3QFAC

Crystal structure of the human thioredoxin reductase-thioredoxin complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
SVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1, cytoplasmic
publication title Crystal structure of the human thioredoxin reductase-thioredoxin complex
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qfaC00
2GLRA 1GNWA 3LYPA 3F4SA 5ID2A 2PPTA 2CAIA 1W4VA 4Z7XA 1V40A 3C1SA 4K0NA 2I9HA 2L5LA 5ECLB 5GAND 1M9AA 2L4CA 5E4WA 4K6XA 2CX4A 3GX0A 5JWOB 2VL2A 4KSMA 3F3RA 2GT5A 3BJ5A 2O85A 1XVQA 4GQCA 3ZVJD 4IELA 3CSIA 1GSYA 2YWOA 5H5RA 2FWFA 3A5WA 3US3A 1DE2A 1GSQA 1BQ7A 1QXHA 2CVBA 4MCUA 4GCIA 3WGXA 1ZCPA 3QFBC 5EY6A 3ZYWA 3D0ZA 1USBA 4ZB6A 3F0IA 5J9BA 5IMVA 1E2YA 1CQGA 1GNEA 4MPGA 3PR8A 3HYPA 2AB6A 4K7IA 3LEFA 4LA1A 3BCIA 1Z6MA 3D22A 2GZYA 1G7EA 4LL1B 4NPBA 4MK3A 8GSSA 4G10A 5HR0A 1HNAA 2E7PA 4POBA 4XHMA 5CP1A 2F3MA 1R7HA 4KGIA 2N5BA 1DUGA 1TK0B 2BTOT 3H4KA 3M9KA 3DEXA 4OWYA 3FR3A 4HEA2 4ISDA 4MH3A 2FA8A 5IMZA 5A4WA 1EP7A 1UN2A 5KN1A 3FRCA 2GVPA 5HR1A 2I1UA 1QK8A 1YEXA 4ECBA 3ED3A 1WOUA 3E9JB 1X5DA 3CSHA 1NW2A 2LRTA 3HJOA 5DAKA 3GKMA 4K9ZA 5D73A 3IK9A 5F8BA 3HKRA 1Z7PA 3LORA 4L0WA 3QAGA 4IW9A 4FO5A 1PN9A 4ZB9A 1K0DA 1SKSB 2C80A 1K0BA 2OACA 2VLUA 4ULXA 2DC5A 3I6AA 2X64A 3Q19A 4EE0A 3EU4A 5DAKB 1GUHA 3FZ4A 1AW9A 1GLPA 3IRAA 4IGJA 2OBKA 2B3SA 4MABA 5J9CA 1GH2A 2HYXA 5CRDA 3GNJA 2NBSA 3P90A 3GYKA 2OE3A 1XW6A 2H19A 2H01A 2LRCA 3M0FA 4Q5FA 3CTGA 1XWGA 5DDLA 4O5RA 2TRXA 5ECPB 4NV5A 4HQZA 2V6KA 1TXXA 1TRUA 3VURA 5JCWA 4JE1A 2H66A 1K0MA 2H1AA 5L71A 1M0UA 4MF6A 1XW9A 2IPAA 2LJKA 5GSTA 1IYHA 3CXGA 4KDYA 4ECIA 4FYCA 1UA5A 6GSUA 1YKCA 5HFKA 3GHAA 1A8LA 4V2MA 1OKDA 3DWVA 3FHKA 5A4VA 2H30A 2PERA 3FZ9A 1M99A 2YV9A 2XPDA 4MJEA 5DJLA 2F51A 3QCPA 1SK2A 4TN8A 5CREA 4CHSA 3NIVA 2VUPA 4N30A 4TXOA 1FOVA 1WE0A 2VIMA 5J5NA 3TKSA 4POLA 4MZWA 3FW2A 3GRXA 2PU9C 3QD9A 1PMTA 4L8EA 2YOIA 4EVMA 3FR9A 1T1VA 1WWJA 3R2QA 5JWQB 1ZGNA 3E0UA 2GSTA 4KUNA 2IMEA 1TK5B 2RM6A 2GQKA 4YH2A 2NTOA 4IJIA 1AAZA 2C0FA 4JU5A 4OO4A 4ZB8A 3KGKA 2FA4A 1FVJA 2TIRA 4EF0A 1T8EB 4QL7A 4JEDA 3P7XA 3SWLA 4ZILA 3OR5A 1YF1A 4XTSA 2B7JA 3DVXA 2OJLA 5A4UA 3Q18A 1ERTA 4L5OA 4HS1A 2XBQA 3F63A 1XW5A 3FR6A 1K0NA 2A2RA 4RQXA 3I69A 3NOFA 2AJQB 5ECNB 3HHVA 1JZOA 4AJ8A 3CRTA 3F3QA 1GSDA 4D73A 1PD21 3UMAA 4GSNA 1J0FA 2JACA 5J4UA 2ALBA 3D5JA 3FZAA 4WBJA 3BOAA 2XC2A 3TKSC 5A5KA 2YCDA 9GSSA 3D6IA 5HR2A 4ECJA 4ACSA 1MEKA 22GSA 5F06A 4MF7A 2P5QA 5IIZA 3EWLA 5AIVA 3TOTA 3TCOA 1O73A 5D96A 5COHA 2IMDA 1O7UA 4O7HA 1K3YA 3VLNA 2B5XA 1V2AA 4KCAA 2JSYA 2HZEA 3TUEA 4X43A 3G7YA 4HJMA 4AGSA 5ECOB 1XOAA 4I2UA 1Q4JA 3M9JA 3WYWA 3ZLPA 2I3YA 1SU9A 2FHEA 1GWCA 2ON5A 2V6OA 3LGCA 4GSSA 2GQLA 1K0AA 3GKKA 2HSYA 1AQWA 4TXVA 1XBSA 1X9SB 5ECHB 3ZIJA 4IS0A 1OE7A 3QAVA 2V41A 2DJJA 2R5GA 1UC7A 3BCKA 1M9BA 1PX7A 4TOPA 2A4VA 3ZL5A 3FY7A 1ERWA 1N8JA 1FO5A 3ZIVA 1O85A 2C0GA 1GTIA 2E2GA 3V1WA 2I4AA 5HQPA 4I2TA 5LCZA 2X8CA 1PL1A 1TTZA 1SK1A 3MSZA 6GSSA 2ES7A 1O8XA 2K9FA 4KAEA 2B1KA 4E8HA 3EU3A 2HLSA 2GDRA 4MJBA 3KMOA 3O3TA 3F4TA 2O8VB 2HRNA 1GUKA 1TK8B 3FYGA 3IDVA 4BWSA 1SD8A 1I5GA 3WGEA 2GGTA 6GSYA 2K18A 3UBLA 2XHFA 1THXA 3GFKA 3N9JA 2NDOA 1U87A 1Z6NA 3RHBA 2FWGA 5KEJA 1GSFA 2VO4A 1SJZA 4WF4A 3TJBA 4BL7A 2L5OA 3TKRA 2GZZA 1YKAA 4ZL8A 3DVWA 5H5QA 4EKZA 4PUAA 4PQHA 4AF2A 4GSTA 1F9MA 1T00A 3ZITA 4P3YB 2LUSA 4BA7A 1AIUA 2REMA 3VI7A 1S3DA 2LV3A 3VWVA 3DYRA 4X0XA 1QFNA 3RPPA 4O92A 4JR4A 4IBPA 5DQSA 5B7CA 4BVYA 1F3AA 4XCSA 4IN0A 1G6WA 2O7KA 5LD0A 1AQXA 2FGXA 4K1FA 1XWKA 2PMTA 3ERFA 2EIQA 1WJKA 5IO0A 4XS4A 4ZL7A 1NM3A 4KB3A 1TRSA 1TI3A 2HZFA 1VRSD 5HR3A 3TRXA 4MZBA 3U5RE 4EXJA 4EC0A 4WBRD 3UL3A 4JZQA 4HZ2A 1AC1A 4G9HA 1Y6EA 2VOCA 3HZ8A 5G5EA 2X8GA 1Z9HA 3EC3A 3C71A 5ELAA 4K7NA 2B7KA 1QGVA 4MZCA 2OBIA 4YAVA 5ID2B 4XRDA 1A0FA 1FHEA 2YWIA 1EZKA 3GTUA 3A2WA 2YWMA 2YWNA 5C04A 2O87A 2N5AA 1ZYEA 2GT6A 5HFGA 4ZBDA 4H86A 3ME8A 2GSQA 3PH9A 1PKWA 3KTBA 2DJ2A 4GF0A 2KUCA 3MNGA 2JZTA 5D8IA 3APSA 2XPEA 4FYBA 4V2NA 5F07A 3BBYA 1TKDB 1XZOA 3GTUB 1ERUA 4PUFC 2JU5A 4GXZA 3HJMA 2J9HA 1J08A 2G0FA 2LNSA 2A2SA 2LTKA 4LL4B 1FG4A 4RI7A 2QC7A 4KE3A 3DMLA 5DVBA 3G7JA 4TKYA 4POMA 3F6DA 3CRUA 3K8NA 2FD3A 4F82A 3ZVJA 2VD1A 1TP9A 5AISA 2H73A 2C1YA 4GRFA 4I97A 2M46A 3GSSA 1GSEA 2X99A 1U3AA 2BJXA 3GSTA 2KLXA 3H8QA 1X5EA 4MA9A 4FH8A 2YV7A 3EVIA 1A2MA 4OCEA 3UBKA 3KP8A 5F05A 19GSA 4KCEA 4IJ3A 1DE1A 4TR4A 5FWGA 1XXUA 3F9UA 2VCQA 1SENA 2ON7A 2VM1A 2H1DA 1B4QA 4RQRA 3KXOA 2MMNA 5G1LA 2IMIA 3KEBA 4ID0A 4BWQA 1H4OA 1M2AA 3M8NA 5J41A 5FHIA 1ILOA 1B48A 2H75A 4MJAA 2P31A 2V32A 4K0GA 3HVSA 3Q6OA 4WETA 3W8JA 2CVDA 4HQSA 1R26A 5D9VA 1LU4A 3TB2A 1GSUA 1GL8A 4Q5QA 5JWRB 4F2IA 3KH9A 4QQ7A 3LSZA 2HNLA 2LKUA 4NMUA 5GSSA 1BJXA 5ABRA 1SKRB 1A2JA 2P0GA 4IQ1A 4E8EA 3MWHA 5KN0A 4TR3A 3IPZA 4F9ZA 1XOBA 2HFDA 3UVTA 1GUMA 3W6GA 2FWHA 1W89A 3UEMA 4I6XA 5CO3A 4TR0A 3L9SA 4NV2A 2PGTA 4OFTA 2E0QA 4CDOA 2IJYA 2OE1A 2VL9A 1RW1A 4NHZA 2YJHA 4XS1A 3TDGA 6GSTA 1R4WA 1TI1A 3EINA 2K8SA 4N0VA 2MZCA 1EEJA 1Z3EA 5B6MA 1AQVA 3QR6A 2RUEA 2OE0A 1A0RP 2IMFA 3SBCA 3EYTA 3LWAA 2DBCA 3TOUA 4J56E 2C3QA 2GS3A 3HXSA 1KEBA 4EUYA 3H1NA 2P5RA 5F0GA 3M1GA 2AAWA 3ZREA 3GMFA 1BYEA 4MMMA 2LEGA 1SK0A 4TXOB 4HI7A 2R3XA 4K8MA 3F6FA 1TRVA 1WP0A 5C00A 1GSSA 2NPBA 2DJKA 1LBKA 1ABAA 3ERGA 3C8EA 2IIYA 2PVOC 4V2LA 2BMXA 1O81A 1HNCA 4YQUA 1GLQA 3O76A 2GSSA 4KDXA 4MJCA 1SKWB 3VWUA 1ZOFA 2DJ1A 3U6VA 3ZTLA 2C0EA 2R2JA 3M3MA 2VLTA 1F2EA 5E59A 1JZDA 2L6DA 1OE8A 4PQIA 4ML1A 4MH2A 1EGRA 5G1KA 1XCCA 1MTCA 2IWTA 1JZWA 3ZFBA 4XS6A 1SYRA 2H8LA 1MDIA 2VCVA 4ZBAA 1R5AA 4L0UA 3IR4A 4G2EA 1EGOA 3UAPA 2H70A 5CRHA 3DGQA 1T4YA 3TRPA 6GSXA 1V98A 4D73B 3HA9A 3KP9A 2GZPA 1HYUA 3GIXA 4L5LA 2L57A 4N11A 1QUWA 4V1Ap 4PX1A 3S9FA 4IHUA 3VWWA 2B1LA 3VPTA 4G19A 1X5CA 3DRNA 3IE3A 3TJJA 3Q74A 1QQ2A 3HVXA 1FB0A 1EOGA 3KIJA 1VF4A 5IOXA 3GUSA 2HZEB 1NSWA 1A8YA 3HJPA 2H76A 4HZ4A 5G30A 1CQHA 1Z5YE 3PGTA 1B9YC 1B4PA 3FEUA 3H79A 3RBTA 5ELGA 2RUFA 1Z7RA 4DSSA 1WIKA 4TR1A 3C73A 4V1Ag 3IV4A 3TRQA 3ZFLA 1S3AA 4IKHA 2YANA 5GZZB 3D4TA 3F8UA 2IN3A 3G7IA 2D2ZA 2IFQA 3TKPA 10GSA 1K0OA 2WFCA 1DBYA 3L4NA 4OD7A 1ZZYA 3APQA 2DLXA 5AGYA 2H74A 4AJ7A 1JZRA 3DD3A 3EMPA 5B8BA 1GTAA 1O6JA 4KX4A 2DSAA 2HT9A 2MYGA 3ISOA 5CYYA 3D4MA 3DXBA 6GSWA 5DCHA 2VCTA 4JBBA 2H1GA 4QL9A 1R5PA 2M72A 13GSA 4OFNA 3UJ1A 3GKNA 1JHBA 4Q5NA 4WR4A 3P8WA 3NZNA 3RPNA 1TRWA 3KTLA 1F37A 4PQ1A 3RAZA 2G2QA 4ML6A 2AHEA 1KNGA 5G31A 1GP1A 2N5FA 3JCML 4TW5A 5HFIA 1K3LA 2DIZA 2B5YA 1DSBA 2L6CA 3HDCA 6GSVA 4YAPA 2WZ9A 4PNFA 1V9WA 4WF5A 1B9XC 3P2AA 3KH7A 4AJ6A 2AYTA 2DMMA 4FIWA 2LRNA 1T4ZA 3ZZXA 3QDNA 2WCIA 2XBIA 1OC9A 2CVKA 1TW9A 2VLVA 1TU7A 2NVLA 1ST9A 2JL4A 2GTUA 2V2GA 4MP4A 3TKQA 1NHOA 1T3BA 3VWXA 1G6YA 3LG6A 5KN3A 3EE2A 3EMXA 1M2BA 3GH9A 1S3CA 5ENUA 1Q98A 2R4VA 3A3TA 1XWCA 1VGLA 1M7TA 1SL1B 1MD3A 1YF0A 3C7MA 5G2ZA 3W8SA 1SJ6A 3FZ5A 12GSA 2H72A 1OC9B 4GLTA 3CTFA 2YNXA 2HRFA 3VK9A 2EC4A 5AN1A 2FLSA 2HXKA 4ZBBA 1GULA 3HVVA 4F03A 4MPFA 7GSSA 2FY6A 5FT3A 1C72A 5IMCA 4EO3A 4XS4B 3QFAC 1UVZA 5IM9A 3J7Yb 2MMOA 2VCXA 3GURA 1VF2A 4F0CA 3ZRDA 4F0BA 1XPVA 1TDIA 3WGDA 4ZXGA 3VFIA 4J2FA 4POKA 2DJ0A 3I9V2 20GSA 4ECCA 4TVEA 3G9BA 3N5OA 3ZMLA 3FKFA 5IMAA 1BG5A 2H6XA 3UOMA 3L9UA 1I9DA 4TRXA 1K0CA 3DKSA 4OMVA 1Y25A 3HCZA 1OC8A 18GSA 3CMIA 4KNDA 2K8VA 2YN1A 2V1MA 1XWBA 2EIOA 2LQQA 1BX9A 2H1BA 1EV4A 1JLWA 4BVXA 1RQMA 1KBNA 3A2VA 2PN8A 5EL8A 1U6TA 2JZRA 2MMAA 2LS5A 4RUVA 2J23A 1YQ1A 4PNGA 3FK8A 1XVWA 2KP2A 4DSQA 2VL2C 3IAS2 3MDKA 2WJUA 2F8AA 4O32A 2ZNMA 3RDWA 4MLYA 2CA8A 11GSA 5LNKe 2AUVA 1YEPA 1AUCA 3QOUA 2HSHA 2PVQA 2C3TA 2GSRA 3IOSA 4HOJA 2CX3A 2JZSA 3IBHA 5J3RA 5IPGA 2PWJA 1FW1A 2LJAA 5KN2A 2YP6A 4HU9A 1XFLA 2F9SA 2ZCTA 3E3EA 4LMVA 4NAXA 5DBQA 2VAFA 5D93A 2VM2A 1GTUA 3BD2A 4OO5A 4XIHA 5ECKB 3WT1A 1XIYA 1WRYA 1ML6A 4HDEA 5AIXA 2B5EA 1VF3A 5D9XA 4PURA 1K3OA 1FAAA 5G5FA 3CBUA 2YPMA 3L9VA 2CZ3A 5DQYA 5CRWA 2HI7A 1A23A 3VI5A 2DMLA 4BPYA 3KMNA 2L4QA 14GSA 3TJKA 3QAWA 5EVOA 4KDUA 4MF5A 3RHCA 3GV1A 4HU7A 5CRGA 5IQYA 1F3BA 3GH6A 4KH7A 3LFLA 1SD9A 3ERWA 5IMFA 4WKWA 2I81A 5DCGA 2LSTA 3KD0A 1YJ6A 5IO2A 2TRCP 2FWEA 3I43A 1WMJA 2VCWA 5CNWA 1YY7A 2RM5A 1XWAA 3LQ7A 4EL1A 2CT6A 2E2MA 3O6TA 4GQFA 1PL2A 2GQMA 2C0DA 3WT2A 3F4RA 1A24A 1V57A 3MAKA 2OA7A 3UIWA 2R6KA 4I5QA 1U3IA 1VF1A 4EDZA 4KW6A 3L78A 2C3NA 5CAXA 3GA4A 2VL3A 1X0RA 1H75A 1OVNA 3AY8A 3TJGA 2H6YA 1ON4A 1EEMA 1ZYQB 1JFUA 3LXZA 2OKAA 3HD5A 1E6BA 2OADA 1URMA 1HD2A 1AXDA 3A2XA 2H0GA 4FYUA 1MD4A 2C4JA 2CAQA 2DJ3A 4JRRA 3GX8A 1THOA 2JSZA 1SL0B 2H0IA 1SYXA 4ZIJA 4I8BA 5IMDA 3GKXA 1JLVA 5JCGA 1U88A 3ME7A 4WR5A 3VPQA 2CQ9A 3TJFA 4DVCA 2QSIA 4K2DA 1KTEA 1MDKA 1ZL9A 3HY2A 1QMVA 2KHPA 4DEJA 2IL3A 1ZMAA 1G0TA 4RI6A 4WEYA 1B8XA 1HQOA 2RLIA 2H71A 2WB9A 3GN3A 5D9WA 4XRAA 1G7OA 1EOHA 1PA3A 1OC3A 2CZ2A 4X1UA 4IQAA 3IC4A 2YZHA 1BEDA 4N0ZA 3TGZA 2R37A 5ECMB 2HE3A 3D21A 3CSJA 4OCFA 2WRTA 2K6VA 3IK7A 3ZMKA 2O89A 1SJIA 3KM6A 1TJDA 2VCZA 3J7Yk 1FVKA 3LYKA 2H0HA 5EPFA 3PINA 2PBJA 3IA1A 3IXRA 2YZUA 4NHWA 2QKEA 2KP1A 1OKTA 2JADA 1WPIA 4YQVA 2LNTA 2Z9SA 3GL3A 3C1RA 1X9WB 1LJRA 3GL5A 17GSA 1YDKA 3IHQA 2MMZA 5IPHA 1PGTA 2WDUA 4ZL9A 1YZXA 4KSOA 4IVFA 1GTBA 3APOA 1F6MC 4DSRA 3UVHA 4LMWA 4MDCA 1HNBA 2PUKC 4CW9A 1PKZA 1EV9A 3WD6A 2MBSA 5B8AA 5DALA 3KZQA 4JR6A 4HUAA 4IP6A 2C8UA 4N10A 3H93A 1BAYA 2FCHA 3EURA 2RIIA 1SL2B 2H6ZA 1ERVA 4DSSB 4TR1B 2KOKA 1FB6A 5ECRB 4PGTA 4IP1A 2IFQB 5DALB 5ECSA 3QMXA 4J57E 5B6NA 1RK4A 2CV4A 5ECIB 4OFMA 2IMKA 4GTUA 4NWYA 3CYNA 2X8HA 3KJYA 2MBTA 2QGVA 2DIYA 1MDJA 1M2DA 3KCMA 3TKSE 1V58A 1N2AA 5JCUA 3QPMA 4NXIA 4HJ2A 1ACVA 4KA0A 4EDYA 5IOWA 3LXTA 1OYJA 2LJRA 2AV4A 5ECQB 1OAZA 2WS2A 2LQOA 3DIEA 1T7PB 5D9TA 4K7OA 5GAPD 2L59A 1TOFA 3LJRA 5H5SA 3HZ4A 2EIRA 1O8WA 2ZUPA 4Q5RA 4ILFA 1EP8A 4PXOA 5DJMA 1TU8A 1NHYA 4LLRA 1GRXA 4WXTA 2B6MA 16GSA 3UARA 2WULA 5INYA 1EWXA 2YJ7A 3L0HA 2FUG2 4GWRA 4YQMA 1PX6A 3IAM2 1A2LA 1J9BA 2FNOA 2WGRA 1X9MB 2VD0A 1IYIA 1PSQA 1PRXA 2F8FA 1PQNA 2M80A
