2B7KA

Crystal structure of yeast sco1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
155
Chain Sequence
GKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO1 protein
publication title Crystal structure of yeast Sco1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 46
structure length 155
sequence length 169
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b7kA00
4I2TA 1ST9A 2VM1A 1AQWA 3M1GA 4E8HA 3QPMA 4IKHA 5G30A 1YJ6A 4RQXA 2G2QA 3G7IA 1ZYQB 1OC9A 5COHA 1WWJA 4TR0A 3SWLA 1U88A 3BJ5A 3F8UA 3GKMA 3LYKA 3F9UA 3KMOA 1K0CA 2YWNA 4ULXA 2BMXA 3CMIA 3BD2A 3VPTA 2JZRA 2VCZA 3NIVA 3GTUA 3HKRA 3UIWA 3UJ1A 1MTCA 2LV3A 2L6CA 2XBIA 3FZ9A 1GUHA 1TW9A 3A2VA 2EIRA 4JE1A 5J9CA 4TXOA 1A8YA 1M7TA 3RPNA 1AIUA 1EV4A 5EY6A 4TW5A 4RI6A 1DBYA 1IYIA 4RI7A 1Z5YE 4F0CA 1F37A 2GSTA 2OACA 1YEPA 1T3BA 4L5LA 1DE2A 1WP0A 1PGTA 2OE3A 3LYPA 2HT9A 17GSA 1EP8A 5D9TA 1OAZA 1SYXA 2OBKA 4EC0A 2IPAA 1H75A 1I5GA 4EXJA 3L9VA 2L59A 5LD0A 4GTUA 3AY8A 1F6MC 5JWRB 5G1LA 1K0MA 1WOUA 2ZUPA 2L5OA 4K6XA 5HFIA 2IMKA 2YP6A 3F3QA 4O7HA 1EOGA 2LRCA 1X9MB 1KEBA 1G6WA 5AIXA 1QQ2A 4WF5A 4IBPA 5GSSA 2F8FA 2GVPA 3KP9A 5J9BA 3CSHA 3P2AA 1MD3A 1GL8A 4JEDA 3QCPA 5D9VA 2VLUA 2H0GA 4OO5A 2VCTA 2OE0A 1S3DA 1Q4JA 4RQRA 1LU4A 4GXZA 1WIKA 5A4UA 2HLSA 2GZPA 1YKCA 5INYA 3IAS2 4KSOA 2IFQA 2MBSA 3F4TA 4DEJA 4EE0A 1SD9A 2IMDA 5EVOA 2ON5A 1HD2A 1XBSA 3CSJA 3IK7A 3FR9A 4TN8A 3F6DA 3TKQA 4WR4A 2CV4A 4KW6A 4KA0A 3VWWA 2FWFA 5D96A 3GSSA 4BPYA 1K3YA 5J3RA 3KTBA 1TXXA 2P5RA 2KHPA 2CAQA 2J23A 2FHEA 4Q5NA 2C0EA 2IMFA 1AAZA 3UAPA 3TKSE 1XZOA 5HFKA 2RM6A 2E7PA 1J9BA 4AF2A 4OCFA 1YF1A 5CRHA 4MP4A 2MBTA 4TR3A 2F9SA 3VWVA 2QC7A 4OCEA 2R5GA 1M2AA 4FIWA 5C04A 3APOA 1U87A 2J9HA 1SL1B 1B48A 2NBSA 3LWAA 2F51A 4ZIJA 3TJJA 2GSSA 4GCIA 3QFBC 2N5AA 1GP1A 4TRXA 1XWAA 2HE3A 3GURA 2B3SA 2LSTA 3L0HA 2HZEB 3C1SA 1YDKA 3DD3A 2VO4A 3D0ZA 2VUPA 4L0WA 3APSA 4OFMA 3IRAA 1ERTA 4IGJA 4FH8A 2DMMA 4PXOA 2HXKA 1M9BA 5ECMB 3G7JA 4OWYA 4XS4A 18GSA 3UVHA 2CVBA 1PQNA 3KP8A 4MZWA 4KCAA 1BQ7A 4WF4A 3BBYA 3IC4A 2X8CA 6GSYA 3L78A 5CRDA 1EOHA 1YKAA 1SU9A 4MK3A 2K18A 3LJRA 1O81A 3KMNA 1FO5A 1QK8A 3DRNA 1G0TA 5CREA 2VL2A 5ECLB 3ZFLA 1M2DA 3A3TA 2C8UA 1X5CA 4D73B 4ZBBA 5HR0A 3A2XA 3FW2A 3RHBA 3HVSA 4MCUA 4YQUA 2FWHA 1ML6A 4ZL8A 4G9HA 1MEKA 1JLVA 2EIQA 3UOMA 3KJYA 4I6XA 2D2ZA 2E2GA 1V9WA 3HJPA 1K0AA 1X9SB 3VLNA 3UARA 1BYEA 3ZZXA 2YWOA 1K0NA 3M3MA 4JR4A 5ECSA 2HFDA 5DVBA 2GSQA 5ECKB 1IYHA 1G7OA 3QAGA 1OC8A 4GSTA 5GAND 2NDOA 4ZBAA 1A24A 1NSWA 3VWUA 4K0NA 4IQ1A 4PNGA 4F82A 3C7MA 2H75A 1GTIA 1JLWA 5HR3A 2O7KA 3VK9A 5GSTA 1E2YA 3Q19A 4K8MA 4IQAA 3MAKA 4HEA2 2JZTA 1XVWA 2CQ9A 2GS3A 1TRWA 2GQLA 2VL2C 4PNFA 3CRUA 2YV7A 5F07A 2PGTA 2FA4A 4F03A 4MF6A 3GL5A 2PVOC 2VCXA 2H1DA 4HS1A 3TRPA 1FAAA 1FHEA 1ERWA 2C0FA 1HNBA 2YNXA 5IO0A 4IP6A 2YCDA 2RM5A 3FR3A 1GSQA 3GHAA 4KSMA 4P3YB 1J0FA 3FZ4A 2FY6A 2VD0A 1T00A 2GQMA 1VF2A 3HHVA 6GSVA 1JZOA 1Z7PA 3GIXA 3GH9A 5D9XA 1YZXA 1RW1A 2GZYA 3CXGA 3GX8A 3IAM2 4IVFA 1SJZA 1B9XC 4ML1A 1WE0A 5IO2A 5HR2A 5DBQA 2WCIA 1V58A 1I9DA 2VCVA 4GWRA 1UN2A 3DGQA 5ABRA 3RPPA 1TRUA 1Y25A 1NHYA 1G7EA 2A2SA 4FYUA 3ERWA 6GSXA 3F3RA 2PN8A 5D8IA 1AUCA 4DSSB 4YQMA 2LUSA 1NW2A 3FY7A 3WT1A 1WMJA 2CZ2A 4MJEA 2HSHA 5DDLA 1XWBA 2GTUA 4TXVA 2LEGA 2C0DA 1AXDA 2FGXA 1XIYA 3DIEA 2O89A 2P5QA 1EWXA 2M80A 7GSSA 3FKFA 3ZMLA 1GUKA 2XC2A 4MABA 1O8WA 1SENA 2R37A 3RAZA 2L4CA 4NHZA 1ZYEA 3F0IA 4H86A 2VCQA 2VL3A 1EV9A 3ZFBA 3ZITA 5J41A 3TCOA 3V1WA 2MMOA 3L4NA 1T7PB 4FYBA 4MH3A 6GSTA 2KP2A 4PGTA 4K0GA 4ECIA 3EVIA 4MF5A 2IIYA 3IHQA 2GT5A 5DQSA 1ZOFA 5IM9A 2N5FA 11GSA 1MDIA 2E0QA 1EEMA 3ME8A 3P7XA 2PWJA 5ECHB 5GZZB 3NZNA 5IPHA 2H74A 3TJKA 2H01A 2I1UA 2HZFA 1R4WA 5JWOB 1B4QA 1GUMA 4NMUA 2P0GA 1R7HA 2CT6A 4MZCA 2B1LA 2HI7A 4LA1A 2YANA 1EP7A 5ECIB 1F3AA 4WBJA 2PUKC 5HQPA 1MDJA 1O8XA 5J4UA 3DVWA 2TRCP 3HCZA 3VI5A 1TK5B 2B5EA 2CAIA 3GKXA 3D21A 5IMAA 3DKSA 3JCML 5ELAA 3VFIA 10GSA 3H4KA 4TKYA 3DEXA 4MA9A 3WYWA 1GRXA 3Q18A 2PERA 2PMTA 1B9YC 1T8EB 2LQOA 5DCHA 3FR6A 3HA9A 1H4OA 2JU5A 5G5FA 2QGVA 1K3LA 3IV4A 2L6DA 1ABAA 6GSWA 4ZXGA 2YJHA 5DQYA 3WGDA 2C4JA 2PBJA 1U3IA 3S9FA 4O32A 2DJJA 2OJLA 4Q5RA 5HFGA 1A2JA 1A0FA 5B6NA 1JZDA 1XVQA 2TIRA 4GF0A 3TJFA 1YEXA 2GZZA 2OADA 2OE1A 4LL4B 1QFNA 4MH2A 5D93A 1TU7A 1CQHA 3EMPA 1F3BA 1SK1A 2K8VA 3EE2A 2I4AA 1HNAA 1G6YA 1GTBA 2BTOT 4KDYA 2TRXA 3UEMA 5ID2A 4MMMA 3BOAA 3ZRDA 2JACA 2VM2A 2X8GA 3IOSA 19GSA 5L71A 5JCUA 1QUWA 1PN9A 2LRTA 4BVXA 1OVNA 3FEUA 2L57A 3FZ5A 4ZB9A 3F4SA 4ZB6A 3IE3A 4NWYA 4YQVA 4QL7A 4IP1A 2DMLA 3GH6A 4DSQA 4YAPA 1XW9A 2V32A 5H5RA 1DE1A 1V57A 2R4VA 1THXA 2KP1A 2O8VB 1M2BA 3BCKA 2NVLA 2JSYA 3CSIA 2VL9A 3ZYWA 2IL3A 4N11A 1OC9B 2HRFA 3TKRA 2M46A 2H71A 5AGYA 2H0IA 3CYNA 4GSNA 3KEBA 4F9ZA 3NOFA 3PINA 5AN1A 2YZUA 4BL7A 4ZBDA 5JCGA 1N8JA 2HNLA 2WJUA 5LCZA 3Q6OA 2VLVA 4XRDA 3E3EA 2CVKA 1GH2A 3H8QA 3GTUB 1O6JA 1R26A 2LNTA 2NPBA 3QFAC 3KTLA 5DALA 2YZHA 4EF0A 2DJ3A 4V2NA 4CDOA 3DWVA 5ECOB 2HRNA 2XHFA 5FHIA 2FLSA 2JADA 1Z9HA 1V40A 3EYTA 4GQCA 2MMNA 2RLIA 4PURA 4EVMA 3LXTA 4OMVA 1TRVA 2C3NA 1XOAA 3PR8A 1THOA 4EO3A 2H1GA 3HJMA 2CX3A 4TOPA 2VAFA 1ERVA 4MPFA 2H73A 3U5RE 4MDCA 4IJ3A 1GLQA 1GWCA 4K7IA 3CTGA 2NTOA 1PKZA 1PKWA 3ZMKA 3PH9A 2MYGA 2L5LA 3EMXA 3QDNA 2B6MA 1OC3A 3GX0A 1M99A 4WXTA 4MZBA 3ZTLA 1SKRB 2AV4A 4XS1A 2B5XA 5ECRB 2YV9A 3UBKA 3C8EA 3LQ7A 3KH7A 3LSZA 9GSSA 1TTZA 3J7Yk 4NV5A 4KE3A 4JRRA 4J56E 2A2RA 3LGCA 1FB0A 3EURA 5IMVA 2C1YA 4I5QA 2LJKA 3H79A 4I8BA 4XRAA 2EC4A 2QKEA 1GTAA 4ECBA 4XTSA 2H1BA 4F2IA 3QOUA 4NV2A 2B7JA 2OBIA 2AB6A 3C71A 2LJAA 2ON7A 2IFQB 1U6TA 1TI1A 5A4VA 3F4RA 5G1KA 2DLXA 4WBRD 3APQA 3FK8A 5FT3A 2X64A 12GSA 4JR6A 3IXRA 4XIHA 5IMDA 4ECJA 3ZVJD 5E4WA 3D4TA 4JBBA 2IMIA 2DIZA 1DSBA 4PX1A 2P31A 1SKSB 1JZRA 2MMAA 3IBHA 2HYXA 2R3XA 4J57E 4XS6A 2V6KA 1TI3A 2CX4A 1K0DA 5ENUA 16GSA 4Q5QA 4PUFC 3C73A 1V98A 2YWMA 4KAEA 2LRNA 2WRTA 4K7NA 1GNWA 1BX9A 4N30A 5IOXA 1T4YA 1XWKA 4EL1A 5B8AA 2AYTA 2KOKA 2K6VA 3I9V2 3WGEA 3MNGA 1BJXA 3TGZA 2YJ7A 3US3A 3DVXA 5ECPB 2GT6A 1QGVA 3ZIJA 5C00A 1XFLA 4JZQA 1XOBA 4QQ7A 1GSFA 3F63A 3ME7A 4HOJA 1X9WB 5G2ZA 5EL8A 2AUVA 2LKUA 2H8LA 3UVTA 1T4ZA 2H19A 2PPTA 4EUYA 5JCWA 1E6BA 4EDYA 3R2QA 1OKDA 2WS2A 3LORA 2I3YA 2KUCA 4XS4B 4FYCA 5KN2A 1MD4A 3GL3A 1A8LA 3KCMA 1XXUA 5CAXA 4AJ8A 1FG4A 2FWGA 2H6YA 2K8SA 4NHWA 2H72A 1FVJA 5CNWA 2EIOA 1AQXA 2RIIA 2YOIA 3KGKA 3ZVJA 4KB3A 4IJIA 3ISOA 1VF3A 1TK8B 3U6VA 1X5DA 4EDZA 4LL1B 4RUVA 2CVDA 2X99A 1Z6MA 2XPEA 1PSQA 20GSA 1YQ1A 3VPQA 4OO4A 1AW9A 3GA4A 3N9JA 3HZ8A 3J7Yb 3O6TA 4POKA 1XWCA 3DYRA 3W8SA 1O7UA 1S3AA 2LNSA 3UBLA 4G10A 4WETA 2H1AA 1OYJA 5DJLA 1R5AA 4GLTA 4Z7XA 1GLPA 4HU9A 1W89A 1LJRA 1PRXA 1XW6A 3H1NA 1JHBA 3WT2A 2CA8A 1VRSD 5ELGA 3DMLA 2IJYA 4AJ7A 1A2LA 3HZ4A 1FB6A 1SJIA 2V41A 3ZIVA 5DCGA 4IS0A 2RUEA 1WJKA 3M0FA 3ZREA 1M0UA 1YF0A 1KTEA 2IN3A 4CHSA 1SL2B 2O87A 4N0VA 4IHUA 2KLXA 2R2JA 2AHEA 8GSSA 2YWIA 1F9MA 1TOFA 1XPVA 4K9ZA 1GSUA 1B8XA 4HJMA 1Z3EA 2JSZA 3HYPA 4EKZA 2HZEA 1R5PA 4OFTA 4OFNA 4PQ1A 1Q98A 3GUSA 4L8EA 1BG5A 3TUEA 4K1FA 1SKWB 2H76A 4J2FA 2DJ1A 1OE7A 1NM3A 3A2WA 3PGTA 4LLRA 4TR1B 4BA7A 1XWGA 1URMA 2H30A 4N10A 1X0RA 3LXZA 3I6AA 1AQVA 2WDUA 1JZWA 4POBA 3D22A 3HDCA 3ZL5A 2PVQA 2V1MA 2PU9C 4FO5A 3CBUA 3IR4A 1X5EA 1NHOA 3L9UA 3F6FA 3HJOA 5JWQB 1ON4A 2DBCA 3GV1A 4V2LA 3SBCA 2O85A 3QR6A 3P8WA 3N5OA 4PUAA 3L9SA 4KH7A 1SD8A 5D9WA 4LMVA 2DSAA 1A2MA 1GSSA 2DJKA 1PD21 3LEFA 4QL9A 3KZQA 1RK4A 4GRFA 5AISA 4D73A 2E2MA 5B7CA 5KN1A 1TK0B 5CRWA 4V1Ag 4V1Ap 2ZNMA 2YPMA 4NPBA 4G19A 3MSZA 4POLA 5DAKB 2C80A 3TDGA 4MJBA 1FOVA 1WPIA 5IIZA 4XCSA 3KD0A 1J08A 5KEJA 1PL2A 3ERFA 2VCWA 3IPZA 2V2GA 2WZ9A 4AGSA 4ZL7A 3HY2A 4HZ4A 4GQFA 3ED3A 3TOTA 2AAWA 2GDRA 5F8BA 1MDKA 2VOCA 3TJGA 5A4WA 1ZCPA 2ZCTA 1TRSA 1ZMAA 3ERGA 3TKSA 1OKTA 3BCIA 4E8EA 2RUFA 3UL3A 4KDXA 3GFKA 3MWHA 1SYRA 5B6MA 1O73A 4IELA 6GSSA 2I9HA 1TJDA 2MMZA 2FCHA 1QXHA 3WD6A 2QSIA 2REMA 2VLTA 1HYUA 5B8BA 1YY7A 3HXSA 4ISDA 2LQQA 2FNOA 3C1RA 1K0OA 4HUAA 1N2AA 1Z6NA 5IPGA 3RBTA 4BWSA 4YAVA 2CZ3A 4AJ6A 3TRQA 2MZCA 4LMWA 3KXOA 2B5YA 4K7OA 5IMFA 2GQKA 1UVZA 3VURA 1SL0B 4L5OA 2B7KA 4TXOB 1EZKA 3CTFA 5G5EA 2K9FA 3FHKA 5IMZA 5F05A 3OR5A 5IQYA 1PX6A 2GGTA 3I43A 2LTKA 3LFLA 1VF4A 4L0UA 3O3TA 1SK0A 2FWEA 3D6IA 3O76A 2H66A 4IW9A 3FYGA 3WGXA 1EGOA 2L4QA 3EWLA 4V2MA 5D73A 1HNCA 1GSYA 3TKSC 4ILFA 4I2UA 1EEJA 4ECCA 4HDEA 1OE8A 3UMAA 4KNDA 4HJ2A 3HVXA 1GNEA 3DXBA 5ECNB 2H70A 2WGRA 3GRXA 13GSA 4NAXA 3ZLPA 1C72A 4HZ2A 3EU4A 4F0BA 4X1UA 22GSA 3EU3A 4ACSA 4HU7A 3G7YA 4DSSA 2DC5A 2C3TA 1SJ6A 3FRCA 3TOUA 2WB9A 1FVKA 3I69A 3QD9A 2ALBA 3LG6A 3MDKA 2WULA 1HQOA 1O85A 1M9AA 1UA5A 4ZILA 1TU8A 1GSEA 1GTUA 5J5NA 5HR1A 2I81A 4YH2A 4BWQA 2DJ2A 1F2EA 1K0BA 5KN0A 4NXIA 3E0UA 3VWXA 1XCCA 4KDUA 2FA8A 1PMTA 2LS5A 4O5RA 3QMXA 1T1VA 4BVYA 5ID2B 1AC1A 4WKWA 3IK9A 3FZAA 4Q5FA 3H93A 5CYYA 2XBQA 4KUNA 5CP1A 1K3OA 1ACVA 4I97A 3TRXA 4ZL9A 4JU5A 1KNGA 2DJ0A 3EINA 4KGIA 4WEYA 2BJXA 2VIMA 1USBA 2GSRA 5LNKe 3QAVA 5ECQB 4WR5A 4OD7A 1FW1A 4CW9A 3GMFA 3KIJA 1TKDB 4K2DA 2H6XA 4X43A 1LBKA 3Q74A 4IN0A 1ZGNA 5GAPD 1RQMA 3VI7A 3HD5A 4MF7A 2M72A 3GSTA 2FD3A 5F0GA 2YN1A 2IMEA 2V6OA 3EC3A 5IMCA 4POMA 1ERUA 3M9JA 2A4VA 1B4PA 3CRTA 3QAWA 2H6ZA 4TR1A 3HVVA 4HQZA 1BAYA 5A5KA 1PX7A 4HQSA 4TVEA 1KBNA 6GSUA 1ZL9A 2G0FA 4MJAA 1JFUA 2VD1A 3D5JA 3M8NA 5G31A 2LJRA 1A0RP 4KX4A 3GKKA 1BEDA 2Z9SA 5DALB 5FWGA 4ML6A 1DUGA 3GNJA 1V2AA 1GULA 4DVCA 4MPGA 3TB2A 1VF1A 5CRGA 4KCEA 1CQGA 3D4MA 1ILOA 3GYKA 1VGLA 3E9JB 5KN3A 1TDIA 4N0ZA 2H0HA 5EPFA 1GSDA 4O92A 1Z7RA 2OKAA 2JL4A 1Y6EA 1QMVA 4GSSA 4TR4A 2F3MA 2C0GA 5CO3A 4G2EA 2R6KA 1UC7A 4X0XA 2GLRA 3KM6A 4MLYA 2X8HA 4XHMA 3M9KA 3GKNA 2OA7A 3A5WA 14GSA 5DAKA 1S3CA 4DSRA 1XW5A 3W8JA 3TJBA 3W6GA 2IWTA 2B1KA 3TKPA 2C3QA 3IDVA 5IOWA 3G9BA 4PQHA 1EGRA 4PQIA 4MJCA 1A23A 3RHCA 4ID0A 3RDWA 3KH9A 2AJQB 3IA1A 5E59A 3P90A 1SK2A 4HI7A 2JZSA 2N5BA 3GN3A 1ZZYA 5AIVA 1PA3A 1W4VA 2XPDA 5DJMA 5H5SA 2WFCA 2ES7A 1U3AA 5F06A 2F8AA 1TP9A 5H5QA 2DIYA 4ZB8A 3K8NA 1WRYA 2FUG2 1PL1A 2HSYA
