4FYCA

Structural and functional characterizations of a thioredoxin-fold protein from helicobacter pylori
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
DKKSYAGLEDVFSDNKSISPNDKYMLLVFGRNGCSYCERFKKDLKNVKELRDYIKEHFSAYYVNISYSKEHDFKVGDKNNEKEIKMSTEELAQIYAVQSTPTIVLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKDDEDLTKKLKAYIKYKTNLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein (DsbC)
publication title Structural and functional characterization of HP0377, a thioredoxin-fold protein from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 59
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fycA00
2K6VA 1PMTA 2FGXA 3D21A 3O6TA 3L9UA 3ZIJA 4FYBA 4KDUA 3D0ZA 1Z6MA 3F0IA 2J9HA 5GAND 3HHVA 5DJMA 1Y6EA 1GLQA 2XPEA 2C80A 2H1BA 1EOHA 4CW9A 2GT6A 3UARA 3RDWA 1WE0A 2XC2A 3UEMA 2MMZA 2OE1A 1M99A 5A4VA 3GTUB 3KMNA 1GUHA 1I5GA 3GTUA 2GLRA 4D73B 3C1RA 1PA3A 2HSHA 5AN1A 1FO5A 3IBHA 4D73A 1EP8A 4RI7A 5GAPD 3FW2A 2X8HA 2JZRA 3KP9A 1THOA 1NHYA 3ZMKA 4MJAA 1OE7A 1AW9A 4PNGA 1RW1A 4OFNA 5GSSA 3KEBA 3WGDA 3HVSA 2FWEA 1GUMA 2YWNA 4OD7A 2REMA 3VWUA 2YN1A 1X9WB 2JACA 2DJJA 1B4QA 2DIZA 5ECQB 5CRWA 3CYNA 3M0FA 2YPMA 1XXUA 2F51A 1PKWA 1K3YA 1EP7A 5KN1A 2YOIA 3F4TA 6GSWA 2JZSA 1JLWA 4MCUA 1A24A 3EU4A 1QGVA 4G2EA 4WKWA 5CNWA 3KH9A 2VO4A 2OACA 2PUKC 4TR4A 3TKSE 1Z6NA 2YANA 4GCIA 1ZZYA 3ME8A 2NVLA 4PUAA 2HI7A 5C04A 3H4KA 2M80A 3NZNA 12GSA 4XHMA 4WXTA 4MZCA 3F3QA 2GZZA 1Q4JA 3U5RE 1NSWA 4K7NA 2PN8A 2OJLA 2V2GA 1TDIA 4K7IA 3GX8A 3H8QA 5D8IA 4HJ2A 1QMVA 2H71A 1GSEA 3RPPA 2WGRA 4HOJA 4XIHA 1HQOA 3QAWA 2RM6A 3LORA 1AUCA 1RQMA 1HYUA 1V2AA 2CVDA 4TR1A 4AJ6A 3TDGA 3C73A 3L4NA 3KZQA 2LJRA 1THXA 2QSIA 3GURA 1ABAA 1GH2A 3GH6A 2V32A 2IMKA 4BVYA 4O32A 2P5QA 5JCUA 1CQGA 4YAPA 1GWCA 5IMFA 1TK5B 4MZWA 2RUEA 3DGQA 2P31A 4NHZA 2ZUPA 4I6XA 5G31A 5D93A 4HI7A 4GQFA 2PVQA 5J4UA 1EEMA 2H73A 3FY7A 4NPBA 4JR4A 5GZZB 4ZXGA 2B1KA 1SENA 5HFGA 5ECRB 5A4UA 3LJRA 5EPFA 2N5BA 5DJLA 2CVBA 4OFTA 5F8BA 2R4VA 2YZHA 3TJKA 1M2AA 4X43A 3GH9A 3TKPA 3RBTA 1O6JA 2NDOA 4JR6A 2QKEA 3Q6OA 1VF1A 4Q5FA 1ACVA 5G2ZA 3HJOA 4N11A 3UL3A 1YEPA 4HU7A 4EDZA 4JU5A 2D2ZA 1R4WA 1SJZA 4TN8A 4NWYA 2H1GA 4ID0A 1R26A 5B8BA 5IO2A 3UBLA 2IMFA 2YWIA 3L9SA 2VCTA 3M8NA 4O7HA 2H70A 1HNBA 2ALBA 2GSTA 1XW6A 1GTUA 2VLTA 4AJ8A 1R7HA 3TKQA 4WBRD 4POMA 5DBQA 4IELA 1X5CA 2F8AA 2H66A 2X8CA 3A5WA 3FR3A 4K9ZA 1K3LA 5D9TA 3DKSA 1Y25A 4Q5QA 4WETA 3LYKA 3U6VA 4KX4A 2XBIA 2IFQB 1C72A 1A0RP 1PKZA 4ECCA 1ST9A 4V1Ap 2NBSA 3G7IA 4EUYA 3J7Yk 4DVCA 2WCIA 3BOAA 2WULA 2CT6A 3HJMA 3D5JA 3F4RA 2K9FA 2H6ZA 4RQXA 3ZTLA 4K2DA 3LG6A 3HZ4A 6GSXA 2VM2A 2B5XA 3F3RA 3CMIA 3GN3A 4OMVA 3G7YA 2B7KA 3RPNA 1BX9A 1OVNA 3LXZA 5IMZA 3APQA 3WYWA 2I81A 2R3XA 4TRXA 2LJKA 4ULXA 2H75A 3BBYA 3EMXA 1KEBA 4CDOA 4MZBA 3F8UA 4IVFA 4I8BA 3GSTA 2O8VB 1XVQA 4LL1B 4DSQA 2VCQA 2KP1A 2O7KA 4OO5A 3HKRA 4TXOB 1GTAA 3UBKA 1MD4A 1PX6A 2MYGA 2HZEB 2CZ2A 2H30A 1MDIA 4JRRA 3TCOA 1QK8A 4DSRA 5CRHA 4HEA2 1NHOA 1FOVA 3TJGA 3HA9A 3R2QA 2OA7A 1E6BA 1T1VA 5IMAA 3IDVA 3KCMA 5D9XA 2WS2A 4DEJA 2F8FA 5G30A 1OC3A 4OWYA 4NV5A 3EWLA 2LV3A 4HDEA 1V58A 1GSFA 2V6OA 3KXOA 4TR3A 1OC8A 1AAZA 2R2JA 4IQAA 3QCPA 2WZ9A 2PBJA 4K1FA 2YWMA 1F2EA 2LRCA 5HR1A 4POLA 3WT2A 3DWVA 5DAKB 4BWSA 2HE3A 1WWJA 4ZL7A 1O7UA 1A8LA 1YDKA 2Z9SA 3IC4A 3GIXA 5DAKA 2RUFA 5ENUA 4LMVA 1SKRB 3DMLA 4MH2A 3TKSA 1A2MA 2JL4A 2GDRA 1FB6A 2C3QA 1TW9A 2VL3A 5HR0A 1SKWB 1H4OA 4PUFC 2FCHA 4KCAA 1TRWA 1A23A 2HRNA 2WFCA 1JZRA 3QDNA 2AYTA 4P3YB 4XS6A 3DVWA 4F82A 3ZZXA 1OC9A 1ERVA 3E9JB 3H93A 3L9VA 2YWOA 1TRUA 3L78A 5JWRB 3LSZA 5CP1A 1VGLA 3GX0A 4IHUA 2MBSA 3TB2A 5DQYA 3GUSA 4XCSA 2DMMA 4ZIJA 3A2VA 2BJXA 3F4SA 2H0GA 4N10A 4EL1A 1ILOA 3W8SA 3MSZA 3E0UA 2R6KA 3GKXA 1M9BA 3PR8A 5IQYA 1TK8B 3HYPA 3FK8A 2VCWA 3CSJA 3NIVA 2L5OA 1G7OA 3WGXA 2DJ2A 2I4AA 2LNTA 1IYIA 2P0GA 5IPGA 1PRXA 4ECJA 5D73A 5KN0A 2LSTA 4F2IA 2HYXA 1TJDA 18GSA 1XWKA 1G6WA 1U6TA 2R37A 2YNXA 4AF2A 3TJFA 1RK4A 1WIKA 1MDJA 3C7MA 1FB0A 4FH8A 2XPDA 1UVZA 1GNEA 3H1NA 3I9V2 2DJ0A 3VURA 4TW5A 5KEJA 1Z5YE 1OE8A 2C3TA 3LGCA 1T8EB 1HD2A 2I3YA 5ELAA 5F05A 2DMLA 1MD3A 6GSVA 1A8YA 2K18A 3FZ5A 3IE3A 2DJ3A 1AQXA 3NOFA 5IOXA 2FWHA 4MLYA 14GSA 2HT9A 4HJMA 2X8GA 3DXBA 4IJ3A 2VL2C 2CZ3A 19GSA 4WF5A 3CSHA 4IBPA 3HY2A 3I69A 4OCFA 4KAEA 3QFBC 1Q98A 2LRNA 3D4TA 2MZCA 3F9UA 2LNSA 1ZL9A 3IPZA 2O87A 3I6AA 3QAGA 4NMUA 11GSA 1YF1A 1TK0B 4KDYA 1GSSA 1U3IA 4HU9A 1GSDA 2VD1A 4I2UA 3TKRA 2H74A 3KGKA 1YY7A 2IN3A 1WP0A 4I5QA 1SL2B 4LLRA 4KUNA 5GSTA 4ZB6A 5IPHA 5DCHA 3P2AA 4KDXA 1F3AA 3W6GA 2PMTA 1R5AA 3GHAA 3F6FA 3ZFLA 4MF5A 4BWQA 2PGTA 4O92A 1MTCA 1TU7A 4G19A 1BYEA 5F06A 1K0NA 2B5EA 4BL7A 2OE0A 3IOSA 5LNKe 4LL4B 2H19A 4ZBDA 4L0WA 3HCZA 2K8SA 1A0FA 4KE3A 3S9FA 5F07A 1ZYEA 4X0XA 2TRCP 1URMA 5CRGA 3J7Yb 4ILFA 3GKMA 2IMIA 1PN9A 2QGVA 1JZWA 22GSA 3FRCA 1AIUA 2C8UA 3UVHA 4GSTA 4FIWA 5ECKB 2VCVA 2VL9A 2F3MA 4BA7A 1F9MA 2KLXA 3HXSA 3MAKA 2M46A 1TP9A 2MMNA 2VLVA 3DYRA 2RIIA 2CQ9A 5J9BA 3FEUA 4MA9A 3ZLPA 5CAXA 1M0UA 4F9ZA 1BQ7A 1GRXA 1F6MC 5J3RA 5DCGA 5IIZA 4ISDA 1QUWA 1G0TA 1X0RA 5B8AA 2FWGA 2C1YA 3KTBA 3L0HA 5ECNB 3EMPA 2PERA 4V1Ag 1UC7A 3VFIA 3CSIA 1EV9A 2L6CA 2B6MA 2A2SA 1GP1A 2YCDA 4TVEA 5COHA 2EC4A 2CAQA 3D4MA 4ZB9A 6GSTA 2AB6A 3KTLA 1XIYA 3FR6A 3VI5A 2FLSA 2WJUA 2CV4A 1O8XA 1G6YA 2C0GA 4NHWA 7GSSA 5JCGA 1EGOA 1VRSD 3APSA 1X5EA 4TOPA 1B9YC 2JSYA 1ZCPA 1S3CA 2I9HA 2CAIA 1YEXA 1V40A 2MBTA 2KUCA 1Z9HA 2CA8A 5HQPA 2IMEA 2FA8A 4FYUA 13GSA 2H0IA 1WMJA 1O81A 2G2QA 20GSA 1QQ2A 2VCXA 3RHCA 3V1WA 4BPYA 1O85A 1M2DA 3KIJA 3FZAA 3HJPA 1O8WA 2OKAA 1AXDA 1FVJA 3CRUA 2J23A 2OADA 1DBYA 2A2RA 3ED3A 1ML6A 3EINA 3N5OA 2VUPA 2VM1A 4XTSA 2B1LA 4PQHA 3HD5A 4RQRA 2B5YA 1W89A 2IJYA 5IMVA 4DSSB 2DSAA 3TJBA 1DUGA 4IW9A 4DSSA 3GRXA 2L6DA 3EVIA 1V57A 2VAFA 2WB9A 4N30A 2GVPA 3IK7A 5FT3A 2QC7A 3GV1A 5CRDA 3UMAA 3QD9A 3DVXA 2IFQA 2LUSA 4KGIA 2P5RA 4EO3A 1GTIA 2LS5A 5DQSA 2IPAA 2NTOA 3TKSC 3SBCA 3WT1A 2DBCA 4CHSA 1W4VA 3A3TA 5H5SA 4E8EA 2YZUA 3PINA 1Z7RA 3KP8A 2H8LA 4WR4A 1K0MA 2ZNMA 3GMFA 4H86A 3ZL5A 2E2MA 3UIWA 5KN3A 4KW6A 1SK1A 1ON4A 1EZKA 3G9BA 1YKCA 1ERTA 2JADA 2E0QA 4GQCA 2V1MA 4V2LA 2N5AA 1R5PA 4MF7A 3QPMA 5D96A 4GRFA 2F9SA 4MP4A 2VCZA 5IM9A 3ZFBA 5AISA 4EXJA 3QOUA 3SWLA 4EC0A 2FHEA 2GT5A 1NM3A 2GSSA 1FAAA 4MABA 4TXOA 2B7JA 2B3SA 1XCCA 2H1AA 3TRQA 1SD8A 2HZEA 4KNDA 2C4JA 1TTZA 5G1LA 5ID2B 2E2GA 3MDKA 3IAM2 2GTUA 5JCWA 4HZ2A 1F37A 5A5KA 1TKDB 5B7CA 5ELGA 2G0FA 1FHEA 4IGJA 1BEDA 1S3AA 1T00A 4FYCA 4MDCA 1EOGA 4NXIA 2H1DA 4IKHA 4FO5A 2DLXA 3F63A 3O3TA 3FHKA 4YAVA 3EYTA 3LEFA 4IJIA 4AJ7A 3MNGA 2V6KA 5HR2A 3D22A 2N5FA 2BMXA 2LEGA 2GGTA 3PGTA 3IV4A 4IP1A 1LU4A 4QL9A 4WR5A 4RUVA 3PH9A 1FW1A 1DE1A 1XWCA 2FWFA 2H0HA 2KOKA 3JCML 2V41A 4IS0A 16GSA 4MF6A 3BCIA 3ISOA 1U3AA 2JZTA 4PQIA 4KSMA 1PX7A 5AIXA 4IP6A 5ECOB 3N9JA 1J9BA 1XW5A 4KH7A 4PURA 3Q19A 2H01A 4ML6A 3TRXA 4MK3A 4EF0A 1OKTA 2C0FA 3VPTA 4ZL8A 1QFNA 1XW9A 3FR9A 3LYPA 5IMDA 5L71A 1JZOA 4KCEA 2GSRA 1UA5A 4MMMA 1MEKA 1O73A 3KJYA 2HNLA 4F0CA 4O5RA 2L5LA 1SK2A 2VD0A 3RAZA 4GXZA 4MJBA 3FZ9A 4GWRA 1TRSA 4POBA 3LWAA 2LQQA 2BTOT 3LXTA 2L4QA 3TOUA 3G7JA 2NPBA 1GTBA 3M1GA 2AHEA 1PSQA 3CTFA 3IR4A 4POKA 5A4WA 1AQWA 4XRAA 1H75A 1GSQA 1GSYA 4PNFA 1CQHA 5IMCA 1SK0A 3CTGA 4YH2A 2ZCTA 3TJJA 4J2FA 1N2AA 1ZMAA 4KA0A 1KNGA 1TRVA 4I2TA 3EC3A 1BG5A 1FG4A 4LMWA 1G7EA 5G1KA 2C0EA 3ERFA 1TXXA 2EIOA 4N0VA 1WOUA 1TU8A 2HZFA 2L59A 3ZIVA 1YZXA 10GSA 2H6XA 1K0DA 5FHIA 3C71A 5JWQB 4Z7XA 4Q5RA 1AC1A 3AY8A 3KMOA 2H6YA 3ZMLA 4GTUA 2IL3A 4ZBBA 1JFUA 4ZILA 5G5EA 2TIRA 3GA4A 1M7TA 4I97A 1PD21 1B9XC 1X9MB 1K0OA 1DE2A 1SU9A 3D6IA 4J56E 5DVBA 1XVWA 2XHFA 5LD0A 1GUKA 1V9WA 3VWWA 5J9CA 3GL5A 3VWXA 3Q74A 3P8WA 1X5DA 3I43A 5INYA 1OYJA 3FZ4A 1K0AA 3IA1A 2FNOA 17GSA 4MPFA 4QL7A 4HS1A 4AGSA 4L0UA 1SL0B 4X1UA 3HVVA 4PX1A 4LA1A 1SYRA 4G9HA 1SD9A 4MPGA 1J08A 4V2NA 5IOWA 4HQZA 1X9SB 1T7PB 3DEXA 4K6XA 2HRFA 1PQNA 2GS3A 5CYYA 2ON5A 1E2YA 5EY6A 4JZQA 4TR0A 4HUAA 2C3NA 3ZITA 2O89A 1GULA 4RI6A 2DC5A 1U87A 3IXRA 5J41A 2IWTA 1S3DA 2A4VA 1XFLA 3QMXA 3ZVJD 3QAVA 4G10A 1VF2A 4GSSA 2K8VA 1LBKA 5ABRA 3HDCA 3O76A 5G5FA 3GKNA 4V2MA 5E4WA 5B6MA 4OO4A 4TXVA 3TRPA 1A2JA 4TR1B 1EGRA 2XBQA 4QQ7A 5ECLB 1XWAA 1GLPA 2WDUA 2HFDA 2FA4A 1EEJA 2VOCA 3GNJA 2DIYA 4XS1A 1JLVA 2PVOC 3IHQA 2FUG2 2YJ7A 1TI3A 5HR3A 3APOA 2JSZA 1ERWA 1WJKA 1I9DA 2LRTA 5AIVA 3UJ1A 1ERUA 3WGEA 2LTKA 5F0GA 6GSSA 3EURA 2X64A 1A2LA 3LQ7A 2VL2A 5LCZA 5D9WA 3F6DA 2FD3A 1ZGNA 1K3OA 4WF4A 3KM6A 5EVOA 1NW2A 1BAYA 1UN2A 1K0CA 5ECSA 3A2XA 3C1SA 4OCEA 2IIYA 2RLIA 2L57A 5AGYA 2KP2A 1U88A 1WPIA 6GSYA 3CXGA 2HXKA 4K0NA 2LKUA 4PGTA 3US3A 4OFMA 2MMOA 2LJAA 3M3MA 5JWOB 4EDYA 3OR5A 3DRNA 4Q5NA 2KHPA 1B8XA 1K0BA 4IQ1A 2OBIA 2OE3A 3VLNA 5ECPB 1ZYQB 3DIEA 3ERWA 3VI7A 3H79A 1XPVA 1BJXA 2PPTA 3CRTA 4J57E 4TKYA 3CBUA 3K8NA 2HSYA 3C8EA 2CVKA 2MMAA 1KTEA 4HQSA 3ERGA 3TOTA 3GKKA 5HFIA 1AQVA 4F03A 2YV7A 3HVXA 4JE1A 3UOMA 1PGTA 4L5OA 3ZRDA 5FWGA 1JHBA 5DDLA 1B48A 1USBA 1XOAA 4ACSA 1B4PA 2TRXA 2VLUA 3W8JA 2GQLA 1GSUA 3EU3A 8GSSA 4EE0A 2JU5A 1WRYA 1OAZA 5H5QA 4EKZA 1SJ6A 2FY6A 2IMDA 1Z7PA 2PU9C 4L5LA 2WRTA 1PL2A 1ZOFA 2GQKA 4YQMA 5IO0A 5KN2A 2YV9A 4PXOA 3UAPA 1TI1A 5D9VA 5EL8A 4WBJA 2ES7A 3KH7A 3IAS2 2DJKA 2VIMA 3IRAA 1SKSB 1KBNA 2OBKA 2RM5A 4YQVA 1Z3EA 2CX3A 1N8JA 1T3BA 1OKDA 3TGZA 4NAXA 4WEYA 1EWXA 3GYKA 1HNCA 2DJ1A 1XBSA 2AV4A 4IN0A 1SJIA 1VF4A 4ECIA 1GNWA 4ZB8A 3ZYWA 1GL8A 4ECBA 3EE2A 2GZYA 1VF3A 3HZ8A 5ID2A 4EVMA 2AJQB 3VWVA 1F3BA 4GF0A 4GLTA 2CX4A 4N0ZA 1YF0A 4L8EA 1XZOA 1M2BA 4K0GA 2GSQA 4KSOA 4GSNA 3ZREA 3ZVJA 2H72A 4XS4B 1XWGA 3TUEA 1J0FA 3KD0A 2EIRA 4XS4A 1YQ1A 4KB3A 3P90A 4K7OA 3E3EA 1LJRA 5ECHB 9GSSA 2M72A 3GL3A 4JBBA 3BCKA 3DD3A 6GSUA 5H5RA 5E59A 1T4YA 2GQMA 4BVXA 5DALB 1V98A 3ME7A 1SYXA 3QR6A 1HNAA 4NV2A 1XOBA 5DALA 2R5GA 5CO3A 2I1UA 3FKFA 4ML1A 3GFKA 2EIQA 1M9AA 2LQOA 4F0BA 1JZDA 3P7XA 4HZ4A 3QFAC 2H76A 2O85A 1XWBA 1DSBA 3A2WA 3Q18A 1PL1A 3MWHA 2ON7A 1T4ZA 4PQ1A 5CREA 1YKAA 1TOFA 3M9KA 5J5NA 4MH3A 4YQUA 2YJHA 1EV4A 3WD6A 4XRDA 1IYHA 4ZBAA 3VK9A 4JEDA 2HLSA 2AUVA 4MJEA 5C00A 3VPQA 2AAWA 1OC9B 1FVKA 2YP6A 3GSSA 3BD2A 3IK9A 5ECMB 2GZPA 4K8MA 1SL1B 2C0DA 3BJ5A 3M9JA 5B6NA 2PWJA 5HFKA 1YJ6A 4MJCA 3LFLA 3FYGA 2X99A 2E7PA 4ZL9A 3RHBA 3UVTA 1MDKA 2L4CA 1QXHA 4E8HA 5ECIB
