2B7KA

Crystal structure of yeast sco1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
155
Chain Sequence
GKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SCO1 protein
publication title Crystal structure of yeast Sco1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 46
structure length 155
sequence length 169
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b7kA00
4P3YB 1M2AA 1K3OA 2R37A 1GTIA 1GSUA 4I6XA 4MZWA 3BBYA 1G7OA 1XXUA 5ELAA 4XS6A 3QAVA 2X8GA 3DEXA 2YJHA 3F4RA 5IO0A 2IMIA 1AC1A 4WF4A 1PRXA 1ZGNA 4TXOB 1J0FA 3E0UA 2HI7A 2VM1A 1PL1A 1S3AA 2QSIA 2LJAA 3J7Yb 3D21A 2F51A 4TXOA 5HFKA 3W8SA 2CZ3A 4ZB9A 2PBJA 1OE7A 3TOUA 3HD5A 2B1KA 2JZTA 3L0HA 5CP1A 3GX0A 2C3NA 2L6CA 4EVMA 2A4VA 1OE8A 2GVPA 4X0XA 4HZ2A 4JU5A 4EF0A 2C1YA 3UEMA 2LRTA 3ZVJA 3NIVA 1ERUA 3IRAA 2DIZA 4HUAA 1MEKA 3LJRA 2C0EA 3GURA 4Q5RA 2H70A 4LA1A 3F4SA 3GKMA 2M80A 1NM3A 2K8SA 3HVSA 3E9JB 4JZQA 4N0ZA 5JWQB 2N5BA 3DYRA 2KP1A 1NSWA 3EURA 1TXXA 3I9V2 1XIYA 3DRNA 2GDRA 2OADA 4OFTA 1FG4A 4IN0A 1M0UA 1KEBA 6GSVA 4GRFA 3SWLA 2H75A 3IXRA 3TKSC 2GQMA 1G0TA 2DMMA 4KSMA 3QPMA 1TRUA 2WZ9A 3I43A 5DQSA 2O87A 1VF1A 3W8JA 1OKTA 4ZXGA 4AF2A 2IFQB 1R26A 3KTLA 1K0OA 2ZUPA 2FWHA 5DQYA 1JZOA 4NMUA 3GN3A 3DXBA 3TJFA 4MF6A 3RBTA 5F06A 4WR5A 4KE3A 4O32A 5HFIA 1PKZA 4MABA 1TU7A 2DJKA 2H72A 2RIIA 2DIYA 5KN2A 2LSTA 3A3TA 4IHUA 4GLTA 1V40A 2HT9A 4KB3A 5DJMA 5HQPA 4TOPA 4D73B 3GMFA 2GZZA 1OKDA 4QL7A 1W4VA 3FR3A 1SJZA 1GWCA 2ON5A 1SYRA 3F6FA 2VL2A 5ECLB 4D73A 6GSXA 5GAPD 4PNGA 4MF5A 1DUGA 1XOBA 4EL1A 2FUG2 3CBUA 2JU5A 1X5CA 1T1VA 4MP4A 3ERGA 4OO4A 3UARA 4G9HA 4YH2A 5ABRA 3HVVA 4XTSA 3ZITA 1K0DA 4YQMA 1ERTA 1GSDA 2OE1A 1V2AA 1TK0B 4ZIJA 4CW9A 3TKPA 3US3A 2H73A 1PX7A 1VF3A 3WGXA 1GLQA 4IS0A 1EOGA 1KBNA 1R4WA 1YKCA 3FRCA 2PU9C 1GSQA 4JEDA 3HKRA 2CAQA 2GQKA 4ISDA 3VWUA 4OMVA 4IGJA 2VIMA 4HQSA 3BCKA 4GF0A 4HJMA 1K0BA 3L9VA 4EKZA 1IYIA 1F3BA 1YF1A 2LKUA 4ZILA 1NHOA 2PVQA 1FAAA 1WMJA 4TR3A 4XRDA 2VO4A 4YQUA 1O7UA 3QR6A 5GAND 5D9WA 4XS4B 3IK7A 3KP8A 4ML6A 3F3RA 1A23A 2N5AA 6GSYA 2HXKA 1U3IA 1GNWA 2WS2A 3CMIA 1EOHA 5DCGA 2VUPA 1EEJA 3APOA 2XHFA 1AIUA 3KM6A 1ZL9A 4LMVA 2VCZA 1R5AA 3H4KA 2OACA 2PMTA 1B48A 2H0IA 5ECKB 3DKSA 8GSSA 5ECPB 2P0GA 5EY6A 2LV3A 2VCWA 12GSA 2PVOC 4MZCA 1B8XA 4HOJA 2WCIA 2GZYA 3IAM2 5F8BA 3GFKA 3HXSA 1MDKA 4PURA 5GSTA 5KN0A 2NVLA 2VAFA 2I9HA 5J41A 1Z6NA 2L5OA 1T8EB 3HA9A 4MJAA 1KTEA 1BAYA 3GL3A 1DSBA 2IMDA 4NV5A 3P7XA 2FLSA 1USBA 3GUSA 2OBKA 1I9DA 5G30A 1F37A 2YWNA 3LG6A 4HS1A 3S9FA 5FHIA 2J9HA 1EP7A 3VPQA 3HJPA 4MLYA 17GSA 3TOTA 2HLSA 2WFCA 3MAKA 4OWYA 4I8BA 2R3XA 3FY7A 4GQFA 1QFNA 3ZFBA 