chains in the Genus database with same CATH superfamily
4I2TA 1ST9A 2VM1A 1AQWA 3M1GA 4E8HA 3QPMA 4IKHA 5G30A 1YJ6A 4RQXA 2G2QA 3G7IA 1ZYQB 1OC9A 5COHA 1WWJA 4TR0A 3SWLA 1U88A 3BJ5A 3F8UA 3GKMA 3LYKA 3F9UA 3KMOA 1K0CA 2YWNA 4ULXA 2BMXA 3CMIA 3BD2A 3VPTA 2JZRA 2VCZA 3NIVA 3GTUA 3HKRA 3UIWA 3UJ1A 1MTCA 2LV3A 2L6CA 2XBIA 3FZ9A 4Z2UA 1GUHA 1TW9A 3A2VA 2EIRA 4JE1A 2R0PA 5J9CA 5BRTA 4TXOA 1A8YA 1M7TA 3RPNA 1AIUA 1EV4A 5EY6A 3MYDA 4TW5A 4RI6A 1DBYA 1IYIA 4RI7A 1Z5YE 4F0CA 1F37A 2GSTA 2OACA 1YEPA 1T3BA 4L5LA 1DE2A 1WP0A 1PGTA 2OE3A 3LYPA 2HT9A 17GSA 1EP8A 5D9TA 1OAZA 1SYXA 2OBKA 4EC0A 2IPAA 1H75A 1I5GA 4EXJA 3L9VA 2L59A 5LD0A 4GTUA 3AY8A 1F6MC 5JWRB 5G1LA 1K0MA 1WOUA 2ZUPA 2L5OA 4K6XA 5HFIA 2IMKA 2YP6A 3F3QA 4O7HA 1EOGA 4A5PA 2LRCA 1X9MB 1KEBA 1G6WA 5AIXA 1QQ2A 4WF5A 4IBPA 5GSSA 2F8FA 2GVPA 2QA2A 3KP9A 5J9BA 3CSHA 3P2AA 1MD3A 1GL8A 4JEDA 3QCPA 5D9VA 2VLUA 2H0GA 4OO5A 2VCTA 2OE0A 1S3DA 1Q4JA 4RQRA 1LU4A 4GXZA 1WIKA 5A4UA 2HLSA 2GZPA 1YKCA 5INYA 3IAS2 4KSOA 2IFQA 2MBSA 3F4TA 4DEJA 4EE0A 1SD9A 2IMDA 5EVOA 2ON5A 1HD2A 1XBSA 3CSJA 3IK7A 3FR9A 4TN8A 4HSCX 3F6DA 4Z2TA 3TKQA 4WR4A 2CV4A 4FQUA 4KW6A 4KA0A 3VWWA 2FWFA 5D96A 3GSSA 4BPYA 1K3YA 5J3RA 3KTBA 1TXXA 2P5RA 2KHPA 2CAQA 2J23A 2FHEA 4Q5NA 2C0EA 2IMFA 1AAZA 3UAPA 1ZYPA 3TKSE 1XZOA 5HFKA 2RM6A 2E7PA 1J9BA 4AF2A 4G0IA 4OCFA 1YF1A 5CRHA 4MP4A 2MBTA 4TR3A 2F9SA 3VWVA 2QC7A 4OCEA 2R5GA 1M2AA 4FIWA 5C04A 3APOA 1U87A 1PFOA 2J9HA 1SL1B 1B48A 2NBSA 3LWAA 2F51A 4ZIJA 3TJJA 2GSSA 4GCIA 3QFBC 2N5AA 1ZYNA 1GP1A 4TRXA 1XWAA 2HE3A 3GURA 2B3SA 2LSTA 3L0HA 2HZEB 3C1SA 1YDKA 3DD3A 2VO4A 3D0ZA 2VUPA 4L0WA 3APSA 4OFMA 3IRAA 1ERTA 4IGJA 4FH8A 2DMMA 4PXOA 2HXKA 1M9BA 5ECMB 3G7JA 4OWYA 4XS4A 18GSA 3UVHA 2CVBA 1PQNA 3KP8A 4MZWA 4KCAA 1BQ7A 4WF4A 3BBYA 3IC4A 2X8CA 2DKIA 6GSYA 3L78A 5CRDA 1EOHA 1YKAA 1SU9A 4MK3A 2K18A 3LJRA 1O81A 3KMNA 1FO5A 1QK8A 3DRNA 1G0TA 5CREA 2VL2A 4G0KA 5ECLB 3ZFLA 1M2DA 3A3TA 2C8UA 1X5CA 4D73B 4ZBBA 5HR0A 3A2XA 3FW2A 3RHBA 3HVSA 4MCUA 4YQUA 2FWHA 1ML6A 4ZL8A 4G9HA 1MEKA 1JLVA 2EIQA 3UOMA 3KJYA 4I6XA 2D2ZA 2E2GA 1V9WA 3HJPA 1K0AA 1X9SB 3VLNA 3UARA 1BYEA 3ZZXA 2YWOA 1K0NA 3M3MA 4JR4A 5ECSA 1M3JA 2HFDA 5DVBA 2GSQA 4YKFA 5ECKB 1IYHA 1G7OA 3QAGA 1OC8A 4GSTA 5GAND 2NDOA 4ZBAA 1A24A 1NSWA 3VWUA 4K0NA 4IQ1A 4PNGA 4F82A 3C7MA 2H75A 1GTIA 1JLWA 5HR3A 2O7KA 3VK9A 5GSTA 1E2YA 3Q19A 4K8MA 4IQAA 3MAKA 4HEA2 2JZTA 1XVWA 2CQ9A 2GS3A 1TRWA 2GQLA 2VL2C 4PNFA 3CRUA 2YV7A 5F07A 2PGTA 2FA4A 4F03A 4MF6A 3GL5A 2PVOC 2VCXA 2H1DA 4HS1A 3TRPA 1FAAA 1FHEA 1ERWA 2C0FA 1HNBA 2YNXA 5IO0A 4IP6A 2YCDA 2RM5A 3FR3A 1GSQA 3GHAA 4KSMA 4P3YB 3IC8A 1J0FA 3FZ4A 2FY6A 2VD0A 1T00A 2GQMA 1VF2A 3HHVA 6GSVA 1JZOA 1Z7PA 3GIXA 4K2XA 3GH9A 5D9XA 1YZXA 1RW1A 2GZYA 3CXGA 3GX8A 3IAM2 4IVFA 1SJZA 1B9XC 4ML1A 1WE0A 5IO2A 5HR2A 5DBQA 2WCIA 1V58A 4MNNA 1I9DA 2VCVA 4GWRA 1UN2A 3DGQA 5ABRA 3RPPA 1TRUA 1Y25A 1NHYA 1G7EA 2A2SA 4FYUA 3ERWA 6GSXA 4KF9A 3F3RA 2PN8A 5D8IA 1AUCA 4DSSB 4YQMA 2LUSA 1NW2A 3FY7A 2X49A 3WT1A 1WMJA 2CZ2A 4MJEA 2HSHA 5DDLA 1XWBA 2GTUA 4TXVA 2LEGA 2C0DA 1AXDA 2FGXA 1XIYA 3DIEA 2O89A 2P5QA 1EWXA 2M80A 7GSSA 3FKFA 3ZMLA 1GUKA 2XC2A 4MABA 1O8WA 3EPTA 1SENA 2R37A 3RAZA 2L4CA 4NHZA 1ZYEA 3F0IA 4H86A 2VCQA 2VL3A 1EV9A 4BVYB 3ZFBA 3ZITA 5J41A 3TCOA 4EIQA 3V1WA 2MMOA 3L4NA 1T7PB 4FYBA 4MH3A 6GSTA 2KP2A 4PGTA 4K0GA 4ECIA 3EVIA 4MF5A 2IIYA 3IHQA 2GT5A 5DQSA 1ZOFA 5IM9A 2N5FA 11GSA 1MDIA 2E0QA 1EEMA 3ME8A 3P7XA 2PWJA 5ECHB 5GZZB 3NZNA 5IPHA 2H74A 4PTSA 3TJKA 2H01A 2I1UA 2HZFA 1R4WA 5JWOB 1B4QA 1GUMA 4NMUA 2P0GA 1R7HA 2CT6A 4MZCA 2B1LA 2HI7A 4LA1A 2YANA 1EP7A 5ECIB 1F3AA 4WBJA 2PUKC 5HQPA 1MDJA 2HRAA 1O8XA 5J4UA 3DVWA 2TRCP 3HCZA 3VI5A 1TK5B 2B5EA 2CAIA 3GKXA 3D21A 5IMAA 3DKSA 3JCML 1FOHA 5ELAA 3VFIA 10GSA 3H4KA 4TKYA 3DEXA 4MA9A 3WYWA 1GRXA 3Q18A 2PERA 2PMTA 1B9YC 1T8EB 2LQOA 5DCHA 3FR6A 3HA9A 1H4OA 2JU5A 5G5FA 2QGVA 1K3LA 5BMUA 3IV4A 2L6DA 1ABAA 6GSWA 4ZXGA 2YJHA 5DQYA 3WGDA 2C4JA 2PBJA 1U3IA 3S9FA 4O32A 2DJJA 2OJLA 4Q5RA 5HFGA 1A2JA 1A0FA 5B6NA 1JZDA 1XVQA 2TIRA 4GF0A 3TJFA 1YEXA 2GZZA 2OADA 2OE1A 4LL4B 1QFNA 4MH2A 5D93A 1TU7A 1CQHA 2QA1A 3EMPA 1F3BA 1SK1A 2K8VA 3EE2A 2I4AA 1HNAA 1G6YA 1GTBA 2BTOT 4KDYA 2TRXA 3UEMA 4K5SA 5ID2A 4MMMA 3BOAA 3ZRDA 2JACA 2VM2A 2X8GA 3IOSA 19GSA 5L71A 5JCUA 1QUWA 1PN9A 2LRTA 4BVXA 1OVNA 3FEUA 2L57A 5KOXA 3FZ5A 4ZB9A 3F4SA 4ZB6A 3IE3A 4NWYA 4YQVA 4QL7A 4IP1A 2DMLA 3GH6A 4DSQA 4YAPA 1XW9A 2V32A 5H5RA 1DE1A 1V57A 2R4VA 1THXA 2KP1A 2O8VB 1M2BA 3BCKA 2NVLA 2JSYA 3CSIA 2VL9A 3ZYWA 2IL3A 4N11A 1OC9B 2HRFA 3TKRA 2M46A 2H71A 5AGYA 2H0IA 3CYNA 4GSNA 3KEBA 4F9ZA 3NOFA 3PINA 5AN1A 2YZUA 4BL7A 4ZBDA 5JCGA 1N8JA 2HNLA 2WJUA 5LCZA 3Q6OA 2VLVA 4XRDA 3E3EA 2CVKA 1GH2A 3H8QA 3GTUB 1O6JA 1R26A 2LNTA 2NPBA 3QFAC 3KTLA 5DALA 2YZHA 4EF0A 2DJ3A 4V2NA 4CDOA 3DWVA 5ECOB 2HRNA 2XHFA 5FHIA 2FLSA 2JADA 1Z9HA 1V40A 3EYTA 4GQCA 2MMNA 2RLIA 4PURA 4EVMA 3LXTA 4OMVA 1TRVA 3HVNA 2C3NA 1XOAA 3PR8A 1THOA 4EO3A 2H1GA 3HJMA 2CX3A 4TOPA 2VAFA 1ERVA 4MPFA 2H73A 3U5RE 4X4JA 4MDCA 4IJ3A 2R0CA 1GLQA 1GWCA 4K7IA 3CTGA 2NTOA 1PKZA 2A2PA 1PKWA 3ZMKA 3PH9A 2MYGA 2L5LA 3EMXA 3QDNA 2B6MA 1OC3A 3GX0A 1M99A 4WXTA 4MZBA 2DKHA 3ZTLA 1SKRB 1M3IA 2AV4A 4XS1A 2B5XA 5ECRB 2YV9A 3UBKA 3C8EA 3LQ7A 3KH7A 3LSZA 9GSSA 1TTZA 3J7Yk 4NV5A 4KE3A 4JRRA 4J56E 2A2RA 3LGCA 1FB0A 3EURA 4G0LA 5IMVA 2C1YA 4I5QA 2LJKA 3H79A 4I8BA 4XRAA 2EC4A 2QKEA 3R3EA 1GTAA 4ECBA 2UZ8A 4XTSA 2H1BA 4F2IA 3QOUA 4NV2A 2B7JA 2OBIA 2AB6A 3C71A 2LJAA 2ON7A 2IFQB 1U6TA 1TI1A 5A4VA 3F4RA 5G1KA 2DLXA 4WBRD 3APQA 3FK8A 5FT3A 2X64A 12GSA 4JR6A 3IXRA 4XIHA 5IMDA 4Z2RA 4ECJA 3ZVJD 5E4WA 3D4TA 4JBBA 2IMIA 2DIZA 1DSBA 4PX1A 2P31A 1SKSB 1JZRA 2MMAA 3IBHA 2HYXA 2R3XA 4J57E 4XS6A 2V6KA 1TI3A 2CX4A 1K0DA 5ENUA 16GSA 4Q5QA 4PUFC 3C73A 1V98A 2YWMA 4KAEA 2LRNA 2WRTA 4K7NA 1GNWA 1BX9A 4N30A 5IOXA 1T4YA 1XWKA 4EL1A 5B8AA 2AYTA 2KOKA 2K6VA 3I9V2 3WGEA 3MNGA 1BJXA 3TGZA 2YJ7A 3US3A 3DVXA 5ECPB 4O5QA 2GT6A 1QGVA 3ZIJA 5C00A 1XFLA 4JZQA 1XOBA 4QQ7A 1GSFA 3F63A 3ME7A 4HOJA 1X9WB 5G2ZA 5EL8A 2AUVA 2LKUA 2H8LA 3UVTA 1T4ZA 2H19A 2PPTA 4EUYA 5JCWA 1E6BA 4EDYA 3R2QA 1OKDA 2WS2A 3LORA 2I3YA 2KUCA 4XS4B 4FYCA 5KN2A 1MD4A 3GL3A 1A8LA 3KCMA 1XXUA 5CAXA 4AJ8A 1FG4A 2FWGA 2H6YA 2K8SA 4NHWA 2H72A 1FVJA 5CNWA 2EIOA 1AQXA 2RIIA 2YOIA 3KGKA 3ZVJA 4KB3A 4IJIA 3ISOA 1VF3A 1TK8B 3U6VA 1X5DA 4EDZA 4LL1B 4RUVA 2CVDA 2X99A 1Z6MA 3MIXA 2XPEA 1PSQA 20GSA 1YQ1A 3VPQA 4OO4A 1AW9A 3GA4A 3N9JA 3HZ8A 3J7Yb 3O6TA 4POKA 1XWCA 3DYRA 3W8SA 1O7UA 1S3AA 2LNSA 3UBLA 4G10A 4WETA 2H1AA 1OYJA 5DJLA 1R5AA 4GLTA 4Z7XA 1GLPA 4HU9A 1W89A 1LJRA 1PRXA 1XW6A 3H1NA 1JHBA 3WT2A 2CA8A 1VRSD 5ELGA 3DMLA 2IJYA 4AJ7A 1A2LA 3HZ4A 1FB6A 1SJIA 2V41A 3ZIVA 5DCGA 4CY8A 4IS0A 2RUEA 1WJKA 3M0FA 3ZREA 1M0UA 1YF0A 1KTEA 2IN3A 4CHSA 1SL2B 2O87A 4N0VA 4IHUA 2KLXA 2R2JA 2AHEA 8GSSA 2YWIA 1F9MA 1TOFA 1XPVA 4K9ZA 1GSUA 1B8XA 4HJMA 1Z3EA 2JSZA 3HYPA 4EKZA 2HZEA 1R5PA 4OFTA 4OFNA 4PQ1A 1Q98A 3GUSA 4L8EA 1BG5A 3TUEA 4K1FA 1SKWB 2H76A 4J2FA 2DJ1A 1OE7A 1NM3A 3A2WA 3PGTA 4LLRA 4TR1B 4BA7A 1XWGA 1URMA 2H30A 4N10A 1X0RA 3LXZA 3I6AA 1AQVA 2WDUA 1JZWA 4POBA 3D22A 3HDCA 3ZL5A 4O5UA 2PVQA 2V1MA 2PU9C 2HRKA 4FO5A 3CBUA 3IR4A 1X5EA 1NHOA 3L9UA 3F6FA 3HJOA 5JWQB 1ON4A 2DBCA 3GV1A 4V2LA 3SBCA 2O85A 3QR6A 3P8WA 3N5OA 4PUAA 3L9SA 4KH7A 1SD8A 5D9WA 4LMVA 2DSAA 1A2MA 1GSSA 2DJKA 1PD21 3LEFA 4QL9A 3KZQA 1RK4A 4GRFA 5AISA 4D73A 2E2MA 5B7CA 3PPUA 5KN1A 1TK0B 5CRWA 4V1Ag 4V1Ap 2ZNMA 2YPMA 4NPBA 4G19A 3MSZA 4POLA 5DAKB 2C80A 3TDGA 4MJBA 1FOVA 1WPIA 5IIZA 2A4HA 4XCSA 3KD0A 1J08A 5KEJA 1PL2A 3ERFA 2VCWA 3IPZA 2V2GA 2WZ9A 4AGSA 4ZL7A 3HY2A 4HZ4A 4GQFA 3ED3A 3TOTA 2AAWA 2GDRA 3FMWA 5F8BA 1MDKA 2VOCA 3TJGA 5A4WA 1ZCPA 2ZCTA 1TRSA 1ZMAA 3ERGA 3TKSA 1OKTA 3BCIA 4E8EA 2RUFA 3UL3A 4KDXA 3GFKA 3MWHA 1SYRA 5B6MA 1O73A 4IELA 3CQFA 6GSSA 2I9HA 1TJDA 2MMZA 2FCHA 1QXHA 3WD6A 2QSIA 2REMA 2VLTA 1HYUA 2X4AA 5B8BA 1YY7A 3HXSA 4ISDA 2LQQA 2FNOA 3C1RA 1K0OA 4HUAA 1N2AA 1Z6NA 5IPGA 3RBTA 4BWSA 4YAVA 2CZ3A 4AJ6A 3TRQA 2MZCA 4LMWA 3KXOA 2B5YA 4BIKA 4K7OA 5IMFA 2GQKA 1UVZA 3VURA 1SL0B 4L5OA 2B7KA 4USSA 4TXOB 1EZKA 3CTFA 5G5EA 2K9FA 3FHKA 5IMZA 5F05A 3OR5A 5IQYA 1PX6A 2GGTA 3I43A 2LTKA 4YKGA 3LFLA 1VF4A 3LW9A 4L0UA 3O3TA 1SK0A 2FWEA 3D6IA 3O76A 2H66A 4IW9A 3FYGA 3WGXA 1EGOA 2L4QA 3EWLA 4V2MA 5D73A 1HNCA 1GSYA 3TKSC 4CY6A 4ILFA 4I2UA 1EEJA 4ECCA 4HDEA 1OE8A 3UMAA 4KNDA 4HJ2A 3HVXA 1GNEA 3DXBA 5ECNB 2H70A 2WGRA 3GRXA 13GSA 4NAXA 3ZLPA 1C72A 4HZ2A 3EU4A 4F0BA 4X1UA 22GSA 3EU3A 4ACSA 4HU7A 3G7YA 4DSSA 2DC5A 2C3TA 1SJ6A 3FRCA 3TOUA 2WB9A 4ICYA 1FVKA 3I69A 3QD9A 3IHGA 2ALBA 3LG6A 3MDKA 2WULA 1HQOA 1O85A 1M9AA 1UA5A 4ZILA 3A5IA 1TU8A 1GSEA 1GTUA 5J5NA 5HR1A 