A;  1KNG A;  2H6Y A;  5LCZ A;  3EVI A;  4PQI A;  1J0F A;  2AAW A;  3W6G A;  3F8U A;  4K6X A;  4PUA A;  1ERT A;  4AF2 A;  3GMF A;  4MJC A;  2VD1 A;  1MTC A;  2DIY A;  2IMI A;  2VM1 A;  1GSY A;  1UC7 A;  1Z6M A;  12GS A;  3FZ4 A;  3DRN A;  1TK5 B;  3I69 A;  4DEJ A;  2NTO A;  1V98 A;  1SK2 A;  1Y25 A;  2V6K A;  3KH9 A;  1IYI A;  4MZW A;  3IAM 2;  1EV9 A;  1U3I A;  2OE0 A;  2RLI A;  4K1F A;  4J57 E;  1JZW A;  2QSI A;  5IPG A;  4AJ7 A;  2VOC A;  3ZZX A;  1AUC A;  4ILF A;  4PNG A;  2R3X A;  2VCW A;  3BCK A;  1SYX A;  3TJB A;  1SJZ A;  6GSS A;  4MF5 A;  5H5S A;  3GSS A;  2NVL A;  2YOI A;  2WCI A;  4PQH A;  3CTF A;  2H1D A;  2H71 A;  2LUS A;  2GT5 A;  3QAG A;  1A23 A;  3F4S A;  5DDL A;  2VL9 A;  1F2E A;  4HZ4 A;  1EOH A;  4J2F A;  14GS A;  1ZGN A;  2M80 A;  3LQ7 A;  2XPD A;  2GSS A;  1AXD A;  3F4T A;  3N5O A;  4HQS A;  2L6C A;  2JZS A;  4POM A;  4CHS A;  4RUV A;  1V57 A;  2YJ7 A;  5IO0 A;  5A4W A;  3J7Y k;  3QOU A;  3SWL A;  4XCS A;  2JZR A;  2HXK A;  4DSS A;  1FG4 A;  1TRS A;  2CZ2 A;  3QAV A;  5DBQ A;  3HKR A;  2LS5 A;  4WR5 A;  4KX4 A;  3G9B A;  1EV4 A;  2RUF A;  1N8J A;  1OC8 A;  2B7K A;  4HS1 A;  1DBY A;  2LQO A;  1ABA A;  3G7I A;  3IK7 A;  1GSF A;  3ZMK A;  3IBH A;  1I9D A;  1ZOF A;  4OCF A;  1EEJ A;  4JU5 A;  1A0F A;  4KE3 A;  3APO A;  2GGT A;  2H75 A;  7GSS A;  2GSQ A;  1SKW B;  1O73 A;  2VLT A;  2HE3 A;  3VFI A;  1GRX A;  4F03 A;  1VRS D;  3IAS 2;  2LJR A;  3KH7 A;  2YV7 A;  5DQS A;  3GL3 A;  1M7T A;  5ID2 A;  2VM2 A;  1JLW A;  3DVX A;  1FOV A;  2CQ9 A;  3TDG A;  2GSR A;  5DAK A;  3ZFL A;  5IMD A;  1AW9 A;  2I3Y A;  2C0G A;  2F8F A;  4TOP A;  5C04 A;  2L59 A;  4FYB A;  2N5B A;  2L4C A;  3VWU A;  4ECB A;  3ZYW A;  4NV2 A;  2IPA A;  1R5P A;  1PGT A;  3VI5 A;  2HRF A;  4X1U A;  2VUP A;  3WGD A;  2B5E A;  5IMV A;  2F9S A;  2H76 A;  4LL1 B;  2C3N A;  4V1A g;  2CVB A;  1Y6E A;  2LKU A;  4GTU A;  1J9B A;  1GLP A;  1F3B A;  4H86 A;  3GKM A;  4ISD A;  3F9U A;  1JZD A;  3EU4 A;  1I5G A;  1PKZ A;  3F4R A;  6GSX A;  4XS4 A;  3DIE A;  5GAN D;  1V58 A;  2HRN A;  2FHE A;  1NM3 A;  2C0E A;  4K8M A;  1U6T A;  1TU8 A;  5KN0 A;  16GS A;  2GQK A;  2B3S A;  3K8N A;  1EP8 A;  3FR6 A;  3MWH A;  2PUK C;  2G0F A;  4TXV A;  3M9J A;  2HT9 A;  3UIW A;  1FHE A;  4WET A;  3IV4 A;  1HNC A;  4MAB A;  5B8A A;  2XBI A;  3DKS A;  1WE0 A;  4BPY A;  3HZ4 A;  2KP2 A;  5A4V A;  2VCV A;  2A4V A;  4HQZ A;  1FVK A;  2H66 A;  2Z9S A;  5DCG A;  1YDK A;  4TXO B;  1Z6N A;  4EC0 A;  4FYC A;  3M0F A;  4NHZ A;  3GN3 A;  3QCP A;  1SL0 B;  3WT2 A;  5D8I A;  4TR0 A;  4G9H A;  4KB3 A;  1AQW A;  2IN3 A;  1WJK A;  2H1A A;  4TRX A;  4N11 A;  1U87 A;  1R26 A;  4TVE A;  1Q4J A;  1PQN A;  3DXB A;  4ZXG A;  1ML6 A;  2X8G A;  3MNG A;  5IOX A;  5DQY A;  2ZUP A;  2VCX A;  1K0B A;  1H4O A;  3GA4 A;  1OC9 B;  4TXO A;  5ABR A;  2VL3 A;  1EGR A;  1C72 A;  2FLS A;  3IK9 A;  4BWS A;  3RHC A;  3LYK A;  3DVW A;  1OAZ A;  2VCT A;  1MDK A;  2X8C A;  1R7H A;  2VIM A;  5JCG A;  4TKY A;  2PGT A;  5GST A;  4OFM A;  4P3Y B;  5B8B A;  3TGZ A;  1OE8 A;  2VCZ A;  4FYU A;  5JCU A;  2CA8 A;  1G7O A;  1OYJ A;  11GS A;  2C0F A;  5ECI B;  3APS A;  4MJB A;  3L4N A;  1OC9 A;  2LJA A;  3GKN A;  4RI7 A;  3MSZ A;  2XBQ A;  2E2G A;  4POK A;  4ZL9 A;  4MZC A;  4HUA A;  1TJD A;  1VF2 A;  2L5O A;  4L8E A;  5G30 A;  1SKS B;  3BD2 A;  3C1S A;  2X8H A;  3AY8 A;  3TCO A;  4IQ1 A;  2H72 A;  2D2Z A;  3P90 A;  1NW2 A;  2I4A A;  5DJM A;  1G6W A;  3CTG A;  3KEB A;  1FVJ A;  3CSH A;  1G7E A;  2B1K A;  3TB2 A;  3HJO A;  4LMW A;  5D96 A;  2HSH A;  2I1U A;  4PX1 A;  4JED A;  5IOW A;  2E0Q A;  3F6D A;  2XPE A;  3I6A A;  3H4K A;  2K18 A;  5F06 A;  2WUL A;  3UVT A;  1TU7 A;  1NHY A;  3C8E A;  2MMO A;  3JCM L;  1XBS A;  5J9C A;  1K0D A;  5B6M A;  2JAD A;  2DIZ A;  2NDO A;  4GSS A;  3IC4 A;  1GH2 A;  3QPM A;  1T7P B;  2IME A;  2H6Z A;  3LXZ A;  1G0T A;  1B4Q A;  1GUL A;  1O8X A;  2DJ1 A;  4GXZ A;  5JWQ B;  3O3T A;  3KD0 A;  4ULX A;  2YP6 A;  4IHU A;  4MK3 A;  1EEM A;  2P31 A;  3UVH A;  2C0D A;  1K3O A;  1TI1 A;  2PVQ A;  5F8B A;  3ZIV A;  1GSU A;  4IS0 A;  2XHF A;  2AJQ B;  3GH9 A;  4ZBD A;  1MD4 A;  3HDC A;  1H75 A;  2JU5 A;  3KXO A;  4AJ8 A;  5DAL B;  3LXT A;  2EC4 A;  3TOT A;  3UJ1 A;  1SK0 A;  1ZYE A;  3PIN A;  4JBB A;  2YWM A;  2JZT A;  4I5Q A;  2KHP A;  1B4P A;  4TW5 A;  2O7K A;  2FA4 A;  1WIK A;  5G1K A;  4LL4 B;  4XS6 A;  3ZIT A;  5IQY A;  1XWG A;  4HU9 A;  4GRF A;  4HJ2 A;  1O7U A;  3DML A;  5IO2 A;  1F3A A;  5IMF A;  1GP1 A;  5DAL A;  4IN0 A;  3LGC A;  2YAN A;  4EE0 A;  2JSY A;  5H5R A;  2OBK A;  5HFI A;  5HR1 A;  2HNL A;  5KEJ A;  3EUR A;  1VF4 A;  17GS A;  1A8L A;  2DJK A;  3FYG A;  4I2U A;  2H0H A;  3P8W A;  4WBR D;  4Q5F A;  4TR4 A;  1SEN A;  4RQX A;  2AB6 A;  1Z7P A;  1BYE A;  1EP7 A;  1SYR A;  4KSM A;  2B1L A;  3E3E A;  5CRD A;  4IP6 A;  2CVK A;  1PD2 1;  1BJX A;  1X9W B;  1KEB A;  1XZO A;  3ZIJ A;  3GX0 A;  2H0G A;  3IDV A;  5DVB A;  4L5O A;  1BAY A;  4KH7 A;  3HZ8 A;  2E7P A;  1A2L A;  3UAR A;  3G7Y A;  2PBJ A;  2N5A A;  4K2D A;  5GAP D;  2NPB A;  4MPF A;  3P2A A;  2WFC A;  2R37 A;  3U6V A;  3F3R A;  4K7I A;  3L9V A;  5CO3 A;  5IIZ A;  2H19 A;  3TKP A;  1A0R P;  4DSS B;  4E8H A;  4MMM A;  1K0N A;  3WT1 A;  2CAI A;  3L9U A;  1K0M A;  1FB0 A;  3H8Q A;  3SBC A;  2GT6 