chains in the Genus database with same CATH superfamily
2K6VA 1PMTA 2FGXA 3D21A 3O6TA 3L9UA 3ZIJA 4FYBA 4KDUA 3D0ZA 1Z6MA 3F0IA 2J9HA 5GAND 3HHVA 5DJMA 1Y6EA 1GLQA 2XPEA 2C80A 2H1BA 4O5QA 1EOHA 4CW9A 2GT6A 3UARA 3RDWA 1WE0A 2XC2A 3UEMA 2MMZA 2OE1A 1M99A 5A4VA 3GTUB 3KMNA 1GUHA 1I5GA 4BIKA 3GTUA 2GLRA 4D73B 3C1RA 1PA3A 2HSHA 5AN1A 1FO5A 3IBHA 4D73A 1EP8A 4RI7A 5GAPD 3FW2A 2X8HA 2JZRA 3KP9A 1THOA 1NHYA 3ZMKA 4MJAA 1OE7A 1AW9A 4PNGA 1RW1A 4OFNA 5GSSA 3KEBA 3WGDA 3HVSA 2FWEA 1GUMA 2YWNA 4OD7A 2REMA 3VWUA 2YN1A 1X9WB 2JACA 2DJJA 1B4QA 2DIZA 4FQUA 5ECQB 5CRWA 3CYNA 3M0FA 2YPMA 1XXUA 2F51A 1PKWA 1K3YA 1EP7A 4ICYA 5KN1A 2YOIA 3F4TA 6GSWA 2JZSA 1JLWA 4MCUA 1A24A 3EU4A 1QGVA 4G2EA 4WKWA 5CNWA 4G0IA 3KH9A 2VO4A 2OACA 2PUKC 4TR4A 3TKSE 1Z6NA 2YANA 4GCIA 1ZZYA 3ME8A 2NVLA 4PUAA 2HI7A 5C04A 3H4KA 2M80A 3NZNA 12GSA 4XHMA 4WXTA 4MZCA 3F3QA 2GZZA 1Q4JA 3U5RE 1NSWA 4K7NA 2PN8A 2OJLA 2V2GA 1TDIA 4K7IA 3GX8A 3H8QA 5D8IA 4HJ2A 1QMVA 2H71A 1GSEA 3RPPA 2WGRA 1XG8A 4HOJA 4XIHA 1HQOA 3QAWA 2RM6A 3LORA 1ZYNA 1AUCA 1FOHA 1RQMA 1HYUA 1V2AA 2CVDA 4TR1A 4AJ6A 3TDGA 3C73A 3L4NA 3KZQA 2LJRA 1THXA 2QSIA 3GURA 1ABAA 4BVYB 1GH2A 3GH6A 2V32A 2IMKA 4BVYA 4O32A 2P5QA 5JCUA 1CQGA 4YAPA 4K5SA 1GWCA 5IMFA 4G0KA 1TK5B 4MZWA 2RUEA 3DGQA 2P31A 4NHZA 2ZUPA 4I6XA 5G31A 5D93A 4HI7A 4GQFA 2PVQA 5J4UA 1EEMA 2H73A 3FY7A 4NPBA 4JR4A 5GZZB 4ZXGA 2B1KA 1SENA 5HFGA 5ECRB 5A4UA 3LJRA 5EPFA 2N5BA 5DJLA 2CVBA 4OFTA 5F8BA 2R4VA 2YZHA 3TJKA 1M2AA 4X43A 3GH9A 3TKPA 3RBTA 1O6JA 2NDOA 4JR6A 2QKEA 3Q6OA 1VF1A 4Q5FA 1ACVA 5G2ZA 4EIPA 3HJOA 4N11A 3UL3A 1YEPA 4HU7A 4EDZA 4JU5A 2D2ZA 1R4WA 1SJZA 4TN8A 4NWYA 2H1GA 4ID0A 1R26A 5B8BA 5IO2A 3UBLA 2IMFA 2YWIA 3L9SA 2VCTA 3M8NA 4O7HA 2H70A 1HNBA 2ALBA 2GSTA 1XW6A 1GTUA 2VLTA 4AJ8A 1R7HA 3TKQA 4WBRD 4POMA 5DBQA 4IELA 1X5CA 2F8AA 2H66A 2X8CA 3A5WA 3FR3A 4K9ZA 1K3LA 5D9TA 3DKSA 1Y25A 2X4AA 4Q5QA 4WETA 3LYKA 3U6VA 4KX4A 2XBIA 2IFQB 1C72A 1A0RP 1PKZA 4ECCA 1ST9A 4V1Ap 2NBSA 3G7IA 4EUYA 3J7Yk 4DVCA 2WCIA 3BOAA 2WULA 2CT6A 3HJMA 3R3EA 3D5JA 2K9FA 3F4RA 2H6ZA 4RQXA 3ZTLA 4K2DA 4A5PA 3LG6A 3HZ4A 6GSXA 2VM2A 2B5XA 3F3RA 3CMIA 3GN3A 4OMVA 3G7YA 2B7KA 3RPNA 4O5UA 1BX9A 1OVNA 3LXZA 5IMZA 3APQA 3WYWA 2I81A 2R3XA 4TRXA 2LJKA 4ULXA 2H75A 3BBYA 3EMXA 1KEBA 4CDOA 4MZBA 3F8UA 4IVFA 4I8BA 3GSTA 2O8VB 1XVQA 4LL1B 4DSQA 2VCQA 2KP1A 2O7KA 4OO5A 3HKRA 4TXOB 1GTAA 3UBKA 1MD4A 1PX6A 2MYGA 2HZEB 2CZ2A 2H30A 1MDIA 4JRRA 3TCOA 1QK8A 3FMWA 4DSRA 5CRHA 4HEA2 1NHOA 1FOVA 3TJGA 3HA9A 3R2QA 2OA7A 1E6BA 1T1VA 5IMAA 3IDVA 3KCMA 5D9XA 2WS2A 4DEJA 2F8FA 5G30A 1OC3A 4OWYA 4USSA 4NV5A 3EWLA 2LV3A 4HDEA 1V58A 1GSFA 2V6OA 3KXOA 4TR3A 1OC8A 1AAZA 2R2JA 4IQAA 3QCPA 2WZ9A 2PBJA 4K1FA 2YWMA 1F2EA 2LRCA 5HR1A 4POLA 3WT2A 3DWVA 5DAKB 4BWSA 2HE3A 1WWJA 4ZL7A 1O7UA 1A8LA 1YDKA 2Z9SA 3IC4A 3GIXA 5DAKA 2RUFA 5ENUA 4LMVA 1SKRB 3DMLA 4MH2A 3TKSA 1A2MA 2JL4A 2GDRA 1FB6A 2C3QA 1TW9A 2VL3A 5HR0A 1SKWB 1H4OA 4PUFC 2FCHA 4KCAA 1TRWA 4CY6A 1A23A 2HRNA 2WFCA 1JZRA 3QDNA 2AYTA 4P3YB 4XS6A 2A4HA 3DVWA 4F82A 3ZZXA 1OC9A 1ERVA 3E9JB 3H93A 2HSMA 3L9VA 1M3JA 3MYDA 2YWOA 1TRUA 3L78A 5JWRB 3LSZA 5CP1A 1VGLA 3GX0A 1ZYPA 4IHUA 2MBSA 3TB2A 5DQYA 3GUSA 4XCSA 2DMMA 4ZIJA 3A2VA 2BJXA 3F4SA 2H0GA 4N10A 4EL1A 1ILOA 3W8SA 3MSZA 3E0UA 2R6KA 3GKXA 2QA2A 1M9BA 3PR8A 5IQYA 1TK8B 3HYPA 3FK8A 2VCWA 3CSJA 3NIVA 2L5OA 1G7OA 3WGXA 2DJ2A 2I4AA 2LNTA 1IYIA 2P0GA 5IPGA 1PRXA 5KOWA 4ECJA 5D73A 5KN0A 2LSTA 4F2IA 2HYXA 1TJDA 18GSA 1XWKA 1G6WA 1U6TA 2R37A 3MIXA 2YNXA 4AF2A 3TJFA 1RK4A 1WIKA 1MDJA 3C7MA 1FB0A 4FH8A 2XPDA 1UVZA 1GNEA 3H1NA 3I9V2 2DJ0A 3VURA 4TW5A 5KEJA 1Z5YE 1OE8A 2C3TA 3LGCA 1T8EB 1HD2A 2I3YA 5ELAA 5F05A 2DMLA 1MD3A 6GSVA 1A8YA 2K18A 3FZ5A 3IE3A 2DJ3A 1AQXA 3NOFA 5IOXA 2FWHA 4MLYA 14GSA 2HT9A 4HJMA 2X8GA 3DXBA 4X4JA 4IJ3A 2VL2C 2CZ3A 19GSA 4WF5A 3CSHA 4IBPA 3HY2A 3I69A 4OCFA 4KAEA 3QFBC 1Q98A 2LRNA 3D4TA 2MZCA 3F9UA 2LNSA 1ZL9A 3IPZA 2O87A 3I6AA 3QAGA 4NMUA 11GSA 1YF1A 1TK0B 4KDYA 1GSSA 1U3IA 4HU9A 1GSDA 2VD1A 4I2UA 3TKRA 2H74A 3KGKA 1YY7A 2IN3A 1WP0A 4I5QA 1SL2B 4LLRA 4KUNA 5GSTA 4ZB6A 5IPHA 5DCHA 3P2AA 4KDXA 1F3AA 3W6GA 2PMTA 1R5AA 3GHAA 3F6FA 3ZFLA 4MF5A 4BWQA 4BL7B 3IC8A 2PGTA 4O92A 1MTCA 1TU7A 4G19A 1BYEA 5F06A 1K0NA 2B5EA 4BL7A 2OE0A 3IOSA 5LNKe 4LL4B 2H19A 4ZBDA 4L0WA 4MNNA 3HCZA 2K8SA 1A0FA 4KE3A 3S9FA 1ZYEA 5F07A 4X0XA 2TRCP 1URMA 5CRGA 3J7Yb 4ILFA 3GKMA 2IMIA 1PN9A 2QGVA 1JZWA 22GSA 3FRCA 1AIUA 2C8UA 3UVHA 4GSTA 4FIWA 5ECKB 2VCVA 2VL9A 2F3MA 4BA7A 1F9MA 2KLXA 3HXSA 3MAKA 2M46A 2R0CA 1TP9A 2MMNA 2VLVA 3DYRA 2RIIA 2CQ9A 5J9BA 3FEUA 4MA9A 3ZLPA 5CAXA 1M0UA 4F9ZA 1BQ7A 3LW9A 1GRXA 1F6MC 5J3RA 5DCGA 5IIZA 4ISDA 1QUWA 1G0TA 1X0RA 5B8AA 2FWGA 2C1YA 3KTBA 3L0HA 2QA1A 5ECNB 3EMPA 2PERA 4V1Ag 1UC7A 3VFIA 3CSIA 1EV9A 2L6CA 2B6MA 2A2SA 1GP1A 2YCDA 4TVEA 5COHA 2EC4A 2CAQA 3D4MA 4ZB9A 6GSTA 2AB6A 3KTLA 1XIYA 3FR6A 3VI5A 2FLSA 4K5RA 2WJUA 2CV4A 4Z2TA 1O8XA 1G6YA 2C0GA 4NHWA 7GSSA 5JCGA 1EGOA 1VRSD 3APSA 1X5EA 4TOPA 1B9YC 2JSYA 1ZCPA 1S3CA 2I9HA 2CAIA 1YEXA 1V40A 2MBTA 2KUCA 3CQFA 1Z9HA 2CA8A 5HQPA 2IMEA 2FA8A 4FYUA 13GSA 2H0IA 1WMJA 1O81A 2G2QA 20GSA 1QQ2A 2VCXA 3RHCA 3V1WA 4BPYA 1O85A 1M2DA 3KIJA 3FZAA 3HJPA 1O8WA 2OKAA 1AXDA 1FVJA 3CRUA 2J23A 2OADA 1DBYA 2A2RA 3ED3A 1ML6A 3EINA 3N5OA 2VUPA 2VM1A 4XTSA 2B1LA 4PQHA 3HD5A 4RQRA 2B5YA 1W89A 2IJYA 5IMVA 4DSSB 2DSAA 3TJBA 1DUGA 1S3RA 4IW9A 4DSSA 3GRXA 2L6DA 3EVIA 1V57A 2VAFA 2WB9A 4N30A 2GVPA 3IK7A 5FT3A 2QC7A 3GV1A 5CRDA 3UMAA 3QD9A 3DVXA 2IFQA 2LUSA 4KGIA 5KOXA 2P5RA 4EO3A 1GTIA 2LS5A 5DQSA 2IPAA 2NTOA 3TKSC 3SBCA 3WT1A 2DBCA 4CHSA 1W4VA 3A3TA 5H5SA 4E8EA 2YZUA 3PINA 1Z7RA 3KP8A 2H8LA 4WR4A 4G0LA 1K0MA 2ZNMA 3GMFA 4H86A 3ZL5A 2E2MA 3UIWA 5KN3A 4KW6A 1SK1A 1ON4A 1EZKA 3G9BA 1YKCA 1ERTA 2JADA 2E0QA 4GQCA 2V1MA 4V2LA 2N5AA 1R5PA 4MF7A 3QPMA 5D96A 4GRFA 2F9SA 4MP4A 2VCZA 5IM9A 3ZFBA 5AISA 4EXJA 3QOUA 3SWLA 4EC0A 2FHEA 2GT5A 1NM3A 4YKFA 2GSSA 1FAAA 4MABA 4TXOA 2B7JA 2B3SA 1XCCA 2H1AA 3TRQA 1SD8A 2HZEA 4KNDA 2C4JA 1TTZA 5G1LA 5ID2B 2E2GA 3MDKA 3IAM2 2GTUA 5JCWA 4HZ2A 1F37A 5A5KA 1TKDB 5B7CA 5ELGA 2G0FA 1FHEA 4IGJA 1BEDA 1S3AA 1T00A 4FYCA 4MDCA 1EOGA 4NXIA 2H1DA 4IKHA 4FO5A 2DLXA 3F63A 3O3TA 3FHKA 4YAVA 3EYTA 3LEFA 4IJIA 4AJ7A 3MNGA 2V6KA 5HR2A 2DKHA 3D22A 2N5FA 2BMXA 2LEGA 2GGTA 3PGTA 3IV4A 4IP1A 1LU4A 4QL9A 1PFOA 4WR5A 4RUVA 3PH9A 1FW1A 1DE1A 1XWCA 2FWFA 2H0HA 2KOKA 3JCML 3IHGA 2V41A 4IS0A 4CY8A 16GSA 4MF6A 3BCIA 3ISOA 1U3AA 2JZTA 4PQIA 4KSMA 2HRKA 1PX7A 5AIXA 4IP6A 5ECOB 3N9JA 1J9BA 1XW5A 4KH7A 4PURA 3Q19A 2H01A 4ML6A 3TRXA 4MK3A 4EF0A 1OKTA 2C0FA 3VPTA 4ZL8A 1QFNA 1XW9A 2UZ8A 3FR9A 3LYPA 5IMDA 5L71A 1JZOA 4KCEA 2GSRA 1UA5A 4MMMA 1MEKA 1O73A 3KJYA 2HNLA 5BRTA 4F0CA 4O5RA 2L5LA 1SK2A 2VD0A 3RAZA 4GXZA 4MJBA 3FZ9A 4GWRA 1TRSA 4POBA 3LWAA 2LQQA 2BTOT 3LXTA 2L4QA 3TOUA 3G7JA 2NPBA 1GTBA 3M1GA 2AHEA 1PSQA 3CTFA 3IR4A 4POKA 5A4WA 1AQWA 4XRAA 1H75A 1GSQA 1GSYA 4PNFA 1CQHA 5IMCA 1SK0A 3CTGA 4YH2A 2ZCTA 3TJJA 4J2FA 2DKIA 1N2AA 1ZMAA 4KA0A 1KNGA 1TRVA 4I2TA 4EIQA 3EC3A 1BG5A 1FG4A 4LMWA 1G7EA 5G1KA 2C0EA 3ERFA 1TXXA 2EIOA 4N0VA 1WOUA 1TU8A 2HZFA 2L59A 3ZIVA 1YZXA 10GSA 2H6XA 1K0DA 5FHIA 3C71A 5JWQB 4Z7XA 4Q5RA 1AC1A 3AY8A 3KMOA 2H6YA 3ZMLA 4GTUA 2IL3A 4ZBBA 1JFUA 4ZILA 5G5EA 2TIRA 3GA4A 1M7TA 4I97A 1PD21 1B9XC 1X9MB 1K0OA 1DE2A 1SU9A 3D6IA 4J56E 5DVBA 1XVWA 2XHFA 5LD0A 1GUKA 1V9WA 3VWWA 5J9CA 3GL5A 3VWXA 4KF9A 3Q74A 3P8WA 1X5DA 3I43A 5INYA 1OYJA 3FZ4A 1K0AA 3IA1A 2FNOA 17GSA 4MPFA 4QL7A 4HS1A 4AGSA 4L0UA 1SL0B 4X1UA 3HVVA 4PX1A 4LA1A 1SYRA 4G9HA 1SD9A 4K2XA 1J08A 4MPGA 4V2NA 5IOWA 4HQZA 1X9SB 1T7PB 3DEXA 4K6XA 2HRFA 1PQNA 2GS3A 5CYYA 2ON5A 1E2YA 5EY6A 4JZQA 1PN0A 4TR0A 4HUAA 2C3NA 3ZITA 2O89A 1GULA 4RI6A 2DC5A 1U87A 3IXRA 5J41A 2IWTA 1S3DA 2A4VA 1XFLA 3QMXA 3ZVJD 3QAVA 4G10A 4YKGA 1VF2A 4GSSA 2K8VA 1LBKA 5ABRA 3HDCA 3O76A 5G5FA 3GKNA 4V2MA 5E4WA 5B6MA 4OO4A 4TXVA 3TRPA 1A2JA 4TR1B 1EGRA 2A2PA 2XBQA 4QQ7A 5ECLB 1XWAA 1GLPA 2WDUA 2HFDA 2FA4A 1EEJA 2VOCA 3GNJA 2DIYA 4XS1A 1JLVA 2PVOC 3IHQA 2FUG2 2YJ7A 1TI3A 5HR3A 3APOA 2JSZA 1ERWA 1WJKA 1I9DA 2LRTA 5AIVA 3UJ1A 1ERUA 3WGEA 2LTKA 5F0GA 6GSSA 3EURA 2X64A 1A2LA 3LQ7A 2VL2A 5LCZA 5D9WA 3F6DA 2FD3A 1ZGNA 1K3OA 4WF4A 3KM6A 5EVOA 1NW2A 1BAYA 1UN2A 1K0CA 5ECSA 3A2XA 3C1SA 4OCEA 2IIYA 2RLIA 2L57A 5AGYA 2KP2A 1U88A 1WPIA 6GSYA 3CXGA 2HXKA 4K0NA 2LKUA 4PGTA 3US3A 4OFMA 2MMOA 2LJAA 3M3MA 5JWOB 4EDYA 3OR5A 3DRNA 4Q5NA 2KHPA 5BMUA 1B8XA 1K0BA 3HVNA 4IQ1A 2OBIA 2OE3A 3VLNA 5ECPB 1ZYQB 3DIEA 3ERWA 3VI7A 3H79A 