1AC1A

Dsba mutant h32l
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPLCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Disulfide oxidoreductase
molecule keywords DSBA
publication title Structural analysis of three His32 mutants of DsbA: support for an electrostatic role of His32 in DsbA stability.
pubmed rcsb
source organism Escherichia coli
total genus 63
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ac1A00
2LKUA 4OFMA 1EOGA 2LRTA 4GF0A 3IA1A 2AV4A 5HR0A 3I9V2 5LNKe 3TCOA 1XW6A 3CYNA 3EMPA 2M72A 2HSYA 2L57A 3MNGA 3GMFA 1OVNA 3Q19A 1PKZA 1TRWA 3O3TA 3A3TA 3ZIJA 4P3YB 1ZL9A 2HNLA 3QFBC 13GSA 4ZBBA 2H1GA 2IN3A 1J0FA 1GUKA 3IAM2 3HJOA 1AC1A 1Z6NA 4EDYA 5D96A 2HZFA 3BD2A 5J4UA 1HQOA 3F63A 1AUCA 4TR0A 1B9XC 2JU5A 2C8UA 5AISA 4JE1A 4HU7A 4POMA 5B6NA 3VWXA 3SBCA 4IJIA 1A24A 2V41A 5ELGA 4MH3A 1XIYA 4K7IA 3TRXA 1OAZA 2OE3A 3FEUA 1O6JA 1URMA 3O6TA 3VURA 2K8SA 2CZ2A 1MD4A 1X9MB 1GH2A 1G0TA 1GRXA 1R26A 2DJ2A 1XFLA 3ERGA 2RLIA 2H0IA 3KMOA 2PBJA 1E2YA 4EXJA 5A5KA 2AUVA 5C04A 5IMVA 2PGTA 4NHZA 4ZXGA 3I43A 2LUSA 1AQVA 1TTZA 3FKFA 1I9DA 1XWCA 2I3YA 1OKTA 3DKSA 5J5NA 2PVOC 1ERWA 3Q6OA 3DMLA 1WRYA 1AW9A 5ECHB 2X8CA 5HR2A 4ZL8A 3KMNA 3H79A 4KA0A 2NTOA 1JFUA 4PUFC 1UN2A 3US3A 2OACA 1ERVA 1PX7A 1R4WA 2LRNA 2IFQB 2M46A 1VGLA 4WF4A 5IMCA 4WR5A 1YY7A 3LYKA 3C73A 2P31A 1SL2B 1FAAA 4IP6A 1W4VA 4PQIA 2JSYA 4LA1A 1UC7A 3TJFA 2K18A 4XS4A 4O92A 2HZEA 3HDCA 5CRWA 1QUWA 3G7YA 1TRUA 4GLTA 2MMAA 3P8WA 3KM6A 1SENA 2OJLA 5IMAA 4POKA 1C72A 1NSWA 2A4VA 1HD2A 1SK0A 4IP1A 5IIZA 4F0BA 1GUHA 2YZUA 18GSA 1M9BA 2NPBA 2C0GA 1QGVA 3ED3A 3M9JA 2PN8A 2LQOA 2TRCP 2I4AA 4DSSA 3QCPA 1EWXA 3K8NA 3DRNA 4Q5NA 3GA4A 1THOA 1T00A 3EU4A 3F4RA 4K8MA 3F0IA 1O8WA 4OFNA 3KH7A 4Q5QA 2ES7A 2H0GA 2VCXA 1ZMAA 1Y25A 3LFLA 3RPNA 2H6YA 5ECRB 4JEDA 19GSA 3FYGA 4KAEA 2CT6A 4AJ8A 1F2EA 2VCQA 3GN3A 3I69A 3H93A 4TW5A 5DCHA 4DVCA 4N30A 4MH2A 2PPTA 20GSA 2C80A 3IK7A 3VLNA 2GLRA 5ECOB 5ECNB 1S3AA 4I2TA 4WXTA 4CHSA 4LLRA 1AAZA 2HSHA 3VWWA 3VWVA 3J7Yb 2GSSA 3D22A 3FZ4A 5AIXA 1JHBA 4IBPA 5HR1A 4GSTA 1X9SB 2N5AA 4IGJA 5JWRB 3KD0A 4XS4B 3CSHA 4IKHA 1MDIA 4I2UA 1GSFA 2O8VB 2GQLA 2OBKA 1EV4A 5J41A 3ME8A 1EP8A 5J9BA 1JZOA 3R2QA 14GSA 6GSVA 1TRVA 4ZB6A 3PGTA 2A2SA 2FWFA 2VCWA 3KTLA 1KEBA 1GNWA 2I1UA 3APSA 1U6TA 2WDUA 2VL3A 2HYXA 4F2IA 3QD9A 2KP1A 3D0ZA 2H66A 3HA9A 1BAYA 1T4YA 2L6DA 1V58A 2N5FA 3DEXA 2YV7A 1IYIA 3EE2A 3GSSA 2LS5A 17GSA 5EY6A 1GTBA 5FT3A 1RK4A 1WP0A 5G5FA 2OA7A 5KEJA 3ME7A 1AIUA 3M1GA 4TR1A 3LGCA 2DLXA 3GRXA 2BJXA 1Z6MA 4KDXA 2G2QA 1PRXA 4PNFA 1PSQA 2B5YA 2PERA 2YWOA 1A8YA 2X8HA 3E3EA 4X43A 3CTFA 3TJKA 2KHPA 3D6IA 3APOA 5CO3A 2R5GA 2N5BA 3MWHA 5F0GA 4RQRA 4TN8A 3LYPA 5HFKA 3UBKA 1K0NA 4BVYA 4RQXA 4TXVA 2QSIA 5ECSA 1KTEA 2MYGA 4F82A 4KDUA 1GSQA 2DMLA 3WYWA 2L4CA 2CAIA 2PUKC 3CTGA 1XOBA 2XPDA 5DJLA 1M0UA 5HQPA 1WIKA 3HY2A 3IPZA 2CAQA 3QAWA 4PGTA 3ERWA 3QOUA 5GZZB 1U3AA 3QDNA 2ON5A 3FW2A 2L6CA 2BTOT 4WBRD 5DQYA 4NV5A 3F9UA 5A4UA 2FCHA 5C00A 2DIYA 2JZRA 3KP9A 3CXGA 3A2VA 1THXA 3RDWA 3EINA 4MF5A 5G2ZA 3GSTA 1HNAA 1ERTA 2H76A 1F3BA 4MABA 2VD1A 3ZMKA 1FVKA 1NHOA 1O81A 1B9YC 4ML6A 5ECKB 3L78A 2YWNA 2FHEA 4GRFA 1Q98A 3ZMLA 3ZVJA 3GYKA 1WMJA 2VLVA 2KP2A 1SKSB 1GSUA 4MJBA 1YQ1A 2IIYA 3EC3A 3TGZA 5D9VA 2DJ3A 4IHUA 1YEPA 3RHBA 1K0OA 5L71A 3DIEA 4MF7A 2LJKA 1A23A 3P90A 3ISOA 4XRAA 1X5CA 2LJAA 3G9BA 4K2DA 3GKNA 4XS6A 1GTAA 1OC8A 4PXOA 3EURA 3WT1A 4MJEA 4XIHA 2D2ZA 3WGXA 2H0HA 1ILOA 4JU5A 4K0GA 2KUCA 5ECQB 1TU8A 3EMXA 5D93A 3IC4A 1DE2A 4ID0A 4K6XA 2CV4A 2JZSA 4WR4A 6GSSA 2HLSA 2LJRA 1Q4JA 1YJ6A 1TRSA 3HJMA 1TI1A 3WD6A 2F51A 1PL2A 2CX3A 2NBSA 5F07A 4OO4A 1X0RA 1TK0B 5B8BA 3F3RA 1HNBA 3CRTA 3IK9A 2GZYA 3GNJA 3RAZA 1DE1A 1ZCPA 4KGIA 2VL2A 4BVXA 3LXZA 3GH6A 5D8IA 2FY6A 2YWMA 2K6VA 1PD21 3WGEA 3KXOA 3ZRDA 4G10A 1UVZA 2H75A 1K0BA 1ZGNA 5H5RA 3IR4A 4EC0A 2C0DA 6GSXA 1AXDA 3ZVJD 4EVMA 4WF5A 1NW2A 1BJXA 2QGVA 1SD8A 5KN2A 1K0MA 2IFQA 2P5RA 4NHWA 1BYEA 5COHA 1J08A 1XBSA 4RI7A 3IBHA 1XVQA 3ZTLA 1VRSD 2V32A 2CZ3A 4RI6A 2VD0A 2C3TA 5DVBA 11GSA 5ECLB 1H4OA 4PUAA 4V2MA 1SK1A 2VM1A 1PGTA 3HHVA 3AY8A 4MK3A 5LD0A 3FHKA 3CRUA 2PWJA 2HFDA 4PQHA 1U87A 1M99A 2C0EA 3J7Yk 4BPYA 3EWLA 3C8EA 4KH7A 5IO0A 2MMOA 2E7PA 1EEJA 4YAPA 1A2MA 3N9JA 2F8AA 4ML1A 2IMDA 4PURA 2YPMA 4IJ3A 2K9FA 5FHIA 1FOVA 1A8LA 5DAKB 1Z7PA 4HI7A 3H8QA 3EU3A 1QFNA 1WOUA 1YKAA 2H6XA 4V2LA 1XWAA 4CW9A 1S3DA 2C0FA 1K0CA 3ZFBA 1SK2A 2WS2A 6GSUA 4Z7XA 2JACA 2E0QA 2VCTA 3L9VA 1ABAA 4ZL7A 1HYUA 1V9WA 2OE1A 1TKDB 3O76A 1EOHA 2H8LA 3DGQA 1V57A 4QL7A 1PX6A 3LXTA 3F8UA 3UIWA 1YEXA 2DC5A 2IMEA 4OD7A 2R3XA 5DALA 2DBCA 3TUEA 1CQGA 4AF2A 5ELAA 5EVOA 3FR6A 2VL9A 4NPBA 5DQSA 1MTCA 3HVXA 4K9ZA 2AHEA 3ZL5A 1ACVA 2EC4A 3VI7A 2GVPA 1Z3EA 2QKEA 2IMFA 3VWUA 4NV2A 3IXRA 1T4ZA 2GQKA 1PL1A 8GSSA 2GSQA 4KB3A 1EGOA 2H70A 1X9WB 1Z9HA 1GSYA 3UVTA 4ECIA 3A5WA 4GSSA 2B1KA 3TJBA 1MEKA 2B5XA 2DMMA 4IQAA 4BWSA 1K0AA 3HVVA 3Q74A 4WBJA 1JLWA 5ABRA 4MZCA 2AB6A 1YZXA 1DBYA 2I9HA 4HJ2A 1F6MC 2REMA 4N0VA 5KN1A 5IMDA 2JZTA 1LJRA 1UA5A 3QAVA 4OMVA 1JZRA 2VCZA 1U88A 3UBLA 1PQNA 3OR5A 3C1RA 1O73A 5D73A 5DALB 2LNTA 4L0UA 2O7KA 1N8JA 2VM2A 5B8AA 2MMNA 1E6BA 3EYTA 2PMTA 3PR8A 4K7NA 2CVKA 4RUVA 1QK8A 1DSBA 2J9HA 1O8XA 2XBQA 4ZBAA 4MMMA 1QXHA 2MMZA 2C4JA 4I5QA 4MLYA 1DUGA 1ERUA 4POBA 5CRHA 2NDOA 3N5OA 5D9TA 4ECCA 3D4TA 2V1MA 1TK8B 4IN0A 2FUG2 4LL4B 1Z5YE 3W8JA 3LORA 1EV9A 1SL1B 5KN0A 1M2BA 1GUMA 2XPEA 2H1DA 2GQMA 1JZDA 2HE3A 2H72A 2R4VA 4G19A 5H5SA 1K3YA 2LNSA 3ZYWA 4MP4A 4EUYA 3FZAA 2H1BA 6GSWA 2IJYA 3DWVA 1O85A 1XW5A 2Z9SA 3BBYA 4ZL9A 3IAS2 2HT9A 4MDCA 4KW6A 3F6DA 4ZBDA 1BG5A 4HU9A 3BOAA 4ECJA 1XW9A 3HZ4A 1FVJA 4GXZA 3S9FA 3PH9A 3GTUA 5IMFA 4JRRA 4ZILA 4XTSA 4ACSA 2B3SA 1TK5B 4EKZA 4HQZA 4MPFA 3VFIA 1OE8A 3TKPA 2YANA 2YZHA 3UEMA 4IELA 3GKXA 3GIXA 4YQMA 2WZ9A 1ML6A 1BEDA 3BJ5A 4L0WA 2VL2C 1EGRA 3PINA 1FB6A 3FR3A 4KDYA 4ECBA 3L4NA 1M9AA 4BWQA 3D21A 3E9JB 2FNOA 1I5GA 3RPPA 5LCZA 2FA4A 1ZZYA 4O32A 3RHCA 1R5PA 2A2RA 3Q18A 5IOWA 3HCZA 2GSRA 5F05A 2FGXA 3GHAA 4HOJA 2EIRA 4X0XA 2YN1A 1MDKA 4TKYA 3CMIA 4FYCA 4AJ7A 4F9ZA 2LRCA 3APQA 1U3IA 5KN3A 5CREA 4O5RA 4FH8A 1PKWA 3DVWA 2B7KA 3NOFA 3HJPA 1GWCA 2GZZA 4HZ4A 1QMVA 4L5LA 1PMTA 1B4QA 1RQMA 1CQHA 3GTUB 4TRXA 4KNDA 5H5QA 2XBIA 4HZ2A 3M9KA 1YKCA 2P0GA 2MBSA 1M2DA 5JWQB 3UMAA 1GTIA 5AN1A 2F3MA 1TXXA 3MSZA 4N11A 2QC7A 4GSNA 3WT2A 2JADA 4YQVA 2PVQA 5ECIB 4GWRA 2EIOA 4KUNA 1W89A 4MJCA 1NM3A 1T7PB 3VPQA 3L9UA 4JBBA 5IPHA 3G7JA 2V6KA 1TOFA 4I6XA 1ST9A 1VF2A 5B6MA 1X5EA 2CX4A 5JCWA 2YOIA 1SYXA 2KLXA 3HXSA 1H75A 3HYPA 4OO5A 3D5JA 2VIMA 3SWLA 1F9MA 3VK9A 3FR9A 5E59A 1O7UA 2HXKA 5EL8A 2H73A 3EVIA 1SYRA 3A2XA 4LMVA 2FLSA 3KTBA 2IPAA 1B4PA 5CNWA 2GS3A 1XXUA 3DVXA 2TRXA 2IMKA 4GQFA 3GL5A 1SL0B 4ULXA 4TXOB 3H1NA 1T1VA 1A2JA 1GNEA 3LEFA 1R5AA 5J3RA 2VLTA 5DAKA 1YF0A 2TIRA 3GKMA 4HUAA 3GL3A 3I6AA 2H30A 3UOMA 2J23A 4YH2A 2H6ZA 3C71A 4L5OA 4MJAA 5EPFA 2YJ7A 1G6YA 1J9BA 2HI7A 3UVHA 3KEBA 5IO2A 1V98A 2MBTA 2O87A 3DD3A 3ZREA 5GAPD 1VF1A 3ZFLA 1G7OA 5ECMB 1R7HA 4KE3A 4JR4A 4E8EA 4OCEA 1FHEA 1GLPA 4I97A 5A4WA 1TP9A 4F03A 1SKWB 3LWAA 4BA7A 1XWKA 1K0DA 3M8NA 1KNGA 1GP1A 2DJ0A 3TKSC 1WWJA 5DJMA 2OKAA 5DDLA 1FG4A 3H4KA 3KGKA 2H74A 2R37A 1T8EB 1XZOA 4KX4A 2DJ1A 3GUSA 4IS0A 2B5EA 3FY7A 4XCSA 3GV1A 1A2LA 3F6FA 2OE0A 4KCEA 3KZQA 2VLUA 4EF0A 3IRAA 1KBNA 1AQXA 2NVLA 3KCMA 4YQUA 3GH9A 1VF3A 4PX1A 2E2GA 2ALBA 4ZB8A 3FZ9A 1FW1A 4WETA 1GSEA 4PQ1A 3GX8A 2I81A 2EIQA 2GSTA 2FA8A 1M2AA 5IM9A 2WULA 1OE7A 2CVBA 1ZYQB 1T3BA 2DJKA 2LSTA 2RM5A 1SJIA 5GAND 3HKRA 3GURA 1B8XA 1A0FA 1SD9A 1TW9A 4Q5RA 1GSSA 6GSTA 3F3QA 4DSRA 4LMWA 1WJKA 5INYA 4L8EA 1YDKA 2LV3A 2KOKA 4POLA 4TVEA 3L9SA 1OC9A 3LSZA 1GTUA 2RM6A 5CYYA 5CP1A 1RW1A 4QQ7A 3TRPA 3WGDA 3KIJA 3QPMA 5GSSA 3TJJA 2H71A 2GT6A 5IPGA 1USBA 5G5EA 1SJ6A 4JZQA 2L4QA 2O85A 3P2AA 1A0RP 4HDEA 2HRNA 1XCCA 1FB0A 3CBUA 2WFCA 2MZCA 4FYBA 1SJZA 1N2AA 1PA3A 2X99A 3MDKA 4E8HA 5A4VA 2E2MA 2VUPA 3M0FA 1WPIA 4CDOA 4FYUA 4BL7A 4Q5FA 5ID2A 2G0FA 1QQ2A 3LJRA 2GTUA 1TI3A 1GL8A 3ERFA 4K0NA 4XS1A 1Z7RA 4GCIA 3LQ7A 4LL1B 3BCKA 5DCGA 3TKSA 1M7TA 2ZNMA 1HNCA 2R2JA 1K3LA 4EDZA 3DYRA 1SKRB 2CQ9A 4MZBA 1Y6EA 1EZKA 3HVSA 4MPGA 1XVWA 3NZNA 2YV9A 2AAWA 3C1SA 1IYHA 2VOCA 3FRCA 3TKQA 1PN9A 5E4WA 5G1KA 2H01A 4F0CA 3TDGA 2YNXA 1EP7A 2RUFA 4ZB9A 1OC9B 1ON4A 4ISDA 4ILFA 2GDRA 2RIIA 5IQYA 3NIVA 4TR4A 4OWYA 2X8GA 3D4MA 4WKWA 1GSDA 2XHFA 3KP8A 1AQWA 2WRTA 3A2WA 2DIZA 4IVFA 3W6GA 1FO5A 1F37A 4N0ZA 2B6MA 2K8VA 2LTKA 4DEJA 3L0HA 2AJQB 2JL4A 4NXIA 1F3AA 4YAVA 1GULA 2F9SA 1WE0A 2V6OA 4DSQA 2HZEB 2BMXA 5J9CA 4MF6A 2AYTA 4NMUA 3UAPA 10GSA 5G31A 1BX9A 3HD5A 5ID2B 2OADA 5DBQA 4ZIJA 1OYJA 1V40A 2XC2A 4QL9A 1VF4A 3KJYA 2DJJA 3KH9A 3TKRA 2WCIA 4EO3A 3TOTA 3TRQA 2CA8A 5JCGA 4DSSB 5CRDA 3C7MA 1JZWA 4IW9A 5D9WA 2VO4A 2YJHA 4MCUA 3QAGA 5HFGA 4J2FA 4PNGA 5F06A 16GSA 2VCVA 1MDJA 5ECPB 3F4TA 4NAXA 4GQCA 2DSAA 2LEGA 5HFIA 2YCDA 3IE3A 4EL1A 3VPTA 4TR3A 4K7OA 2WGRA 1NHYA 12GSA 4AJ6A 2ZCTA 2GZPA 22GSA 5B7CA 2CVDA 3TJGA 5FWGA 3IDVA 4EE0A 5CAXA 1XOAA 3JCML 4KCAA 3DXBA 1YF1A 2YWIA 3CSJA 5ENUA 3LG6A 3M3MA 2GT5A 1JLVA 2C3NA 2B1LA 3U5RE 4H86A 5IMZA 3U6VA 4XHMA 5IOXA 4J57E 3GX0A 3FK8A 3GFKA 3G7IA 5HR3A 4O7HA 3ZIVA 4GTUA 3QFAC 2GGTA 2F8FA 2L5LA 2B7JA 2ON7A 3UARA 2H19A 4HEA2 1G7EA 2IWTA 5F8BA 5JCUA 2C1YA 1B48A 4TOPA 1XWBA 1OKDA 4V1Ap 4XRDA 4D73A 3FZ5A 5JWOB 4V1Ag 3IV4A 2IMIA 4HJMA 4NWYA 7GSSA 3TKSE 2O89A 4G9HA 3ZZXA 2PU9C 2L59A 5G30A 4IQ1A 4V2NA 2VAFA 3HZ8A 4TXOA 5CRGA 3E0UA 2JSZA 2V2GA 4KSOA 1K3OA 1OC3A 4WEYA 1ZYEA 2FWEA 4MA9A 2OBIA 2M80A 4I8BA 1TDIA 3UJ1A 2WJUA 4X1UA 1XPVA 2FD3A 3BCIA 4FO5A 1XWGA 6GSYA 9GSSA 5D9XA 3UL3A 2WB9A 3TOUA 1LBKA 3QMXA 3W8SA 2FWHA 5AGYA 2FWGA 2P5QA 1X5DA 1EEMA 1TU7A 2H1AA 3MAKA 3GKKA 4TR1B 1ZOFA 2X64A 4FIWA 1V2AA 1MD3A 2C3QA 2R6KA 3ZLPA 3F4SA 3TB2A 3IHQA 4HS1A 4MZWA 2IL3A 1LU4A 4K1FA 4G2EA 1S3CA 3IOSA 3ZITA 1TJDA 5GSTA 3QR6A 1GLQA 2L5OA 2RUEA 2YP6A 1G6WA 4D73B 2ZUPA 3VI5A 3CSIA 2LQQA 3V1WA 4HQSA 5G1LA 3P7XA 2HRFA 3RBTA 4KSMA 4AGSA 4OFTA 4OCFA 1BQ7A 5AIVA 4N10A 4JR6A 4J56E 1SU9A