2BTOT 2JSZA 1RK4A 2VD0A 2XBIA 5CYYA 3Q18A 3WGDA 1BG5A 4IVFA 1FB0A 4XIHA 2IL3A 2MYGA 3FW2A 1JLVA 4DEJA 2AJQB 4GSTA 1WRYA 2YJ7A 1HNCA 4E8EA 2RLIA 3LQ7A 1BX9A 4ECBA 5ECQB 2DJJA 3A2XA 1URMA 1Z3EA 4PQIA 3TB2A 4K6XA 2I81A 2C0DA 3IA1A 4IQ1A 1HNAA 4KDXA 2IIYA 4KDYA 22GSA 4PQHA 4EDZA 4OCFA 4POBA 4ULXA 1WJKA 4K7OA 2G0FA 1A8YA 4K0NA 2L6DA 3WD6A 4E8HA 7GSSA 4TXVA 5G5EA 1TU8A 1HQOA 2H6YA 4PX1A 1TJDA 4FYBA 5D9VA 1SK0A 3KZQA 4NWYA 5IO2A 2H30A 1U88A 1EGOA 2AAWA 1N8JA 1BEDA 2AHEA 1X5DA 3UBKA 4ECIA 3TKQA 1DE1A 2B3SA 1GL8A 1B4QA 2YOIA 2O8VB 2PERA 2O89A 3N5OA 1TRVA 2LTKA 6GSTA 3D22A 4ZBAA 1SL1B 4HDEA 3GL5A 3D4TA 4MK3A 4TRXA 2ALBA 1AUCA 2KHPA 2YWIA 5IIZA 5DVBA 2WDUA 5FT3A 3ED3A 5ECMB 2X8CA 3GA4A 4KNDA 3APSA 1A8LA 3RPPA 2P5RA 2I4AA 3IC4A 5F07A 20GSA 4J2FA 3TJBA 1TK5B 4WF5A 2B7JA 1XW9A 1QXHA 4F9ZA 4ZL9A 1J9BA 1Z7PA 3IHQA 2YZHA 3D6IA 1WWJA 3F63A 2AB6A 3EE2A 3IK9A 4GQCA 4ZBDA 4K2DA 4F2IA 1QQ2A 3HJMA 1GSSA 4MPFA 3H8QA 1GSFA 4XS1A 1YEXA 2CX4A 3GTUB 4J57E 1GH2A 3C71A 5KEJA 3KD0A 5ECRB 1HYUA 3LFLA 4MJCA 3N9JA 19GSA 4K9ZA 4KH7A 5CRGA 2FY6A 3GTUA 1H75A 3O76A 1V58A 4L0UA 3K8NA 5ECHB 4NAXA 3RDWA 4V2MA 2KUCA 1LU4A 2FWEA 1VF4A 1B9XC 1FB6A 2DJ0A 5HR2A 3W6GA 2VL3A 3ME7A 6GSWA 4TVEA 2F8FA 4ILFA 1M99A 4GWRA 4Q5QA 4K8MA 4DVCA 5IMDA 3QOUA 2IWTA 3GHAA 1SL2B 4WBJA 1EZKA 3CTFA 3MSZA 2JADA 2OBIA 4JE1A 5D9XA 3ZRDA 5D8IA 1OC8A 2L4CA 3CTGA 4JBBA 4OO5A 3ME8A 2H19A 1XFLA 5G1LA 3SBCA 3VI7A 2C0GA 2CT6A 3A2VA 2AUVA 2V2GA 4HJ2A 1PMTA 1OVNA 2DBCA 1EWXA 4X1UA 2H6ZA 5B6NA 4GSSA 3GSSA 1G6WA 5B6MA 4EE0A 3F0IA 1S3DA 3GH6A 3FHKA 1QK8A 2YWMA 2VOCA 3P2AA 4BPYA 4I2UA 2REMA 2RM6A 2NPBA 2CVKA 1GNEA 4L5OA 3U5RE 4NHWA 2LQOA 4F03A 1GULA 3CRUA 2VCTA 1AQXA 3VWVA 3FR9A 3VFIA 3TKSA 4OFMA 2YV9A 1THXA 3GRXA 1A2LA 3C8EA 3IAS2 3Q6OA 2M72A 4JRRA 5A4VA 3GKKA 2DJ1A 4IELA 3KMOA 4BA7A 4XCSA 5ECNB 2C3TA 5DALB 4HZ4A 2LRNA 1ZZYA 1GUKA 1A0RP 2LNTA 2WULA 3KIJA 4IW9A 3QFAC 4MH3A 1GSYA 1O8WA 4KDUA 1X9SB 5DALA 5ECIB 3IE3A 1WE0A 2C8UA 3FZ5A 4FYCA 3ZYWA 2MZCA 4FYUA 1J08A 2HFDA 4MJEA 2GTUA 2GSRA 2YV7A 4TR1B 2FGXA 1O81A 3TJGA 1MDIA 2HZEB 4XRAA 1AXDA 1QUWA 2DJ2A 5H5SA 4TR1A 4HU7A 1SL0B 3LEFA 5ECSA 2HZEA 3D0ZA 3UBLA 1A24A 2V6KA 2VCVA 1RQMA 1SKSB 3RHCA 1FO5A 3VK9A 1ERWA 1XWAA 5IMAA 2VD1A 3H79A 4NHZA 1XWBA 5CNWA 4BVXA 2WJUA 2LS5A 1XWGA 1V9WA 5CRWA 2H71A 1ERVA 2EIRA 5FWGA 1ZYQB 3G7JA 5JWRB 5JCWA 1TRWA 2RUFA 3M8NA 1H4OA 3HY2A 2KOKA 1SD9A 1V57A 4V1Ag 4OCEA 1F3AA 1FW1A 1SJ6A 4NV2A 5B8AA 5DBQA 3EU4A 1AAZA 3ERFA 4ACSA 5IMCA 1M9AA 2I3YA 1OYJA 4Q5FA 4IJIA 3ZTLA 2OE3A 2E0QA 1RW1A 1EV4A 2L4QA 5CO3A 5INYA 4AJ6A 3VLNA 2YP6A 3D5JA 1OC3A 6GSUA 2OA7A 3G9BA 2B6MA 