A;  1FW1 A;  1JFU A;  1BQ7 A;  1YF0 A;  3GV1 A;  1TRV A;  2DBC A;  1X5C A;  2FUG 2;  3CRT A;  3H79 A;  1FB6 A;  3VPT A;  2H0I A;  1HD2 A;  4HZ2 A;  4XTS A;  1YY7 A;  19GS A;  2O87 A;  1AAZ A;  3LEF A;  1O8W A;  2OBI A;  3QFA C;  2CV4 A;  3RPP A;  1TOF A;  2DSA A;  3V1W A;  1WPI A;  2L6D A;  4JE1 A;  3ERW A;  3QFB C;  1X9S B;  2IWT A;  2WS2 A;  3KZQ A;  3Q18 A;  2C1Y A;  3IXR A;  4IP1 A;  4NPB A;  2J23 A;  5ID2 B;  2HSY A;  1YEP A;  4EVM A;  1TK8 B;  3ZRD A;  2FY6 A;  5J4U A;  1SL2 B;  3EE2 A;  3M3M A;  2YV9 A;  10GS A;  4MF6 A;  4XS1 A;  2F8A A;  5DAK B;  4ECJ A;  1OVN A;  5J9B A;  2DMM A;  3ED3 A;  4MJE A;  1T4Z A;  1M9B A;  2LRC A;  4OO5 A;  4WF5 A;  1R4W A;  1VF1 A;  1USB A;  1X5D A;  4GST A;  1K0A A;  1AQV A;  1XWC A;  1U88 A;  3FW2 A;  4CW9 A;  2B5Y A;  2CVD A;  3HVX A;  4HJM A;  4IQA A;  2C3Q A;  5FWG A;  2LNT A;  3KM6 A;  5A5K A;  3KJY A;  3TJJ A;  4V1A p;  4N30 A;  3CBU A;  1XOA A;  2P0G A;  3C71 A;  4ZB9 A;  1S3D A;  3J7Y b;  2TRC P;  1K3L A;  2H8L A;  5IPH A;  1QK8 A;  4XS4 B;  2A2R A;  2GDR A;  5EVO A;  4HDE A;  3IOS A;  2YZU A;  1U3A A;  2LNS A;  2DLX A;  4MJA A;  3CMI A;  5E59 A;  4I97 A;  4EXJ A;  3D5J A;  2V41 A;  4FH8 A;  4L0U A;  3EC3 A;  3GUR A;  3ME7 A;  2P5Q A;  4Q5N A;  4WBJ A;  4ZBB A;  2QGV A;  2L57 A;  3WGE A;  2JAC A;  3FK8 A;  3GKK A;  1MDJ A;  5G5E A;  13GS A;  2HZE A;  1N2A A;  1GL8 A;  4ZL8 A;  3DD3 A;  2AYT A;  3KTL A;  2OJL A;  1SKR B;  1IYH A;  2C8U A;  1XPV A;  3S9F A;  2FWF A;  1TTZ A;  4GQC A;  4YQV A;  2DJ2 A;  5HR0 A;  5IMA A;  2YNX A;  3HCZ A;  5ECM B;  3R2Q A;  2FA8 A;  2ON7 A;  4I6X A;  1HNB A;  5ELG A;  1ERW A;  1SK1 A;  2O85 A;  4OMV A;  3KIJ A;  5EL8 A;  1RW1 A;  3IR4 A;  2DC5 A;  3BBY A;  5EPF A;  2CAQ A;  3HXS A;  3NIV A;  1PA3 A;  2PER A;  1WMJ A;  2QC7 A;  3LWA A;  1GUH A;  3TRP A;  2H1B A;  4HU7 A;  3ZML A;  3KGK A;  4JR6 A;  1ZL9 A;  3TKR A;  4ZIJ A;  3E9J B;  5D93 A;  1M0U A;  1SD8 A;  2OAD A;  1B9X C;  4ECC A;  1GLQ A;  1QMV A;  4O7H A;  1PKW A;  3BCI A;  3WYW A;  2YWN A;  3TKS A;  2GS3 A;  2OE3 A;  3ME8 A;  3NZN A;  2YWO A;  4GWR A;  2IJY A;  2WRT A;  1PRX A;  5E4W A;  1V40 A;  5AIX A;  4IJ3 A;  2RM6 A;  4K0N A;  1V2A A;  2B5X A;  4L5L A;  3ERG A;  1LU4 A;  2LST A;  1Z7R A;  2N5F A;  3DWV A;  4YH2 A;  3US3 A;  1QFN A;  2C3T A;  1BX9 A;  1GWC A;  3FR3 A;  2DJ0 A;  1M2B A;  1OE7 A;  3VWV A;  3IA1 A;  3UMA A;  3UOM A;  5ECH B;  2K8V A;  2IIY A;  3UAP A;  4V2M A;  1T8E B;  4MPG A;  3D22 A;  3M8N A;  4XHM A;  1ILO A;  1BED A;  1NSW A;  3M1G A;  4I2T A;  1S3C A;  3ZVJ A;  3O76 A;  4YAP A;  3W8S A;  3VUR A;  1YF1 A;  2BTO T;  4WKW A;  1AIU A;  1YJ6 A;  1O6J A;  3KP8 A;  4NAX A;  2ALB A;  2H74 A;  2EIO A;  3GNJ A;  5IMC A;  3DYR A;  4KCA A;  1X5E A;  1ERU A;  4N0Z A;  3D0Z A;  3TJG A;  1GUK A;  4ID0 A;  3C1R A;  3QMX A;  5F0G A;  3GIX A;  3O6T A;  4OCE A;  4XRD A;  4QL9 A;  3UBL A;  5ECK B;  1ACV A;  5HQP A;  3TKS E;  2MYG A;  1TKD B;  3F6F A;  5ECQ B;  2NBS A;  3HHV A;  5G1L A;  2O89 A;  1PMT A;  4EDY A;  1QQ2 A;  1SJ6 A;  3UBK A;  4N0V A;  2X64 A;  5EY6 A;  2H73 A;  1THO A;  5HFK A;  1UN2 A;  2FNO A;  1T3B A;  2PPT A;  4OFN A;  1E6B A;  3GH6 A;  4RQR A;  5D9W A;  1GNW A;  2YPM A;  1WOU A;  4OWY A;  4GQF A;  4F0B A;  1WRY A;  2FWE A;  5CAX A;  3HVV A;  1LBK A;  6GSV A;  2GQM A;  4ZB6 A;  2KUC A;  2PU9 C;  5A4U A;  4IEL A;  2B7J A;  2VO4 A;  1YZX A;  1A2M A;  1QXH A;  2G2Q A;  3IPZ A;  4DVC A;  1WWJ A;  20GS A;  5FHI A;  1G6Y A;  2WZ9 A;  4NXI A;  1VF3 A;  2V2G A;  2FCH A;  2GTU A;  1M9A A;  1ZCP A;  6GST A;  3EIN A;  1UVZ A;  2AV4 A;  4GLT A;  4BL7 A;  3FZ5 A;  3QDN A;  1ZYQ B;  2HFD A;  5J3R A;  4RI6 A;  4ML6 A;  1T00 A;  1K0C A;  1GUM A;  5AIS A;  3FRC A;  1TK0 B;  1B8X A;  2LV3 A;  2LEG A;  2FD3 A;  5CP1 A;  2F51 A;  1SD9 A;  2A2S A;  3APQ A;  2WGR A;  1EWX A;  3A3T A;  1DE2 A;  1TXX A;  2PMT A;  2GQL A;  4DSQ A;  2R6K A;  1MEK A;  1Z5Y E;  2K8S A;  4WF4 A;  1KBN A;  2DML A;  8GSS A;  2HYX A;  3F3Q A;  1K3Y A;  5L71 A;  3CSJ A;  1GTU A;  3A5W A;  1GSS A;  4GSN A;  3QAW A;  5CRW A;  3I9V 2;  4WR4 A;  4JR4 A;  1GTI A;  5AIV A;  4KDU A;  1GSE A;  4G19 A;  3GST A;  5F05 A;  3HVS A;  2C4J A;  4NHW A;  3EU3 A;  1XVW A;  4CDO A;  3F63 A;  2YWI A;  3GHA A;  2IFQ A;  4WXT A;  2J9H A;  2HI7 A;  2R4V A;  2DJJ A;  5J5N A;  3EMP A;  1NHO A;  1OKT A;  4KAE A;  3A2X A;  4ML1 A;  1THX A;  2EIQ A;  4YQM A;  1XW9 A;  2H1G A;  1W4V A;  1F37 A;  2HLS A;  3P7X A;  2X99 A;  3ZFB A;  3LOR A;  4PNF A;  2CZ3 A;  4BWQ A;  4Q5Q A;  5JCW A;  1TW9 A;  5ECP B;  2LJK A;  2PVO C;  1HQO A;  4XIH A;  1TP9 A;  3BOA A;  2ZCT A;  2MMN A;  1OC3 A;  2FWG A;  4V2L A;  4ACS A;  3UEM A;  3IRA A;  2RII A;  1GSD A;  5D73 A;  1XIY A;  2MZC A;  3LYP A;  1YKC A;  2WB9 A;  1T1V A;  1ZZY A;  3U5R E;  2VAF A;  3HD5 A;  3H93 A;  1B9Y C;  5KN3 A;  3VI7 A;  4TN8 A;  2GLR A;  2M72 A;  3WGX A;  3CYN A;  4GF0 A;  2C80 A;  3GL5 A;  1TI3 A;  4EF0 A;  3KP9 A;  2VCQ A;  5LD0 A;  3H1N A;  1XVQ A;  2IL3 A;  1WP0 A;  1EZK A;  4O5R A;  2O8V B;  4MDC A;  3CXG A;  5CRG A;  5C00 A;  1LJR A;  3GRX A;  3HY2 A;  4MH3 A;  2VLU A;  6GSY A;  3A2V A;  4MCU A;  1E2Y A;  3A2W A;  1XCC A;  1TDI A;  9GSS A;  1TRW A;  1XW5 A;  4J56 E;  5GZZ B;  3Q19 A;  1M99 A;  3WD6 A;  4PUF C;  22GS A;  3ERF A;  2LRN