1XPVA 1BJXA 2PPTA 3CRTA 4J57E 4TKYA 3CBUA 3K8NA 2HSYA 3C8EA 2CVKA 2MMAA 1KTEA 4HQSA 3ERGA 3TOTA 2HRAA 3GKKA 5HFIA 1AQVA 4F03A 2YV7A 3HVXA 4JE1A 3UOMA 1PGTA 4L5OA 3ZRDA 5FWGA 1JHBA 5DDLA 1B48A 4Z2UA 1USBA 1XOAA 4ACSA 1B4PA 2TRXA 2VLUA 3W8JA 2GQLA 1GSUA 3EU3A 4HSCX 8GSSA 4EE0A 2JU5A 1WRYA 2R0GA 1OAZA 5H5QA 4EKZA 1SJ6A 2FY6A 2IMDA 1Z7PA 2PU9C 4L5LA 2WRTA 1PL2A 1ZOFA 4Z2RA 2GQKA 4YQMA 5IO0A 5KN2A 2YV9A 4PXOA 3UAPA 1TI1A 5D9VA 5EL8A 4WBJA 2ES7A 3KH7A 3IAS2 2DJKA 1M3IA 2VIMA 3IRAA 1SKSB 1KBNA 2R0PA 2OBKA 2RM5A 4YQVA 1Z3EA 2CX3A 1N8JA 1T3BA 1OKDA 3TGZA 4NAXA 4WEYA 1EWXA 3GYKA 1HNCA 2DJ1A 1XBSA 2AV4A 4IN0A 1SJIA 1VF4A 4ECIA 1GNWA 4ZB8A 3ZYWA 1GL8A 4ECBA 3EE2A 2GZYA 1VF3A 3HZ8A 5ID2A 4EVMA 2AJQB 3VWVA 1F3BA 4GF0A 4GLTA 2CX4A 4N0ZA 1YF0A 4L8EA 1XZOA 1M2BA 4K0GA 2GSQA 4KSOA 4GSNA 3ZREA 3ZVJA 2H72A 4XS4B 1XWGA 3TUEA 1J0FA 3KD0A 2EIRA 2X49A 4XS4A 1YQ1A 4KB3A 3P90A 4K7OA 3E3EA 1LJRA 5ECHB 9GSSA 2M72A 3GL3A 4JBBA 3BCKA 4BVXB 3DD3A 6GSUA 5H5RA 5E59A 1T4YA 2GQMA 4BVXA 1V98A 5DALB 3ME7A 1SYXA 3QR6A 1HNAA 4NV2A 1XOBA 5DALA 2R5GA 5CO3A 2I1UA 3FKFA 4ML1A 3GFKA 2EIQA 1M9AA 2LQOA 3PPUA 4F0BA 1JZDA 3P7XA 4HZ4A 3QFAC 2H76A 2O85A 1XWBA 1DSBA 3A2WA 3Q18A 1PL1A 3MWHA 2ON7A 1T4ZA 4PQ1A 5CREA 1YKAA 1TOFA 3M9KA 5J5NA 4MH3A 4YQUA 2YJHA 1EV4A 3WD6A 4XRDA 1IYHA 4ZBAA 3VK9A 4JEDA 4PTSA 2HLSA 2AUVA 4MJEA 5C00A 3VPQA 2AAWA 1OC9B 1FVKA 2YP6A 3GSSA 3BD2A 3IK9A 5ECMB 2GZPA 4K8MA 1SL1B 2C0DA 3BJ5A 3M9JA 5B6NA 2PWJA 5HFKA 1YJ6A 4MJCA 3LFLA 3FYGA 3A5IA 2X99A 3EPTA 2E7PA 4ZL9A 3RHBA 3UVTA 1MDKA 2L4CA 1QXHA 4E8HA 5ECIB
chains in the Genus database with same CATH topology
2K6VA 1PMTA 2FGXA 3D21A 3O6TA 3L9UA 3ZIJA 4FYBA 4KDUA 3D0ZA 1Z6MA 3F0IA 2J9HA 5GAND 3HHVA 5DJMA 1Y6EA 1GLQA 2XPEA 2C80A 2H1BA 4O5QA 1EOHA 4CW9A 2GT6A 3UARA 3RDWA 1WE0A 2XC2A 3UEMA 2MMZA 2OE1A 1M99A 5A4VA 3GTUB 3KMNA 1GUHA 1I5GA 3GTUA 2GLRA 4D73B 3C1RA 1PA3A 2HSHA 5AN1A 1FO5A 3IBHA 4D73A 1EP8A 4RI7A 5GAPD 3FW2A 2X8HA 2JZRA 3KP9A 1THOA 1NHYA 3ZMKA 4MJAA 1OE7A 1AW9A 4PNGA 1RW1A 4OFNA 5GSSA 3KEBA 3WGDA 3HVSA 2FWEA 1GUMA 2YWNA 4OD7A 2REMA 3VWUA 2YN1A 1X9WB 2JACA 2DJJA 1B4QA 2DIZA 4FQUA 5ECQB 5CRWA 3CYNA 3M0FA 2YPMA 1XXUA 2F51A 1PKWA 1K3YA 1EP7A 4ICYA 5KN1A 2YOIA 3F4TA 6GSWA 2JZSA 1JLWA 4MCUA 1A24A 3EU4A 1QGVA 4G2EA 4WKWA 5CNWA 4G0IA 3KH9A 2VO4A 2OACA 2PUKC 4TR4A 3TKSE 1Z6NA 2YANA 4GCIA 1ZZYA 3ME8A 2NVLA 4PUAA 2HI7A 5C04A 3H4KA 2M80A 3NZNA 12GSA 4XHMA 4WXTA 4MZCA 3F3QA 2GZZA 1Q4JA 3U5RE 1NSWA 4K7NA 2PN8A 2OJLA 2V2GA 1TDIA 4K7IA 3GX8A 3H8QA 5D8IA 4HJ2A 1QMVA 2H71A 1GSEA 3RPPA 2WGRA 4HOJA 4XIHA 1HQOA 3QAWA 2RM6A 3LORA 1ZYNA 1AUCA 1FOHA 1RQMA 1HYUA 1V2AA 2CVDA 4TR1A 4AJ6A 3TDGA 3C73A 3L4NA 3KZQA 2LJRA 1THXA 2QSIA 3GURA 1ABAA 4BVYB 1GH2A 3GH6A 2V32A 2IMKA 4BVYA 4O32A 2P5QA 5JCUA 1CQGA 4YAPA 4K5SA 1GWCA 5IMFA 4G0KA 1TK5B 4MZWA 2RUEA 3DGQA 2P31A 4NHZA 2ZUPA 4I6XA 5G31A 5D93A 4HI7A 4GQFA 2PVQA 5J4UA 1EEMA 2H73A 3FY7A 4NPBA 4JR4A 5GZZB 4ZXGA 2B1KA 1SENA 5HFGA 5ECRB 5A4UA 3LJRA 5EPFA 2N5BA 5DJLA 2CVBA 4OFTA 5F8BA 2R4VA 2YZHA 3TJKA 1M2AA 4X43A 3GH9A 3TKPA 3RBTA 1O6JA 2NDOA 4JR6A 2QKEA 3Q6OA 1VF1A 4Q5FA 1ACVA 5G2ZA 4EIPA 3HJOA 4N11A 3UL3A 1YEPA 4HU7A 4EDZA 4JU5A 2D2ZA 1R4WA 1SJZA 4TN8A 4NWYA 2H1GA 4ID0A 1R26A 5B8BA 5IO2A 3UBLA 2IMFA 2YWIA 3L9SA 2VCTA 3M8NA 4O7HA 2H70A 1HNBA 2ALBA 2GSTA 1XW6A 1GTUA 2VLTA 4AJ8A 1R7HA 3TKQA 4WBRD 4POMA 5DBQA 4IELA 1X5CA 2F8AA 2H66A 2X8CA 3A5WA 3FR3A 4K9ZA 1K3LA 5D9TA 3DKSA 1Y25A 2X4AA 4Q5QA 4WETA 3LYKA 3U6VA 4KX4A 2XBIA 2IFQB 1C72A 1A0RP 1PKZA 4ECCA 1ST9A 4V1Ap 2NBSA 3G7IA 4EUYA 3J7Yk 4DVCA 2WCIA 3BOAA 2WULA 2CT6A 3HJMA 3R3EA 3D5JA 2K9FA 3F4RA 2H6ZA 4RQXA 3ZTLA 4K2DA 4A5PA 3LG6A 3HZ4A 6GSXA 2VM2A 2B5XA 3F3RA 3CMIA 3GN3A 4OMVA 3G7YA 2B7KA 3RPNA 4O5UA 1BX9A 1OVNA 3LXZA 5IMZA 3APQA 3WYWA 2I81A 2R3XA 4TRXA 2LJKA 4ULXA 2H75A 3BBYA 3EMXA 1KEBA 4CDOA 4MZBA 3F8UA 4IVFA 4I8BA 3GSTA 2O8VB 1XVQA 4LL1B 4DSQA 2VCQA 2KP1A 2O7KA 4OO5A 3HKRA 4TXOB 1GTAA 3UBKA 1MD4A 1PX6A 2MYGA 2HZEB 2CZ2A 2H30A 1MDIA 4JRRA 3TCOA 1QK8A 3FMWA 4DSRA 5CRHA 4HEA2 1NHOA 1FOVA 3TJGA 3HA9A 3R2QA 2OA7A 1E6BA 1T1VA 5IMAA 3IDVA 3KCMA 5D9XA 2WS2A 4DEJA 2F8FA 5G30A 1OC3A 4OWYA 4USSA 4NV5A 3EWLA 2LV3A 4HDEA 1V58A 1GSFA 2V6OA 3KXOA 4TR3A 1OC8A 1AAZA 2R2JA 4IQAA 3QCPA 2WZ9A 2PBJA 4K1FA 2YWMA 1F2EA 2LRCA 5HR1A 4POLA 3WT2A 3DWVA 5DAKB 4BWSA 2HE3A 1WWJA 4ZL7A 1O7UA 1A8LA 1YDKA 2Z9SA 3IC4A 3GIXA 5DAKA 2RUFA 5ENUA 4LMVA 1SKRB 3DMLA 4MH2A 3TKSA 1A2MA 2JL4A 2GDRA 1FB6A 2C3QA 1TW9A 2VL3A 5HR0A 1SKWB 1H4OA 4PUFC 2FCHA 4KCAA 1TRWA 4CY6A 1A23A 2HRNA 2WFCA 1JZRA 3QDNA 2AYTA 4P3YB 4XS6A 2A4HA 3DVWA 4F82A 3ZZXA 1OC9A 1ERVA 3E9JB 3H93A 2HSMA 3L9VA 3MYDA 2YWOA 1TRUA 3L78A 5JWRB 3LSZA 5CP1A 1VGLA 3GX0A 1ZYPA 4IHUA 2MBSA 3TB2A 5DQYA 3GUSA 4XCSA 2DMMA 4ZIJA 3A2VA 2BJXA 3F4SA 2H0GA 4N10A 4EL1A 1ILOA 3W8SA 3MSZA 3E0UA 2R6KA 3GKXA 2QA2A 1M9BA 3PR8A 5IQYA 1TK8B 3HYPA 3FK8A 2VCWA 3CSJA 3NIVA 2L5OA 1G7OA 3WGXA 2DJ2A 2I4AA 2LNTA 1IYIA 2P0GA 5IPGA 1PRXA 5KOWA 4ECJA 5D73A 5KN0A 2LSTA 4F2IA 2HYXA 1TJDA 18GSA 1XWKA 1G6WA 1U6TA 2R37A 3MIXA 2YNXA 4AF2A 3TJFA 1RK4A 1WIKA 1MDJA 3C7MA 1FB0A 4FH8A 2XPDA 1UVZA 1GNEA 3H1NA 3I9V2 2DJ0A 3VURA 4TW5A 5KEJA 1Z5YE 1OE8A 2C3TA 3LGCA 1T8EB 1HD2A 2I3YA 5ELAA 5F05A 2DMLA 1MD3A 6GSVA 1A8YA 2K18A 3FZ5A 3IE3A 2DJ3A 1AQXA 3NOFA 5IOXA 2FWHA 4MLYA 14GSA 2HT9A 4HJMA 2X8GA 3DXBA 4X4JA 4IJ3A 2VL2C 2CZ3A 19GSA 4WF5A 3CSHA 4IBPA 3HY2A 3I69A 4OCFA 4KAEA 3QFBC 1Q98A 2LRNA 3D4TA 2MZCA 3F9UA 2LNSA 1ZL9A 3IPZA 2O87A 3I6AA 3QAGA 4NMUA 11GSA 1YF1A 1TK0B 4KDYA 1GSSA 1U3IA 4HU9A 1GSDA 2VD1A 4I2UA 3TKRA 2H74A 3KGKA 1YY7A 2IN3A 1WP0A 4I5QA 1SL2B 4LLRA 4KUNA 5GSTA 4ZB6A 5IPHA 5DCHA 3P2AA 4KDXA 1F3AA 3W6GA 2PMTA 1R5AA 3GHAA 3F6FA 3ZFLA 4MF5A 4BWQA 4BL7B 3IC8A 2PGTA 4O92A 1MTCA 1TU7A 4G19A 1BYEA 5F06A 1K0NA 2B5EA 4BL7A 2OE0A 3IOSA 5LNKe 4LL4B 2H19A 4ZBDA 4L0WA 4MNNA 3HCZA 2K8SA 1A0FA 4KE3A 3S9FA 1ZYEA 5F07A 4X0XA 2TRCP 1URMA 5CRGA 3J7Yb 4ILFA 3GKMA 2IMIA 1PN9A 2QGVA 1JZWA 22GSA 3FRCA 1AIUA 2C8UA 3UVHA 4GSTA 4FIWA 5ECKB 2VCVA 2VL9A 2F3MA 4BA7A 1F9MA 2KLXA 3HXSA 3MAKA 2M46A 2R0CA 1TP9A 2MMNA 2VLVA 3DYRA 2RIIA 2CQ9A 5J9BA 3FEUA 4MA9A 3ZLPA 5CAXA 1M0UA 4F9ZA 1BQ7A 3LW9A 1GRXA 1F6MC 5J3RA 5DCGA 5IIZA 4ISDA 1QUWA 1G0TA 1X0RA 5B8AA 2FWGA 2C1YA 3KTBA 3L0HA 2QA1A 5ECNB 3EMPA 2PERA 4V1Ag 1UC7A 3VFIA 3CSIA 1EV9A 2L6CA 2B6MA 2A2SA 1GP1A 2YCDA 4TVEA 5COHA 2EC4A 2CAQA 3D4MA 4ZB9A 6GSTA 2AB6A 3KTLA 1XIYA 3FR6A 3VI5A 2FLSA 4K5RA 2WJUA 2CV4A 4Z2TA 1O8XA 1G6YA 2C0GA 4NHWA 7GSSA 5JCGA 1EGOA 1VRSD 3APSA 1X5EA 4TOPA 1B9YC 2JSYA 1ZCPA 1S3CA 2I9HA 2CAIA 1YEXA 1V40A 2MBTA 2KUCA 1Z9HA 2CA8A 5HQPA 2IMEA 2FA8A 4FYUA 13GSA 2H0IA 1WMJA 1O81A 2G2QA 20GSA 1QQ2A 2VCXA 3RHCA 3V1WA 4BPYA 1O85A 1M2DA 3KIJA 3FZAA 3HJPA 1O8WA 2OKAA 1AXDA 1FVJA 3CRUA 2J23A 2OADA 1DBYA 2A2RA 3ED3A 1ML6A 3EINA 3N5OA 2VUPA 2VM1A 4XTSA 2B1LA 4PQHA 3HD5A 4RQRA 2B5YA 1W89A 2IJYA 5IMVA 4DSSB 2DSAA 3TJBA 1DUGA 4IW9A 4DSSA 3GRXA 2L6DA 3EVIA 1V57A 2VAFA 2WB9A 4N30A 2GVPA 3IK7A 5FT3A 2QC7A 3GV1A 5CRDA 3UMAA 3QD9A 3DVXA 2IFQA 2LUSA 4KGIA 5KOXA 2P5RA 4EO3A 1GTIA 2LS5A 5DQSA 2IPAA 2NTOA 3TKSC 3SBCA 3WT1A 2DBCA 4CHSA 1W4VA 3A3TA 5H5SA 4E8EA 2YZUA 3PINA 1Z7RA 3KP8A 2H8LA 4WR4A 4G0LA 1K0MA 2ZNMA 3GMFA 4H86A 3ZL5A 2E2MA 3UIWA 5KN3A 4KW6A 1SK1A 1ON4A 1EZKA 3G9BA 1YKCA 1ERTA 2JADA 2E0QA 4GQCA 2V1MA 4V2LA 2N5AA 1R5PA 4MF7A 3QPMA 5D96A 4GRFA 2F9SA 4MP4A 2VCZA 5IM9A 3ZFBA 5AISA 4EXJA 3QOUA 3SWLA 4EC0A 2FHEA 2GT5A 1NM3A 4YKFA 2GSSA 1FAAA 4MABA 4TXOA 2B7JA 2B3SA 1XCCA 2H1AA 3TRQA 1SD8A 2HZEA 4KNDA 2C4JA 1TTZA 5G1LA 5ID2B 2E2GA 3MDKA 3IAM2 2GTUA 5JCWA 4HZ2A 1F37A 5A5KA 1TKDB 5B7CA 5ELGA 2G0FA 1FHEA 4IGJA 1BEDA 1S3AA 1T00A 4FYCA 4MDCA 1EOGA 4NXIA 2H1DA 4IKHA 4FO5A 2DLXA 3F63A 3O3TA 3FHKA 4YAVA 3EYTA 3LEFA 4IJIA 4AJ7A 3MNGA 2V6KA 5HR2A 2DKHA 3D22A 2N5FA 2BMXA 2LEGA 2GGTA 3PGTA 3IV4A 4IP1A 1LU4A 4QL9A 4WR5A 4RUVA 3PH9A 1FW1A 1DE1A 1XWCA 2FWFA 2H0HA 2KOKA 3JCML 3IHGA 2V41A 4IS0A 4CY8A 16GSA 4MF6A 3BCIA 3ISOA 1U3AA 2JZTA 4PQIA 4KSMA 2HRKA 1PX7A 5AIXA 4IP6A 5ECOB 3N9JA 1J9BA 1XW5A 4KH7A 4PURA 3Q19A 2H01A 4ML6A 3TRXA 4MK3A 4EF0A 1OKTA 2C0FA 3VPTA 4ZL8A 1QFNA 1XW9A 2UZ8A 3FR9A 3LYPA 5IMDA 5L71A 1JZOA 4KCEA 2GSRA 1UA5A 4MMMA 1MEKA 1O73A 3KJYA 2HNLA 5BRTA 4F0CA 4O5RA 2L5LA 1SK2A 2VD0A 3RAZA 4GXZA 4MJBA 3FZ9A 4GWRA 1TRSA 4POBA 3LWAA 2LQQA 2BTOT 3LXTA 2L4QA 3TOUA 3G7JA 2NPBA 1GTBA 3M1GA 2AHEA 1PSQA 3CTFA 3IR4A 4POKA 5A4WA 1AQWA 4XRAA 1H75A 1GSQA 1GSYA 4PNFA 1CQHA 5IMCA 1SK0A 3CTGA 4YH2A 2ZCTA 3TJJA 4J2FA 2DKIA 1N2AA 1ZMAA 4KA0A 1KNGA 1TRVA 4I2TA 4EIQA 3EC3A 1BG5A 1FG4A 4LMWA 1G7EA 5G1KA 2C0EA 3ERFA 1TXXA 2EIOA 4N0VA 1WOUA 1TU8A 2HZFA 2L59A 3ZIVA 1YZXA 10GSA 2H6XA 1K0DA 5FHIA 3C71A 5JWQB 4Z7XA 4Q5RA 1AC1A 3AY8A 3KMOA 2H6YA 3ZMLA 4GTUA 2IL3A 4ZBBA 1JFUA 4ZILA 5G5EA 2TIRA 3GA4A 1M7TA 4I97A 1PD21 1B9XC 1X9MB 1K0OA 1DE2A 1SU9A 3D6IA 4J56E 5DVBA 1XVWA 2XHFA 5LD0A 1GUKA 1V9WA 3VWWA 5J9CA 3GL5A 3VWXA 4KF9A 3Q74A 3P8WA 1X5DA 3I43A 5INYA 1OYJA 3FZ4A 1K0AA 3IA1A 2FNOA 17GSA 4MPFA 4QL7A 4HS1A 4AGSA 4L0UA 1SL0B 4X1UA 3HVVA 4PX1A 4LA1A 1SYRA 4G9HA 1SD9A 4K2XA 1J08A 4MPGA 4V2NA 5IOWA 4HQZA 1X9SB 1T7PB 3DEXA 4K6XA 2HRFA 1PQNA 2GS3A 5CYYA 2ON5A 1E2YA 5EY6A 4JZQA 1PN0A 4TR0A 4HUAA 2C3NA 3ZITA 2O89A 1GULA 4RI6A 2DC5A 1U87A 3IXRA 5J41A 2IWTA 1S3DA 2A4VA 1XFLA 3QMXA 3ZVJD 3QAVA 4G10A 4YKGA 1VF2A 4GSSA 2K8VA 1LBKA 5ABRA 