2I81A 4YH2A 4BWQA 2DJ2A 1F2EA 1K0BA 5KN0A 4NXIA 3E0UA 3VWXA 1XCCA 4KDUA 2FA8A 1PMTA 2LS5A 4O5RA 3QMXA 1T1VA 4BVYA 5ID2B 1AC1A 4WKWA 3IK9A 3FZAA 4Q5FA 3H93A 5CYYA 2XBQA 4KUNA 5CP1A 1K3OA 1ACVA 4K5RA 4I97A 3TRXA 4ZL9A 4JU5A 4EIPA 1KNGA 2DJ0A 3EINA 4KGIA 4BVXB 4WEYA 2BJXA 2VIMA 1USBA 2GSRA 5LNKe 3QAVA 5ECQB 4WR5A 4OD7A 1FW1A 4CW9A 3GMFA 3KIJA 1TKDB 4K2DA 2H6XA 4X43A 1LBKA 3Q74A 4IN0A 1ZGNA 5GAPD 1RQMA 3VI7A 3HD5A 4MF7A 2M72A 1S3RA 3GSTA 2FD3A 5F0GA 2YN1A 2IMEA 2V6OA 3EC3A 5IMCA 4POMA 1ERUA 3M9JA 2A4VA 1B4PA 3CRTA 3QAWA 4BL7B 2H6ZA 4TR1A 3HVVA 4HQZA 1BAYA 5A5KA 1PX7A 4HQSA 4TVEA 1KBNA 6GSUA 1ZL9A 2G0FA 4MJAA 1JFUA 2VD1A 3D5JA 3M8NA 5G31A 2LJRA 2R0GA 1A0RP 4KX4A 3GKKA 1BEDA 2HSMA 2Z9SA 5DALB 5FWGA 4ML6A 1DUGA 3GNJA 1V2AA 1GULA 4DVCA 4MPGA 3TB2A 1VF1A 5CRGA 4KCEA 1CQGA 3D4MA 1ILOA 3GYKA 5KOWA 1VGLA 3E9JB 5KN3A 1TDIA 4N0ZA 2H0HA 5EPFA 1GSDA 4O92A 1Z7RA 2OKAA 2JL4A 1Y6EA 1QMVA 4GSSA 4TR4A 2F3MA 2C0GA 5CO3A 4G2EA 2R6KA 1UC7A 4X0XA 2GLRA 3KM6A 4MLYA 2X8HA 4XHMA 3M9KA 3GKNA 2OA7A 3A5WA 14GSA 5DAKA 1S3CA 4DSRA 1XW5A 3W8JA 3TJBA 3W6GA 2IWTA 2B1KA 3TKPA 2C3QA 3IDVA 5IOWA 3G9BA 4PQHA 1EGRA 4PQIA 4MJCA 1A23A 3RHCA 4ID0A 3RDWA 3KH9A 2AJQB 3IA1A 1XG8A 5E59A 3P90A 1SK2A 4HI7A 2JZSA 1PN0A 2N5BA 3GN3A 1ZZYA 5AIVA 1PA3A 1W4VA 2XPDA 5DJMA 5H5SA 2WFCA 2ES7A 1U3AA 5F06A 2F8AA 1TP9A 5H5QA 2DIYA 4ZB8A 3K8NA 1WRYA 2FUG2 1PL1A 2HSYA
chains in the Genus database with same CATH topology
4I2TA 1ST9A 2VM1A 1AQWA 3M1GA 4E8HA 3QPMA 4IKHA 5G30A 1YJ6A 4RQXA 2G2QA 3G7IA 1ZYQB 1OC9A 5COHA 1WWJA 4TR0A 3SWLA 1U88A 3BJ5A 3F8UA 3GKMA 3LYKA 3F9UA 3KMOA 1K0CA 2YWNA 4ULXA 2BMXA 3CMIA 3BD2A 3VPTA 2JZRA 2VCZA 3NIVA 3GTUA 3HKRA 3UIWA 3UJ1A 1MTCA 2LV3A 2L6CA 2XBIA 3FZ9A 4Z2UA 1GUHA 1TW9A 3A2VA 2EIRA 4JE1A 2R0PA 5J9CA 5BRTA 4TXOA 1A8YA 1M7TA 3RPNA 1AIUA 1EV4A 5EY6A 3MYDA 4TW5A 4RI6A 1DBYA 1IYIA 4RI7A 1Z5YE 4F0CA 1F37A 2GSTA 2OACA 1YEPA 1T3BA 4L5LA 1DE2A 1WP0A 1PGTA 2OE3A 3LYPA 2HT9A 17GSA 1EP8A 5D9TA 1OAZA 1SYXA 2OBKA 4EC0A 2IPAA 1H75A 1I5GA 4EXJA 3L9VA 2L59A 5LD0A 4GTUA 3AY8A 1F6MC 5JWRB 5G1LA 1K0MA 1WOUA 2ZUPA 2L5OA 4K6XA 5HFIA 2IMKA 2YP6A 3F3QA 4O7HA 1EOGA 4A5PA 2LRCA 1X9MB 1KEBA 1G6WA 5AIXA 1QQ2A 4WF5A 4IBPA 5GSSA 2F8FA 2GVPA 2QA2A 3KP9A 5J9BA 3CSHA 3P2AA 1MD3A 1GL8A 4JEDA 3QCPA 5D9VA 2VLUA 2H0GA 4OO5A 2VCTA 2OE0A 1S3DA 1Q4JA 4RQRA 1LU4A 4GXZA 1WIKA 5A4UA 2HLSA 2GZPA 1YKCA 5INYA 3IAS2 4KSOA 2IFQA 2MBSA 3F4TA 4DEJA 4EE0A 1SD9A 2IMDA 5EVOA 2ON5A 1HD2A 1XBSA 3CSJA 3IK7A 3FR9A 4TN8A 3F6DA 4Z2TA 3TKQA 4WR4A 2CV4A 4FQUA 4KW6A 4KA0A 3VWWA 2FWFA 5D96A 3GSSA 4BPYA 1K3YA 5J3RA 3KTBA 1TXXA 2P5RA 2KHPA 2CAQA 2J23A 2FHEA 4Q5NA 2C0EA 2IMFA 1AAZA 3UAPA 1ZYPA 3TKSE 1XZOA 5HFKA 2RM6A 2E7PA 1J9BA 4AF2A 4G0IA 4OCFA 1YF1A 5CRHA 4MP4A 2MBTA 4TR3A 2F9SA 3VWVA 2QC7A 4OCEA 2R5GA 1M2AA 4FIWA 5C04A 3APOA 1U87A 2J9HA 1SL1B 1B48A 2NBSA 3LWAA 2F51A 4ZIJA 3TJJA 2GSSA 4GCIA 3QFBC 2N5AA 1ZYNA 1GP1A 4TRXA 1XWAA 2HE3A 3GURA 2B3SA 2LSTA 3L0HA 2HZEB 3C1SA 1YDKA 3DD3A 2VO4A 3D0ZA 2VUPA 4L0WA 3APSA 4OFMA 3IRAA 1ERTA 4IGJA 4FH8A 2DMMA 4PXOA 2HXKA 1M9BA 5ECMB 3G7JA 4OWYA 4XS4A 18GSA 3UVHA 2CVBA 1PQNA 3KP8A 4MZWA 4KCAA 1BQ7A 4WF4A 3BBYA 3IC4A 2X8CA 2DKIA 6GSYA 3L78A 5CRDA 1EOHA 1YKAA 1SU9A 4MK3A 2K18A 3LJRA 1O81A 3KMNA 1FO5A 1QK8A 3DRNA 1G0TA 5CREA 2VL2A 4G0KA 5ECLB 3ZFLA 1M2DA 3A3TA 2C8UA 1X5CA 4D73B 4ZBBA 5HR0A 3A2XA 3FW2A 3RHBA 3HVSA 4MCUA 4YQUA 2FWHA 1ML6A 4ZL8A 4G9HA 1MEKA 1JLVA 2EIQA 3UOMA 3KJYA 4I6XA 2D2ZA 2E2GA 1V9WA 3HJPA 1K0AA 1X9SB 3VLNA 3UARA 1BYEA 3ZZXA 2YWOA 1K0NA 3M3MA 4JR4A 5ECSA 2HFDA 5DVBA 2GSQA 4YKFA 5ECKB 1IYHA 1G7OA 3QAGA 1OC8A 4GSTA 5GAND 2NDOA 4ZBAA 1A24A 1NSWA 3VWUA 4K0NA 4IQ1A 4PNGA 4F82A 3C7MA 2H75A 1GTIA 1JLWA 5HR3A 2O7KA 3VK9A 5GSTA 1E2YA 3Q19A 4K8MA 4IQAA 3MAKA 4HEA2 2JZTA 1XVWA 2CQ9A 2GS3A 1TRWA 2GQLA 2VL2C 4PNFA 3CRUA 2YV7A 5F07A 2PGTA 2FA4A 4F03A 4MF6A 3GL5A 2PVOC 2VCXA 2H1DA 4HS1A 3TRPA 1FAAA 1FHEA 1ERWA 2C0FA 1HNBA 2YNXA 5IO0A 4IP6A 2YCDA 2RM5A 3FR3A 1GSQA 3GHAA 4KSMA 4P3YB 3IC8A 1J0FA 3FZ4A 2FY6A 2VD0A 1T00A 2GQMA 1VF2A 3HHVA 6GSVA 1JZOA 1Z7PA 3GIXA 4K2XA 3GH9A 5D9XA 1YZXA 1RW1A 2GZYA 3CXGA 3GX8A 3IAM2 4IVFA 1SJZA 1B9XC 4ML1A 1WE0A 5IO2A 5HR2A 5DBQA 2WCIA 1V58A 4MNNA 1I9DA 2VCVA 4GWRA 1UN2A 3DGQA 5ABRA 3RPPA 1TRUA 1Y25A 1NHYA 1G7EA 2A2SA 4FYUA 3ERWA 6GSXA 4KF9A 3F3RA 2PN8A 5D8IA 1AUCA 4DSSB 4YQMA 2LUSA 1NW2A 3FY7A 2X49A 3WT1A 1WMJA 2CZ2A 4MJEA 2HSHA 5DDLA 1XWBA 2GTUA 4TXVA 2LEGA 2C0DA 1AXDA 2FGXA 1XIYA 3DIEA 2O89A 2P5QA 1EWXA 2M80A 7GSSA 3FKFA 3ZMLA 1GUKA 2XC2A 4MABA 1O8WA 3EPTA 1SENA 2R37A 3RAZA 2L4CA 4NHZA 1ZYEA 3F0IA 4H86A 2VCQA 2VL3A 1EV9A 4BVYB 3ZFBA 3ZITA 5J41A 3TCOA 4EIQA 3V1WA 2MMOA 3L4NA 1T7PB 4FYBA 4MH3A 6GSTA 2KP2A 4PGTA 4K0GA 4ECIA 3EVIA 4MF5A 2IIYA 3IHQA 2GT5A 5DQSA 1ZOFA 5IM9A 2N5FA 11GSA 1MDIA 2E0QA 1EEMA 3ME8A 3P7XA 2PWJA 5ECHB 5GZZB 3NZNA 5IPHA 2H74A 4PTSA 3TJKA 2H01A 2I1UA 2HZFA 1R4WA 5JWOB 1B4QA 1GUMA 4NMUA 2P0GA 1R7HA 2CT6A 4MZCA 2B1LA 2HI7A 4LA1A 2YANA 1EP7A 5ECIB 1F3AA 4WBJA 2PUKC 5HQPA 1MDJA 2HRAA 1O8XA 5J4UA 3DVWA 2TRCP 3HCZA 3VI5A 1TK5B 2B5EA 2CAIA 3GKXA 3D21A 5IMAA 3DKSA 3JCML 1FOHA 5ELAA 3VFIA 10GSA 3H4KA 4TKYA 3DEXA 4MA9A 3WYWA 1GRXA 3Q18A 2PERA 2PMTA 1B9YC 1T8EB 2LQOA 5DCHA 3FR6A 3HA9A 1H4OA 2JU5A 5G5FA 2QGVA 1K3LA 5BMUA 3IV4A 2L6DA 1ABAA 6GSWA 4ZXGA 2YJHA 5DQYA 3WGDA 2C4JA 2PBJA 1U3IA 3S9FA 4O32A 2DJJA 2OJLA 4Q5RA 5HFGA 1A2JA 1A0FA 5B6NA 1JZDA 1XVQA 2TIRA 4GF0A 3TJFA 1YEXA 2GZZA 2OADA 2OE1A 4LL4B 1QFNA 4MH2A 5D93A 1TU7A 1CQHA 2QA1A 3EMPA 1F3BA 1SK1A 2K8VA 3EE2A 2I4AA 1HNAA 1G6YA 1GTBA 2BTOT 4KDYA 2TRXA 3UEMA 4K5SA 5ID2A 4MMMA 3BOAA 3ZRDA 2JACA 2VM2A 2X8GA 3IOSA 19GSA 5L71A 5JCUA 1QUWA 1PN9A 2LRTA 4BVXA 1OVNA 3FEUA 2L57A 5KOXA 3FZ5A 4ZB9A 3F4SA 4ZB6A 3IE3A 4NWYA 4YQVA 4QL7A 4IP1A 2DMLA 3GH6A 4DSQA 4YAPA 1XW9A 2V32A 5H5RA 1DE1A 1V57A 2R4VA 1THXA 2KP1A 2O8VB 1M2BA 3BCKA 2NVLA 2JSYA 3CSIA 2VL9A 3ZYWA 2IL3A 4N11A 1OC9B 2HRFA 3TKRA 2M46A 2H71A 5AGYA 2H0IA 3CYNA 4GSNA 3KEBA 4F9ZA 3NOFA 3PINA 5AN1A 2YZUA 4BL7A 4ZBDA 5JCGA 1N8JA 2HNLA 2WJUA 5LCZA 3Q6OA 2VLVA 4XRDA 3E3EA 2CVKA 1GH2A 3H8QA 3GTUB 1O6JA 1R26A 2LNTA 2NPBA 3QFAC 3KTLA 5DALA 2YZHA 4EF0A 2DJ3A 4V2NA 4CDOA 3DWVA 5ECOB 2HRNA 2XHFA 5FHIA 2FLSA 2JADA 1Z9HA 1V40A 3EYTA 4GQCA 2MMNA 2RLIA 4PURA 4EVMA 3LXTA 4OMVA 1TRVA 2C3NA 1XOAA 3PR8A 1THOA 4EO3A 2H1GA 3HJMA 2CX3A 4TOPA 2VAFA 1ERVA 4MPFA 2H73A 3U5RE 4X4JA 4MDCA 4IJ3A 2R0CA 1GLQA 1GWCA 4K7IA 3CTGA 2NTOA 1PKZA 2A2PA 1PKWA 3ZMKA 3PH9A 2MYGA 2L5LA 3EMXA 3QDNA 2B6MA 1OC3A 3GX0A 1M99A 4WXTA 4MZBA 2DKHA 3ZTLA 1SKRB 2AV4A 4XS1A 2B5XA 5ECRB 2YV9A 3UBKA 3C8EA 3LQ7A 3KH7A 3LSZA 9GSSA 1TTZA 3J7Yk 4NV5A 4KE3A 4JRRA 4J56E 2A2RA 3LGCA 1FB0A 3EURA 4G0LA 5IMVA 2C1YA 4I5QA 2LJKA 3H79A 4I8BA 4XRAA 2EC4A 2QKEA 3R3EA 1GTAA 4ECBA 2UZ8A 4XTSA 2H1BA 4F2IA 3QOUA 4NV2A 2B7JA 2OBIA 2AB6A 3C71A 2LJAA 2ON7A 2IFQB 1U6TA 1TI1A 5A4VA 3F4RA 5G1KA 2DLXA 4WBRD 3APQA 3FK8A 5FT3A 2X64A 12GSA 4JR6A 3IXRA 4XIHA 5IMDA 4Z2RA 4ECJA 3ZVJD 5E4WA 3D4TA 4JBBA 2IMIA 2DIZA 1DSBA 4PX1A 2P31A 1SKSB 1JZRA 2MMAA 3IBHA 2HYXA 2R3XA 4J57E 4XS6A 2V6KA 1TI3A 2CX4A 1K0DA 5ENUA 16GSA 4Q5QA 4PUFC 3C73A 1V98A 2YWMA 4KAEA 2LRNA 2WRTA 4K7NA 1GNWA 1BX9A 4N30A 5IOXA 1T4YA 1XWKA 4EL1A 5B8AA 2AYTA 2KOKA 2K6VA 3I9V2 3WGEA 3MNGA 1BJXA 3TGZA 2YJ7A 3US3A 3DVXA 5ECPB 4O5QA 2GT6A 1QGVA 3ZIJA 5C00A 1XFLA 4JZQA 1XOBA 4QQ7A 1GSFA 3F63A 3ME7A 4HOJA 1X9WB 5G2ZA 5EL8A 2AUVA 2LKUA 2H8LA 3UVTA 1T4ZA 2H19A 2PPTA 4EUYA 5JCWA 1E6BA 4EDYA 3R2QA 1OKDA 2WS2A 3LORA 2I3YA 2KUCA 4XS4B 4FYCA 5KN2A 1MD4A 3GL3A 1A8LA 3KCMA 1XXUA 5CAXA 4AJ8A 1FG4A 2FWGA 2H6YA 2K8SA 4NHWA 2H72A 1FVJA 5CNWA 2EIOA 1AQXA 2RIIA 2YOIA 3KGKA 3ZVJA 4KB3A 4IJIA 3ISOA 1VF3A 1TK8B 3U6VA 1X5DA 4EDZA 4LL1B 4RUVA 2CVDA 2X99A 1Z6MA 3MIXA 2XPEA 1PSQA 20GSA 1YQ1A 3VPQA 4OO4A 1AW9A 3GA4A 3N9JA 3HZ8A 3J7Yb 3O6TA 4POKA 1XWCA 3DYRA 3W8SA 1O7UA 1S3AA 2LNSA 3UBLA 4G10A 4WETA 2H1AA 1OYJA 5DJLA 1R5AA 4GLTA 4Z7XA 1GLPA 4HU9A 1W89A 1LJRA 1PRXA 1XW6A 3H1NA 1JHBA 3WT2A 2CA8A 1VRSD 5ELGA 3DMLA 2IJYA 4AJ7A 1A2LA 3HZ4A 1FB6A 1SJIA 2V41A 3ZIVA 5DCGA 4CY8A 4IS0A 2RUEA 1WJKA 3M0FA 3ZREA 1M0UA 1YF0A 1KTEA 2IN3A 4CHSA 1SL2B 2O87A 4N0VA 4IHUA 2KLXA 2R2JA 2AHEA 8GSSA 2YWIA 1F9MA 1TOFA 1XPVA 4K9ZA 1GSUA 1B8XA 4HJMA 1Z3EA 2JSZA 3HYPA 4EKZA 2HZEA 1R5PA 4OFTA 4OFNA 4PQ1A 1Q98A 3GUSA 4L8EA 1BG5A 3TUEA 4K1FA 1SKWB 2H76A 4J2FA 2DJ1A 1OE7A 1NM3A 3A2WA 3PGTA 4LLRA 4TR1B 4BA7A 1XWGA 1URMA 2H30A 4N10A 1X0RA 3LXZA 3I6AA 1AQVA 2WDUA 1JZWA 4POBA 3D22A 3HDCA 3ZL5A 4O5UA 2PVQA 2V1MA 2PU9C 2HRKA 4FO5A 3CBUA 3IR4A 1X5EA 1NHOA 3L9UA 3F6FA 3HJOA 5JWQB 1ON4A 2DBCA 3GV1A 4V2LA 3SBCA 2O85A 3QR6A 3P8WA 3N5OA 4PUAA 3L9SA 4KH7A 1SD8A 5D9WA 4LMVA 2DSAA 1A2MA 1GSSA 2DJKA 1PD21 3LEFA 4QL9A 3KZQA 1RK4A 4GRFA 5AISA 4D73A 2E2MA 5B7CA 3PPUA 5KN1A 1TK0B 5CRWA 4V1Ag 4V1Ap 2ZNMA 2YPMA 4NPBA 4G19A 3MSZA 4POLA 5DAKB 2C80A 3TDGA 4MJBA 1FOVA 1WPIA 5IIZA 2A4HA 4XCSA 3KD0A 1J08A 5KEJA 1PL2A 3ERFA 2VCWA 3IPZA 2V2GA 2WZ9A 4AGSA 4ZL7A 3HY2A 4HZ4A 4GQFA 3ED3A 3TOTA 2AAWA 2GDRA 3FMWA 5F8BA 1MDKA 2VOCA 3TJGA 5A4WA 1ZCPA 2ZCTA 1TRSA 1ZMAA 3ERGA 3TKSA 1OKTA 3BCIA 4E8EA 2RUFA 3UL3A 4KDXA 3GFKA 3MWHA 1SYRA 5B6MA 1O73A 4IELA 6GSSA 2I9HA 1TJDA 2MMZA 2FCHA 1QXHA 3WD6A 2QSIA 2REMA 2VLTA 1HYUA 2X4AA 5B8BA 1YY7A 3HXSA 4ISDA 2LQQA 2FNOA 3C1RA 1K0OA 4HUAA 1N2AA 1Z6NA 5IPGA 3RBTA 4BWSA 