chains in the Genus database with same CATH superfamily
2GLRA 1GNWA 3LYPA 3F4SA 5ID2A 2PPTA 2CAIA 1W4VA 4Z7XA 1V40A 3C1SA 4K0NA 2I9HA 2L5LA 5ECLB 5GAND 1M9AA 2L4CA 5E4WA 4K6XA 2CX4A 3GX0A 5JWOB 4G0IA 2VL2A 4KSMA 3F3RA 2GT5A 3BJ5A 2O85A 1XVQA 4GQCA 1M3IA 3ZVJD 4IELA 3CSIA 1GSYA 2YWOA 5H5RA 2FWFA 3A5WA 3US3A 1DE2A 1GSQA 1BQ7A 1QXHA 2CVBA 4MCUA 4GCIA 3WGXA 1ZCPA 3QFBC 5EY6A 3ZYWA 3D0ZA 1USBA 4ZB6A 3F0IA 5J9BA 5IMVA 1E2YA 1CQGA 1GNEA 4MPGA 3PR8A 3HYPA 2AB6A 4K7IA 3LEFA 4LA1A 3BCIA 1Z6MA 3D22A 2GZYA 1G7EA 4LL1B 4NPBA 4MK3A 8GSSA 4G10A 5HR0A 1HNAA 2E7PA 4POBA 4XHMA 5CP1A 2F3MA 1R7HA 4KGIA 2N5BA 1DUGA 1TK0B 2BTOT 3H4KA 3M9KA 3DEXA 4OWYA 3FR3A 4HEA2 4BVXB 4ISDA 4MH3A 2FA8A 5IMZA 5A4WA 1EP7A 1UN2A 5KN1A 3FRCA 2GVPA 5HR1A 2I1UA 1QK8A 1YEXA 4ECBA 3ED3A 1WOUA 3E9JB 1X5DA 3CSHA 1NW2A 2LRTA 3HJOA 5DAKA 3GKMA 4K9ZA 5D73A 3IK9A 5F8BA 3HKRA 1Z7PA 3LORA 4L0WA 3QAGA 4IW9A 4FO5A 1PN9A 4ZB9A 1K0DA 1SKSB 2C80A 1K0BA 2OACA 2VLUA 4ULXA 2DC5A 3I6AA 2X64A 3Q19A 4O5UA 4EE0A 3EU4A 5DAKB 1GUHA 3FZ4A 1AW9A 1GLPA 3IRAA 4IGJA 2OBKA 2B3SA 4MABA 5J9CA 1GH2A 2HYXA 5CRDA 3GNJA 2NBSA 3P90A 3GYKA 2OE3A 1XW6A 2H19A 2H01A 2LRCA 3M0FA 4Q5FA 3CTGA 1XWGA 3MIXA 5DDLA 4O5RA 2TRXA 5ECPB 4NV5A 4HQZA 2V6KA 1TXXA 1TRUA 3VURA 5JCWA 4JE1A 2H66A 1K0MA 2H1AA 5L71A 1M0UA 4MF6A 1XW9A 2IPAA 2LJKA 5GSTA 1IYHA 3CXGA 4KDYA 4ECIA 4FYCA 1UA5A 6GSUA 1YKCA 5HFKA 3GHAA 1A8LA 4V2MA 1OKDA 3DWVA 3FHKA 5A4VA 2H30A 2PERA 3FZ9A 1M99A 2YV9A 2XPDA 4MJEA 5DJLA 2F51A 3QCPA 1SK2A 4TN8A 5CREA 4CHSA 3NIVA 2VUPA 4N30A 4TXOA 1FOVA 1WE0A 2VIMA 5J5NA 3A5IA 3TKSA 4O5QA 4POLA 4MZWA 3CQFA 3FW2A 3GRXA 2PU9C 3QD9A 1PMTA 4L8EA 2YOIA 4EVMA 3FR9A 1T1VA 1WWJA 3R2QA 5JWQB 1ZGNA 3E0UA 2GSTA 4KUNA 2IMEA 1TK5B 2RM6A 2GQKA 4YH2A 2NTOA 4IJIA 1AAZA 2C0FA 4JU5A 4OO4A 4ZB8A 3KGKA 2FA4A 1FVJA 2TIRA 4EF0A 1T8EB 4QL7A 4JEDA 3P7XA 3SWLA 4ZILA 3OR5A 1YF1A 4XTSA 2B7JA 3DVXA 2OJLA 5A4UA 3Q18A 1ERTA 4L5OA 4HS1A 2XBQA 3F63A 1XW5A 3FR6A 1K0NA 2A2RA 4RQXA 3I69A 3NOFA 2AJQB 5ECNB 3HHVA 1JZOA 4AJ8A 3CRTA 3F3QA 1GSDA 4D73A 1PD21 3UMAA 4GSNA 1J0FA 2JACA 5J4UA 2ALBA 3D5JA 3FZAA 4WBJA 3BOAA 5BMUA 2XC2A 3TKSC 5A5KA 2YCDA 9GSSA 3D6IA 5HR2A 4ECJA 4ACSA 1MEKA 22GSA 5F06A 4MF7A 2P5QA 5IIZA 3EWLA 5AIVA 3TOTA 3TCOA 1O73A 5D96A 5COHA 2IMDA 1O7UA 4O7HA 2X4AA 1K3YA 3VLNA 2B5XA 1V2AA 4KCAA 2JSYA 2HZEA 3TUEA 4X43A 3G7YA 4HJMA 4AGSA 5ECOB 1XOAA 4I2UA 1Q4JA 3M9JA 3WYWA 3ZLPA 2I3YA 1SU9A 2FHEA 1GWCA 2ON5A 2V6OA 3LGCA 4GSSA 2GQLA 1K0AA 3GKKA 2HSYA 1AQWA 4TXVA 1XBSA 1X9SB 5ECHB 3ZIJA 4IS0A 1OE7A 3QAVA 2V41A 2DJJA 1S3RA 2R5GA 1UC7A 3BCKA 1M9BA 1PX7A 4TOPA 2A4VA 3ZL5A 3FY7A 1ERWA 1N8JA 1FO5A 3ZIVA 1O85A 2C0GA 1GTIA 2E2GA 3V1WA 2I4AA 2R0GA 5HQPA 4I2TA 5LCZA 2X8CA 1PL1A 1TTZA 1SK1A 3MSZA 6GSSA 4MNNA 2ES7A 1O8XA 2K9FA 4KAEA 2B1KA 4E8HA 3EU3A 2HLSA 2GDRA 4MJBA 3KMOA 3O3TA 3F4TA 2O8VB 2HRNA 1GUKA 1TK8B 3FYGA 3IDVA 3IHGA 4BWSA 1SD8A 1I5GA 3WGEA 2GGTA 6GSYA 2K18A 3UBLA 2XHFA 1THXA 3GFKA 3N9JA 2NDOA 1U87A 1Z6NA 3RHBA 2FWGA 5KEJA 1GSFA 2VO4A 1PN0A 1SJZA 4WF4A 3TJBA 4BL7A 2L5OA 3TKRA 2GZZA 1YKAA 4ZL8A 3DVWA 5H5QA 3R3EA 4EKZA 4PUAA 4PQHA 4AF2A 4GSTA 1F9MA 1T00A 3ZITA 4P3YB 2LUSA 4BA7A 1AIUA 2REMA 3VI7A 1S3DA 2LV3A 3VWVA 3DYRA 4X0XA 1QFNA 3RPPA 4O92A 4JR4A 4IBPA 5DQSA 5B7CA 4BVYA 1F3AA 4XCSA 4IN0A 1G6WA 2O7KA 5LD0A 4CY8A 1AQXA 2FGXA 4K1FA 1XWKA 2PMTA 3ERFA 2EIQA 1WJKA 5IO0A 4XS4A 4ZL7A 1NM3A 4KB3A 1TRSA 1TI3A 2HZFA 1VRSD 4BVYB 5HR3A 3TRXA 4MZBA 3U5RE 4EXJA 4EC0A 4WBRD 3UL3A 4JZQA 4HZ2A 1AC1A 4G9HA 1Y6EA 2VOCA 3HZ8A 5G5EA 2X8GA 1Z9HA 3EC3A 4HSCX 3C71A 5ELAA 2HSMA 4K7NA 2B7KA 1QGVA 4MZCA 2OBIA 4YAVA 5ID2B 4XRDA 1A0FA 1FHEA 2YWIA 1EZKA 3GTUA 3A2WA 2YWMA 2YWNA 5C04A 2O87A 2N5AA 1ZYEA 2GT6A 5HFGA 4ZBDA 4H86A 3ME8A 2GSQA 3PH9A 3IC8A 1PKWA 3KTBA 2DJ2A 4GF0A 2KUCA 3MNGA 2JZTA 5D8IA 3APSA 2XPEA 4FYBA 4V2NA 5F07A 2A4HA 3BBYA 1TKDB 1XZOA 3GTUB 1ERUA 4PUFC 2JU5A 1PFOA 4GXZA 3HJMA 2J9HA 4Z2TA 1J08A 2G0FA 2LNSA 2A2SA 2LTKA 4LL4B 1FG4A 4RI7A 2QC7A 4KE3A 3DMLA 5DVBA 3G7JA 4TKYA 4POMA 3F6DA 3CRUA 3K8NA 2FD3A 4F82A 3ZVJA 2VD1A 1TP9A 5AISA 2H73A 2C1YA 4GRFA 4I97A 2M46A 3GSSA 1GSEA 2X99A 1U3AA 2BJXA 3GSTA 2KLXA 3H8QA 1X5EA 4MA9A 4FH8A 2YV7A 3EVIA 1A2MA 4OCEA 3UBKA 3KP8A 5F05A 4ICYA 19GSA 4KCEA 4IJ3A 1DE1A 4TR4A 5FWGA 1XXUA 3F9UA 2VCQA 1SENA 2ON7A 2VM1A 2H1DA 1B4QA 4RQRA 2QA1A 3KXOA 2MMNA 5G1LA 2IMIA 3KEBA 4ID0A 4BWQA 1H4OA 1M2AA 3M8NA 5J41A 5FHIA 1ILOA 1B48A 2H75A 3EPTA 4MJAA 2P31A 2V32A 4K0GA 3HVSA 3Q6OA 4WETA 3W8JA 2CVDA 4HQSA 1R26A 5D9VA 1LU4A 3TB2A 1GSUA 1GL8A 4Q5QA 3HVNA 5JWRB 4F2IA 3KH9A 4QQ7A 4USSA 3LSZA 2HNLA 2LKUA 4NMUA 5GSSA 1BJXA 5ABRA 1SKRB 1A2JA 2P0GA 4IQ1A 4E8EA 3MWHA 5KN0A 4TR3A 3IPZA 4F9ZA 1XOBA 2HFDA 3UVTA 3LW9A 1GUMA 3W6GA 2FWHA 1W89A 3UEMA 4I6XA 5CO3A 4TR0A 3L9SA 4NV2A 2PGTA 4OFTA 2E0QA 4CDOA 2IJYA 2OE1A 2VL9A 5KOWA 1RW1A 4NHZA 2YJHA 4XS1A 3TDGA 6GSTA 1R4WA 1TI1A 3EINA 2K8SA 4N0VA 2MZCA 1EEJA 1Z3EA 2QA2A 5B6MA 1AQVA 3QR6A 2RUEA 2OE0A 1A0RP 2IMFA 3SBCA 3EYTA 3LWAA 2DBCA 3TOUA 4J56E 2C3QA 5BRTA 2GS3A 3HXSA 1KEBA 4EUYA 3H1NA 2P5RA 5F0GA 3M1GA 2AAWA 3ZREA 3GMFA 1BYEA 4MMMA 2LEGA 1SK0A 4TXOB 4HI7A 2R3XA 4K8MA 3F6FA 1TRVA 1WP0A 5C00A 1GSSA 2NPBA 2DJKA 1LBKA 1ABAA 3ERGA 3C8EA 2IIYA 2PVOC 4V2LA 2BMXA 1O81A 1HNCA 4YQUA 1GLQA 1XG8A 3O76A 2GSSA 4KDXA 4MJCA 1SKWB 3VWUA 1ZOFA 2DJ1A 3U6VA 4A5PA 3ZTLA 2C0EA 2R2JA 3M3MA 2VLTA 1F2EA 5E59A 1JZDA 2L6DA 1OE8A 4PQIA 4ML1A 4MH2A 1EGRA 5G1KA 1XCCA 2DKIA 1MTCA 2IWTA 2R0PA 1JZWA 3ZFBA 4XS6A 1SYRA 2H8LA 1MDIA 2VCVA 4ZBAA 1R5AA 4L0UA 3IR4A 4G2EA 1EGOA 3UAPA 2H70A 5CRHA 4Z2RA 3DGQA 1T4YA 3TRPA 6GSXA 1V98A 4D73B 3HA9A 3KP9A 2GZPA 1HYUA 3GIXA 4L5LA 2L57A 4N11A 1QUWA 4V1Ap 4PX1A 3S9FA 4IHUA 3VWWA 2B1LA 3VPTA 4G19A 1X5CA 3DRNA 3IE3A 4G0LA 3TJJA 3Q74A 1QQ2A 4Z2UA 3HVXA 1FB0A 1EOGA 3KIJA 1VF4A 5IOXA 3GUSA 2HZEB 1NSWA 1A8YA 3HJPA 2H76A 2A2PA 4HZ4A 5G30A 1CQHA 1Z5YE 3PGTA 4PTSA 1B9YC 1B4PA 3FEUA 3H79A 3RBTA 5ELGA 2HRAA 2RUFA 1Z7RA 4DSSA 1WIKA 4TR1A 3C73A 4V1Ag 3IV4A 3TRQA 3ZFLA 1S3AA 4IKHA 2YANA 5GZZB 3D4TA 3F8UA 2IN3A 3G7IA 2D2ZA 2IFQA 3TKPA 10GSA 1K0OA 2WFCA 1DBYA 3L4NA 4OD7A 1ZZYA 3APQA 2DLXA 5AGYA 2H74A 4AJ7A 1JZRA 3DD3A 3EMPA 5B8BA 1GTAA 1O6JA 1ZYNA 2DSAA 4KX4A 2HT9A 2MYGA 3ISOA 5CYYA 3D4MA 3DXBA 6GSWA 5DCHA 2VCTA 4JBBA 2H1GA 4QL9A 1R5PA 2M72A 13GSA 4OFNA 3UJ1A 3GKNA 1JHBA 4Q5NA 4WR4A 3P8WA 3NZNA 3RPNA 1TRWA 3KTLA 1F37A 4PQ1A 3RAZA 2G2QA 4ML6A 1ZYPA 2AHEA 1KNGA 5G31A 1GP1A 2N5FA 3JCML 4TW5A 4X4JA 5HFIA 1K3LA 2DIZA 2B5YA 1DSBA 2L6CA 3HDCA 6GSVA 4YAPA 2WZ9A 4PNFA 1V9WA 4WF5A 1B9XC 3P2AA 3KH7A 4AJ6A 2AYTA 2DMMA 4FIWA 2LRNA 1T4ZA 3ZZXA 3QDNA 2WCIA 2XBIA 4BL7B 1OC9A 2CVKA 1TW9A 2VLVA 1TU7A 2NVLA 1ST9A 2JL4A 2GTUA 2V2GA 2R0CA 4MP4A 3TKQA 1NHOA 1T3BA 3VWXA 1G6YA 3LG6A 5KN3A 3EE2A 3EMXA 1M2BA 3GH9A 1S3CA 5ENUA 1Q98A 2R4VA 3A3TA 1XWCA 1VGLA 1M7TA 1SL1B 1MD3A 1YF0A 3C7MA 5G2ZA 3W8SA 1SJ6A 3FZ5A 12GSA 2H72A 4BIKA 1OC9B 4GLTA 3CTFA 2YNXA 2HRFA 3VK9A 2EC4A 5AN1A 2FLSA 2HXKA 4ZBBA 1GULA 3HVVA 4F03A 4MPFA 7GSSA 2FY6A 5FT3A 1C72A 5IMCA 4EO3A 4XS4B 3QFAC 1UVZA 5IM9A 3J7Yb 2MMOA 2VCXA 3GURA 1VF2A 4F0CA 3ZRDA 4F0BA 1XPVA 1TDIA 3WGDA 4ZXGA 3VFIA 3MYDA 4J2FA 4POKA 2DJ0A 3I9V2 20GSA 4ECCA 4TVEA 3G9BA 3N5OA 1FOHA 3ZMLA 3FKFA 5IMAA 1BG5A 2H6XA 3UOMA 3L9UA 1I9DA 4TRXA 1K0CA 3DKSA 4OMVA 1Y25A 3HCZA 1OC8A 18GSA 3CMIA 4KNDA 2K8VA 2YN1A 2V1MA 1XWBA 2EIOA 2LQQA 1BX9A 2H1BA 1EV4A 1JLWA 4BVXA 1RQMA 1KBNA 3A2VA 2PN8A 5EL8A 1U6TA 2JZRA 2MMAA 2LS5A 4RUVA 2J23A 4YKFA 1YQ1A 4PNGA 3FK8A 1XVWA 2KP2A 4DSQA 2VL2C 3IAS2 3MDKA 2WJUA 2F8AA 4O32A 2ZNMA 3RDWA 4MLYA 2CA8A 11GSA 5LNKe 2AUVA 1YEPA 1AUCA 3QOUA 2HSHA 2PVQA 2C3TA 2GSRA 3IOSA 4HOJA 2CX3A 2JZSA 3IBHA 5J3RA 5IPGA 2PWJA 1FW1A 2LJAA 5KN2A 2YP6A 4HU9A 1XFLA 2F9SA 4G0KA 2ZCTA 3E3EA 4LMVA 4NAXA 5DBQA 2VAFA 5D93A 2VM2A 1GTUA 3BD2A 4OO5A 4XIHA 5ECKB 3WT1A 1XIYA 4KF9A 1WRYA 1ML6A 4HDEA 5AIXA 2B5EA 1VF3A 5D9XA 4PURA 1K3OA 1FAAA 5G5FA 3CBUA 2YPMA 3L9VA 2CZ3A 5DQYA 5CRWA 2HI7A 1A23A 3VI5A 2DMLA 4BPYA 3KMNA 2L4QA 14GSA 3TJKA 3QAWA 5EVOA 4KDUA 4MF5A 3RHCA 3GV1A 4HU7A 5CRGA 5IQYA 1F3BA 3GH6A 4KH7A 3LFLA 1SD9A 3ERWA 5IMFA 4WKWA 2I81A 5DCGA 2LSTA 3KD0A 1YJ6A 5IO2A 2TRCP 2FWEA 3I43A 1WMJA 2VCWA 5CNWA 5KOXA 1YY7A 2RM5A 1XWAA 3LQ7A 4EL1A 2CT6A 2E2MA 3O6TA 4K2XA 4GQFA 1PL2A 2GQMA 2C0DA 3WT2A 3F4RA 1A24A 1V57A 3MAKA 2OA7A 3UIWA 2R6KA 4I5QA 1U3IA 4K5RA 1VF1A 4EDZA 4KW6A 3L78A 2C3NA 5CAXA 3GA4A 2VL3A 1X0RA 1H75A 1OVNA 3AY8A 3TJGA 2H6YA 1ON4A 1EEMA 1ZYQB 1JFUA 3LXZA 2OKAA 3HD5A 1E6BA 2OADA 1URMA 1HD2A 1AXDA 4CY6A 3A2XA 2H0GA 4FYUA 1MD4A 2C4JA 2CAQA 2DJ3A 4JRRA 2UZ8A 3GX8A 1THOA 2JSZA 1SL0B 2H0IA 1SYXA 4ZIJA 4I8BA 5IMDA 3GKXA 1JLVA 5JCGA 1U88A 3ME7A 4WR5A 3VPQA 2CQ9A 3TJFA 4DVCA 4YKGA 2QSIA 4K2DA 1KTEA 1MDKA 1ZL9A 3HY2A 1QMVA 2KHPA 4DEJA 2IL3A 1ZMAA 1G0TA 4RI6A 4WEYA 1B8XA 1HQOA 2RLIA 2H71A 2WB9A 3GN3A 5D9WA 4XRAA 1G7OA 1EOHA 1PA3A 1OC3A 2CZ2A 4X1UA 4IQAA 3IC4A 2YZHA 1BEDA 4N0ZA 3TGZA 2R37A 2HE3A 3D21A 5ECMB 3CSJA 2X49A 3PPUA 4OCFA 2WRTA 2K6VA 3IK7A 3ZMKA 2O89A 1SJIA 3KM6A 1TJDA 2VCZA 3J7Yk 1FVKA 3LYKA 2H0HA 5EPFA 3PINA 2PBJA 3IA1A 3IXRA 2YZUA 4NHWA 2QKEA 2KP1A 1OKTA 2JADA 1WPIA 4YQVA 2LNTA 2Z9SA 3GL3A 3C1RA 1X9WB 1LJRA 3GL5A 17GSA 1YDKA 3IHQA 2MMZA 5IPHA 1PGTA 2HRKA 2WDUA 4ZL9A 1YZXA 4KSOA 3FMWA 4IVFA 1GTBA 3APOA 1F6MC 4DSRA 3UVHA 4LMWA 4MDCA 1HNBA 2PUKC 4CW9A 1PKZA 1EV9A 3WD6A 2MBSA 5B8AA 5DALA 3KZQA 4JR6A 4HUAA 4IP6A 2C8UA 4N10A 3H93A 1BAYA 2FCHA 3EURA 2RIIA 1SL2B 2H6ZA 1ERVA 4DSSB 4TR1B 4EIQA 2KOKA 1FB6A 5ECRB 4PGTA 4IP1A 2IFQB 5DALB 5ECSA 3QMXA 4J57E 5B6NA 1RK4A 2CV4A 5ECIB 4OFMA 2IMKA 4GTUA 4NWYA 4EIPA 3CYNA 2X8HA 3KJYA 2MBTA 4K5SA 2QGVA 2DIYA 4FQUA 1MDJA 1M2DA 3KCMA 3TKSE 1V58A 1N2AA 5JCUA 3QPMA 4NXIA 4HJ2A 1ACVA 4KA0A 4EDYA 5IOWA 3LXTA 1OYJA 2LJRA 2AV4A 5ECQB 1OAZA 2WS2A 2LQOA 3DIEA 2DKHA 1T7PB 5D9TA 4K7OA 5GAPD 2L59A 1TOFA 3LJRA 5H5SA 3HZ4A 2EIRA 1O8WA 2ZUPA 4Q5RA 4ILFA 1EP8A 4PXOA 5DJMA 1TU8A 1NHYA 4LLRA 1GRXA 4WXTA 2B6MA 16GSA 1M3JA 3UARA 2WULA 5INYA 1EWXA 2YJ7A 3L0HA 2FUG2 4GWRA 4YQMA 1PX6A 3IAM2 1A2LA 1J9BA 2FNOA 2WGRA 1X9MB 2VD0A 1IYIA 1PSQA 1PRXA 2F8FA 1PQNA 2M80A