3HDCA 3O76A 5G5FA 3GKNA 4V2MA 5E4WA 5B6MA 4OO4A 4TXVA 3TRPA 1A2JA 4TR1B 1EGRA 2A2PA 2XBQA 4QQ7A 5ECLB 1XWAA 1GLPA 2WDUA 2HFDA 2FA4A 1EEJA 2VOCA 3GNJA 2DIYA 4XS1A 1JLVA 2PVOC 3IHQA 2FUG2 2YJ7A 1TI3A 5HR3A 3APOA 2JSZA 1ERWA 1WJKA 1I9DA 2LRTA 5AIVA 3UJ1A 1ERUA 3WGEA 2LTKA 5F0GA 6GSSA 3EURA 2X64A 1A2LA 3LQ7A 2VL2A 5LCZA 5D9WA 3F6DA 2FD3A 1ZGNA 1K3OA 4WF4A 3KM6A 5EVOA 1NW2A 1BAYA 1UN2A 1K0CA 5ECSA 3A2XA 3C1SA 4OCEA 2IIYA 2RLIA 2L57A 5AGYA 2KP2A 1U88A 1WPIA 6GSYA 3CXGA 2HXKA 4K0NA 2LKUA 4PGTA 3US3A 4OFMA 2MMOA 2LJAA 3M3MA 5JWOB 4EDYA 3OR5A 3DRNA 4Q5NA 2KHPA 5BMUA 1B8XA 1K0BA 4IQ1A 2OBIA 2OE3A 3VLNA 5ECPB 1ZYQB 3DIEA 3ERWA 3VI7A 3H79A 1XPVA 1BJXA 2PPTA 3CRTA 4J57E 4TKYA 3CBUA 3K8NA 2HSYA 3C8EA 2CVKA 2MMAA 1KTEA 4HQSA 3ERGA 3TOTA 2HRAA 3GKKA 5HFIA 1AQVA 4F03A 2YV7A 3HVXA 4JE1A 3UOMA 1PGTA 4L5OA 3ZRDA 5FWGA 1JHBA 5DDLA 1B48A 4Z2UA 1USBA 1XOAA 4ACSA 1B4PA 2TRXA 2VLUA 3W8JA 2GQLA 1GSUA 3EU3A 8GSSA 4EE0A 2JU5A 1WRYA 2R0GA 1OAZA 5H5QA 4EKZA 1SJ6A 2FY6A 2IMDA 1Z7PA 2PU9C 4L5LA 2WRTA 1PL2A 1ZOFA 4Z2RA 2GQKA 4YQMA 5IO0A 5KN2A 2YV9A 4PXOA 3UAPA 1TI1A 5D9VA 5EL8A 4WBJA 2ES7A 3KH7A 3IAS2 2DJKA 2VIMA 3IRAA 1SKSB 1KBNA 2R0PA 2OBKA 2RM5A 4YQVA 1Z3EA 2CX3A 1N8JA 1T3BA 1OKDA 3TGZA 4NAXA 4WEYA 1EWXA 3GYKA 1HNCA 2DJ1A 1XBSA 2AV4A 4IN0A 1SJIA 1VF4A 4ECIA 1GNWA 4ZB8A 3ZYWA 1GL8A 4ECBA 3EE2A 2GZYA 1VF3A 3HZ8A 5ID2A 4EVMA 2AJQB 3VWVA 1F3BA 4GF0A 4GLTA 2CX4A 4N0ZA 1YF0A 4L8EA 1XZOA 1M2BA 4K0GA 2GSQA 4KSOA 4GSNA 3ZREA 3ZVJA 2H72A 4XS4B 1XWGA 3TUEA 1J0FA 3KD0A 2EIRA 2X49A 4XS4A 1YQ1A 4KB3A 3P90A 4K7OA 3E3EA 1LJRA 5ECHB 9GSSA 2M72A 3GL3A 4JBBA 3BCKA 4BVXB 3DD3A 6GSUA 5H5RA 5E59A 1T4YA 2GQMA 4BVXA 1V98A 5DALB 3ME7A 1SYXA 3QR6A 1HNAA 4NV2A 1XOBA 5DALA 2R5GA 5CO3A 2I1UA 3FKFA 4ML1A 3GFKA 2EIQA 1M9AA 2LQOA 3PPUA 4F0BA 1JZDA 3P7XA 4HZ4A 3QFAC 2H76A 2O85A 1XWBA 1DSBA 3A2WA 3Q18A 1PL1A 3MWHA 2ON7A 1T4ZA 4PQ1A 5CREA 1YKAA 1TOFA 3M9KA 5J5NA 4MH3A 4YQUA 2YJHA 1EV4A 3WD6A 4XRDA 1IYHA 4ZBAA 3VK9A 4JEDA 4PTSA 2HLSA 2AUVA 4MJEA 5C00A 3VPQA 2AAWA 1OC9B 1FVKA 2YP6A 3GSSA 3BD2A 3IK9A 5ECMB 2GZPA 4K8MA 1SL1B 2C0DA 3BJ5A 3M9JA 5B6NA 2PWJA 5HFKA 1YJ6A 4MJCA 3LFLA 3FYGA 3A5IA 2X99A 3EPTA 2E7PA 4ZL9A 3RHBA 3UVTA 1MDKA 2L4CA 1QXHA 4E8HA 5ECIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6V A;  1PMT A;  2FGX A;  3D21 A;  3O6T A;  3L9U A;  3ZIJ A;  4FYB A;  4KDU A;  3D0Z A;  1Z6M A;  3F0I A;  2J9H A;  5GAN D;  3HHV A;  5DJM A;  1Y6E A;  1GLQ A;  2XPE A;  2C80 A;  2H1B A;  1EOH A;  4CW9 A;  2GT6 A;  3UAR A;  3RDW A;  1WE0 A;  2XC2 A;  3UEM A;  2MMZ A;  2OE1 A;  1M99 A;  5A4V A;  3GTU B;  3KMN A;  1GUH A;  1I5G A;  3GTU A;  2GLR A;  4D73 B;  3C1R A;  1PA3 A;  2HSH A;  5AN1 A;  1FO5 A;  3IBH A;  4D73 A;  1EP8 A;  4RI7 A;  5GAP D;  3FW2 A;  2X8H A;  2JZR A;  3KP9 A;  1THO A;  1NHY A;  3ZMK A;  4MJA A;  1OE7 A;  1AW9 A;  4PNG A;  1RW1 A;  4OFN A;  5GSS A;  3KEB A;  3WGD A;  3HVS A;  2FWE A;  1GUM A;  2YWN A;  4OD7 A;  2REM A;  3VWU A;  2YN1 A;  1X9W B;  2JAC A;  2DJJ A;  1B4Q A;  2DIZ A;  5ECQ B;  5CRW A;  3CYN A;  3M0F A;  2YPM A;  1XXU A;  2F51 A;  1PKW A;  1K3Y A;  1EP7 A;  5KN1 A;  2YOI A;  3F4T A;  6GSW A;  2JZS A;  1JLW A;  4MCU A;  1A24 A;  3EU4 A;  1QGV A;  4G2E A;  4WKW A;  5CNW A;  3KH9 A;  2VO4 A;  2OAC A;  2PUK C;  4TR4 A;  3TKS E;  1Z6N A;  2YAN A;  4GCI A;  1ZZY A;  3ME8 A;  2NVL A;  4PUA A;  2HI7 A;  5C04 A;  3H4K A;  2M80 A;  3NZN A;  12GS A;  4XHM A;  4WXT A;  4MZC A;  3F3Q A;  2GZZ A;  1Q4J A;  3U5R E;  1NSW A;  4K7N A;  2PN8 A;  2OJL A;  2V2G A;  1TDI A;  4K7I A;  3GX8 A;  3H8Q A;  5D8I A;  4HJ2 A;  1QMV A;  2H71 A;  1GSE A;  3RPP A;  2WGR A;  4HOJ A;  4XIH A;  1HQO A;  3QAW A;  2RM6 A;  3LOR A;  1AUC A;  1RQM A;  1HYU A;  1V2A A;  2CVD A;  4TR1 A;  4AJ6 A;  3TDG A;  3C73 A;  3L4N A;  3KZQ A;  2LJR A;  1THX A;  2QSI A;  3GUR A;  1ABA A;  1GH2 A;  3GH6 A;  2V32 A;  2IMK A;  4BVY A;  4O32 A;  2P5Q A;  5JCU A;  1CQG A;  4YAP A;  1GWC A;  5IMF A;  1TK5 B;  4MZW A;  2RUE A;  3DGQ A;  2P31 A;  4NHZ A;  2ZUP A;  4I6X A;  5G31 A;  5D93 A;  4HI7 A;  4GQF A;  2PVQ A;  5J4U A;  1EEM A;  2H73 A;  3FY7 A;  4NPB A;  4JR4 A;  5GZZ B;  4ZXG A;  2B1K A;  1SEN A;  5HFG A;  5ECR B;  5A4U A;  3LJR A;  5EPF A;  2N5B A;  5DJL A;  2CVB A;  4OFT A;  5F8B A;  2R4V A;  2YZH A;  3TJK A;  1M2A A;  4X43 A;  3GH9 A;  3TKP A;  3RBT A;  1O6J A;  2NDO A;  4JR6 A;  2QKE A;  3Q6O A;  1VF1 A;  4Q5F A;  1ACV A;  5G2Z A;  3HJO A;  4N11 A;  3UL3 A;  1YEP A;  4HU7 A;  4EDZ A;  4JU5 A;  2D2Z A;  1R4W A;  1SJZ A;  4TN8 A;  4NWY A;  2H1G A;  4ID0 A;  1R26 A;  5B8B A;  5IO2 A;  3UBL A;  2IMF A;  2YWI A;  3L9S A;  2VCT A;  3M8N A;  4O7H A;  2H70 A;  1HNB A;  2ALB A;  2GST A;  1XW6 A;  1GTU A;  2VLT A;  4AJ8 A;  1R7H A;  3TKQ A;  4WBR D;  4POM A;  5DBQ A;  4IEL A;  1X5C A;  2F8A A;  2H66 A;  2X8C A;  3A5W A;  3FR3 A;  4K9Z A;  1K3L A;  5D9T A;  3DKS A;  1Y25 A;  4Q5Q A;  4WET A;  3LYK A;  3U6V A;  4KX4 A;  2XBI A;  2IFQ B;  1C72 A;  1A0R P;  1PKZ A;  4ECC A;  1ST9 A;  4V1A p;  2NBS A;  3G7I A;  4EUY A;  3J7Y k;  4DVC A;  2WCI A;  3BOA A;  2WUL A;  2CT6 A;  3HJM A;  3D5J A;  3F4R A;  2K9F A;  2H6Z A;  4RQX A;  3ZTL A;  4K2D A;  3LG6 A;  3HZ4 A;  6GSX A;  2VM2 A;  2B5X A;  3F3R A;  3CMI A;  3GN3 A;  4OMV A;  3G7Y A;  2B7K A;  3RPN A;  1BX9 A;  1OVN A;  3LXZ A;  5IMZ A;  3APQ A;  3WYW A;  2I81 A;  2R3X A;  4TRX A;  2LJK A;  4ULX A;  2H75 A;  3BBY A;  3EMX A;  1KEB A;  4CDO A;  4MZB A;  3F8U A;  4IVF A;  4I8B A;  3GST A;  2O8V B;  1XVQ A;  4LL1 B;  4DSQ A;  2VCQ A;  2KP1 A;  2O7K A;  4OO5 A;  3HKR A;  4TXO B;  1GTA A;  3UBK A;  1MD4 A;  1PX6 A;  2MYG A;  2HZE B;  2CZ2 A;  2H30 A;  1MDI A;  4JRR A;  3TCO A;  1QK8 A;  4DSR A;  5CRH A;  4HEA 2;  1NHO A;  1FOV A;  3TJG A;  3HA9 A;  3R2Q A;  2OA7 A;  1E6B A;  1T1V A;  5IMA A;  3IDV A;  3KCM A;  5D9X A;  2WS2 A;  4DEJ A;  2F8F A;  5G30 A;  1OC3 A;  4OWY A;  4NV5 A;  3EWL A;  2LV3 A;  4HDE A;  1V58 A;  1GSF A;  2V6O A;  3KXO A;  4TR3 A;  1OC8 A;  1AAZ A;  2R2J A;  4IQA A;  3QCP A;  2WZ9 A;  2PBJ A;  4K1F A;  2YWM A;  1F2E A;  2LRC A;  5HR1 A;  4POL A;  3WT2 A;  3DWV A;  5DAK B;  4BWS A;  2HE3 A;  1WWJ A;  4ZL7 A;  1O7U A;  1A8L A;  1YDK A;  2Z9S A;  3IC4 A;  3GIX A;  5DAK A;  2RUF A;  5ENU A;  4LMV A;  1SKR B;  3DML A;  4MH2 A;  3TKS A;  1A2M A;  2JL4 A;  2GDR A;  1FB6 A;  2C3Q A;  1TW9 A;  2VL3 A;  5HR0 A;  1SKW B;  1H4O A;  4PUF C;  2FCH A;  4KCA A;  1TRW A;  1A23 A;  2HRN A;  2WFC A;  1JZR A;  3QDN A;  2AYT A;  4P3Y B;  4XS6 A;  3DVW A;  4F82 A;  3ZZX A;  1OC9 A;  1ERV A;  3E9J B;  3H93 A;  3L9V A;  2YWO A;  1TRU A;  3L78 A;  5JWR B;  3LSZ A;  5CP1 A;  1VGL A;  3GX0 A;  4IHU A;  2MBS A;  3TB2 A;  5DQY A;  3GUS A;  4XCS A;  2DMM A;  4ZIJ A;  3A2V A;  2BJX A;  3F4S A;  2H0G A;  4N10 A;  4EL1 A;  1ILO A;  3W8S A;  3MSZ A;  3E0U A;  2R6K A;  3GKX A;  1M9B A;  3PR8 A;  5IQY A;  1TK8 B;  3HYP A;  3FK8 A;  2VCW A;  3CSJ A;  3NIV A;  2L5O A;  1G7O A;  3WGX A;  2DJ2 A;  2I4A A;  2LNT A;  1IYI A;  2P0G A;  5IPG A;  1PRX A;  4ECJ A;  5D73 A;  5KN0 A;  2LST A;  4F2I A;  2HYX A;  1TJD A;  18GS A;  1XWK A;  1G6W A;  1U6T A;  2R37 A;  2YNX A;  4AF2 A;  3TJF A;  1RK4 A;  1WIK A;  1MDJ A;  3C7M A;  1FB0 A;  4FH8 A;  2XPD A;  1UVZ A;  1GNE A;  3H1N A;  3I9V 2;  2DJ0 A;  3VUR A;  4TW5 A;  5KEJ A;  1Z5Y E;  1OE8 A;  2C3T A;  3LGC A;  1T8E B;  1HD2 A;  2I3Y A;  5ELA A;  5F05 A;  2DML A;  1MD3 A;  6GSV A;  1A8Y A;  2K18 A;  3FZ5 A;  3IE3 A;  2DJ3 A;  1AQX A;  3NOF A;  5IOX A;  2FWH A;  4MLY A;  14GS A;  2HT9 A;  4HJM A;  2X8G A;  3DXB A;  4IJ3 A;  2VL2 C;  2CZ3 A;  19GS A;  4WF5 A;  3CSH A;  4IBP A;  3HY2 A;  3I69 A;  4OCF A;  4KAE A;  3QFB C;  1Q98 A;  2LRN A;  3D4T A;  2MZC A;  3F9U A;  2LNS A;  1ZL9 A;  3IPZ A;  2O87 A;  3I6A A;  3QAG A;  4NMU A;  11GS A;  1YF1 A;  1TK0 B;  4KDY A;  1GSS A;  1U3I A;  4HU9 A;  1GSD A;  2VD1 A;  4I2U A;  3TKR A;  2H74 A;  3KGK A;  1YY7 A;  2IN3 A;  1WP0 A;  4I5Q A;  1SL2 B;  4LLR A;  4KUN A;  5GST A;  4ZB6 A;  5IPH A;  5DCH A;  3P2A A;  4KDX A;  1F3A A;  3W6G A;  2PMT A;  1R5A A;  3GHA A;  3F6F A;  3ZFL A;  4MF5 A;  4BWQ A;  2PGT A;  4O92 A;  1MTC A;  1TU7 A;  4G19 A;  1BYE A;  5F06 A;  1K0N A;  2B5E A;  4BL7 A;  2OE0 A;  3IOS A;  5LNK e;  4LL4 B;  2H19 A;  4ZBD A;  4L0W A;  3HCZ A;  2K8S A;  1A0F A;  4KE3 A;  3S9F A;  5F07 A;  1ZYE A;  4X0X A;  2TRC P;  1URM A;  5CRG A;  3J7Y b;  4ILF A;  3GKM A;  2IMI A;  1PN9 A;  2QGV A;  1JZW A;  22GS A;  3FRC A;  1AIU A;  2C8U A;  3UVH A;  4GST A;  4FIW A;  5ECK B;  2VCV A;  2VL9 A;  2F3M A;  4BA7 A;  1F9M A;  2KLX A;  3HXS A;  3MAK A;  2M46 A;  1TP9 A;  2MMN A;  2VLV A;  3DYR A;  2RII A;  2CQ9 A;  5J9B A;  3FEU A;  4MA9 A;  3ZLP A;  5CAX A;  1M0U A;  4F9Z A;  1BQ7 A;  1GRX A;  1F6M C;  5J3R A;  5DCG A;  5IIZ A;  4ISD A;  1QUW A;  1G0T A;  1X0R A;  5B8A A;  2FWG A;  2C1Y A;  3KTB A;  3L0H A;  5ECN B;  3EMP A;  2PER A;  4V1A g;  1UC7 A;  3VFI A;  3CSI A;  1EV9 A;  2L6C A;  2B6M A;  2A2S A;  1GP1 A;  2YCD A;  4TVE A;  5COH A;  2EC4 A;  2CAQ A;  3D4M A;  4ZB9 A;  6GST A;  2AB6 A;  3KTL A;  1XIY A;  3FR6 A;  3VI5 A;  2FLS A;  2WJU A;  2CV4 A;  1O8X A;  1G6Y A;  2C0G A;  4NHW A;  7GSS A;  5JCG A;  1EGO A;  1VRS D;  3APS A;  1X5E A;  4TOP A;  1B9Y C;  2JSY A;  1ZCP A;  1S3C