2D2ZA 2CX3A 3P90A 2ES7A 1HD2A 3VI5A 2H0HA 4N30A 1U87A 1PL2A 1WPIA 3QFBC 1WIKA 2J23A 3WT1A 1W89A 3D4MA 3E3EA 1TI3A 2OJLA 1Q98A 1PQNA 4PXOA 1K0MA 3I69A 2X8HA 1GRXA 1Y25A 1XWKA 3ERWA 5AGYA 3LWAA 1SU9A 2GLRA 4EO3A 1K3LA 5JWOB 1OAZA 5B7CA 4PQ1A 3M0FA 2IMFA 3KTBA 2H66A 3UAPA 2WB9A 11GSA 2H1GA 4LMWA 5E4WA 1NW2A 5L71A 1BQ7A 2X64A 1TKDB 2H0GA 5J4UA 1K0CA 1SENA 3G7YA 2VCXA 3TJJA 1ST9A 4FIWA 2YNXA 3C73A 2CZ2A 5DJLA 2LQQA 3LORA 3BJ5A 4AGSA 3PGTA 3M1GA 2B1LA 4PUFC 4WXTA 1K3YA 5ID2A 2FWFA 2EIOA 1K0NA 2B7KA 4XHMA 3FK8A 2LRCA 1YY7A 5ECOB 3ISOA 3TJKA 2AV4A 6GSSA 5JCGA 1IYHA 2VCQA 3QMXA 4MCUA 1QGVA 4KGIA 3M3MA 5H5QA 1T4YA 2C80A 4RI6A 3EWLA 3TUEA 3F8UA 3KEBA 4I2TA 4ZL7A 2VM2A 1PA3A 2MMOA 2L57A 2TRCP 3DVXA 1PKWA 5D93A 2RM5A 3RPNA 2QKEA 4MMMA 2N5FA 2H8LA 2AYTA 5KN1A 3EC3A 3HZ4A 1UVZA 4KA0A 2VLTA 13GSA 4MPGA 5IOXA 2FA8A 4AJ7A 1PD21 2LNSA 3VPTA 2FHEA 1E2YA 1E6BA 4IBPA 1PN9A 1GTAA 4MDCA 2CV4A 3CRTA 3MNGA 1XCCA 1B4PA 4WETA 4DSRA 5DAKA 1ABAA 5A5KA 4KUNA 4F0CA 3KH7A 2DLXA 1ILOA 4RQRA 2K18A 2XBQA 3IOSA 3EVIA 2FNOA 4L5LA 1TRSA 3Q19A 3VURA 3IPZA 4BVYA 5CRHA 2JSYA 2XPEA 3J7Yk 3IR4A 4TR4A 2KLXA 4YAVA 5A4WA 1SKRB 4LLRA 1XBSA 2YANA 1XWCA 4WBRD 2CAIA 1PX6A 2Z9SA 3PR8A 2DJ3A 1YZXA 1WP0A 1EEMA 3ZREA 4HEA2 5J5NA 4POMA 4HQZA 3L4NA 2YN1A 3L9SA 1TI1A 2I1UA 1XVWA 5E59A 3TCOA 3CXGA 4WR4A 4NPBA 2GSTA 3DVWA 1FHEA 4BWQA 3HVXA 2IPAA 4PGTA 1AQVA 2PUKC 4FO5A 4MZBA 2B5XA 2GSQA 1LJRA 1FVJA 1GP1A 2XC2A 2IJYA 2GSSA 1YDKA 3KCMA 4NXIA 1DBYA 5F0GA 3M9JA 2OKAA 3VWXA 5DCHA 2JZRA 2E2MA 3U6VA 1Z5YE 1M2BA 1ZMAA 4BWSA 5LNKe 2NTOA 3R2QA 1JHBA 2ON7A 2F3MA 4TW5A 1AW9A 2V32A 2KP2A 3FZAA 1MTCA 3HCZA 3TKSE 2K6VA 1PSQA 3P8WA 4N11A 5J9CA 4FH8A 5CREA 4ZB6A 1UA5A 3GNJA 4KSOA 2PGTA 1X0RA 3GV1A 4DSSB 2CA8A 2X99A 3QCPA 5AN1A 5CRDA 1MD4A 2BJXA 4N0VA 1NHYA 1EP8A 3ZVJD 2C0FA 4EXJA 2JL4A 2G2QA 3O3TA 4DSSA 1GUHA 4L0WA 2FD3A 4ZBBA 3A2WA 2DC5A 1X5EA 1X9WB 3UL3A 5H5RA 4F82A 4N10A 4K0GA 2M46A 2XPDA 2E2GA 1THOA 4IKHA 2GQLA 3GSTA 5AIVA 5IM9A 1PGTA 2FWGA 1UC7A 5EPFA 1TK8B 1MDJA 4KCAA 5HR1A 1GTBA 1XOAA 1BYEA 4RI7A 1M2DA 4IP1A 3UIWA 1OC9B 2YCDA 1KNGA 1QMVA 4Z7XA 1R5PA 4HU9A 1XW5A 3DGQA 2OE0A 3AY8A 3DIEA 2O7KA 1CQGA 3ZMLA 2B5YA 3KH9A 1LBKA 1OC9A 2V1MA 5IMFA 4LL4B 3LSZA 5IOWA 1FOVA 3TDGA 2R5GA 3TRXA 2EC4A 1O73A 2MMAA 9GSSA 4AJ8A 1HNBA 3QD9A 2HSYA 3KGKA 1F2EA 1Z6MA 2GS3A 1U6TA 2FCHA 3NOFA 3Q74A 2WGRA 4CDOA 2B5EA 1VGLA 3CSIA 1XW6A 1A2MA 1U3AA 4YQVA 4G2EA 1YQ1A 4I5QA 4QQ7A 2JACA 3IBHA 3M9KA 2IFQA 3ZLPA 4MA9A 2IN3A 3UMAA 2VLVA 1ZOFA 1O85A 3CSHA 3GKNA 2BMXA 5GZZB 2NDOA 1N2AA 3TRQA 5B8BA 4PNFA 3ZL5A 1JFUA 5IMZA 3EU3A 3NZNA 10GSA 2PN8A 3HYPA 5G2ZA 3O6TA 5D96A 3LGCA 4ZB8A 3DWVA 1TTZA 1I5GA 1YEPA 3C7MA 4TKYA 4TN8A 3LXTA 1ON4A 4IQAA 5JCUA 3MWHA 3HJOA 1Q4JA 2VL2C 3GX8A 2DSAA 2HNLA 1T3BA 5ELGA 1TDIA 1FVKA 3IV4A 2GT5A 1GUMA 3FZ9A 4Q5NA 5DDLA 1VF2A 2GGTA 1XPVA 5EVOA 4CHSA 1O8XA 2R4VA 2H1DA 4POLA 3EYTA 4MF7A 2PPTA 1X9MB 1DE2A 4G19A 3WYWA 3BOAA 1O6JA 1AQWA 1CQHA 3FZ4A 2HRNA 5A4UA 5G1KA 4GXZA 5G31A 2K9FA 5HR0A 4YAPA 3KMNA 2YPMA 2C3QA 2L5LA 2PWJA 1SK2A 5CAXA 1GSEA 3IDVA 1EV9A 4ECJA 4POKA 3EMXA 4IJ3A 2LUSA 4H86A 4V1Ap 2YZUA 4JR6A 2H1BA 3CSJA 3GH9A 2EIQA 3TRPA 5IMVA 2LJKA 4TR0A 5ENUA 3F3QA 3BD2A 1Z7RA 4WKWA 1A2JA 5C00A 1JZRA 2FA4A 5KN3A 4L8EA 1VRSD 1EGRA 1YF0A 3L9UA 4XS4A 3L78A 3PH9A 2RUEA 3TKRA 2H1AA 1MD3A 4OD7A 2H01A 3LYKA 5F05A 5HFGA 1Y6EA 2HYXA 4EC0A 2F8AA 2MBTA 16GSA 5ID2B 1Z9HA 1G6YA 5IPHA 4K1FA 2CQ9A 3CYNA 4O5RA 3DD3A 2ZCTA 4K7NA 4KCEA 2HSHA 2QC7A 3H1NA 4QL9A 2K8VA 3GKXA 3FYGA 1SYXA 4KW6A 4ML1A 2MMZA 3QAGA 5G5FA 1XVQA 3BCIA 2MMNA 2O85A 2WRTA 4PUAA 2H76A 3RAZA 1SD8A 4KX4A 4BL7A 18GSA 2MBSA 1G7EA 3LXZA 3FKFA 5COHA 1F6MC 2JZSA 4GTUA 3HHVA 4HI7A 3UVHA 3UOMA 3GYKA 2VL9A 1A0FA 3QAWA 4MH2A 4V2NA 2H6XA 5D9TA 14GSA 3I6AA 2A2RA 3F9UA 4GCIA 4EDYA 1YJ6A 2F9SA 5D73A 4RQXA 3C1RA 4X43A 2YWOA 4V2LA 1TW9A 4IP6A 1R7HA 2GZPA 1B9YC 4KAEA 3GIXA 2NBSA 3ZIVA 5DAKB 3MDKA 3DMLA 3VWWA 2ZNMA 4EUYA 2QGVA 2A2SA 1TOFA 1XZOA 2H74A 3H93A 3LYPA 3JCML 1ACVA 5IPGA 2HZFA 3APQA 1YKAA 4K7IA 3HZ8A 3ZIJA 1T7PB 2C4JA 3ZFLA 2IMEA 1ML6A 3OR5A 3KXOA 4O92A 2LEGA 1UN2A 5AIXA 2E7PA 1M9BA 3EINA 2TIRA 5C04A 1GLPA 1S3CA 1SK1A 4ZL8A 1SKWB 5IQYA 3FR6A 1T4ZA 1ZCPA 3WGEA 1K0AA 4I97A 2V6OA 1F9MA 3HDCA 4ID0A 3KJYA 4JR4A 2VLUA 3C1SA 1T00A 3WT2A 2GT6A 4OFNA 3UJ1A 2CVBA 2CVDA 3ZZXA 3A5WA 3EMPA 5AISA 2R2JA 4GSNA 2HE3A 2P5QA 4G10A 1JZWA 3TGZA 2IMKA 5J9BA 3UVTA 2TRXA 4MJBA 1JLWA 3V1WA 1BJXA 1ZYEA 3F4TA 3FEUA 2LJRA 1C72A 3PINA 3RHBA 1WOUA 1GTUA 4F0BA 4O7HA 3QDNA 3ZMKA 5EL8A 3KP9A 1V98A 4ECCA 5J3RA 3G7IA 5LD0A 2P31A 1JZDA 1M7TA 1TP9A 5GSSA 2DMLA 1SJIA 4J56E 4RUVA 4WEYA 5HR3A 2R6KA 2V41A 5LCZA 2HRFA 4DSQA 4LL1B 2L59A 3F6DA
chains in the Genus database with same CATH superfamily
4P3YB 1M2AA 1K3OA 2R37A 1GTIA 1GSUA 4I6XA 4MZWA 3BBYA 1G7OA 1XXUA 5ELAA 4XS6A 3QAVA 2X8GA 3DEXA 2YJHA 3F4RA 5IO0A 2IMIA 1AC1A 4WF4A 1PRXA 1ZGNA 4TXOB 1J0FA 3E0UA 2HI7A 2VM1A 1PL1A 1S3AA 2QSIA 2LJAA 3J7Yb 3D21A 2F51A 4TXOA 5HFKA 3W8SA 2CZ3A 4ZB9A 2PBJA 1OE7A 3TOUA 3HD5A 2B1KA 2JZTA 3L0HA 5CP1A 3GX0A 2C3NA 2L6CA 4EVMA 2A4VA 1OE8A 2GVPA 4X0XA 4HZ2A 4BIKA 4JU5A 4EF0A 2C1YA 3UEMA 2LRTA 3ZVJA 3NIVA 1ERUA 3IRAA 2DIZA 4HUAA 1MEKA 3LJRA 2C0EA 3GURA 4Q5RA 2H70A 4LA1A 1ZYPA 3F4SA 3GKMA 2M80A 1NM3A 2K8SA 