chains in the Genus database with same CATH superfamily
2LKUA 4OFMA 1EOGA 2LRTA 4GF0A 3IA1A 2AV4A 5HR0A 3I9V2 5LNKe 4G0KA 3TCOA 1XW6A 3CYNA 3EMPA 2M72A 2HSYA 2L57A 3MNGA 3GMFA 1OVNA 3Q19A 1PKZA 1TRWA 3O3TA 3A3TA 3ZIJA 4P3YB 1ZL9A 2HNLA 3QFBC 13GSA 4ZBBA 2H1GA 2IN3A 1J0FA 1GUKA 3IAM2 3HJOA 1AC1A 1Z6NA 4EDYA 5D96A 2HZFA 3BD2A 5J4UA 1HQOA 1XG8A 3F63A 1AUCA 4TR0A 1B9XC 2JU5A 2C8UA 5AISA 2QA2A 4JE1A 4HU7A 4POMA 5B6NA 3VWXA 3SBCA 4IJIA 1A24A 2V41A 5ELGA 4MH3A 1M3IA 1XIYA 4K7IA 3TRXA 1OAZA 2OE3A 4X4JA 3FEUA 1O6JA 1URMA 3O6TA 3VURA 2K8SA 2CZ2A 1MD4A 1X9MB 1GH2A 1G0TA 1GRXA 1R26A 2DJ2A 1XFLA 3ERGA 2RLIA 2H0IA 3KMOA 1M3JA 2PBJA 1E2YA 4EXJA 5A5KA 2AUVA 5C04A 5IMVA 2PGTA 4NHZA 4ZXGA 3I43A 2LUSA 1AQVA 1TTZA 3FKFA 1I9DA 1PN0A 1XWCA 2I3YA 1OKTA 3DKSA 5J5NA 2PVOC 1ERWA 3Q6OA 3DMLA 1WRYA 1AW9A 5ECHB 2X8CA 5HR2A 4ZL8A 3KMNA 3H79A 4KA0A 2NTOA 2HSMA 1JFUA 4PUFC 1UN2A 3US3A 2OACA 1ERVA 1PX7A 1R4WA 2LRNA 2IFQB 2M46A 1VGLA 4WF4A 5IMCA 4WR5A 1YY7A 3LYKA 3C73A 2P31A 1SL2B 1FAAA 4IP6A 1W4VA 4PQIA 2JSYA 4LA1A 1UC7A 3TJFA 2K18A 4XS4A 4O92A 2HZEA 3HDCA 5CRWA 1QUWA 3G7YA 1TRUA 4GLTA 2MMAA 3P8WA 3KM6A 1SENA 2OJLA 5IMAA 4POKA 1C72A 1NSWA 2A4VA 1HD2A 1SK0A 4IP1A 5IIZA 4F0BA 1GUHA 2YZUA 18GSA 1M9BA 2NPBA 2C0GA 1QGVA 3ED3A 2R0PA 3M9JA 2PN8A 2LQOA 2TRCP 2I4AA 4DSSA 3QCPA 1EWXA 3K8NA 3DRNA 4Q5NA 3GA4A 4PTSA 1THOA 1T00A 3EU4A 3F4RA 4K8MA 3F0IA 1O8WA 4OFNA 3KH7A 4Q5QA 5BMUA 2ES7A 2H0GA 2VCXA 1ZMAA 1Y25A 3LFLA 3RPNA 2H6YA 5ECRB 4JEDA 19GSA 3FYGA 4KAEA 2CT6A 4AJ8A 1F2EA 2VCQA 3GN3A 3I69A 3H93A 4TW5A 5DCHA 4DVCA 4N30A 4MH2A 2PPTA 20GSA 2C80A 3IK7A 3VLNA 2GLRA 5ECOB 5ECNB 1S3AA 4I2TA 4WXTA 4CHSA 4LLRA 1AAZA 2HSHA 3VWWA 3VWVA 3J7Yb 2GSSA 3D22A 3FZ4A 5KOXA 5AIXA 1ZYPA 1JHBA 4KF9A 4IBPA 5HR1A 4GSTA 1X9SB 2N5AA 4IGJA 5JWRB 3KD0A 4XS4B 3CSHA 4IKHA 1MDIA 4I2UA 1GSFA 2O8VB 2GQLA 2OBKA 1EV4A 5J41A 3ME8A 1EP8A 5J9BA 1JZOA 3R2QA 14GSA 6GSVA 1TRVA 4ZB6A 3PGTA 2A2SA 4HSCX 2FWFA 2A2PA 2VCWA 3KTLA 1KEBA 1GNWA 2I1UA 3APSA 1U6TA 2WDUA 2VL3A 2HYXA 4F2IA 3QD9A 2KP1A 3D0ZA 2H66A 3HA9A 1BAYA 1T4YA 2L6DA 1V58A 2N5FA 2X49A 3DEXA 2YV7A 1IYIA 3EE2A 3GSSA 2LS5A 17GSA 5EY6A 1GTBA 5FT3A 1RK4A 1WP0A 5G5FA 2OA7A 5KEJA 3ME7A 1AIUA 3M1GA 4TR1A 3LGCA 2DLXA 3GRXA 2BJXA 1Z6MA 4KDXA 2G2QA 1PRXA 4PNFA 1PSQA 2B5YA 2PERA 2YWOA 1A8YA 2X8HA 3E3EA 4X43A 3CTFA 3TJKA 2KHPA 3D6IA 3APOA 5CO3A 2R5GA 2N5BA 3HVNA 3MWHA 5F0GA 4RQRA 4TN8A 3LYPA 5HFKA 3UBKA 1K0NA 4BVYA 4RQXA 4TXVA 2QSIA 5ECSA 1KTEA 2MYGA 4F82A 4KDUA 1GSQA 2DMLA 3WYWA 2L4CA 2CAIA 2PUKC 3CTGA 1XOBA 2XPDA 5DJLA 1M0UA 5HQPA 1WIKA 3HY2A 3IPZA 2CAQA 3QAWA 4PGTA 3ERWA 3QOUA 5GZZB 1U3AA 3QDNA 2ON5A 3FW2A 2L6CA 2BTOT 4WBRD 5DQYA 4NV5A 3F9UA 5A4UA 3R3EA 2FCHA 5C00A 2DIYA 2JZRA 3KP9A 3CXGA 3A2VA 1THXA 3RDWA 3EINA 4MF5A 5G2ZA 3GSTA 1HNAA 1ERTA 2H76A 1F3BA 4MABA 2QA1A 2VD1A 3ZMKA 1FVKA 1NHOA 1O81A 1B9YC 4ML6A 5ECKB 3L78A 2YWNA 2FHEA 4GRFA 1Q98A 3ZMLA 3ZVJA 3GYKA 1WMJA 2VLVA 2KP2A 1SKSB 1GSUA 4MJBA 1YQ1A 2IIYA 3EC3A 3TGZA 5D9VA 2DJ3A 4IHUA 1YEPA 3RHBA 1K0OA 5L71A 3DIEA 4MF7A 2LJKA 1A23A 3P90A 3ISOA 4XRAA 1X5CA 2LJAA 3G9BA 4K2DA 3GKNA 4XS6A 1GTAA 4K2XA 1OC8A 4PXOA 3EURA 3WT1A 4MJEA 4XIHA 2D2ZA 3WGXA 2H0HA 1ILOA 4JU5A 4K0GA 2KUCA 2DKHA 5ECQB 1S3RA 1TU8A 3EMXA 5D93A 3IC4A 1DE2A 4ID0A 4K6XA 2CV4A 2JZSA 4WR4A 6GSSA 2HLSA 2LJRA 1Q4JA 1YJ6A 1TRSA 3HJMA 1TI1A 3WD6A 2F51A 1PL2A 2CX3A 2NBSA 5F07A 4OO4A 1X0RA 1TK0B 5B8BA 3F3RA 1HNBA 3CRTA 3IK9A 2GZYA 3GNJA 3RAZA 1DE1A 1ZCPA 4KGIA 2VL2A 4BVXA 3LXZA 3GH6A 5D8IA 2FY6A 2YWMA 2K6VA 1PD21 3WGEA 3KXOA 3ZRDA 4G10A 1UVZA 2H75A 1K0BA 1ZGNA 5H5RA 3IR4A 4EC0A 2C0DA 6GSXA 1AXDA 3ZVJD 4EVMA 4WF5A 4YKGA 1NW2A 1BJXA 2QGVA 1SD8A 5KN2A 1FOHA 1K0MA 2IFQA 2P5RA 4NHWA 1BYEA 5COHA 1J08A 1XBSA 4RI7A 3IBHA 1XVQA 3ZTLA 1VRSD 2V32A 2CZ3A 4RI6A 2VD0A 2C3TA 5DVBA 11GSA 5ECLB 1H4OA 4PUAA 4V2MA 1SK1A 2VM1A 1PGTA 3HHVA 3AY8A 4MK3A 5LD0A 3FHKA 3CRUA 2PWJA 2HFDA 4PQHA 1U87A 1M99A 2C0EA 3J7Yk 4BPYA 3EWLA 3C8EA 4KH7A 5IO0A 2MMOA 2E7PA 1EEJA 4YAPA 1A2MA 3N9JA 2F8AA 4ML1A 2IMDA 4PURA 2YPMA 4IJ3A 2K9FA 5FHIA 1FOVA 1A8LA 5DAKB 1Z7PA 4HI7A 3H8QA 3EU3A 4BVXB 1QFNA 1WOUA 4G0IA 1YKAA 2H6XA 4V2LA 1XWAA 4CW9A 1S3DA 2C0FA 1K0CA 3ZFBA 1SK2A 2WS2A 6GSUA 4Z7XA 2JACA 3IHGA 2E0QA 2VCTA 3L9VA 1ABAA 4ZL7A 1HYUA 1V9WA 2OE1A 1TKDB 3O76A 1EOHA 2H8LA 3DGQA 1V57A 4QL7A 1PX6A 3LXTA 3F8UA 3UIWA 1YEXA 4A5PA 2DC5A 2IMEA 4OD7A 2R3XA 5DALA 2DBCA 3TUEA 1CQGA 4AF2A 5ELAA 5EVOA 3FR6A 2VL9A 4NPBA 5DQSA 2DKIA 1MTCA 3HVXA 4K9ZA 2AHEA 3ZL5A 1ACVA 2EC4A 3VI7A 2GVPA 1Z3EA 2QKEA 2IMFA 3VWUA 4NV2A 3IXRA 1T4ZA 2GQKA 1PL1A 8GSSA 2GSQA 4KB3A 1EGOA 2H70A 1X9WB 1Z9HA 1GSYA 3UVTA 4ECIA 3A5WA 4GSSA 2B1KA 3TJBA 1MEKA 2B5XA 2DMMA 4IQAA 4BWSA 1K0AA 3HVVA 3Q74A 4MNNA 4WBJA 1JLWA 5ABRA 4MZCA 2AB6A 1YZXA 1DBYA 2I9HA 4HJ2A 1F6MC 2REMA 4N0VA 5KN1A 5IMDA 2JZTA 2X4AA 1LJRA 1UA5A 3QAVA 4OMVA 1JZRA 2VCZA 1U88A 3UBLA 1PQNA 3OR5A 3C1RA 1O73A 5D73A 5DALB 2LNTA 4L0UA 2O7KA 1N8JA 2VM2A 5B8AA 2MMNA 1E6BA 3EYTA 2PMTA 3PR8A 4K7NA 2CVKA 4RUVA 1QK8A 1DSBA 2J9HA 1O8XA 2XBQA 4ZBAA 4MMMA 1QXHA 2MMZA 2C4JA 4I5QA 4MLYA 1DUGA 1ERUA 4POBA 5CRHA 2NDOA 3N5OA 5D9TA 4ECCA 3D4TA 2V1MA 1TK8B 4IN0A 2FUG2 4LL4B 1Z5YE 3W8JA 3LORA 1EV9A 1SL1B 5KN0A 1M2BA 1GUMA 2XPEA 2H1DA 2GQMA 1JZDA 2HE3A 2H72A 2R4VA 4G19A 5H5SA 1K3YA 2LNSA 3ZYWA 4MP4A 4EUYA 3FZAA 2H1BA 6GSWA 2IJYA 2UZ8A 3DWVA 1O85A 1XW5A 2Z9SA 3BBYA 4ZL9A 3IAS2 2HT9A 4MDCA 4KW6A 3F6DA 4ZBDA 1BG5A 4HU9A 3BOAA 4ECJA 1XW9A 3HZ4A 1FVJA 4GXZA 3S9FA 3PH9A 3GTUA 5IMFA 4CY6A 4JRRA 4ZILA 4XTSA 4ACSA 2B3SA 1TK5B 4EKZA 4HQZA 4MPFA 4O5UA 3VFIA 1OE8A 3TKPA 2YANA 2YZHA 3UEMA 4IELA 3GKXA 3EPTA 3GIXA 4YQMA 2WZ9A 1ML6A 1BEDA 3BJ5A 4L0WA 2VL2C 1EGRA 3PINA 1FB6A 3FR3A 4KDYA 4ECBA 3L4NA 1M9AA 4BWQA 3D21A 3E9JB 2R0CA 2FNOA 1I5GA 2HRAA 3RPPA 5LCZA 2FA4A 1ZZYA 4O32A 3RHCA 1R5PA 2A2RA 3Q18A 5IOWA 3HCZA 2GSRA 5F05A 2FGXA 3GHAA 4HOJA 2EIRA 4X0XA 2YN1A 1MDKA 4TKYA 3CMIA 4FYCA 4AJ7A 4F9ZA 2LRCA 3APQA 1U3IA 5KN3A 5CREA 4O5RA 4FH8A 1PKWA 1ZYNA 3DVWA 2B7KA 3NOFA 3HJPA 1GWCA 2GZZA 4HZ4A 1QMVA 4L5LA 2HRKA 1PMTA 1B4QA 1RQMA 1CQHA 3GTUB 4TRXA 3FMWA 4KNDA 5H5QA 2XBIA 4HZ2A 3M9KA 1YKCA 2P0GA 2MBSA 1M2DA 5JWQB 3UMAA 1GTIA 5AN1A 2F3MA 1TXXA 3MSZA 4N11A 2QC7A 4GSNA 3WT2A 2JADA 4K5SA 4USSA 4YQVA 2PVQA 5ECIB 4GWRA 2EIOA 4KUNA 1W89A 4MJCA 1NM3A 1T7PB 3VPQA 3L9UA 4JBBA 5IPHA 3G7JA 2V6KA 1TOFA 4I6XA 1ST9A 1VF2A 5B6MA 1X5EA 2CX4A 5JCWA 2YOIA 1SYXA 2KLXA 3HXSA 1H75A 3HYPA 4OO5A 3D5JA 2VIMA 3SWLA 1F9MA 3VK9A 3FR9A 5E59A 1O7UA 2HXKA 5EL8A 2H73A 3EVIA 1SYRA 3A2XA 4LMVA 2FLSA 3KTBA 2IPAA 1B4PA 5CNWA 2GS3A 1XXUA 3DVXA 2TRXA 2IMKA 4GQFA 3GL5A 1SL0B 4ULXA 4TXOB 3H1NA 1T1VA 1A2JA 1GNEA 3LEFA 1R5AA 5J3RA 2VLTA 5DAKA 1YF0A 2TIRA 3GKMA 4HUAA 3GL3A 3I6AA 2H30A 3UOMA 2J23A 4YH2A 2H6ZA 3C71A 4L5OA 4MJAA 5EPFA 2YJ7A 1G6YA 1J9BA 2HI7A 3UVHA 3KEBA 5IO2A 4Z2TA 1V98A 2MBTA 2O87A 3DD3A 3ZREA 5GAPD 1VF1A 3ZFLA 1G7OA 5ECMB 1R7HA 4KE3A 4JR4A 4E8EA 4OCEA 1FHEA 1GLPA 4I97A 5A4WA 1TP9A 4F03A 1SKWB 3LWAA 4BA7A 1XWKA 1K0DA 3M8NA 1KNGA 1GP1A 2DJ0A 3TKSC 1WWJA 5DJMA 2OKAA 5DDLA 5BRTA 1FG4A 3H4KA 3KGKA 2H74A 2R37A 1T8EB 1XZOA 4KX4A 2DJ1A 3GUSA 4IS0A 2B5EA 3FY7A 4XCSA 3GV1A 1A2LA 3F6FA 2OE0A 4KCEA 3KZQA 2VLUA 4EF0A 3IRAA 1KBNA 1AQXA 2NVLA 3KCMA 4YQUA 3GH9A 1VF3A 4PX1A 2E2GA 2ALBA 4ZB8A 3FZ9A 1FW1A 4WETA 4Z2RA 1GSEA 4PQ1A 3GX8A 2I81A 2EIQA 2GSTA 2FA8A 1M2AA 5IM9A 2WULA 1OE7A 2CVBA 1ZYQB 1T3BA 2DJKA 2LSTA 2RM5A 1SJIA 5GAND 3HKRA 3GURA 1B8XA 1A0FA 1SD9A 1TW9A 4Q5RA 1GSSA 6GSTA 3F3QA 4DSRA 4LMWA 1WJKA 5INYA 4YKFA 4L8EA 1YDKA 2LV3A 2KOKA 4POLA 4TVEA 3L9SA 1OC9A 3LSZA 2R0GA 1GTUA 2RM6A 5CYYA 5CP1A 1RW1A 4QQ7A 3TRPA 3WGDA 3KIJA 3QPMA 5GSSA 3TJJA 2H71A 2GT6A 5IPGA 1USBA 5G5EA 1SJ6A 4JZQA 2L4QA 2O85A 3P2AA 1A0RP 4HDEA 2HRNA 1XCCA 1FB0A 3CBUA 4EIPA 2WFCA 2MZCA 4FYBA 1SJZA 1N2AA 1PA3A 2X99A 3MDKA 4E8HA 5A4VA 2E2MA 2VUPA 3M0FA 1WPIA 4CDOA 4FYUA 4BL7A 4Q5FA 5ID2A 2G0FA 2A4HA 1QQ2A 3LJRA 2GTUA 1TI3A 1GL8A 3ERFA 4K0NA 4XS1A 1Z7RA 4GCIA 3LQ7A 4LL1B 3BCKA 5DCGA 3TKSA 1M7TA 2ZNMA 1HNCA 2R2JA 1K3LA 4EDZA 3DYRA 1SKRB 2CQ9A 4MZBA 1Y6EA 1EZKA 3HVSA 4MPGA 1XVWA 3NZNA 2YV9A 2AAWA 3C1SA 1IYHA 2VOCA 3FRCA 3LW9A 3TKQA 1PN9A 5E4WA 5G1KA 2H01A 4F0CA 3TDGA 2YNXA 1EP7A 2RUFA 4ZB9A 1OC9B 1ON4A 4ISDA 4ILFA 2GDRA 2RIIA 5IQYA 3NIVA 4TR4A 4OWYA 2X8GA 3D4MA 4WKWA 1GSDA 2XHFA 3KP8A 1AQWA 3IC8A 2WRTA 3A2WA 2DIZA 4IVFA 3W6GA 1FO5A 1F37A 4N0ZA 2B6MA 2K8VA 2LTKA 4DEJA 3L0HA 2AJQB 2JL4A 4NXIA 1F3AA 4YAVA 1GULA 2F9SA 1WE0A 2V6OA 4DSQA 2HZEB 2BMXA 5J9CA 4MF6A 2AYTA 4NMUA 3UAPA 10GSA 5G31A 4BL7B 1BX9A 3HD5A 5ID2B 2OADA 5DBQA 4ZIJA 1OYJA 1V40A 2XC2A 4QL9A 1VF4A 3KJYA 2DJJA 3KH9A 3TKRA 3A5IA 1PFOA 