4YAVA 2CZ3A 4AJ6A 3TRQA 2MZCA 4LMWA 3KXOA 2B5YA 4K7OA 5IMFA 2GQKA 1UVZA 3VURA 1SL0B 4L5OA 2B7KA 4USSA 4TXOB 1EZKA 3CTFA 5G5EA 2K9FA 3FHKA 5IMZA 5F05A 3OR5A 5IQYA 1PX6A 2GGTA 3I43A 2LTKA 4YKGA 3LFLA 1VF4A 3LW9A 4L0UA 3O3TA 1SK0A 2FWEA 3D6IA 3O76A 2H66A 4IW9A 3FYGA 3WGXA 1EGOA 2L4QA 3EWLA 4V2MA 5D73A 1HNCA 1GSYA 3TKSC 4CY6A 4ILFA 4I2UA 1EEJA 4ECCA 4HDEA 1OE8A 3UMAA 4KNDA 4HJ2A 3HVXA 1GNEA 3DXBA 5ECNB 2H70A 2WGRA 3GRXA 13GSA 4NAXA 3ZLPA 1C72A 4HZ2A 3EU4A 4F0BA 4X1UA 22GSA 3EU3A 4ACSA 4HU7A 3G7YA 4DSSA 2DC5A 2C3TA 1SJ6A 3FRCA 3TOUA 2WB9A 4ICYA 1FVKA 3I69A 3QD9A 3IHGA 2ALBA 3LG6A 3MDKA 2WULA 1HQOA 1O85A 1M9AA 1UA5A 4ZILA 3A5IA 1TU8A 1GSEA 1GTUA 5J5NA 5HR1A 2I81A 4YH2A 4BWQA 2DJ2A 1F2EA 1K0BA 5KN0A 4NXIA 3E0UA 3VWXA 1XCCA 4KDUA 2FA8A 1PMTA 2LS5A 4O5RA 3QMXA 1T1VA 4BVYA 5ID2B 1AC1A 4WKWA 3IK9A 3FZAA 4Q5FA 3H93A 5CYYA 2XBQA 4KUNA 5CP1A 1K3OA 1ACVA 4K5RA 4I97A 3TRXA 4ZL9A 4JU5A 4EIPA 1KNGA 2DJ0A 3EINA 4KGIA 4BVXB 4WEYA 2BJXA 2VIMA 1USBA 2GSRA 5LNKe 3QAVA 5ECQB 4WR5A 4OD7A 1FW1A 4CW9A 3GMFA 3KIJA 1TKDB 4K2DA 2H6XA 4X43A 1LBKA 3Q74A 4IN0A 1ZGNA 5GAPD 1RQMA 3VI7A 3HD5A 4MF7A 2M72A 3GSTA 2FD3A 5F0GA 2YN1A 2IMEA 2V6OA 3EC3A 5IMCA 4POMA 1ERUA 3M9JA 2A4VA 1B4PA 3CRTA 3QAWA 4BL7B 2H6ZA 4TR1A 3HVVA 4HQZA 1BAYA 5A5KA 1PX7A 4HQSA 4TVEA 1KBNA 6GSUA 1ZL9A 2G0FA 4MJAA 1JFUA 2VD1A 3D5JA 3M8NA 5G31A 2LJRA 2R0GA 1A0RP 4KX4A 3GKKA 1BEDA 2HSMA 2Z9SA 5DALB 5FWGA 4ML6A 1DUGA 3GNJA 1V2AA 1GULA 4DVCA 4MPGA 3TB2A 1VF1A 5CRGA 4KCEA 1CQGA 3D4MA 1ILOA 3GYKA 5KOWA 1VGLA 3E9JB 5KN3A 1TDIA 4N0ZA 2H0HA 5EPFA 1GSDA 4O92A 1Z7RA 2OKAA 2JL4A 1Y6EA 1QMVA 4GSSA 4TR4A 2F3MA 2C0GA 5CO3A 4G2EA 2R6KA 1UC7A 4X0XA 2GLRA 3KM6A 4MLYA 2X8HA 4XHMA 3M9KA 3GKNA 2OA7A 3A5WA 14GSA 5DAKA 1S3CA 4DSRA 1XW5A 3W8JA 3TJBA 3W6GA 2IWTA 2B1KA 3TKPA 2C3QA 3IDVA 5IOWA 3G9BA 4PQHA 1EGRA 4PQIA 4MJCA 1A23A 3RHCA 4ID0A 3RDWA 3KH9A 2AJQB 3IA1A 5E59A 3P90A 1SK2A 4HI7A 2JZSA 1PN0A 2N5BA 3GN3A 1ZZYA 5AIVA 1PA3A 1W4VA 2XPDA 5DJMA 5H5SA 2WFCA 2ES7A 1U3AA 5F06A 2F8AA 1TP9A 5H5QA 2DIYA 4ZB8A 3K8NA 1WRYA 2FUG2 1PL1A 2HSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2T A;  1ST9 A;  2VM1 A;  1AQW A;  3M1G A;  4E8H A;  3QPM A;  4IKH A;  5G30 A;  1YJ6 A;  4RQX A;  2G2Q A;  3G7I A;  1ZYQ B;  1OC9 A;  5COH A;  1WWJ A;  4TR0 A;  3SWL A;  1U88 A;  3BJ5 A;  3F8U A;  3GKM A;  3LYK A;  3F9U A;  3KMO A;  1K0C A;  2YWN A;  4ULX A;  2BMX A;  3CMI A;  3BD2 A;  3VPT A;  2JZR A;  2VCZ A;  3NIV A;  3GTU A;  3HKR A;  3UIW A;  3UJ1 A;  1MTC A;  2LV3 A;  2L6C A;  2XBI A;  3FZ9 A;  1GUH A;  1TW9 A;  3A2V A;  2EIR A;  4JE1 A;  5J9C A;  4TXO A;  1A8Y A;  1M7T A;  3RPN A;  1AIU A;  1EV4 A;  5EY6 A;  4TW5 A;  4RI6 A;  1DBY A;  1IYI A;  4RI7 A;  1Z5Y E;  4F0C A;  1F37 A;  2GST A;  2OAC A;  1YEP A;  1T3B A;  4L5L A;  1DE2 A;  1WP0 A;  1PGT A;  2OE3 A;  3LYP A;  2HT9 A;  17GS A;  1EP8 A;  5D9T A;  1OAZ A;  1SYX A;  2OBK A;  4EC0 A;  2IPA A;  1H75 A;  1I5G A;  4EXJ A;  3L9V A;  2L59 A;  5LD0 A;  4GTU A;  3AY8 A;  1F6M C;  5JWR B;  5G1L A;  1K0M A;  1WOU A;  2ZUP A;  2L5O A;  4K6X A;  5HFI A;  2IMK A;  2YP6 A;  3F3Q A;  4O7H A;  1EOG A;  2LRC A;  1X9M B;  1KEB A;  1G6W A;  5AIX A;  1QQ2 A;  4WF5 A;  4IBP A;  5GSS A;  2F8F A;  2GVP A;  3KP9 A;  5J9B A;  3CSH A;  3P2A A;  1MD3 A;  1GL8 A;  4JED A;  3QCP A;  5D9V A;  2VLU A;  2H0G A;  4OO5 A;  2VCT A;  2OE0 A;  1S3D A;  1Q4J A;  4RQR A;  1LU4 A;  4GXZ A;  1WIK A;  5A4U A;  2HLS A;  2GZP A;  1YKC A;  5INY A;  3IAS 2;  4KSO A;  2IFQ A;  2MBS A;  3F4T A;  4DEJ A;  4EE0 A;  1SD9 A;  2IMD A;  5EVO A;  2ON5 A;  1HD2 A;  1XBS A;  3CSJ A;  3IK7 A;  3FR9 A;  4TN8 A;  3F6D A;  3TKQ A;  4WR4 A;  2CV4 A;  4KW6 A;  4KA0 A;  3VWW A;  2FWF A;  5D96 A;  3GSS A;  4BPY A;  1K3Y A;  5J3R A;  3KTB A;  1TXX A;  2P5R A;  2KHP A;  2CAQ A;  2J23 A;  2FHE A;  4Q5N A;  2C0E A;  2IMF A;  1AAZ A;  3UAP A;  3TKS E;  1XZO A;  5HFK A;  2RM6 A;  2E7P A;  1J9B A;  4AF2 A;  4OCF A;  1YF1 A;  5CRH A;  4MP4 A;  2MBT A;  4TR3 A;  2F9S A;  3VWV A;  2QC7 A;  4OCE A;  2R5G A;  1M2A A;  4FIW A;  5C04 A;  3APO A;  1U87 A;  2J9H A;  1SL1 B;  1B48 A;  2NBS A;  3LWA A;  2F51 A;  4ZIJ A;  3TJJ A;  2GSS A;  4GCI A;  3QFB C;  2N5A A;  1GP1 A;  4TRX A;  1XWA A;  2HE3 A;  3GUR A;  2B3S A;  2LST A;  3L0H A;  2HZE B;  3C1S A;  1YDK A;  3DD3 A;  2VO4 A;  3D0Z A;  2VUP A;  4L0W A;  3APS A;  4OFM A;  3IRA A;  1ERT A;  4IGJ A;  4FH8 A;  2DMM A;  4PXO A;  2HXK A;  1M9B A;  5ECM B;  3G7J A;  4OWY A;  4XS4 A;  18GS A;  3UVH A;  2CVB A;  1PQN A;  3KP8 A;  4MZW A;  4KCA A;  1BQ7 A;  4WF4 A;  3BBY A;  3IC4 A;  2X8C A;  6GSY A;  3L78 A;  5CRD A;  1EOH A;  1YKA A;  1SU9 A;  4MK3 A;  2K18 A;  3LJR A;  1O81 A;  3KMN A;  1FO5 A;  1QK8 A;  3DRN A;  1G0T A;  5CRE A;  2VL2 A;  5ECL B;  3ZFL A;  1M2D A;  3A3T A;  2C8U A;  1X5C A;  4D73 B;  4ZBB A;  5HR0 A;  3A2X A;  3FW2 A;  3RHB A;  3HVS A;  4MCU A;  4YQU A;  2FWH A;  1ML6 A;  4ZL8 A;  4G9H A;  1MEK A;  1JLV A;  2EIQ A;  3UOM A;  3KJY A;  4I6X A;  2D2Z A;  2E2G A;  1V9W A;  3HJP A;  1K0A A;  1X9S B;  3VLN A;  3UAR A;  1BYE A;  3ZZX A;  2YWO A;  1K0N A;  3M3M A;  4JR4 A;  5ECS A;  2HFD A;  5DVB A;  2GSQ A;  5ECK B;  1IYH A;  1G7O A;  3QAG A;  1OC8 A;  4GST A;  5GAN D;  2NDO A;  4ZBA A;  1A24 A;  1NSW A;  3VWU A;  4K0N A;  4IQ1 A;  4PNG A;  4F82 A;  3C7M A;  2H75 A;  1GTI A;  1JLW A;  5HR3 A;  2O7K A;  3VK9 A;  5GST A;  1E2Y A;  3Q19 A;  4K8M A;  4IQA A;  3MAK A;  4HEA 2;  2JZT A;  1XVW A;  2CQ9 A;  2GS3 A;  1TRW A;  2GQL A;  2VL2 C;  4PNF A;  3CRU A;  2YV7 A;  5F07 A;  2PGT A;  2FA4 A;  4F03 A;  4MF6 A;  3GL5 A;  2PVO C;  2VCX A;  2H1D A;  4HS1 A;  3TRP A;  1FAA A;  1FHE A;  1ERW A;  2C0F A;  1HNB A;  2YNX A;  5IO0 A;  4IP6 A;  2YCD A;  2RM5 A;  3FR3 A;  1GSQ A;  3GHA A;  4KSM A;  4P3Y B;  1J0F A;  3FZ4 A;  2FY6 A;  2VD0 A;  1T00 A;  2GQM A;  1VF2 A;  3HHV A;  6GSV A;  1JZO A;  1Z7P A;  3GIX A;  3GH9 A;  5D9X A;  1YZX A;  1RW1 A;  2GZY A;  3CXG A;  3GX8 A;  3IAM 2;  4IVF A;  1SJZ A;  1B9X C;  4ML1 A;  1WE0 A;  5IO2 A;  5HR2 A;  5DBQ A;  2WCI A;  1V58 A;  1I9D A;  2VCV A;  4GWR A;  1UN2 A;  3DGQ A;  5ABR A;  3RPP A;  1TRU A;  1Y25 A;  1NHY A;  1G7E A;  2A2S A;  4FYU A;  3ERW A;  6GSX A;  3F3R A;  2PN8 A;  5D8I A;  1AUC A;  4DSS B;  4YQM A;  2LUS A;  1NW2 A;  3FY7 A;  3WT1 A;  1WMJ A;  2CZ2 A;  4MJE A;  2HSH A;  5DDL A;  1XWB A;  2GTU A;  4TXV A;  2LEG A;  2C0D A;  1AXD A;  2FGX A;  1XIY A;  3DIE A;  2O89 A;  2P5Q A;  1EWX A;  2M80 A;  7GSS A;  3FKF A;  3ZML A;  1GUK A;  2XC2 A;  4MAB A;  1O8W A;  1SEN A;  2R37 A;  3RAZ A;  2L4C A;  4NHZ A;  1ZYE A;  3F0I A;  4H86 A;  2VCQ A;  2VL3 A;  1EV9 A;  3ZFB A;  3ZIT A;  5J41 A;  3TCO A;  3V1W A;  2MMO A;  3L4N A;  1T7P B;  4FYB A;  4MH3 A;  6GST A;  2KP2 A;  4PGT A;  4K0G A;  4ECI A;  3EVI A;  4MF5 A;  2IIY A;  3IHQ A;  2GT5 A;  5DQS A;  1ZOF A;  5IM9 A;  2N5F A;  11GS A;  1MDI A;  2E0Q A;  1EEM A;  3ME8 A;  3P7X A;  2PWJ A;  5ECH B;  5GZZ B;  3NZN A;  5IPH A;  2H74 A;  3TJK A;  2H01 A;  2I1U A;  2HZF A;  1R4W A;  5JWO B;  1B4Q A;  1GUM A;  4NMU A;  2P0G A;  1R7H A;  2CT6 A;  4MZC A;  2B1L A;  2HI7 A;  4LA1 A;  2YAN A;  1EP7 A;  5ECI B;  1F3A A;  4WBJ A;  2PUK C;  5HQP A;  1MDJ A;  1O8X A;  5J4U A;  3DVW A;  2TRC P;  3HCZ A;  3VI5 A;  1TK5 B;  2B5E A;  2CAI A;  3GKX A;  3D21 A;  5IMA A;  3DKS A;  3JCM L;  5ELA A;  3VFI A;  10GS A;  3H4K A;  4TKY A;  3DEX A;  4MA9 A;  3WYW A;  1GRX A;  3Q18 A;  2PER A;  2PMT A;  1B9Y C;  1T8E B;  2LQO A;  5DCH A;  3FR6 A;  3HA9 A;  1H4O A;  2JU5 A;  5G5F A;  2QGV A;  1K3L A;  3IV4 A;  2L6D A;  1ABA A;  6GSW A;  4ZXG A;  2YJH A;  5DQY A;  3WGD A;  2C4J A;  2PBJ A;  1U3I A;  3S9F A;  4O32 A;  2DJJ A;  2OJL A;  4Q5R A;  5HFG A;  1A2J A;  1A0F A;  5B6N A;  1JZD A;  1XVQ A;  2TIR A;  4GF0 A;  3TJF A;  1YEX A;  2GZZ A;  2OAD A;  2OE1 A;  4LL4 B;  1QFN A;  4MH2 A;  5D93 A;  1TU7 A;  1CQH A;  3EMP A;  1F3B A;  1SK1 A;  2K8V A;  3EE2 A;  2I4A A;  1HNA A;  1G6Y A;  1GTB A;  2BTO T;  4KDY A;  2TRX A;  3UEM A;  5ID2 A;  4MMM A;  3BOA A;  3ZRD A;  2JAC A;  2VM2 A;  2X8G A;  3IOS A;  19GS A;  5L71 A;  5JCU A;  1QUW A;  1PN9 A;  2LRT A;  4BVX A;  1OVN A;  3FEU A;  2L57 A;  3FZ5 A;  4ZB9 A;  3F4S A;  4ZB6 A;  3IE3 A;  4NWY A;  4YQV A;  4QL7 A;  4IP1 A;  2DML A;  3GH6 A;  4DSQ A;  4YAP A;  1XW9 A;  2V32 A;  5H5R A;  1DE1 A;  1V57 A;  2R4V A;  1THX A;  2KP1 A;  2O8V B;  1M2B A;  3BCK A;  2NVL A;  2JSY A;  3CSI A;  2VL9 A;  3ZYW A;  2IL3 A;  4N11 A;  1OC9 B;  2HRF A;  3TKR A;  2M46 A;  2H71 A;  5AGY A;  2H0I A;  3CYN A;  4GSN A;  3KEB A;  4F9Z A;  3NOF A;  3PIN A;  5AN1 A;  2YZU A;  4BL7 A;  4ZBD A;  5JCG A;  1N8J A;  2HNL A;  2WJU A;  5LCZ A;  3Q6O A;  2VLV A;  4XRD A;  3E3E A;  2CVK A;  1GH2 A;  3H8Q A;  3GTU B;  1O6J A;  1R26 A;  2LNT A;  2NPB A;  3QFA C;  3KTL A;  5DAL A;  2YZH A;  4EF0 A;  2DJ3 A;  4V2N A;  4CDO A;  3DWV A;  5ECO B;  2HRN A;  2XHF A;  5FHI A;  2FLS A;  2JAD A;  1Z9H A;  1V40 A;  3EYT A;  4GQC A;  2MMN A;  2RLI A;  4PUR A;  4EVM A;  3LXT A;  4OMV A;  1TRV A;  2C3N A;  1XOA A;  3PR8 A;  1THO A;  4EO3 A;  2H1G A;  3HJM A;  2CX3 A;  4TOP A;  2VAF A;  1ERV A;  4MPF A;  2H73 A;  3U5R E;  4MDC A;  4IJ3 A;  1GLQ A;  1GWC A;  4K7I A;  3CTG A;  2NTO A;  1PKZ A;  1PKW A;  3ZMK A;  3PH9 A;  2MYG A;  2L5L A;  3EMX A;  3QDN A;  2B6M A;  1OC3 A;  3GX0 A;  1M99 A;  4WXT A;  4MZB A;  3ZTL A;  1SKR B;  2AV4 A;  4XS1 A;  2B5X A;  5ECR B;  2YV9 A;  3UBK A;  3C8E A;  3LQ7 A;  3KH7 A;  3LSZ A;  9GSS A;  1TTZ A;  3J7Y k;  4NV5 A;  4KE3 A;  4JRR A;  4J56 E;  2A2R A;  3LGC A;  1FB0 A;  3EUR A;  5IMV A;  2C1Y A;  4I5Q A;  2LJK A;  3H79 A;  4I8B A;  4XRA A;  2EC4 A;  2QKE A;  1GTA A;  4ECB A;  4XTS A;  2H1B A;  4F2I A;  3QOU A;  4NV2 A;  2B7J A;  2OBI A;  2AB6 A;  3C71 A;  2LJA A;  2ON7 A;  2IFQ B;  1U6T A;  1TI1 A;  5A4V A;  3F4R A;  5G1K A;  2DLX A;  4WBR D;  3APQ A;  3FK8 A;  5FT3 A;  2X64 A;  12GS A;  4JR6 A;  3IXR A;  4XIH A;  5IMD A;  4ECJ A;  3ZVJ D;  5E4W A;  3D4T A;  4JBB A;  2IMI A;  2DIZ A;  1DSB A;  4PX1 A;  2P31 A;  1SKS B;  1JZR A;  2MMA A;  3IBH A;  2HYX A;  2R3X A;  4J57 E;  4XS6 A;  2V6K A;  1TI3 A;  2CX4 A;  1K0D A;  5ENU A;  16GS A;  4Q5Q A;  4PUF C;  3C73 A;  1V98 A;  2YWM A;  4KAE A;  2LRN A;  2WRT A;  4K7N A;  1GNW A;  1BX9 A;  4N30 A;  5IOX A;  1T4Y A;  1XWK A;  4EL1 A;  5B8A A;  2AYT A;  2KOK A;  2K6V A;  3I9V 2;  3WGE A;  3MNG A;  1BJX A;  3TGZ A;  2YJ7 A;  3US3 A;  3DVX A;  5ECP B;  2GT6 A;  1QGV A;  3ZIJ A;  5C00 A;  1XFL A;  4JZQ A;  1XOB A;  4QQ7 A;  1GSF A;  3F63 A;  3ME7 A;  4HOJ A;  1X9W B;  5G2Z A;  5EL8 A;  2AUV A;  2LKU A;  2H8L A;  3UVT A;  1T4Z A;  2H19 A;  2PPT A;  4EUY A;  5JCW A;  1E6B A;  4EDY A;  3R2Q A;  1OKD A;  2WS2 A;  3LOR A;  2I3Y A;  2KUC A;  4XS4 B;  4FYC A;  5KN2 A;  1MD4 A;  3GL3 A;  1A8L A;  3KCM A;  1XXU A;  5CAX A;  4AJ8 A;  1FG4 A;  2FWG A;  2H6Y A;  2K8S A;  4NHW A;  2H72 A;  1FVJ A;  5CNW A;  2EIO A;  1AQX A;  2RII A;  2YOI A;  3KGK A;  3ZVJ A;  4KB3 A;  4IJI A;  3ISO A;  1VF3 A;  1TK8 B;  3U6V A;  1X5D A;  4EDZ A;  4LL1 B;  4RUV A;  2CVD A;  2X99 A;  1Z6M A;  2XPE A;  1PSQ A;  20GS A;  1YQ1 A;  3VPQ A;  4OO4 A;  1AW9 A;  3GA4 A;  3N9J A;  3HZ8 A;  3J7Y b;  3O6T A;  4POK A;  1XWC A;  3DYR A;  3W8S A;  1O7U A;  1S3A A;  2LNS A;  3UBL A;  4G10 A;  4WET A;  2H1A A;  1OYJ A;  5DJL A;  1R5A A;  4GLT A;  4Z7X A;  1GLP A;  4HU9 A;  1W89 A;  1LJR A;  1PRX A;  1XW6 A;  3H1N A;  1JHB A;  3WT2 A;  2CA8 A;  1VRS D;  5ELG A;  3DML A;  2IJY A;  4AJ7 A;  1A2L A;  3HZ4 A;  1FB6 A;  1SJI A;  2V41 A;  3ZIV A;  5DCG A;  4IS0 A;  2RUE A;  1WJK A;  3M0F A;  3ZRE A;  1M0U A;  1YF0 A;  1KTE A;  2IN3 A;  4CHS A;  1SL2 B;  2O87 A;  4N0V A;  4IHU A;  2KLX A;  2R2J A;  2AHE A;  8GSS A;  2YWI A;  1F9M A;  1TOF A;  1XPV A;  4K9Z A;  1GSU A;  1B8X A;  4HJM A;  1Z3E A;  2JSZ A;  3HYP A;  4EKZ A;  2HZE A;  1R5P A;  4OFT A;  4OFN A;  4PQ1 A;  1Q98 A;  3GUS A;  4L8E A;  1BG5 A;  3TUE A;  4K1F A;  1SKW B;  2H76 A;  4J2F A;  2DJ1 A;  1OE7 A;  1NM3 A;  3A2W A;  3PGT A;  4LLR A;  4TR1 B;  4BA7 A;  1XWG A;  1URM A;  2H30 A;  4N10 A;  1X0R A;  3LXZ A;  3I6A A;  1AQV A;  2WDU A;  1JZW A;  4POB A;  3D22 A;  3HDC A;  3ZL5 A;  2PVQ A;  2V1M A;  2PU9 C;  4FO5 A;  3CBU A;  3IR4 A;  1X5E A;  1NHO A;  3L9U A;  3F6F A;  3HJO A;  5JWQ B;  1ON4 A;  2DBC A;  3GV1 A;  4V2L A;  3SBC A;  2O85 A;  3QR6 A;  3P8W A;  3N5O A;  4PUA A;  3L9S A;  4KH7 A;  1SD8 A;  5D9W A;  4LMV A;  2DSA A;  1A2M A;  1GSS A;  2DJK A;  1PD2 1;  3LEF A;  4QL9 A;  3KZQ A;  1RK4 A;  4GRF A;  5AIS A;  4D73 A;  2E2M A;  5B7C A;  5KN1 A;  1TK0 B;  5CRW A;  4V1A g;  4V1A p;  2ZNM A;  2YPM A;  4NPB A;  4G19 A;  3MSZ A;  4POL A;  5DAK B;  2C80 A;  3TDG A;  4MJB A;  1FOV A;  1WPI A;  5IIZ A;  4XCS A;  3KD0 A;  1J08 A;  5KEJ A;  1PL2 A;  3ERF A;  2VCW A;  3IPZ A;  2V2G A;  2WZ9 A;  4AGS A;  4ZL7 A;  3HY2 A;  4HZ4 A;  4GQF A;  3ED3 A;  3TOT A;  2AAW A;  2GDR A;  5F8B A;  1MDK A;  2VOC A;  3TJG A;  5A4W A;  1ZCP A;  2ZCT A;  1TRS A;  1ZMA A;  3ERG A;  3TKS A;  1OKT A;  3BCI A;  4E8E A;  2RUF A;  3UL3 A;  4KDX A;  3GFK A;  3MWH A;  1SYR A;  5B6M A;  1O73 A;  4IEL A;  6GSS A;  2I9H A;  1TJD A;  2MMZ A;  2FCH A;  1QXH A;  3WD6 A;  2QSI A;  2REM A;  2VLT A;  1HYU A;  5B8B A;  1YY7 A;  3HXS A;  4ISD A;  2LQQ A;  2FNO A;  3C1R A;  1K0O A;  4HUA A;  1N2A A;  1Z6N A;  5IPG A;  3RBT A;  4BWS A;  4YAV A;  2CZ3 A;  4AJ6 A;  3TRQ A;  2MZC A;  4LMW A;  3KXO A;  2B5Y A;  4K7O A;  5IMF A;  2GQK A;  1UVZ A;  3VUR A;  1SL0 B;  4L5O A;  2B7K A;  4TXO B;  1EZK A;  3CTF A;  5G5E A;  2K9F A;  3FHK A;  5IMZ A;  5F05 A;  3OR5 A;  5IQY A;  1PX6 A;  2GGT A;  3I43 A;  2LTK A;  3LFL A;  1VF4 A;  4L0U A;  3O3T A;  1SK0 A;  2FWE A;  3D6I A;  3O76 A;  2H66 A;  4IW9 A;  3FYG A;  3WGX A;  1EGO A;  2L4Q A;  3EWL A;  4V2M A;  5D73 A;  1HNC A;  1GSY A;  3TKS C;  4ILF A;  4I2U A;  1EEJ A;  4ECC A;  4HDE A;  1OE8 A;  3UMA A;  4KND A;  4HJ2 A;  3HVX A;  1GNE A;  3DXB A;  5ECN B;  2H70 A;  2WGR A;  3GRX A;  13GS A;  4NAX A;  3ZLP A;  1C72 A;  4HZ2 A;  3EU4 A;  4F0B A;  4X1U A;  22GS A;  3EU3 A;  4ACS A;  4HU7 A;  3G7Y A;  4DSS A;  2DC5 A;  2C3T A;  1SJ6 A;  3FRC A;  3TOU A;  2WB9 A;  1FVK A;  3I69 A;  3QD9 A;  2ALB A;  3LG6 A;  3MDK A;  2WUL A;  1HQO A;  1O85 A;  1M9A A;  1UA5 A;  4ZIL A;  1TU8 A;  1GSE A;  1GTU A;  5J5N A;  5HR1 A;  2I81 A;  4YH2 A;  4BWQ A;  2DJ2 A;  1F2E A;  1K0B A;  5KN0 A;  4NXI A;  3E0U A;  3VWX A;  1XCC A;  4KDU A;  2FA8 A;  1PMT A;  2LS5 A;  4O5R A;  3QMX A;  1T1V A;  4BVY A;  5ID2 B;  1AC1 A;  4WKW A;  3IK9 A;  3FZA A;  4Q5F A;  3H93 A;  5CYY A;  2XBQ A;  4KUN A;  5CP1 A;  1K3O A;  1ACV A;  4I97 A;  3TRX A;  4ZL9 A;  4JU5 A;  1KNG A;  2DJ0 A;  3EIN A;  4KGI A;  4WEY A;  2BJX A;  2VIM A;  1USB A;  2GSR A;  5LNK e;  3QAV A;  5ECQ B;  4WR5 A;  4OD7 A;  1FW1 A;  4CW9 A;  3GMF A;  3KIJ A;  1TKD B;  4K2D A;  2H6X A;  4X43 A;  1LBK A;  3Q74 A;  4IN0 A;  1ZGN A;  5GAP D;  1RQM A;  3VI7 A;  3HD5 A;  4MF7 A;  2M72 A;  3GST A;  2FD3 A;  5F0G A;  2YN1 A;  2IME A;  2V6O A;  3EC3 A;  5IMC A;  4POM A;  1ERU A;  3M9J A;  2A4V A;  1B4P A;  3CRT A;  3QAW A;  2H6Z A;  4TR1 A;  3HVV A;  4HQZ A;  1BAY A;  5A5K A;  1PX7 A;  4HQS A;  4TVE A;  1KBN A;  6GSU A;  1ZL9 A;  2G0F A;  4MJA A;  1JFU A;  2VD1 A;  3D5J A;  3M8N A;  5G31 A;  2LJR A;  1A0R P;  4KX4 A;  3GKK A;  1BED A;  2Z9S A;  5DAL B;  5FWG A;  4ML6 A;  1DUG A;  3GNJ A;  1V2A A;  1GUL A;  4DVC A;  4MPG A;  3TB2 A;  1VF1 A;  5CRG A;  4KCE A;  1CQG A;  3D4M A;  1ILO A;  3GYK A;  1VGL A;  3E9J B;  5KN3 A;  1TDI A;  4N0Z A;  2H0H A;  5EPF A;  1GSD A;  4O92 A;  1Z7R A;  2OKA A;  2JL4 A;  1Y6E A;  1QMV A;  4GSS A;  4TR4 A;  2F3M A;  2C0G A;  5CO3 A;  4G2E A;  2R6K A;  1UC7 A;  4X0X A;  2GLR A;  3KM6 A;  4MLY A;  2X8H A;  4XHM A;  3M9K A;  3GKN A;  2OA7 A;  3A5W A;  14GS A;  5DAK A;  1S3C A;  4DSR A;  1XW5 A;  3W8J A;  3TJB A;  3W6G A;  2IWT A;  2B1K A;  3TKP A;  2C3Q A;  3IDV A;  5IOW A;  3G9B A;  4PQH A;  1EGR A;  4PQI A;  4MJC A;  1A23 A;  3RHC A;  4ID0 A;  3RDW A;  3KH9 A;  2AJQ B;  3IA1 A;  5E59 A;  3P90 A;  1SK2 A;  4HI7 A;  2JZS A;  2N5B A;  3GN3 A;  1ZZY A;  5AIV A;  1PA3 A;  1W4V A;  2XPD A;  5DJM A;  5H5S A;  2WFC A;  2ES7 A;  1U3A A;  5F06 A;  2F8A A;  1TP9 A;  5H5Q A;  2DIY A;  4ZB8 A;  3K8N A;  1WRY A;  2FUG 2;  1PL1 A;  2HSY A; 
#chains in the Genus database with same CATH topology
 4I2T A;  1ST9 A;  2VM1 A;  1AQW A;  3M1G A;  4E8H A;  3QPM A;  4IKH A;  5G30 A;  1YJ6 A;  4RQX A;  2G2Q A;  3G7I A;  1ZYQ B;  1OC9 A;  5COH A;  1WWJ A;  4TR0 A;  3SWL A;  1U88 A;  3BJ5 A;  3F8U A;  3GKM A;  3LYK A;  3F9U A;  3KMO A;  1K0C A;  2YWN A;  4ULX A;  2BMX A;  3CMI A;  3BD2 A;  3VPT A;  2JZR A;  2VCZ A;  3NIV A;  3GTU A;  3HKR A;  3UIW A;  3UJ1 A;  1MTC A;  2LV3 A;  2L6C A;  2XBI A;  3FZ9 A;  4Z2U A;  1GUH A;  1TW9 A;  3A2V A;  2EIR A;  4JE1 A;  2R0P A;  5J9C A;  5BRT A;  4TXO A;  1A8Y A;  1M7T A;  3RPN A;  1AIU A;  1EV4 A;  5EY6 A;  3MYD A;  4TW5 A;  4RI6 A;  1DBY A;  1IYI A;  4RI7 A;  1Z5Y E;  4F0C A;  1F37 A;  2GST A;  2OAC A;  1YEP A;  1T3B A;  4L5L A;  1DE2 A;  1WP0 A;  1PGT A;  2OE3 A;  3LYP A;  2HT9 A;  17GS A;  1EP8 A;  5D9T A;  1OAZ A;  1SYX A;  2OBK A;  4EC0 A;  2IPA A;  1H75 A;  1I5G A;  4EXJ A;  3L9V A;  2L59 A;  5LD0 A;  4GTU A;  3AY8 A;  1F6M C;  5JWR B;  5G1L A;  1K0M A;  1WOU A;  2ZUP A;  2L5O A;  4K6X A;  5HFI A;  2IMK A;  2YP6 A;  3F3Q A;  4O7H A;  1EOG A;  4A5P A;  2LRC A;  1X9M B;  1KEB A;  1G6W A;  5AIX A;  1QQ2 A;  4WF5 A;  4IBP A;  5GSS A;  2F8F A;  2GVP A;  2QA2 A;  3KP9 A;  5J9B A;  3CSH A;  3P2A A;  1MD3 A;  1GL8 A;  4JED A;  3QCP A;  5D9V A;  2VLU A;  2H0G A;  4OO5 A;  2VCT A;  2OE0 A;  1S3D A;  1Q4J A;  4RQR A;  1LU4 A;  4GXZ A;  1WIK A;  5A4U A;  2HLS A;  2GZP A;  1YKC A;  5INY A;  3IAS 2;  4KSO A;  2IFQ A;  2MBS A;  3F4T A;  4DEJ A;  4EE0 A;  1SD9 A;  2IMD A;  5EVO A;  2ON5 A;  1HD2 A;  1XBS A;  3CSJ A;  3IK7 A;  3FR9 A;  4TN8 A;  4HSC X;  3F6D A;  4Z2T A;  3TKQ A;  4WR4 A;  2CV4 A;  4FQU A;  4KW6 A;  4KA0 A;  3VWW A;  2FWF A;  5D96 A;  3GSS A;  4BPY A;  1K3Y A;  5J3R A;  3KTB A;  1TXX A;  2P5R A;  2KHP A;  2CAQ A;  2J23 A;  2FHE A;  4Q5N A;  2C0E A;  2IMF A;  1AAZ A;  3UAP A;  1ZYP A;  3TKS E;  1XZO A;  5HFK A;  2RM6 A;  2E7P A;  1J9B A;  4AF2 A;  4G0I A;  4OCF A;  1YF1 A;  5CRH A;  4MP4 A;  2MBT A;  4TR3 A;  2F9S A;  3VWV A;  2QC7 A;  4OCE A;  2R5G A;  1M2A A;  4FIW A;  5C04 A;  3APO A;  1U87 A;  1PFO A;  