3HVSA 3E9JB 4JZQA 4N0ZA 5JWQB 2N5BA 3DYRA 2KP1A 1NSWA 3EURA 1TXXA 3I9V2 3R3EA 1XIYA 3DRNA 2GDRA 2OADA 4OFTA 1FG4A 4IN0A 1M0UA 1KEBA 6GSVA 4GRFA 3SWLA 2H75A 3IXRA 3TKSC 2GQMA 1G0TA 2DMMA 4KSMA 3QPMA 1TRUA 2WZ9A 3I43A 5DQSA 2O87A 1VF1A 3W8JA 1OKTA 4ZXGA 4AF2A 2IFQB 1R26A 3KTLA 1K0OA 2ZUPA 2FWHA 5DQYA 1JZOA 4NMUA 3GN3A 3DXBA 3TJFA 4MF6A 3RBTA 5F06A 4WR5A 4KE3A 4O32A 5HFIA 1PKZA 4MABA 1TU7A 2DJKA 2H72A 2RIIA 2DIYA 2A4HA 5KN2A 2LSTA 3A3TA 4IHUA 4GLTA 1V40A 2HT9A 4KB3A 5DJMA 5HQPA 4TOPA 4D73B 3GMFA 2GZZA 1OKDA 4QL7A 1W4VA 3FR3A 1SJZA 1GWCA 2ON5A 1SYRA 3F6FA 2VL2A 5ECLB 4D73A 6GSXA 5GAPD 4PNGA 4MF5A 1DUGA 1XOBA 4EL1A 2FUG2 3CBUA 2JU5A 1X5CA 1T1VA 4MP4A 3ERGA 4OO4A 3UARA 4G9HA 4YH2A 5ABRA 3HVVA 4XTSA 3ZITA 1K0DA 4YQMA 1ERTA 1GSDA 4FQUA 2OE1A 1V2AA 1TK0B 4ZIJA 4CW9A 3TKPA 3US3A 2H73A 1PX7A 1VF3A 1FOHA 2HSMA 3WGXA 1GLQA 4IS0A 1EOGA 1KBNA 1R4WA 1YKCA 3IC8A 3FRCA 2PU9C 1GSQA 4JEDA 3HKRA 2CAQA 2GQKA 4ISDA 3VWUA 4OMVA 4IGJA 2VIMA 4HQSA 3BCKA 4GF0A 4HJMA 1K0BA 3L9VA 4EKZA 1IYIA 1F3BA 1YF1A 2LKUA 3EPTA 4ZILA 1NHOA 2PVQA 1FAAA 1WMJA 3MYDA 4G0LA 4TR3A 4XRDA 2VO4A 4YQUA 1O7UA 3QR6A 5GAND 5D9WA 4XS4B 3IK7A 3KP8A 4ML6A 3F3RA 1A23A 2N5AA 6GSYA 2HXKA 1U3IA 1GNWA 2WS2A 3CMIA 1EOHA 5DCGA 2VUPA 1EEJA 3APOA 2XHFA 1AIUA 3KM6A 1ZL9A 4LMVA 2VCZA 1R5AA 3H4KA 2OACA 2PMTA 1B48A 2H0IA 1M3IA 5ECKB 3DKSA 8GSSA 5ECPB 2P0GA 5EY6A 2LV3A 2VCWA 12GSA 2PVOC 4MZCA 1B8XA 4HOJA 2WCIA 2GZYA 3IAM2 5F8BA 3GFKA 3HXSA 1MDKA 4PURA 5GSTA 5KN0A 2NVLA 2VAFA 2I9HA 5J41A 1Z6NA 2L5OA 1T8EB 3HA9A 4MJAA 4BL7B 1KTEA 1BAYA 3GL3A 1DSBA 4K2XA 2IMDA 4NV5A 3P7XA 2FLSA 1USBA 3GUSA 2OBKA 1I9DA 5G30A 1F37A 2YWNA 3LG6A 4HS1A 3S9FA 5FHIA 2J9HA 1EP7A 3VPQA 3HJPA 4MLYA 17GSA 3TOTA 2HLSA 2WFCA 3MAKA 4OWYA 4I8BA 2R3XA 3FY7A 4GQFA 1QFNA 3ZFBA 2BTOT 2JSZA 1RK4A 2VD0A 2XBIA 5BMUA 5CYYA 3Q18A 3WGDA 1BG5A 4IVFA 1FB0A 4XIHA 2IL3A 2MYGA 3FW2A 1JLVA 4DEJA 2AJQB 4GSTA 1WRYA 2YJ7A 1HNCA 4E8EA 2RLIA 3LQ7A 1BX9A 4ECBA 5ECQB 2DJJA 3A2XA 1URMA 1Z3EA 4PQIA 3TB2A 4K6XA 2I81A 2C0DA 3IA1A 4IQ1A 1HNAA 4KDXA 2IIYA 4KDYA 22GSA 4PQHA 4EDZA 4OCFA 4POBA 4ULXA 1WJKA 4K7OA 2G0FA 1A8YA 4K0NA 2L6DA 3WD6A 4E8HA 7GSSA 4PTSA 4TXVA 5G5EA 1TU8A 1HQOA 2H6YA 4PX1A 1TJDA 4FYBA 5D9VA 1SK0A 3KZQA 4NWYA 5IO2A 2H30A 1U88A 1EGOA 2AAWA 1N8JA 1BEDA 2AHEA 1X5DA 3UBKA 3A5IA 4ECIA 3TKQA 1DE1A 2B3SA 1GL8A 1B4QA 2YOIA 2O8VB 2PERA 2O89A 3N5OA 1TRVA 2LTKA 6GSTA 2DKHA 3D22A 1M3JA 4ZBAA 1SL1B 4HDEA 3GL5A 3D4TA 4MK3A 4TRXA 2ALBA 1AUCA 2KHPA 2YWIA 5IIZA 5DVBA 1ZYNA 2WDUA 2DKIA 5FT3A 3ED3A 5ECMB 2X8CA 3GA4A 4KNDA 3APSA 1A8LA 3RPPA 2P5RA 2I4AA 3IC4A 5F07A 20GSA 4J2FA 3TJBA 4Z2TA 