chains in the Genus database with same CATH topology
2GLRA 1GNWA 3LYPA 3F4SA 5ID2A 2PPTA 2CAIA 1W4VA 4Z7XA 1V40A 3C1SA 4K0NA 2I9HA 2L5LA 5ECLB 5GAND 1M9AA 2L4CA 5E4WA 4K6XA 2CX4A 3GX0A 5JWOB 4G0IA 2VL2A 4KSMA 3F3RA 2GT5A 3BJ5A 2O85A 1XVQA 4GQCA 3ZVJD 4IELA 3CSIA 1GSYA 2YWOA 5H5RA 2FWFA 3A5WA 3US3A 1DE2A 1GSQA 1BQ7A 1QXHA 2CVBA 4MCUA 4GCIA 3WGXA 1ZCPA 3QFBC 5EY6A 3ZYWA 3D0ZA 1USBA 4ZB6A 3F0IA 5J9BA 5IMVA 1E2YA 1CQGA 1GNEA 4MPGA 3PR8A 3HYPA 2AB6A 4K7IA 3LEFA 4LA1A 3BCIA 1Z6MA 3D22A 2GZYA 1G7EA 4LL1B 4NPBA 4MK3A 8GSSA 4G10A 5HR0A 1HNAA 2E7PA 4POBA 4XHMA 5CP1A 2F3MA 1R7HA 4KGIA 2N5BA 1DUGA 1TK0B 2BTOT 3H4KA 3M9KA 3DEXA 4OWYA 3FR3A 4HEA2 4BVXB 4ISDA 4MH3A 2FA8A 5IMZA 5A4WA 1EP7A 1UN2A 5KN1A 3FRCA 2GVPA 5HR1A 2I1UA 1QK8A 1YEXA 4ECBA 3ED3A 1WOUA 3E9JB 1X5DA 3CSHA 1NW2A 2LRTA 3HJOA 5DAKA 3GKMA 4K9ZA 5D73A 3IK9A 5F8BA 3HKRA 1Z7PA 3LORA 4L0WA 3QAGA 4IW9A 4FO5A 1PN9A 4ZB9A 1K0DA 1SKSB 2C80A 1K0BA 2OACA 2VLUA 4ULXA 2DC5A 3I6AA 2X64A 3Q19A 4O5UA 4EE0A 3EU4A 5DAKB 1GUHA 3FZ4A 1AW9A 1GLPA 3IRAA 4IGJA 2OBKA 2B3SA 4MABA 5J9CA 1GH2A 2HYXA 5CRDA 3GNJA 2NBSA 3P90A 3GYKA 2OE3A 1XW6A 2H19A 2H01A 2LRCA 3M0FA 4Q5FA 3CTGA 1XWGA 3MIXA 5DDLA 4O5RA 2TRXA 5ECPB 4NV5A 4HQZA 2V6KA 1TXXA 1TRUA 3VURA 5JCWA 4JE1A 2H66A 1K0MA 2H1AA 5L71A 1M0UA 4MF6A 1XW9A 2IPAA 2LJKA 5GSTA 1IYHA 3CXGA 4KDYA 4ECIA 4FYCA 1UA5A 6GSUA 1YKCA 5HFKA 3GHAA 1A8LA 4V2MA 1OKDA 3DWVA 3FHKA 5A4VA 2H30A 2PERA 3FZ9A 1M99A 2YV9A 2XPDA 4MJEA 5DJLA 2F51A 3QCPA 1SK2A 4TN8A 5CREA 4CHSA 3NIVA 2VUPA 4N30A 4TXOA 1FOVA 1WE0A 2VIMA 5J5NA 3A5IA 3TKSA 4O5QA 4POLA 4MZWA 3FW2A 3GRXA 2PU9C 3QD9A 1PMTA 4L8EA 2YOIA 4EVMA 3FR9A 1T1VA 1WWJA 3R2QA 5JWQB 1ZGNA 3E0UA 2GSTA 4KUNA 2IMEA 1TK5B 2RM6A 2GQKA 4YH2A 2NTOA 4IJIA 1AAZA 2C0FA 4JU5A 4OO4A 4ZB8A 3KGKA 2FA4A 1FVJA 2TIRA 4EF0A 1T8EB 4QL7A 4JEDA 3P7XA 3SWLA 4ZILA 3OR5A 1YF1A 4XTSA 2B7JA 3DVXA 2OJLA 5A4UA 3Q18A 1ERTA 4L5OA 4HS1A 2XBQA 3F63A 1XW5A 3FR6A 1K0NA 2A2RA 4RQXA 3I69A 3NOFA 2AJQB 5ECNB 3HHVA 1JZOA 4AJ8A 3CRTA 3F3QA 1GSDA 4D73A 1PD21 3UMAA 4GSNA 1J0FA 2JACA 5J4UA 2ALBA 3D5JA 3FZAA 4WBJA 3BOAA 5BMUA 2XC2A 3TKSC 5A5KA 2YCDA 9GSSA 3D6IA 5HR2A 4ECJA 4ACSA 1MEKA 22GSA 5F06A 4MF7A 2P5QA 5IIZA 3EWLA 5AIVA 3TOTA 3TCOA 1O73A 5D96A 5COHA 2IMDA 1O7UA 4O7HA 2X4AA 1K3YA 3VLNA 2B5XA 1V2AA 4KCAA 2JSYA 2HZEA 3TUEA 4X43A 3G7YA 4HJMA 4AGSA 5ECOB 1XOAA 4I2UA 1Q4JA 3M9JA 3WYWA 3ZLPA 2I3YA 1SU9A 2FHEA 1GWCA 2ON5A 2V6OA 3LGCA 4GSSA 2GQLA 1K0AA 3GKKA 2HSYA 1AQWA 4TXVA 1XBSA 1X9SB 5ECHB 3ZIJA 4IS0A 1OE7A 3QAVA 2V41A 2DJJA 2R5GA 1UC7A 3BCKA 1M9BA 1PX7A 4TOPA 2A4VA 3ZL5A 3FY7A 1ERWA 1N8JA 1FO5A 3ZIVA 1O85A 2C0GA 1GTIA 2E2GA 3V1WA 2I4AA 2R0GA 5HQPA 4I2TA 5LCZA 2X8CA 1PL1A 1TTZA 1SK1A 3MSZA 6GSSA 4MNNA 2ES7A 1O8XA 2K9FA 4KAEA 2B1KA 4E8HA 3EU3A 2HLSA 2GDRA 4MJBA 3KMOA 3O3TA 3F4TA 2O8VB 2HRNA 1GUKA 1TK8B 3FYGA 3IDVA 3IHGA 4BWSA 1SD8A 1I5GA 3WGEA 2GGTA 6GSYA 2K18A 3UBLA 2XHFA 1THXA 3GFKA 3N9JA 2NDOA 1U87A 1Z6NA 3RHBA 2FWGA 5KEJA 1GSFA 2VO4A 1PN0A 1SJZA 4WF4A 3TJBA 4BL7A 2L5OA 3TKRA 2GZZA 1YKAA 4ZL8A 3DVWA 5H5QA 3R3EA 4EKZA 4PUAA 4PQHA 4AF2A 4GSTA 1F9MA 1T00A 3ZITA 4P3YB 2LUSA 4BA7A 1AIUA 2REMA 3VI7A 1S3DA 2LV3A 3VWVA 3DYRA 4X0XA 1QFNA 3RPPA 4O92A 4JR4A 4IBPA 5DQSA 5B7CA 4BVYA 1F3AA 4XCSA 4IN0A 1G6WA 2O7KA 5LD0A 4CY8A 1AQXA 2FGXA 4K1FA 1XWKA 2PMTA 3ERFA 2EIQA 1WJKA 5IO0A 4XS4A 4ZL7A 1NM3A 4KB3A 1TRSA 1TI3A 2HZFA 1VRSD 4BVYB 5HR3A 3TRXA 4MZBA 3U5RE 4EXJA 4EC0A 4WBRD 3UL3A 4JZQA 4HZ2A 1AC1A 4G9HA 1Y6EA 2VOCA 3HZ8A 5G5EA 2X8GA 1Z9HA 3EC3A 3C71A 5ELAA 2HSMA 4K7NA 2B7KA 1QGVA 4MZCA 2OBIA 4YAVA 5ID2B 4XRDA 1A0FA 1FHEA 2YWIA 1EZKA 3GTUA 3A2WA 2YWMA 2YWNA 5C04A 2O87A 2N5AA 1ZYEA 2GT6A 5HFGA 4ZBDA 4H86A 3ME8A 2GSQA 3PH9A 3IC8A 1PKWA 3KTBA 2DJ2A 4GF0A 2KUCA 3MNGA 2JZTA 5D8IA 3APSA 2XPEA 4FYBA 4V2NA 5F07A 2A4HA 3BBYA 1TKDB 1XZOA 3GTUB 1ERUA 4PUFC 2JU5A 4GXZA 3HJMA 2J9HA 4Z2TA 1J08A 2G0FA 2LNSA 2A2SA 2LTKA 4LL4B 1FG4A 4RI7A 2QC7A 4KE3A 3DMLA 5DVBA 3G7JA 4TKYA 4POMA 3F6DA 3CRUA 3K8NA 2FD3A 4F82A 3ZVJA 2VD1A 1TP9A 5AISA 2H73A 2C1YA 4GRFA 4I97A 2M46A 3GSSA 1GSEA 2X99A 1U3AA 2BJXA 3GSTA 2KLXA 3H8QA 1X5EA 4MA9A 4FH8A 2YV7A 3EVIA 1A2MA 4OCEA 3UBKA 3KP8A 5F05A 4ICYA 19GSA 4KCEA 4IJ3A 1DE1A 4TR4A 5FWGA 1XXUA 3F9UA 2VCQA 1SENA 2ON7A 2VM1A 2H1DA 1B4QA 4RQRA 2QA1A 3KXOA 2MMNA 5G1LA 2IMIA 3KEBA 4ID0A 4BWQA 1H4OA 1M2AA 3M8NA 5J41A 5FHIA 1ILOA 1B48A 2H75A 3EPTA 4MJAA 2P31A 2V32A 4K0GA 3HVSA 3Q6OA 4WETA 3W8JA 2CVDA 4HQSA 1R26A 5D9VA 1LU4A 3TB2A 1GSUA 1GL8A 4Q5QA 5JWRB 4F2IA 3KH9A 4QQ7A 4USSA 3LSZA 2HNLA 2LKUA 4NMUA 5GSSA 1BJXA 5ABRA 1SKRB 1A2JA 2P0GA 4IQ1A 4E8EA 3MWHA 5KN0A 4TR3A 3IPZA 4F9ZA 1XOBA 2HFDA 3UVTA 3LW9A 1GUMA 3W6GA 2FWHA 1W89A 3UEMA 4I6XA 5CO3A 4TR0A 3L9SA 4NV2A 2PGTA 4OFTA 2E0QA 4CDOA 2IJYA 2OE1A 2VL9A 5KOWA 1RW1A 4NHZA 2YJHA 4XS1A 3TDGA 6GSTA 1R4WA 1TI1A 3EINA 2K8SA 4N0VA 2MZCA 1EEJA 1Z3EA 2QA2A 5B6MA 1AQVA 3QR6A 2RUEA 2OE0A 1A0RP 2IMFA 3SBCA 3EYTA 3LWAA 2DBCA 3TOUA 4J56E 2C3QA 5BRTA 2GS3A 3HXSA 1KEBA 4EUYA 3H1NA 2P5RA 5F0GA 3M1GA 2AAWA 3ZREA 3GMFA 1BYEA 4MMMA 2LEGA 1SK0A 4TXOB 4HI7A 2R3XA 4K8MA 3F6FA 1TRVA 1WP0A 5C00A 1GSSA 2NPBA 2DJKA 1LBKA 1ABAA 3ERGA 3C8EA 2IIYA 2PVOC 4V2LA 2BMXA 1O81A 1HNCA 4YQUA 1GLQA 3O76A 2GSSA 4KDXA 4MJCA 1SKWB 3VWUA 1ZOFA 2DJ1A 3U6VA 4A5PA 3ZTLA 2C0EA 2R2JA 3M3MA 2VLTA 1F2EA 5E59A 1JZDA 2L6DA 1OE8A 4PQIA 4ML1A 4MH2A 1EGRA 5G1KA 1XCCA 2DKIA 1MTCA 2IWTA 2R0PA 1JZWA 3ZFBA 4XS6A 1SYRA 2H8LA 1MDIA 2VCVA 4ZBAA 1R5AA 4L0UA 3IR4A 4G2EA 1EGOA 3UAPA 2H70A 5CRHA 4Z2RA 3DGQA 1T4YA 3TRPA 6GSXA 1V98A 4D73B 3HA9A 3KP9A 2GZPA 1HYUA 3GIXA 4L5LA 2L57A 4N11A 1QUWA 4V1Ap 4PX1A 3S9FA 4IHUA 3VWWA 2B1LA 3VPTA 4G19A 1X5CA 3DRNA 3IE3A 4G0LA 3TJJA 3Q74A 1QQ2A 4Z2UA 3HVXA 1FB0A 1EOGA 3KIJA 1VF4A 5IOXA 3GUSA 2HZEB 1NSWA 1A8YA 3HJPA 2H76A 2A2PA 4HZ4A 5G30A 1CQHA 1Z5YE 3PGTA 4PTSA 1B9YC 1B4PA 3FEUA 3H79A 3RBTA 5ELGA 2HRAA 2RUFA 1Z7RA 4DSSA 1WIKA 4TR1A 3C73A 4V1Ag 3IV4A 3TRQA 3ZFLA 1S3AA 4IKHA 2YANA 5GZZB 3D4TA 3F8UA 2IN3A 3G7IA 2D2ZA 2IFQA 3TKPA 10GSA 1K0OA 2WFCA 1DBYA 3L4NA 4OD7A 1ZZYA 3APQA 2DLXA 5AGYA 2H74A 4AJ7A 1JZRA 3DD3A 3EMPA 5B8BA 1GTAA 1O6JA 1ZYNA 2DSAA 4KX4A 2HT9A 2MYGA 3ISOA 5CYYA 3D4MA 3DXBA 6GSWA 5DCHA 2VCTA 4JBBA 2H1GA 4QL9A 1R5PA 2M72A 13GSA 4OFNA 3UJ1A 3GKNA 1JHBA 4Q5NA 4WR4A 3P8WA 3NZNA 3RPNA 1TRWA 3KTLA 1F37A 4PQ1A 3RAZA 2G2QA 4ML6A 1ZYPA 2AHEA 1KNGA 5G31A 1GP1A 2N5FA 3JCML 4TW5A 4X4JA 5HFIA 1K3LA 2DIZA 2B5YA 1DSBA 2L6CA 3HDCA 6GSVA 4YAPA 2WZ9A 4PNFA 1V9WA 4WF5A 1B9XC 3P2AA 3KH7A 4AJ6A 2AYTA 2DMMA 4FIWA 2LRNA 1T4ZA 3ZZXA 3QDNA 2WCIA 2XBIA 4BL7B 1OC9A 2CVKA 1TW9A 2VLVA 1TU7A 2NVLA 1ST9A 2JL4A 2GTUA 2V2GA 2R0CA 4MP4A 3TKQA 1NHOA 1T3BA 3VWXA 1G6YA 3LG6A 5KN3A 3EE2A 3EMXA 1M2BA 3GH9A 1S3CA 5ENUA 1Q98A 2R4VA 3A3TA 1XWCA 1VGLA 1M7TA 1SL1B 1MD3A 1YF0A 3C7MA 5G2ZA 3W8SA 1SJ6A 3FZ5A 12GSA 2H72A 1OC9B 4GLTA 3CTFA 2YNXA 2HRFA 3VK9A 2EC4A 5AN1A 2FLSA 2HXKA 4ZBBA 1GULA 3HVVA 4F03A 4MPFA 7GSSA 2FY6A 5FT3A 1C72A 5IMCA 4EO3A 4XS4B 3QFAC 1UVZA 5IM9A 3J7Yb 2MMOA 2VCXA 3GURA 1VF2A 4F0CA 3ZRDA 4F0BA 1XPVA 1TDIA 3WGDA 4ZXGA 3VFIA 3MYDA 4J2FA 4POKA 2DJ0A 3I9V2 20GSA 4ECCA 4TVEA 3G9BA 3N5OA 1FOHA 3ZMLA 3FKFA 5IMAA 1BG5A 2H6XA 3UOMA 3L9UA 1I9DA 4TRXA 1K0CA 3DKSA 4OMVA 1Y25A 3HCZA 1OC8A 18GSA 3CMIA 4KNDA 2K8VA 2YN1A 2V1MA 1XWBA 2EIOA 2LQQA 1BX9A 2H1BA 1EV4A 1JLWA 4BVXA 1RQMA 1KBNA 3A2VA 2PN8A 5EL8A 1U6TA 2JZRA 2MMAA 2LS5A 4RUVA 2J23A 4YKFA 1YQ1A 4PNGA 3FK8A 1XVWA 2KP2A 4DSQA 2VL2C 3IAS2 3MDKA 2WJUA 2F8AA 4O32A 2ZNMA 3RDWA 4MLYA 2CA8A 11GSA 5LNKe 2AUVA 1YEPA 1AUCA 3QOUA 2HSHA 2PVQA 2C3TA 2GSRA 3IOSA 4HOJA 2CX3A 2JZSA 3IBHA 5J3RA 5IPGA 2PWJA 1FW1A 2LJAA 5KN2A 2YP6A 4HU9A 1XFLA 2F9SA 4G0KA 2ZCTA 3E3EA 4LMVA 4NAXA 5DBQA 2VAFA 5D93A 2VM2A 1GTUA 3BD2A 4OO5A 4XIHA 5ECKB 3WT1A 1XIYA 4KF9A 1WRYA 1ML6A 4HDEA 5AIXA 2B5EA 1VF3A 5D9XA 4PURA 1K3OA 1FAAA 5G5FA 3CBUA 2YPMA 3L9VA 2CZ3A 5DQYA 5CRWA 2HI7A 1A23A 3VI5A 2DMLA 4BPYA 3KMNA 2L4QA 14GSA 3TJKA 3QAWA 5EVOA 4KDUA 