A;  2I9H A;  2CAI A;  1YEX A;  1V40 A;  2MBT A;  2KUC A;  1Z9H A;  2CA8 A;  5HQP A;  2IME A;  2FA8 A;  4FYU A;  13GS A;  2H0I A;  1WMJ A;  1O81 A;  2G2Q A;  20GS A;  1QQ2 A;  2VCX A;  3RHC A;  3V1W A;  4BPY A;  1O85 A;  1M2D A;  3KIJ A;  3FZA A;  3HJP A;  1O8W A;  2OKA A;  1AXD A;  1FVJ A;  3CRU A;  2J23 A;  2OAD A;  1DBY A;  2A2R A;  3ED3 A;  1ML6 A;  3EIN A;  3N5O A;  2VUP A;  2VM1 A;  4XTS A;  2B1L A;  4PQH A;  3HD5 A;  4RQR A;  2B5Y A;  1W89 A;  2IJY A;  5IMV A;  4DSS B;  2DSA A;  3TJB A;  1DUG A;  4IW9 A;  4DSS A;  3GRX A;  2L6D A;  3EVI A;  1V57 A;  2VAF A;  2WB9 A;  4N30 A;  2GVP A;  3IK7 A;  5FT3 A;  2QC7 A;  3GV1 A;  5CRD A;  3UMA A;  3QD9 A;  3DVX A;  2IFQ A;  2LUS A;  4KGI A;  2P5R A;  4EO3 A;  1GTI A;  2LS5 A;  5DQS A;  2IPA A;  2NTO A;  3TKS C;  3SBC A;  3WT1 A;  2DBC A;  4CHS A;  1W4V A;  3A3T A;  5H5S A;  4E8E A;  2YZU A;  3PIN A;  1Z7R A;  3KP8 A;  2H8L A;  4WR4 A;  1K0M A;  2ZNM A;  3GMF A;  4H86 A;  3ZL5 A;  2E2M A;  3UIW A;  5KN3 A;  4KW6 A;  1SK1 A;  1ON4 A;  1EZK A;  3G9B A;  1YKC A;  1ERT A;  2JAD A;  2E0Q A;  4GQC A;  2V1M A;  4V2L A;  2N5A A;  1R5P A;  4MF7 A;  3QPM A;  5D96 A;  4GRF A;  2F9S A;  4MP4 A;  2VCZ A;  5IM9 A;  3ZFB A;  5AIS A;  4EXJ A;  3QOU A;  3SWL A;  4EC0 A;  2FHE A;  2GT5 A;  1NM3 A;  2GSS A;  1FAA A;  4MAB A;  4TXO A;  2B7J A;  2B3S A;  1XCC A;  2H1A A;  3TRQ A;  1SD8 A;  2HZE A;  4KND A;  2C4J A;  1TTZ A;  5G1L A;  5ID2 B;  2E2G A;  3MDK A;  3IAM 2;  2GTU A;  5JCW A;  4HZ2 A;  1F37 A;  5A5K A;  1TKD B;  5B7C A;  5ELG A;  2G0F A;  1FHE A;  4IGJ A;  1BED A;  1S3A A;  1T00 A;  4FYC A;  4MDC A;  1EOG A;  4NXI A;  2H1D A;  4IKH A;  4FO5 A;  2DLX A;  3F63 A;  3O3T A;  3FHK A;  4YAV A;  3EYT A;  3LEF A;  4IJI A;  4AJ7 A;  3MNG A;  2V6K A;  5HR2 A;  3D22 A;  2N5F A;  2BMX A;  2LEG A;  2GGT A;  3PGT A;  3IV4 A;  4IP1 A;  1LU4 A;  4QL9 A;  4WR5 A;  4RUV A;  3PH9 A;  1FW1 A;  1DE1 A;  1XWC A;  2FWF A;  2H0H A;  2KOK A;  3JCM L;  2V41 A;  4IS0 A;  16GS A;  4MF6 A;  3BCI A;  3ISO A;  1U3A A;  2JZT A;  4PQI A;  4KSM A;  1PX7 A;  5AIX A;  4IP6 A;  5ECO B;  3N9J A;  1J9B A;  1XW5 A;  4KH7 A;  4PUR A;  3Q19 A;  2H01 A;  4ML6 A;  3TRX A;  4MK3 A;  4EF0 A;  1OKT A;  2C0F A;  3VPT A;  4ZL8 A;  1QFN A;  1XW9 A;  3FR9 A;  3LYP A;  5IMD A;  5L71 A;  1JZO A;  4KCE A;  2GSR A;  1UA5 A;  4MMM A;  1MEK A;  1O73 A;  3KJY A;  2HNL A;  4F0C A;  4O5R A;  2L5L A;  1SK2 A;  2VD0 A;  3RAZ A;  4GXZ A;  4MJB A;  3FZ9 A;  4GWR A;  1TRS A;  4POB A;  3LWA A;  2LQQ A;  2BTO T;  3LXT A;  2L4Q A;  3TOU A;  3G7J A;  2NPB A;  1GTB A;  3M1G A;  2AHE A;  1PSQ A;  3CTF A;  3IR4 A;  4POK A;  5A4W A;  1AQW A;  4XRA A;  1H75 A;  1GSQ A;  1GSY A;  4PNF A;  1CQH A;  5IMC A;  1SK0 A;  3CTG A;  4YH2 A;  2ZCT A;  3TJJ A;  4J2F A;  1N2A A;  1ZMA A;  4KA0 A;  1KNG A;  1TRV A;  4I2T A;  3EC3 A;  1BG5 A;  1FG4 A;  4LMW A;  1G7E A;  5G1K A;  2C0E A;  3ERF A;  1TXX A;  2EIO A;  4N0V A;  1WOU A;  1TU8 A;  2HZF A;  2L59 A;  3ZIV A;  1YZX A;  10GS A;  2H6X A;  1K0D A;  5FHI A;  3C71 A;  5JWQ B;  4Z7X A;  4Q5R A;  1AC1 A;  3AY8 A;  3KMO A;  2H6Y A;  3ZML A;  4GTU A;  2IL3 A;  4ZBB A;  1JFU A;  4ZIL A;  5G5E A;  2TIR A;  3GA4 A;  1M7T A;  4I97 A;  1PD2 1;  1B9X C;  1X9M B;  1K0O A;  1DE2 A;  1SU9 A;  3D6I A;  4J56 E;  5DVB A;  1XVW A;  2XHF A;  5LD0 A;  1GUK A;  1V9W A;  3VWW A;  5J9C A;  3GL5 A;  3VWX A;  3Q74 A;  3P8W A;  1X5D A;  3I43 A;  5INY A;  1OYJ A;  3FZ4 A;  1K0A A;  3IA1 A;  2FNO A;  17GS A;  4MPF A;  4QL7 A;  4HS1 A;  4AGS A;  4L0U A;  1SL0 B;  4X1U A;  3HVV A;  4PX1 A;  4LA1 A;  1SYR A;  4G9H A;  1SD9 A;  4MPG A;  1J08 A;  4V2N A;  5IOW A;  4HQZ A;  1X9S B;  1T7P B;  3DEX A;  4K6X A;  2HRF A;  1PQN A;  2GS3 A;  5CYY A;  2ON5 A;  1E2Y A;  5EY6 A;  4JZQ A;  4TR0 A;  4HUA A;  2C3N A;  3ZIT A;  2O89 A;  1GUL A;  4RI6 A;  2DC5 A;  1U87 A;  3IXR A;  5J41 A;  2IWT A;  1S3D A;  2A4V A;  1XFL A;  3QMX A;  3ZVJ D;  3QAV A;  4G10 A;  1VF2 A;  4GSS A;  2K8V A;  1LBK A;  5ABR A;  3HDC A;  3O76 A;  5G5F A;  3GKN A;  4V2M A;  5E4W A;  5B6M A;  4OO4 A;  4TXV A;  3TRP A;  1A2J A;  4TR1 B;  1EGR A;  2XBQ A;  4QQ7 A;  5ECL B;  1XWA A;  1GLP A;  2WDU A;  2HFD A;  2FA4 A;  1EEJ A;  2VOC A;  3GNJ A;  2DIY A;  4XS1 A;  1JLV A;  2PVO C;  3IHQ A;  2FUG 2;  2YJ7 A;  1TI3 A;  5HR3 A;  3APO A;  2JSZ A;  1ERW A;  1WJK A;  1I9D A;  2LRT A;  5AIV A;  3UJ1 A;  1ERU A;  3WGE A;  2LTK A;  5F0G A;  6GSS A;  3EUR A;  2X64 A;  1A2L A;  3LQ7 A;  2VL2 A;  5LCZ A;  5D9W A;  3F6D A;  2FD3 A;  1ZGN A;  1K3O A;  4WF4 A;  3KM6 A;  5EVO A;  1NW2 A;  1BAY A;  1UN2 A;  1K0C A;  5ECS A;  3A2X A;  3C1S A;  4OCE A;  2IIY A;  2RLI A;  2L57 A;  5AGY A;  2KP2 A;  1U88 A;  1WPI A;  6GSY A;  3CXG A;  2HXK A;  4K0N A;  2LKU A;  4PGT A;  3US3 A;  4OFM A;  2MMO A;  2LJA A;  3M3M A;  5JWO B;  4EDY A;  3OR5 A;  3DRN A;  4Q5N A;  2KHP A;  1B8X A;  1K0B A;  4IQ1 A;  2OBI A;  2OE3 A;  3VLN A;  5ECP B;  1ZYQ B;  3DIE A;  3ERW A;  3VI7 A;  3H79 A;  1XPV A;  1BJX A;  2PPT A;  3CRT A;  4J57 E;  4TKY A;  3CBU A;  3K8N A;  2HSY A;  3C8E A;  2CVK A;  2MMA A;  1KTE A;  4HQS A;  3ERG A;  3TOT A;  3GKK A;  5HFI A;  1AQV A;  4F03 A;  2YV7 A;  3HVX A;  4JE1 A;  3UOM A;  1PGT A;  4L5O A;  3ZRD A;  5FWG A;  1JHB A;  5DDL A;  1B48 A;  1USB A;  1XOA A;  4ACS A;  1B4P A;  2TRX A;  2VLU A;  3W8J A;  2GQL A;  1GSU A;  3EU3 A;  8GSS A;  4EE0 A;  2JU5 A;  1WRY A;  1OAZ A;  5H5Q A;  4EKZ A;  1SJ6 A;  2FY6 A;  2IMD A;  1Z7P A;  2PU9 C;  4L5L A;  2WRT A;  1PL2 A;  1ZOF A;  2GQK A;  4YQM A;  5IO0 A;  5KN2 A;  2YV9 A;  4PXO A;  3UAP A;  1TI1 A;  5D9V A;  5EL8 A;  4WBJ A;  2ES7 A;  3KH7 A;  3IAS 2;  2DJK A;  2VIM A;  3IRA A;  1SKS B;  1KBN A;  2OBK A;  2RM5 A;  4YQV A;  1Z3E A;  2CX3 A;  1N8J A;  1T3B A;  1OKD A;  3TGZ A;  4NAX A;  4WEY A;  1EWX A;  3GYK A;  1HNC A;  2DJ1 A;  1XBS A;  2AV4 A;  4IN0 A;  1SJI A;  1VF4 A;  4ECI A;  1GNW A;  4ZB8 A;  3ZYW A;  1GL8 A;  4ECB A;  3EE2 A;  2GZY A;  1VF3 A;  3HZ8 A;  5ID2 A;  4EVM A;  2AJQ B;  3VWV A;  1F3B A;  4GF0 A;  4GLT A;  2CX4 A;  4N0Z A;  1YF0 A;  4L8E A;  1XZO A;  1M2B A;  4K0G A;  2GSQ A;  4KSO A;  4GSN A;  3ZRE A;  3ZVJ A;  2H72 A;  4XS4 B;  1XWG A;  3TUE A;  1J0F A;  3KD0 A;  2EIR A;  4XS4 A;  1YQ1 A;  4KB3 A;  3P90 A;  4K7O A;  3E3E A;  1LJR A;  5ECH B;  9GSS A;  2M72 A;  3GL3 A;  4JBB A;  3BCK A;  3DD3 A;  6GSU A;  5H5R A;  5E59 A;  1T4Y A;  2GQM A;  4BVX A;  5DAL B;  1V98 A;  3ME7 A;  1SYX A;  3QR6 A;  1HNA A;  4NV2 A;  1XOB A;  5DAL A;  2R5G A;  5CO3 A;  2I1U A;  3FKF A;  4ML1 A;  3GFK A;  2EIQ A;  1M9A A;  2LQO A;  4F0B A;  1JZD A;  3P7X A;  4HZ4 A;  3QFA C;  2H76 A;  2O85 A;  1XWB A;  1DSB A;  3A2W A;  3Q18 A;  1PL1 A;  3MWH A;  2ON7 A;  1T4Z A;  4PQ1 A;  5CRE A;  1YKA A;  1TOF A;  3M9K A;  5J5N A;  4MH3 A;  4YQU A;  2YJH A;  1EV4 A;  3WD6 A;  4XRD A;  1IYH A;  4ZBA A;  3VK9 A;  4JED A;  2HLS A;  2AUV A;  4MJE A;  5C00 A;  3VPQ A;  2AAW A;  1OC9 B;  1FVK A;  2YP6 A;  3GSS A;  3BD2 A;  3IK9 A;  5ECM B;  2GZP A;  4K8M A;  1SL1 B;  2C0D A;  3BJ5 A;  3M9J A;  5B6N A;  2PWJ A;  5HFK A;  1YJ6 A;  4MJC A;  3LFL A;  3FYG A;  2X99 A;  2E7P A;  4ZL9 A;  3RHB A;  3UVT A;  1MDK A;  2L4C A;  1QXH A;  4E8H A;  5ECI B; 
#chains in the Genus database with same CATH topology
 2K6V A;  1PMT A;  2FGX A;  3D21 A;  3O6T A;  3L9U A;  3ZIJ A;  4FYB A;  4KDU A;  3D0Z A;  1Z6M A;  3F0I A;  2J9H A;  5GAN D;  3HHV A;  5DJM A;  1Y6E A;  1GLQ A;  2XPE A;  2C80 A;  2H1B A;  4O5Q A;  1EOH A;  4CW9 A;  2GT6 A;  3UAR A;  3RDW A;  1WE0 A;  2XC2 A;  3UEM A;  2MMZ A;  2OE1 A;  1M99 A;  5A4V A;  3GTU B;  3KMN A;  1GUH A;  1I5G A;  4BIK A;  3GTU A;  2GLR A;  4D73 B;  3C1R A;  1PA3 A;  2HSH A;  5AN1 A;  1FO5 A;  3IBH A;  4D73 A;  1EP8 A;  4RI7 A;  5GAP D;  3FW2 A;  2X8H A;  2JZR A;  3KP9 A;  1THO A;  1NHY A;  3ZMK A;  4MJA A;  1OE7 A;  1AW9 A;  4PNG A;  1RW1 A;  4OFN A;  5GSS A;  3KEB A;  3WGD A;  3HVS A;  2FWE A;  1GUM A;  2YWN A;  4OD7 A;  2REM A;  3VWU A;  2YN1 A;  1X9W B;  2JAC A;  2DJJ A;  1B4Q A;  2DIZ A;  4FQU A;  5ECQ B;  5CRW A;  3CYN A;  3M0F A;  2YPM A;  1XXU A;  2F51 A;  1PKW A;  1K3Y A;  1EP7 A;  4ICY A;  5KN1 A;  2YOI A;  3F4T A;  6GSW A;  2JZS A;  1JLW A;  4MCU A;  1A24 A;  3EU4 A;  1QGV A;  4G2E A;  4WKW A;  5CNW A;  4G0I A;  3KH9 A;  2VO4 A;  2OAC A;  2PUK C;  4TR4 A;  3TKS E;  1Z6N A;  2YAN A;  4GCI A;  1ZZY A;  3ME8 A;  2NVL A;  4PUA A;  2HI7 A;  5C04 A;  3H4K A;  2M80 A;  3NZN A;  12GS A;  4XHM A;  4WXT A;  4MZC A;  3F3Q A;  2GZZ A;  1Q4J A;  3U5R E;  1NSW A;  4K7N A;  2PN8 A;  2OJL A;  2V2G A;  1TDI A;  4K7I A;  3GX8 A;  3H8Q A;  5D8I A;  4HJ2 A;  1QMV A;  2H71 A;  1GSE A;  3RPP A;  2WGR A;  1XG8 A;  4HOJ A;  4XIH A;  1HQO A;  3QAW A;  2RM6 A;  3LOR A;  1ZYN A;  1AUC A;  1FOH A;  1RQM A;  1HYU A;  1V2A A;  2CVD A;  4TR1 A;  4AJ6 A;  3TDG A;  3C73 A;  3L4N A;  3KZQ A;  2LJR A;  1THX A;  2QSI A;  3GUR A;  1ABA A;  4BVY B;  1GH2 A;  3GH6 A;  2V32 A;  2IMK A;  4BVY A;  4O32 A;  2P5Q A;  5JCU A;  1CQG A;  4YAP A;  4K5S A;  1GWC A;  5IMF A;  4G0K A;  1TK5 B;  4MZW A;  2RUE A;  3DGQ A;  2P31 A;  4NHZ A;  2ZUP A;  4I6X A;  5G31 A;  5D93 A;  4HI7 A;  4GQF A;  2PVQ A;  5J4U A;  1EEM A;  2H73 A;  3FY7 A;  4NPB A;  4JR4 A;  5GZZ B;  4ZXG A;  