3MIXA 1TK5B 4WF5A 2B7JA 1XW9A 1QXHA 4F9ZA 4ZL9A 1J9BA 1Z7PA 3IHQA 2YZHA 3D6IA 1WWJA 3F63A 2AB6A 3EE2A 3IK9A 4GQCA 4ZBDA 4K2DA 4F2IA 1QQ2A 3HJMA 1GSSA 4MPFA 3H8QA 1GSFA 4XS1A 1YEXA 2CX4A 3GTUB 4J57E 1GH2A 3C71A 5KEJA 3KD0A 5ECRB 1HYUA 3LFLA 4MJCA 3N9JA 19GSA 4K9ZA 4KH7A 5CRGA 2FY6A 3GTUA 1H75A 3O76A 1V58A 4L0UA 3K8NA 5ECHB 4NAXA 3RDWA 4V2MA 2KUCA 1LU4A 2FWEA 1VF4A 1B9XC 1FB6A 2DJ0A 5HR2A 3W6GA 2VL3A 3ME7A 6GSWA 4TVEA 2F8FA 4ILFA 1M99A 4CY8A 4GWRA 4Q5QA 4K8MA 4DVCA 5IMDA 3QOUA 2IWTA 3GHAA 1SL2B 4WBJA 1EZKA 3CTFA 3MSZA 2JADA 2OBIA 4JE1A 5D9XA 3ZRDA 5D8IA 1OC8A 2L4CA 3CTGA 4JBBA 4OO5A 3ME8A 2H19A 1XFLA 5G1LA 3SBCA 3VI7A 2C0GA 2CT6A 3A2VA 2AUVA 2V2GA 4HJ2A 1PMTA 1OVNA 2DBCA 1EWXA 3CQFA 4X1UA 2H6ZA 5B6NA 4GSSA 3GSSA 1G6WA 5B6MA 4EE0A 3F0IA 1S3DA 3GH6A 3FHKA 1QK8A 2YWMA 2VOCA 3P2AA 4BPYA 4I2UA 2REMA 2RM6A 5KOXA 2NPBA 2CVKA 1GNEA 4L5OA 4CY6A 3U5RE 4NHWA 4USSA 2LQOA 4F03A 1GULA 3CRUA 2VCTA 1AQXA 3VWVA 3FR9A 3VFIA 3TKSA 4OFMA 2YV9A 1THXA 3GRXA 1A2LA 3C8EA 3IAS2 3Q6OA 2M72A 4JRRA 5A4VA 3GKKA 2DJ1A 4IELA 3KMOA 4BA7A 4YKGA 4XCSA 5ECNB 2C3TA 5DALB 4HZ4A 2LRNA 1ZZYA 1GUKA 1A0RP 2LNTA 2WULA 3KIJA 4IW9A 3QFAC 4MH3A 1GSYA 1O8WA 4KDUA 1X9SB 5DALA 5ECIB 3IE3A 1WE0A 2C8UA 3FZ5A 4FYCA 3ZYWA 2MZCA 4FYUA 1J08A 2HFDA 4MJEA 4Z2RA 2GTUA 2GSRA 2YV7A 4TR1B 2FGXA 1O81A 3TJGA 1MDIA 2HZEB 4XRAA 1AXDA 3LW9A 2A2PA 1QUWA 2DJ2A 5H5SA 4TR1A 4HU7A 1SL0B 3LEFA 5ECSA 4BVXB 2HZEA 3D0ZA 3UBLA 1A24A 2V6KA 2VCVA 1RQMA 1SKSB 3RHCA 1FO5A 3VK9A 1ERWA 1XWAA 5IMAA 2VD1A 3H79A 4NHZA 1XWBA 5CNWA 4BVXA 2WJUA 2LS5A 1XWGA 1V9WA 5CRWA 2H71A 1ERVA 2EIRA 5FWGA 1ZYQB 3G7JA 5JWRB 5JCWA 1TRWA 2RUFA 3M8NA 1H4OA 3HY2A 2KOKA 1SD9A 1V57A 4V1Ag 4OCEA 1F3AA 1FW1A 1SJ6A 4NV2A 5B8AA 5DBQA 3EU4A 1AAZA 3ERFA 4ACSA 5IMCA 1M9AA 2I3YA 1OYJA 4Q5FA 4IJIA 3ZTLA 2OE3A 2E0QA 1RW1A 1EV4A 2L4QA 5CO3A 2HRKA 5INYA 4AJ6A 3VLNA 2YP6A 3D5JA 1OC3A 6GSUA 2OA7A 3G9BA 2B6MA 2D2ZA 2CX3A 3P90A 2ES7A 1HD2A 4X4JA 3VI5A 2H0HA 4N30A 1U87A 1PL2A 1WPIA 3QFBC 1WIKA 2J23A 3WT1A 1W89A 3D4MA 3E3EA 1TI3A 2OJLA 1Q98A 1PQNA 4PXOA 1K0MA 3I69A 2X8HA 1GRXA 1Y25A 2R0PA 1XWKA 3ERWA 5AGYA 3LWAA 1SU9A 2GLRA 4EO3A 1K3LA 5JWOB 1OAZA 5B7CA 4EIPA 4PQ1A 3M0FA 2IMFA 3KTBA 2H66A 4Z2UA 3UAPA 2WB9A 11GSA 2H1GA 4LMWA 5E4WA 1NW2A 5L71A 1BQ7A 2X64A 1TKDB 2H0GA 5J4UA 1K0CA 1SENA 3G7YA 2VCXA 3TJJA 1ST9A 4FIWA 2YNXA 3C73A 2CZ2A 5DJLA 2LQQA 3LORA 3BJ5A 4AGSA 3PGTA 4KF9A 3M1GA 2B1LA 4PUFC 4WXTA 1K3YA 5ID2A 2R0CA 2FWFA 2EIOA 1K0NA 2B7KA 4XHMA 3FK8A 2LRCA 1YY7A 5ECOB 3ISOA 3TJKA 2AV4A 6GSSA 5JCGA 1IYHA 2VCQA 3QMXA 4MCUA 1QGVA 4KGIA 3M3MA 5H5QA 1T4YA 2C80A 4RI6A 3EWLA 3TUEA 3F8UA 