4MF5A 3RHCA 3GV1A 4HU7A 5CRGA 5IQYA 1F3BA 3GH6A 4KH7A 3LFLA 1SD9A 3ERWA 5IMFA 4WKWA 2I81A 5DCGA 2LSTA 3KD0A 1YJ6A 5IO2A 2TRCP 2FWEA 3I43A 1WMJA 2VCWA 5CNWA 5KOXA 1YY7A 2RM5A 1XWAA 3LQ7A 4EL1A 2CT6A 2E2MA 3O6TA 4K2XA 4GQFA 1PL2A 2GQMA 2C0DA 3WT2A 3F4RA 1A24A 1V57A 3MAKA 2OA7A 3UIWA 2R6KA 4I5QA 1U3IA 4K5RA 1VF1A 4EDZA 4KW6A 3L78A 2C3NA 5CAXA 3GA4A 2VL3A 1X0RA 1H75A 1OVNA 3AY8A 3TJGA 2H6YA 1ON4A 1EEMA 1ZYQB 1JFUA 3LXZA 2OKAA 3HD5A 1E6BA 2OADA 1URMA 1HD2A 1AXDA 4CY6A 3A2XA 2H0GA 4FYUA 1MD4A 2C4JA 2CAQA 2DJ3A 4JRRA 2UZ8A 3GX8A 1THOA 2JSZA 1SL0B 2H0IA 1SYXA 4ZIJA 4I8BA 5IMDA 3GKXA 1JLVA 5JCGA 1U88A 3ME7A 4WR5A 3VPQA 2CQ9A 3TJFA 4DVCA 4YKGA 2QSIA 4K2DA 1KTEA 1MDKA 1ZL9A 3HY2A 1QMVA 2KHPA 4DEJA 2IL3A 1ZMAA 1G0TA 4RI6A 4WEYA 1B8XA 1HQOA 2RLIA 2H71A 2WB9A 3GN3A 5D9WA 4XRAA 1G7OA 1EOHA 1PA3A 1OC3A 2CZ2A 4X1UA 4IQAA 3IC4A 2YZHA 1BEDA 4N0ZA 3TGZA 2R37A 2HE3A 3D21A 5ECMB 3CSJA 2X49A 3PPUA 4OCFA 2WRTA 2K6VA 3IK7A 3ZMKA 2O89A 1SJIA 3KM6A 1TJDA 2VCZA 3J7Yk 1FVKA 3LYKA 2H0HA 5EPFA 3PINA 2PBJA 3IA1A 3IXRA 2YZUA 4NHWA 2QKEA 2KP1A 1OKTA 2JADA 1WPIA 4YQVA 2LNTA 2Z9SA 3GL3A 3C1RA 1X9WB 1LJRA 3GL5A 17GSA 1YDKA 3IHQA 2MMZA 5IPHA 1PGTA 2HRKA 2WDUA 4ZL9A 1YZXA 4KSOA 3FMWA 4IVFA 1GTBA 3APOA 1F6MC 4DSRA 3UVHA 4LMWA 4MDCA 1HNBA 2PUKC 4CW9A 1PKZA 1EV9A 3WD6A 2MBSA 5B8AA 5DALA 3KZQA 4JR6A 4HUAA 4IP6A 2C8UA 4N10A 3H93A 1BAYA 2FCHA 3EURA 2RIIA 1SL2B 2H6ZA 1ERVA 4DSSB 4TR1B 4EIQA 2KOKA 1FB6A 5ECRB 4PGTA 4IP1A 2IFQB 5DALB 5ECSA 3QMXA 4J57E 5B6NA 1RK4A 2CV4A 5ECIB 4OFMA 2IMKA 4GTUA 4NWYA 4EIPA 3CYNA 2X8HA 3KJYA 2MBTA 4K5SA 2QGVA 2DIYA 4FQUA 1MDJA 1M2DA 3KCMA 3TKSE 1V58A 1N2AA 5JCUA 3QPMA 4NXIA 4HJ2A 1ACVA 4KA0A 4EDYA 5IOWA 3LXTA 1OYJA 2LJRA 2AV4A 5ECQB 1OAZA 2WS2A 2LQOA 3DIEA 2DKHA 1T7PB 5D9TA 4K7OA 5GAPD 2L59A 1TOFA 3LJRA 5H5SA 3HZ4A 2EIRA 1O8WA 2ZUPA 4Q5RA 4ILFA 1EP8A 4PXOA 5DJMA 1TU8A 1NHYA 4LLRA 1GRXA 4WXTA 2B6MA 16GSA 3UARA 2WULA 5INYA 1EWXA 2YJ7A 3L0HA 2FUG2 4GWRA 4YQMA 1PX6A 3IAM2 1A2LA 1J9BA 2FNOA 2WGRA 1X9MB 2VD0A 1IYIA 1PSQA 1PRXA 2F8FA 1PQNA 2M80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLR A;  1GNW A;  3LYP A;  3F4S A;  5ID2 A;  2PPT A;  2CAI A;  1W4V A;  4Z7X A;  1V40 A;  3C1S A;  4K0N A;  2I9H A;  2L5L A;  5ECL B;  5GAN D;  1M9A A;  2L4C A;  5E4W A;  4K6X A;  2CX4 A;  3GX0 A;  5JWO B;  2VL2 A;  4KSM A;  3F3R A;  2GT5 A;  3BJ5 A;  2O85 A;  1XVQ A;  4GQC A;  3ZVJ D;  4IEL A;  3CSI A;  1GSY A;  2YWO A;  5H5R A;  2FWF A;  3A5W A;  3US3 A;  1DE2 A;  1GSQ A;  1BQ7 A;  1QXH A;  2CVB A;  4MCU A;  4GCI A;  3WGX A;  1ZCP A;  3QFB C;  5EY6 A;  3ZYW A;  3D0Z A;  1USB A;  4ZB6 A;  3F0I A;  5J9B A;  5IMV A;  1E2Y A;  1CQG A;  1GNE A;  4MPG A;  3PR8 A;  3HYP A;  2AB6 A;  4K7I A;  3LEF A;  4LA1 A;  3BCI A;  1Z6M A;  3D22 A;  2GZY A;  1G7E A;  4LL1 B;  4NPB A;  4MK3 A;  8GSS A;  4G10 A;  5HR0 A;  1HNA A;  2E7P A;  4POB A;  4XHM A;  5CP1 A;  2F3M A;  1R7H A;  4KGI A;  2N5B A;  1DUG A;  1TK0 B;  2BTO T;  3H4K A;  3M9K A;  3DEX A;  4OWY A;  3FR3 A;  4HEA 2;  4ISD A;  4MH3 A;  2FA8 A;  5IMZ A;  5A4W A;  1EP7 A;  1UN2 A;  5KN1 A;  3FRC A;  2GVP A;  5HR1 A;  2I1U A;  1QK8 A;  1YEX A;  4ECB A;  3ED3 A;  1WOU A;  3E9J B;  1X5D A;  3CSH A;  1NW2 A;  2LRT A;  3HJO A;  5DAK A;  3GKM A;  4K9Z A;  5D73 A;  3IK9 A;  5F8B A;  3HKR A;  1Z7P A;  3LOR A;  4L0W A;  3QAG A;  4IW9 A;  4FO5 A;  1PN9 A;  4ZB9 A;  1K0D A;  1SKS B;  2C80 A;  1K0B A;  2OAC A;  2VLU A;  4ULX A;  2DC5 A;  3I6A A;  2X64 A;  3Q19 A;  4EE0 A;  3EU4 A;  5DAK B;  1GUH A;  3FZ4 A;  1AW9 A;  1GLP A;  3IRA A;  4IGJ A;  2OBK A;  2B3S A;  4MAB A;  5J9C A;  1GH2 A;  2HYX A;  5CRD A;  3GNJ A;  2NBS A;  3P90 A;  3GYK A;  2OE3 A;  1XW6 A;  2H19 A;  2H01 A;  2LRC A;  3M0F A;  4Q5F A;  3CTG A;  1XWG A;  5DDL A;  4O5R A;  2TRX A;  5ECP B;  4NV5 A;  4HQZ A;  2V6K A;  1TXX A;  1TRU A;  3VUR A;  5JCW A;  4JE1 A;  2H66 A;  1K0M A;  2H1A A;  5L71 A;  1M0U A;  4MF6 A;  1XW9 A;  2IPA A;  2LJK A;  5GST A;  1IYH A;  3CXG A;  4KDY A;  4ECI A;  4FYC A;  1UA5 A;  6GSU A;  1YKC A;  5HFK A;  3GHA A;  1A8L A;  4V2M A;  1OKD A;  3DWV A;  3FHK A;  5A4V A;  2H30 A;  2PER A;  3FZ9 A;  1M99 A;  2YV9 A;  2XPD A;  4MJE A;  5DJL A;  2F51 A;  3QCP A;  1SK2 A;  4TN8 A;  5CRE A;  4CHS A;  3NIV A;  2VUP A;  4N30 A;  4TXO A;  1FOV A;  1WE0 A;  2VIM A;  5J5N A;  3TKS A;  4POL A;  4MZW A;  3FW2 A;  3GRX A;  2PU9 C;  3QD9 A;  1PMT A;  4L8E A;  2YOI A;  4EVM A;  3FR9 A;  1T1V A;  1WWJ A;  3R2Q A;  5JWQ B;  1ZGN A;  3E0U A;  2GST A;  4KUN A;  2IME A;  1TK5 B;  2RM6 A;  2GQK A;  4YH2 A;  2NTO A;  4IJI A;  1AAZ A;  2C0F A;  4JU5 A;  4OO4 A;  4ZB8 A;  3KGK A;  2FA4 A;  1FVJ A;  2TIR A;  4EF0 A;  1T8E B;  4QL7 A;  4JED A;  3P7X A;  3SWL A;  4ZIL A;  3OR5 A;  1YF1 A;  4XTS A;  2B7J A;  3DVX A;  2OJL A;  5A4U A;  3Q18 A;  1ERT A;  4L5O A;  4HS1 A;  2XBQ A;  3F63 A;  1XW5 A;  3FR6 A;  1K0N A;  2A2R A;  4RQX A;  3I69 A;  3NOF A;  2AJQ B;  5ECN B;  3HHV A;  1JZO A;  4AJ8 A;  3CRT A;  3F3Q A;  1GSD A;  4D73 A;  1PD2 1;  3UMA A;  4GSN A;  1J0F A;  2JAC A;  5J4U A;  2ALB A;  3D5J A;  3FZA A;  4WBJ A;  3BOA A;  2XC2 A;  3TKS C;  5A5K A;  2YCD A;  9GSS A;  3D6I A;  5HR2 A;  4ECJ A;  4ACS A;  1MEK A;  22GS A;  5F06 A;  4MF7 A;  2P5Q A;  5IIZ A;  3EWL A;  5AIV A;  3TOT A;  3TCO A;  1O73 A;  5D96 A;  5COH A;  2IMD A;  1O7U A;  4O7H A;  1K3Y A;  3VLN A;  2B5X A;  1V2A A;  4KCA A;  2JSY A;  2HZE A;  3TUE A;  4X43 A;  3G7Y A;  4HJM A;  4AGS A;  5ECO B;  1XOA A;  4I2U A;  1Q4J A;  3M9J A;  3WYW A;  3ZLP A;  2I3Y A;  1SU9 A;  2FHE A;  1GWC A;  2ON5 A;  2V6O A;  3LGC A;  4GSS A;  2GQL A;  1K0A A;  3GKK A;  2HSY A;  1AQW A;  4TXV A;  1XBS A;  1X9S B;  5ECH B;  3ZIJ A;  4IS0 A;  1OE7 A;  3QAV A;  2V41 A;  2DJJ A;  2R5G A;  1UC7 A;  3BCK A;  1M9B A;  1PX7 A;  4TOP A;  2A4V A;  3ZL5 A;  3FY7 A;  1ERW A;  1N8J A;  1FO5 A;  3ZIV A;  1O85 A;  2C0G A;  1GTI A;  2E2G A;  3V1W A;  2I4A A;  5HQP A;  4I2T A;  5LCZ A;  2X8C A;  1PL1 A;  1TTZ A;  1SK1 A;  3MSZ A;  6GSS A;  2ES7 A;  1O8X A;  2K9F A;  4KAE A;  2B1K A;  4E8H A;  3EU3 A;  2HLS A;  2GDR A;  4MJB A;  3KMO A;  3O3T A;  3F4T A;  2O8V B;  2HRN A;  1GUK A;  1TK8 B;  3FYG A;  3IDV A;  4BWS A;  1SD8 A;  1I5G A;  3WGE A;  2GGT A;  6GSY A;  2K18 A;  3UBL A;  2XHF A;  1THX A;  3GFK A;  3N9J A;  2NDO A;  1U87 A;  1Z6N A;  3RHB A;  2FWG A;  5KEJ A;  1GSF A;  2VO4 A;  1SJZ A;  4WF4 A;  3TJB A;  4BL7 A;  2L5O A;  3TKR A;  2GZZ A;  1YKA A;  4ZL8 A;  3DVW A;  5H5Q A;  4EKZ A;  4PUA A;  4PQH A;  4AF2 A;  4GST A;  1F9M A;  1T00 A;  3ZIT A;  4P3Y B;  2LUS A;  4BA7 A;  1AIU A;  2REM A;  3VI7 A;  1S3D A;  2LV3 A;  3VWV A;  3DYR A;  4X0X A;  1QFN A;  3RPP A;  4O92 A;  4JR4 A;  4IBP A;  5DQS A;  5B7C A;  4BVY A;  1F3A A;  4XCS A;  4IN0 A;  1G6W A;  2O7K A;  5LD0 A;  1AQX A;  2FGX A;  4K1F A;  1XWK A;  2PMT A;  3ERF A;  2EIQ A;  1WJK A;  5IO0 A;  4XS4 A;  4ZL7 A;  1NM3 A;  4KB3 A;  1TRS A;  1TI3 A;  2HZF A;  1VRS D;  5HR3 A;  3TRX A;  4MZB A;  3U5R E;  4EXJ A;  4EC0 A;  4WBR D;  3UL3 A;  4JZQ A;  4HZ2 A;  1AC1 A;  4G9H A;  1Y6E A;  2VOC A;  3HZ8 A;  5G5E A;  2X8G A;  1Z9H A;  3EC3 A;  3C71 A;  5ELA A;  4K7N A;  2B7K A;  1QGV A;  4MZC A;  2OBI A;  4YAV A;  5ID2 B;  4XRD A;  1A0F A;  1FHE A;  2YWI A;  1EZK A;  3GTU A;  3A2W A;  2YWM A;  2YWN A;  5C04 A;  2O87 A;  2N5A A;  1ZYE A;  2GT6 A;  5HFG A;  4ZBD A;  4H86 A;  3ME8 A;  2GSQ A;  3PH9 A;  1PKW A;  3KTB A;  2DJ2 A;  4GF0 A;  2KUC A;  3MNG A;  2JZT A;  5D8I A;  3APS A;  2XPE A;  4FYB A;  4V2N A;  5F07 A;  3BBY A;  1TKD B;  1XZO A;  3GTU B;  1ERU A;  4PUF C;  2JU5 A;  4GXZ A;  3HJM A;  2J9H A;  1J08 A;  2G0F A;  2LNS A;  2A2S A;  2LTK A;  4LL4 B;  1FG4 A;  4RI7 A;  2QC7 A;  4KE3 A;  3DML A;  5DVB A;  3G7J A;  4TKY A;  4POM A;  3F6D A;  3CRU A;  3K8N A;  2FD3 A;  4F82 A;  3ZVJ A;  2VD1 A;  1TP9 A;  5AIS A;  2H73 A;  2C1Y A;  4GRF A;  4I97 A;  2M46 A;  3GSS A;  1GSE A;  2X99 A;  1U3A A;  2BJX A;  3GST A;  2KLX A;  3H8Q A;  1X5E A;  4MA9 A;  4FH8 A;  2YV7 A;  3EVI A;  1A2M A;  4OCE A;  3UBK A;  3KP8 A;  5F05 A;  19GS A;  4KCE A;  4IJ3 A;  1DE1 A;  4TR4 A;  5FWG A;  1XXU A;  3F9U A;  2VCQ A;  1SEN A;  2ON7 A;  2VM1 A;  2H1D A;  1B4Q A;  4RQR A;  3KXO A;  2MMN A;  5G1L A;  2IMI A;  3KEB A;  4ID0 A;  4BWQ A;  1H4O A;  1M2A A;  3M8N A;  5J41 A;  5FHI A;  1ILO A;  1B48 A;  2H75 A;  4MJA A;  2P31 A;  2V32 A;  4K0G A;  3HVS A;  3Q6O A;  4WET A;  3W8J A;  2CVD A;  4HQS A;  1R26 A;  5D9V A;  1LU4 A;  3TB2 A;  1GSU A;  1GL8 A;  4Q5Q A;  5JWR B;  4F2I A;  3KH9 A;  4QQ7 A;  3LSZ A;  2HNL A;  2LKU A;  4NMU A;  5GSS A;  1BJX A;  5ABR A;  1SKR B;  1A2J A;  2P0G A;  4IQ1 A;  4E8E A;  3MWH A;  5KN0 A;  4TR3 A;  3IPZ A;  4F9Z A;  1XOB A;  2HFD A;  3UVT A;  1GUM A;  3W6G A;  2FWH A;  1W89 A;  3UEM A;  4I6X A;  5CO3 A;  4TR0 A;  3L9S A;  4NV2 A;  2PGT A;  4OFT A;  2E0Q A;  4CDO A;  2IJY A;  2OE1 A;  2VL9 A;  1RW1 A;  4NHZ A;  2YJH A;  4XS1 A;  3TDG A;  6GST A;  1R4W A;  1TI1 A;  3EIN A;  2K8S A;  4N0V A;  2MZC A;  1EEJ A;  1Z3E A;  5B6M A;  1AQV A;  3QR6 A;  2RUE A;  2OE0 A;  1A0R P;  2IMF A;  3SBC A;  3EYT A;  3LWA A;  2DBC A;  3TOU A;  4J56 E;  2C3Q A;  2GS3 A;  3HXS A;  1KEB A;  4EUY A;  3H1N A;  2P5R A;  5F0G A;  3M1G A;  2AAW A;  3ZRE