2WCIA 4EO3A 3TOTA 4Z2UA 3TRQA 2CA8A 5JCGA 4DSSB 5CRDA 3C7MA 4O5QA 1JZWA 4IW9A 5D9WA 2VO4A 2YJHA 4MCUA 3QAGA 5HFGA 4J2FA 4PNGA 4CY8A 5F06A 16GSA 2VCVA 1MDJA 5ECPB 3F4TA 4NAXA 4GQCA 2DSAA 2LEGA 5HFIA 2YCDA 3IE3A 4EL1A 3VPTA 4TR3A 4K7OA 2WGRA 1NHYA 12GSA 4AJ6A 2ZCTA 2GZPA 22GSA 5B7CA 2CVDA 3TJGA 5FWGA 3IDVA 4EE0A 5CAXA 4EIQA 1XOAA 3JCML 4KCAA 3DXBA 1YF1A 2YWIA 3CSJA 5ENUA 3LG6A 3M3MA 2GT5A 1JLVA 2C3NA 2B1LA 3U5RE 4H86A 5IMZA 3U6VA 4XHMA 5IOXA 4J57E 3GX0A 3FK8A 3GFKA 3G7IA 5HR3A 4O7HA 3ZIVA 4GTUA 3QFAC 2GGTA 2F8FA 2L5LA 2B7JA 2ON7A 3UARA 3MYDA 2H19A 4HEA2 1G7EA 2IWTA 5F8BA 5KOWA 5JCUA 2C1YA 1B48A 4TOPA 1XWBA 1OKDA 4V1Ap 4XRDA 4D73A 3FZ5A 5JWOB 4V1Ag 3IV4A 2IMIA 4HJMA 4NWYA 7GSSA 3TKSE 2O89A 4G9HA 3ZZXA 4K5RA 2PU9C 2L59A 5G30A 4IQ1A 4V2NA 2VAFA 4ICYA 3HZ8A 4TXOA 5CRGA 3E0UA 2JSZA 2V2GA 4KSOA 1K3OA 1OC3A 4WEYA 1ZYEA 2FWEA 4BIKA 4MA9A 2OBIA 2M80A 4I8BA 1TDIA 4FQUA 3UJ1A 2WJUA 4X1UA 1XPVA 2FD3A 3BCIA 4FO5A 1XWGA 6GSYA 9GSSA 5D9XA 3UL3A 2WB9A 3MIXA 3TOUA 1LBKA 3QMXA 3W8SA 2FWHA 5AGYA 2FWGA 2P5QA 1X5DA 1EEMA 1TU7A 2H1AA 3MAKA 3GKKA 4TR1B 1ZOFA 4G0LA 2X64A 4FIWA 1V2AA 1MD3A 2C3QA 2R6KA 3ZLPA 3F4SA 3TB2A 3IHQA 4HS1A 4MZWA 2IL3A 1LU4A 4K1FA 4G2EA 1S3CA 3IOSA 3ZITA 1TJDA 5GSTA 3QR6A 1GLQA 2L5OA 2RUEA 2YP6A 1G6WA 4D73B 2ZUPA 3VI5A 3CSIA 4BVYB 2LQQA 3V1WA 4HQSA 5G1LA 3P7XA 2HRFA 3RBTA 4KSMA 3PPUA 4AGSA 4OFTA 4OCFA 1BQ7A 5AIVA 4N10A 4JR6A 3CQFA 4J56E 1SU9A
chains in the Genus database with same CATH topology
2LKUA 4OFMA 1EOGA 2LRTA 4GF0A 3IA1A 2AV4A 5HR0A 3I9V2 5LNKe 4G0KA 3TCOA 1XW6A 3CYNA 3EMPA 2M72A 2HSYA 2L57A 3MNGA 3GMFA 1OVNA 3Q19A 1PKZA 1TRWA 3O3TA 3A3TA 3ZIJA 4P3YB 1ZL9A 2HNLA 3QFBC 13GSA 4ZBBA 2H1GA 2IN3A 1J0FA 1GUKA 3IAM2 3HJOA 1AC1A 1Z6NA 4EDYA 5D96A 2HZFA 3BD2A 5J4UA 1HQOA 3F63A 1AUCA 4TR0A 1B9XC 2JU5A 2C8UA 5AISA 2QA2A 4JE1A 4HU7A 4POMA 5B6NA 3VWXA 3SBCA 4IJIA 1A24A 2V41A 5ELGA 4MH3A 1XIYA 4K7IA 3TRXA 1OAZA 2OE3A 4X4JA 3FEUA 1O6JA 1URMA 3O6TA 3VURA 2K8SA 2CZ2A 1MD4A 1X9MB 1GH2A 1G0TA 1GRXA 1R26A 2DJ2A 1XFLA 3ERGA 2RLIA 2H0IA 3KMOA 2PBJA 1E2YA 4EXJA 5A5KA 2AUVA 5C04A 5IMVA 2PGTA 4NHZA 4ZXGA 3I43A 2LUSA 1AQVA 1TTZA 3FKFA 1I9DA 1PN0A 1XWCA 2I3YA 1OKTA 3DKSA 5J5NA 2PVOC 1ERWA 3Q6OA 3DMLA 1WRYA 1AW9A 5ECHB 2X8CA 5HR2A 4ZL8A 3KMNA 3H79A 4KA0A 2NTOA 2HSMA 1JFUA 4PUFC 1UN2A 3US3A 2OACA 1ERVA 1PX7A 1R4WA 2LRNA 2IFQB 2M46A 1VGLA 4WF4A 5IMCA 4WR5A 1YY7A 3LYKA 3C73A 2P31A 1SL2B 1FAAA 4IP6A 1W4VA 4PQIA 2JSYA 4LA1A 1UC7A 3TJFA 2K18A 4XS4A 4O92A 2HZEA 3HDCA 5CRWA 1QUWA 3G7YA 1TRUA 4GLTA 2MMAA 3P8WA 3KM6A 1SENA 2OJLA 5IMAA 4POKA 1C72A 1NSWA 2A4VA 1HD2A 1SK0A 4IP1A 5IIZA 4F0BA 1GUHA 2YZUA 18GSA 1M9BA 2NPBA 2C0GA 1QGVA 3ED3A 2R0PA 3M9JA 2PN8A 2LQOA 2TRCP 2I4AA 4DSSA 3QCPA 1EWXA 3K8NA 3DRNA 4Q5NA 3GA4A 4PTSA 1THOA 1T00A 3EU4A 3F4RA 4K8MA 3F0IA 1O8WA 4OFNA 3KH7A 4Q5QA 5BMUA 2ES7A 2H0GA 2VCXA 1ZMAA 1Y25A 3LFLA 3RPNA 2H6YA 5ECRB 4JEDA 19GSA 3FYGA 4KAEA 2CT6A 4AJ8A 1F2EA 2VCQA 3GN3A 3I69A 3H93A 4TW5A 5DCHA 4DVCA 4N30A 4MH2A 2PPTA 20GSA 2C80A 3IK7A 3VLNA 2GLRA 5ECOB 5ECNB 1S3AA 4I2TA 4WXTA 4CHSA 4LLRA 1AAZA 2HSHA 3VWWA 3VWVA 3J7Yb 2GSSA 3D22A 3FZ4A 5KOXA 5AIXA 1ZYPA 1JHBA 4KF9A 4IBPA 5HR1A 4GSTA 1X9SB 2N5AA 4IGJA 5JWRB 3KD0A 4XS4B 3CSHA 4IKHA 1MDIA 4I2UA 1GSFA 2O8VB 2GQLA 2OBKA 1EV4A 5J41A 3ME8A 1EP8A 5J9BA 1JZOA 3R2QA 14GSA 6GSVA 1TRVA 4ZB6A 3PGTA 2A2SA 2FWFA 2A2PA 2VCWA 3KTLA 1KEBA 1GNWA 2I1UA 3APSA 1U6TA 2WDUA 2VL3A 2HYXA 4F2IA 3QD9A 2KP1A 3D0ZA 2H66A 3HA9A 1BAYA 1T4YA 2L6DA 1V58A 2N5FA 2X49A 3DEXA 2YV7A 1IYIA 3EE2A 3GSSA 2LS5A 17GSA 5EY6A 1GTBA 5FT3A 1RK4A 1WP0A 5G5FA 2OA7A 5KEJA 3ME7A 1AIUA 3M1GA 4TR1A 3LGCA 2DLXA 3GRXA 2BJXA 1Z6MA 4KDXA 2G2QA 1PRXA 4PNFA 1PSQA 2B5YA 2PERA 2YWOA 1A8YA 2X8HA 3E3EA 4X43A 3CTFA 3TJKA 2KHPA 3D6IA 3APOA 5CO3A 2R5GA 2N5BA 3MWHA 5F0GA 4RQRA 4TN8A 3LYPA 5HFKA 3UBKA 1K0NA 4BVYA 4RQXA 4TXVA 2QSIA 5ECSA 1KTEA 2MYGA 4F82A 4KDUA 1GSQA 2DMLA 3WYWA 2L4CA 2CAIA 2PUKC 3CTGA 1XOBA 2XPDA 5DJLA 1M0UA 5HQPA 1WIKA 3HY2A 3IPZA 2CAQA 3QAWA 4PGTA 3ERWA 3QOUA 5GZZB 1U3AA 3QDNA 2ON5A 3FW2A 2L6CA 2BTOT 4WBRD 5DQYA 4NV5A 3F9UA 5A4UA 3R3EA 2FCHA 5C00A 2DIYA 2JZRA 3KP9A 3CXGA 3A2VA 1THXA 3RDWA 3EINA 4MF5A 5G2ZA 3GSTA 1HNAA 1ERTA 2H76A 1F3BA 4MABA 2QA1A 2VD1A 3ZMKA 1FVKA 1NHOA 1O81A 1B9YC 4ML6A 5ECKB 3L78A 2YWNA 2FHEA 4GRFA 1Q98A 3ZMLA 3ZVJA 3GYKA 1WMJA 2VLVA 2KP2A 1SKSB 1GSUA 4MJBA 1YQ1A 2IIYA 3EC3A 3TGZA 5D9VA 2DJ3A 4IHUA 1YEPA 3RHBA 1K0OA 5L71A 3DIEA 4MF7A 2LJKA 1A23A 3P90A 3ISOA 4XRAA 1X5CA 2LJAA 3G9BA 4K2DA 3GKNA 4XS6A 1GTAA 4K2XA 1OC8A 4PXOA 3EURA 3WT1A 4MJEA 4XIHA 2D2ZA 3WGXA 2H0HA 1ILOA 4JU5A 4K0GA 2KUCA 2DKHA 5ECQB 1TU8A 3EMXA 5D93A 3IC4A 1DE2A 4ID0A 4K6XA 2CV4A 2JZSA 4WR4A 6GSSA 2HLSA 2LJRA 1Q4JA 1YJ6A 1TRSA 3HJMA 1TI1A 3WD6A 2F51A 1PL2A 2CX3A 2NBSA 5F07A 4OO4A 1X0RA 1TK0B 5B8BA 3F3RA 1HNBA 3CRTA 3IK9A 2GZYA 3GNJA 3RAZA 1DE1A 1ZCPA 4KGIA 2VL2A 4BVXA 3LXZA 3GH6A 5D8IA 2FY6A 2YWMA 2K6VA 1PD21 3WGEA 3KXOA 3ZRDA 4G10A 1UVZA 2H75A 1K0BA 1ZGNA 5H5RA 3IR4A 4EC0A 2C0DA 6GSXA 1AXDA 3ZVJD 4EVMA 4WF5A 4YKGA 1NW2A 1BJXA 2QGVA 1SD8A 5KN2A 1FOHA 1K0MA 2IFQA 2P5RA 4NHWA 1BYEA 5COHA 1J08A 1XBSA 4RI7A 3IBHA 1XVQA 3ZTLA 1VRSD 2V32A 2CZ3A 4RI6A 2VD0A 2C3TA 5DVBA 11GSA 5ECLB 1H4OA 4PUAA 4V2MA 1SK1A 2VM1A 1PGTA 3HHVA 3AY8A 4MK3A 5LD0A 3FHKA 3CRUA 2PWJA 2HFDA 4PQHA 1U87A 1M99A 2C0EA 3J7Yk 4BPYA 3EWLA 3C8EA 4KH7A 5IO0A 2MMOA 2E7PA 1EEJA 4YAPA 1A2MA 3N9JA 2F8AA 4ML1A 2IMDA 4PURA 2YPMA 4IJ3A 2K9FA 5FHIA 1FOVA 1A8LA 5DAKB 1Z7PA 4HI7A 3H8QA 3EU3A 4BVXB 1QFNA 1WOUA 4G0IA 1YKAA 2H6XA 4V2LA 1XWAA 4CW9A 1S3DA 2C0FA 1K0CA 3ZFBA 1SK2A 2WS2A 6GSUA 4Z7XA 2JACA 3IHGA 2E0QA 2VCTA 3L9VA 1ABAA 4ZL7A 1HYUA 1V9WA 2OE1A 1TKDB 3O76A 1EOHA 2H8LA 3DGQA 1V57A 4QL7A 1PX6A 3LXTA 3F8UA 3UIWA 1YEXA 4A5PA 2DC5A 2IMEA 4OD7A 2R3XA 5DALA 2DBCA 3TUEA 1CQGA 4AF2A 5ELAA 5EVOA 3FR6A 2VL9A 4NPBA 5DQSA 2DKIA 1MTCA 3HVXA 4K9ZA 2AHEA 3ZL5A 1ACVA 2EC4A 3VI7A 2GVPA 1Z3EA 2QKEA 2IMFA 3VWUA 4NV2A 3IXRA 1T4ZA 2GQKA 1PL1A 8GSSA 2GSQA 4KB3A 1EGOA 2H70A 1X9WB 1Z9HA 1GSYA 3UVTA 4ECIA 3A5WA 4GSSA 2B1KA 3TJBA 1MEKA 2B5XA 2DMMA 4IQAA 4BWSA 1K0AA 3HVVA 3Q74A 4MNNA 4WBJA 1JLWA 5ABRA 4MZCA 2AB6A 1YZXA 1DBYA 2I9HA 4HJ2A 1F6MC 2REMA 4N0VA 5KN1A 5IMDA 2JZTA 2X4AA 1LJRA 1UA5A 3QAVA 4OMVA 1JZRA 2VCZA 1U88A 3UBLA 1PQNA 3OR5A 3C1RA 1O73A 5D73A 5DALB 2LNTA 4L0UA 2O7KA 1N8JA 2VM2A 5B8AA 2MMNA 1E6BA 3EYTA 2PMTA 3PR8A 4K7NA 2CVKA 4RUVA 1QK8A 1DSBA 2J9HA 1O8XA 2XBQA 4ZBAA 4MMMA 1QXHA 2MMZA 2C4JA 4I5QA 4MLYA 1DUGA 1ERUA 4POBA 5CRHA 2NDOA 3N5OA 5D9TA 4ECCA 3D4TA 2V1MA 1TK8B 4IN0A 2FUG2 4LL4B 1Z5YE 3W8JA 3LORA 1EV9A 1SL1B 5KN0A 1M2BA 1GUMA 2XPEA 2H1DA 2GQMA 1JZDA 2HE3A 2H72A 2R4VA 4G19A 5H5SA 1K3YA 2LNSA 3ZYWA 4MP4A 4EUYA 3FZAA 2H1BA 6GSWA 2IJYA 2UZ8A 3DWVA 1O85A 1XW5A 2Z9SA 3BBYA 4ZL9A 3IAS2 2HT9A 4MDCA 4KW6A 3F6DA 4ZBDA 1BG5A 4HU9A 3BOAA 4ECJA 1XW9A 3HZ4A 1FVJA 4GXZA 3S9FA 3PH9A 3GTUA 5IMFA 4CY6A 4JRRA 4ZILA 4XTSA 4ACSA 2B3SA 1TK5B 4EKZA 4HQZA 4MPFA 4O5UA 3VFIA 1OE8A 3TKPA 2YANA 2YZHA 3UEMA 4IELA 3GKXA 3EPTA 3GIXA 4YQMA 2WZ9A 1ML6A 1BEDA 3BJ5A 4L0WA 2VL2C 1EGRA 3PINA 1FB6A 3FR3A 4KDYA 4ECBA 3L4NA 1M9AA 4BWQA 3D21A 3E9JB 2R0CA 2FNOA 1I5GA 2HRAA 3RPPA 5LCZA 2FA4A 1ZZYA 4O32A 3RHCA 1R5PA 2A2RA 3Q18A 5IOWA 3HCZA 2GSRA 5F05A 2FGXA 3GHAA 4HOJA 2EIRA 4X0XA 2YN1A 1MDKA 4TKYA 3CMIA 4FYCA 4AJ7A 4F9ZA 2LRCA 3APQA 1U3IA 5KN3A 5CREA 4O5RA 4FH8A 1PKWA 1ZYNA 3DVWA 2B7KA 3NOFA 3HJPA 1GWCA 2GZZA 4HZ4A 1QMVA 4L5LA 2HRKA 1PMTA 1B4QA 1RQMA 1CQHA 3GTUB 4TRXA 3FMWA 4KNDA 5H5QA 2XBIA 4HZ2A 3M9KA 1YKCA 2P0GA 2MBSA 1M2DA 5JWQB 3UMAA 1GTIA 5AN1A 2F3MA 1TXXA 3MSZA 4N11A 2QC7A 4GSNA 3WT2A 2JADA 4K5SA 4USSA 4YQVA 2PVQA 5ECIB 4GWRA 2EIOA 4KUNA 1W89A 4MJCA 1NM3A 1T7PB 3VPQA 3L9UA 4JBBA 5IPHA 3G7JA 2V6KA 1TOFA 4I6XA 1ST9A 1VF2A 5B6MA 1X5EA 2CX4A 5JCWA 2YOIA 1SYXA 2KLXA 3HXSA 1H75A 3HYPA 4OO5A 3D5JA 2VIMA 3SWLA 1F9MA 3VK9A 3FR9A 5E59A 1O7UA 2HXKA 5EL8A 2H73A 3EVIA 1SYRA 3A2XA 4LMVA 2FLSA 3KTBA 2IPAA 1B4PA 5CNWA 2GS3A 1XXUA 3DVXA 2TRXA 2IMKA 4GQFA 3GL5A 1SL0B 4ULXA 4TXOB 3H1NA 1T1VA 1A2JA 1GNEA 3LEFA 1R5AA 5J3RA 2VLTA 5DAKA 1YF0A 2TIRA 3GKMA 4HUAA 3GL3A 3I6AA 2H30A 3UOMA 2J23A 4YH2A 2H6ZA 3C71A 4L5OA 4MJAA 5EPFA 2YJ7A 1G6YA 1J9BA 2HI7A 3UVHA 3KEBA 5IO2A 4Z2TA 1V98A 2MBTA 2O87A 3DD3A 3ZREA 5GAPD 1VF1A 3ZFLA 1G7OA 5ECMB 1R7HA 4KE3A 4JR4A 4E8EA 4OCEA 1FHEA 1GLPA 4I97A 5A4WA 1TP9A 4F03A 1SKWB 3LWAA 4BA7A 1XWKA 1K0DA 3M8NA 1KNGA 1GP1A 2DJ0A 3TKSC 1WWJA 5DJMA 2OKAA 5DDLA 5BRTA 1FG4A 3H4KA 3KGKA 2H74A 2R37A 1T8EB 1XZOA 4KX4A 2DJ1A 3GUSA 4IS0A 2B5EA 3FY7A 4XCSA 3GV1A 1A2LA 3F6FA 2OE0A 4KCEA 3KZQA 2VLUA 4EF0A 3IRAA 1KBNA 1AQXA 2NVLA 3KCMA 4YQUA 3GH9A 1VF3A 4PX1A 2E2GA 2ALBA 4ZB8A 3FZ9A 1FW1A 4WETA 4Z2RA 1GSEA 4PQ1A 3GX8A 2I81A 2EIQA 2GSTA 2FA8A 1M2AA 5IM9A 2WULA 1OE7A 2CVBA 1ZYQB 1T3BA 2DJKA 2LSTA 2RM5A 1SJIA 5GAND 3HKRA 3GURA 1B8XA 1A0FA 1SD9A 1TW9A 4Q5RA 1GSSA 6GSTA 3F3QA 4DSRA 4LMWA 1WJKA 5INYA 4YKFA 4L8EA 1YDKA 2LV3A 2KOKA 4POLA 4TVEA 3L9SA 1OC9A 3LSZA 2R0GA 1GTUA 2RM6A 5CYYA 5CP1A 1RW1A 4QQ7A 3TRPA 3WGDA 3KIJA 3QPMA 5GSSA 3TJJA 2H71A 2GT6A 5IPGA 1USBA 5G5EA 1SJ6A 4JZQA 2L4QA 2O85A 3P2AA 1A0RP 4HDEA 2HRNA 1XCCA 1FB0A 3CBUA 4EIPA 2WFCA 2MZCA 4FYBA 1SJZA 1N2AA 1PA3A 2X99A 3MDKA 4E8HA 5A4VA 2E2MA 2VUPA 3M0FA 1WPIA 4CDOA 4FYUA 4BL7A 4Q5FA 5ID2A 2G0FA 2A4HA 1QQ2A 3LJRA 2GTUA 1TI3A 1GL8A 3ERFA 4K0NA 