A;  4LMV A;  1CQH A;  2CX4 A;  1PL2 A;  5AGY A;  2R5G A;  4OFT A;  2E2M A;  3PR8 A;  4LA1 A;  4ZIL A;  2TIR A;  1QGV A;  2MBT A;  3NOF A;  2H01 A;  3HYP A;  4G10 A;  2M46 A;  4KND A;  5G31 A;  5CNW A;  1AC1 A;  2LQQ A;  1SU9 A;  5IM9 A;  3M9K A;  3PGT A;  1JLV A;  1F9M A;  1UA5 A;  3VPQ A;  3GUS A;  4YAV A;  1W89 A;  3QR6 A;  2K9F A;  3Q6O A;  1ZMA A;  4PQ1 A;  1MD3 A;  2FWH A;  2KOK A;  5ENU A;  5ECS A;  1YKA A;  5JWR B;  3IE3 A;  4HOJ A;  4KA0 A;  5AN1 A;  1Z9H A;  2EIR A;  2DJ3 A;  3Q74 A;  2FGX A;  3RHB A;  1XWB A;  5KN1 A;  6GSU A;  4NWY A;  1FO5 A;  2I81 A;  3TRQ A;  3N9J A;  5LNK e;  3RBT A;  2YJH A;  1F6M C;  4DSR A;  2HZE B;  1HYU A;  1RQM A;  4OO4 A;  3D4M A;  4PGT A;  1DSB A;  2V1M A;  4E8E A;  3HJM A;  1OKD A;  4IVF A;  1CQG A;  3VK9 A;  3KCM A;  4O92 A;  2IMD A;  1VGL A;  3ZVJ D;  2H70 A;  4MF7 A;  4K9Z A;  4PXO A;  3ZTL A;  2MBS A;  4IW9 A;  5DJL A;  4KGI A;  2H6X A;  3W8J A;  3BJ5 A;  5ECO B;  3VWX A;  2B6M A;  3TKS C;  3IHQ A;  3EYT A;  2MMZ A;  2RUE A;  5B6N A;  1B48 A;  3GX8 A;  1V9W A;  2VLV A;  2IMF A;  4ZL7 A;  4Q5R A;  4AJ6 A;  1XWA A;  5CYY A;  3RAZ A;  1MDI A;  1R5A A;  4BVX A;  1JHB A;  4EO3 A;  2OKA A;  3FKF A;  1YQ1 A;  3GKX A;  2VD0 A;  4X0X A;  1DE1 A;  4MLY A;  1XWK A;  5G5F A;  1M2D A;  2L4Q A;  2WJU A;  5HFG A;  3TOU A;  3DGQ A;  1GTB A;  2GZY A;  4KSO A;  1GSQ A;  3GYK A;  5FT3 A;  3TRX A;  4PUR A;  3D6I A;  3L78 A;  18GS A;  1XW6 A;  1TRU A;  5CRH A;  2YZH A;  3ISO A;  3RDW A;  2F3M A;  2P5R A;  4F9Z A;  1QUW A;  1ERV A;  4QL7 A;  1Z3E A;  2VL2 C;  5ELA A;  4NV5 A;  1X0R A;  4QQ7 A;  2QKE A;  4F2I A;  4POL A;  4XRA A;  3TKQ A;  3RPN A;  2GST A;  4FO5 A;  2KLX A;  2GVP A;  3D4T A;  3LG6 A;  2AHE A;  4KDY A;  3FZA A;  2REM A;  3LSZ A;  4G2E A;  5HR3 A;  1HNA A;  4KUN A;  5ECN B;  4KCE A;  4MA9 A;  2L5L A;  4EDZ A;  6GSW A;  2IMK A;  1Q98 A;  5B7C A;  3VWW A;  2GZP A;  1M2A A;  2RM5 A;  3TJK A;  2CT6 A;  4NMU A;  4HI7 A;  2VL2 A;  4GCI A;  2V6O A; 
#chains in the Genus database with same CATH topology
 1JZO A;  3E0U A;  2R2J A;  1A2J A;  4O32 A;  3UL3 A;  1FAA A;  3ZL5 A;  4K7O A;  2H30 A;  5JWO B;  3L9S A;  1SL1 B;  1KTE A;  1ST9 A;  1RK4 A;  1XOB A;  3LJR A;  4EL1 A;  4JZQ A;  3FY7 A;  2OA7 A;  4V2N A;  3HA9 A;  1X9M B;  5ECR B;  3F0I A;  1DUG A;  1PX6 A;  2AUV A;  1GTA A;  1ON4 A;  2KP1 A;  3MDK A;  5D9V A;  1PL1 A;  1EGO A;  4ECI A;  5D9T A;  1SJI A;  4JRR A;  4Z7X A;  3C73 A;  3VLN A;  4BVY A;  3QD9 A;  3GFK A;  4EUY A;  2ON5 A;  5GSS A;  1O81 A;  4BA7 A;  1EOG A;  3TJF A;  4EKZ A;  4IBP A;  3ZLP A;  3CRU A;  3D21 A;  4FIW A;  4BL7 B;  1K0O A;  4IGJ A;  2JSZ A;  3G7J A;  4TR3 A;  2GZZ A;  1URM A;  2WDU A;  2LTK A;  4F0C A;  2PN8 A;  2BMX A;  4POB A;  5H5Q A;  3FZ9 A;  2HRK A;  4WEY A;  2ZNM A;  3GTU B;  3LFL A;  2HZF A;  2V32 A;  4ZB8 A;  4K0G A;  2JL4 A;  2ES7 A;  3KTB A;  1O85 A;  3DEX A;  1A8Y A;  2K6V A;  4O5U A;  4KW6 A;  2YCD A;  1YEX A;  3FR9 A;  2QA2 A;  4N10 A;  3LW9 A;  3TUE A;  4MH2 A;  2LRT A;  4Z2T A;  4I8B A;  5J41 A;  5CRE A;  2OAC A;  5KN2 A;  4OD7 A;  5INY A;  1XXU A;  4L0W A;  3ZRE A;  3CSI A;  1XFL A;  3MAK A;  1BG5 A;  3L0H A;  3GTU A;  2XC2 A;  5IMZ A;  2TRX A;  3KMN A;  4YQU A;  4X43 A;  4HEA 2;  4KDX A;  4TR1 B;  4D73 B;  1A24 A;  4IJI A;  2IFQ B;  2PWJ A;  4K7N A;  4AGS A;  1AQX A;  3HJP A;  2MMA A;  2YN1 A;  3KMO A;  1PX7 A;  4F82 A;  2I9H A;  5DCH A;  3OR5 A;  4ZBA A;  4MZB A;  3I43 A;  4IKH A;  5D9X A;  1JZR A;  5ECL B;  3FEU A;  4LLR A;  4TR1 A;  5COH A;  1J08 A;  1T4Y A;  1PN9 A;  5HR2 A;  3FHK A;  4D73 A;  3C7M A;  2UZ8 A;  1S3A A;  2OE1 A;  3PH9 A;  5G2Z A;  3EWL A;  1PSQ A;  2BJX A;  2CX3 A;  3EMX A;  4MP4 A;  5F07 A;  1GNE A;  1KNG A;  2H6Y A;  5LCZ A;  3EVI A;  4PQI A;  1J0F A;  2AAW A;  3W6G A;  3F8U A;  4K6X A;  4PUA A;  1ERT A;  4AF2 A;  3GMF A;  4MJC A;  2VD1 A;  1MTC A;  2DIY A;  2IMI A;  2VM1 A;  1GSY A;  1UC7 A;  1Z6M A;  12GS A;  3FZ4 A;  3FMW A;  3DRN A;  1TK5 B;  3I69 A;  4DEJ A;  2NTO A;  1V98 A;  1SK2 A;  1Y25 A;  2V6K A;  3KH9 A;  1IYI A;  4MZW A;  3IAM 2;  1EV9 A;  1U3I A;  2OE0 A;  2RLI A;  4K1F A;  4J57 E;  1JZW A;  2QSI A;  5IPG A;  4AJ7 A;  2VOC A;  3ZZX A;  1AUC A;  4ILF A;  3EPT A;  4PNG A;  2R3X A;  2VCW A;  3BCK A;  1SYX A;  3TJB A;  1SJZ A;  6GSS A;  4MF5 A;  5H5S A;  3GSS A;  2NVL A;  2YOI A;  2WCI A;  4PQH A;  3CTF A;  2H1D A;  2H71 A;  2LUS A;  2GT5 A;  3QAG A;  1A23 A;  3F4S A;  5DDL A;  2VL9 A;  1F2E A;  4HZ4 A;  1EOH A;  4J2F A;  14GS A;  1ZGN A;  2M80 A;  3LQ7 A;  2XPD A;  2GSS A;  1AXD A;  3F4T A;  3N5O A;  4HQS A;  2L6C A;  2JZS A;  4POM A;  4CHS A;  4RUV A;  1V57 A;  2YJ7 A;  5IO0 A;  5A4W A;  3J7Y k;  3QOU A;  3SWL A;  4XCS A;  2JZR A;  2HXK A;  4DSS A;  1FG4 A;  1TRS A;  2CZ2 A;  3QAV A;  5DBQ A;  3HKR A;  2LS5 A;  4WR5 A;  4KX4 A;  3G9B A;  1EV4 A;  2RUF A;  1N8J A;  1OC8 A;  2B7K A;  4HS1 A;  1DBY A;  2LQO A;  1ABA A;  3G7I A;  3IK7 A;  1GSF A;  3ZMK A;  3IBH A;  1I9D A;  1ZOF A;  4OCF A;  1EEJ A;  4JU5 A;  1A0F A;  4KE3 A;  3APO A;  2HSM A;  2GGT A;  2H75 A;  7GSS A;  2GSQ A;  1SKW B;  1O73 A;  2VLT A;  2HE3 A;  3VFI A;  1GRX A;  4BIK A;  4F03 A;  4ICY A;  1VRS D;  3IAS 2;  2LJR A;  3KH7 A;  2YV7 A;  5DQS A;  3GL3 A;  1M7T A;  5ID2 A;  4O5Q A;  2VM2 A;  1JLW A;  