2J9H A;  1SL1 B;  1B48 A;  2NBS A;  3LWA A;  2F51 A;  4ZIJ A;  3TJJ A;  2GSS A;  4GCI A;  3QFB C;  2N5A A;  1ZYN A;  1GP1 A;  4TRX A;  1XWA A;  2HE3 A;  3GUR A;  2B3S A;  2LST A;  3L0H A;  2HZE B;  3C1S A;  1YDK A;  3DD3 A;  2VO4 A;  3D0Z A;  2VUP A;  4L0W A;  3APS A;  4OFM A;  3IRA A;  1ERT A;  4IGJ A;  4FH8 A;  2DMM A;  4PXO A;  2HXK A;  1M9B A;  5ECM B;  3G7J A;  4OWY A;  4XS4 A;  18GS A;  3UVH A;  2CVB A;  1PQN A;  3KP8 A;  4MZW A;  4KCA A;  1BQ7 A;  4WF4 A;  3BBY A;  3IC4 A;  2X8C A;  2DKI A;  6GSY A;  3L78 A;  5CRD A;  1EOH A;  1YKA A;  1SU9 A;  4MK3 A;  2K18 A;  3LJR A;  1O81 A;  3KMN A;  1FO5 A;  1QK8 A;  3DRN A;  1G0T A;  5CRE A;  2VL2 A;  4G0K A;  5ECL B;  3ZFL A;  1M2D A;  3A3T A;  2C8U A;  1X5C A;  4D73 B;  4ZBB A;  5HR0 A;  3A2X A;  3FW2 A;  3RHB A;  3HVS A;  4MCU A;  4YQU A;  2FWH A;  1ML6 A;  4ZL8 A;  4G9H A;  1MEK A;  1JLV A;  2EIQ A;  3UOM A;  3KJY A;  4I6X A;  2D2Z A;  2E2G A;  1V9W A;  3HJP A;  1K0A A;  1X9S B;  3VLN A;  3UAR A;  1BYE A;  3ZZX A;  2YWO A;  1K0N A;  3M3M A;  4JR4 A;  5ECS A;  1M3J A;  2HFD A;  5DVB A;  2GSQ A;  4YKF A;  5ECK B;  1IYH A;  1G7O A;  3QAG A;  1OC8 A;  4GST A;  5GAN D;  2NDO A;  4ZBA A;  1A24 A;  1NSW A;  3VWU A;  4K0N A;  4IQ1 A;  4PNG A;  4F82 A;  3C7M A;  2H75 A;  1GTI A;  1JLW A;  5HR3 A;  2O7K A;  3VK9 A;  5GST A;  1E2Y A;  3Q19 A;  4K8M A;  4IQA A;  3MAK A;  4HEA 2;  2JZT A;  1XVW A;  2CQ9 A;  2GS3 A;  1TRW A;  2GQL A;  2VL2 C;  4PNF A;  3CRU A;  2YV7 A;  5F07 A;  2PGT A;  2FA4 A;  4F03 A;  4MF6 A;  3GL5 A;  2PVO C;  2VCX A;  2H1D A;  4HS1 A;  3TRP A;  1FAA A;  1FHE A;  1ERW A;  2C0F A;  1HNB A;  2YNX A;  5IO0 A;  4IP6 A;  2YCD A;  2RM5 A;  3FR3 A;  1GSQ A;  3GHA A;  4KSM A;  4P3Y B;  3IC8 A;  1J0F A;  3FZ4 A;  2FY6 A;  2VD0 A;  1T00 A;  2GQM A;  1VF2 A;  3HHV A;  6GSV A;  1JZO A;  1Z7P A;  3GIX A;  4K2X A;  3GH9 A;  5D9X A;  1YZX A;  1RW1 A;  2GZY A;  3CXG A;  3GX8 A;  3IAM 2;  4IVF A;  1SJZ A;  1B9X C;  4ML1 A;  1WE0 A;  5IO2 A;  5HR2 A;  5DBQ A;  2WCI A;  1V58 A;  4MNN A;  1I9D A;  2VCV A;  4GWR A;  1UN2 A;  3DGQ A;  5ABR A;  3RPP A;  1TRU A;  1Y25 A;  1NHY A;  1G7E A;  2A2S A;  4FYU A;  3ERW A;  6GSX A;  4KF9 A;  3F3R A;  2PN8 A;  5D8I A;  1AUC A;  4DSS B;  4YQM A;  2LUS A;  1NW2 A;  3FY7 A;  2X49 A;  3WT1 A;  1WMJ A;  2CZ2 A;  4MJE A;  2HSH A;  5DDL A;  1XWB A;  2GTU A;  4TXV A;  2LEG A;  2C0D A;  1AXD A;  2FGX A;  1XIY A;  3DIE A;  2O89 A;  2P5Q A;  1EWX A;  2M80 A;  7GSS A;  3FKF A;  3ZML A;  1GUK A;  2XC2 A;  4MAB A;  1O8W A;  3EPT A;  1SEN A;  2R37 A;  3RAZ A;  2L4C A;  4NHZ A;  1ZYE A;  3F0I A;  4H86 A;  2VCQ A;  2VL3 A;  1EV9 A;  4BVY B;  3ZFB A;  3ZIT A;  5J41 A;  3TCO A;  4EIQ A;  3V1W A;  2MMO A;  3L4N A;  1T7P B;  4FYB A;  4MH3 A;  6GST A;  2KP2 A;  4PGT A;  4K0G A;  4ECI A;  3EVI A;  4MF5 A;  2IIY A;  3IHQ A;  2GT5 A;  5DQS A;  1ZOF A;  5IM9 A;  2N5F A;  11GS A;  1MDI A;  2E0Q A;  1EEM A;  3ME8 A;  3P7X A;  2PWJ A;  5ECH B;  5GZZ B;  3NZN A;  5IPH A;  2H74 A;  4PTS A;  3TJK A;  2H01 A;  2I1U A;  2HZF A;  1R4W A;  5JWO B;  1B4Q A;  1GUM A;  4NMU A;  2P0G A;  1R7H A;  2CT6 A;  4MZC A;  2B1L A;  2HI7 A;  4LA1 A;  2YAN A;  1EP7 A;  5ECI B;  1F3A A;  4WBJ A;  2PUK C;  5HQP A;  1MDJ A;  2HRA A;  1O8X A;  5J4U A;  3DVW A;  2TRC P;  3HCZ A;  3VI5 A;  1TK5 B;  2B5E A;  2CAI A;  3GKX A;  3D21 A;  5IMA A;  3DKS A;  3JCM L;  1FOH A;  5ELA A;  3VFI A;  10GS A;  3H4K A;  4TKY A;  3DEX A;  4MA9 A;  3WYW A;  1GRX A;  3Q18 A;  2PER A;  2PMT A;  1B9Y C;  1T8E B;  2LQO A;  5DCH A;  3FR6 A;  3HA9 A;  1H4O A;  2JU5 A;  5G5F A;  2QGV A;  1K3L A;  5BMU A;  3IV4 A;  2L6D A;  1ABA A;  6GSW A;  4ZXG A;  2YJH A;  5DQY A;  3WGD A;  2C4J A;  2PBJ A;  1U3I A;  3S9F A;  4O32 A;  2DJJ A;  2OJL A;  4Q5R A;  5HFG A;  1A2J A;  1A0F A;  5B6N A;  1JZD A;  1XVQ A;  2TIR A;  4GF0 A;  3TJF A;  1YEX A;  2GZZ A;  2OAD A;  2OE1 A;  4LL4 B;  1QFN A;  4MH2 A;  5D93 A;  1TU7 A;  1CQH A;  2QA1 A;  3EMP A;  1F3B A;  1SK1 A;  2K8V A;  3EE2 A;  2I4A A;  1HNA A;  1G6Y A;  1GTB A;  2BTO T;  4KDY A;  2TRX A;  3UEM A;  4K5S A;  5ID2 A;  4MMM A;  3BOA A;  3ZRD A;  2JAC A;  2VM2 A;  2X8G A;  3IOS A;  19GS A;  5L71 A;  5JCU A;  1QUW A;  1PN9 A;  2LRT A;  4BVX A;  1OVN A;  3FEU A;  2L57 A;  5KOX A;  3FZ5 A;  4ZB9 A;  3F4S A;  4ZB6 A;  3IE3 A;  4NWY A;  4YQV A;  4QL7 A;  4IP1 A;  2DML A;  3GH6 A;  4DSQ A;  4YAP A;  1XW9 A;  2V32 A;  5H5R A;  1DE1 A;  1V57 A;  2R4V A;  1THX A;  2KP1 A;  2O8V B;  1M2B A;  3BCK A;  2NVL A;  2JSY A;  3CSI A;  2VL9 A;  3ZYW A;  2IL3 A;  4N11 A;  1OC9 B;  2HRF A;  3TKR A;  2M46 A;  2H71 A;  5AGY A;  2H0I A;  3CYN A;  4GSN A;  3KEB A;  4F9Z A;  3NOF A;  3PIN A;  5AN1 A;  2YZU A;  4BL7 A;  4ZBD A;  5JCG A;  1N8J A;  2HNL A;  2WJU A;  5LCZ A;  3Q6O A;  2VLV A;  4XRD A;  3E3E A;  2CVK A;  1GH2 A;  3H8Q A;  3GTU B;  1O6J A;  1R26 A;  2LNT A;  2NPB A;  3QFA C;  3KTL A;  5DAL A;  2YZH A;  4EF0 A;  2DJ3 A;  4V2N A;  4CDO A;  3DWV A;  5ECO B;  2HRN A;  2XHF A;  5FHI A;  2FLS A;  2JAD A;  1Z9H A;  1V40 A;  3EYT A;  4GQC A;  2MMN A;  2RLI A;  4PUR A;  4EVM A;  3LXT A;  4OMV A;  1TRV A;  3HVN A;  2C3N A;  1XOA A;  3PR8 A;  1THO A;  4EO3 A;  2H1G A;  3HJM A;  2CX3 A;  4TOP A;  2VAF A;  1ERV A;  4MPF A;  2H73 A;  3U5R E;  4X4J A;  4MDC A;  4IJ3 A;  2R0C A;  1GLQ A;  1GWC A;  4K7I A;  3CTG A;  2NTO A;  1PKZ A;  2A2P A;  1PKW A;  3ZMK A;  3PH9 A;  2MYG A;  2L5L A;  3EMX A;  3QDN A;  2B6M A;  1OC3 A;  3GX0 A;  1M99 A;  4WXT A;  4MZB A;  2DKH A;  3ZTL A;  1SKR B;  1M3I A;  2AV4 A;  4XS1 A;  2B5X A;  5ECR B;  2YV9 A;  3UBK A;  3C8E A;  3LQ7 A;  3KH7 A;  3LSZ A;  9GSS A;  1TTZ A;  3J7Y k;  4NV5 A;  4KE3 A;  4JRR A;  4J56 E;  2A2R A;  3LGC A;  1FB0 A;  3EUR A;  4G0L A;  5IMV A;  2C1Y A;  4I5Q A;  2LJK A;  3H79 A;  4I8B A;  4XRA A;  2EC4 A;  2QKE A;  3R3E A;  1GTA A;  4ECB A;  2UZ8 A;  4XTS A;  2H1B A;  4F2I A;  3QOU A;  4NV2 A;  2B7J A;  2OBI A;  2AB6 A;  3C71 A;  2LJA A;  2ON7 A;  2IFQ B;  1U6T A;  1TI1 A;  5A4V A;  3F4R A;  5G1K A;  2DLX A;  4WBR D;  3APQ A;  3FK8 A;  5FT3 A;  2X64 A;  12GS A;  4JR6 A;  3IXR A;  4XIH A;  5IMD A;  4Z2R A;  4ECJ A;  3ZVJ D;  5E4W A;  3D4T A;  4JBB A;  2IMI A;  2DIZ A;  1DSB A;  4PX1 A;  2P31 A;  1SKS B;  1JZR A;  2MMA A;  3IBH A;  2HYX A;  2R3X A;  4J57 E;  4XS6 A;  2V6K A;  1TI3 A;  2CX4 A;  1K0D A;  5ENU A;  16GS A;  4Q5Q A;  4PUF C;  3C73 A;  1V98 A;  2YWM A;  4KAE A;  2LRN A;  2WRT A;  4K7N A;  1GNW A;  1BX9 A;  4N30 A;  5IOX A;  1T4Y A;  1XWK A;  4EL1 A;  5B8A A;  2AYT A;  2KOK A;  2K6V A;  3I9V 2;  3WGE A;  3MNG A;  1BJX A;  3TGZ A;  2YJ7 A;  3US3 A;  3DVX A;  5ECP B;  4O5Q A;  2GT6 A;  1QGV A;  3ZIJ A;  5C00 A;  1XFL A;  4JZQ A;  1XOB A;  4QQ7 A;  1GSF A;  3F63 A;  3ME7 A;  4HOJ A;  1X9W B;  5G2Z A;  5EL8 A;  2AUV A;  2LKU A;  2H8L A;  3UVT A;  1T4Z A;  2H19 A;  2PPT A;  4EUY A;  5JCW A;  1E6B A;  4EDY A;  3R2Q A;  1OKD A;  2WS2 A;  3LOR A;  2I3Y A;  2KUC A;  4XS4 B;  4FYC A;  5KN2 A;  1MD4 A;  3GL3 A;  1A8L A;  3KCM A;  1XXU A;  5CAX A;  4AJ8 A;  1FG4 A;  2FWG A;  2H6Y A;  2K8S A;  4NHW A;  2H72 A;  1FVJ A;  5CNW A;  2EIO A;  1AQX A;  2RII A;  2YOI A;  3KGK A;  3ZVJ A;  4KB3 A;  4IJI A;  3ISO A;  1VF3 A;  1TK8 B;  3U6V A;  1X5D A;  4EDZ A;  4LL1 B;  4RUV A;  2CVD A;  2X99 A;  1Z6M A;  3MIX A;  2XPE A;  1PSQ A;  20GS A;  1YQ1 A;  3VPQ A;  4OO4 A;  1AW9 A;  3GA4 A;  3N9J A;  3HZ8 A;  3J7Y b;  3O6T A;  4POK A;  1XWC A;  3DYR A;  3W8S A;  1O7U A;  1S3A A;  2LNS A;  3UBL A;  4G10 A;  4WET A;  2H1A A;  1OYJ A;  5DJL A;  1R5A A;  4GLT A;  4Z7X A;  1GLP A;  4HU9 A;  1W89 A;  1LJR A;  1PRX A;  1XW6 A;  3H1N A;  1JHB A;  3WT2 A;  2CA8 A;  1VRS D;  5ELG A;  3DML A;  2IJY A;  4AJ7 A;  1A2L A;  3HZ4 A;  1FB6 A;  1SJI A;  2V41 A;  3ZIV A;  5DCG A;  4CY8 A;  4IS0 A;  2RUE A;  1WJK A;  3M0F A;  3ZRE A;  1M0U A;  1YF0 A;  1KTE A;  2IN3 A;  4CHS A;  1SL2 B;  2O87 A;  4N0V A;  4IHU A;  2KLX A;  2R2J A;  2AHE A;  8GSS A;  2YWI A;  1F9M A;  1TOF A;  1XPV A;  4K9Z A;  1GSU A;  1B8X A;  4HJM A;  1Z3E A;  2JSZ A;  3HYP A;  4EKZ A;  2HZE A;  1R5P A;  4OFT A;  4OFN A;  4PQ1 A;  1Q98 A;  3GUS A;  4L8E A;  1BG5 A;  3TUE A;  4K1F A;  1SKW B;  2H76 A;  4J2F A;  2DJ1 A;  1OE7 A;  1NM3 A;  3A2W A;  3PGT A;  4LLR A;  4TR1 B;  4BA7 A;  1XWG A;  1URM A;  2H30 A;  4N10 A;  1X0R A;  3LXZ A;  3I6A A;  1AQV A;  2WDU A;  1JZW A;  4POB A;  3D22 A;  3HDC A;  3ZL5 A;  4O5U A;  2PVQ A;  2V1M A;  2PU9 C;  2HRK A;  4FO5 A;  3CBU A;  3IR4 A;  1X5E A;  1NHO A;  3L9U A;  3F6F A;  3HJO A;  5JWQ B;  1ON4 A;  2DBC A;  3GV1 A;  4V2L A;  3SBC A;  2O85 A;  3QR6 A;  3P8W A;  3N5O A;  4PUA A;  3L9S A;  4KH7 A;  1SD8 A;  5D9W A;  4LMV A;  2DSA A;  1A2M A;  1GSS A;  2DJK A;  1PD2 1;  3LEF A;  4QL9 A;  3KZQ A;  1RK4 A;  4GRF A;  5AIS A;  4D73 A;  2E2M A;  5B7C A;  3PPU A;  5KN1 A;  1TK0 B;  5CRW A;  4V1A g;  4V1A p;  2ZNM A;  2YPM A;  4NPB A;  4G19 A;  3MSZ A;  4POL A;  5DAK B;  2C80 A;  3TDG A;  4MJB A;  1FOV A;  1WPI A;  5IIZ A;  2A4H A;  4XCS A;  3KD0 A;  1J08 A;  5KEJ A;  1PL2 A;  3ERF A;  2VCW A;  3IPZ A;  2V2G A;  2WZ9 A;  4AGS A;  4ZL7 A;  3HY2 A;  4HZ4 A;  4GQF A;  3ED3 A;  3TOT A;  2AAW A;  2GDR A;  3FMW A;  5F8B A;  1MDK A;  2VOC A;  3TJG