4XS1A 1Z7RA 4GCIA 3LQ7A 4LL1B 3BCKA 5DCGA 3TKSA 1M7TA 2ZNMA 1HNCA 2R2JA 1K3LA 4EDZA 3DYRA 1SKRB 2CQ9A 4MZBA 1Y6EA 1EZKA 3HVSA 4MPGA 1XVWA 3NZNA 2YV9A 2AAWA 3C1SA 1IYHA 2VOCA 3FRCA 3LW9A 3TKQA 1PN9A 5E4WA 5G1KA 2H01A 4F0CA 3TDGA 2YNXA 1EP7A 2RUFA 4ZB9A 1OC9B 1ON4A 4ISDA 4ILFA 2GDRA 2RIIA 5IQYA 3NIVA 4TR4A 4OWYA 2X8GA 3D4MA 4WKWA 1GSDA 2XHFA 3KP8A 1AQWA 3IC8A 2WRTA 3A2WA 2DIZA 4IVFA 3W6GA 1FO5A 1F37A 4N0ZA 2B6MA 2K8VA 2LTKA 4DEJA 3L0HA 2AJQB 2JL4A 4NXIA 1F3AA 4YAVA 1GULA 2F9SA 1WE0A 2V6OA 4DSQA 2HZEB 2BMXA 5J9CA 4MF6A 2AYTA 4NMUA 3UAPA 10GSA 5G31A 4BL7B 1BX9A 3HD5A 5ID2B 2OADA 5DBQA 4ZIJA 1OYJA 1V40A 2XC2A 4QL9A 1VF4A 3KJYA 2DJJA 3KH9A 3TKRA 3A5IA 2WCIA 4EO3A 3TOTA 4Z2UA 3TRQA 2CA8A 5JCGA 4DSSB 5CRDA 3C7MA 4O5QA 1JZWA 4IW9A 5D9WA 2VO4A 2YJHA 4MCUA 3QAGA 5HFGA 4J2FA 4PNGA 4CY8A 5F06A 16GSA 2VCVA 1MDJA 5ECPB 3F4TA 4NAXA 4GQCA 2DSAA 2LEGA 5HFIA 2YCDA 3IE3A 4EL1A 3VPTA 4TR3A 4K7OA 2WGRA 1NHYA 12GSA 4AJ6A 2ZCTA 2GZPA 22GSA 5B7CA 2CVDA 3TJGA 5FWGA 3IDVA 4EE0A 5CAXA 4EIQA 1XOAA 3JCML 4KCAA 3DXBA 1YF1A 2YWIA 3CSJA 5ENUA 3LG6A 3M3MA 2GT5A 1JLVA 2C3NA 2B1LA 3U5RE 4H86A 5IMZA 3U6VA 4XHMA 5IOXA 4J57E 3GX0A 3FK8A 3GFKA 3G7IA 5HR3A 4O7HA 3ZIVA 4GTUA 3QFAC 2GGTA 2F8FA 2L5LA 2B7JA 2ON7A 3UARA 3MYDA 2H19A 4HEA2 1G7EA 2IWTA 5F8BA 5KOWA 5JCUA 2C1YA 1B48A 4TOPA 1XWBA 1OKDA 4V1Ap 4XRDA 4D73A 3FZ5A 5JWOB 4V1Ag 3IV4A 2IMIA 4HJMA 4NWYA 7GSSA 3TKSE 2O89A 4G9HA 3ZZXA 4K5RA 2PU9C 2L59A 5G30A 4IQ1A 4V2NA 2VAFA 4ICYA 3HZ8A 4TXOA 5CRGA 3E0UA 2JSZA 2V2GA 4KSOA 1K3OA 1OC3A 4WEYA 1ZYEA 2FWEA 4MA9A 2OBIA 2M80A 4I8BA 1TDIA 4FQUA 3UJ1A 2WJUA 4X1UA 1XPVA 2FD3A 3BCIA 4FO5A 1XWGA 6GSYA 9GSSA 5D9XA 3UL3A 2WB9A 3MIXA 3TOUA 1LBKA 3QMXA 3W8SA 2FWHA 5AGYA 2FWGA 2P5QA 1X5DA 1EEMA 1TU7A 2H1AA 3MAKA 3GKKA 4TR1B 1ZOFA 4G0LA 2X64A 4FIWA 1V2AA 1MD3A 2C3QA 2R6KA 3ZLPA 3F4SA 3TB2A 3IHQA 4HS1A 4MZWA 2IL3A 1LU4A 4K1FA 4G2EA 1S3CA 3IOSA 3ZITA 1TJDA 5GSTA 3QR6A 1GLQA 2L5OA 2RUEA 2YP6A 1G6WA 4D73B 2ZUPA 3VI5A 3CSIA 4BVYB 2LQQA 3V1WA 4HQSA 5G1LA 3P7XA 2HRFA 3RBTA 4KSMA 3PPUA 4AGSA 4OFTA 4OCFA 1BQ7A 5AIVA 4N10A 4JR6A 4J56E 1SU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKU A;  4OFM A;  1EOG A;  2LRT A;  4GF0 A;  3IA1 A;  2AV4 A;  5HR0 A;  3I9V 2;  5LNK e;  3TCO A;  1XW6 A;  3CYN A;  3EMP A;  2M72 A;  2HSY A;  2L57 A;  3MNG A;  3GMF A;  1OVN A;  3Q19 A;  1PKZ A;  1TRW A;  3O3T A;  3A3T A;  3ZIJ A;  4P3Y B;  1ZL9 A;  2HNL A;  3QFB C;  13GS A;  4ZBB A;  2H1G A;  2IN3 A;  1J0F A;  1GUK A;  3IAM 2;  3HJO A;  1AC1 A;  1Z6N A;  4EDY A;  5D96 A;  2HZF A;  3BD2 A;  5J4U A;  1HQO A;  3F63 A;  1AUC A;  4TR0 A;  1B9X C;  2JU5 A;  2C8U A;  5AIS A;  4JE1 A;  4HU7 A;  4POM A;  5B6N A;  3VWX A;  3SBC A;  4IJI A;  1A24 A;  2V41 A;  5ELG A;  4MH3 A;  1XIY A;  4K7I A;  3TRX A;  1OAZ A;  2OE3 A;  3FEU A;  1O6J A;  1URM A;  3O6T A;  3VUR A;  2K8S A;  2CZ2 A;  1MD4 A;  1X9M B;  1GH2 A;  1G0T A;  1GRX A;  1R26 A;  2DJ2 A;  1XFL A;  3ERG A;  2RLI A;  2H0I A;  3KMO A;  2PBJ A;  1E2Y A;  4EXJ A;  5A5K A;  2AUV A;  5C04 A;  5IMV A;  2PGT A;  4NHZ A;  4ZXG A;  3I43 A;  2LUS A;  1AQV A;  1TTZ A;  3FKF A;  1I9D A;  1XWC A;  2I3Y A;  1OKT A;  3DKS A;  5J5N A;  2PVO C;  1ERW A;  3Q6O A;  3DML A;  1WRY A;  1AW9 A;  5ECH B;  2X8C A;  5HR2 A;  4ZL8 A;  3KMN A;  3H79 A;  4KA0 A;  2NTO A;  1JFU A;  4PUF C;  1UN2 A;  3US3 A;  2OAC A;  1ERV A;  1PX7 A;  1R4W A;  2LRN A;  2IFQ B;  2M46 A;  1VGL A;  4WF4 A;  5IMC A;  4WR5 A;  1YY7 A;  3LYK A;  3C73 A;  2P31 A;  1SL2 B;  1FAA A;  4IP6 A;  1W4V A;  4PQI A;  2JSY A;  4LA1 A;  1UC7 A;  3TJF A;  2K18 A;  4XS4 A;  4O92 A;  2HZE A;  3HDC A;  5CRW A;  1QUW A;  3G7Y A;  1TRU A;  4GLT A;  2MMA A;  3P8W A;  3KM6 A;  1SEN A;  2OJL A;  5IMA A;  4POK A;  1C72 A;  1NSW A;  2A4V A;  1HD2 A;  1SK0 A;  4IP1 A;  5IIZ A;  4F0B A;  1GUH A;  2YZU A;  18GS A;  1M9B A;  2NPB A;  2C0G A;  1QGV A;  3ED3 A;  3M9J A;  2PN8 A;  2LQO A;  2TRC P;  2I4A A;  4DSS A;  3QCP A;  1EWX A;  3K8N A;  3DRN A;  4Q5N A;  3GA4 A;  1THO A;  1T00 A;  3EU4 A;  3F4R A;  4K8M A;  3F0I A;  1O8W A;  4OFN A;  3KH7 A;  4Q5Q A;  2ES7 A;  2H0G A;  2VCX A;  1ZMA A;  1Y25 A;  3LFL A;  3RPN A;  2H6Y A;  5ECR B;  4JED A;  19GS A;  3FYG A;  4KAE A;  2CT6 A;  4AJ8 A;  1F2E A;  2VCQ A;  3GN3 A;  3I69 A;  3H93 A;  4TW5 A;  5DCH A;  4DVC A;  4N30 A;  4MH2 A;  2PPT A;  20GS A;  2C80 A;  3IK7 A;  3VLN A;  2GLR A;  5ECO B;  5ECN B;  1S3A A;  4I2T A;  4WXT A;  4CHS A;  4LLR A;  1AAZ A;  2HSH A;  3VWW A;  3VWV A;  3J7Y b;  2GSS A;  3D22 A;  3FZ4 A;  5AIX A;  1JHB A;  4IBP A;  5HR1 A;  4GST A;  1X9S B;  2N5A A;  4IGJ A;  5JWR B;  3KD0 A;  4XS4 B;  3CSH A;  4IKH A;  1MDI A;  4I2U A;  1GSF A;  2O8V B;  2GQL A;  2OBK A;  1EV4 A;  5J41 A;  3ME8 A;  1EP8 A;  5J9B A;  1JZO A;  3R2Q A;  14GS A;  6GSV A;  1TRV A;  4ZB6 A;  3PGT A;  2A2S A;  2FWF A;  2VCW A;  3KTL A;  1KEB A;  1GNW A;  2I1U A;  3APS A;  1U6T A;  2WDU A;  2VL3 A;  2HYX A;  4F2I A;  3QD9 A;  2KP1 A;  3D0Z A;  2H66 A;  3HA9 A;  1BAY A;  1T4Y A;  2L6D A;  1V58 A;  2N5F A;  3DEX A;  2YV7 A;  1IYI A;  3EE2 A;  3GSS A;  2LS5 A;  17GS A;  5EY6 A;  1GTB A;  5FT3 A;  1RK4 A;  1WP0 A;  5G5F A;  2OA7 A;  5KEJ A;  3ME7 A;  1AIU A;  3M1G A;  4TR1 A;  3LGC A;  2DLX A;  3GRX A;  2BJX A;  1Z6M A;  4KDX A;  2G2Q A;  1PRX A;  4PNF A;  1PSQ A;  2B5Y A;  2PER A;  2YWO A;  1A8Y A;  2X8H A;  3E3E A;  4X43 A;  3CTF A;  3TJK A;  2KHP A;  3D6I A;  3APO A;  5CO3 A;  2R5G A;  2N5B A;  3MWH A;  5F0G A;  4RQR A;  4TN8 A;  3LYP A;  5HFK A;  3UBK A;  1K0N A;  4BVY A;  4RQX A;  4TXV A;  2QSI A;  5ECS A;  1KTE A;  2MYG A;  4F82 A;  4KDU A;  1GSQ A;  2DML A;  3WYW A;  2L4C A;  2CAI A;  2PUK C;  3CTG A;  1XOB A;  2XPD A;  5DJL A;  1M0U A;  5HQP A;  1WIK A;  3HY2 A;  3IPZ A;  2CAQ A;  3QAW A;  4PGT A;  3ERW A;  3QOU A;  5GZZ B;  1U3A A;  3QDN A;  2ON5 A;  3FW2 A;  2L6C A;  2BTO T;  4WBR D;  5DQY A;  4NV5 A;  3F9U A;  5A4U A;  2FCH A;  5C00 A;  2DIY A;  2JZR A;  3KP9 A;  3CXG A;  3A2V A;  1THX A;  3RDW A;  3EIN A;  4MF5 A;  5G2Z A;  3GST A;  1HNA A;  1ERT A;  2H76 A;  1F3B A;  4MAB A;  2VD1 A;  3ZMK A;  1FVK A;  1NHO A;  1O81 A;  1B9Y C;  4ML6 A;  5ECK B;  3L78 A;  2YWN A;  2FHE A;  4GRF A;  1Q98 A;  3ZML A;  3ZVJ A;  3GYK A;  1WMJ A;  2VLV A;  2KP2 A;  1SKS B;  1GSU A;  4MJB A;  1YQ1 A;  2IIY A;  3EC3 A;  3TGZ A;  5D9V A;  2DJ3 A;  4IHU A;  1YEP A;  3RHB A;  1K0O A;  5L71 A;  3DIE A;  4MF7 A;  2LJK A;  1A23 A;  3P90 A;  3ISO A;  4XRA A;  1X5C A;  2LJA A;  3G9B A;  4K2D A;  3GKN A;  4XS6 A;  1GTA A;  1OC8 A;  4PXO A;  3EUR A;  3WT1 A;  4MJE A;  4XIH A;  2D2Z A;  3WGX A;  2H0H A;  1ILO A;  4JU5 A;  4K0G A;  2KUC A;  5ECQ B;  1TU8 A;  3EMX A;  5D93 A;  3IC4 A;  1DE2 A;  4ID0 A;  4K6X A;  2CV4 A;  2JZS A;  4WR4 A;  6GSS A;  2HLS A;  2LJR A;  1Q4J A;  1YJ6 A;  1TRS A;  3HJM A;  1TI1 A;  3WD6 A;  2F51 A;  1PL2 A;  2CX3 A;  2NBS A;  5F07 A;  4OO4 A;  1X0R A;  1TK0 B;  5B8B A;  3F3R A;  1HNB A;  3CRT A;  3IK9 A;  2GZY A;  3GNJ A;  3RAZ A;  1DE1 A;  1ZCP A;  4KGI A;  2VL2 A;  4BVX A;  3LXZ A;  3GH6 A;  5D8I A;  2FY6 A;  2YWM A;  2K6V A;  1PD2 1;  3WGE A;  3KXO A;  3ZRD A;  4G10 A;  1UVZ A;  2H75 A;  1K0B A;  1ZGN A;  5H5R A;  3IR4 A;  4EC0 A;  2C0D A;  6GSX A;  1AXD A;  3ZVJ D;  4EVM A;  4WF5 A;  1NW2 A;  1BJX A;  2QGV A;  1SD8 A;  5KN2 A;  1K0M A;  2IFQ A;  2P5R A;  4NHW A;  1BYE A;  5COH A;  1J08 A;  1XBS A;  4RI7 A;  3IBH A;  1XVQ A;  3ZTL A;  1VRS D;  2V32 A;  2CZ3 A;  4RI6 A;  2VD0 A;  2C3T A;  5DVB A;  11GS A;  5ECL B;  1H4O A;  4PUA A;  4V2M A;  1SK1 A;  2VM1 A;  1PGT A;  3HHV A;  3AY8 A;  4MK3 A;  5LD0 A;  3FHK A;  3CRU A;  2PWJ A;  2HFD A;  4PQH A;  1U87 A;  1M99 A;  2C0E A;  3J7Y k;  4BPY A;  3EWL A;  3C8E A;  4KH7 A;  5IO0 A;  2MMO A;  2E7P A;  1EEJ A;  4YAP A;  1A2M A;  3N9J A;  2F8A A;  4ML1 A;  2IMD A;  4PUR A;  2YPM A;  4IJ3 A;  2K9F A;  5FHI A;  1FOV A;  1A8L A;  5DAK B;  1Z7P A;  4HI7 A;  3H8Q A;  3EU3 A;  1QFN A;  1WOU A;  1YKA A;  2H6X A;  4V2L A;  1XWA A;  4CW9 A;  1S3D A;  2C0F A;  1K0C A;  3ZFB A;  1SK2 A;  2WS2 A;  6GSU A;  4Z7X A;  2JAC A;  2E0Q A;  2VCT A;  3L9V A;  1ABA A;  4ZL7 A;  1HYU A;  1V9W A;  2OE1 A;  1TKD B;  3O76 A;  1EOH A;  2H8L A;  3DGQ A;  1V57 A;  4QL7 A;  1PX6 A;  3LXT A;  3F8U A;  3UIW A;  1YEX A;  2DC5 A;  2IME A;  4OD7 A;  2R3X A;  5DAL A;  2DBC A;  3TUE A;  1CQG A;  4AF2 A;  5ELA A;  5EVO A;  3FR6 A;  2VL9 A;  4NPB A;  5DQS A;  1MTC A;  3HVX A;  4K9Z A;  2AHE A;  3ZL5 A;  1ACV A;  2EC4 A;  3VI7 A;  2GVP A;  1Z3E A;  2QKE A;  2IMF A;  3VWU A;  4NV2 A;  3IXR A;  1T4Z A;  2GQK A;  1PL1 A;  8GSS A;  2GSQ A;  4KB3 A;  1EGO A;  2H70 A;  1X9W B;  1Z9H A;  1GSY A;  3UVT A;  4ECI A;  3A5W A;  4GSS A;  2B1K A;  3TJB A;  1MEK A;  2B5X A;  2DMM A;  4IQA A;  4BWS A;  1K0A A;  3HVV A;  3Q74 A;  4WBJ A;  1JLW A;  5ABR A;  4MZC A;  2AB6 A;  1YZX A;  1DBY A;  2I9H A;  4HJ2 A;  1F6M C;  2REM A;  4N0V A;  5KN1 A;  5IMD A;  2JZT A;  1LJR A;  1UA5 A;  3QAV A;  4OMV A;  1JZR A;  2VCZ A;  1U88 A;  3UBL A;  1PQN A;  3OR5 A;  3C1R A;  1O73 A;  5D73 A;  5DAL B;  2LNT A;  4L0U A;  2O7K A;  1N8J A;  2VM2 A;  5B8A A;  2MMN A;  1E6B A;  3EYT A;  2PMT A;  3PR8 A;  4K7N A;  2CVK A;  4RUV A;  1QK8 A;  1DSB A;  2J9H A;  1O8X A;  2XBQ A;  