A;  3GMF A;  1BYE A;  4MMM A;  2LEG A;  1SK0 A;  4TXO B;  4HI7 A;  2R3X A;  4K8M A;  3F6F A;  1TRV A;  1WP0 A;  5C00 A;  1GSS A;  2NPB A;  2DJK A;  1LBK A;  1ABA A;  3ERG A;  3C8E A;  2IIY A;  2PVO C;  4V2L A;  2BMX A;  1O81 A;  1HNC A;  4YQU A;  1GLQ A;  3O76 A;  2GSS A;  4KDX A;  4MJC A;  1SKW B;  3VWU A;  1ZOF A;  2DJ1 A;  3U6V A;  3ZTL A;  2C0E A;  2R2J A;  3M3M A;  2VLT A;  1F2E A;  5E59 A;  1JZD A;  2L6D A;  1OE8 A;  4PQI A;  4ML1 A;  4MH2 A;  1EGR A;  5G1K A;  1XCC A;  1MTC A;  2IWT A;  1JZW A;  3ZFB A;  4XS6 A;  1SYR A;  2H8L A;  1MDI A;  2VCV A;  4ZBA A;  1R5A A;  4L0U A;  3IR4 A;  4G2E A;  1EGO A;  3UAP A;  2H70 A;  5CRH A;  3DGQ A;  1T4Y A;  3TRP A;  6GSX A;  1V98 A;  4D73 B;  3HA9 A;  3KP9 A;  2GZP A;  1HYU A;  3GIX A;  4L5L A;  2L57 A;  4N11 A;  1QUW A;  4V1A p;  4PX1 A;  3S9F A;  4IHU A;  3VWW A;  2B1L A;  3VPT A;  4G19 A;  1X5C A;  3DRN A;  3IE3 A;  3TJJ A;  3Q74 A;  1QQ2 A;  3HVX A;  1FB0 A;  1EOG A;  3KIJ A;  1VF4 A;  5IOX A;  3GUS A;  2HZE B;  1NSW A;  1A8Y A;  3HJP A;  2H76 A;  4HZ4 A;  5G30 A;  1CQH A;  1Z5Y E;  3PGT A;  1B9Y C;  1B4P A;  3FEU A;  3H79 A;  3RBT A;  5ELG A;  2RUF A;  1Z7R A;  4DSS A;  1WIK A;  4TR1 A;  3C73 A;  4V1A g;  3IV4 A;  3TRQ A;  3ZFL A;  1S3A A;  4IKH A;  2YAN A;  5GZZ B;  3D4T A;  3F8U A;  2IN3 A;  3G7I A;  2D2Z A;  2IFQ A;  3TKP A;  10GS A;  1K0O A;  2WFC A;  1DBY A;  3L4N A;  4OD7 A;  1ZZY A;  3APQ A;  2DLX A;  5AGY A;  2H74 A;  4AJ7 A;  1JZR A;  3DD3 A;  3EMP A;  5B8B A;  1GTA A;  1O6J A;  4KX4 A;  2DSA A;  2HT9 A;  2MYG A;  3ISO A;  5CYY A;  3D4M A;  3DXB A;  6GSW A;  5DCH A;  2VCT A;  4JBB A;  2H1G A;  4QL9 A;  1R5P A;  2M72 A;  13GS A;  4OFN A;  3UJ1 A;  3GKN A;  1JHB A;  4Q5N A;  4WR4 A;  3P8W A;  3NZN A;  3RPN A;  1TRW A;  3KTL A;  1F37 A;  4PQ1 A;  3RAZ A;  2G2Q A;  4ML6 A;  2AHE A;  1KNG A;  5G31 A;  1GP1 A;  2N5F A;  3JCM L;  4TW5 A;  5HFI A;  1K3L A;  2DIZ A;  2B5Y A;  1DSB A;  2L6C A;  3HDC A;  6GSV A;  4YAP A;  2WZ9 A;  4PNF A;  1V9W A;  4WF5 A;  1B9X C;  3P2A A;  3KH7 A;  4AJ6 A;  2AYT A;  2DMM A;  4FIW A;  2LRN A;  1T4Z A;  3ZZX A;  3QDN A;  2WCI A;  2XBI A;  1OC9 A;  2CVK A;  1TW9 A;  2VLV A;  1TU7 A;  2NVL A;  1ST9 A;  2JL4 A;  2GTU A;  2V2G A;  4MP4 A;  3TKQ A;  1NHO A;  1T3B A;  3VWX A;  1G6Y A;  3LG6 A;  5KN3 A;  3EE2 A;  3EMX A;  1M2B A;  3GH9 A;  1S3C A;  5ENU A;  1Q98 A;  2R4V A;  3A3T A;  1XWC A;  1VGL A;  1M7T A;  1SL1 B;  1MD3 A;  1YF0 A;  3C7M A;  5G2Z A;  3W8S A;  1SJ6 A;  3FZ5 A;  12GS A;  2H72 A;  1OC9 B;  4GLT A;  3CTF A;  2YNX A;  2HRF A;  3VK9 A;  2EC4 A;  5AN1 A;  2FLS A;  2HXK A;  4ZBB A;  1GUL A;  3HVV A;  4F03 A;  4MPF A;  7GSS A;  2FY6 A;  5FT3 A;  1C72 A;  5IMC A;  4EO3 A;  4XS4 B;  3QFA C;  1UVZ A;  5IM9 A;  3J7Y b;  2MMO A;  2VCX A;  3GUR A;  1VF2 A;  4F0C A;  3ZRD A;  4F0B A;  1XPV A;  1TDI A;  3WGD A;  4ZXG A;  3VFI A;  4J2F A;  4POK A;  2DJ0 A;  3I9V 2;  20GS A;  4ECC A;  4TVE A;  3G9B A;  3N5O A;  3ZML A;  3FKF A;  5IMA A;  1BG5 A;  2H6X A;  3UOM A;  3L9U A;  1I9D A;  4TRX A;  1K0C A;  3DKS A;  4OMV A;  1Y25 A;  3HCZ A;  1OC8 A;  18GS A;  3CMI A;  4KND A;  2K8V A;  2YN1 A;  2V1M A;  1XWB A;  2EIO A;  2LQQ A;  1BX9 A;  2H1B A;  1EV4 A;  1JLW A;  4BVX A;  1RQM A;  1KBN A;  3A2V A;  2PN8 A;  5EL8 A;  1U6T A;  2JZR A;  2MMA A;  2LS5 A;  4RUV A;  2J23 A;  1YQ1 A;  4PNG A;  3FK8 A;  1XVW A;  2KP2 A;  4DSQ A;  2VL2 C;  3IAS 2;  3MDK A;  2WJU A;  2F8A A;  4O32 A;  2ZNM A;  3RDW A;  4MLY A;  2CA8 A;  11GS A;  5LNK e;  2AUV A;  1YEP A;  1AUC A;  3QOU A;  2HSH A;  2PVQ A;  2C3T A;  2GSR A;  3IOS A;  4HOJ A;  2CX3 A;  2JZS A;  3IBH A;  5J3R A;  5IPG A;  2PWJ A;  1FW1 A;  2LJA A;  5KN2 A;  2YP6 A;  4HU9 A;  1XFL A;  2F9S A;  2ZCT A;  3E3E A;  4LMV A;  4NAX A;  5DBQ A;  2VAF A;  5D93 A;  2VM2 A;  1GTU A;  3BD2 A;  4OO5 A;  4XIH A;  5ECK B;  3WT1 A;  1XIY A;  1WRY A;  1ML6 A;  4HDE A;  5AIX A;  2B5E A;  1VF3 A;  5D9X A;  4PUR A;  1K3O A;  1FAA A;  5G5F A;  3CBU A;  2YPM A;  3L9V A;  2CZ3 A;  5DQY A;  5CRW A;  2HI7 A;  1A23 A;  3VI5 A;  2DML A;  4BPY A;  3KMN A;  2L4Q A;  14GS A;  3TJK A;  3QAW A;  5EVO A;  4KDU A;  4MF5 A;  3RHC A;  3GV1 A;  4HU7 A;  5CRG A;  5IQY A;  1F3B A;  3GH6 A;  4KH7 A;  3LFL A;  1SD9 A;  3ERW A;  5IMF A;  4WKW A;  2I81 A;  5DCG A;  2LST A;  3KD0 A;  1YJ6 A;  5IO2 A;  2TRC P;  2FWE A;  3I43 A;  1WMJ A;  2VCW A;  5CNW A;  1YY7 A;  2RM5 A;  1XWA A;  3LQ7 A;  4EL1 A;  2CT6 A;  2E2M A;  3O6T A;  4GQF A;  1PL2 A;  2GQM A;  2C0D A;  3WT2 A;  3F4R A;  1A24 A;  1V57 A;  3MAK A;  2OA7 A;  3UIW A;  2R6K A;  4I5Q A;  1U3I A;  1VF1 A;  4EDZ A;  4KW6 A;  3L78 A;  2C3N A;  5CAX A;  3GA4 A;  2VL3 A;  1X0R A;  1H75 A;  1OVN A;  3AY8 A;  3TJG A;  2H6Y A;  1ON4 A;  1EEM A;  1ZYQ B;  1JFU A;  3LXZ A;  2OKA A;  3HD5 A;  1E6B A;  2OAD A;  1URM A;  1HD2 A;  1AXD A;  3A2X A;  2H0G A;  4FYU A;  1MD4 A;  2C4J A;  2CAQ A;  2DJ3 A;  4JRR A;  3GX8 A;  1THO A;  2JSZ A;  1SL0 B;  2H0I A;  1SYX A;  4ZIJ A;  4I8B A;  5IMD A;  3GKX A;  1JLV A;  5JCG A;  1U88 A;  3ME7 A;  4WR5 A;  3VPQ A;  2CQ9 A;  3TJF A;  4DVC A;  2QSI A;  4K2D A;  1KTE A;  1MDK A;  1ZL9 A;  3HY2 A;  1QMV A;  2KHP A;  4DEJ A;  2IL3 A;  1ZMA A;  1G0T A;  4RI6 A;  4WEY A;  1B8X A;  1HQO A;  2RLI A;  2H71 A;  2WB9 A;  3GN3 A;  5D9W A;  4XRA A;  1G7O A;  1EOH A;  1PA3 A;  1OC3 A;  2CZ2 A;  4X1U A;  4IQA A;  3IC4 A;  2YZH A;  1BED A;  4N0Z A;  3TGZ A;  2R37 A;  5ECM B;  2HE3 A;  3D21 A;  3CSJ A;  4OCF A;  2WRT A;  2K6V A;  3IK7 A;  3ZMK A;  2O89 A;  1SJI A;  3KM6 A;  1TJD A;  2VCZ A;  3J7Y k;  1FVK A;  3LYK A;  2H0H A;  5EPF A;  3PIN A;  2PBJ A;  3IA1 A;  3IXR A;  2YZU A;  4NHW A;  2QKE A;  2KP1 A;  1OKT A;  2JAD A;  1WPI A;  4YQV A;  2LNT A;  2Z9S A;  3GL3 A;  3C1R A;  1X9W B;  1LJR A;  3GL5 A;  17GS A;  1YDK A;  3IHQ A;  2MMZ A;  5IPH A;  1PGT A;  2WDU A;  4ZL9 A;  1YZX A;  4KSO A;  4IVF A;  1GTB A;  3APO A;  1F6M C;  4DSR A;  3UVH A;  4LMW A;  4MDC A;  1HNB A;  2PUK C;  4CW9 A;  1PKZ A;  1EV9 A;  3WD6 A;  2MBS A;  5B8A A;  5DAL A;  3KZQ A;  4JR6 A;  4HUA A;  4IP6 A;  2C8U A;  4N10 A;  3H93 A;  1BAY A;  2FCH A;  3EUR A;  2RII A;  1SL2 B;  2H6Z A;  1ERV A;  4DSS B;  4TR1 B;  2KOK A;  1FB6 A;  5ECR B;  4PGT A;  4IP1 A;  2IFQ B;  5DAL B;  5ECS A;  3QMX A;  4J57 E;  5B6N A;  1RK4 A;  2CV4 A;  5ECI B;  4OFM A;  2IMK A;  4GTU A;  4NWY A;  3CYN A;  2X8H A;  3KJY A;  2MBT A;  2QGV A;  2DIY A;  1MDJ A;  1M2D A;  3KCM A;  3TKS E;  1V58 A;  1N2A A;  5JCU A;  3QPM A;  4NXI A;  4HJ2 A;  1ACV A;  4KA0 A;  4EDY A;  5IOW A;  3LXT A;  1OYJ A;  2LJR A;  2AV4 A;  5ECQ B;  1OAZ A;  2WS2 A;  2LQO A;  3DIE A;  1T7P B;  5D9T A;  4K7O A;  5GAP D;  2L59 A;  1TOF A;  3LJR A;  5H5S A;  3HZ4 A;  2EIR A;  1O8W A;  2ZUP A;  4Q5R A;  4ILF A;  1EP8 A;  4PXO A;  5DJM A;  1TU8 A;  1NHY A;  4LLR A;  1GRX A;  4WXT A;  2B6M A;  16GS A;  3UAR A;  2WUL A;  5INY A;  1EWX A;  2YJ7 A;  3L0H A;  2FUG 2;  4GWR A;  4YQM A;  1PX6 A;  3IAM 2;  1A2L A;  1J9B A;  2FNO A;  2WGR A;  1X9M B;  2VD0 A;  1IYI A;  1PSQ A;  1PRX A;  2F8F A;  1PQN A;  2M80 A; 
#chains in the Genus database with same CATH topology
 2GLR A;  1GNW A;  3LYP A;  3F4S A;  5ID2 A;  2PPT A;  2CAI A;  1W4V A;  4Z7X A;  1V40 A;  3C1S A;  4K0N A;  2I9H A;  2L5L A;  5ECL B;  5GAN D;  1M9A A;  2L4C A;  5E4W A;  4K6X A;  2CX4 A;  3GX0 A;  5JWO B;  4G0I A;  2VL2 A;  4KSM A;  3F3R A;  2GT5 A;  3BJ5 A;  2O85 A;  1XVQ A;  4GQC A;  1M3I A;  3ZVJ D;  4IEL A;  3CSI A;  1GSY A;  2YWO A;  5H5R A;  2FWF A;  3A5W A;  3US3 A;  1DE2 A;  1GSQ A;  1BQ7 A;  1QXH A;  2CVB A;  4MCU A;  4GCI A;  3WGX A;  1ZCP A;  3QFB C;  5EY6 A;  3ZYW A;  3D0Z A;  1USB A;  4ZB6 A;  3F0I A;  5J9B A;  5IMV A;  1E2Y A;  1CQG A;  1GNE A;  4MPG A;  3PR8 A;  3HYP A;  2AB6 A;  4K7I A;  3LEF A;  4LA1 A;  3BCI A;  1Z6M A;  3D22 A;  2GZY A;  1G7E A;  4LL1 B;  4NPB A;  4MK3 A;  8GSS A;  4G10 A;  5HR0 A;  1HNA A;  2E7P A;  4POB A;  4XHM A;  5CP1 A;  2F3M A;  1R7H A;  4KGI A;  2N5B A;  1DUG A;  1TK0 B;  2BTO T;  3H4K A;  3M9K A;  3DEX A;  4OWY A;  3FR3 A;  4HEA 2;  4BVX B;  4ISD A;  4MH3 A;  2FA8 A;  5IMZ A;  5A4W A;  1EP7 A;  1UN2 A;  5KN1 A;  3FRC A;  2GVP A;  5HR1 A;  2I1U A;  1QK8 A;  1YEX A;  4ECB A;  3ED3 A;  1WOU A;  3E9J B;  1X5D A;  3CSH A;  1NW2 A;  2LRT A;  3HJO A;  5DAK A;  3GKM A;  4K9Z A;  5D73 A;  3IK9 A;  5F8B A;  3HKR A;  1Z7P A;  3LOR A;  4L0W A;  3QAG A;  4IW9 A;  4FO5 A;  1PN9 A;  4ZB9 A;  1K0D A;  1SKS B;  2C80 A;  1K0B A;  2OAC A;  2VLU A;  4ULX A;  2DC5 A;  3I6A A;  2X64 A;  3Q19 A;  4O5U A;  4EE0 A;  3EU4 A;  5DAK B;  1GUH A;  3FZ4 A;  1AW9 A;  1GLP A;  3IRA A;  4IGJ A;  2OBK A;  2B3S A;  4MAB A;  5J9C A;  1GH2 A;  2HYX A;  5CRD A;  3GNJ A;  2NBS A;  3P90 A;  3GYK A;  2OE3 A;  1XW6 A;  2H19 A;  2H01 A;  2LRC A;  3M0F A;  4Q5F A;  3CTG A;  1XWG A;  3MIX A;  5DDL A;  4O5R A;  2TRX A;  5ECP B;  4NV5 A;  4HQZ A;  2V6K A;  1TXX A;  1TRU A;  3VUR A;  5JCW A;  4JE1 A;  2H66 A;  1K0M A;  2H1A A;  5L71 A;  1M0U A;  4MF6 A;  1XW9 A;  2IPA A;  2LJK A;  5GST A;  1IYH A;  3CXG A;  4KDY A;  4ECI A;  4FYC A;  1UA5 A;  6GSU A;  1YKC A;  5HFK A;  3GHA A;  1A8L A;  4V2M A;  1OKD A;  3DWV A;  3FHK A;  5A4V A;  2H30 A;  2PER A;  3FZ9 A;  1M99 