3DVX A;  1FOV A;  2CQ9 A;  3TDG A;  2GSR A;  5DAK A;  3ZFL A;  5IMD A;  1AW9 A;  2I3Y A;  2C0G A;  2F8F A;  4TOP A;  5C04 A;  2L59 A;  4FYB A;  2N5B A;  2L4C A;  1PN0 A;  3VWU A;  4ECB A;  3ZYW A;  4NV2 A;  2IPA A;  1R5P A;  1PGT A;  3VI5 A;  2HRF A;  4X1U A;  2VUP A;  3WGD A;  2B5E A;  5IMV A;  4BVX B;  2F9S A;  2H76 A;  4LL1 B;  2C3N A;  4V1A g;  2CVB A;  1Y6E A;  2LKU A;  4GTU A;  1J9B A;  1GLP A;  1F3B A;  4H86 A;  3GKM A;  4ISD A;  3F9U A;  1JZD A;  3EU4 A;  1I5G A;  1PKZ A;  3F4R A;  4K5R A;  6GSX A;  4XS4 A;  3DIE A;  5GAN D;  1V58 A;  2HRN A;  2FHE A;  1NM3 A;  2C0E A;  4K8M A;  1U6T A;  1TU8 A;  4G0K A;  5KN0 A;  16GS A;  2GQK A;  2B3S A;  4CY6 A;  3K8N A;  1EP8 A;  3FR6 A;  3MWH A;  2PUK C;  2G0F A;  4TXV A;  4YKF A;  3M9J A;  2HT9 A;  3UIW A;  1FHE A;  4WET A;  3IV4 A;  1HNC A;  4MAB A;  5B8A A;  2XBI A;  3DKS A;  1WE0 A;  4BPY A;  3HZ4 A;  2KP2 A;  5A4V A;  2VCV A;  2A4V A;  4HQZ A;  1FVK A;  5KOX A;  2H66 A;  2Z9S A;  5DCG A;  1YDK A;  4TXO B;  1Z6N A;  4EC0 A;  4FYC A;  3M0F A;  4NHZ A;  3GN3 A;  3QCP A;  1SL0 B;  3WT2 A;  5D8I A;  4TR0 A;  4G9H A;  4KB3 A;  1AQW A;  2IN3 A;  1WJK A;  2H1A A;  4TRX A;  4N11 A;  4G0L A;  1U87 A;  1R26 A;  4TVE A;  1Q4J A;  1PQN A;  3DXB A;  4ZXG A;  1ML6 A;  1FOH A;  2X8G A;  3MNG A;  5DQY A;  5IOX A;  2ZUP A;  2VCX A;  1K0B A;  1H4O A;  3GA4 A;  1OC9 B;  4TXO A;  5ABR A;  2VL3 A;  1EGR A;  1C72 A;  2DKH A;  2FLS A;  3IK9 A;  4BWS A;  3RHC A;  3LYK A;  3DVW A;  1OAZ A;  2VCT A;  1MDK A;  2X8C A;  1R7H A;  2VIM A;  5JCG A;  4TKY A;  2PGT A;  5GST A;  4OFM A;  4P3Y B;  5B8B A;  3TGZ A;  1OE8 A;  2VCZ A;  4FYU A;  5JCU A;  2CA8 A;  1G7O A;  1OYJ A;  11GS A;  2C0F A;  5ECI B;  3APS A;  4MJB A;  3L4N A;  1OC9 A;  2LJA A;  3GKN A;  4BVY B;  4RI7 A;  3MSZ A;  2XBQ A;  2QA1 A;  2E2G A;  4POK A;  4Z2U A;  2A2P A;  4MZC A;  4ZL9 A;  4HUA A;  1TJD A;  1VF2 A;  2L5O A;  4L8E A;  5G30 A;  1SKS B;  3BD2 A;  3C1S A;  2X8H A;  3AY8 A;  3TCO A;  4IQ1 A;  2H72 A;  2D2Z A;  3P90 A;  1NW2 A;  2I4A A;  5DJM A;  4X4J A;  1G6W A;  3CTG A;  3KEB A;  1FVJ A;  3CSH A;  1G7E A;  2B1K A;  3TB2 A;  3HJO A;  4LMW A;  5D96 A;  2HSH A;  2I1U A;  4PX1 A;  4JED A;  5IOW A;  2E0Q A;  3F6D A;  2XPE A;  3I6A A;  3H4K A;  2K18 A;  5F06 A;  2WUL A;  1XG8 A;  3UVT A;  1TU7 A;  1NHY A;  3C8E A;  2MMO A;  3JCM L;  1XBS A;  5J9C A;  1K0D A;  5B6M A;  2JAD A;  2DIZ A;  2NDO A;  4GSS A;  3IC4 A;  1GH2 A;  3QPM A;  1T7P B;  2X49 A;  2IME A;  2H6Z A;  3LXZ A;  1G0T A;  1B4Q A;  1M3J A;  1GUL A;  1O8X A;  2DJ1 A;  4GXZ A;  5JWQ B;  3O3T A;  3KD0 A;  4ULX A;  2YP6 A;  4IHU A;  4MK3 A;  1EEM A;  2P31 A;  3UVH A;  2C0D A;  1K3O A;  1TI1 A;  2PVQ A;  5F8B A;  3ZIV A;  1GSU A;  5BRT A;  4IS0 A;  2XHF A;  2AJQ B;  3GH9 A;  4ZBD A;  1MD4 A;  3HDC A;  1H75 A;  2JU5 A;  3KXO A;  4AJ8 A;  5DAL B;  3LXT A;  2EC4 A;  3TOT A;  3UJ1 A;  1SK0 A;  1ZYE A;  3PIN A;  4JBB A;  2YWM A;  2JZT A;  4I5Q A;  2KHP A;  1B4P A;  4TW5 A;  2O7K A;  2FA4 A;  1WIK A;  5G1K A;  4LL4 B;  4XS6 A;  3ZIT A;  5IQY A;  1XWG A;  4HU9 A;  4GRF A;  4HJ2 A;  1O7U A;  3DML A;  5IO2 A;  1F3A A;  5IMF A;  1GP1 A;  5DAL A;  4IN0 A;  3LGC A;  2YAN A;  4EE0 A;  2JSY A;  5H5R A;  2OBK A;  5HFI A;  5HR1 A;  2HNL A;  5KEJ A;  3EUR A;  1VF4 A;  17GS A;  1A8L A;  2DJK A;  3FYG A;  4I2U A;  4K5S A;  2H0H A;  3P8W A;  4WBR D;  4Q5F A;  4TR4 A;  1SEN A;  4RQX A;  2AB6 A;  1Z7P A;  1BYE A;  1EP7 A;  1SYR A;  4KSM A;  2B1L A;  3E3E A;  5CRD A;  4IP6 A;  2CVK A;  1PD2 1;  1BJX A;  3HVN A;  1X9W B;  1KEB A;  1XZO A;  3ZIJ A;  3GX0 A;  2H0G A;  3IDV A;  5DVB A;  4L5O A;  3MYD A;  1BAY A;  4KH7 A;  3HZ8 A;  1M3I A;  2E7P A;  1A2L A;  3UAR A;  3G7Y A;  4KF9 A;  3CQF A;  2PBJ A;  2N5A A;  4K2D A;  5GAP D;  3IC8 A;  2NPB A;  4MPF A;  3P2A A;  2WFC A;  2R37 A;  3U6V A;  3F3R A;  4K7I A;  3L9V A;  5CO3 A;  5IIZ A;  2H19 A;  3TKP A;  1A0R P;  4DSS B;  4E8H A;  4MMM A;  1K0N A;  3WT1 A;  2CAI A;  3L9U A;  1K0M A;  1FB0 A;  3H8Q A;  3SBC A;  2GT6 A;  1FW1 A;  1JFU A;  1BQ7 A;  1YF0 A;  3GV1 A;  1TRV A;  2DBC A;  1X5C A;  2FUG 2;  3CRT A;  3H79 A;  1FB6 A;  3VPT A;  2H0I A;  1HD2 A;  4HZ2 A;  4XTS A;  1YY7 A;  19GS A;  2O87 A;  1AAZ A;  3LEF A;  1O8W A;  2OBI A;  3QFA C;  2CV4 A;  3RPP A;  1TOF A;  2DSA A;  3V1W A;  1WPI A;  2L6D A;  4JE1 A;  3ERW A;  3QFB C;  1X9S B;  2IWT A;  2WS2 A;  3KZQ A;  3Q18 A;  2C1Y A;  3IXR A;  4IP1 A;  4NPB A;  2J23 A;  5ID2 B;  2HSY A;  1YEP A;  4EVM A;  1TK8 B;  3ZRD A;  2FY6 A;  5J4U A;  1SL2 B;  3EE2 A;  3M3M A;  2YV9 A;  10GS A;  4MF6 A;  4XS1 A;  2F8A A;  5DAK B;  4ECJ A;  1OVN A;  5J9B A;  2DMM A;  2DKI A;  3ED3 A;  4MJE A;  1T4Z A;  1M9B A;  2LRC A;  4OO5 A;  4WF5 A;  1R4W A;  1VF1 A;  1USB A;  3R3E A;  1X5D A;  4GST A;  1K0A A;  1AQV A;  1XWC A;  1U88 A;  3FW2 A;  4CW9 A;  2B5Y A;  2CVD A;  3HVX A;  4HJM A;  4IQA A;  2C3Q A;  5FWG A;  2LNT A;  3KM6 A;  5A5K A;  3KJY A;  3TJJ A;  2R0C A;  4V1A p;  4N30 A;  3CBU A;  1XOA A;  2P0G A;  3C71 A;  4ZB9 A;  1S3D A;  3J7Y b;  2TRC P;  4EIP A;  1K3L A;  2H8L A;  5IPH A;  1QK8 A;  2X4A A;  4XS4 B;  2A2R A;  2GDR A;  5EVO A;  4HDE A;  3IOS A;  2YZU A;  1U3A A;  2LNS A;  2DLX A;  4MJA A;  3CMI A;  5E59 A;  4I97 A;  4EXJ A;  3D5J A;  2V41 A;  4FH8 A;  4L0U A;  3EC3 A;  