4ZBA A;  4MMM A;  1QXH A;  2MMZ A;  2C4J A;  4I5Q A;  4MLY A;  1DUG A;  1ERU A;  4POB A;  5CRH A;  2NDO A;  3N5O A;  5D9T A;  4ECC A;  3D4T A;  2V1M A;  1TK8 B;  4IN0 A;  2FUG 2;  4LL4 B;  1Z5Y E;  3W8J A;  3LOR A;  1EV9 A;  1SL1 B;  5KN0 A;  1M2B A;  1GUM A;  2XPE A;  2H1D A;  2GQM A;  1JZD A;  2HE3 A;  2H72 A;  2R4V A;  4G19 A;  5H5S A;  1K3Y A;  2LNS A;  3ZYW A;  4MP4 A;  4EUY A;  3FZA A;  2H1B A;  6GSW A;  2IJY A;  3DWV A;  1O85 A;  1XW5 A;  2Z9S A;  3BBY A;  4ZL9 A;  3IAS 2;  2HT9 A;  4MDC A;  4KW6 A;  3F6D A;  4ZBD A;  1BG5 A;  4HU9 A;  3BOA A;  4ECJ A;  1XW9 A;  3HZ4 A;  1FVJ A;  4GXZ A;  3S9F A;  3PH9 A;  3GTU A;  5IMF A;  4JRR A;  4ZIL A;  4XTS A;  4ACS A;  2B3S A;  1TK5 B;  4EKZ A;  4HQZ A;  4MPF A;  3VFI A;  1OE8 A;  3TKP A;  2YAN A;  2YZH A;  3UEM A;  4IEL A;  3GKX A;  3GIX A;  4YQM A;  2WZ9 A;  1ML6 A;  1BED A;  3BJ5 A;  4L0W A;  2VL2 C;  1EGR A;  3PIN A;  1FB6 A;  3FR3 A;  4KDY A;  4ECB A;  3L4N A;  1M9A A;  4BWQ A;  3D21 A;  3E9J B;  2FNO A;  1I5G A;  3RPP A;  5LCZ A;  2FA4 A;  1ZZY A;  4O32 A;  3RHC A;  1R5P A;  2A2R A;  3Q18 A;  5IOW A;  3HCZ A;  2GSR A;  5F05 A;  2FGX A;  3GHA A;  4HOJ A;  2EIR A;  4X0X A;  2YN1 A;  1MDK A;  4TKY A;  3CMI A;  4FYC A;  4AJ7 A;  4F9Z A;  2LRC A;  3APQ A;  1U3I A;  5KN3 A;  5CRE A;  4O5R A;  4FH8 A;  1PKW A;  3DVW A;  2B7K A;  3NOF A;  3HJP A;  1GWC A;  2GZZ A;  4HZ4 A;  1QMV A;  4L5L A;  1PMT A;  1B4Q A;  1RQM A;  1CQH A;  3GTU B;  4TRX A;  4KND A;  5H5Q A;  2XBI A;  4HZ2 A;  3M9K A;  1YKC A;  2P0G A;  2MBS A;  1M2D A;  5JWQ B;  3UMA A;  1GTI A;  5AN1 A;  2F3M A;  1TXX A;  3MSZ A;  4N11 A;  2QC7 A;  4GSN A;  3WT2 A;  2JAD A;  4YQV A;  2PVQ A;  5ECI B;  4GWR A;  2EIO A;  4KUN A;  1W89 A;  4MJC A;  1NM3 A;  1T7P B;  3VPQ A;  3L9U A;  4JBB A;  5IPH A;  3G7J A;  2V6K A;  1TOF A;  4I6X A;  1ST9 A;  1VF2 A;  5B6M A;  1X5E A;  2CX4 A;  5JCW A;  2YOI A;  1SYX A;  2KLX A;  3HXS A;  1H75 A;  3HYP A;  4OO5 A;  3D5J A;  2VIM A;  3SWL A;  1F9M A;  3VK9 A;  3FR9 A;  5E59 A;  1O7U A;  2HXK A;  5EL8 A;  2H73 A;  3EVI A;  1SYR A;  3A2X A;  4LMV A;  2FLS A;  3KTB A;  2IPA A;  1B4P A;  5CNW A;  2GS3 A;  1XXU A;  3DVX A;  2TRX A;  2IMK A;  4GQF A;  3GL5 A;  1SL0 B;  4ULX A;  4TXO B;  3H1N A;  1T1V A;  1A2J A;  1GNE A;  3LEF A;  1R5A A;  5J3R A;  2VLT A;  5DAK A;  1YF0 A;  2TIR A;  3GKM A;  4HUA A;  3GL3 A;  3I6A A;  2H30 A;  3UOM A;  2J23 A;  4YH2 A;  2H6Z A;  3C71 A;  4L5O A;  4MJA A;  5EPF A;  2YJ7 A;  1G6Y A;  1J9B A;  2HI7 A;  3UVH A;  3KEB A;  5IO2 A;  1V98 A;  2MBT A;  2O87 A;  3DD3 A;  3ZRE A;  5GAP D;  1VF1 A;  3ZFL A;  1G7O A;  5ECM B;  1R7H A;  4KE3 A;  4JR4 A;  4E8E A;  4OCE A;  1FHE A;  1GLP A;  4I97 A;  5A4W A;  1TP9 A;  4F03 A;  1SKW B;  3LWA A;  4BA7 A;  1XWK A;  1K0D A;  3M8N A;  1KNG A;  1GP1 A;  2DJ0 A;  3TKS C;  1WWJ A;  5DJM A;  2OKA A;  5DDL A;  1FG4 A;  3H4K A;  3KGK A;  2H74 A;  2R37 A;  1T8E B;  1XZO A;  4KX4 A;  2DJ1 A;  3GUS A;  4IS0 A;  2B5E A;  3FY7 A;  4XCS A;  3GV1 A;  1A2L A;  3F6F A;  2OE0 A;  4KCE A;  3KZQ A;  2VLU A;  4EF0 A;  3IRA A;  1KBN A;  1AQX A;  2NVL A;  3KCM A;  4YQU A;  3GH9 A;  1VF3 A;  4PX1 A;  2E2G A;  2ALB A;  4ZB8 A;  3FZ9 A;  1FW1 A;  4WET A;  1GSE A;  4PQ1 A;  3GX8 A;  2I81 A;  2EIQ A;  2GST A;  2FA8 A;  1M2A A;  5IM9 A;  2WUL A;  1OE7 A;  2CVB A;  1ZYQ B;  1T3B A;  2DJK A;  2LST A;  2RM5 A;  1SJI A;  5GAN D;  3HKR A;  3GUR A;  1B8X A;  1A0F A;  1SD9 A;  1TW9 A;  4Q5R A;  1GSS A;  6GST A;  3F3Q A;  4DSR A;  4LMW A;  1WJK A;  5INY A;  4L8E A;  1YDK A;  2LV3 A;  2KOK A;  4POL A;  4TVE A;  3L9S A;  1OC9 A;  3LSZ A;  1GTU A;  2RM6 A;  5CYY A;  5CP1 A;  1RW1 A;  4QQ7 A;  3TRP A;  3WGD A;  3KIJ A;  3QPM A;  5GSS A;  3TJJ A;  2H71 A;  2GT6 A;  5IPG A;  1USB A;  5G5E A;  1SJ6 A;  4JZQ A;  2L4Q A;  2O85 A;  3P2A A;  1A0R P;  4HDE A;  2HRN A;  1XCC A;  1FB0 A;  3CBU A;  2WFC A;  2MZC A;  4FYB A;  1SJZ A;  1N2A A;  1PA3 A;  2X99 A;  3MDK A;  4E8H A;  5A4V A;  2E2M A;  2VUP A;  3M0F A;  1WPI A;  4CDO A;  4FYU A;  4BL7 A;  4Q5F A;  5ID2 A;  2G0F A;  1QQ2 A;  3LJR A;  2GTU A;  1TI3 A;  1GL8 A;  3ERF A;  4K0N A;  4XS1 A;  1Z7R A;  4GCI A;  3LQ7 A;  4LL1 B;  3BCK A;  5DCG A;  3TKS A;  1M7T A;  2ZNM A;  1HNC A;  2R2J A;  1K3L A;  4EDZ A;  3DYR A;  1SKR B;  2CQ9 A;  4MZB A;  1Y6E A;  1EZK A;  3HVS A;  4MPG A;  1XVW A;  3NZN A;  2YV9 A;  2AAW A;  3C1S A;  1IYH A;  2VOC A;  3FRC A;  3TKQ A;  1PN9 A;  5E4W A;  5G1K A;  2H01 A;  4F0C A;  3TDG A;  2YNX A;  1EP7 A;  2RUF A;  4ZB9 A;  1OC9 B;  1ON4 A;  4ISD A;  4ILF A;  2GDR A;  2RII A;  5IQY A;  3NIV A;  4TR4 A;  4OWY A;  2X8G A;  3D4M A;  4WKW A;  1GSD A;  2XHF A;  3KP8 A;  1AQW A;  2WRT A;  3A2W A;  2DIZ A;  4IVF A;  3W6G A;  1FO5 A;  1F37 A;  4N0Z A;  2B6M A;  2K8V A;  2LTK A;  4DEJ A;  3L0H A;  2AJQ B;  2JL4 A;  4NXI A;  1F3A A;  4YAV A;  1GUL A;  2F9S A;  1WE0 A;  2V6O A;  4DSQ A;  2HZE B;  2BMX A;  5J9C A;  4MF6 A;  2AYT A;  4NMU A;  3UAP A;  10GS A;  5G31 A;  1BX9 A;  3HD5 A;  5ID2 B;  2OAD A;  5DBQ A;  4ZIJ A;  1OYJ A;  1V40 A;  2XC2 A;  4QL9 A;  1VF4 A;  3KJY A;  2DJJ A;  3KH9 A;  3TKR A;  2WCI A;  4EO3 A;  3TOT A;  3TRQ A;  2CA8 A;  5JCG A;  4DSS B;  5CRD A;  3C7M A;  1JZW A;  4IW9 A;  5D9W A;  2VO4 A;  2YJH A;  4MCU A;  3QAG A;  5HFG A;  4J2F A;  4PNG A;  5F06 A;  16GS A;  2VCV A;  1MDJ A;  5ECP B;  3F4T A;  4NAX A;  4GQC A;  2DSA A;  2LEG A;  5HFI A;  2YCD A;  3IE3 A;  4EL1 A;  3VPT A;  4TR3 A;  4K7O A;  2WGR A;  1NHY A;  12GS A;  4AJ6 A;  2ZCT A;  2GZP A;  22GS A;  5B7C A;  2CVD A;  3TJG A;  5FWG A;  3IDV A;  4EE0 A;  5CAX A;  1XOA A;  3JCM L;  4KCA A;  3DXB A;  1YF1 A;  2YWI A;  3CSJ A;  5ENU A;  3LG6 A;  3M3M A;  2GT5 A;  1JLV A;  2C3N A;  2B1L A;  3U5R E;  4H86 A;  5IMZ A;  3U6V A;  4XHM A;  5IOX A;  4J57 E;  3GX0 A;  3FK8 A;  3GFK A;  3G7I A;  5HR3 A;  4O7H A;  3ZIV A;  4GTU A;  3QFA C;  2GGT A;  2F8F A;  2L5L A;  2B7J A;  2ON7 A;  3UAR A;  2H19 A;  4HEA 2;  1G7E A;  2IWT A;  5F8B A;  5JCU A;  2C1Y A;  1B48 A;  4TOP A;  1XWB A;  1OKD A;  4V1A p;  4XRD A;  4D73 A;  3FZ5 A;  5JWO B;  4V1A g;  3IV4 A;  2IMI A;  4HJM A;  4NWY A;  7GSS A;  3TKS E;  2O89 A;  4G9H A;  3ZZX A;  2PU9 C;  2L59 A;  5G30 A;  4IQ1 A;  4V2N A;  2VAF A;  3HZ8 A;  4TXO A;  5CRG A;  3E0U A;  2JSZ A;  2V2G A;  4KSO A;  1K3O A;  1OC3 A;  4WEY A;  1ZYE A;  2FWE A;  4MA9 A;  2OBI A;  2M80 A;  4I8B A;  1TDI A;  3UJ1 A;  2WJU A;  4X1U A;  1XPV A;  2FD3 A;  3BCI A;  4FO5 A;  1XWG A;  6GSY A;  9GSS A;  5D9X A;  3UL3 A;  2WB9 A;  3TOU A;  1LBK A;  3QMX A;  3W8S A;  2FWH A;  5AGY A;  2FWG A;  2P5Q A;  1X5D A;  1EEM A;  1TU7 A;  2H1A A;  3MAK A;  3GKK A;  4TR1 B;  1ZOF A;  2X64 A;  4FIW A;  1V2A A;  1MD3 A;  2C3Q A;  2R6K A;  3ZLP A;  3F4S A;  3TB2 A;  3IHQ A;  4HS1 A;  4MZW A;  2IL3 A;  1LU4 A;  4K1F A;  4G2E A;  1S3C A;  3IOS A;  3ZIT A;  1TJD A;  5GST A;  3QR6 A;  1GLQ A;  2L5O A;  2RUE A;  2YP6 A;  1G6W A;  4D73 B;  2ZUP A;  3VI5 A;  3CSI A;  2LQQ A;  3V1W A;  4HQS A;  5G1L A;  3P7X A;  2HRF A;  3RBT A;  4KSM A;  4AGS A;  4OFT A;  4OCF A;  1BQ7 A;  5AIV A;  4N10 A;  4JR6 A;  4J56 E;  1SU9 A; 
#chains in the Genus database with same CATH topology
 2LKU A;  4OFM A;  1EOG A;  2LRT A;  4GF0 A;  3IA1 A;  2AV4 A;  5HR0 A;  3I9V 2;  5LNK e;  4G0K A;  3TCO A;  1XW6 A;  3CYN A;  3EMP A;  2M72 A;  2HSY A;  2L57 A;  3MNG A;  3GMF A;  1OVN A;  3Q19 A;  1PKZ A;  1TRW A;  3O3T A;  3A3T A;  3ZIJ A;  4P3Y B;  1ZL9 A;  2HNL A;  3QFB C;  13GS A;  4ZBB A;  2H1G A;  2IN3 A;  1J0F A;  1GUK A;  3IAM 2;  3HJO A;  1AC1 A;  1Z6N A;  4EDY A;  5D96 A;  2HZF A;  3BD2 A;  5J4U A;  1HQO A;  1XG8 A;  3F63 A;  1AUC A;  4TR0 A;  1B9X C;  2JU5 A;  2C8U A;  5AIS A;  2QA2 A;  4JE1 A;  4HU7 A;  4POM A;  5B6N A;  3VWX A;  3SBC A;  4IJI A;  1A24 A;  2V41 A;  5ELG A;  4MH3 A;  1M3I A;  1XIY A;  4K7I A;  3TRX A;  1OAZ A;  2OE3 A;  4X4J A;  3FEU A;  1O6J A;  1URM A;  3O6T A;  3VUR A;  2K8S A;  2CZ2 A;  1MD4 A;  1X9M B;  1GH2 A;  1G0T A;  1GRX A;  1R26 A;  2DJ2 A;  1XFL A;  3ERG A;  2RLI A;  2H0I A;  3KMO A;  1M3J A;  2PBJ A;  1E2Y A;  4EXJ A;  5A5K A;  2AUV A;  5C04 A;  5IMV A;  2PGT A;  4NHZ A;  4ZXG A;  3I43 A;  2LUS A;  1AQV A;  1TTZ A;  3FKF A;  1I9D A;  1PN0 A;  1XWC A;  2I3Y A;  1OKT A;  3DKS A;  5J5N A;  2PVO C;  1ERW A;  3Q6O A;  3DML A;  1WRY A;  1AW9 A;  5ECH B;  2X8C A;  5HR2 A;  4ZL8 A;  3KMN A;  3H79 A;  4KA0 A;  2NTO A;  2HSM A;  1JFU A;  4PUF C;  1UN2 A;  3US3 A;  2OAC A;  1ERV A;  1PX7 A;  1R4W A;  2LRN A;  2IFQ B;  2M46 A;  1VGL A;  4WF4 A;  5IMC A;  4WR5 A;  1YY7 A;  3LYK A;  3C73 A;  2P31 A;  1SL2 B;  1FAA A;  4IP6 A;  1W4V A;  4PQI A;  2JSY A;  4LA1 A;  1UC7 A;  3TJF A;  2K18 A;  4XS4 A;  4O92 A;  2HZE A;  3HDC A;  5CRW A;  1QUW A;  3G7Y A;  1TRU A;  4GLT A;  2MMA A;  3P8W A;  3KM6 A;  1SEN A;  2OJL A;  5IMA A;  4POK A;  1C72 A;  1NSW A;  2A4V A;  1HD2 A;  1SK0 A;  4IP1 A;  5IIZ A;  4F0B A;  1GUH A;  2YZU A;  18GS A;  1M9B A;  2NPB A;  2C0G A;  1QGV A;  3ED3 A;  2R0P A;  3M9J A;  2PN8 A;  2LQO A;  2TRC P;  2I4A A;  4DSS A;  3QCP A;  1EWX A;  3K8N A;  3DRN A;  4Q5N A;  3GA4 A;  4PTS A;  1THO A;  1T00 A;  3EU4 A;  3F4R A;  4K8M A;  3F0I A;  1O8W A;  4OFN A;  3KH7 A;  4Q5Q A;  5BMU A;  2ES7 A;  