A;  2YV9 A;  2XPD A;  4MJE A;  5DJL A;  2F51 A;  3QCP A;  1SK2 A;  4TN8 A;  5CRE A;  4CHS A;  3NIV A;  2VUP A;  4N30 A;  4TXO A;  1FOV A;  1WE0 A;  2VIM A;  5J5N A;  3A5I A;  3TKS A;  4O5Q A;  4POL A;  4MZW A;  3CQF A;  3FW2 A;  3GRX A;  2PU9 C;  3QD9 A;  1PMT A;  4L8E A;  2YOI A;  4EVM A;  3FR9 A;  1T1V A;  1WWJ A;  3R2Q A;  5JWQ B;  1ZGN A;  3E0U A;  2GST A;  4KUN A;  2IME A;  1TK5 B;  2RM6 A;  2GQK A;  4YH2 A;  2NTO A;  4IJI A;  1AAZ A;  2C0F A;  4JU5 A;  4OO4 A;  4ZB8 A;  3KGK A;  2FA4 A;  1FVJ A;  2TIR A;  4EF0 A;  1T8E B;  4QL7 A;  4JED A;  3P7X A;  3SWL A;  4ZIL A;  3OR5 A;  1YF1 A;  4XTS A;  2B7J A;  3DVX A;  2OJL A;  5A4U A;  3Q18 A;  1ERT A;  4L5O A;  4HS1 A;  2XBQ A;  3F63 A;  1XW5 A;  3FR6 A;  1K0N A;  2A2R A;  4RQX A;  3I69 A;  3NOF A;  2AJQ B;  5ECN B;  3HHV A;  1JZO A;  4AJ8 A;  3CRT A;  3F3Q A;  1GSD A;  4D73 A;  1PD2 1;  3UMA A;  4GSN A;  1J0F A;  2JAC A;  5J4U A;  2ALB A;  3D5J A;  3FZA A;  4WBJ A;  3BOA A;  5BMU A;  2XC2 A;  3TKS C;  5A5K A;  2YCD A;  9GSS A;  3D6I A;  5HR2 A;  4ECJ A;  4ACS A;  1MEK A;  22GS A;  5F06 A;  4MF7 A;  2P5Q A;  5IIZ A;  3EWL A;  5AIV A;  3TOT A;  3TCO A;  1O73 A;  5D96 A;  5COH A;  2IMD A;  1O7U A;  4O7H A;  2X4A A;  1K3Y A;  3VLN A;  2B5X A;  1V2A A;  4KCA A;  2JSY A;  2HZE A;  3TUE A;  4X43 A;  3G7Y A;  4HJM A;  4AGS A;  5ECO B;  1XOA A;  4I2U A;  1Q4J A;  3M9J A;  3WYW A;  3ZLP A;  2I3Y A;  1SU9 A;  2FHE A;  1GWC A;  2ON5 A;  2V6O A;  3LGC A;  4GSS A;  2GQL A;  1K0A A;  3GKK A;  2HSY A;  1AQW A;  4TXV A;  1XBS A;  1X9S B;  5ECH B;  3ZIJ A;  4IS0 A;  1OE7 A;  3QAV A;  2V41 A;  2DJJ A;  1S3R A;  2R5G A;  1UC7 A;  3BCK A;  1M9B A;  1PX7 A;  4TOP A;  2A4V A;  3ZL5 A;  3FY7 A;  1ERW A;  1N8J A;  1FO5 A;  3ZIV A;  1O85 A;  2C0G A;  1GTI A;  2E2G A;  3V1W A;  2I4A A;  2R0G A;  5HQP A;  4I2T A;  5LCZ A;  2X8C A;  1PL1 A;  1TTZ A;  1SK1 A;  3MSZ A;  6GSS A;  4MNN A;  2ES7 A;  1O8X A;  2K9F A;  4KAE A;  2B1K A;  4E8H A;  3EU3 A;  2HLS A;  2GDR A;  4MJB A;  3KMO A;  3O3T A;  3F4T A;  2O8V B;  2HRN A;  1GUK A;  1TK8 B;  3FYG A;  3IDV A;  3IHG A;  4BWS A;  1SD8 A;  1I5G A;  3WGE A;  2GGT A;  6GSY A;  2K18 A;  3UBL A;  2XHF A;  1THX A;  3GFK A;  3N9J A;  2NDO A;  1U87 A;  1Z6N A;  3RHB A;  2FWG A;  5KEJ A;  1GSF A;  2VO4 A;  1PN0 A;  1SJZ A;  4WF4 A;  3TJB A;  4BL7 A;  2L5O A;  3TKR A;  2GZZ A;  1YKA A;  4ZL8 A;  3DVW A;  5H5Q A;  3R3E A;  4EKZ A;  4PUA A;  4PQH A;  4AF2 A;  4GST A;  1F9M A;  1T00 A;  3ZIT A;  4P3Y B;  2LUS A;  4BA7 A;  1AIU A;  2REM A;  3VI7 A;  1S3D A;  2LV3 A;  3VWV A;  3DYR A;  4X0X A;  1QFN A;  3RPP A;  4O92 A;  4JR4 A;  4IBP A;  5DQS A;  5B7C A;  4BVY A;  1F3A A;  4XCS A;  4IN0 A;  1G6W A;  2O7K A;  5LD0 A;  4CY8 A;  1AQX A;  2FGX A;  4K1F A;  1XWK A;  2PMT A;  3ERF A;  2EIQ A;  1WJK A;  5IO0 A;  4XS4 A;  4ZL7 A;  1NM3 A;  4KB3 A;  1TRS A;  1TI3 A;  2HZF A;  1VRS D;  4BVY B;  5HR3 A;  3TRX A;  4MZB A;  3U5R E;  4EXJ A;  4EC0 A;  4WBR D;  3UL3 A;  4JZQ A;  4HZ2 A;  1AC1 A;  4G9H A;  1Y6E A;  2VOC A;  3HZ8 A;  5G5E A;  2X8G A;  1Z9H A;  3EC3 A;  4HSC X;  3C71 A;  5ELA A;  2HSM A;  4K7N A;  2B7K A;  1QGV A;  4MZC A;  2OBI A;  4YAV A;  5ID2 B;  4XRD A;  1A0F A;  1FHE A;  2YWI A;  1EZK A;  3GTU A;  3A2W A;  2YWM A;  2YWN A;  5C04 A;  2O87 A;  2N5A A;  1ZYE A;  2GT6 A;  5HFG A;  4ZBD A;  4H86 A;  3ME8 A;  2GSQ A;  3PH9 A;  3IC8 A;  1PKW A;  3KTB A;  2DJ2 A;  4GF0 A;  2KUC A;  3MNG A;  2JZT A;  5D8I A;  3APS A;  2XPE A;  4FYB A;  4V2N A;  5F07 A;  2A4H A;  3BBY A;  1TKD B;  1XZO A;  3GTU B;  1ERU A;  4PUF C;  2JU5 A;  1PFO A;  4GXZ A;  3HJM A;  2J9H A;  4Z2T A;  1J08 A;  2G0F A;  2LNS A;  2A2S A;  2LTK A;  4LL4 B;  1FG4 A;  4RI7 A;  2QC7 A;  4KE3 A;  3DML A;  5DVB A;  3G7J A;  4TKY A;  4POM A;  3F6D A;  3CRU A;  3K8N A;  2FD3 A;  4F82 A;  3ZVJ A;  2VD1 A;  1TP9 A;  5AIS A;  2H73 A;  2C1Y A;  4GRF A;  4I97 A;  2M46 A;  3GSS A;  1GSE A;  2X99 A;  1U3A A;  2BJX A;  3GST A;  2KLX A;  3H8Q A;  1X5E A;  4MA9 A;  4FH8 A;  2YV7 A;  3EVI A;  1A2M A;  4OCE A;  3UBK A;  3KP8 A;  5F05 A;  4ICY A;  19GS A;  4KCE A;  4IJ3 A;  1DE1 A;  4TR4 A;  5FWG A;  1XXU A;  3F9U A;  2VCQ A;  1SEN A;  2ON7 A;  2VM1 A;  2H1D A;  1B4Q A;  4RQR A;  2QA1 A;  3KXO A;  2MMN A;  5G1L A;  2IMI A;  3KEB A;  4ID0 A;  4BWQ A;  1H4O A;  1M2A A;  3M8N A;  5J41 A;  5FHI A;  1ILO A;  1B48 A;  2H75 A;  3EPT A;  4MJA A;  2P31 A;  2V32 A;  4K0G A;  3HVS A;  3Q6O A;  4WET A;  3W8J A;  2CVD A;  4HQS A;  1R26 A;  5D9V A;  1LU4 A;  3TB2 A;  1GSU A;  1GL8 A;  4Q5Q A;  3HVN A;  5JWR B;  4F2I A;  3KH9 A;  4QQ7 A;  4USS A;  3LSZ A;  2HNL A;  2LKU A;  4NMU A;  5GSS A;  1BJX A;  5ABR A;  1SKR B;  1A2J A;  2P0G A;  4IQ1 A;  4E8E A;  3MWH A;  5KN0 A;  4TR3 A;  3IPZ A;  4F9Z A;  1XOB A;  2HFD A;  3UVT A;  3LW9 A;  1GUM A;  3W6G A;  2FWH A;  1W89 A;  3UEM A;  4I6X A;  5CO3 A;  4TR0 A;  3L9S A;  4NV2 A;  2PGT A;  4OFT A;  2E0Q A;  4CDO A;  2IJY A;  2OE1 A;  2VL9 A;  5KOW A;  1RW1 A;  4NHZ A;  2YJH A;  4XS1 A;  3TDG A;  6GST A;  1R4W A;  1TI1 A;  3EIN A;  2K8S A;  4N0V A;  2MZC A;  1EEJ A;  1Z3E A;  2QA2 A;  5B6M A;  1AQV A;  3QR6 A;  2RUE A;  2OE0 A;  1A0R P;  2IMF A;  3SBC A;  3EYT A;  3LWA A;  2DBC A;  3TOU A;  4J56 E;  2C3Q A;  5BRT A;  2GS3 A;  3HXS A;  1KEB A;  4EUY A;  3H1N A;  2P5R A;  5F0G A;  3M1G A;  2AAW A;  3ZRE A;  3GMF A;  1BYE A;  4MMM A;  2LEG A;  1SK0 A;  4TXO B;  4HI7 A;  2R3X A;  4K8M A;  3F6F A;  1TRV A;  1WP0 A;  5C00 A;  1GSS A;  2NPB A;  2DJK A;  1LBK A;  1ABA A;  3ERG A;  3C8E A;  2IIY A;  2PVO C;  4V2L A;  2BMX A;  1O81 A;  1HNC A;  4YQU A;  1GLQ A;  1XG8 A;  3O76 A;  2GSS A;  4KDX A;  4MJC A;  1SKW B;  3VWU A;  1ZOF A;  2DJ1 A;  3U6V A;  4A5P A;  3ZTL A;  2C0E A;  2R2J A;  3M3M A;  2VLT A;  1F2E A;  5E59 A;  1JZD A;  2L6D A;  1OE8 A;  4PQI A;  4ML1 A;  4MH2 A;  1EGR A;  5G1K A;  1XCC A;  2DKI A;  1MTC A;  2IWT A;  2R0P A;  1JZW A;  3ZFB A;  4XS6 A;  1SYR A;  2H8L A;  1MDI A;  2VCV A;  4ZBA A;  1R5A A;  4L0U A;  3IR4 A;  4G2E A;  1EGO A;  3UAP A;  2H70 A;  5CRH A;  4Z2R A;  3DGQ A;  1T4Y A;  3TRP A;  6GSX A;  1V98 A;  4D73 B;  3HA9 A;  3KP9 A;  2GZP A;  1HYU A;  3GIX A;  4L5L A;  2L57 A;  4N11 A;  1QUW A;  4V1A p;  4PX1 A;  3S9F A;  4IHU A;  3VWW A;  2B1L A;  3VPT A;  4G19 A;  1X5C A;  3DRN A;  3IE3 A;  4G0L A;  3TJJ A;  3Q74 A;  1QQ2 A;  4Z2U A;  3HVX A;  1FB0 A;  1EOG A;  3KIJ A;  1VF4 A;  5IOX A;  3GUS A;  2HZE B;  1NSW A;  1A8Y A;  3HJP A;  2H76 A;  2A2P A;  4HZ4 A;  5G30 A;  1CQH A;  1Z5Y E;  3PGT A;  4PTS A;  1B9Y C;  1B4P A;  3FEU A;  3H79 A;  3RBT A;  5ELG A;  2HRA A;  2RUF A;  1Z7R A;  4DSS A;  1WIK A;  4TR1 A;  3C73 A;  4V1A g;  3IV4 A;  3TRQ A;  3ZFL A;  1S3A A;  4IKH A;  2YAN A;  5GZZ B;  3D4T A;  3F8U A;  2IN3 A;  3G7I A;  2D2Z A;  2IFQ A;  3TKP A;  10GS A;  1K0O A;  2WFC A;  1DBY A;  3L4N A;  4OD7 A;  1ZZY A;  3APQ A;  2DLX A;  5AGY A;  2H74 A;  4AJ7 A;  1JZR A;  3DD3 A;  3EMP A;  5B8B A;  1GTA A;  1O6J A;  1ZYN A;  2DSA A;  4KX4 A;  2HT9 A;  2MYG A;  3ISO A;  5CYY A;  3D4M A;  3DXB A;  6GSW A;  5DCH A;  2VCT A;  4JBB A;  2H1G A;  4QL9 A;  1R5P A;  2M72 A;  13GS A;  4OFN A;  3UJ1 A;  3GKN A;  1JHB A;  4Q5N A;  4WR4 A;  3P8W A;  3NZN A;  3RPN A;  1TRW A;  3KTL A;  1F37 A;  4PQ1 A;  3RAZ A;  2G2Q A;  4ML6 A;  1ZYP A;  2AHE A;  1KNG A;  5G31 A;  1GP1 A;  2N5F A;  3JCM L;  4TW5 A;  4X4J A;  5HFI A;  1K3L A;  2DIZ A;  2B5Y A;  1DSB A;  2L6C A;  3HDC A;  6GSV A;  4YAP A;  2WZ9 A;  4PNF A;  1V9W A;  4WF5 A;  1B9X C;  3P2A A;  3KH7 A;  4AJ6 A;  2AYT A;  2DMM A;  4FIW A;  2LRN A;  1T4Z A;  3ZZX A;  3QDN A;  2WCI A;  2XBI A;  4BL7 B;  1OC9 A;  2CVK A;  1TW9 A;  2VLV A;  1TU7 A;  2NVL A;  1ST9 A;  2JL4 A;  2GTU A;  2V2G A;  2R0C A;  4MP4 A;  3TKQ A;  1NHO A;  1T3B A;  3VWX A;  1G6Y A;  3LG6 A;  5KN3 A;  3EE2 A;  3EMX A;  1M2B A;  3GH9 A;  1S3C A;  5ENU A;  1Q98 A;  2R4V A;  3A3T A;  1XWC A;  1VGL A;  1M7T A;  1SL1 B;  1MD3 A;  1YF0 A;  3C7M A;  5G2Z A;  3W8S A;  1SJ6 A;  3FZ5 A;  12GS A;  2H72 A;  4BIK A;  1OC9 B;  4GLT A;  3CTF A;  2YNX A;  2HRF A;  3VK9 A;  2EC4 A;  5AN1 A;  2FLS A;  2HXK A;  4ZBB A;  1GUL A;  3HVV A;  4F03 A;  4MPF A;  7GSS A;  2FY6 A;  5FT3 A;  1C72 A;  5IMC A;  4EO3 A;  4XS4 B;  3QFA C;  1UVZ A;  5IM9 A;  3J7Y b;  2MMO A;  2VCX A;  3GUR A;  1VF2 A;  4F0C A;  3ZRD A;  4F0B A;  1XPV A;  1TDI A;  3WGD A;  4ZXG A;  3VFI A;  3MYD A;  4J2F A;  4POK A;  2DJ0 A;  3I9V 2;  20GS A;  4ECC A;  4TVE A;  3G9B A;  3N5O A;  1FOH A;  3ZML A;  3FKF A;  5IMA A;  1BG5 A;  2H6X A;  3UOM A;  3L9U A;  1I9D A;  4TRX A;  1K0C A;  3DKS A;  4OMV A;  1Y25 A;  3HCZ A;  1OC8 A;  18GS A;  3CMI A;  4KND A;  2K8V A;  2YN1 A;  2V1M A;  1XWB A;  2EIO A;  2LQQ A;  1BX9 A;  2H1B A;  1EV4 A;  1JLW A;  4BVX A;  1RQM A;  1KBN A;  3A2V A;  2PN8 A;  5EL8 A;  1U6T A;  2JZR A;  2MMA A;  2LS5 A;  4RUV A;  2J23 A;  4YKF A;  1YQ1 A;  4PNG A;  3FK8 A;  1XVW A;  2KP2 A;  4DSQ A;  2VL2 C;  3IAS 2;  3MDK A;  2WJU A;  2F8A A;  4O32 A;  2ZNM A;  3RDW A;  4MLY A;  2CA8 A;  11GS A;  5LNK e;  2AUV A;  1YEP A;  1AUC A;  3QOU A;  2HSH A;  2PVQ A;  2C3T A;  2GSR A;  3IOS A;  4HOJ A;  2CX3 A;  2JZS A;  3IBH A;  5J3R A;  5IPG A;  2PWJ A;  1FW1 A;  2LJA A;  5KN2 