A;  5A4W A;  1ZCP A;  2ZCT A;  1TRS A;  1ZMA A;  3ERG A;  3TKS A;  1OKT A;  3BCI A;  4E8E A;  2RUF A;  3UL3 A;  4KDX A;  3GFK A;  3MWH A;  1SYR A;  5B6M A;  1O73 A;  4IEL A;  3CQF A;  6GSS A;  2I9H A;  1TJD A;  2MMZ A;  2FCH A;  1QXH A;  3WD6 A;  2QSI A;  2REM A;  2VLT A;  1HYU A;  2X4A A;  5B8B A;  1YY7 A;  3HXS A;  4ISD A;  2LQQ A;  2FNO A;  3C1R A;  1K0O A;  4HUA A;  1N2A A;  1Z6N A;  5IPG A;  3RBT A;  4BWS A;  4YAV A;  2CZ3 A;  4AJ6 A;  3TRQ A;  2MZC A;  4LMW A;  3KXO A;  2B5Y A;  4BIK A;  4K7O A;  5IMF A;  2GQK A;  1UVZ A;  3VUR A;  1SL0 B;  4L5O A;  2B7K A;  4USS A;  4TXO B;  1EZK A;  3CTF A;  5G5E A;  2K9F A;  3FHK A;  5IMZ A;  5F05 A;  3OR5 A;  5IQY A;  1PX6 A;  2GGT A;  3I43 A;  2LTK A;  4YKG A;  3LFL A;  1VF4 A;  3LW9 A;  4L0U A;  3O3T A;  1SK0 A;  2FWE A;  3D6I A;  3O76 A;  2H66 A;  4IW9 A;  3FYG A;  3WGX A;  1EGO A;  2L4Q A;  3EWL A;  4V2M A;  5D73 A;  1HNC A;  1GSY A;  3TKS C;  4CY6 A;  4ILF A;  4I2U A;  1EEJ A;  4ECC A;  4HDE A;  1OE8 A;  3UMA A;  4KND A;  4HJ2 A;  3HVX A;  1GNE A;  3DXB A;  5ECN B;  2H70 A;  2WGR A;  3GRX A;  13GS A;  4NAX A;  3ZLP A;  1C72 A;  4HZ2 A;  3EU4 A;  4F0B A;  4X1U A;  22GS A;  3EU3 A;  4ACS A;  4HU7 A;  3G7Y A;  4DSS A;  2DC5 A;  2C3T A;  1SJ6 A;  3FRC A;  3TOU A;  2WB9 A;  4ICY A;  1FVK A;  3I69 A;  3QD9 A;  3IHG A;  2ALB A;  3LG6 A;  3MDK A;  2WUL A;  1HQO A;  1O85 A;  1M9A A;  1UA5 A;  4ZIL A;  3A5I A;  1TU8 A;  1GSE A;  1GTU A;  5J5N A;  5HR1 A;  2I81 A;  4YH2 A;  4BWQ A;  2DJ2 A;  1F2E A;  1K0B A;  5KN0 A;  4NXI A;  3E0U A;  3VWX A;  1XCC A;  4KDU A;  2FA8 A;  1PMT A;  2LS5 A;  4O5R A;  3QMX A;  1T1V A;  4BVY A;  5ID2 B;  1AC1 A;  4WKW A;  3IK9 A;  3FZA A;  4Q5F A;  3H93 A;  5CYY A;  2XBQ A;  4KUN A;  5CP1 A;  1K3O A;  1ACV A;  4K5R A;  4I97 A;  3TRX A;  4ZL9 A;  4JU5 A;  4EIP A;  1KNG A;  2DJ0 A;  3EIN A;  4KGI A;  4BVX B;  4WEY A;  2BJX A;  2VIM A;  1USB A;  2GSR A;  5LNK e;  3QAV A;  5ECQ B;  4WR5 A;  4OD7 A;  1FW1 A;  4CW9 A;  3GMF A;  3KIJ A;  1TKD B;  4K2D A;  2H6X A;  4X43 A;  1LBK A;  3Q74 A;  4IN0 A;  1ZGN A;  5GAP D;  1RQM A;  3VI7 A;  3HD5 A;  4MF7 A;  2M72 A;  1S3R A;  3GST A;  2FD3 A;  5F0G A;  2YN1 A;  2IME A;  2V6O A;  3EC3 A;  5IMC A;  4POM A;  1ERU A;  3M9J A;  2A4V A;  1B4P A;  3CRT A;  3QAW A;  4BL7 B;  2H6Z A;  4TR1 A;  3HVV A;  4HQZ A;  1BAY A;  5A5K A;  1PX7 A;  4HQS A;  4TVE A;  1KBN A;  6GSU A;  1ZL9 A;  2G0F A;  4MJA A;  1JFU A;  2VD1 A;  3D5J A;  3M8N A;  5G31 A;  2LJR A;  2R0G A;  1A0R P;  4KX4 A;  3GKK A;  1BED A;  2HSM A;  2Z9S A;  5DAL B;  5FWG A;  4ML6 A;  1DUG A;  3GNJ A;  1V2A A;  1GUL A;  4DVC A;  4MPG A;  3TB2 A;  1VF1 A;  5CRG A;  4KCE A;  1CQG A;  3D4M A;  1ILO A;  3GYK A;  5KOW A;  1VGL A;  3E9J B;  5KN3 A;  1TDI A;  4N0Z A;  2H0H A;  5EPF A;  1GSD A;  4O92 A;  1Z7R A;  2OKA A;  2JL4 A;  1Y6E A;  1QMV A;  4GSS A;  4TR4 A;  2F3M A;  2C0G A;  5CO3 A;  4G2E A;  2R6K A;  1UC7 A;  4X0X A;  2GLR A;  3KM6 A;  4MLY A;  2X8H A;  4XHM A;  3M9K A;  3GKN A;  2OA7 A;  3A5W A;  14GS A;  5DAK A;  1S3C A;  4DSR A;  1XW5 A;  3W8J A;  3TJB A;  3W6G A;  2IWT A;  2B1K A;  3TKP A;  2C3Q A;  3IDV A;  5IOW A;  3G9B A;  4PQH A;  1EGR A;  4PQI A;  4MJC A;  1A23 A;  3RHC A;  4ID0 A;  3RDW A;  3KH9 A;  2AJQ B;  3IA1 A;  1XG8 A;  5E59 A;  3P90 A;  1SK2 A;  4HI7 A;  2JZS A;  1PN0 A;  2N5B A;  3GN3 A;  1ZZY A;  5AIV A;  1PA3 A;  1W4V A;  2XPD A;  5DJM A;  5H5S A;  2WFC A;  2ES7 A;  1U3A A;  5F06 A;  2F8A A;  1TP9 A;  5H5Q A;  2DIY A;  4ZB8 A;  3K8N A;  1WRY A;  2FUG 2;  1PL1 A;  2HSY A; 
#chains in the Genus database with same CATH homology
 4I2T A;  1ST9 A;  2VM1 A;  1AQW A;  3M1G A;  4E8H A;  3QPM A;  4IKH A;  5G30 A;  1YJ6 A;  4RQX A;  2G2Q A;  3G7I A;  1ZYQ B;  1OC9 A;  5COH A;  1WWJ A;  4TR0 A;  3SWL A;  1U88 A;  3BJ5 A;  3F8U A;  3GKM A;  3LYK A;  3F9U A;  3KMO A;  1K0C A;  2YWN A;  4ULX A;  2BMX A;  3CMI A;  3BD2 A;  3VPT A;  2JZR A;  2VCZ A;  3NIV A;  3GTU A;  3HKR A;  3UIW A;  3UJ1 A;  1MTC A;  2LV3 A;  2L6C A;  2XBI A;  3FZ9 A;  4Z2U A;  1GUH A;  1TW9 A;  3A2V A;  2EIR A;  4JE1 A;  2R0P A;  5J9C A;  5BRT A;  4TXO A;  1A8Y A;  1M7T A;  3RPN A;  1AIU A;  1EV4 A;  5EY6 A;  3MYD A;  4TW5 A;  4RI6 A;  1DBY A;  1IYI A;  4RI7 A;  1Z5Y E;  4F0C A;  1F37 A;  2GST A;  2OAC A;  1YEP A;  1T3B A;  4L5L A;  1DE2 A;  1WP0 A;  1PGT A;  2OE3 A;  3LYP A;  2HT9 A;  17GS A;  1EP8 A;  5D9T A;  1OAZ A;  1SYX A;  2OBK A;  4EC0 A;  2IPA A;  1H75 A;  1I5G A;  4EXJ A;  3L9V A;  2L59 A;  5LD0 A;  4GTU A;  3AY8 A;  1F6M C;  5JWR B;  5G1L A;  1K0M A;  1WOU A;  2ZUP A;  2L5O A;  4K6X A;  5HFI A;  2IMK A;  2YP6 A;  3F3Q A;  4O7H A;  1EOG A;  4A5P A;  2LRC A;  1X9M B;  1KEB A;  1G6W A;  5AIX A;  1QQ2 A;  4WF5 A;  4IBP A;  5GSS A;  2F8F A;  2GVP A;  2QA2 A;  3KP9 A;  5J9B A;  3CSH A;  3P2A A;  1MD3 A;  1GL8 A;  4JED A;  3QCP A;  5D9V A;  2VLU A;  2H0G A;  4OO5 A;  2VCT A;  2OE0 A;  1S3D A;  1Q4J A;  4RQR A;  1LU4 A;  4GXZ A;  1WIK A;  5A4U A;  2HLS A;  2GZP A;  1YKC A;  5INY A;  3IAS 2;  4KSO A;  2IFQ A;  2MBS A;  3F4T A;  4DEJ A;  4EE0 A;  1SD9 A;  2IMD A;  5EVO A;  2ON5 A;  1HD2 A;  1XBS A;  3CSJ A;  3IK7 A;  3FR9 A;  4TN8 A;  3F6D A;  4Z2T A;  3TKQ A;  4WR4 A;  2CV4 A;  4FQU A;  4KW6 A;  4KA0 A;  3VWW A;  2FWF A;  5D96 A;  3GSS A;  4BPY A;  1K3Y A;  5J3R A;  3KTB A;  1TXX A;  2P5R A;  2KHP A;  2CAQ A;  2J23 A;  2FHE A;  4Q5N A;  2C0E A;  2IMF A;  1AAZ A;  3UAP A;  1ZYP A;  3TKS E;  1XZO A;  5HFK A;  2RM6 A;  2E7P A;  1J9B A;  4AF2 A;  4G0I A;  4OCF A;  1YF1 A;  5CRH A;  4MP4 A;  2MBT A;  4TR3 A;  2F9S A;  3VWV A;  2QC7 A;  4OCE A;  2R5G A;  1M2A A;  4FIW A;  5C04 A;  3APO A;  1U87 A;  2J9H A;  1SL1 B;  1B48 A;  2NBS A;  3LWA A;  2F51 A;  4ZIJ A;  3TJJ A;  2GSS A;  4GCI A;  3QFB C;  2N5A A;  1ZYN A;  1GP1 A;  4TRX A;  1XWA A;  2HE3 A;  3GUR A;  2B3S A;  2LST A;  3L0H A;  2HZE B;  3C1S A;  1YDK A;  3DD3 A;  2VO4 A;  3D0Z A;  2VUP A;  4L0W A;  3APS A;  4OFM A;  3IRA A;  1ERT A;  4IGJ A;  4FH8 A;  2DMM A;  4PXO A;  2HXK A;  1M9B A;  5ECM B;  3G7J A;  4OWY A;  4XS4 A;  18GS A;  3UVH A;  2CVB A;  1PQN A;  3KP8 A;  4MZW A;  4KCA A;  1BQ7 A;  4WF4 A;  3BBY A;  3IC4 A;  2X8C A;  2DKI A;  6GSY A;  3L78 A;  5CRD A;  1EOH A;  1YKA A;  1SU9 A;  4MK3 A;  2K18 A;  3LJR A;  1O81 A;  3KMN A;  1FO5 A;  1QK8 A;  3DRN A;  1G0T A;  5CRE A;  2VL2 A;  4G0K A;  5ECL B;  3ZFL A;  1M2D A;  3A3T A;  2C8U A;  1X5C A;  4D73 B;  4ZBB A;  5HR0 A;  3A2X A;  3FW2 A;  3RHB A;  3HVS A;  4MCU A;  4YQU A;  2FWH A;  1ML6 A;  4ZL8 A;  4G9H A;  1MEK A;  1JLV A;  2EIQ A;  3UOM A;  3KJY A;  4I6X A;  2D2Z A;  2E2G A;  1V9W A;  3HJP A;  1K0A A;  1X9S B;  3VLN A;  3UAR A;  1BYE A;  3ZZX A;  2YWO A;  1K0N A;  3M3M A;  4JR4 A;  5ECS A;  2HFD A;  5DVB A;  2GSQ A;  4YKF A;  5ECK B;  1IYH A;  1G7O A;  3QAG A;  1OC8 A;  4GST A;  5GAN D;  2NDO A;  4ZBA A;  1A24 A;  1NSW A;  3VWU A;  4K0N A;  4IQ1 A;  4PNG A;  4F82 A;  3C7M A;  2H75 A;  1GTI A;  1JLW A;  5HR3 A;  2O7K A;  3VK9 A;  5GST A;  1E2Y A;  3Q19 A;  4K8M A;  4IQA A;  3MAK A;  4HEA 2;  2JZT A;  1XVW A;  2CQ9 A;  2GS3 A;  1TRW A;  2GQL A;  2VL2 C;  4PNF A;  3CRU A;  2YV7 A;  5F07 A;  2PGT A;  2FA4 A;  4F03 A;  4MF6 A;  3GL5 A;  2PVO C;  2VCX A;  2H1D A;  4HS1 A;  3TRP A;  1FAA A;  1FHE A;  1ERW A;  2C0F A;  1HNB A;  2YNX A;  5IO0 A;  4IP6 A;  2YCD A;  2RM5 A;  3FR3 A;  1GSQ A;  3GHA A;  4KSM A;  4P3Y B;  3IC8 A;  1J0F A;  3FZ4 A;  2FY6 A;  2VD0 A;  1T00 A;  2GQM A;  1VF2 A;  3HHV A;  6GSV A;  1JZO A;  1Z7P A;  3GIX A;  4K2X A;  3GH9 A;  5D9X A;  1YZX A;  1RW1 A;  2GZY A;  3CXG A;  3GX8 A;  3IAM 2;  4IVF A;  1SJZ A;  1B9X C;  4ML1 A;  1WE0 A;  5IO2 A;  5HR2 A;  5DBQ A;  2WCI A;  1V58 A;  4MNN A;  1I9D A;  2VCV A;  4GWR A;  1UN2 A;  3DGQ A;  5ABR A;  3RPP A;  1TRU A;  1Y25 A;  1NHY A;  1G7E A;  2A2S A;  4FYU A;  3ERW A;  6GSX A;  4KF9 A;  3F3R A;  2PN8 A;  5D8I A;  1AUC A;  4DSS B;  4YQM A;  2LUS A;  1NW2 A;  3FY7 A;  2X49 A;  3WT1 A;  1WMJ A;  2CZ2 A;  4MJE A;  2HSH A;  5DDL A;  1XWB A;  2GTU A;  4TXV A;  2LEG A;  2C0D A;  1AXD A;  2FGX A;  1XIY A;  3DIE A;  2O89 A;  2P5Q A;  1EWX A;  2M80 A;  7GSS A;  3FKF A;  3ZML A;  1GUK A;  2XC2 A;  4MAB A;  1O8W A;  3EPT A;  1SEN A;  2R37 A;  3RAZ A;  2L4C A;  4NHZ A;  1ZYE A;  3F0I A;  4H86 A;  2VCQ A;  2VL3 A;  1EV9 A;  4BVY B;  3ZFB A;  3ZIT A;  5J41 A;  3TCO A;  4EIQ A;  3V1W A;  2MMO A;  3L4N A;  1T7P B;  4FYB A;  4MH3 A;  6GST A;  2KP2 A;  4PGT A;  4K0G A;  4ECI A;  3EVI A;  4MF5 A;  2IIY A;  3IHQ A;  2GT5 A;  5DQS A;  1ZOF A;  5IM9 A;  2N5F A;  11GS A;  1MDI A;  2E0Q A;  1EEM A;  3ME8 A;  3P7X A;  2PWJ A;  5ECH B;  5GZZ B;  3NZN A;  5IPH A;  2H74 A;  4PTS A;  3TJK A;  2H01 A;  2I1U A;  2HZF A;  1R4W A;  5JWO B;  1B4Q A;  1GUM A;  4NMU A;  2P0G A;  1R7H A;  2CT6 A;  4MZC A;  2B1L A;  2HI7 A;  4LA1 A;  2YAN A;  1EP7 A;  5ECI B;  1F3A A;  4WBJ A;  2PUK C;  5HQP A;  1MDJ A;  2HRA A;  1O8X A;  5J4U A;  3DVW A;  2TRC P;  3HCZ A;  3VI5 A;  1TK5 B;  2B5E A;  2CAI A;  3GKX A;  3D21 A;  5IMA A;  3DKS A;  3JCM L;  1FOH A;  5ELA A;  3VFI A;  10GS A;  3H4K A;  4TKY A;  3DEX A;  4MA9 A;  3WYW A;  1GRX A;  3Q18 A;  2PER A;  2PMT A;  1B9Y C;  1T8E B;  2LQO A;  5DCH A;  3FR6 A;  