2H0G A;  2VCX A;  1ZMA A;  1Y25 A;  3LFL A;  3RPN A;  2H6Y A;  5ECR B;  4JED A;  19GS A;  3FYG A;  4KAE A;  2CT6 A;  4AJ8 A;  1F2E A;  2VCQ A;  3GN3 A;  3I69 A;  3H93 A;  4TW5 A;  5DCH A;  4DVC A;  4N30 A;  4MH2 A;  2PPT A;  20GS A;  2C80 A;  3IK7 A;  3VLN A;  2GLR A;  5ECO B;  5ECN B;  1S3A A;  4I2T A;  4WXT A;  4CHS A;  4LLR A;  1AAZ A;  2HSH A;  3VWW A;  3VWV A;  3J7Y b;  2GSS A;  3D22 A;  3FZ4 A;  5KOX A;  5AIX A;  1ZYP A;  1JHB A;  4KF9 A;  4IBP A;  5HR1 A;  4GST A;  1X9S B;  2N5A A;  4IGJ A;  5JWR B;  3KD0 A;  4XS4 B;  3CSH A;  4IKH A;  1MDI A;  4I2U A;  1GSF A;  2O8V B;  2GQL A;  2OBK A;  1EV4 A;  5J41 A;  3ME8 A;  1EP8 A;  5J9B A;  1JZO A;  3R2Q A;  14GS A;  6GSV A;  1TRV A;  4ZB6 A;  3PGT A;  2A2S A;  4HSC X;  2FWF A;  2A2P A;  2VCW A;  3KTL A;  1KEB A;  1GNW A;  2I1U A;  3APS A;  1U6T A;  2WDU A;  2VL3 A;  2HYX A;  4F2I A;  3QD9 A;  2KP1 A;  3D0Z A;  2H66 A;  3HA9 A;  1BAY A;  1T4Y A;  2L6D A;  1V58 A;  2N5F A;  2X49 A;  3DEX A;  2YV7 A;  1IYI A;  3EE2 A;  3GSS A;  2LS5 A;  17GS A;  5EY6 A;  1GTB A;  5FT3 A;  1RK4 A;  1WP0 A;  5G5F A;  2OA7 A;  5KEJ A;  3ME7 A;  1AIU A;  3M1G A;  4TR1 A;  3LGC A;  2DLX A;  3GRX A;  2BJX A;  1Z6M A;  4KDX A;  2G2Q A;  1PRX A;  4PNF A;  1PSQ A;  2B5Y A;  2PER A;  2YWO A;  1A8Y A;  2X8H A;  3E3E A;  4X43 A;  3CTF A;  3TJK A;  2KHP A;  3D6I A;  3APO A;  5CO3 A;  2R5G A;  2N5B A;  3HVN A;  3MWH A;  5F0G A;  4RQR A;  4TN8 A;  3LYP A;  5HFK A;  3UBK A;  1K0N A;  4BVY A;  4RQX A;  4TXV A;  2QSI A;  5ECS A;  1KTE A;  2MYG A;  4F82 A;  4KDU A;  1GSQ A;  2DML A;  3WYW A;  2L4C A;  2CAI A;  2PUK C;  3CTG A;  1XOB A;  2XPD A;  5DJL A;  1M0U A;  5HQP A;  1WIK A;  3HY2 A;  3IPZ A;  2CAQ A;  3QAW A;  4PGT A;  3ERW A;  3QOU A;  5GZZ B;  1U3A A;  3QDN A;  2ON5 A;  3FW2 A;  2L6C A;  2BTO T;  4WBR D;  5DQY A;  4NV5 A;  3F9U A;  5A4U A;  3R3E A;  2FCH A;  5C00 A;  2DIY A;  2JZR A;  3KP9 A;  3CXG A;  3A2V A;  1THX A;  3RDW A;  3EIN A;  4MF5 A;  5G2Z A;  3GST A;  1HNA A;  1ERT A;  2H76 A;  1F3B A;  4MAB A;  2QA1 A;  2VD1 A;  3ZMK A;  1FVK A;  1NHO A;  1O81 A;  1B9Y C;  4ML6 A;  5ECK B;  3L78 A;  2YWN A;  2FHE A;  4GRF A;  1Q98 A;  3ZML A;  3ZVJ A;  3GYK A;  1WMJ A;  2VLV A;  2KP2 A;  1SKS B;  1GSU A;  4MJB A;  1YQ1 A;  2IIY A;  3EC3 A;  3TGZ A;  5D9V A;  2DJ3 A;  4IHU A;  1YEP A;  3RHB A;  1K0O A;  5L71 A;  3DIE A;  4MF7 A;  2LJK A;  1A23 A;  3P90 A;  3ISO A;  4XRA A;  1X5C A;  2LJA A;  3G9B A;  4K2D A;  3GKN A;  4XS6 A;  1GTA A;  4K2X A;  1OC8 A;  4PXO A;  3EUR A;  3WT1 A;  4MJE A;  4XIH A;  2D2Z A;  3WGX A;  2H0H A;  1ILO A;  4JU5 A;  4K0G A;  2KUC A;  2DKH A;  5ECQ B;  1S3R A;  1TU8 A;  3EMX A;  5D93 A;  3IC4 A;  1DE2 A;  4ID0 A;  4K6X A;  2CV4 A;  2JZS A;  4WR4 A;  6GSS A;  2HLS A;  2LJR A;  1Q4J A;  1YJ6 A;  1TRS A;  3HJM A;  1TI1 A;  3WD6 A;  2F51 A;  1PL2 A;  2CX3 A;  2NBS A;  5F07 A;  4OO4 A;  1X0R A;  1TK0 B;  5B8B A;  3F3R A;  1HNB A;  3CRT A;  3IK9 A;  2GZY A;  3GNJ A;  3RAZ A;  1DE1 A;  1ZCP A;  4KGI A;  2VL2 A;  4BVX A;  3LXZ A;  3GH6 A;  5D8I A;  2FY6 A;  2YWM A;  2K6V A;  1PD2 1;  3WGE A;  3KXO A;  3ZRD A;  4G10 A;  1UVZ A;  2H75 A;  1K0B A;  1ZGN A;  5H5R A;  3IR4 A;  4EC0 A;  2C0D A;  6GSX A;  1AXD A;  3ZVJ D;  4EVM A;  4WF5 A;  4YKG A;  1NW2 A;  1BJX A;  2QGV A;  1SD8 A;  5KN2 A;  1FOH A;  1K0M A;  2IFQ A;  2P5R A;  4NHW A;  1BYE A;  5COH A;  1J08 A;  1XBS A;  4RI7 A;  3IBH A;  1XVQ A;  3ZTL A;  1VRS D;  2V32 A;  2CZ3 A;  4RI6 A;  2VD0 A;  2C3T A;  5DVB A;  11GS A;  5ECL B;  1H4O A;  4PUA A;  4V2M A;  1SK1 A;  2VM1 A;  1PGT A;  3HHV A;  3AY8 A;  4MK3 A;  5LD0 A;  3FHK A;  3CRU A;  2PWJ A;  2HFD A;  4PQH A;  1U87 A;  1M99 A;  2C0E A;  3J7Y k;  4BPY A;  3EWL A;  3C8E A;  4KH7 A;  5IO0 A;  2MMO A;  2E7P A;  1EEJ A;  4YAP A;  1A2M A;  3N9J A;  2F8A A;  4ML1 A;  2IMD A;  4PUR A;  2YPM A;  4IJ3 A;  2K9F A;  5FHI A;  1FOV A;  1A8L A;  5DAK B;  1Z7P A;  4HI7 A;  3H8Q A;  3EU3 A;  4BVX B;  1QFN A;  1WOU A;  4G0I A;  1YKA A;  2H6X A;  4V2L A;  1XWA A;  4CW9 A;  1S3D A;  2C0F A;  1K0C A;  3ZFB A;  1SK2 A;  2WS2 A;  6GSU A;  4Z7X A;  2JAC A;  3IHG A;  2E0Q A;  2VCT A;  3L9V A;  1ABA A;  4ZL7 A;  1HYU A;  1V9W A;  2OE1 A;  1TKD B;  3O76 A;  1EOH A;  2H8L A;  3DGQ A;  1V57 A;  4QL7 A;  1PX6 A;  3LXT A;  3F8U A;  3UIW A;  1YEX A;  4A5P A;  2DC5 A;  2IME A;  4OD7 A;  2R3X A;  5DAL A;  2DBC A;  3TUE A;  1CQG A;  4AF2 A;  5ELA A;  5EVO A;  3FR6 A;  2VL9 A;  4NPB A;  5DQS A;  2DKI A;  1MTC A;  3HVX A;  4K9Z A;  2AHE A;  3ZL5 A;  1ACV A;  2EC4 A;  3VI7 A;  2GVP A;  1Z3E A;  2QKE A;  2IMF A;  3VWU A;  4NV2 A;  3IXR A;  1T4Z A;  2GQK A;  1PL1 A;  8GSS A;  2GSQ A;  4KB3 A;  1EGO A;  2H70 A;  1X9W B;  1Z9H A;  1GSY A;  3UVT A;  4ECI A;  3A5W A;  4GSS A;  2B1K A;  3TJB A;  1MEK A;  2B5X A;  2DMM A;  4IQA A;  4BWS A;  1K0A A;  3HVV A;  3Q74 A;  4MNN A;  4WBJ A;  1JLW A;  5ABR A;  4MZC A;  2AB6 A;  1YZX A;  1DBY A;  2I9H A;  4HJ2 A;  1F6M C;  2REM A;  4N0V A;  5KN1 A;  5IMD A;  2JZT A;  2X4A A;  1LJR A;  1UA5 A;  3QAV A;  4OMV A;  1JZR A;  2VCZ A;  1U88 A;  3UBL A;  1PQN A;  3OR5 A;  3C1R A;  1O73 A;  5D73 A;  5DAL B;  2LNT A;  4L0U A;  2O7K A;  1N8J A;  2VM2 A;  5B8A A;  2MMN A;  1E6B A;  3EYT A;  2PMT A;  3PR8 A;  4K7N A;  2CVK A;  4RUV A;  1QK8 A;  1DSB A;  2J9H A;  1O8X A;  2XBQ A;  4ZBA A;  4MMM A;  1QXH A;  2MMZ A;  2C4J A;  4I5Q A;  4MLY A;  1DUG A;  1ERU A;  4POB A;  5CRH A;  2NDO A;  3N5O A;  5D9T A;  4ECC A;  3D4T A;  2V1M A;  1TK8 B;  4IN0 A;  2FUG 2;  4LL4 B;  1Z5Y E;  3W8J A;  3LOR A;  1EV9 A;  1SL1 B;  5KN0 A;  1M2B A;  1GUM A;  2XPE A;  2H1D A;  2GQM A;  1JZD A;  2HE3 A;  2H72 A;  2R4V A;  4G19 A;  5H5S A;  1K3Y A;  2LNS A;  3ZYW A;  4MP4 A;  4EUY A;  3FZA A;  2H1B A;  6GSW A;  2IJY A;  2UZ8 A;  3DWV A;  1O85 A;  1XW5 A;  2Z9S A;  3BBY A;  4ZL9 A;  3IAS 2;  2HT9 A;  4MDC A;  4KW6 A;  3F6D A;  4ZBD A;  1BG5 A;  4HU9 A;  3BOA A;  4ECJ A;  1XW9 A;  3HZ4 A;  1FVJ A;  4GXZ A;  3S9F A;  3PH9 A;  3GTU A;  5IMF A;  4CY6 A;  4JRR A;  4ZIL A;  4XTS A;  4ACS A;  2B3S A;  1TK5 B;  4EKZ A;  4HQZ A;  4MPF A;  4O5U A;  3VFI A;  1OE8 A;  3TKP A;  2YAN A;  2YZH A;  3UEM A;  4IEL A;  3GKX A;  3EPT A;  3GIX A;  4YQM A;  2WZ9 A;  1ML6 A;  1BED A;  3BJ5 A;  4L0W A;  2VL2 C;  1EGR A;  3PIN A;  1FB6 A;  3FR3 A;  4KDY A;  4ECB A;  3L4N A;  1M9A A;  4BWQ A;  3D21 A;  3E9J B;  2R0C A;  2FNO A;  1I5G A;  2HRA A;  3RPP A;  5LCZ A;  2FA4 A;  1ZZY A;  4O32 A;  3RHC A;  1R5P A;  2A2R A;  3Q18 A;  5IOW A;  3HCZ A;  2GSR A;  5F05 A;  2FGX A;  3GHA A;  4HOJ A;  2EIR A;  4X0X A;  2YN1 A;  1MDK A;  4TKY A;  3CMI A;  4FYC A;  4AJ7 A;  4F9Z A;  2LRC A;  3APQ A;  1U3I A;  5KN3 A;  5CRE A;  4O5R A;  4FH8 A;  1PKW A;  1ZYN A;  3DVW A;  2B7K A;  3NOF A;  3HJP A;  1GWC A;  2GZZ A;  4HZ4 A;  1QMV A;  4L5L A;  2HRK A;  1PMT A;  1B4Q A;  1RQM A;  1CQH A;  3GTU B;  4TRX A;  3FMW A;  4KND A;  5H5Q A;  2XBI A;  4HZ2 A;  3M9K A;  1YKC A;  2P0G A;  2MBS A;  1M2D A;  5JWQ B;  3UMA A;  1GTI A;  5AN1 A;  2F3M A;  1TXX A;  3MSZ A;  4N11 A;  2QC7 A;  4GSN A;  3WT2 A;  2JAD A;  4K5S A;  4USS A;  4YQV A;  2PVQ A;  5ECI B;  4GWR A;  2EIO A;  4KUN A;  1W89 A;  4MJC A;  1NM3 A;  1T7P B;  3VPQ A;  3L9U A;  4JBB A;  5IPH A;  3G7J A;  2V6K A;  1TOF A;  4I6X A;  1ST9 A;  1VF2 A;  5B6M A;  1X5E A;  2CX4 A;  5JCW A;  2YOI A;  1SYX A;  2KLX A;  3HXS A;  1H75 A;  3HYP A;  4OO5 A;  3D5J A;  2VIM A;  3SWL A;  1F9M A;  3VK9 A;  3FR9 A;  5E59 A;  1O7U A;  2HXK A;  5EL8 A;  2H73 A;  3EVI A;  1SYR A;  3A2X A;  4LMV A;  2FLS A;  3KTB A;  2IPA A;  1B4P A;  5CNW A;  2GS3 A;  1XXU A;  3DVX A;  2TRX A;  2IMK A;  4GQF A;  3GL5 A;  1SL0 B;  4ULX A;  4TXO B;  3H1N A;  1T1V A;  1A2J A;  1GNE A;  3LEF A;  1R5A A;  5J3R A;  2VLT A;  5DAK A;  1YF0 A;  2TIR A;  3GKM A;  4HUA A;  3GL3 A;  3I6A A;  2H30 A;  3UOM A;  2J23 A;  4YH2 A;  2H6Z A;  3C71 A;  4L5O A;  4MJA A;  5EPF A;  2YJ7 A;  1G6Y A;  1J9B A;  2HI7 A;  3UVH A;  3KEB A;  5IO2 A;  4Z2T A;  1V98 A;  2MBT A;  2O87 A;  3DD3 A;  3ZRE A;  5GAP D;  1VF1 A;  3ZFL A;  1G7O A;  5ECM B;  1R7H A;  4KE3 A;  4JR4 A;  4E8E A;  4OCE A;  1FHE A;  1GLP A;  4I97 A;  5A4W A;  1TP9 A;  4F03 A;  1SKW B;  3LWA A;  4BA7 A;  1XWK A;  1K0D A;  3M8N A;  1KNG A;  1GP1 A;  2DJ0 A;  3TKS C;  1WWJ A;  5DJM A;  2OKA A;  5DDL A;  5BRT A;  1FG4 A;  3H4K A;  3KGK A;  2H74 A;  2R37 A;  1T8E B;  1XZO A;  4KX4 A;  2DJ1 A;  3GUS A;  4IS0 A;  2B5E A;  3FY7 A;  4XCS A;  3GV1 A;  1A2L A;  3F6F A;  2OE0 A;  4KCE A;  3KZQ A;  2VLU A;  4EF0 A;  3IRA A;  1KBN A;  1AQX A;  2NVL A;  3KCM A;  4YQU A;  3GH9 A;  1VF3 A;  4PX1 A;  2E2G A;  2ALB A;  4ZB8 A;  3FZ9 A;  1FW1 A;  4WET A;  4Z2R A;  1GSE A;  4PQ1 A;  3GX8 A;  2I81 A;  2EIQ A;  2GST A;  2FA8 A;  1M2A A;  5IM9 A;  2WUL A;  1OE7 A;  2CVB A;  1ZYQ B;  1T3B A;  2DJK A;  2LST A;  2RM5 A;  1SJI A;  5GAN D;  3HKR A;  3GUR A;  1B8X A;  1A0F A;  1SD9 A;  1TW9 A;  4Q5R A;  1GSS A;  6GST A;  3F3Q A;  4DSR A;  4LMW A;  1WJK A;  5INY A;  4YKF A;  4L8E A;  1YDK A;  2LV3 A;  2KOK A;  4POL A;  4TVE A;  3L9S A;  1OC9 A;  3LSZ A;  2R0G A;  1GTU A;  2RM6 A;  5CYY A;  5CP1 A;  1RW1 A;  4QQ7 A;  3TRP A;  3WGD A;  3KIJ A;  3QPM A;  5GSS A;  3TJJ A;  2H71 A;  2GT6 A;  