A;  2YP6 A;  4HU9 A;  1XFL A;  2F9S A;  4G0K A;  2ZCT A;  3E3E A;  4LMV A;  4NAX A;  5DBQ A;  2VAF A;  5D93 A;  2VM2 A;  1GTU A;  3BD2 A;  4OO5 A;  4XIH A;  5ECK B;  3WT1 A;  1XIY A;  4KF9 A;  1WRY A;  1ML6 A;  4HDE A;  5AIX A;  2B5E A;  1VF3 A;  5D9X A;  4PUR A;  1K3O A;  1FAA A;  5G5F A;  3CBU A;  2YPM A;  3L9V A;  2CZ3 A;  5DQY A;  5CRW A;  2HI7 A;  1A23 A;  3VI5 A;  2DML A;  4BPY A;  3KMN A;  2L4Q A;  14GS A;  3TJK A;  3QAW A;  5EVO A;  4KDU A;  4MF5 A;  3RHC A;  3GV1 A;  4HU7 A;  5CRG A;  5IQY A;  1F3B A;  3GH6 A;  4KH7 A;  3LFL A;  1SD9 A;  3ERW A;  5IMF A;  4WKW A;  2I81 A;  5DCG A;  2LST A;  3KD0 A;  1YJ6 A;  5IO2 A;  2TRC P;  2FWE A;  3I43 A;  1WMJ A;  2VCW A;  5CNW A;  5KOX A;  1YY7 A;  2RM5 A;  1XWA A;  3LQ7 A;  4EL1 A;  2CT6 A;  2E2M A;  3O6T A;  4K2X A;  4GQF A;  1PL2 A;  2GQM A;  2C0D A;  3WT2 A;  3F4R A;  1A24 A;  1V57 A;  3MAK A;  2OA7 A;  3UIW A;  2R6K A;  4I5Q A;  1U3I A;  4K5R A;  1VF1 A;  4EDZ A;  4KW6 A;  3L78 A;  2C3N A;  5CAX A;  3GA4 A;  2VL3 A;  1X0R A;  1H75 A;  1OVN A;  3AY8 A;  3TJG A;  2H6Y A;  1ON4 A;  1EEM A;  1ZYQ B;  1JFU A;  3LXZ A;  2OKA A;  3HD5 A;  1E6B A;  2OAD A;  1URM A;  1HD2 A;  1AXD A;  4CY6 A;  3A2X A;  2H0G A;  4FYU A;  1MD4 A;  2C4J A;  2CAQ A;  2DJ3 A;  4JRR A;  2UZ8 A;  3GX8 A;  1THO A;  2JSZ A;  1SL0 B;  2H0I A;  1SYX A;  4ZIJ A;  4I8B A;  5IMD A;  3GKX A;  1JLV A;  5JCG A;  1U88 A;  3ME7 A;  4WR5 A;  3VPQ A;  2CQ9 A;  3TJF A;  4DVC A;  4YKG A;  2QSI A;  4K2D A;  1KTE A;  1MDK A;  1ZL9 A;  3HY2 A;  1QMV A;  2KHP A;  4DEJ A;  2IL3 A;  1ZMA A;  1G0T A;  4RI6 A;  4WEY A;  1B8X A;  1HQO A;  2RLI A;  2H71 A;  2WB9 A;  3GN3 A;  5D9W A;  4XRA A;  1G7O A;  1EOH A;  1PA3 A;  1OC3 A;  2CZ2 A;  4X1U A;  4IQA A;  3IC4 A;  2YZH A;  1BED A;  4N0Z A;  3TGZ A;  2R37 A;  2HE3 A;  3D21 A;  5ECM B;  3CSJ A;  2X49 A;  3PPU A;  4OCF A;  2WRT A;  2K6V A;  3IK7 A;  3ZMK A;  2O89 A;  1SJI A;  3KM6 A;  1TJD A;  2VCZ A;  3J7Y k;  1FVK A;  3LYK A;  2H0H A;  5EPF A;  3PIN A;  2PBJ A;  3IA1 A;  3IXR A;  2YZU A;  4NHW A;  2QKE A;  2KP1 A;  1OKT A;  2JAD A;  1WPI A;  4YQV A;  2LNT A;  2Z9S A;  3GL3 A;  3C1R A;  1X9W B;  1LJR A;  3GL5 A;  17GS A;  1YDK A;  3IHQ A;  2MMZ A;  5IPH A;  1PGT A;  2HRK A;  2WDU A;  4ZL9 A;  1YZX A;  4KSO A;  3FMW A;  4IVF A;  1GTB A;  3APO A;  1F6M C;  4DSR A;  3UVH A;  4LMW A;  4MDC A;  1HNB A;  2PUK C;  4CW9 A;  1PKZ A;  1EV9 A;  3WD6 A;  2MBS A;  5B8A A;  5DAL A;  3KZQ A;  4JR6 A;  4HUA A;  4IP6 A;  2C8U A;  4N10 A;  3H93 A;  1BAY A;  2FCH A;  3EUR A;  2RII A;  1SL2 B;  2H6Z A;  1ERV A;  4DSS B;  4TR1 B;  4EIQ A;  2KOK A;  1FB6 A;  5ECR B;  4PGT A;  4IP1 A;  2IFQ B;  5DAL B;  5ECS A;  3QMX A;  4J57 E;  5B6N A;  1RK4 A;  2CV4 A;  5ECI B;  4OFM A;  2IMK A;  4GTU A;  4NWY A;  4EIP A;  3CYN A;  2X8H A;  3KJY A;  2MBT A;  4K5S A;  2QGV A;  2DIY A;  4FQU A;  1MDJ A;  1M2D A;  3KCM A;  3TKS E;  1V58 A;  1N2A A;  5JCU A;  3QPM A;  4NXI A;  4HJ2 A;  1ACV A;  4KA0 A;  4EDY A;  5IOW A;  3LXT A;  1OYJ A;  2LJR A;  2AV4 A;  5ECQ B;  1OAZ A;  2WS2 A;  2LQO A;  3DIE A;  2DKH A;  1T7P B;  5D9T A;  4K7O A;  5GAP D;  2L59 A;  1TOF A;  3LJR A;  5H5S A;  3HZ4 A;  2EIR A;  1O8W A;  2ZUP A;  4Q5R A;  4ILF A;  1EP8 A;  4PXO A;  5DJM A;  1TU8 A;  1NHY A;  4LLR A;  1GRX A;  4WXT A;  2B6M A;  16GS A;  1M3J A;  3UAR A;  2WUL A;  5INY A;  1EWX A;  2YJ7 A;  3L0H A;  2FUG 2;  4GWR A;  4YQM A;  1PX6 A;  3IAM 2;  1A2L A;  1J9B A;  2FNO A;  2WGR A;  1X9M B;  2VD0 A;  1IYI A;  1PSQ A;  1PRX A;  2F8F A;  1PQN A;  2M80 A; 
#chains in the Genus database with same CATH homology
 2GLR A;  1GNW A;  3LYP A;  3F4S A;  5ID2 A;  2PPT A;  2CAI A;  1W4V A;  4Z7X A;  1V40 A;  3C1S A;  4K0N A;  2I9H A;  2L5L A;  5ECL B;  5GAN D;  1M9A A;  2L4C A;  5E4W A;  4K6X A;  2CX4 A;  3GX0 A;  5JWO B;  4G0I A;  2VL2 A;  4KSM A;  3F3R A;  2GT5 A;  3BJ5 A;  2O85 A;  1XVQ A;  4GQC A;  3ZVJ D;  4IEL A;  3CSI A;  1GSY A;  2YWO A;  5H5R A;  2FWF A;  3A5W A;  3US3 A;  1DE2 A;  1GSQ A;  1BQ7 A;  1QXH A;  2CVB A;  4MCU A;  4GCI A;  3WGX A;  1ZCP A;  3QFB C;  5EY6 A;  3ZYW A;  3D0Z A;  1USB A;  4ZB6 A;  3F0I A;  5J9B A;  5IMV A;  1E2Y A;  1CQG A;  1GNE A;  4MPG A;  3PR8 A;  3HYP A;  2AB6 A;  4K7I A;  3LEF A;  4LA1 A;  3BCI A;  1Z6M A;  3D22 A;  2GZY A;  1G7E A;  4LL1 B;  4NPB A;  4MK3 A;  8GSS A;  4G10 A;  5HR0 A;  1HNA A;  2E7P A;  4POB A;  4XHM A;  5CP1 A;  2F3M A;  1R7H A;  4KGI A;  2N5B A;  1DUG A;  1TK0 B;  2BTO T;  3H4K A;  3M9K A;  3DEX A;  4OWY A;  3FR3 A;  4HEA 2;  4BVX B;  4ISD A;  4MH3 A;  2FA8 A;  5IMZ A;  5A4W A;  1EP7 A;  1UN2 A;  5KN1 A;  3FRC A;  2GVP A;  5HR1 A;  2I1U A;  1QK8 A;  1YEX A;  4ECB A;  3ED3 A;  1WOU A;  3E9J B;  1X5D A;  3CSH A;  1NW2 A;  2LRT A;  3HJO A;  5DAK A;  3GKM A;  4K9Z A;  5D73 A;  3IK9 A;  5F8B A;  3HKR A;  1Z7P A;  3LOR A;  4L0W A;  3QAG A;  4IW9 A;  4FO5 A;  1PN9 A;  4ZB9 A;  1K0D A;  1SKS B;  2C80 A;  1K0B A;  2OAC A;  2VLU A;  4ULX A;  2DC5 A;  3I6A A;  2X64 A;  3Q19 A;  4O5U A;  4EE0 A;  3EU4 A;  5DAK B;  1GUH A;  3FZ4 A;  1AW9 A;  1GLP A;  3IRA A;  4IGJ A;  2OBK A;  2B3S A;  4MAB A;  5J9C A;  1GH2 A;  2HYX A;  5CRD A;  3GNJ A;  2NBS A;  3P90 A;  3GYK A;  2OE3 A;  1XW6 A;  2H19 A;  2H01 A;  2LRC A;  3M0F A;  4Q5F A;  3CTG A;  1XWG A;  3MIX A;  5DDL A;  4O5R A;  2TRX A;  5ECP B;  4NV5 A;  4HQZ A;  2V6K A;  1TXX A;  1TRU A;  3VUR A;  5JCW A;  4JE1 A;  2H66 A;  1K0M A;  2H1A A;  5L71 A;  1M0U A;  4MF6 A;  1XW9 A;  2IPA A;  2LJK A;  5GST A;  1IYH A;  3CXG A;  4KDY A;  4ECI A;  4FYC A;  1UA5 A;  6GSU A;  1YKC A;  5HFK A;  3GHA A;  1A8L A;  4V2M A;  1OKD A;  3DWV A;  3FHK A;  5A4V A;  2H30 A;  2PER A;  3FZ9 A;  1M99 A;  2YV9 A;  2XPD A;  4MJE A;  5DJL A;  2F51 A;  3QCP A;  1SK2 A;  4TN8 A;  5CRE A;  4CHS A;  3NIV A;  2VUP A;  4N30 A;  4TXO A;  1FOV A;  1WE0 A;  2VIM A;  5J5N A;  3A5I A;  3TKS A;  4O5Q A;  4POL A;  4MZW A;  3FW2 A;  3GRX A;  2PU9 C;  3QD9 A;  1PMT A;  4L8E A;  2YOI A;  4EVM A;  3FR9 A;  1T1V A;  1WWJ A;  3R2Q A;  5JWQ B;  1ZGN A;  3E0U A;  2GST A;  4KUN A;  2IME A;  1TK5 B;  2RM6 A;  2GQK A;  4YH2 A;  2NTO A;  4IJI A;  1AAZ A;  2C0F A;  4JU5 A;  4OO4 A;  4ZB8 A;  3KGK A;  2FA4 A;  1FVJ A;  2TIR A;  4EF0 A;  1T8E B;  4QL7 A;  4JED A;  3P7X A;  3SWL A;  4ZIL A;  3OR5 A;  1YF1 A;  4XTS A;  2B7J A;  3DVX A;  2OJL A;  5A4U A;  3Q18 A;  1ERT A;  4L5O A;  4HS1 A;  2XBQ A;  3F63 A;  1XW5 A;  3FR6 A;  1K0N A;  2A2R A;  4RQX A;  3I69 A;  3NOF A;  2AJQ B;  5ECN B;  3HHV A;  1JZO A;  4AJ8 A;  3CRT A;  3F3Q A;  1GSD A;  4D73 A;  1PD2 1;  3UMA A;  4GSN A;  1J0F A;  2JAC A;  5J4U A;  2ALB A;  3D5J A;  3FZA A;  4WBJ A;  3BOA A;  5BMU A;  2XC2 A;  3TKS C;  5A5K A;  2YCD A;  9GSS A;  3D6I A;  5HR2 A;  4ECJ A;  4ACS A;  1MEK A;  22GS A;  5F06 A;  4MF7 A;  2P5Q A;  5IIZ A;  3EWL A;  5AIV A;  3TOT A;  3TCO A;  1O73 A;  5D96 A;  5COH A;  2IMD A;  1O7U A;  4O7H A;  2X4A A;  1K3Y A;  3VLN A;  2B5X A;  1V2A A;  4KCA A;  2JSY A;  2HZE A;  3TUE A;  4X43 A;  3G7Y A;  4HJM A;  4AGS A;  5ECO B;  1XOA A;  4I2U A;  1Q4J A;  3M9J A;  3WYW A;  3ZLP A;  2I3Y A;  1SU9 A;  2FHE A;  1GWC A;  2ON5 A;  2V6O A;  3LGC A;  4GSS A;  2GQL A;  1K0A A;  3GKK A;  2HSY A;  1AQW A;  4TXV A;  1XBS A;  1X9S B;  5ECH B;  3ZIJ A;  4IS0 A;  1OE7 A;  3QAV A;  2V41 A;  2DJJ A;  2R5G A;  1UC7 A;  3BCK A;  1M9B A;  1PX7 A;  4TOP A;  2A4V A;  3ZL5 A;  3FY7 A;  1ERW A;  1N8J A;  1FO5 A;  3ZIV A;  1O85 A;  2C0G A;  1GTI A;  2E2G A;  3V1W A;  2I4A A;  2R0G A;  5HQP A;  4I2T A;  5LCZ A;  2X8C A;  1PL1 A;  1TTZ A;  1SK1 A;  3MSZ A;  6GSS A;  4MNN A;  2ES7 A;  1O8X A;  2K9F A;  4KAE A;  2B1K A;  4E8H A;  3EU3 A;  2HLS A;  2GDR A;  4MJB A;  3KMO A;  3O3T A;  3F4T A;  2O8V B;  2HRN A;  1GUK A;  1TK8 B;  3FYG A;  3IDV A;  3IHG A;  4BWS A;  1SD8 A;  1I5G A;  3WGE A;  2GGT A;  6GSY A;  2K18 A;  3UBL A;  2XHF A;  1THX A;  3GFK A;  3N9J A;  2NDO A;  1U87 A;  1Z6N A;  3RHB A;  2FWG A;  5KEJ A;  1GSF A;  2VO4 A;  1PN0 A;  1SJZ A;  4WF4 A;  3TJB A;  4BL7 A;  2L5O A;  3TKR A;  2GZZ A;  1YKA A;  4ZL8 A;  3DVW A;  5H5Q A;  3R3E A;  4EKZ A;  4PUA A;  4PQH A;  4AF2 A;  4GST A;  1F9M A;  1T00 A;  3ZIT A;  4P3Y B;  2LUS A;  4BA7 A;  1AIU A;  2REM A;  3VI7 A;  1S3D A;  2LV3 A;  3VWV A;  3DYR A;  4X0X A;  1QFN A;  3RPP A;  4O92 A;  4JR4 A;  4IBP A;  5DQS A;  5B7C A;  4BVY A;  1F3A A;  4XCS A;  4IN0 A;  1G6W A;  2O7K A;  5LD0 A;  4CY8 A;  1AQX A;  2FGX A;  4K1F A;  1XWK A;  2PMT A;  3ERF A;  2EIQ A;  1WJK A;  5IO0 A;  4XS4 A;  4ZL7 A;  1NM3 A;  4KB3 A;  1TRS A;  1TI3 A;  2HZF A;  1VRS D;  4BVY B;  5HR3 A;  3TRX A;  4MZB A;  3U5R E;  4EXJ A;  4EC0 A;  4WBR D;  3UL3 A;  4JZQ A;  4HZ2 A;  1AC1 A;  4G9H A;  1Y6E A;  2VOC A;  3HZ8 A;  5G5E A;  2X8G A;  1Z9H A;  3EC3 A;  3C71 A;  5ELA A;  2HSM A;  4K7N A;  2B7K A;  1QGV A;  4MZC A;  2OBI A;  4YAV A;  5ID2 B;  4XRD A;  1A0F A;  1FHE A;  2YWI A;  1EZK A;  3GTU A;  3A2W A;  2YWM A;  2YWN A;  5C04 A;  2O87 A;  2N5A A;  1ZYE A;  2GT6 A;  5HFG A;  4ZBD A;  4H86 A;  3ME8 A;  2GSQ A;  3PH9 A;  3IC8 A;  1PKW A;  3KTB A;  2DJ2 A;  4GF0 A;  2KUC A;  3MNG A;  2JZT A;  5D8I A;  3APS A;  2XPE A;  4FYB A;  4V2N A;  5F07 A;  2A4H A;  3BBY A;  1TKD B;  1XZO A;  3GTU