3GUR A;  3ME7 A;  2P5Q A;  4Q5N A;  4WBJ A;  4ZBB A;  2QGV A;  2L57 A;  3WGE A;  2JAC A;  3FK8 A;  3GKK A;  1MDJ A;  5G5E A;  13GS A;  3IHG A;  2HZE A;  1N2A A;  1GL8 A;  4ZL8 A;  3DD3 A;  2AYT A;  3KTL A;  2OJL A;  1SKR B;  1IYH A;  2C8U A;  1XPV A;  3S9F A;  2FWF A;  1TTZ A;  4GQC A;  4YQV A;  2DJ2 A;  5HR0 A;  5IMA A;  2YNX A;  3HCZ A;  5ECM B;  3R2Q A;  2FA8 A;  2ON7 A;  4I6X A;  5KOW A;  1HNB A;  5ELG A;  1ERW A;  1SK1 A;  2O85 A;  4OMV A;  3KIJ A;  5EL8 A;  1RW1 A;  3IR4 A;  2DC5 A;  3BBY A;  5EPF A;  2CAQ A;  3HXS A;  4EIQ A;  3NIV A;  1PA3 A;  2PER A;  1WMJ A;  2QC7 A;  3LWA A;  1GUH A;  3TRP A;  2H1B A;  4FQU A;  4HU7 A;  3ZML A;  3KGK A;  4JR6 A;  1ZL9 A;  3TKR A;  4ZIJ A;  3E9J B;  5D93 A;  4Z2R A;  1M0U A;  1SD8 A;  4MNN A;  2OAD A;  1B9X C;  4ECC A;  1GLQ A;  1QMV A;  4O7H A;  1PKW A;  3BCI A;  3WYW A;  2YWN A;  3TKS A;  2GS3 A;  2OE3 A;  3ME8 A;  3NZN A;  2YWO A;  4GWR A;  2IJY A;  2WRT A;  1PRX A;  3MIX A;  5E4W A;  1V40 A;  5AIX A;  4IJ3 A;  2RM6 A;  4K0N A;  1V2A A;  2B5X A;  4L5L A;  3ERG A;  1LU4 A;  2LST A;  1Z7R A;  2N5F A;  3DWV A;  4YH2 A;  3US3 A;  1QFN A;  2C3T A;  1BX9 A;  1GWC A;  3FR3 A;  2DJ0 A;  1M2B A;  1OE7 A;  3VWV A;  3IA1 A;  3UMA A;  3UOM A;  5ECH B;  2K8V A;  2IIY A;  3UAP A;  4V2M A;  1T8E B;  4MPG A;  3D22 A;  3M8N A;  4XHM A;  1ILO A;  1BED A;  1NSW A;  3M1G A;  4I2T A;  1S3C A;  3ZVJ A;  3O76 A;  4YAP A;  3W8S A;  3VUR A;  1YF1 A;  2BTO T;  4WKW A;  1AIU A;  2R0G A;  1YJ6 A;  1O6J A;  3KP8 A;  4NAX A;  2ALB A;  2H74 A;  2EIO A;  3GNJ A;  5IMC A;  3DYR A;  4KCA A;  1X5E A;  1ERU A;  4N0Z A;  3D0Z A;  3TJG A;  1GUK A;  4ID0 A;  3C1R A;  3QMX A;  5F0G A;  3A5I A;  3GIX A;  3O6T A;  4OCE A;  4XRD A;  4QL9 A;  3UBL A;  5ECK B;  1ACV A;  5HQP A;  3TKS E;  2MYG A;  1TKD B;  3F6F A;  5ECQ B;  2NBS A;  3HHV A;  5G1L A;  2O89 A;  1PMT A;  4EDY A;  1QQ2 A;  2A4H A;  1SJ6 A;  3UBK A;  4N0V A;  2X64 A;  5EY6 A;  2H73 A;  1THO A;  5HFK A;  1UN2 A;  2FNO A;  1T3B A;  2PPT A;  4OFN A;  1E6B A;  3GH6 A;  4RQR A;  5D9W A;  1GNW A;  2YPM A;  1WOU A;  4OWY A;  4GQF A;  4F0B A;  1WRY A;  1ZYN A;  2FWE A;  5CAX A;  4HSC X;  3HVV A;  1LBK A;  6GSV A;  2GQM A;  4ZB6 A;  2KUC A;  2PU9 C;  5A4U A;  4IEL A;  2B7J A;  2VO4 A;  1YZX A;  1A2M A;  1QXH A;  2G2Q A;  3IPZ A;  4DVC A;  1WWJ A;  20GS A;  5FHI A;  1G6Y A;  2WZ9 A;  4NXI A;  1VF3 A;  2V2G A;  2FCH A;  2GTU A;  1M9A A;  1ZCP A;  6GST A;  3EIN A;  1UVZ A;  2AV4 A;  4GLT A;  4BL7 A;  3FZ5 A;  3QDN A;  1ZYQ B;  2HFD A;  5J3R A;  4RI6 A;  4ML6 A;  1T00 A;  1K0C A;  1GUM A;  5AIS A;  3FRC A;  1TK0 B;  1B8X A;  2LV3 A;  2LEG A;  2FD3 A;  5CP1 A;  2F51 A;  1SD9 A;  2A2S A;  3APQ A;  3PPU A;  2WGR A;  1EWX A;  3A3T A;  1DE2 A;  1TXX A;  1PFO A;  2PMT A;  2GQL A;  4DSQ A;  2R6K A;  1MEK A;  1Z5Y E;  2K8S A;  4WF4 A;  1KBN A;  2DML A;  8GSS A;  2HYX A;  3F3Q A;  1K3Y A;  5L71 A;  3CSJ A;  1GTU A;  3A5W A;  1GSS A;  4GSN A;  3QAW A;  5CRW A;  3I9V 2;  4WR4 A;  4JR4 A;  1GTI A;  5AIV A;  4KDU A;  1GSE A;  4PTS A;  4G19 A;  3GST A;  5F05 A;  3HVS A;  2C4J A;  4NHW A;  3EU3 A;  1XVW A;  4CDO A;  3F63 A;  2YWI A;  3GHA A;  2IFQ A;  4WXT A;  2J9H A;  2HI7 A;  2HRA A;  2R4V A;  2DJJ A;  5J5N A;  3EMP A;  1NHO A;  1OKT A;  4KAE A;  3A2X A;  4ML1 A;  1THX A;  2EIQ A;  4YQM A;  1XW9 A;  2H1G A;  1W4V A;  1F37 A;  2HLS A;  3P7X A;  2X99 A;  3ZFB A;  3LOR A;  4PNF A;  2CZ3 A;  4BWQ A;  4Q5Q A;  5JCW A;  1TW9 A;  5ECP B;  2LJK A;  2PVO C;  1HQO A;  4XIH A;  1TP9 A;  3BOA A;  2ZCT A;  2MMN A;  1OC3 A;  2FWG A;  4V2L A;  4ACS A;  3UEM A;  3IRA A;  2RII A;  1GSD A;  5D73 A;  1XIY A;  2MZC A;  3LYP A;  1YKC A;  2WB9 A;  1T1V A;  1ZZY A;  3U5R E;  2VAF A;  3HD5 A;  3H93 A;  1B9Y C;  5KN3 A;  3VI7 A;  4TN8 A;  2GLR A;  2M72 A;  3WGX A;  3CYN A;  4GF0 A;  2C80 A;  3GL5 A;  1TI3 A;  4EF0 A;  3KP9 A;  2VCQ A;  5LD0 A;  3H1N A;  1XVQ A;  2IL3 A;  1WP0 A;  1EZK A;  4O5R A;  2O8V B;  4MDC A;  3CXG A;  5CRG A;  5C00 A;  1LJR A;  3GRX A;  3HY2 A;  4MH3 A;  2VLU A;  6GSY A;  3A2V A;  4MCU A;  1E2Y A;  3A2W A;  1XCC A;  1TDI A;  4A5P A;  9GSS A;  1TRW A;  1XW5 A;  4J56 E;  5GZZ B;  3Q19 A;  1M99 A;  3WD6 A;  4PUF C;  22GS A;  3ERF A;  2LRN A;  4LMV A;  1CQH A;  2CX4 A;  1PL2 A;  5AGY A;  2R5G A;  4OFT A;  2E2M A;  3PR8 A;  4LA1 A;  4ZIL A;  2TIR A;  1QGV A;  2MBT A;  3NOF A;  2H01 A;  3HYP A;  4G10 A;  2M46 A;  4KND A;  5G31 A;  5CNW A;  1AC1 A;  2LQQ A;  1SU9 A;  5IM9 A;  3M9K A;  3PGT A;  4CY8 A;  1JLV A;  1F9M A;  1UA5 A;  3VPQ A;  3GUS A;  4YAV A;  1W89 A;  3QR6 A;  2K9F A;  3Q6O A;  1ZMA A;  4PQ1 A;  1MD3 A;  2FWH A;  2KOK A;  5ENU A;  5ECS A;  1YKA A;  5JWR B;  3IE3 A;  4HOJ A;  4KA0 A;  5AN1 A;  1Z9H A;  2EIR A;  2DJ3 A;  3Q74 A;  2FGX A;  3RHB A;  1XWB A;  5KN1 A;  6GSU A;  4NWY A;  1FO5 A;  2I81 A;  3TRQ A;  3N9J A;  5LNK e;  3RBT A;  2YJH A;  1F6M C;  4DSR A;  2HZE B;  1HYU A;  1RQM A;  4OO4 A;  4G0I A;  3D4M A;  4PGT A;  1DSB A;  2V1M A;  4E8E A;  3HJM A;  1OKD A;  4IVF A;  1CQG A;  3VK9 A;  3KCM A;  4O92 A;  2IMD A;  1VGL A;  3ZVJ D;  2H70 A;  4MF7 A;  4K9Z A;  4PXO A;  3ZTL A;  2MBS A;  4IW9 A;  5DJL A;  4KGI A;  2H6X A;  3W8J A;  3BJ5 A;  5ECO B;  3VWX A;  2B6M A;  3TKS C;  4YKG A;  3IHQ A;  3EYT A;  2MMZ A;  2RUE A;  5B6N A;  