3KEBA 1S3RA 4I2TA 4ZL7A 2VM2A 4MNNA 1PA3A 2MMOA 2L57A 2TRCP 3DVXA 1PKWA 5D93A 2RM5A 3RPNA 2QKEA 4MMMA 2N5FA 2H8LA 2AYTA 5KN1A 3EC3A 3HZ4A 1UVZA 4KA0A 2VLTA 13GSA 4MPGA 5IOXA 2FA8A 4AJ7A 4G0IA 1PD21 2LNSA 3VPTA 2FHEA 1E2YA 1E6BA 4IBPA 1PN9A 1GTAA 4MDCA 2CV4A 3CRTA 3MNGA 1XCCA 1B4PA 4WETA 4DSRA 5DAKA 1ABAA 5A5KA 4KUNA 4F0CA 3KH7A 2DLXA 1ILOA 4RQRA 2K18A 2XBQA 3IOSA 3EVIA 2FNOA 4L5LA 1TRSA 3Q19A 3VURA 3IPZA 4BVYA 5CRHA 2JSYA 2XPEA 3J7Yk 3IR4A 4TR4A 2KLXA 4YAVA 5A4WA 1SKRB 4LLRA 1XBSA 2YANA 1XWCA 4WBRD 2CAIA 1PX6A 2Z9SA 3PR8A 2DJ3A 1YZXA 1WP0A 1EEMA 3ZREA 4HEA2 5J5NA 4POMA 4HQZA 3L4NA 2YN1A 3L9SA 1TI1A 2I1UA 1XVWA 5E59A 3TCOA 3CXGA 4WR4A 4NPBA 2GSTA 3DVWA 1FHEA 4BWQA 3HVXA 2IPAA 4PGTA 1AQVA 2PUKC 4FO5A 4MZBA 4O5UA 2B5XA 2GSQA 1LJRA 1FVJA 1GP1A 2XC2A 2IJYA 2GSSA 1YDKA 3KCMA 4NXIA 1DBYA 5F0GA 3M9JA 2OKAA 3VWXA 5DCHA 2JZRA 4K5RA 2E2MA 5BRTA 3U6VA 1Z5YE 1M2BA 1ZMAA 4BWSA 4HSCX 5LNKe 2NTOA 3R2QA 1JHBA 2ON7A 2F3MA 4TW5A 1AW9A 2V32A 2KP2A 3FZAA 1MTCA 3HCZA 3TKSE 2K6VA 4O5QA 1PSQA 3P8WA 4N11A 5J9CA 4FH8A 5CREA 4ZB6A 1UA5A 1PN0A 3GNJA 4KSOA 2PGTA 1X0RA 3GV1A 4DSSB 2CA8A 2X99A 3QCPA 5AN1A 5CRDA 1MD4A 2BJXA 4N0VA 1NHYA 1EP8A 3ZVJD 2C0FA 4EXJA 2JL4A 2G2QA 3O3TA 4DSSA 1GUHA 4L0WA 2FD3A 2R0GA 4ZBBA 3A2WA 2DC5A 1X5EA 1X9WB 3UL3A 5H5RA 4F82A 4N10A 4K0GA 2M46A 2XPDA 3IHGA 2E2GA 1THOA 4IKHA 2GQLA 4K5SA 3GSTA 5AIVA 5IM9A 1PGTA 2FWGA 1UC7A 5EPFA 1TK8B 1MDJA 4KCAA 5HR1A 1GTBA 1XOAA 2QA2A 1BYEA 4RI7A 1M2DA 4IP1A 3UIWA 1OC9B 2YCDA 1KNGA 1QMVA 4Z7XA 1R5PA 4HU9A 1XW5A 3DGQA 2OE0A 3AY8A 3DIEA 2O7KA 1CQGA 3ZMLA 2B5YA 3KH9A 1LBKA 1OC9A 2V1MA 5IMFA 4LL4B 3LSZA 5IOWA 1FOVA 3TDGA 2R5GA 3TRXA 2EC4A 1O73A 2MMAA 9GSSA 4AJ8A 1HNBA 3QD9A 2HSYA 3KGKA 1F2EA 1Z6MA 2GS3A 1U6TA 2FCHA 3NOFA 3Q74A 2WGRA 4CDOA 2B5EA 1VGLA 3CSIA 1XW6A 2QA1A 1A2MA 1U3AA 4YQVA 4G2EA 1YQ1A 4I5QA 4QQ7A 2JACA 3IBHA 3M9KA 2IFQA 4ICYA 3ZLPA 4MA9A 2IN3A 3UMAA 2VLVA 1ZOFA 1O85A 3CSHA 3GKNA 2BMXA 5GZZB 2NDOA 1N2AA 3TRQA 5KOWA 5B8BA 4PNFA 3ZL5A 1JFUA 5IMZA 3EU3A 3NZNA 10GSA 2PN8A 3HYPA 5G2ZA 3O6TA 5D96A 3LGCA 4ZB8A 3DWVA 1TTZA 1I5GA 1YEPA 3C7MA 4TKYA 4TN8A 3LXTA 1ON4A 4IQAA 5JCUA 3MWHA 3HJOA 1Q4JA 2VL2C 3GX8A 2DSAA 2HNLA 1T3BA 5ELGA 1TDIA 1FVKA 3IV4A 2GT5A 1GUMA 3FZ9A 4Q5NA 5DDLA 1VF2A 2GGTA 1XPVA 5EVOA 4CHSA 1O8XA 2R4VA 2H1DA 4POLA 3EYTA 4MF7A 2PPTA 4A5PA 1X9MB 1DE2A 4G19A 3WYWA 3BOAA 1O6JA 1AQWA 1CQHA 3FZ4A 2HRNA 4G0KA 2UZ8A 5A4UA 5G1KA 4GXZA 5G31A 2K9FA 5HR0A 4YAPA 3KMNA 2YPMA 2C3QA 2L5LA 2PWJA 1SK2A 5CAXA 1GSEA 3IDVA 1EV9A 4ECJA 4POKA 3EMXA 4IJ3A 2LUSA 4H86A 4V1Ap 2YZUA 4JR6A 2H1BA 3CSJA 3GH9A 2EIQA 3TRPA 5IMVA 2LJKA 4TR0A 