B;  1ERU A;  4PUF C;  2JU5 A;  4GXZ A;  3HJM A;  2J9H A;  4Z2T A;  1J08 A;  2G0F A;  2LNS A;  2A2S A;  2LTK A;  4LL4 B;  1FG4 A;  4RI7 A;  2QC7 A;  4KE3 A;  3DML A;  5DVB A;  3G7J A;  4TKY A;  4POM A;  3F6D A;  3CRU A;  3K8N A;  2FD3 A;  4F82 A;  3ZVJ A;  2VD1 A;  1TP9 A;  5AIS A;  2H73 A;  2C1Y A;  4GRF A;  4I97 A;  2M46 A;  3GSS A;  1GSE A;  2X99 A;  1U3A A;  2BJX A;  3GST A;  2KLX A;  3H8Q A;  1X5E A;  4MA9 A;  4FH8 A;  2YV7 A;  3EVI A;  1A2M A;  4OCE A;  3UBK A;  3KP8 A;  5F05 A;  4ICY A;  19GS A;  4KCE A;  4IJ3 A;  1DE1 A;  4TR4 A;  5FWG A;  1XXU A;  3F9U A;  2VCQ A;  1SEN A;  2ON7 A;  2VM1 A;  2H1D A;  1B4Q A;  4RQR A;  2QA1 A;  3KXO A;  2MMN A;  5G1L A;  2IMI A;  3KEB A;  4ID0 A;  4BWQ A;  1H4O A;  1M2A A;  3M8N A;  5J41 A;  5FHI A;  1ILO A;  1B48 A;  2H75 A;  3EPT A;  4MJA A;  2P31 A;  2V32 A;  4K0G A;  3HVS A;  3Q6O A;  4WET A;  3W8J A;  2CVD A;  4HQS A;  1R26 A;  5D9V A;  1LU4 A;  3TB2 A;  1GSU A;  1GL8 A;  4Q5Q A;  5JWR B;  4F2I A;  3KH9 A;  4QQ7 A;  4USS A;  3LSZ A;  2HNL A;  2LKU A;  4NMU A;  5GSS A;  1BJX A;  5ABR A;  1SKR B;  1A2J A;  2P0G A;  4IQ1 A;  4E8E A;  3MWH A;  5KN0 A;  4TR3 A;  3IPZ A;  4F9Z A;  1XOB A;  2HFD A;  3UVT A;  3LW9 A;  1GUM A;  3W6G A;  2FWH A;  1W89 A;  3UEM A;  4I6X A;  5CO3 A;  4TR0 A;  3L9S A;  4NV2 A;  2PGT A;  4OFT A;  2E0Q A;  4CDO A;  2IJY A;  2OE1 A;  2VL9 A;  5KOW A;  1RW1 A;  4NHZ A;  2YJH A;  4XS1 A;  3TDG A;  6GST A;  1R4W A;  1TI1 A;  3EIN A;  2K8S A;  4N0V A;  2MZC A;  1EEJ A;  1Z3E A;  2QA2 A;  5B6M A;  1AQV A;  3QR6 A;  2RUE A;  2OE0 A;  1A0R P;  2IMF A;  3SBC A;  3EYT A;  3LWA A;  2DBC A;  3TOU A;  4J56 E;  2C3Q A;  5BRT A;  2GS3 A;  3HXS A;  1KEB A;  4EUY A;  3H1N A;  2P5R A;  5F0G A;  3M1G A;  2AAW A;  3ZRE A;  3GMF A;  1BYE A;  4MMM A;  2LEG A;  1SK0 A;  4TXO B;  4HI7 A;  2R3X A;  4K8M A;  3F6F A;  1TRV A;  1WP0 A;  5C00 A;  1GSS A;  2NPB A;  2DJK A;  1LBK A;  1ABA A;  3ERG A;  3C8E A;  2IIY A;  2PVO C;  4V2L A;  2BMX A;  1O81 A;  1HNC A;  4YQU A;  1GLQ A;  3O76 A;  2GSS A;  4KDX A;  4MJC A;  1SKW B;  3VWU A;  1ZOF A;  2DJ1 A;  3U6V A;  4A5P A;  3ZTL A;  2C0E A;  2R2J A;  3M3M A;  2VLT A;  1F2E A;  5E59 A;  1JZD A;  2L6D A;  1OE8 A;  4PQI A;  4ML1 A;  4MH2 A;  1EGR A;  5G1K A;  1XCC A;  2DKI A;  1MTC A;  2IWT A;  2R0P A;  1JZW A;  3ZFB A;  4XS6 A;  1SYR A;  2H8L A;  1MDI A;  2VCV A;  4ZBA A;  1R5A A;  4L0U A;  3IR4 A;  4G2E A;  1EGO A;  3UAP A;  2H70 A;  5CRH A;  4Z2R A;  3DGQ A;  1T4Y A;  3TRP A;  6GSX A;  1V98 A;  4D73 B;  3HA9 A;  3KP9 A;  2GZP A;  1HYU A;  3GIX A;  4L5L A;  2L57 A;  4N11 A;  1QUW A;  4V1A p;  4PX1 A;  3S9F A;  4IHU A;  3VWW A;  2B1L A;  3VPT A;  4G19 A;  1X5C A;  3DRN A;  3IE3 A;  4G0L A;  3TJJ A;  3Q74 A;  1QQ2 A;  4Z2U A;  3HVX A;  1FB0 A;  1EOG A;  3KIJ A;  1VF4 A;  5IOX A;  3GUS A;  2HZE B;  1NSW A;  1A8Y A;  3HJP A;  2H76 A;  2A2P A;  4HZ4 A;  5G30 A;  1CQH A;  1Z5Y E;  3PGT A;  4PTS A;  1B9Y C;  1B4P A;  3FEU A;  3H79 A;  3RBT A;  5ELG A;  2HRA A;  2RUF A;  1Z7R A;  4DSS A;  1WIK A;  4TR1 A;  3C73 A;  4V1A g;  3IV4 A;  3TRQ A;  3ZFL A;  1S3A A;  4IKH A;  2YAN A;  5GZZ B;  3D4T A;  3F8U A;  2IN3 A;  3G7I A;  2D2Z A;  2IFQ A;  3TKP A;  10GS A;  1K0O A;  2WFC A;  1DBY A;  3L4N A;  4OD7 A;  1ZZY A;  3APQ A;  2DLX A;  5AGY A;  2H74 A;  4AJ7 A;  1JZR A;  3DD3 A;  3EMP A;  5B8B A;  1GTA A;  1O6J A;  1ZYN A;  2DSA A;  4KX4 A;  2HT9 A;  2MYG A;  3ISO A;  5CYY A;  3D4M A;  3DXB A;  6GSW A;  5DCH A;  2VCT A;  4JBB A;  2H1G A;  4QL9 A;  1R5P A;  2M72 A;  13GS A;  4OFN A;  3UJ1 A;  3GKN A;  1JHB A;  4Q5N A;  4WR4 A;  3P8W A;  3NZN A;  3RPN A;  1TRW A;  3KTL A;  1F37 A;  4PQ1 A;  3RAZ A;  2G2Q A;  4ML6 A;  1ZYP A;  2AHE A;  1KNG A;  5G31 A;  1GP1 A;  2N5F A;  3JCM L;  4TW5 A;  4X4J A;  5HFI A;  1K3L A;  2DIZ A;  2B5Y A;  1DSB A;  2L6C A;  3HDC A;  6GSV A;  4YAP A;  2WZ9 A;  4PNF A;  1V9W A;  4WF5 A;  1B9X C;  3P2A A;  3KH7 A;  4AJ6 A;  2AYT A;  2DMM A;  4FIW A;  2LRN A;  1T4Z A;  3ZZX A;  3QDN A;  2WCI A;  2XBI A;  4BL7 B;  1OC9 A;  2CVK A;  1TW9 A;  2VLV A;  1TU7 A;  2NVL A;  1ST9 A;  2JL4 A;  2GTU A;  2V2G A;  2R0C A;  4MP4 A;  3TKQ A;  1NHO A;  1T3B A;  3VWX A;  1G6Y A;  3LG6 A;  5KN3 A;  3EE2 A;  3EMX A;  1M2B A;  3GH9 A;  1S3C A;  5ENU A;  1Q98 A;  2R4V A;  3A3T A;  1XWC A;  1VGL A;  1M7T A;  1SL1 B;  1MD3 A;  1YF0 A;  3C7M A;  5G2Z A;  3W8S A;  1SJ6 A;  3FZ5 A;  12GS A;  2H72 A;  1OC9 B;  4GLT A;  3CTF A;  2YNX A;  2HRF A;  3VK9 A;  2EC4 A;  5AN1 A;  2FLS A;  2HXK A;  4ZBB A;  1GUL A;  3HVV A;  4F03 A;  4MPF A;  7GSS A;  2FY6 A;  5FT3 A;  1C72 A;  5IMC A;  4EO3 A;  4XS4 B;  3QFA C;  1UVZ A;  5IM9 A;  3J7Y b;  2MMO A;  2VCX A;  3GUR A;  1VF2 A;  4F0C A;  3ZRD A;  4F0B A;  1XPV A;  1TDI A;  3WGD A;  4ZXG A;  3VFI A;  3MYD A;  4J2F A;  4POK A;  2DJ0 A;  3I9V 2;  20GS A;  4ECC A;  4TVE A;  3G9B A;  3N5O A;  1FOH A;  3ZML A;  3FKF A;  5IMA A;  1BG5 A;  2H6X A;  3UOM A;  3L9U A;  1I9D A;  4TRX A;  1K0C A;  3DKS A;  4OMV A;  1Y25 A;  3HCZ A;  1OC8 A;  18GS A;  3CMI A;  4KND A;  2K8V A;  2YN1 A;  2V1M A;  1XWB A;  2EIO A;  2LQQ A;  1BX9 A;  2H1B A;  1EV4 A;  1JLW A;  4BVX A;  1RQM A;  1KBN A;  3A2V A;  2PN8 A;  5EL8 A;  1U6T A;  2JZR A;  2MMA A;  2LS5 A;  4RUV A;  2J23 A;  4YKF A;  1YQ1 A;  4PNG A;  3FK8 A;  1XVW A;  2KP2 A;  4DSQ A;  2VL2 C;  3IAS 2;  3MDK A;  2WJU A;  2F8A A;  4O32 A;  2ZNM A;  3RDW A;  4MLY A;  2CA8 A;  11GS A;  5LNK e;  2AUV A;  1YEP A;  1AUC A;  3QOU A;  2HSH A;  2PVQ A;  2C3T A;  2GSR A;  3IOS A;  4HOJ A;  2CX3 A;  2JZS A;  3IBH A;  5J3R A;  5IPG A;  2PWJ A;  1FW1 A;  2LJA A;  5KN2 A;  2YP6 A;  4HU9 A;  1XFL A;  2F9S A;  4G0K A;  2ZCT A;  3E3E A;  4LMV A;  4NAX A;  5DBQ A;  2VAF A;  5D93 A;  2VM2 A;  1GTU A;  3BD2 A;  4OO5 A;  4XIH A;  5ECK B;  3WT1 A;  1XIY A;  4KF9 A;  1WRY A;  1ML6 A;  4HDE A;  5AIX A;  2B5E A;  1VF3 A;  5D9X A;  4PUR A;  1K3O A;  1FAA A;  5G5F A;  3CBU A;  2YPM A;  3L9V A;  2CZ3 A;  5DQY A;  5CRW A;  2HI7 A;  1A23 A;  3VI5 A;  2DML A;  4BPY A;  3KMN A;  2L4Q A;  14GS A;  3TJK A;  3QAW A;  5EVO A;  4KDU A;  4MF5 A;  3RHC A;  3GV1 A;  4HU7 A;  5CRG A;  5IQY A;  1F3B A;  3GH6 A;  4KH7 A;  3LFL A;  1SD9 A;  3ERW A;  5IMF A;  4WKW A;  2I81 A;  5DCG A;  2LST A;  3KD0 A;  1YJ6 A;  5IO2 A;  2TRC P;  2FWE A;  3I43 A;  1WMJ A;  2VCW A;  5CNW A;  5KOX A;  1YY7 A;  2RM5 A;  1XWA A;  3LQ7 A;  4EL1 A;  2CT6 A;  2E2M A;  3O6T A;  4K2X A;  4GQF A;  1PL2 A;  2GQM A;  2C0D A;  3WT2 A;  3F4R A;  1A24 A;  1V57 A;  3MAK A;  2OA7 A;  3UIW A;  2R6K A;  4I5Q A;  1U3I A;  4K5R A;  1VF1 A;  4EDZ A;  4KW6 A;  3L78 A;  2C3N A;  5CAX A;  3GA4 A;  2VL3 A;  1X0R A;  1H75 A;  1OVN A;  3AY8 A;  3TJG A;  2H6Y A;  1ON4 A;  1EEM A;  1ZYQ B;  1JFU A;  3LXZ A;  2OKA A;  3HD5 A;  1E6B A;  2OAD A;  1URM A;  1HD2 A;  1AXD A;  4CY6 A;  3A2X A;  2H0G A;  4FYU A;  1MD4 A;  2C4J A;  2CAQ A;  2DJ3 A;  4JRR A;  2UZ8 A;  3GX8 A;  1THO A;  2JSZ A;  1SL0 B;  2H0I A;  1SYX A;  4ZIJ A;  4I8B A;  5IMD A;  3GKX A;  1JLV A;  5JCG A;  1U88 A;  3ME7 A;  4WR5 A;  3VPQ A;  2CQ9 A;  3TJF A;  4DVC A;  4YKG A;  2QSI A;  4K2D A;  1KTE A;  1MDK A;  1ZL9 A;  3HY2 A;  1QMV A;  2KHP A;  4DEJ A;  2IL3 A;  1ZMA A;  1G0T A;  4RI6 A;  4WEY A;  1B8X A;  1HQO A;  2RLI A;  2H71 A;  2WB9 A;  3GN3 A;  5D9W A;  4XRA A;  1G7O A;  1EOH A;  1PA3 A;  1OC3 A;  2CZ2 A;  4X1U A;  4IQA A;  3IC4 A;  2YZH A;  1BED A;  4N0Z A;  3TGZ A;  2R37 A;  2HE3 A;  3D21 A;  5ECM B;  3CSJ A;  2X49 A;  3PPU A;  4OCF A;  2WRT A;  2K6V A;  3IK7 A;  3ZMK A;  2O89 A;  1SJI A;  3KM6 A;  1TJD A;  2VCZ A;  3J7Y k;  1FVK A;  3LYK A;  2H0H A;  5EPF A;  3PIN A;  2PBJ A;  3IA1 A;  3IXR A;  2YZU A;  4NHW A;  2QKE A;  2KP1 A;  1OKT A;  2JAD A;  1WPI A;  4YQV A;  2LNT A;  2Z9S A;  3GL3 A;  3C1R A;  1X9W B;  1LJR A;  3GL5 A;  17GS A;  1YDK A;  3IHQ A;  2MMZ A;  5IPH A;  1PGT A;  2HRK A;  2WDU A;  4ZL9 A;  1YZX A;  4KSO A;  3FMW A;  4IVF A;  1GTB A;  3APO A;  1F6M C;  4DSR A;  3UVH A;  4LMW A;  4MDC A;  1HNB A;  2PUK C;  4CW9 A;  1PKZ A;  1EV9 A;  3WD6 A;  2MBS A;  5B8A A;  5DAL A;  3KZQ A;  4JR6 A;  4HUA A;  4IP6 A;  2C8U A;  4N10 A;  3H93 A;  1BAY A;  2FCH A;  3EUR A;  2RII A;  1SL2 B;  2H6Z A;  1ERV A;  4DSS B;  4TR1 B;  4EIQ A;  2KOK A;  1FB6 A;  5ECR B;  4PGT A;  4IP1 A;  2IFQ B;  5DAL B;  5ECS A;  3QMX A;  4J57 E;  5B6N A;  1RK4 A;  2CV4 A;  5ECI B;  4OFM A;  2IMK A;  4GTU A;  4NWY A;  4EIP A;  3CYN A;  2X8H A;  3KJY A;  2MBT A;  4K5S A;  2QGV A;  2DIY A;  4FQU A;  1MDJ A;  1M2D A;  3KCM A;  3TKS E;  1V58 A;  1N2A A;  5JCU A;  3QPM A;  4NXI A;  4HJ2 A;  1ACV A;  4KA0 A;  4EDY A;  5IOW A;  3LXT A;  1OYJ A;  2LJR A;  2AV4 A;  5ECQ B;  1OAZ A;  2WS2 A;  2LQO A;  3DIE A;  2DKH A;  1T7P B;  5D9T A;  4K7O A;  5GAP D;  2L59 A;  1TOF A;  3LJR A;  5H5S A;  3HZ4 A;  2EIR A;  1O8W A;  2ZUP A;  4Q5R A;  4ILF A;  1EP8 A;  4PXO A;  5DJM A;  1TU8 A;  1NHY A;  4LLR A;  1GRX A;  4WXT A;  2B6M A;  16GS A;  3UAR A;  2WUL A;  5INY A;  1EWX A;  2YJ7 A;  3L0H A;  2FUG 2;  4GWR A;  4YQM A;  1PX6 A;  3IAM 2;  1A2L A;  1J9B A;  2FNO A;  2WGR A;  1X9M B;  2VD0 A;  1IYI A;  1PSQ A;  1PRX A;  2F8F A;  1PQN A;  2M80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...