1B48 A;  3GX8 A;  1V9W A;  2VLV A;  2IMF A;  4ZL7 A;  4Q5R A;  4AJ6 A;  1XWA A;  5CYY A;  3RAZ A;  1MDI A;  1R5A A;  4BVX A;  1JHB A;  4EO3 A;  2OKA A;  3FKF A;  1YQ1 A;  3GKX A;  2VD0 A;  4X0X A;  1DE1 A;  4MLY A;  1XWK A;  5G5F A;  1M2D A;  2L4Q A;  2WJU A;  5HFG A;  3TOU A;  3DGQ A;  1GTB A;  2GZY A;  4KSO A;  1GSQ A;  3GYK A;  2R0P A;  5FT3 A;  3TRX A;  4PUR A;  3D6I A;  3L78 A;  18GS A;  1XW6 A;  1TRU A;  5CRH A;  5BMU A;  2YZH A;  3ISO A;  3RDW A;  2F3M A;  2P5R A;  4F9Z A;  1QUW A;  1ERV A;  4QL7 A;  1Z3E A;  2VL2 C;  5ELA A;  4NV5 A;  1X0R A;  4QQ7 A;  2QKE A;  4F2I A;  4POL A;  4XRA A;  3TKQ A;  3RPN A;  2GST A;  4K2X A;  4USS A;  4FO5 A;  2KLX A;  2GVP A;  3D4T A;  3LG6 A;  2AHE A;  4KDY A;  3FZA A;  2REM A;  1ZYP A;  3LSZ A;  4G2E A;  5HR3 A;  1HNA A;  4KUN A;  5ECN B;  4KCE A;  1S3R A;  4MA9 A;  2L5L A;  4EDZ A;  6GSW A;  2IMK A;  1Q98 A;  5B7C A;  3VWW A;  2GZP A;  1M2A A;  2RM5 A;  3TJK A;  2CT6 A;  4NMU A;  4HI7 A;  2VL2 A;  4GCI A;  2V6O A; 
#chains in the Genus database with same CATH homology
 1JZO A;  3E0U A;  2R2J A;  1A2J A;  4O32 A;  3UL3 A;  1FAA A;  3ZL5 A;  4K7O A;  2H30 A;  5JWO B;  3L9S A;  1SL1 B;  1KTE A;  1ST9 A;  1RK4 A;  1XOB A;  3LJR A;  4EL1 A;  4JZQ A;  3FY7 A;  2OA7 A;  4V2N A;  3HA9 A;  1X9M B;  5ECR B;  3F0I A;  1DUG A;  1PX6 A;  2AUV A;  1GTA A;  1ON4 A;  2KP1 A;  3MDK A;  5D9V A;  1PL1 A;  1EGO A;  4ECI A;  5D9T A;  1SJI A;  4JRR A;  4Z7X A;  3C73 A;  3VLN A;  4BVY A;  3QD9 A;  3GFK A;  4EUY A;  2ON5 A;  5GSS A;  1O81 A;  4BA7 A;  1EOG A;  3TJF A;  4EKZ A;  4IBP A;  3ZLP A;  3CRU A;  3D21 A;  4FIW A;  4BL7 B;  1K0O A;  4IGJ A;  2JSZ A;  3G7J A;  4TR3 A;  2GZZ A;  1URM A;  2WDU A;  2LTK A;  4F0C A;  2PN8 A;  2BMX A;  4POB A;  5H5Q A;  3FZ9 A;  2HRK A;  4WEY A;  2ZNM A;  3GTU B;  3LFL A;  2HZF A;  2V32 A;  4ZB8 A;  4K0G A;  2JL4 A;  2ES7 A;  3KTB A;  1O85 A;  3DEX A;  1A8Y A;  2K6V A;  4O5U A;  4KW6 A;  2YCD A;  1YEX A;  3FR9 A;  2QA2 A;  4N10 A;  3LW9 A;  3TUE A;  4MH2 A;  2LRT A;  4Z2T A;  4I8B A;  5J41 A;  5CRE A;  2OAC A;  5KN2 A;  4OD7 A;  5INY A;  1XXU A;  4L0W A;  3ZRE A;  3CSI A;  1XFL A;  3MAK A;  1BG5 A;  3L0H A;  3GTU A;  2XC2 A;  5IMZ A;  2TRX A;  3KMN A;  4YQU A;  4X43 A;  4HEA 2;  4KDX A;  4TR1 B;  4D73 B;  1A24 A;  4IJI A;  2IFQ B;  2PWJ A;  4K7N A;  4AGS A;  1AQX A;  3HJP A;  2MMA A;  2YN1 A;  3KMO A;  1PX7 A;  4F82 A;  2I9H A;  5DCH A;  3OR5 A;  4ZBA A;  4MZB A;  3I43 A;  4IKH A;  5D9X A;  1JZR A;  5ECL B;  3FEU A;  4LLR A;  4TR1 A;  5COH A;  1J08 A;  1T4Y A;  1PN9 A;  5HR2 A;  3FHK A;  4D73 A;  3C7M A;  2UZ8 A;  1S3A A;  2OE1 A;  3PH9 A;  5G2Z A;  3EWL A;  1PSQ A;  2BJX A;  2CX3 A;  3EMX A;  4MP4 A;  5F07 A;  1GNE A;  1KNG A;  2H6Y A;  5LCZ A;  3EVI A;  4PQI A;  1J0F A;  2AAW A;  3W6G A;  3F8U A;  4K6X A;  4PUA A;  1ERT A;  4AF2 A;  3GMF A;  4MJC A;  2VD1 A;  1MTC A;  2DIY A;  2IMI A;  2VM1 A;  1GSY A;  1UC7 A;  1Z6M A;  12GS A;  3FZ4 A;  3FMW A;  3DRN A;  1TK5 B;  3I69 A;  4DEJ A;  2NTO A;  1V98 A;  1SK2 A;  1Y25 A;  2V6K A;  3KH9 A;  1IYI A;  4MZW A;  3IAM 2;  1EV9 A;  1U3I A;  2OE0 A;  2RLI A;  4K1F A;  4J57 E;  1JZW A;  2QSI A;  5IPG A;  4AJ7 A;  2VOC A;  3ZZX A;  1AUC A;  4ILF A;  3EPT A;  4PNG A;  2R3X A;  2VCW A;  3BCK A;  1SYX A;  3TJB A;  1SJZ A;  6GSS A;  4MF5 A;  5H5S A;  3GSS A;  2NVL A;  2YOI A;  2WCI A;  4PQH A;  3CTF A;  2H1D A;  2H71 A;  2LUS A;  2GT5 A;  3QAG A;  1A23 A;  3F4S A;  5DDL A;  2VL9 A;  1F2E A;  4HZ4 A;  1EOH A;  4J2F A;  14GS A;  1ZGN A;  2M80 A;  3LQ7 A;  2XPD A;  2GSS A;  1AXD A;  3F4T A;  3N5O A;  4HQS A;  2L6C A;  2JZS A;  4POM A;  4CHS A;  4RUV A;  1V57 A;  2YJ7 A;  5IO0 A;  5A4W A;  3J7Y k;  3QOU A;  3SWL A;  4XCS A;  2JZR A;  2HXK A;  4DSS A;  1FG4 A;  1TRS A;  2CZ2 A;  3QAV A;  5DBQ A;  3HKR A;  2LS5 A;  4WR5 A;  4KX4 A;  3G9B A;  1EV4 A;  2RUF A;  1N8J A;  1OC8 A;  2B7K A;  4HS1 A;  1DBY A;  2LQO A;  1ABA A;  3G7I A;  3IK7 A;  1GSF A;  3ZMK A;  3IBH A;  1I9D A;  1ZOF A;  4OCF A;  1EEJ A;  4JU5 A;  1A0F A;  4KE3 A;  3APO A;  2HSM A;  2GGT A;  2H75 A;  7GSS A;  2GSQ A;  1SKW B;  1O73 A;  2VLT A;  2HE3 A;  3VFI A;  1GRX A;  4F03 A;  4ICY A;  1VRS D;  3IAS 2;  2LJR A;  3KH7 A;  2YV7 A;  5DQS A;  3GL3 A;  1M7T A;  5ID2 A;  4O5Q A;  2VM2 A;  1JLW A;  3DVX A;  1FOV A;  2CQ9 A;  3TDG A;  2GSR A;  5DAK A;  3ZFL A;  5IMD A;  1AW9 A;  2I3Y A;  2C0G A;  2F8F A;  4TOP A;  5C04 A;  2L59 A;  4FYB A;  2N5B A;  2L4C A;  1PN0 A;  3VWU A;  4ECB A;  3ZYW A;  4NV2 A;  2IPA A;  1R5P A;  1PGT A;  3VI5 A;  2HRF A;  4X1U A;  2VUP A;  3WGD A;  2B5E A;  5IMV A;  4BVX B;  2F9S A;  2H76 A;  4LL1 B;  2C3N A;  4V1A g;  2CVB A;  1Y6E A;  2LKU A;  4GTU A;  1J9B A;  1GLP A;  1F3B A;  4H86 A;  3GKM A;  4ISD A;  3F9U A;  1JZD A;  3EU4 A;  1I5G A;  1PKZ A;  3F4R A;  4K5R A;  6GSX A;  4XS4 A;  3DIE A;  5GAN D;  1V58 A;  2HRN A;  2FHE A;  1NM3 A;  2C0E A;  4K8M A;  1U6T A;  1TU8 A;  4G0K A;  5KN0 A;  16GS A;  2GQK A;  2B3S A;  4CY6 A;  3K8N A;  1EP8 A;  3FR6 A;  3MWH A;  2PUK C;  2G0F A;  4TXV A;  4YKF A;  3M9J A;  2HT9 A;  3UIW A;  1FHE A;  4WET A;  3IV4 A;  1HNC A;  4MAB A;  5B8A A;  2XBI A;  3DKS A;  1WE0 A;  4BPY A;  3HZ4 A;  2KP2 A;  5A4V A;  2VCV A;  2A4V A;  4HQZ A;  1FVK A;  5KOX A;  2H66 A;  2Z9S A;  5DCG