3HA9 A;  1H4O A;  2JU5 A;  5G5F A;  2QGV A;  1K3L A;  5BMU A;  3IV4 A;  2L6D A;  1ABA A;  6GSW A;  4ZXG A;  2YJH A;  5DQY A;  3WGD A;  2C4J A;  2PBJ A;  1U3I A;  3S9F A;  4O32 A;  2DJJ A;  2OJL A;  4Q5R A;  5HFG A;  1A2J A;  1A0F A;  5B6N A;  1JZD A;  1XVQ A;  2TIR A;  4GF0 A;  3TJF A;  1YEX A;  2GZZ A;  2OAD A;  2OE1 A;  4LL4 B;  1QFN A;  4MH2 A;  5D93 A;  1TU7 A;  1CQH A;  2QA1 A;  3EMP A;  1F3B A;  1SK1 A;  2K8V A;  3EE2 A;  2I4A A;  1HNA A;  1G6Y A;  1GTB A;  2BTO T;  4KDY A;  2TRX A;  3UEM A;  4K5S A;  5ID2 A;  4MMM A;  3BOA A;  3ZRD A;  2JAC A;  2VM2 A;  2X8G A;  3IOS A;  19GS A;  5L71 A;  5JCU A;  1QUW A;  1PN9 A;  2LRT A;  4BVX A;  1OVN A;  3FEU A;  2L57 A;  5KOX A;  3FZ5 A;  4ZB9 A;  3F4S A;  4ZB6 A;  3IE3 A;  4NWY A;  4YQV A;  4QL7 A;  4IP1 A;  2DML A;  3GH6 A;  4DSQ A;  4YAP A;  1XW9 A;  2V32 A;  5H5R A;  1DE1 A;  1V57 A;  2R4V A;  1THX A;  2KP1 A;  2O8V B;  1M2B A;  3BCK A;  2NVL A;  2JSY A;  3CSI A;  2VL9 A;  3ZYW A;  2IL3 A;  4N11 A;  1OC9 B;  2HRF A;  3TKR A;  2M46 A;  2H71 A;  5AGY A;  2H0I A;  3CYN A;  4GSN A;  3KEB A;  4F9Z A;  3NOF A;  3PIN A;  5AN1 A;  2YZU A;  4BL7 A;  4ZBD A;  5JCG A;  1N8J A;  2HNL A;  2WJU A;  5LCZ A;  3Q6O A;  2VLV A;  4XRD A;  3E3E A;  2CVK A;  1GH2 A;  3H8Q A;  3GTU B;  1O6J A;  1R26 A;  2LNT A;  2NPB A;  3QFA C;  3KTL A;  5DAL A;  2YZH A;  4EF0 A;  2DJ3 A;  4V2N A;  4CDO A;  3DWV A;  5ECO B;  2HRN A;  2XHF A;  5FHI A;  2FLS A;  2JAD A;  1Z9H A;  1V40 A;  3EYT A;  4GQC A;  2MMN A;  2RLI A;  4PUR A;  4EVM A;  3LXT A;  4OMV A;  1TRV A;  2C3N A;  1XOA A;  3PR8 A;  1THO A;  4EO3 A;  2H1G A;  3HJM A;  2CX3 A;  4TOP A;  2VAF A;  1ERV A;  4MPF A;  2H73 A;  3U5R E;  4X4J A;  4MDC A;  4IJ3 A;  2R0C A;  1GLQ A;  1GWC A;  4K7I A;  3CTG A;  2NTO A;  1PKZ A;  2A2P A;  1PKW A;  3ZMK A;  3PH9 A;  2MYG A;  2L5L A;  3EMX A;  3QDN A;  2B6M A;  1OC3 A;  3GX0 A;  1M99 A;  4WXT A;  4MZB A;  2DKH A;  3ZTL A;  1SKR B;  2AV4 A;  4XS1 A;  2B5X A;  5ECR B;  2YV9 A;  3UBK A;  3C8E A;  3LQ7 A;  3KH7 A;  3LSZ A;  9GSS A;  1TTZ A;  3J7Y k;  4NV5 A;  4KE3 A;  4JRR A;  4J56 E;  2A2R A;  3LGC A;  1FB0 A;  3EUR A;  4G0L A;  5IMV A;  2C1Y A;  4I5Q A;  2LJK A;  3H79 A;  4I8B A;  4XRA A;  2EC4 A;  2QKE A;  3R3E A;  1GTA A;  4ECB A;  2UZ8 A;  4XTS A;  2H1B A;  4F2I A;  3QOU A;  4NV2 A;  2B7J A;  2OBI A;  2AB6 A;  3C71 A;  2LJA A;  2ON7 A;  2IFQ B;  1U6T A;  1TI1 A;  5A4V A;  3F4R A;  5G1K A;  2DLX A;  4WBR D;  3APQ A;  3FK8 A;  5FT3 A;  2X64 A;  12GS A;  4JR6 A;  3IXR A;  4XIH A;  5IMD A;  4Z2R A;  4ECJ A;  3ZVJ D;  5E4W A;  3D4T A;  4JBB A;  2IMI A;  2DIZ A;  1DSB A;  4PX1 A;  2P31 A;  1SKS B;  1JZR A;  2MMA A;  3IBH A;  2HYX A;  2R3X A;  4J57 E;  4XS6 A;  2V6K A;  1TI3 A;  2CX4 A;  1K0D A;  5ENU A;  16GS A;  4Q5Q A;  4PUF C;  3C73 A;  1V98 A;  2YWM A;  4KAE A;  2LRN A;  2WRT A;  4K7N A;  1GNW A;  1BX9 A;  4N30 A;  5IOX A;  1T4Y A;  1XWK A;  4EL1 A;  5B8A A;  2AYT A;  2KOK A;  2K6V A;  3I9V 2;  3WGE A;  3MNG A;  1BJX A;  3TGZ A;  2YJ7 A;  3US3 A;  3DVX A;  5ECP B;  4O5Q A;  2GT6 A;  1QGV A;  3ZIJ A;  5C00 A;  1XFL A;  4JZQ A;  1XOB A;  4QQ7 A;  1GSF A;  3F63 A;  3ME7 A;  4HOJ A;  1X9W B;  5G2Z A;  5EL8 A;  2AUV A;  2LKU A;  2H8L A;  3UVT A;  1T4Z A;  2H19 A;  2PPT A;  4EUY A;  5JCW A;  1E6B A;  4EDY A;  3R2Q A;  1OKD A;  2WS2 A;  3LOR A;  2I3Y A;  2KUC A;  4XS4 B;  4FYC A;  5KN2 A;  1MD4 A;  3GL3 A;  1A8L A;  3KCM A;  1XXU A;  5CAX A;  4AJ8 A;  1FG4 A;  2FWG A;  2H6Y A;  2K8S A;  4NHW A;  2H72 A;  1FVJ A;  5CNW A;  2EIO A;  1AQX A;  2RII A;  2YOI A;  3KGK A;  3ZVJ A;  4KB3 A;  4IJI A;  3ISO A;  1VF3 A;  1TK8 B;  3U6V A;  1X5D A;  4EDZ A;  4LL1 B;  4RUV A;  2CVD A;  2X99 A;  1Z6M A;  3MIX A;  2XPE A;  1PSQ A;  20GS A;  1YQ1 A;  3VPQ A;  4OO4 A;  1AW9 A;  3GA4 A;  3N9J A;  3HZ8 A;  3J7Y b;  3O6T A;  4POK A;  1XWC A;  3DYR A;  3W8S A;  1O7U A;  1S3A A;  2LNS A;  3UBL A;  4G10 A;  4WET A;  2H1A A;  1OYJ A;  5DJL A;  1R5A A;  4GLT A;  4Z7X A;  1GLP A;  4HU9 A;  1W89 A;  1LJR A;  1PRX A;  1XW6 A;  3H1N A;  1JHB A;  3WT2 A;  2CA8 A;  1VRS D;  5ELG A;  3DML A;  2IJY A;  4AJ7 A;  1A2L A;  3HZ4 A;  1FB6 A;  1SJI A;  2V41 A;  3ZIV A;  5DCG A;  4CY8 A;  4IS0 A;  2RUE A;  1WJK A;  3M0F A;  3ZRE A;  1M0U A;  1YF0 A;  1KTE A;  2IN3 A;  4CHS A;  1SL2 B;  2O87 A;  4N0V A;  4IHU A;  2KLX A;  2R2J A;  2AHE A;  8GSS A;  2YWI A;  1F9M A;  1TOF A;  1XPV A;  4K9Z A;  1GSU A;  1B8X A;  4HJM A;  1Z3E A;  2JSZ A;  3HYP A;  4EKZ A;  2HZE A;  1R5P A;  4OFT A;  4OFN A;  4PQ1 A;  1Q98 A;  3GUS A;  4L8E A;  1BG5 A;  3TUE A;  4K1F A;  1SKW B;  2H76 A;  4J2F A;  2DJ1 A;  1OE7 A;  1NM3 A;  3A2W A;  3PGT A;  4LLR A;  4TR1 B;  4BA7 A;  1XWG A;  1URM A;  2H30 A;  4N10 A;  1X0R A;  3LXZ A;  3I6A A;  1AQV A;  2WDU A;  1JZW A;  4POB A;  3D22 A;  3HDC A;  3ZL5 A;  4O5U A;  2PVQ A;  2V1M A;  2PU9 C;  2HRK A;  4FO5 A;  3CBU A;  3IR4 A;  1X5E A;  1NHO A;  3L9U A;  3F6F A;  3HJO A;  5JWQ B;  1ON4 A;  2DBC A;  3GV1 A;  4V2L A;  3SBC A;  2O85 A;  3QR6 A;  3P8W A;  3N5O A;  4PUA A;  3L9S A;  4KH7 A;  1SD8 A;  5D9W A;  4LMV A;  2DSA A;  1A2M A;  1GSS A;  2DJK A;  1PD2 1;  3LEF A;  4QL9 A;  3KZQ A;  1RK4 A;  4GRF A;  5AIS A;  4D73 A;  2E2M A;  5B7C A;  3PPU A;  5KN1 A;  1TK0 B;  5CRW A;  4V1A g;  4V1A p;  2ZNM A;  2YPM A;  4NPB A;  4G19 A;  3MSZ A;  4POL A;  5DAK B;  2C80 A;  3TDG A;  4MJB A;  1FOV A;  1WPI A;  5IIZ A;  2A4H A;  4XCS A;  3KD0 A;  1J08 A;  5KEJ A;  1PL2 A;  3ERF A;  2VCW A;  3IPZ A;  2V2G A;  2WZ9 A;  4AGS A;  4ZL7 A;  3HY2 A;  4HZ4 A;  4GQF A;  3ED3 A;  3TOT A;  2AAW A;  2GDR A;  3FMW A;  5F8B A;  1MDK A;  2VOC A;  3TJG A;  5A4W A;  1ZCP A;  2ZCT A;  1TRS A;  1ZMA A;  3ERG A;  3TKS A;  1OKT A;  3BCI A;  4E8E A;  2RUF A;  3UL3 A;  4KDX A;  3GFK A;  3MWH A;  1SYR A;  5B6M A;  1O73 A;  4IEL A;  6GSS A;  2I9H A;  1TJD A;  2MMZ A;  2FCH A;  1QXH A;  3WD6 A;  2QSI A;  2REM A;  2VLT A;  1HYU A;  2X4A A;  5B8B A;  1YY7 A;  3HXS A;  4ISD A;  2LQQ A;  2FNO A;  3C1R A;  1K0O A;  4HUA A;  1N2A A;  1Z6N A;  5IPG A;  3RBT A;  4BWS A;  4YAV A;  2CZ3 A;  4AJ6 A;  3TRQ A;  2MZC A;  4LMW A;  3KXO A;  2B5Y A;  4K7O A;  5IMF A;  2GQK A;  1UVZ A;  3VUR A;  1SL0 B;  4L5O A;  2B7K A;  4USS A;  4TXO B;  1EZK A;  3CTF A;  5G5E A;  2K9F A;  3FHK A;  5IMZ A;  5F05 A;  3OR5 A;  5IQY A;  1PX6 A;  2GGT A;  3I43 A;  2LTK A;  4YKG A;  3LFL A;  1VF4 A;  3LW9 A;  4L0U A;  3O3T A;  1SK0 A;  2FWE A;  3D6I A;  3O76 A;  2H66 A;  4IW9 A;  3FYG A;  3WGX A;  1EGO A;  2L4Q A;  3EWL A;  4V2M A;  5D73 A;  1HNC A;  1GSY A;  3TKS C;  4CY6 A;  4ILF A;  4I2U A;  1EEJ A;  4ECC A;  4HDE A;  1OE8 A;  3UMA A;  4KND A;  4HJ2 A;  3HVX A;  1GNE A;  3DXB A;  5ECN B;  2H70 A;  2WGR A;  3GRX A;  13GS A;  4NAX A;  3ZLP A;  1C72 A;  4HZ2 A;  3EU4 A;  4F0B A;  4X1U A;  22GS A;  3EU3 A;  4ACS A;  4HU7 A;  3G7Y A;  4DSS A;  2DC5 A;  2C3T A;  1SJ6 A;  3FRC A;  3TOU A;  2WB9 A;  4ICY A;  1FVK A;  3I69 A;  3QD9 A;  3IHG A;  2ALB A;  3LG6 A;  3MDK A;  2WUL A;  1HQO A;  1O85 A;  1M9A A;  1UA5 A;  4ZIL A;  3A5I A;  1TU8 A;  1GSE A;  1GTU A;  5J5N A;  5HR1 A;  2I81 A;  4YH2 A;  4BWQ A;  2DJ2 A;  1F2E A;  1K0B A;  5KN0 A;  4NXI A;  3E0U A;  3VWX A;  1XCC A;  4KDU A;  2FA8 A;  1PMT A;  2LS5 A;  4O5R A;  3QMX A;  1T1V A;  4BVY A;  5ID2 B;  1AC1 A;  4WKW A;  3IK9 A;  3FZA A;  4Q5F A;  3H93 A;  5CYY A;  2XBQ A;  4KUN A;  5CP1 A;  1K3O A;  1ACV A;  4K5R A;  4I97 A;  3TRX A;  4ZL9 A;  4JU5 A;  4EIP A;  1KNG A;  2DJ0 A;  3EIN A;  4KGI A;  4BVX B;  4WEY A;  2BJX A;  2VIM A;  1USB A;  2GSR A;  5LNK e;  3QAV A;  5ECQ B;  4WR5 A;  4OD7 A;  1FW1 A;  4CW9 A;  3GMF A;  3KIJ A;  1TKD B;  4K2D A;  2H6X A;  4X43 A;  1LBK A;  3Q74 A;  4IN0 A;  1ZGN A;  5GAP D;  1RQM A;  3VI7 A;  3HD5 A;  4MF7 A;  2M72 A;  3GST A;  2FD3 A;  5F0G A;  2YN1 A;  2IME A;  2V6O A;  3EC3 A;  5IMC A;  4POM A;  1ERU A;  3M9J A;  2A4V A;  1B4P A;  3CRT A;  3QAW A;  4BL7 B;  2H6Z A;  4TR1 A;  3HVV A;  4HQZ A;  1BAY A;  5A5K A;  1PX7 A;  4HQS A;  4TVE A;  1KBN A;  6GSU A;  1ZL9 A;  2G0F A;  4MJA A;  1JFU A;  2VD1 A;  3D5J A;  3M8N A;  5G31 A;  2LJR A;  2R0G A;  1A0R P;  4KX4 A;  3GKK A;  1BED A;  2HSM A;  2Z9S A;  5DAL B;  5FWG A;  4ML6 A;  1DUG A;  3GNJ A;  1V2A A;  1GUL A;  4DVC A;  4MPG A;  3TB2 A;  1VF1 A;  5CRG A;  4KCE A;  1CQG A;  3D4M A;  1ILO A;  3GYK A;  5KOW A;  1VGL A;  3E9J B;  5KN3 A;  1TDI A;  4N0Z A;  2H0H A;  5EPF A;  1GSD A;  4O92 A;  1Z7R A;  2OKA A;  2JL4 A;  1Y6E A;  1QMV A;  4GSS A;  4TR4 A;  2F3M A;  2C0G A;  5CO3 A;  4G2E A;  2R6K A;  1UC7 A;  4X0X A;  2GLR A;  3KM6 A;  4MLY A;  2X8H A;  4XHM A;  3M9K A;  3GKN A;  2OA7 A;  3A5W A;  14GS A;  5DAK A;  1S3C A;  4DSR A;  1XW5 A;  3W8J A;  3TJB A;  3W6G A;  2IWT A;  2B1K A;  3TKP A;  2C3Q A;  3IDV A;  5IOW A;  3G9B A;  4PQH A;  1EGR A;  4PQI A;  4MJC A;  1A23 A;  3RHC A;  4ID0 A;  3RDW A;  3KH9 A;  2AJQ B;  3IA1 A;  5E59 A;  3P90 A;  1SK2 A;  4HI7 A;  2JZS A;  1PN0 A;  2N5B A;  3GN3 A;  1ZZY A;  5AIV A;  1PA3 A;  1W4V A;  2XPD A;  5DJM A;  5H5S A;  2WFC A;  2ES7 A;  1U3A A;  5F06 A;  2F8A A;  1TP9 A;  5H5Q A;  2DIY A;  4ZB8 A;  3K8N A;  1WRY A;  2FUG 2;  1PL1 A;  2HSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...