2B1K A;  1SEN A;  5HFG A;  5ECR B;  5A4U A;  3LJR A;  5EPF A;  2N5B A;  5DJL A;  2CVB A;  4OFT A;  5F8B A;  2R4V A;  2YZH A;  3TJK A;  1M2A A;  4X43 A;  3GH9 A;  3TKP A;  3RBT A;  1O6J A;  2NDO A;  4JR6 A;  2QKE A;  3Q6O A;  1VF1 A;  4Q5F A;  1ACV A;  5G2Z A;  4EIP A;  3HJO A;  4N11 A;  3UL3 A;  1YEP A;  4HU7 A;  4EDZ A;  4JU5 A;  2D2Z A;  1R4W A;  1SJZ A;  4TN8 A;  4NWY A;  2H1G A;  4ID0 A;  1R26 A;  5B8B A;  5IO2 A;  3UBL A;  2IMF A;  2YWI A;  3L9S A;  2VCT A;  3M8N A;  4O7H A;  2H70 A;  1HNB A;  2ALB A;  2GST A;  1XW6 A;  1GTU A;  2VLT A;  4AJ8 A;  1R7H A;  3TKQ A;  4WBR D;  4POM A;  5DBQ A;  4IEL A;  1X5C A;  2F8A A;  2H66 A;  2X8C A;  3A5W A;  3FR3 A;  4K9Z A;  1K3L A;  5D9T A;  3DKS A;  1Y25 A;  2X4A A;  4Q5Q A;  4WET A;  3LYK A;  3U6V A;  4KX4 A;  2XBI A;  2IFQ B;  1C72 A;  1A0R P;  1PKZ A;  4ECC A;  1ST9 A;  4V1A p;  2NBS A;  3G7I A;  4EUY A;  3J7Y k;  4DVC A;  2WCI A;  3BOA A;  2WUL A;  2CT6 A;  3HJM A;  3R3E A;  3D5J A;  2K9F A;  3F4R A;  2H6Z A;  4RQX A;  3ZTL A;  4K2D A;  4A5P A;  3LG6 A;  3HZ4 A;  6GSX A;  2VM2 A;  2B5X A;  3F3R A;  3CMI A;  3GN3 A;  4OMV A;  3G7Y A;  2B7K A;  3RPN A;  4O5U A;  1BX9 A;  1OVN A;  3LXZ A;  5IMZ A;  3APQ A;  3WYW A;  2I81 A;  2R3X A;  4TRX A;  2LJK A;  4ULX A;  2H75 A;  3BBY A;  3EMX A;  1KEB A;  4CDO A;  4MZB A;  3F8U A;  4IVF A;  4I8B A;  3GST A;  2O8V B;  1XVQ A;  4LL1 B;  4DSQ A;  2VCQ A;  2KP1 A;  2O7K A;  4OO5 A;  3HKR A;  4TXO B;  1GTA A;  3UBK A;  1MD4 A;  1PX6 A;  2MYG A;  2HZE B;  2CZ2 A;  2H30 A;  1MDI A;  4JRR A;  3TCO A;  1QK8 A;  3FMW A;  4DSR A;  5CRH A;  4HEA 2;  1NHO A;  1FOV A;  3TJG A;  3HA9 A;  3R2Q A;  2OA7 A;  1E6B A;  1T1V A;  5IMA A;  3IDV A;  3KCM A;  5D9X A;  2WS2 A;  4DEJ A;  2F8F A;  5G30 A;  1OC3 A;  4OWY A;  4USS A;  4NV5 A;  3EWL A;  2LV3 A;  4HDE A;  1V58 A;  1GSF A;  2V6O A;  3KXO A;  4TR3 A;  1OC8 A;  1AAZ A;  2R2J A;  4IQA A;  3QCP A;  2WZ9 A;  2PBJ A;  4K1F A;  2YWM A;  1F2E A;  2LRC A;  5HR1 A;  4POL A;  3WT2 A;  3DWV A;  5DAK B;  4BWS A;  2HE3 A;  1WWJ A;  4ZL7 A;  1O7U A;  1A8L A;  1YDK A;  2Z9S A;  3IC4 A;  3GIX A;  5DAK A;  2RUF A;  5ENU A;  4LMV A;  1SKR B;  3DML A;  4MH2 A;  3TKS A;  1A2M A;  2JL4 A;  2GDR A;  1FB6 A;  2C3Q A;  1TW9 A;  2VL3 A;  5HR0 A;  1SKW B;  1H4O A;  4PUF C;  2FCH A;  4KCA A;  1TRW A;  4CY6 A;  1A23 A;  2HRN A;  2WFC A;  1JZR A;  3QDN A;  2AYT A;  4P3Y B;  4XS6 A;  2A4H A;  3DVW A;  4F82 A;  3ZZX A;  1OC9 A;  1ERV A;  3E9J B;  3H93 A;  2HSM A;  3L9V A;  1M3J A;  3MYD A;  2YWO A;  1TRU A;  3L78 A;  5JWR B;  3LSZ A;  5CP1 A;  1VGL A;  3GX0 A;  1ZYP A;  4IHU A;  2MBS A;  3TB2 A;  5DQY A;  3GUS A;  4XCS A;  2DMM A;  4ZIJ A;  3A2V A;  2BJX A;  3F4S A;  2H0G A;  4N10 A;  4EL1 A;  1ILO A;  3W8S A;  3MSZ A;  3E0U A;  2R6K A;  3GKX A;  2QA2 A;  1M9B A;  3PR8 A;  5IQY A;  1TK8 B;  3HYP A;  3FK8 A;  2VCW A;  3CSJ A;  3NIV A;  2L5O A;  1G7O A;  3WGX A;  2DJ2 A;  2I4A A;  2LNT A;  1IYI A;  2P0G A;  5IPG A;  1PRX A;  5KOW A;  4ECJ A;  5D73 A;  5KN0 A;  2LST A;  4F2I A;  2HYX A;  1TJD A;  18GS A;  1XWK A;  1G6W A;  1U6T A;  2R37 A;  3MIX A;  2YNX A;  4AF2 A;  3TJF A;  1RK4 A;  1WIK A;  1MDJ A;  3C7M A;  1FB0 A;  4FH8 A;  2XPD A;  1UVZ A;  1GNE A;  3H1N A;  3I9V 2;  2DJ0 A;  3VUR A;  4TW5 A;  5KEJ A;  1Z5Y E;  1OE8 A;  2C3T A;  3LGC A;  1T8E B;  1HD2 A;  2I3Y A;  5ELA A;  5F05 A;  2DML A;  1MD3 A;  6GSV A;  1A8Y A;  2K18 A;  3FZ5 A;  3IE3 A;  2DJ3 A;  1AQX A;  3NOF A;  5IOX A;  2FWH A;  4MLY A;  14GS A;  2HT9 A;  4HJM A;  2X8G A;  3DXB A;  4X4J A;  4IJ3 A;  2VL2 C;  2CZ3 A;  19GS A;  4WF5 A;  3CSH A;  4IBP A;  3HY2 A;  3I69 A;  4OCF A;  4KAE A;  3QFB C;  1Q98 A;  2LRN A;  3D4T A;  2MZC A;  3F9U A;  2LNS A;  1ZL9 A;  3IPZ A;  2O87 A;  3I6A A;  3QAG A;  4NMU A;  11GS A;  1YF1 A;  1TK0 B;  4KDY A;  1GSS A;  1U3I A;  4HU9 A;  1GSD A;  2VD1 A;  4I2U A;  3TKR A;  2H74 A;  3KGK A;  1YY7 A;  2IN3 A;  1WP0 A;  4I5Q A;  1SL2 B;  4LLR A;  4KUN A;  5GST A;  4ZB6 A;  5IPH A;  5DCH A;  3P2A A;  4KDX A;  1F3A A;  3W6G A;  2PMT A;  1R5A A;  3GHA A;  3F6F A;  3ZFL A;  4MF5 A;  4BWQ A;  4BL7 B;  3IC8 A;  2PGT A;  4O92 A;  1MTC A;  1TU7 A;  4G19 A;  1BYE A;  5F06 A;  1K0N A;  2B5E A;  4BL7 A;  2OE0 A;  3IOS A;  5LNK e;  4LL4 B;  2H19 A;  4ZBD A;  4L0W A;  4MNN A;  3HCZ A;  2K8S A;  1A0F A;  4KE3 A;  3S9F A;  1ZYE A;  5F07 A;  4X0X A;  2TRC P;  1URM A;  5CRG A;  3J7Y b;  4ILF A;  3GKM A;  2IMI A;  1PN9 A;  2QGV A;  1JZW A;  22GS A;  3FRC A;  1AIU A;  2C8U A;  3UVH A;  4GST A;  4FIW A;  5ECK B;  2VCV A;  2VL9 A;  2F3M A;  4BA7 A;  1F9M A;  2KLX A;  3HXS A;  3MAK A;  2M46 A;  2R0C A;  1TP9 A;  2MMN A;  2VLV A;  3DYR A;  2RII A;  2CQ9 A;  5J9B A;  3FEU A;  4MA9 A;  3ZLP A;  5CAX A;  1M0U A;  4F9Z A;  1BQ7 A;  3LW9 A;  1GRX A;  1F6M C;  5J3R A;  5DCG A;  5IIZ A;  4ISD A;  1QUW A;  1G0T A;  1X0R A;  5B8A A;  2FWG A;  2C1Y A;  3KTB A;  3L0H A;  2QA1 A;  5ECN B;  3EMP A;  2PER A;  4V1A g;  1UC7 A;  3VFI A;  3CSI A;  1EV9 A;  2L6C A;  2B6M A;  2A2S A;  1GP1 A;  2YCD A;  4TVE A;  5COH A;  2EC4 A;  2CAQ A;  3D4M A;  4ZB9 A;  6GST A;  2AB6 A;  3KTL A;  1XIY A;  3FR6 A;  3VI5 A;  2FLS A;  4K5R A;  2WJU A;  2CV4 A;  4Z2T A;  1O8X A;  1G6Y A;  2C0G A;  4NHW A;  7GSS A;  5JCG A;  1EGO A;  1VRS D;  3APS A;  1X5E A;  4TOP A;  1B9Y C;  2JSY A;  1ZCP A;  1S3C A;  2I9H A;  2CAI A;  1YEX A;  1V40 A;  2MBT A;  2KUC A;  3CQF A;  1Z9H A;  2CA8 A;  5HQP A;  2IME A;  2FA8 A;  4FYU A;  13GS A;  2H0I A;  1WMJ A;  1O81 A;  2G2Q A;  20GS A;  1QQ2 A;  2VCX A;  3RHC A;  3V1W A;  4BPY A;  1O85 A;  1M2D A;  3KIJ A;  3FZA A;  3HJP A;  1O8W A;  2OKA A;  1AXD A;  1FVJ A;  3CRU A;  2J23 A;  2OAD A;  1DBY A;  2A2R A;  3ED3 A;  1ML6 A;  3EIN A;  3N5O A;  2VUP A;  2VM1 A;  4XTS A;  2B1L A;  4PQH A;  3HD5 A;  4RQR A;  2B5Y A;  1W89 A;  2IJY A;  5IMV A;  4DSS B;  2DSA A;  3TJB A;  1DUG A;  1S3R A;  4IW9 A;  4DSS A;  3GRX A;  2L6D A;  3EVI A;  1V57 A;  2VAF A;  2WB9 A;  4N30 A;  2GVP A;  3IK7 A;  5FT3 A;  2QC7 A;  3GV1 A;  5CRD A;  3UMA A;  3QD9 A;  3DVX A;  2IFQ A;  2LUS A;  4KGI A;  5KOX A;  2P5R A;  4EO3 A;  1GTI A;  2LS5 A;  5DQS A;  2IPA A;  2NTO A;  3TKS C;  3SBC A;  3WT1 A;  2DBC A;  4CHS A;  1W4V A;  3A3T A;  5H5S A;  4E8E A;  2YZU A;  3PIN A;  1Z7R A;  3KP8 A;  2H8L A;  4WR4 A;  4G0L A;  1K0M A;  2ZNM A;  3GMF A;  4H86 A;  3ZL5 A;  2E2M A;  3UIW A;  5KN3 A;  4KW6 A;  1SK1 A;  1ON4 A;  1EZK A;  3G9B A;  1YKC A;  1ERT A;  2JAD A;  2E0Q A;  4GQC A;  2V1M A;  4V2L A;  2N5A A;  1R5P A;  4MF7 A;  3QPM A;  5D96 A;  4GRF A;  2F9S A;  4MP4 A;  2VCZ A;  5IM9 A;  3ZFB A;  5AIS A;  4EXJ A;  3QOU A;  3SWL A;  4EC0 A;  2FHE A;  2GT5 A;  1NM3 A;  4YKF A;  2GSS A;  1FAA A;  4MAB A;  4TXO A;  2B7J A;  2B3S A;  1XCC A;  2H1A A;  3TRQ A;  1SD8 A;  2HZE A;  4KND A;  2C4J A;  1TTZ A;  5G1L A;  5ID2 B;  2E2G A;  3MDK A;  3IAM 2;  2GTU A;  5JCW A;  4HZ2 A;  1F37 A;  5A5K A;  1TKD B;  5B7C A;  5ELG A;  2G0F A;  1FHE A;  4IGJ A;  1BED A;  1S3A A;  1T00 A;  4FYC A;  4MDC A;  1EOG A;  4NXI A;  2H1D A;  4IKH A;  4FO5 A;  2DLX A;  3F63 A;  3O3T A;  3FHK A;  4YAV A;  3EYT A;  3LEF A;  4IJI A;  4AJ7 A;  3MNG A;  2V6K A;  5HR2 A;  2DKH A;  3D22 A;  2N5F A;  2BMX A;  2LEG A;  2GGT A;  3PGT A;  3IV4 A;  4IP1 A;  1LU4 A;  4QL9 A;  1PFO A;  4WR5 A;  4RUV A;  3PH9 A;  1FW1 A;  1DE1 A;  1XWC A;  2FWF A;  2H0H A;  2KOK A;  3JCM L;  3IHG A;  2V41 A;  4IS0 A;  4CY8 A;  16GS A;  4MF6 A;  3BCI A;  3ISO A;  1U3A A;  2JZT A;  4PQI A;  4KSM A;  2HRK A;  1PX7 A;  5AIX A;  4IP6 A;  5ECO B;  3N9J A;  1J9B A;  1XW5 A;  4KH7 A;  4PUR A;  3Q19 A;  2H01 A;  4ML6 A;  3TRX A;  4MK3 A;  4EF0 A;  1OKT A;  2C0F A;  3VPT A;  4ZL8 A;  1QFN A;  1XW9 A;  2UZ8 A;  3FR9 A;  3LYP A;  5IMD A;  5L71 A;  1JZO A;  4KCE A;  2GSR A;  1UA5 A;  4MMM A;  1MEK A;  1O73 A;  3KJY A;  2HNL A;  5BRT A;  4F0C A;  4O5R A;  2L5L A;  1SK2 A;  2VD0 A;  3RAZ A;  4GXZ A;  4MJB A;  3FZ9 A;  4GWR A;  1TRS A;  4POB A;  3LWA A;  2LQQ A;  2BTO T;  3LXT A;  2L4Q A;  3TOU A;  3G7J A;  2NPB A;  1GTB A;  3M1G A;  2AHE A;  1PSQ A;  3CTF A;  3IR4 A;  4POK A;  5A4W A;  1AQW A;  4XRA A;  1H75 A;  1GSQ A;  1GSY A;  4PNF A;  1CQH A;  5IMC A;  1SK0 A;  3CTG A;  4YH2 A;  2ZCT A;  3TJJ A;  4J2F A;  2DKI A;  1N2A A;  1ZMA A;  4KA0 A;  1KNG A;  1TRV A;  4I2T A;  4EIQ A;  3EC3 A;  1BG5 A;  1FG4 A;  4LMW A;  1G7E A;  5G1K A;  2C0E A;  3ERF A;  1TXX A;  2EIO A;  4N0V A;  1WOU A;  1TU8 A;  2HZF A;  2L59 A;  3ZIV A;  1YZX A;  10GS A;  2H6X A;  1K0D A;  5FHI A;  3C71 A;  5JWQ B;  4Z7X A;  4Q5R A;  1AC1 A;  3AY8 A;  3KMO A;  2H6Y A;  3ZML A;  4GTU A;  2IL3 A;  4ZBB A;  1JFU A;  4ZIL A;  5G5E A;  2TIR A;  3GA4 A;  1M7T A;  4I97 A;  1PD2 1;  1B9X C;  1X9M B;  1K0O A;  1DE2 A;  1SU9 A;  3D6I A;  4J56 E;  5DVB A;  1XVW A;  2XHF A;  5LD0 A;  1GUK A;  1V9W A;  3VWW A;  5J9C A;  3GL5 A;  3VWX A;  4KF9 A;  3Q74 A;  3P8W A;  1X5D A;  3I43 A;  5INY A;  1OYJ A;  3FZ4 A;  1K0A A;  3IA1 A;  2FNO A;  17GS A;  4MPF A;  4QL7 A;  4HS1 A;  4AGS A;  4L0U A;  1SL0 B;  4X1U A;  3HVV A;  4PX1 A;  4LA1 A;  1SYR A;  4G9H A;  1SD9 A;  4K2X A;  1J08 A;  4MPG A;  4V2N A;  5IOW A;  4HQZ A;  1X9S B;  1T7P B;  3DEX A;  4K6X A;  2HRF A;  1PQN A;  2GS3 A;  5CYY A;  2ON5 A;  1E2Y A;  