A;  1YDK A;  4TXO B;  1Z6N A;  4EC0 A;  4FYC A;  3M0F A;  4NHZ A;  3GN3 A;  3QCP A;  1SL0 B;  3WT2 A;  5D8I A;  4TR0 A;  4G9H A;  4KB3 A;  1AQW A;  2IN3 A;  1WJK A;  2H1A A;  4TRX A;  4N11 A;  4G0L A;  1U87 A;  1R26 A;  4TVE A;  1Q4J A;  1PQN A;  3DXB A;  4ZXG A;  1ML6 A;  1FOH A;  2X8G A;  3MNG A;  5DQY A;  5IOX A;  2ZUP A;  2VCX A;  1K0B A;  1H4O A;  3GA4 A;  1OC9 B;  4TXO A;  5ABR A;  2VL3 A;  1EGR A;  1C72 A;  2DKH A;  2FLS A;  3IK9 A;  4BWS A;  3RHC A;  3LYK A;  3DVW A;  1OAZ A;  2VCT A;  1MDK A;  2X8C A;  1R7H A;  2VIM A;  5JCG A;  4TKY A;  2PGT A;  5GST A;  4OFM A;  4P3Y B;  5B8B A;  3TGZ A;  1OE8 A;  2VCZ A;  4FYU A;  5JCU A;  2CA8 A;  1G7O A;  1OYJ A;  11GS A;  2C0F A;  5ECI B;  3APS A;  4MJB A;  3L4N A;  1OC9 A;  2LJA A;  3GKN A;  4BVY B;  4RI7 A;  3MSZ A;  2XBQ A;  2QA1 A;  2E2G A;  4POK A;  4Z2U A;  2A2P A;  4MZC A;  4ZL9 A;  4HUA A;  1TJD A;  1VF2 A;  2L5O A;  4L8E A;  5G30 A;  1SKS B;  3BD2 A;  3C1S A;  2X8H A;  3AY8 A;  3TCO A;  4IQ1 A;  2H72 A;  2D2Z A;  3P90 A;  1NW2 A;  2I4A A;  5DJM A;  4X4J A;  1G6W A;  3CTG A;  3KEB A;  1FVJ A;  3CSH A;  1G7E A;  2B1K A;  3TB2 A;  3HJO A;  4LMW A;  5D96 A;  2HSH A;  2I1U A;  4PX1 A;  4JED A;  5IOW A;  2E0Q A;  3F6D A;  2XPE A;  3I6A A;  3H4K A;  2K18 A;  5F06 A;  2WUL A;  3UVT A;  1TU7 A;  1NHY A;  3C8E A;  2MMO A;  3JCM L;  1XBS A;  5J9C A;  1K0D A;  5B6M A;  2JAD A;  2DIZ A;  2NDO A;  4GSS A;  3IC4 A;  1GH2 A;  3QPM A;  1T7P B;  2X49 A;  2IME A;  2H6Z A;  3LXZ A;  1G0T A;  1B4Q A;  1GUL A;  1O8X A;  2DJ1 A;  4GXZ A;  5JWQ B;  3O3T A;  3KD0 A;  4ULX A;  2YP6 A;  4IHU A;  4MK3 A;  1EEM A;  2P31 A;  3UVH A;  2C0D A;  1K3O A;  1TI1 A;  2PVQ A;  5F8B A;  3ZIV A;  1GSU A;  5BRT A;  4IS0 A;  2XHF A;  2AJQ B;  3GH9 A;  4ZBD A;  1MD4 A;  3HDC A;  1H75 A;  2JU5 A;  3KXO A;  4AJ8 A;  5DAL B;  3LXT A;  2EC4 A;  3TOT A;  3UJ1 A;  1SK0 A;  1ZYE A;  3PIN A;  4JBB A;  2YWM A;  2JZT A;  4I5Q A;  2KHP A;  1B4P A;  4TW5 A;  2O7K A;  2FA4 A;  1WIK A;  5G1K A;  4LL4 B;  4XS6 A;  3ZIT A;  5IQY A;  1XWG A;  4HU9 A;  4GRF A;  4HJ2 A;  1O7U A;  3DML A;  5IO2 A;  1F3A A;  5IMF A;  1GP1 A;  5DAL A;  4IN0 A;  3LGC A;  2YAN A;  4EE0 A;  2JSY A;  5H5R A;  2OBK A;  5HFI A;  5HR1 A;  2HNL A;  5KEJ A;  3EUR A;  1VF4 A;  17GS A;  1A8L A;  2DJK A;  3FYG A;  4I2U A;  4K5S A;  2H0H A;  3P8W A;  4WBR D;  4Q5F A;  4TR4 A;  1SEN A;  4RQX A;  2AB6 A;  1Z7P A;  1BYE A;  1EP7 A;  1SYR A;  4KSM A;  2B1L A;  3E3E A;  5CRD A;  4IP6 A;  2CVK A;  1PD2 1;  1BJX A;  1X9W B;  1KEB A;  1XZO A;  3ZIJ A;  3GX0 A;  2H0G A;  3IDV A;  5DVB A;  4L5O A;  3MYD A;  1BAY A;  4KH7 A;  3HZ8 A;  2E7P A;  1A2L A;  3UAR A;  3G7Y A;  4KF9 A;  2PBJ A;  2N5A A;  4K2D A;  5GAP D;  3IC8 A;  2NPB A;  4MPF A;  3P2A A;  2WFC A;  2R37 A;  3U6V A;  3F3R A;  4K7I A;  3L9V A;  5CO3 A;  5IIZ A;  2H19 A;  3TKP A;  1A0R P;  4DSS B;  4E8H A;  4MMM A;  1K0N A;  3WT1 A;  2CAI A;  3L9U A;  1K0M A;  1FB0 A;  3H8Q A;  3SBC A;  2GT6 A;  1FW1 A;  1JFU A;  1BQ7 A;  1YF0 A;  3GV1 A;  1TRV A;  2DBC A;  1X5C A;  2FUG 2;  3CRT A;  3H79 A;  1FB6 A;  3VPT A;  2H0I A;  1HD2 A;  4HZ2 A;  4XTS A;  1YY7 A;  19GS A;  2O87 A;  1AAZ A;  3LEF A;  1O8W A;  2OBI A;  3QFA C;  2CV4 A;  3RPP A;  1TOF A;  2DSA A;  3V1W A;  1WPI A;  2L6D A;  4JE1 A;  3ERW A;  3QFB C;  1X9S B;  2IWT A;  2WS2 A;  3KZQ A;  3Q18 A;  2C1Y A;  3IXR A;  4IP1 A;  4NPB A;  2J23 A;  5ID2 B;  2HSY A;  1YEP A;  4EVM A;  1TK8 B;  3ZRD A;  2FY6 A;  5J4U A;  1SL2 B;  3EE2 A;  3M3M A;  2YV9 A;  10GS A;  4MF6 A;  4XS1 A;  2F8A A;  5DAK B;  4ECJ A;  1OVN A;  5J9B A;  2DMM A;  2DKI A;  3ED3 A;  4MJE A;  1T4Z A;  1M9B A;  2LRC A;  4OO5 A;  4WF5 A;  1R4W A;  1VF1 A;  1USB A;  3R3E A;  1X5D A;  4GST A;  1K0A A;  1AQV A;  1XWC A;  1U88 A;  3FW2 A;  4CW9 A;  2B5Y A;  2CVD A;  3HVX A;  4HJM A;  4IQA A;  2C3Q A;  5FWG A;  2LNT A;  3KM6 A;  5A5K A;  3KJY A;  3TJJ A;  2R0C A;  4V1A p;  4N30 A;  3CBU A;  1XOA A;  2P0G A;  3C71 A;  4ZB9 A;  1S3D A;  3J7Y b;  2TRC P;  4EIP A;  1K3L A;  2H8L A;  5IPH A;  1QK8 A;  2X4A A;  4XS4 B;  2A2R A;  2GDR A;  5EVO A;  4HDE A;  3IOS A;  2YZU A;  1U3A A;  2LNS A;  2DLX A;  4MJA A;  3CMI A;  5E59 A;  4I97 A;  4EXJ A;  3D5J A;  2V41 A;  4FH8 A;  4L0U A;  3EC3 A;  3GUR A;  3ME7 A;  2P5Q A;  4Q5N A;  4WBJ A;  4ZBB A;  2QGV A;  2L57 A;  3WGE A;  2JAC A;  3FK8 A;  3GKK A;  1MDJ A;  5G5E A;  13GS A;  3IHG A;  2HZE A;  1N2A A;  1GL8 A;  4ZL8 A;  3DD3 A;  2AYT A;  3KTL A;  2OJL A;  1SKR B;  1IYH A;  2C8U A;  1XPV A;  3S9F A;  2FWF A;  1TTZ A;  4GQC A;  4YQV A;  2DJ2 A;  5HR0 A;  5IMA A;  2YNX A;  3HCZ A;  5ECM B;  3R2Q A;  2FA8 A;  2ON7 A;  4I6X A;  5KOW A;  1HNB A;  5ELG A;  1ERW A;  1SK1 A;  2O85 A;  4OMV A;  3KIJ A;  5EL8 A;  1RW1 A;  3IR4 A;  2DC5 A;  3BBY A;  5EPF A;  2CAQ A;  3HXS A;  4EIQ A;  3NIV A;  1PA3 A;  2PER A;  1WMJ A;  2QC7 A;  3LWA A;  1GUH A;  3TRP A;  2H1B A;  4FQU A;  4HU7 A;  3ZML A;  3KGK A;  4JR6 A;  1ZL9 A;  3TKR A;  4ZIJ A;  3E9J B;  5D93 A;  4Z2R A;  1M0U A;  1SD8 A;  4MNN A;  2OAD A;  1B9X C;  4ECC A;  1GLQ A;  1QMV A;  4O7H A;  1PKW A;  3BCI A;  3WYW A;  2YWN A;  3TKS A;  2GS3 A;  2OE3 A;  3ME8 A;  3NZN A;  2YWO A;  4GWR A;  2IJY A;  2WRT A;  1PRX A;  3MIX A;  5E4W A;  1V40 A;  5AIX A;  4IJ3 A;  2RM6 A;  4K0N A;  1V2A