5IPG A;  1USB A;  5G5E A;  1SJ6 A;  4JZQ A;  2L4Q A;  2O85 A;  3P2A A;  1A0R P;  4HDE A;  2HRN A;  1XCC A;  1FB0 A;  3CBU A;  4EIP A;  2WFC A;  2MZC A;  4FYB A;  1SJZ A;  1N2A A;  1PA3 A;  2X99 A;  3MDK A;  4E8H A;  5A4V A;  2E2M A;  2VUP A;  3M0F A;  1WPI A;  4CDO A;  4FYU A;  4BL7 A;  4Q5F A;  5ID2 A;  2G0F A;  2A4H A;  1QQ2 A;  3LJR A;  2GTU A;  1TI3 A;  1GL8 A;  3ERF A;  4K0N A;  4XS1 A;  1Z7R A;  4GCI A;  3LQ7 A;  4LL1 B;  3BCK A;  5DCG A;  3TKS A;  1M7T A;  2ZNM A;  1HNC A;  2R2J A;  1K3L A;  4EDZ A;  3DYR A;  1SKR B;  2CQ9 A;  4MZB A;  1Y6E A;  1EZK A;  3HVS A;  4MPG A;  1XVW A;  3NZN A;  2YV9 A;  2AAW A;  3C1S A;  1IYH A;  2VOC A;  3FRC A;  3LW9 A;  3TKQ A;  1PN9 A;  5E4W A;  5G1K A;  2H01 A;  4F0C A;  3TDG A;  2YNX A;  1EP7 A;  2RUF A;  4ZB9 A;  1OC9 B;  1ON4 A;  4ISD A;  4ILF A;  2GDR A;  2RII A;  5IQY A;  3NIV A;  4TR4 A;  4OWY A;  2X8G A;  3D4M A;  4WKW A;  1GSD A;  2XHF A;  3KP8 A;  1AQW A;  3IC8 A;  2WRT A;  3A2W A;  2DIZ A;  4IVF A;  3W6G A;  1FO5 A;  1F37 A;  4N0Z A;  2B6M A;  2K8V A;  2LTK A;  4DEJ A;  3L0H A;  2AJQ B;  2JL4 A;  4NXI A;  1F3A A;  4YAV A;  1GUL A;  2F9S A;  1WE0 A;  2V6O A;  4DSQ A;  2HZE B;  2BMX A;  5J9C A;  4MF6 A;  2AYT A;  4NMU A;  3UAP A;  10GS A;  5G31 A;  4BL7 B;  1BX9 A;  3HD5 A;  5ID2 B;  2OAD A;  5DBQ A;  4ZIJ A;  1OYJ A;  1V40 A;  2XC2 A;  4QL9 A;  1VF4 A;  3KJY A;  2DJJ A;  3KH9 A;  3TKR A;  3A5I A;  1PFO A;  2WCI A;  4EO3 A;  3TOT A;  4Z2U A;  3TRQ A;  2CA8 A;  5JCG A;  4DSS B;  5CRD A;  3C7M A;  4O5Q A;  1JZW A;  4IW9 A;  5D9W A;  2VO4 A;  2YJH A;  4MCU A;  3QAG A;  5HFG A;  4J2F A;  4PNG A;  4CY8 A;  5F06 A;  16GS A;  2VCV A;  1MDJ A;  5ECP B;  3F4T A;  4NAX A;  4GQC A;  2DSA A;  2LEG A;  5HFI A;  2YCD A;  3IE3 A;  4EL1 A;  3VPT A;  4TR3 A;  4K7O A;  2WGR A;  1NHY A;  12GS A;  4AJ6 A;  2ZCT A;  2GZP A;  22GS A;  5B7C A;  2CVD A;  3TJG A;  5FWG A;  3IDV A;  4EE0 A;  5CAX A;  4EIQ A;  1XOA A;  3JCM L;  4KCA A;  3DXB A;  1YF1 A;  2YWI A;  3CSJ A;  5ENU A;  3LG6 A;  3M3M A;  2GT5 A;  1JLV A;  2C3N A;  2B1L A;  3U5R E;  4H86 A;  5IMZ A;  3U6V A;  4XHM A;  5IOX A;  4J57 E;  3GX0 A;  3FK8 A;  3GFK A;  3G7I A;  5HR3 A;  4O7H A;  3ZIV A;  4GTU A;  3QFA C;  2GGT A;  2F8F A;  2L5L A;  2B7J A;  2ON7 A;  3UAR A;  3MYD A;  2H19 A;  4HEA 2;  1G7E A;  2IWT A;  5F8B A;  5KOW A;  5JCU A;  2C1Y A;  1B48 A;  4TOP A;  1XWB A;  1OKD A;  4V1A p;  4XRD A;  4D73 A;  3FZ5 A;  5JWO B;  4V1A g;  3IV4 A;  2IMI A;  4HJM A;  4NWY A;  7GSS A;  3TKS E;  2O89 A;  4G9H A;  3ZZX A;  4K5R A;  2PU9 C;  2L59 A;  5G30 A;  4IQ1 A;  4V2N A;  2VAF A;  4ICY A;  3HZ8 A;  4TXO A;  5CRG A;  3E0U A;  2JSZ A;  2V2G A;  4KSO A;  1K3O A;  1OC3 A;  4WEY A;  1ZYE A;  2FWE A;  4BIK A;  4MA9 A;  2OBI A;  2M80 A;  4I8B A;  1TDI A;  4FQU A;  3UJ1 A;  2WJU A;  4X1U A;  1XPV A;  2FD3 A;  3BCI A;  4FO5 A;  1XWG A;  6GSY A;  9GSS A;  5D9X A;  3UL3 A;  2WB9 A;  3MIX A;  3TOU A;  1LBK A;  3QMX A;  3W8S A;  2FWH A;  5AGY A;  2FWG A;  2P5Q A;  1X5D A;  1EEM A;  1TU7 A;  2H1A A;  3MAK A;  3GKK A;  4TR1 B;  1ZOF A;  4G0L A;  2X64 A;  4FIW A;  1V2A A;  1MD3 A;  2C3Q A;  2R6K A;  3ZLP A;  3F4S A;  3TB2 A;  3IHQ A;  4HS1 A;  4MZW A;  2IL3 A;  1LU4 A;  4K1F A;  4G2E A;  1S3C A;  3IOS A;  3ZIT A;  1TJD A;  5GST A;  3QR6 A;  1GLQ A;  2L5O A;  2RUE A;  2YP6 A;  1G6W A;  4D73 B;  2ZUP A;  3VI5 A;  3CSI A;  4BVY B;  2LQQ A;  3V1W A;  4HQS A;  5G1L A;  3P7X A;  2HRF A;  3RBT A;  4KSM A;  3PPU A;  4AGS A;  4OFT A;  4OCF A;  1BQ7 A;  5AIV A;  4N10 A;  4JR6 A;  3CQF A;  4J56 E;  1SU9 A; 
#chains in the Genus database with same CATH homology
 2LKU A;  4OFM A;  1EOG A;  2LRT A;  4GF0 A;  3IA1 A;  2AV4 A;  5HR0 A;  3I9V 2;  5LNK e;  4G0K A;  3TCO A;  1XW6 A;  3CYN A;  3EMP A;  2M72 A;  2HSY A;  2L57 A;  3MNG A;  3GMF A;  1OVN A;  3Q19 A;  1PKZ A;  1TRW A;  3O3T A;  3A3T A;  3ZIJ A;  4P3Y B;  1ZL9 A;  2HNL A;  3QFB C;  13GS A;  4ZBB A;  2H1G A;  2IN3 A;  1J0F A;  1GUK A;  3IAM 2;  3HJO A;  1AC1 A;  1Z6N A;  4EDY A;  5D96 A;  2HZF A;  3BD2 A;  5J4U A;  1HQO A;  3F63 A;  1AUC A;  4TR0 A;  1B9X C;  2JU5 A;  2C8U A;  5AIS A;  2QA2 A;  4JE1 A;  4HU7 A;  4POM A;  5B6N A;  3VWX A;  3SBC A;  4IJI A;  1A24 A;  2V41 A;  5ELG A;  4MH3 A;  1XIY A;  4K7I A;  3TRX A;  1OAZ A;  2OE3 A;  4X4J A;  3FEU A;  1O6J A;  1URM A;  3O6T A;  3VUR A;  2K8S A;  2CZ2 A;  1MD4 A;  1X9M B;  1GH2 A;  1G0T A;  1GRX A;  1R26 A;  2DJ2 A;  1XFL A;  3ERG A;  2RLI A;  2H0I A;  3KMO A;  2PBJ A;  1E2Y A;  4EXJ A;  5A5K A;  2AUV A;  5C04 A;  5IMV A;  2PGT A;  4NHZ A;  4ZXG A;  3I43 A;  2LUS A;  1AQV A;  1TTZ A;  3FKF A;  1I9D A;  1PN0 A;  1XWC A;  2I3Y A;  1OKT A;  3DKS A;  5J5N A;  2PVO C;  1ERW A;  3Q6O A;  3DML A;  1WRY A;  1AW9 A;  5ECH B;  2X8C A;  5HR2 A;  4ZL8 A;  3KMN A;  3H79 A;  4KA0 A;  2NTO A;  2HSM A;  1JFU A;  4PUF C;  1UN2 A;  3US3 A;  2OAC A;  1ERV A;  1PX7 A;  1R4W A;  2LRN A;  2IFQ B;  2M46 A;  1VGL A;  4WF4 A;  5IMC A;  4WR5 A;  1YY7 A;  3LYK A;  3C73 A;  2P31 A;  1SL2 B;  1FAA A;  4IP6 A;  1W4V A;  4PQI A;  2JSY A;  4LA1 A;  1UC7 A;  3TJF A;  2K18 A;  4XS4 A;  4O92 A;  2HZE A;  3HDC A;  5CRW A;  1QUW A;  3G7Y A;  1TRU A;  4GLT A;  2MMA A;  3P8W A;  3KM6 A;  1SEN A;  2OJL A;  5IMA A;  4POK A;  1C72 A;  1NSW A;  2A4V A;  1HD2 A;  1SK0 A;  4IP1 A;  5IIZ A;  4F0B A;  1GUH A;  2YZU A;  18GS A;  1M9B A;  2NPB A;  2C0G A;  1QGV A;  3ED3 A;  2R0P A;  3M9J A;  2PN8 A;  2LQO A;  2TRC P;  2I4A A;  4DSS A;  3QCP A;  1EWX A;  3K8N A;  3DRN A;  4Q5N A;  3GA4 A;  4PTS A;  1THO A;  1T00 A;  3EU4 A;  3F4R A;  4K8M A;  3F0I A;  1O8W A;  4OFN A;  3KH7 A;  4Q5Q A;  5BMU A;  2ES7 A;  2H0G A;  2VCX A;  1ZMA A;  1Y25 A;  3LFL A;  3RPN A;  2H6Y A;  5ECR B;  4JED A;  19GS A;  3FYG A;  4KAE A;  2CT6 A;  4AJ8 A;  1F2E A;  2VCQ A;  3GN3 A;  3I69 A;  3H93 A;  4TW5 A;  5DCH A;  4DVC A;  4N30 A;  4MH2 A;  2PPT A;  20GS A;  2C80 A;  3IK7 A;  3VLN A;  2GLR A;  5ECO B;  5ECN B;  1S3A A;  4I2T A;  4WXT A;  4CHS A;  4LLR A;  1AAZ A;  2HSH A;  3VWW A;  3VWV A;  3J7Y b;  2GSS A;  3D22 A;  3FZ4 A;  5KOX A;  5AIX A;  1ZYP A;  1JHB A;  4KF9 A;  4IBP A;  5HR1 A;  4GST A;  1X9S B;  2N5A A;  4IGJ A;  5JWR B;  3KD0 A;  4XS4 B;  3CSH A;  4IKH A;  1MDI A;  4I2U A;  1GSF A;  2O8V B;  2GQL A;  2OBK A;  1EV4 A;  5J41 A;  3ME8 A;  1EP8 A;  5J9B A;  1JZO A;  3R2Q A;  14GS A;  6GSV A;  1TRV A;  4ZB6 A;  3PGT A;  2A2S A;  2FWF A;  2A2P A;  2VCW A;  3KTL A;  1KEB A;  1GNW A;  2I1U A;  3APS A;  1U6T A;  2WDU A;  2VL3 A;  2HYX A;  4F2I A;  3QD9 A;  2KP1 A;  3D0Z A;  2H66 A;  3HA9 A;  1BAY A;  1T4Y A;  2L6D A;  1V58 A;  2N5F A;  2X49 A;  3DEX A;  2YV7 A;  1IYI A;  3EE2 A;  3GSS A;  2LS5 A;  17GS A;  5EY6 A;  1GTB A;  5FT3 A;  1RK4 A;  1WP0 A;  5G5F A;  2OA7 A;  5KEJ A;  3ME7 A;  1AIU A;  3M1G A;  4TR1 A;  3LGC A;  2DLX A;  3GRX A;  2BJX A;  1Z6M A;  4KDX A;  2G2Q A;  1PRX A;  4PNF A;  1PSQ A;  2B5Y A;  2PER A;  2YWO A;  1A8Y A;  2X8H A;  3E3E A;  4X43 A;  3CTF A;  3TJK A;  2KHP A;  3D6I A;  3APO A;  5CO3 A;  2R5G A;  2N5B A;  3MWH A;  5F0G A;  4RQR A;  4TN8 A;  3LYP A;  5HFK A;  3UBK A;  1K0N A;  4BVY A;  4RQX A;  4TXV A;  2QSI A;  5ECS A;  1KTE A;  2MYG A;  4F82 A;  4KDU A;  1GSQ A;  2DML A;  3WYW A;  2L4C A;  2CAI A;  2PUK C;  3CTG A;  1XOB A;  2XPD A;  5DJL A;  1M0U A;  5HQP A;  1WIK A;  3HY2 A;  3IPZ A;  2CAQ A;  3QAW A;  4PGT A;  3ERW A;  3QOU A;  5GZZ B;  1U3A A;  3QDN A;  2ON5 A;  3FW2 A;  2L6C A;  2BTO T;  4WBR D;  5DQY A;  4NV5 A;  3F9U A;  5A4U A;  3R3E A;  2FCH A;  5C00 A;  2DIY A;  2JZR A;  3KP9 A;  3CXG A;  3A2V A;  1THX A;  3RDW A;  3EIN A;  4MF5 A;  5G2Z A;  3GST A;  1HNA A;  1ERT A;  2H76 A;  1F3B A;  4MAB A;  2QA1 A;  2VD1 A;  3ZMK A;  1FVK A;  1NHO A;  1O81 A;  1B9Y C;  4ML6 A;  5ECK B;  3L78 A;  2YWN A;  2FHE A;  4GRF A;  1Q98 A;  3ZML A;  3ZVJ A;  3GYK A;  1WMJ A;  2VLV A;  2KP2 A;  1SKS B;  1GSU A;  4MJB A;  1YQ1 A;  2IIY A;  3EC3 A;  3TGZ A;  5D9V A;  2DJ3 A;  4IHU A;  1YEP A;  3RHB A;  1K0O A;  5L71 A;  3DIE A;  4MF7 A;  2LJK A;  1A23 A;  3P90 A;  3ISO A;  4XRA A;  1X5C A;  2LJA A;  3G9B A;  4K2D A;  3GKN A;  4XS6 A;  1GTA A;  4K2X A;  1OC8 A;  4PXO A;  3EUR A;  3WT1 A;  4MJE A;  4XIH A;  2D2Z A;  3WGX A;  2H0H A;  1ILO A;  4JU5 A;  4K0G A;  2KUC A;  2DKH A;  5ECQ B;  1TU8 A;  3EMX A;  5D93 A;  3IC4 A;  1DE2 A;  4ID0 A;  4K6X A;  2CV4 A;  2JZS A;  4WR4 A;  6GSS A;  2HLS A;  2LJR A;  1Q4J A;  1YJ6 A;  1TRS A;  3HJM A;  1TI1 A;  3WD6 A;  2F51 A;  1PL2 A;  2CX3 A;  2NBS A;  5F07 A;  4OO4 A;  1X0R A;  1TK0 B;  5B8B A;  3F3R A;  1HNB A;  3CRT A;  3IK9 A;  2GZY A;  3GNJ A;  3RAZ A;  1DE1 A;  1ZCP A;  4KGI A;  2VL2 A;  4BVX A;  3LXZ A;  3GH6 A;  5D8I A;  2FY6 A;  2YWM A;  2K6V A;  1PD2 1;  3WGE A;  3KXO A;  3ZRD A;  4G10 A;  1UVZ A;  2H75 A;  1K0B A;  1ZGN A;  5H5R A;  3IR4 A;  4EC0 A;  2C0D A;  6GSX A;  1AXD A;  3ZVJ D;  4EVM A;  4WF5 A;  4YKG A;  1NW2 A;  1BJX A;  2QGV A;  1SD8 A;  5KN2 A;  1FOH A;  1K0M A;  2IFQ A;  2P5R A;  4NHW A;  1BYE A;  5COH A;  1J08 A;  1XBS A;  4RI7 A;  3IBH A;  1XVQ A;  3ZTL A;  1VRS D;  2V32 A;  2CZ3 A;  4RI6 A;  2VD0 A;  2C3T A;  5DVB A;  11GS A;  5ECL B;  1H4O A;  4PUA A;  4V2M A;  1SK1 A;  2VM1 A;  1PGT A;  3HHV A;  3AY8 