5EY6 A;  4JZQ A;  1PN0 A;  4TR0 A;  4HUA A;  2C3N A;  3ZIT A;  2O89 A;  1GUL A;  4RI6 A;  2DC5 A;  1U87 A;  3IXR A;  5J41 A;  2IWT A;  1S3D A;  2A4V A;  1XFL A;  3QMX A;  3ZVJ D;  3QAV A;  4G10 A;  4YKG A;  1VF2 A;  4GSS A;  2K8V A;  1LBK A;  5ABR A;  3HDC A;  3O76 A;  5G5F A;  3GKN A;  4V2M A;  5E4W A;  5B6M A;  4OO4 A;  4TXV A;  3TRP A;  1A2J A;  4TR1 B;  1EGR A;  2A2P A;  2XBQ A;  4QQ7 A;  5ECL B;  1XWA A;  1GLP A;  2WDU A;  2HFD A;  2FA4 A;  1EEJ A;  2VOC A;  3GNJ A;  2DIY A;  4XS1 A;  1JLV A;  2PVO C;  3IHQ A;  2FUG 2;  2YJ7 A;  1TI3 A;  5HR3 A;  3APO A;  2JSZ A;  1ERW A;  1WJK A;  1I9D A;  2LRT A;  5AIV A;  3UJ1 A;  1ERU A;  3WGE A;  2LTK A;  5F0G A;  6GSS A;  3EUR A;  2X64 A;  1A2L A;  3LQ7 A;  2VL2 A;  5LCZ A;  5D9W A;  3F6D A;  2FD3 A;  1ZGN A;  1K3O A;  4WF4 A;  3KM6 A;  5EVO A;  1NW2 A;  1BAY A;  1UN2 A;  1K0C A;  5ECS A;  3A2X A;  3C1S A;  4OCE A;  2IIY A;  2RLI A;  2L57 A;  5AGY A;  2KP2 A;  1U88 A;  1WPI A;  6GSY A;  3CXG A;  2HXK A;  4K0N A;  2LKU A;  4PGT A;  3US3 A;  4OFM A;  2MMO A;  2LJA A;  3M3M A;  5JWO B;  4EDY A;  3OR5 A;  3DRN A;  4Q5N A;  2KHP A;  5BMU A;  1B8X A;  1K0B A;  3HVN A;  4IQ1 A;  2OBI A;  2OE3 A;  3VLN A;  5ECP B;  1ZYQ B;  3DIE A;  3ERW A;  3VI7 A;  3H79 A;  1XPV A;  1BJX A;  2PPT A;  3CRT A;  4J57 E;  4TKY A;  3CBU A;  3K8N A;  2HSY A;  3C8E A;  2CVK A;  2MMA A;  1KTE A;  4HQS A;  3ERG A;  3TOT A;  2HRA A;  3GKK A;  5HFI A;  1AQV A;  4F03 A;  2YV7 A;  3HVX A;  4JE1 A;  3UOM A;  1PGT A;  4L5O A;  3ZRD A;  5FWG A;  1JHB A;  5DDL A;  1B48 A;  4Z2U A;  1USB A;  1XOA A;  4ACS A;  1B4P A;  2TRX A;  2VLU A;  3W8J A;  2GQL A;  1GSU A;  3EU3 A;  4HSC X;  8GSS A;  4EE0 A;  2JU5 A;  1WRY A;  2R0G A;  1OAZ A;  5H5Q A;  4EKZ A;  1SJ6 A;  2FY6 A;  2IMD A;  1Z7P A;  2PU9 C;  4L5L A;  2WRT A;  1PL2 A;  1ZOF A;  4Z2R A;  2GQK A;  4YQM A;  5IO0 A;  5KN2 A;  2YV9 A;  4PXO A;  3UAP A;  1TI1 A;  5D9V A;  5EL8 A;  4WBJ A;  2ES7 A;  3KH7 A;  3IAS 2;  2DJK A;  1M3I A;  2VIM A;  3IRA A;  1SKS B;  1KBN A;  2R0P A;  2OBK A;  2RM5 A;  4YQV A;  1Z3E A;  2CX3 A;  1N8J A;  1T3B A;  1OKD A;  3TGZ A;  4NAX A;  4WEY A;  1EWX A;  3GYK A;  1HNC A;  2DJ1 A;  1XBS A;  2AV4 A;  4IN0 A;  1SJI A;  1VF4 A;  4ECI A;  1GNW A;  4ZB8 A;  3ZYW A;  1GL8 A;  4ECB A;  3EE2 A;  2GZY A;  1VF3 A;  3HZ8 A;  5ID2 A;  4EVM A;  2AJQ B;  3VWV A;  1F3B A;  4GF0 A;  4GLT A;  2CX4 A;  4N0Z A;  1YF0 A;  4L8E A;  1XZO A;  1M2B A;  4K0G A;  2GSQ A;  4KSO A;  4GSN A;  3ZRE A;  3ZVJ A;  2H72 A;  4XS4 B;  1XWG A;  3TUE A;  1J0F A;  3KD0 A;  2EIR A;  2X49 A;  4XS4 A;  1YQ1 A;  4KB3 A;  3P90 A;  4K7O A;  3E3E A;  1LJR A;  5ECH B;  9GSS A;  2M72 A;  3GL3 A;  4JBB A;  3BCK A;  4BVX B;  3DD3 A;  6GSU A;  5H5R A;  5E59 A;  1T4Y A;  2GQM A;  4BVX A;  1V98 A;  5DAL B;  3ME7 A;  1SYX A;  3QR6 A;  1HNA A;  4NV2 A;  1XOB A;  5DAL A;  2R5G A;  5CO3 A;  2I1U A;  3FKF A;  4ML1 A;  3GFK A;  2EIQ A;  1M9A A;  2LQO A;  3PPU A;  4F0B A;  1JZD A;  3P7X A;  4HZ4 A;  3QFA C;  2H76 A;  2O85 A;  1XWB A;  1DSB A;  3A2W A;  3Q18 A;  1PL1 A;  3MWH A;  2ON7 A;  1T4Z A;  4PQ1 A;  5CRE A;  1YKA A;  1TOF A;  3M9K A;  5J5N A;  4MH3 A;  4YQU A;  2YJH A;  1EV4 A;  3WD6 A;  4XRD A;  1IYH A;  4ZBA A;  3VK9 A;  4JED A;  4PTS A;  2HLS A;  2AUV A;  4MJE A;  5C00 A;  3VPQ A;  2AAW A;  1OC9 B;  1FVK A;  2YP6 A;  3GSS A;  3BD2 A;  3IK9 A;  5ECM B;  2GZP A;  4K8M A;  1SL1 B;  2C0D A;  3BJ5 A;  3M9J A;  5B6N A;  2PWJ A;  5HFK A;  1YJ6 A;  4MJC A;  3LFL A;  3FYG A;  3A5I A;  2X99 A;  3EPT A;  2E7P A;  4ZL9 A;  3RHB A;  3UVT A;  1MDK A;  2L4C A;  1QXH A;  4E8H A;  5ECI B; 
#chains in the Genus database with same CATH homology
 2K6V A;  1PMT A;  2FGX A;  3D21 A;  3O6T A;  3L9U A;  3ZIJ A;  4FYB A;  4KDU A;  3D0Z A;  1Z6M A;  3F0I A;  2J9H A;  5GAN D;  3HHV A;  5DJM A;  1Y6E A;  1GLQ A;  2XPE A;  2C80 A;  2H1B A;  4O5Q A;  1EOH A;  4CW9 A;  2GT6 A;  3UAR A;  3RDW A;  1WE0 A;  2XC2 A;  3UEM A;  2MMZ A;  2OE1 A;  1M99 A;  5A4V A;  3GTU B;  3KMN A;  1GUH A;  1I5G A;  3GTU A;  2GLR A;  4D73 B;  3C1R A;  1PA3 A;  2HSH A;  5AN1 A;  1FO5 A;  3IBH A;  4D73 A;  1EP8 A;  4RI7 A;  5GAP D;  3FW2 A;  2X8H A;  2JZR A;  3KP9 A;  1THO A;  1NHY A;  3ZMK A;  4MJA A;  1OE7 A;  1AW9 A;  4PNG A;  1RW1 A;  4OFN A;  5GSS A;  3KEB A;  3WGD A;  3HVS A;  2FWE A;  1GUM A;  2YWN A;  4OD7 A;  2REM A;  3VWU A;  2YN1 A;  1X9W B;  2JAC A;  2DJJ A;  1B4Q A;  2DIZ A;  4FQU A;  5ECQ B;  5CRW A;  3CYN A;  3M0F A;  2YPM A;  1XXU A;  2F51 A;  1PKW A;  1K3Y A;  1EP7 A;  4ICY A;  5KN1 A;  2YOI A;  3F4T A;  6GSW A;  2JZS A;  1JLW A;  4MCU A;  1A24 A;  3EU4 A;  1QGV A;  4G2E A;  4WKW A;  5CNW A;  4G0I A;  3KH9 A;  2VO4 A;  2OAC A;  2PUK C;  4TR4 A;  3TKS E;  1Z6N A;  2YAN A;  4GCI A;  1ZZY A;  3ME8 A;  2NVL A;  4PUA A;  2HI7 A;  5C04 A;  3H4K A;  2M80 A;  3NZN A;  12GS A;  4XHM A;  4WXT A;  4MZC A;  3F3Q A;  2GZZ A;  1Q4J A;  3U5R E;  1NSW A;  4K7N A;  2PN8 A;  2OJL A;  2V2G A;  1TDI A;  4K7I A;  3GX8 A;  3H8Q A;  5D8I A;  4HJ2 A;  1QMV A;  2H71 A;  1GSE A;  3RPP A;  2WGR A;  4HOJ A;  4XIH A;  1HQO A;  3QAW A;  2RM6 A;  3LOR A;  1ZYN A;  1AUC A;  1FOH A;  1RQM A;  1HYU A;  1V2A A;  2CVD A;  4TR1 A;  4AJ6 A;  3TDG A;  3C73 A;  3L4N A;  3KZQ A;  2LJR A;  1THX A;  2QSI A;  3GUR A;  1ABA A;  4BVY B;  1GH2 A;  3GH6 A;  2V32 A;  2IMK A;  4BVY A;  4O32 A;  2P5Q A;  5JCU A;  1CQG A;  4YAP A;  4K5S A;  1GWC A;  5IMF A;  4G0K A;  1TK5 B;  4MZW A;  2RUE A;  3DGQ A;  2P31 A;  4NHZ A;  2ZUP A;  4I6X A;  5G31 A;  5D93 A;  4HI7 A;  4GQF A;  2PVQ A;  5J4U A;  1EEM A;  2H73 A;  3FY7 A;  4NPB A;  4JR4 A;  5GZZ B;  4ZXG A;  2B1K A;  1SEN A;  5HFG A;  5ECR B;  5A4U A;  3LJR A;  5EPF A;  2N5B A;  5DJL A;  2CVB A;  4OFT A;  5F8B A;  2R4V A;  2YZH A;  3TJK A;  1M2A A;  4X43 A;  3GH9 A;  3TKP A;  3RBT A;  1O6J A;  2NDO A;  4JR6 A;  2QKE A;  3Q6O A;  1VF1 A;  4Q5F A;  1ACV A;  5G2Z A;  4EIP A;  3HJO A;  4N11 A;  3UL3 A;  1YEP A;  4HU7 A;  4EDZ A;  4JU5 A;  2D2Z A;  1R4W A;  1SJZ A;  4TN8 A;  4NWY A;  2H1G A;  4ID0 A;  1R26 A;  5B8B A;  5IO2 A;  3UBL A;  2IMF A;  2YWI A;  3L9S A;  2VCT A;  3M8N A;  4O7H A;  2H70 A;  1HNB A;  2ALB A;  2GST A;  1XW6 A;  1GTU A;  2VLT A;  4AJ8 A;  1R7H A;  3TKQ A;  4WBR D;  4POM A;  5DBQ A;  4IEL A;  1X5C A;  2F8A A;  2H66 A;  2X8C A;  3A5W A;  3FR3 A;  4K9Z A;  1K3L A;  5D9T A;  3DKS A;  1Y25 A;  2X4A A;  4Q5Q A;  4WET A;  3LYK A;  3U6V A;  4KX4 A;  2XBI A;  2IFQ B;  1C72 A;  1A0R P;  1PKZ A;  4ECC A;  1ST9 A;  4V1A p;  2NBS A;  3G7I A;  4EUY A;  3J7Y k;  4DVC A;  2WCI A;  3BOA A;  2WUL A;  2CT6 A;  3HJM A;  3R3E A;  3D5J A;  2K9F A;  3F4R A;  2H6Z A;  4RQX A;  3ZTL A;  4K2D A;  4A5P A;  3LG6 A;  3HZ4 A;  6GSX A;  2VM2 A;  2B5X A;  3F3R A;  3CMI A;  3GN3 A;  4OMV A;  3G7Y A;  2B7K A;  3RPN A;  4O5U A;  1BX9 A;  1OVN A;  3LXZ A;  5IMZ A;  3APQ A;  3WYW A;  2I81 A;  2R3X A;  4TRX A;  2LJK A;  4ULX A;  2H75 A;  3BBY A;  3EMX A;  1KEB A;  4CDO A;  4MZB A;  3F8U A;  4IVF A;  4I8B A;  3GST A;  2O8V B;  1XVQ A;  4LL1 B;  4DSQ A;  2VCQ A;  2KP1 A;  2O7K A;  4OO5 A;  3HKR A;  4TXO B;  1GTA A;  3UBK A;  1MD4 A;  1PX6 A;  2MYG A;  2HZE B;  2CZ2 A;  2H30 A;  1MDI A;  4JRR A;  3TCO A;  1QK8 A;  3FMW A;  4DSR A;  5CRH A;  4HEA 2;  1NHO A;  1FOV A;  3TJG A;  3HA9 A;  3R2Q A;  2OA7 A;  1E6B A;  1T1V A;  5IMA A;  3IDV A;  3KCM A;  5D9X A;  2WS2 A;  4DEJ A;  2F8F A;  5G30 A;  1OC3 A;  4OWY A;  4USS A;  4NV5 A;  3EWL A;  2LV3 A;  4HDE A;  1V58 A;  1GSF A;  2V6O A;  3KXO A;  4TR3 A;  1OC8 A;  1AAZ A;  2R2J A;  4IQA A;  3QCP A;  2WZ9 A;  2PBJ A;  4K1F A;  2YWM A;  1F2E A;  2LRC A;  5HR1 A;  4POL A;  3WT2 A;  3DWV A;  5DAK B;  4BWS A;  2HE3 A;  1WWJ A;  4ZL7 A;  1O7U A;  1A8L A;  1YDK A;  2Z9S A;  3IC4 A;  3GIX A;  5DAK A;  2RUF A;  5ENU A;  4LMV A;  1SKR B;  3DML A;  4MH2 A;  3TKS A;  1A2M A;  2JL4 A;  2GDR A;  1FB6 A;  2C3Q A;  1TW9 A;  2VL3 A;  5HR0 A;  1SKW B;  1H4O A;  4PUF C;  2FCH A;  4KCA A;  1TRW A;  4CY6 A;  1A23 A;  2HRN A;  2WFC A;  1JZR A;  3QDN A;  2AYT A;  4P3Y B;  4XS6 A;  2A4H A;  3DVW A;  4F82 A;  3ZZX A;  1OC9 A;  1ERV A;  3E9J B;  3H93 A;  2HSM A;  3L9V A;  3MYD A;  2YWO A;  1TRU A;  3L78 A;  5JWR B;  3LSZ A;  5CP1 A;  1VGL A;  3GX0 A;  1ZYP A;  4IHU A;  2MBS A;  3TB2 A;  5DQY A;  3GUS A;  4XCS A;  2DMM A;  4ZIJ A;  3A2V A;  2BJX A;  3F4S A;  2H0G A;  4N10 A;  4EL1 A;  1ILO A;  3W8S A;  3MSZ A;  3E0U A;  2R6K A;  3GKX A;  2QA2 A;  1M9B A;  3PR8 A;  5IQY A;  1TK8 B;  3HYP A;  3FK8 A;  2VCW A;  3CSJ A;  3NIV A;  2L5O A;  1G7O A;  3WGX A;  2DJ2 A;  2I4A A;  2LNT A;  1IYI A;  2P0G A;  5IPG A;  1PRX A;  5KOW A;  4ECJ A;  5D73 A;  5KN0 A;  2LST A;  4F2I A;  2HYX A;  1TJD A;  18GS A;  1XWK A;  1G6W A;  1U6T A;  2R37 A;  3MIX A;  2YNX A;  4AF2 A;  3TJF A;  1RK4 A;  1WIK A;  1MDJ A;  3C7M A;  1FB0 A;  4FH8 A;  2XPD A;  1UVZ A;  1GNE A;  3H1N A;  3I9V 2;  2DJ0 A;  3VUR A;  4TW5 A;  5KEJ A;  1Z5Y E;  1OE8 A;  2C3T A;  3LGC A;  1T8E B;  1HD2 A;  2I3Y A;  5ELA A;  5F05 A;  2DML A;  1MD3 A;  6GSV A;  1A8Y A;  2K18 A;  3FZ5 A;  3IE3 A;  2DJ3 A;  1AQX A;  3NOF A;  5IOX A;  2FWH A;  4MLY A;  14GS A;  2HT9 A;  4HJM A;  2X8G A;  3DXB A;  4X4J A;  4IJ3 A;  2VL2 C;  2CZ3 A;  19GS A;  4WF5 A;  3CSH A;  4IBP A;  