A;  2B5X A;  4L5L A;  3ERG A;  1LU4 A;  2LST A;  1Z7R A;  2N5F A;  3DWV A;  4YH2 A;  3US3 A;  1QFN A;  2C3T A;  1BX9 A;  1GWC A;  3FR3 A;  2DJ0 A;  1M2B A;  1OE7 A;  3VWV A;  3IA1 A;  3UMA A;  3UOM A;  5ECH B;  2K8V A;  2IIY A;  3UAP A;  4V2M A;  1T8E B;  4MPG A;  3D22 A;  3M8N A;  4XHM A;  1ILO A;  1BED A;  1NSW A;  3M1G A;  4I2T A;  1S3C A;  3ZVJ A;  3O76 A;  4YAP A;  3W8S A;  3VUR A;  1YF1 A;  2BTO T;  4WKW A;  1AIU A;  2R0G A;  1YJ6 A;  1O6J A;  3KP8 A;  4NAX A;  2ALB A;  2H74 A;  2EIO A;  3GNJ A;  5IMC A;  3DYR A;  4KCA A;  1X5E A;  1ERU A;  4N0Z A;  3D0Z A;  3TJG A;  1GUK A;  4ID0 A;  3C1R A;  3QMX A;  5F0G A;  3A5I A;  3GIX A;  3O6T A;  4OCE A;  4XRD A;  4QL9 A;  3UBL A;  5ECK B;  1ACV A;  5HQP A;  3TKS E;  2MYG A;  1TKD B;  3F6F A;  5ECQ B;  2NBS A;  3HHV A;  5G1L A;  2O89 A;  1PMT A;  4EDY A;  1QQ2 A;  2A4H A;  1SJ6 A;  3UBK A;  4N0V A;  2X64 A;  5EY6 A;  2H73 A;  1THO A;  5HFK A;  1UN2 A;  2FNO A;  1T3B A;  2PPT A;  4OFN A;  1E6B A;  3GH6 A;  4RQR A;  5D9W A;  1GNW A;  2YPM A;  1WOU A;  4OWY A;  4GQF A;  4F0B A;  1WRY A;  1ZYN A;  2FWE A;  5CAX A;  3HVV A;  1LBK A;  6GSV A;  2GQM A;  4ZB6 A;  2KUC A;  2PU9 C;  5A4U A;  4IEL A;  2B7J A;  2VO4 A;  1YZX A;  1A2M A;  1QXH A;  2G2Q A;  3IPZ A;  4DVC A;  1WWJ A;  20GS A;  5FHI A;  1G6Y A;  2WZ9 A;  4NXI A;  1VF3 A;  2V2G A;  2FCH A;  2GTU A;  1M9A A;  1ZCP A;  6GST A;  3EIN A;  1UVZ A;  2AV4 A;  4GLT A;  4BL7 A;  3FZ5 A;  3QDN A;  1ZYQ B;  2HFD A;  5J3R A;  4RI6 A;  4ML6 A;  1T00 A;  1K0C A;  1GUM A;  5AIS A;  3FRC A;  1TK0 B;  1B8X A;  2LV3 A;  2LEG A;  2FD3 A;  5CP1 A;  2F51 A;  1SD9 A;  2A2S A;  3APQ A;  3PPU A;  2WGR A;  1EWX A;  3A3T A;  1DE2 A;  1TXX A;  2PMT A;  2GQL A;  4DSQ A;  2R6K A;  1MEK A;  1Z5Y E;  2K8S A;  4WF4 A;  1KBN A;  2DML A;  8GSS A;  2HYX A;  3F3Q A;  1K3Y A;  5L71 A;  3CSJ A;  1GTU A;  3A5W A;  1GSS A;  4GSN A;  3QAW A;  5CRW A;  3I9V 2;  4WR4 A;  4JR4 A;  1GTI A;  5AIV A;  4KDU A;  1GSE A;  4PTS A;  4G19 A;  3GST A;  5F05 A;  3HVS A;  2C4J A;  4NHW A;  3EU3 A;  1XVW A;  4CDO A;  3F63 A;  2YWI A;  3GHA A;  2IFQ A;  4WXT A;  2J9H A;  2HI7 A;  2HRA A;  2R4V A;  2DJJ A;  5J5N A;  3EMP A;  1NHO A;  1OKT A;  4KAE A;  3A2X A;  4ML1 A;  1THX A;  2EIQ A;  4YQM A;  1XW9 A;  2H1G A;  1W4V A;  1F37 A;  2HLS A;  3P7X A;  2X99 A;  3ZFB A;  3LOR A;  4PNF A;  2CZ3 A;  4BWQ A;  4Q5Q A;  5JCW A;  1TW9 A;  5ECP B;  2LJK A;  2PVO C;  1HQO A;  4XIH A;  1TP9 A;  3BOA A;  2ZCT A;  2MMN A;  1OC3 A;  2FWG A;  4V2L A;  4ACS A;  3UEM A;  3IRA A;  2RII A;  1GSD A;  5D73 A;  1XIY A;  2MZC A;  3LYP A;  1YKC A;  2WB9 A;  1T1V A;  1ZZY A;  3U5R E;  2VAF A;  3HD5 A;  3H93 A;  1B9Y C;  5KN3 A;  3VI7 A;  4TN8 A;  2GLR A;  2M72 A;  3WGX A;  3CYN A;  4GF0 A;  2C80 A;  3GL5 A;  1TI3 A;  4EF0 A;  3KP9 A;  2VCQ A;  5LD0 A;  3H1N A;  1XVQ A;  2IL3 A;  1WP0 A;  1EZK A;  4O5R A;  2O8V B;  4MDC A;  3CXG A;  5CRG A;  5C00 A;  1LJR A;  3GRX A;  3HY2 A;  4MH3 A;  2VLU A;  6GSY A;  3A2V A;  4MCU A;  1E2Y A;  3A2W A;  1XCC A;  1TDI A;  4A5P A;  9GSS A;  1TRW A;  1XW5 A;  4J56 E;  5GZZ B;  3Q19 A;  1M99 A;  3WD6 A;  4PUF C;  22GS A;  3ERF A;  2LRN A;  4LMV A;  1CQH A;  2CX4 A;  1PL2 A;  5AGY A;  2R5G A;  4OFT A;  2E2M A;  3PR8 A;  4LA1 A;  4ZIL A;  2TIR A;  1QGV A;  2MBT A;  3NOF A;  2H01 A;  3HYP A;  4G10 A;  2M46 A;  4KND A;  5G31 A;  5CNW A;  1AC1 A;  2LQQ A;  1SU9 A;  5IM9 A;  3M9K A;  3PGT A;  4CY8 A;  1JLV A;  1F9M A;  1UA5 A;  3VPQ A;  3GUS A;  4YAV A;  1W89 A;  3QR6 A;  2K9F A;  3Q6O A;  1ZMA A;  4PQ1 A;  1MD3 A;  2FWH A;  2KOK A;  5ENU A;  5ECS A;  1YKA A;  5JWR B;  3IE3 A;  4HOJ A;  4KA0 A;  5AN1 A;  1Z9H A;  2EIR A;  2DJ3 A;  3Q74 A;  2FGX A;  3RHB A;  1XWB A;  5KN1 A;  6GSU A;  4NWY A;  1FO5 A;  2I81 A;  3TRQ A;  3N9J A;  5LNK e;  3RBT A;  2YJH A;  1F6M C;  4DSR A;  2HZE B;  1HYU A;  1RQM A;  4OO4 A;  4G0I A;  3D4M A;  4PGT A;  1DSB A;  2V1M A;  4E8E A;  3HJM A;  1OKD A;  4IVF A;  1CQG A;  3VK9 A;  3KCM A;  4O92 A;  2IMD A;  1VGL A;  3ZVJ D;  2H70 A;  4MF7 A;  4K9Z A;  4PXO A;  3ZTL A;  2MBS A;  4IW9 A;  5DJL A;  4KGI A;  2H6X A;  3W8J A;  3BJ5 A;  5ECO B;  3VWX A;  2B6M A;  3TKS C;  4YKG A;  3IHQ A;  3EYT A;  2MMZ A;  2RUE A;  5B6N A;  1B48 A;  3GX8 A;  1V9W A;  2VLV A;  2IMF A;  4ZL7 A;  4Q5R A;  4AJ6 A;  1XWA A;  5CYY A;  3RAZ A;  1MDI A;  1R5A A;  4BVX A;  1JHB A;  4EO3 A;  2OKA A;  3FKF A;  1YQ1 A;  3GKX A;  2VD0 A;  4X0X A;  1DE1 A;  4MLY A;  1XWK A;  5G5F A;  1M2D A;  2L4Q A;  2WJU A;  5HFG A;  3TOU A;  3DGQ A;  1GTB A;  2GZY A;  4KSO A;  1GSQ A;  3GYK A;  2R0P A;  5FT3 A;  3TRX A;  4PUR A;  3D6I A;  3L78 A;  18GS A;  1XW6 A;  1TRU A;  5CRH A;  5BMU A;  2YZH A;  3ISO A;  3RDW A;  2F3M A;  2P5R A;  4F9Z A;  1QUW A;  1ERV A;  4QL7 A;  1Z3E A;  2VL2 C;  5ELA A;  4NV5 A;  1X0R A;  4QQ7 A;  2QKE A;  4F2I A;  4POL A;  4XRA A;  3TKQ A;  3RPN A;  2GST A;  4K2X A;  4USS A;  4FO5 A;  2KLX A;  2GVP A;  3D4T A;  3LG6 A;  2AHE A;  4KDY A;  3FZA A;  2REM A;  1ZYP A;  3LSZ A;  4G2E A;  5HR3 A;  1HNA A;  4KUN A;  5ECN B;  4KCE A;  4MA9 A;  2L5L A;  4EDZ A;  6GSW A;  2IMK A;  1Q98 A;  5B7C A;  3VWW A;  2GZP A;  1M2A A;  2RM5 A;  3TJK A;  2CT6 A;  4NMU A;  4HI7 A;  2VL2 A;  4GCI A;  2V6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...