A;  4MK3 A;  5LD0 A;  3FHK A;  3CRU A;  2PWJ A;  2HFD A;  4PQH A;  1U87 A;  1M99 A;  2C0E A;  3J7Y k;  4BPY A;  3EWL A;  3C8E A;  4KH7 A;  5IO0 A;  2MMO A;  2E7P A;  1EEJ A;  4YAP A;  1A2M A;  3N9J A;  2F8A A;  4ML1 A;  2IMD A;  4PUR A;  2YPM A;  4IJ3 A;  2K9F A;  5FHI A;  1FOV A;  1A8L A;  5DAK B;  1Z7P A;  4HI7 A;  3H8Q A;  3EU3 A;  4BVX B;  1QFN A;  1WOU A;  4G0I A;  1YKA A;  2H6X A;  4V2L A;  1XWA A;  4CW9 A;  1S3D A;  2C0F A;  1K0C A;  3ZFB A;  1SK2 A;  2WS2 A;  6GSU A;  4Z7X A;  2JAC A;  3IHG A;  2E0Q A;  2VCT A;  3L9V A;  1ABA A;  4ZL7 A;  1HYU A;  1V9W A;  2OE1 A;  1TKD B;  3O76 A;  1EOH A;  2H8L A;  3DGQ A;  1V57 A;  4QL7 A;  1PX6 A;  3LXT A;  3F8U A;  3UIW A;  1YEX A;  4A5P A;  2DC5 A;  2IME A;  4OD7 A;  2R3X A;  5DAL A;  2DBC A;  3TUE A;  1CQG A;  4AF2 A;  5ELA A;  5EVO A;  3FR6 A;  2VL9 A;  4NPB A;  5DQS A;  2DKI A;  1MTC A;  3HVX A;  4K9Z A;  2AHE A;  3ZL5 A;  1ACV A;  2EC4 A;  3VI7 A;  2GVP A;  1Z3E A;  2QKE A;  2IMF A;  3VWU A;  4NV2 A;  3IXR A;  1T4Z A;  2GQK A;  1PL1 A;  8GSS A;  2GSQ A;  4KB3 A;  1EGO A;  2H70 A;  1X9W B;  1Z9H A;  1GSY A;  3UVT A;  4ECI A;  3A5W A;  4GSS A;  2B1K A;  3TJB A;  1MEK A;  2B5X A;  2DMM A;  4IQA A;  4BWS A;  1K0A A;  3HVV A;  3Q74 A;  4MNN A;  4WBJ A;  1JLW A;  5ABR A;  4MZC A;  2AB6 A;  1YZX A;  1DBY A;  2I9H A;  4HJ2 A;  1F6M C;  2REM A;  4N0V A;  5KN1 A;  5IMD A;  2JZT A;  2X4A A;  1LJR A;  1UA5 A;  3QAV A;  4OMV A;  1JZR A;  2VCZ A;  1U88 A;  3UBL A;  1PQN A;  3OR5 A;  3C1R A;  1O73 A;  5D73 A;  5DAL B;  2LNT A;  4L0U A;  2O7K A;  1N8J A;  2VM2 A;  5B8A A;  2MMN A;  1E6B A;  3EYT A;  2PMT A;  3PR8 A;  4K7N A;  2CVK A;  4RUV A;  1QK8 A;  1DSB A;  2J9H A;  1O8X A;  2XBQ A;  4ZBA A;  4MMM A;  1QXH A;  2MMZ A;  2C4J A;  4I5Q A;  4MLY A;  1DUG A;  1ERU A;  4POB A;  5CRH A;  2NDO A;  3N5O A;  5D9T A;  4ECC A;  3D4T A;  2V1M A;  1TK8 B;  4IN0 A;  2FUG 2;  4LL4 B;  1Z5Y E;  3W8J A;  3LOR A;  1EV9 A;  1SL1 B;  5KN0 A;  1M2B A;  1GUM A;  2XPE A;  2H1D A;  2GQM A;  1JZD A;  2HE3 A;  2H72 A;  2R4V A;  4G19 A;  5H5S A;  1K3Y A;  2LNS A;  3ZYW A;  4MP4 A;  4EUY A;  3FZA A;  2H1B A;  6GSW A;  2IJY A;  2UZ8 A;  3DWV A;  1O85 A;  1XW5 A;  2Z9S A;  3BBY A;  4ZL9 A;  3IAS 2;  2HT9 A;  4MDC A;  4KW6 A;  3F6D A;  4ZBD A;  1BG5 A;  4HU9 A;  3BOA A;  4ECJ A;  1XW9 A;  3HZ4 A;  1FVJ A;  4GXZ A;  3S9F A;  3PH9 A;  3GTU A;  5IMF A;  4CY6 A;  4JRR A;  4ZIL A;  4XTS A;  4ACS A;  2B3S A;  1TK5 B;  4EKZ A;  4HQZ A;  4MPF A;  4O5U A;  3VFI A;  1OE8 A;  3TKP A;  2YAN A;  2YZH A;  3UEM A;  4IEL A;  3GKX A;  3EPT A;  3GIX A;  4YQM A;  2WZ9 A;  1ML6 A;  1BED A;  3BJ5 A;  4L0W A;  2VL2 C;  1EGR A;  3PIN A;  1FB6 A;  3FR3 A;  4KDY A;  4ECB A;  3L4N A;  1M9A A;  4BWQ A;  3D21 A;  3E9J B;  2R0C A;  2FNO A;  1I5G A;  2HRA A;  3RPP A;  5LCZ A;  2FA4 A;  1ZZY A;  4O32 A;  3RHC A;  1R5P A;  2A2R A;  3Q18 A;  5IOW A;  3HCZ A;  2GSR A;  5F05 A;  2FGX A;  3GHA A;  4HOJ A;  2EIR A;  4X0X A;  2YN1 A;  1MDK A;  4TKY A;  3CMI A;  4FYC A;  4AJ7 A;  4F9Z A;  2LRC A;  3APQ A;  1U3I A;  5KN3 A;  5CRE A;  4O5R A;  4FH8 A;  1PKW A;  1ZYN A;  3DVW A;  2B7K A;  3NOF A;  3HJP A;  1GWC A;  2GZZ A;  4HZ4 A;  1QMV A;  4L5L A;  2HRK A;  1PMT A;  1B4Q A;  1RQM A;  1CQH A;  3GTU B;  4TRX A;  3FMW A;  4KND A;  5H5Q A;  2XBI A;  4HZ2 A;  3M9K A;  1YKC A;  2P0G A;  2MBS A;  1M2D A;  5JWQ B;  3UMA A;  1GTI A;  5AN1 A;  2F3M A;  1TXX A;  3MSZ A;  4N11 A;  2QC7 A;  4GSN A;  3WT2 A;  2JAD A;  4K5S A;  4USS A;  4YQV A;  2PVQ A;  5ECI B;  4GWR A;  2EIO A;  4KUN A;  1W89 A;  4MJC A;  1NM3 A;  1T7P B;  3VPQ A;  3L9U A;  4JBB A;  5IPH A;  3G7J A;  2V6K A;  1TOF A;  4I6X A;  1ST9 A;  1VF2 A;  5B6M A;  1X5E A;  2CX4 A;  5JCW A;  2YOI A;  1SYX A;  2KLX A;  3HXS A;  1H75 A;  3HYP A;  4OO5 A;  3D5J A;  2VIM A;  3SWL A;  1F9M A;  3VK9 A;  3FR9 A;  5E59 A;  1O7U A;  2HXK A;  5EL8 A;  2H73 A;  3EVI A;  1SYR A;  3A2X A;  4LMV A;  2FLS A;  3KTB A;  2IPA A;  1B4P A;  5CNW A;  2GS3 A;  1XXU A;  3DVX A;  2TRX A;  2IMK A;  4GQF A;  3GL5 A;  1SL0 B;  4ULX A;  4TXO B;  3H1N A;  1T1V A;  1A2J A;  1GNE A;  3LEF A;  1R5A A;  5J3R A;  2VLT A;  5DAK A;  1YF0 A;  2TIR A;  3GKM A;  4HUA A;  3GL3 A;  3I6A A;  2H30 A;  3UOM A;  2J23 A;  4YH2 A;  2H6Z A;  3C71 A;  4L5O A;  4MJA A;  5EPF A;  2YJ7 A;  1G6Y A;  1J9B A;  2HI7 A;  3UVH A;  3KEB A;  5IO2 A;  4Z2T A;  1V98 A;  2MBT A;  2O87 A;  3DD3 A;  3ZRE A;  5GAP D;  1VF1 A;  3ZFL A;  1G7O A;  5ECM B;  1R7H A;  4KE3 A;  4JR4 A;  4E8E A;  4OCE A;  1FHE A;  1GLP A;  4I97 A;  5A4W A;  1TP9 A;  4F03 A;  1SKW B;  3LWA A;  4BA7 A;  1XWK A;  1K0D A;  3M8N A;  1KNG A;  1GP1 A;  2DJ0 A;  3TKS C;  1WWJ A;  5DJM A;  2OKA A;  5DDL A;  5BRT A;  1FG4 A;  3H4K A;  3KGK A;  2H74 A;  2R37 A;  1T8E B;  1XZO A;  4KX4 A;  2DJ1 A;  3GUS A;  4IS0 A;  2B5E A;  3FY7 A;  4XCS A;  3GV1 A;  1A2L A;  3F6F A;  2OE0 A;  4KCE A;  3KZQ A;  2VLU A;  4EF0 A;  3IRA A;  1KBN A;  1AQX A;  2NVL A;  3KCM A;  4YQU A;  3GH9 A;  1VF3 A;  4PX1 A;  2E2G A;  2ALB A;  4ZB8 A;  3FZ9 A;  1FW1 A;  4WET A;  4Z2R A;  1GSE A;  4PQ1 A;  3GX8 A;  2I81 A;  2EIQ A;  2GST A;  2FA8 A;  1M2A A;  5IM9 A;  2WUL A;  1OE7 A;  2CVB A;  1ZYQ B;  1T3B A;  2DJK A;  2LST A;  2RM5 A;  1SJI A;  5GAN D;  3HKR A;  3GUR A;  1B8X A;  1A0F A;  1SD9 A;  1TW9 A;  4Q5R A;  1GSS A;  6GST A;  3F3Q A;  4DSR A;  4LMW A;  1WJK A;  5INY A;  4YKF A;  4L8E A;  1YDK A;  2LV3 A;  2KOK A;  4POL A;  4TVE A;  3L9S A;  1OC9 A;  3LSZ A;  2R0G A;  1GTU A;  2RM6 A;  5CYY A;  5CP1 A;  1RW1 A;  4QQ7 A;  3TRP A;  3WGD A;  3KIJ A;  3QPM A;  5GSS A;  3TJJ A;  2H71 A;  2GT6 A;  5IPG A;  1USB A;  5G5E A;  1SJ6 A;  4JZQ A;  2L4Q A;  2O85 A;  3P2A A;  1A0R P;  4HDE A;  2HRN A;  1XCC A;  1FB0 A;  3CBU A;  4EIP A;  2WFC A;  2MZC A;  4FYB A;  1SJZ A;  1N2A A;  1PA3 A;  2X99 A;  3MDK A;  4E8H A;  5A4V A;  2E2M A;  2VUP A;  3M0F A;  1WPI A;  4CDO A;  4FYU A;  4BL7 A;  4Q5F A;  5ID2 A;  2G0F A;  2A4H A;  1QQ2 A;  3LJR A;  2GTU A;  1TI3 A;  1GL8 A;  3ERF A;  4K0N A;  4XS1 A;  1Z7R A;  4GCI A;  3LQ7 A;  4LL1 B;  3BCK A;  5DCG A;  3TKS A;  1M7T A;  2ZNM A;  1HNC A;  2R2J A;  1K3L A;  4EDZ A;  3DYR A;  1SKR B;  2CQ9 A;  4MZB A;  1Y6E A;  1EZK A;  3HVS A;  4MPG A;  1XVW A;  3NZN A;  2YV9 A;  2AAW A;  3C1S A;  1IYH A;  2VOC A;  3FRC A;  3LW9 A;  3TKQ A;  1PN9 A;  5E4W A;  5G1K A;  2H01 A;  4F0C A;  3TDG A;  2YNX A;  1EP7 A;  2RUF A;  4ZB9 A;  1OC9 B;  1ON4 A;  4ISD A;  4ILF A;  2GDR A;  2RII A;  5IQY A;  3NIV A;  4TR4 A;  4OWY A;  2X8G A;  3D4M A;  4WKW A;  1GSD A;  2XHF A;  3KP8 A;  1AQW A;  3IC8 A;  2WRT A;  3A2W A;  2DIZ A;  4IVF A;  3W6G A;  1FO5 A;  1F37 A;  4N0Z A;  2B6M A;  2K8V A;  2LTK A;  4DEJ A;  3L0H A;  2AJQ B;  2JL4 A;  4NXI A;  1F3A A;  4YAV A;  1GUL A;  2F9S A;  1WE0 A;  2V6O A;  4DSQ A;  2HZE B;  2BMX A;  5J9C A;  4MF6 A;  2AYT A;  4NMU A;  3UAP A;  10GS A;  5G31 A;  4BL7 B;  1BX9 A;  3HD5 A;  5ID2 B;  2OAD A;  5DBQ A;  4ZIJ A;  1OYJ A;  1V40 A;  2XC2 A;  4QL9 A;  1VF4 A;  3KJY A;  2DJJ A;  3KH9 A;  3TKR A;  3A5I A;  2WCI A;  4EO3 A;  3TOT A;  4Z2U A;  3TRQ A;  2CA8 A;  5JCG A;  4DSS B;  5CRD A;  3C7M A;  4O5Q A;  1JZW A;  4IW9 A;  5D9W A;  2VO4 A;  2YJH A;  4MCU A;  3QAG A;  5HFG A;  4J2F A;  4PNG A;  4CY8 A;  5F06 A;  16GS A;  2VCV A;  1MDJ A;  5ECP B;  3F4T A;  4NAX A;  4GQC A;  2DSA A;  2LEG A;  5HFI A;  2YCD A;  3IE3 A;  4EL1 A;  3VPT A;  4TR3 A;  4K7O A;  2WGR A;  1NHY A;  12GS A;  4AJ6 A;  2ZCT A;  2GZP A;  22GS A;  5B7C A;  2CVD A;  3TJG A;  5FWG A;  3IDV A;  4EE0 A;  5CAX A;  4EIQ A;  1XOA A;  3JCM L;  4KCA A;  3DXB A;  1YF1 A;  2YWI A;  3CSJ A;  5ENU A;  3LG6 A;  3M3M A;  2GT5 A;  1JLV A;  2C3N A;  2B1L A;  3U5R E;  4H86 A;  5IMZ A;  3U6V A;  4XHM A;  5IOX A;  4J57 E;  3GX0 A;  3FK8 A;  3GFK A;  3G7I A;  5HR3 A;  4O7H A;  3ZIV A;  4GTU A;  3QFA C;  2GGT A;  2F8F A;  2L5L A;  2B7J A;  2ON7 A;  3UAR A;  3MYD A;  2H19 A;  4HEA 2;  1G7E A;  2IWT A;  5F8B A;  5KOW A;  5JCU A;  2C1Y A;  1B48 A;  4TOP A;  1XWB A;  1OKD A;  4V1A p;  4XRD A;  4D73 A;  3FZ5 A;  5JWO B;  4V1A g;  3IV4 A;  2IMI A;  4HJM A;  4NWY A;  7GSS A;  3TKS E;  2O89 A;  4G9H A;  3ZZX A;  4K5R A;  2PU9 C;  2L59 A;  5G30 A;  4IQ1 A;  4V2N A;  2VAF A;  4ICY A;  3HZ8 A;  4TXO A;  5CRG A;  3E0U A;  2JSZ A;  2V2G A;  4KSO A;  1K3O A;  1OC3 A;  4WEY A;  1ZYE A;  2FWE A;  4MA9 A;  2OBI A;  2M80 A;  4I8B A;  1TDI A;  4FQU A;  3UJ1 A;  2WJU A;  4X1U A;  1XPV A;  2FD3 A;  3BCI A;  4FO5 A;  1XWG A;  6GSY A;  9GSS A;  5D9X A;  3UL3 A;  2WB9 A;  3MIX A;  3TOU A;  1LBK A;  3QMX A;  3W8S A;  2FWH A;  5AGY A;  2FWG A;  2P5Q A;  1X5D A;  1EEM A;  1TU7 A;  2H1A A;  3MAK A;  3GKK A;  4TR1 B;  1ZOF A;  4G0L A;  2X64 A;  4FIW A;  1V2A A;  1MD3 A;  2C3Q A;  2R6K A;  3ZLP A;  3F4S A;  3TB2 A;  3IHQ A;  4HS1 A;  4MZW A;  2IL3 A;  1LU4 A;  4K1F A;  4G2E A;  1S3C A;  3IOS A;  3ZIT A;  1TJD A;  5GST A;  3QR6 A;  1GLQ A;  2L5O A;  2RUE A;  2YP6 A;  1G6W A;  4D73 B;  2ZUP A;  3VI5 A;  3CSI A;  4BVY B;  2LQQ A;  3V1W A;  4HQS A;  5G1L A;  3P7X A;  2HRF A;  3RBT A;  4KSM A;  3PPU A;  4AGS A;  4OFT A;  4OCF A;  1BQ7 A;  5AIV A;  4N10 A;  4JR6 A;  4J56 E;  1SU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...