3HY2 A;  3I69 A;  4OCF A;  4KAE A;  3QFB C;  1Q98 A;  2LRN A;  3D4T A;  2MZC A;  3F9U A;  2LNS A;  1ZL9 A;  3IPZ A;  2O87 A;  3I6A A;  3QAG A;  4NMU A;  11GS A;  1YF1 A;  1TK0 B;  4KDY A;  1GSS A;  1U3I A;  4HU9 A;  1GSD A;  2VD1 A;  4I2U A;  3TKR A;  2H74 A;  3KGK A;  1YY7 A;  2IN3 A;  1WP0 A;  4I5Q A;  1SL2 B;  4LLR A;  4KUN A;  5GST A;  4ZB6 A;  5IPH A;  5DCH A;  3P2A A;  4KDX A;  1F3A A;  3W6G A;  2PMT A;  1R5A A;  3GHA A;  3F6F A;  3ZFL A;  4MF5 A;  4BWQ A;  4BL7 B;  3IC8 A;  2PGT A;  4O92 A;  1MTC A;  1TU7 A;  4G19 A;  1BYE A;  5F06 A;  1K0N A;  2B5E A;  4BL7 A;  2OE0 A;  3IOS A;  5LNK e;  4LL4 B;  2H19 A;  4ZBD A;  4L0W A;  4MNN A;  3HCZ A;  2K8S A;  1A0F A;  4KE3 A;  3S9F A;  1ZYE A;  5F07 A;  4X0X A;  2TRC P;  1URM A;  5CRG A;  3J7Y b;  4ILF A;  3GKM A;  2IMI A;  1PN9 A;  2QGV A;  1JZW A;  22GS A;  3FRC A;  1AIU A;  2C8U A;  3UVH A;  4GST A;  4FIW A;  5ECK B;  2VCV A;  2VL9 A;  2F3M A;  4BA7 A;  1F9M A;  2KLX A;  3HXS A;  3MAK A;  2M46 A;  2R0C A;  1TP9 A;  2MMN A;  2VLV A;  3DYR A;  2RII A;  2CQ9 A;  5J9B A;  3FEU A;  4MA9 A;  3ZLP A;  5CAX A;  1M0U A;  4F9Z A;  1BQ7 A;  3LW9 A;  1GRX A;  1F6M C;  5J3R A;  5DCG A;  5IIZ A;  4ISD A;  1QUW A;  1G0T A;  1X0R A;  5B8A A;  2FWG A;  2C1Y A;  3KTB A;  3L0H A;  2QA1 A;  5ECN B;  3EMP A;  2PER A;  4V1A g;  1UC7 A;  3VFI A;  3CSI A;  1EV9 A;  2L6C A;  2B6M A;  2A2S A;  1GP1 A;  2YCD A;  4TVE A;  5COH A;  2EC4 A;  2CAQ A;  3D4M A;  4ZB9 A;  6GST A;  2AB6 A;  3KTL A;  1XIY A;  3FR6 A;  3VI5 A;  2FLS A;  4K5R A;  2WJU A;  2CV4 A;  4Z2T A;  1O8X A;  1G6Y A;  2C0G A;  4NHW A;  7GSS A;  5JCG A;  1EGO A;  1VRS D;  3APS A;  1X5E A;  4TOP A;  1B9Y C;  2JSY A;  1ZCP A;  1S3C A;  2I9H A;  2CAI A;  1YEX A;  1V40 A;  2MBT A;  2KUC A;  1Z9H A;  2CA8 A;  5HQP A;  2IME A;  2FA8 A;  4FYU A;  13GS A;  2H0I A;  1WMJ A;  1O81 A;  2G2Q A;  20GS A;  1QQ2 A;  2VCX A;  3RHC A;  3V1W A;  4BPY A;  1O85 A;  1M2D A;  3KIJ A;  3FZA A;  3HJP A;  1O8W A;  2OKA A;  1AXD A;  1FVJ A;  3CRU A;  2J23 A;  2OAD A;  1DBY A;  2A2R A;  3ED3 A;  1ML6 A;  3EIN A;  3N5O A;  2VUP A;  2VM1 A;  4XTS A;  2B1L A;  4PQH A;  3HD5 A;  4RQR A;  2B5Y A;  1W89 A;  2IJY A;  5IMV A;  4DSS B;  2DSA A;  3TJB A;  1DUG A;  4IW9 A;  4DSS A;  3GRX A;  2L6D A;  3EVI A;  1V57 A;  2VAF A;  2WB9 A;  4N30 A;  2GVP A;  3IK7 A;  5FT3 A;  2QC7 A;  3GV1 A;  5CRD A;  3UMA A;  3QD9 A;  3DVX A;  2IFQ A;  2LUS A;  4KGI A;  5KOX A;  2P5R A;  4EO3 A;  1GTI A;  2LS5 A;  5DQS A;  2IPA A;  2NTO A;  3TKS C;  3SBC A;  3WT1 A;  2DBC A;  4CHS A;  1W4V A;  3A3T A;  5H5S A;  4E8E A;  2YZU A;  3PIN A;  1Z7R A;  3KP8 A;  2H8L A;  4WR4 A;  4G0L A;  1K0M A;  2ZNM A;  3GMF A;  4H86 A;  3ZL5 A;  2E2M A;  3UIW A;  5KN3 A;  4KW6 A;  1SK1 A;  1ON4 A;  1EZK A;  3G9B A;  1YKC A;  1ERT A;  2JAD A;  2E0Q A;  4GQC A;  2V1M A;  4V2L A;  2N5A A;  1R5P A;  4MF7 A;  3QPM A;  5D96 A;  4GRF A;  2F9S A;  4MP4 A;  2VCZ A;  5IM9 A;  3ZFB A;  5AIS A;  4EXJ A;  3QOU A;  3SWL A;  4EC0 A;  2FHE A;  2GT5 A;  1NM3 A;  4YKF A;  2GSS A;  1FAA A;  4MAB A;  4TXO A;  2B7J A;  2B3S A;  1XCC A;  2H1A A;  3TRQ A;  1SD8 A;  2HZE A;  4KND A;  2C4J A;  1TTZ A;  5G1L A;  5ID2 B;  2E2G A;  3MDK A;  3IAM 2;  2GTU A;  5JCW A;  4HZ2 A;  1F37 A;  5A5K A;  1TKD B;  5B7C A;  5ELG A;  2G0F A;  1FHE A;  4IGJ A;  1BED A;  1S3A A;  1T00 A;  4FYC A;  4MDC A;  1EOG A;  4NXI A;  2H1D A;  4IKH A;  4FO5 A;  2DLX A;  3F63 A;  3O3T A;  3FHK A;  4YAV A;  3EYT A;  3LEF A;  4IJI A;  4AJ7 A;  3MNG A;  2V6K A;  5HR2 A;  2DKH A;  3D22 A;  2N5F A;  2BMX A;  2LEG A;  2GGT A;  3PGT A;  3IV4 A;  4IP1 A;  1LU4 A;  4QL9 A;  4WR5 A;  4RUV A;  3PH9 A;  1FW1 A;  1DE1 A;  1XWC A;  2FWF A;  2H0H A;  2KOK A;  3JCM L;  3IHG A;  2V41 A;  4IS0 A;  4CY8 A;  16GS A;  4MF6 A;  3BCI A;  3ISO A;  1U3A A;  2JZT A;  4PQI A;  4KSM A;  2HRK A;  1PX7 A;  5AIX A;  4IP6 A;  5ECO B;  3N9J A;  1J9B A;  1XW5 A;  4KH7 A;  4PUR A;  3Q19 A;  2H01 A;  4ML6 A;  3TRX A;  4MK3 A;  4EF0 A;  1OKT A;  2C0F A;  3VPT A;  4ZL8 A;  1QFN A;  1XW9 A;  2UZ8 A;  3FR9 A;  3LYP A;  5IMD A;  5L71 A;  1JZO A;  4KCE A;  2GSR A;  1UA5 A;  4MMM A;  1MEK A;  1O73 A;  3KJY A;  2HNL A;  5BRT A;  4F0C A;  4O5R A;  2L5L A;  1SK2 A;  2VD0 A;  3RAZ A;  4GXZ A;  4MJB A;  3FZ9 A;  4GWR A;  1TRS A;  4POB A;  3LWA A;  2LQQ A;  2BTO T;  3LXT A;  2L4Q A;  3TOU A;  3G7J A;  2NPB A;  1GTB A;  3M1G A;  2AHE A;  1PSQ A;  3CTF A;  3IR4 A;  4POK A;  5A4W A;  1AQW A;  4XRA A;  1H75 A;  1GSQ A;  1GSY A;  4PNF A;  1CQH A;  5IMC A;  1SK0 A;  3CTG A;  4YH2 A;  2ZCT A;  3TJJ A;  4J2F A;  2DKI A;  1N2A A;  1ZMA A;  4KA0 A;  1KNG A;  1TRV A;  4I2T A;  4EIQ A;  3EC3 A;  1BG5 A;  1FG4 A;  4LMW A;  1G7E A;  5G1K A;  2C0E A;  3ERF A;  1TXX A;  2EIO A;  4N0V A;  1WOU A;  1TU8 A;  2HZF A;  2L59 A;  3ZIV A;  1YZX A;  10GS A;  2H6X A;  1K0D A;  5FHI A;  3C71 A;  5JWQ B;  4Z7X A;  4Q5R A;  1AC1 A;  3AY8 A;  3KMO A;  2H6Y A;  3ZML A;  4GTU A;  2IL3 A;  4ZBB A;  1JFU A;  4ZIL A;  5G5E A;  2TIR A;  3GA4 A;  1M7T A;  4I97 A;  1PD2 1;  1B9X C;  1X9M B;  1K0O A;  1DE2 A;  1SU9 A;  3D6I A;  4J56 E;  5DVB A;  1XVW A;  2XHF A;  5LD0 A;  1GUK A;  1V9W A;  3VWW A;  5J9C A;  3GL5 A;  3VWX A;  4KF9 A;  3Q74 A;  3P8W A;  1X5D A;  3I43 A;  5INY A;  1OYJ A;  3FZ4 A;  1K0A A;  3IA1 A;  2FNO A;  17GS A;  4MPF A;  4QL7 A;  4HS1 A;  4AGS A;  4L0U A;  1SL0 B;  4X1U A;  3HVV A;  4PX1 A;  4LA1 A;  1SYR A;  4G9H A;  1SD9 A;  4K2X A;  1J08 A;  4MPG A;  4V2N A;  5IOW A;  4HQZ A;  1X9S B;  1T7P B;  3DEX A;  4K6X A;  2HRF A;  1PQN A;  2GS3 A;  5CYY A;  2ON5 A;  1E2Y A;  5EY6 A;  4JZQ A;  1PN0 A;  4TR0 A;  4HUA A;  2C3N A;  3ZIT A;  2O89 A;  1GUL A;  4RI6 A;  2DC5 A;  1U87 A;  3IXR A;  5J41 A;  2IWT A;  1S3D A;  2A4V A;  1XFL A;  3QMX A;  3ZVJ D;  3QAV A;  4G10 A;  4YKG A;  1VF2 A;  4GSS A;  2K8V A;  1LBK A;  5ABR A;  3HDC A;  3O76 A;  5G5F A;  3GKN A;  4V2M A;  5E4W A;  5B6M A;  4OO4 A;  4TXV A;  3TRP A;  1A2J A;  4TR1 B;  1EGR A;  2A2P A;  2XBQ A;  4QQ7 A;  5ECL B;  1XWA A;  1GLP A;  2WDU A;  2HFD A;  2FA4 A;  1EEJ A;  2VOC A;  3GNJ A;  2DIY A;  4XS1 A;  1JLV A;  2PVO C;  3IHQ A;  2FUG 2;  2YJ7 A;  1TI3 A;  5HR3 A;  3APO A;  2JSZ A;  1ERW A;  1WJK A;  1I9D A;  2LRT A;  5AIV A;  3UJ1 A;  1ERU A;  3WGE A;  2LTK A;  5F0G A;  6GSS A;  3EUR A;  2X64 A;  1A2L A;  3LQ7 A;  2VL2 A;  5LCZ A;  5D9W A;  3F6D A;  2FD3 A;  1ZGN A;  1K3O A;  4WF4 A;  3KM6 A;  5EVO A;  1NW2 A;  1BAY A;  1UN2 A;  1K0C A;  5ECS A;  3A2X A;  3C1S A;  4OCE A;  2IIY A;  2RLI A;  2L57 A;  5AGY A;  2KP2 A;  1U88 A;  1WPI A;  6GSY A;  3CXG A;  2HXK A;  4K0N A;  2LKU A;  4PGT A;  3US3 A;  4OFM A;  2MMO A;  2LJA A;  3M3M A;  5JWO B;  4EDY A;  3OR5 A;  3DRN A;  4Q5N A;  2KHP A;  5BMU A;  1B8X A;  1K0B A;  4IQ1 A;  2OBI A;  2OE3 A;  3VLN A;  5ECP B;  1ZYQ B;  3DIE A;  3ERW A;  3VI7 A;  3H79 A;  1XPV A;  1BJX A;  2PPT A;  3CRT A;  4J57 E;  4TKY A;  3CBU A;  3K8N A;  2HSY A;  3C8E A;  2CVK A;  2MMA A;  1KTE A;  4HQS A;  3ERG A;  3TOT A;  2HRA A;  3GKK A;  5HFI A;  1AQV A;  4F03 A;  2YV7 A;  3HVX A;  4JE1 A;  3UOM A;  1PGT A;  4L5O A;  3ZRD A;  5FWG A;  1JHB A;  5DDL A;  1B48 A;  4Z2U A;  1USB A;  1XOA A;  4ACS A;  1B4P A;  2TRX A;  2VLU A;  3W8J A;  2GQL A;  1GSU A;  3EU3 A;  8GSS A;  4EE0 A;  2JU5 A;  1WRY A;  2R0G A;  1OAZ A;  5H5Q A;  4EKZ A;  1SJ6 A;  2FY6 A;  2IMD A;  1Z7P A;  2PU9 C;  4L5L A;  2WRT A;  1PL2 A;  1ZOF A;  4Z2R A;  2GQK A;  4YQM A;  5IO0 A;  5KN2 A;  2YV9 A;  4PXO A;  3UAP A;  1TI1 A;  5D9V A;  5EL8 A;  4WBJ A;  2ES7 A;  3KH7 A;  3IAS 2;  2DJK A;  2VIM A;  3IRA A;  1SKS B;  1KBN A;  2R0P A;  2OBK A;  2RM5 A;  4YQV A;  1Z3E A;  2CX3 A;  1N8J A;  1T3B A;  1OKD A;  3TGZ A;  4NAX A;  4WEY A;  1EWX A;  3GYK A;  1HNC A;  2DJ1 A;  1XBS A;  2AV4 A;  4IN0 A;  1SJI A;  1VF4 A;  4ECI A;  1GNW A;  4ZB8 A;  3ZYW A;  1GL8 A;  4ECB A;  3EE2 A;  2GZY A;  1VF3 A;  3HZ8 A;  5ID2 A;  4EVM A;  2AJQ B;  3VWV A;  1F3B A;  4GF0 A;  4GLT A;  2CX4 A;  4N0Z A;  1YF0 A;  4L8E A;  1XZO A;  1M2B A;  4K0G A;  2GSQ A;  4KSO A;  4GSN A;  3ZRE A;  3ZVJ A;  2H72 A;  4XS4 B;  1XWG A;  3TUE A;  1J0F A;  3KD0 A;  2EIR A;  2X49 A;  4XS4 A;  1YQ1 A;  4KB3 A;  3P90 A;  4K7O A;  3E3E A;  1LJR A;  5ECH B;  9GSS A;  2M72 A;  3GL3 A;  4JBB A;  3BCK A;  4BVX B;  3DD3 A;  6GSU A;  5H5R A;  5E59 A;  1T4Y A;  2GQM A;  4BVX A;  1V98 A;  5DAL B;  3ME7 A;  1SYX A;  3QR6 A;  1HNA A;  4NV2 A;  1XOB A;  5DAL A;  2R5G A;  5CO3 A;  2I1U A;  3FKF A;  4ML1 A;  3GFK A;  2EIQ A;  1M9A A;  2LQO A;  3PPU A;  4F0B A;  1JZD A;  3P7X A;  4HZ4 A;  3QFA C;  2H76 A;  2O85 A;  1XWB A;  1DSB A;  3A2W A;  3Q18 A;  1PL1 A;  3MWH A;  2ON7 A;  1T4Z A;  4PQ1 A;  5CRE A;  1YKA A;  1TOF A;  3M9K A;  5J5N A;  4MH3 A;  4YQU A;  2YJH A;  1EV4 A;  3WD6 A;  4XRD A;  1IYH A;  4ZBA A;  3VK9 A;  4JED A;  4PTS A;  2HLS A;  2AUV A;  4MJE A;  5C00 A;  3VPQ A;  2AAW A;  1OC9 B;  1FVK A;  2YP6 A;  3GSS A;  3BD2 A;  3IK9 A;  5ECM B;  2GZP A;  4K8M A;  1SL1 B;  2C0D A;  3BJ5 A;  3M9J A;  5B6N A;  2PWJ A;  5HFK A;  1YJ6 A;  4MJC A;  3LFL A;  3FYG A;  3A5I A;  2X99 A;  3EPT A;  2E7P A;  4ZL9 A;  3RHB A;  3UVT A;  1MDK A;  2L4C A;  1QXH A;  4E8H A;  5ECI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...