5ENUA 3F3QA 3BD2A 1Z7RA 4WKWA 1A2JA 5C00A 1JZRA 2FA4A 5KN3A 4L8EA 1VRSD 1EGRA 1YF0A 3L9UA 4XS4A 3L78A 3PH9A 2RUEA 3TKRA 2H1AA 1MD3A 4OD7A 2H01A 3LYKA 5F05A 5HFGA 1Y6EA 2HYXA 4EC0A 2F8AA 2MBTA 16GSA 5ID2B 1Z9HA 1G6YA 5IPHA 4K1FA 2CQ9A 3CYNA 4O5RA 3DD3A 2ZCTA 4K7NA 4KCEA 2HSHA 2QC7A 3H1NA 4QL9A 2K8VA 3GKXA 3FYGA 1SYXA 4KW6A 4ML1A 2X4AA 2MMZA 3QAGA 5G5FA 1XVQA 3BCIA 2MMNA 2O85A 2WRTA 4PUAA 2H76A 3RAZA 1SD8A 4KX4A 4BL7A 18GSA 2MBSA 1G7EA 3LXZA 3FKFA 5COHA 1F6MC 2JZSA 4GTUA 4YKFA 2X49A 3HHVA 4HI7A 3UVHA 3UOMA 3GYKA 2VL9A 1A0FA 3QAWA 4MH2A 4V2NA 2H6XA 5D9TA 14GSA 3I6AA 2A2RA 3F9UA 4GCIA 4EDYA 1YJ6A 3FMWA 2F9SA 2HRAA 5D73A 4RQXA 3C1RA 4X43A 2YWOA 4V2LA 1TW9A 4IP6A 1R7HA 2GZPA 1B9YC 4KAEA 3GIXA 2NBSA 3ZIVA 5DAKB 3MDKA 3DMLA 3VWWA 2ZNMA 4EUYA 2QGVA 2A2SA 1TOFA 1XZOA 2H74A 3H93A 3LYPA 3JCML 1ACVA 5IPGA 2HZFA 3APQA 1YKAA 4K7IA 3HZ8A 3ZIJA 1T7PB 2C4JA 3ZFLA 4BVYB 2IMEA 1ML6A 3OR5A 3KXOA 4O92A 1PFOA 2LEGA 1UN2A 5AIXA 2E7PA 1M9BA 3EINA 2TIRA 5C04A 1GLPA 1S3CA 1SK1A 4ZL8A 1SKWB 5IQYA 3FR6A 1T4ZA 1ZCPA 3WGEA 1K0AA 4I97A 2V6OA 3HVNA 1F9MA 3HDCA 4ID0A 3KJYA 4JR4A 2VLUA 3PPUA 3C1SA 1T00A 3WT2A 1XG8A 2GT6A 4OFNA 3UJ1A 2CVBA 2CVDA 3ZZXA 3A5WA 3EMPA 5AISA 2R2JA 4GSNA 2HE3A 4EIQA 2P5QA 4G10A 1JZWA 3TGZA 2IMKA 5J9BA 3UVTA 2TRXA 4MJBA 1JLWA 3V1WA 1BJXA 1ZYEA 3F4TA 3FEUA 2LJRA 1C72A 3PINA 3RHBA 1WOUA 1GTUA 4F0BA 4O7HA 3QDNA 3ZMKA 5EL8A 3KP9A 1V98A 4ECCA 5J3RA 3G7IA 5LD0A 2P31A 1JZDA 1M7TA 1TP9A 5GSSA 2DMLA 1SJIA 4J56E 4RUVA 4WEYA 5HR3A 2R6KA 2V41A 5LCZA 2HRFA 4DSQA 4LL1B 2L59A 3F6DA
chains in the Genus database with same CATH topology
4P3YB 1M2AA 1K3OA 2R37A 1GTIA 1GSUA 4I6XA 4MZWA 3BBYA 1G7OA 1XXUA 5ELAA 4XS6A 3QAVA 2X8GA 3DEXA 2YJHA 3F4RA 5IO0A 2IMIA 1AC1A 4WF4A 1PRXA 1ZGNA 4TXOB 1J0FA 3E0UA 2HI7A 2VM1A 1PL1A 1S3AA 2QSIA 2LJAA 3J7Yb 3D21A 2F51A 4TXOA 5HFKA 3W8SA 2CZ3A 4ZB9A 2PBJA 1OE7A 3TOUA 3HD5A 2B1KA 2JZTA 3L0HA 5CP1A 3GX0A 2C3NA 2L6CA 4EVMA 2A4VA 1OE8A 2GVPA 4X0XA 4HZ2A 4JU5A 4EF0A 2C1YA 3UEMA 2LRTA 3ZVJA 3NIVA 1ERUA 3IRAA 2DIZA 4HUAA 1MEKA 3LJRA 2C0EA 3GURA 4Q5RA 2H70A 4LA1A 1ZYPA 3F4SA 3GKMA 2M80A 1NM3A 2K8SA 3HVSA 3E9JB 4JZQA 4N0ZA 5JWQB 2N5BA 3DYRA 2KP1A 1NSWA 3EURA 1TXXA 3I9V2 3R3EA 1XIYA 3DRNA 2GDRA 2OADA 4OFTA 1FG4A 4IN0A 1M0UA 1KEBA 6GSVA 4GRFA 3SWLA 2H75A 3IXRA 3TKSC 2GQMA 1G0TA 2DMMA 4KSMA 3QPMA 1TRUA 2WZ9A 3I43A 5DQSA 2O87A 1VF1A 3W8JA 1OKTA 4ZXGA 4AF2A 2IFQB 1R26A 3KTLA 1K0OA 2ZUPA 2FWHA 5DQYA 1JZOA 4NMUA 3GN3A 3DXBA 3TJFA 4MF6A 3RBTA 5F06A 4WR5A 4KE3A 4O32A 5HFIA 1PKZA 4MABA 1TU7A 2DJKA 2H72A 2RIIA 2DIYA 2A4HA 5KN2A 2LSTA 3A3TA 4IHUA 4GLTA 1V40A 2HT9A 4KB3A 5DJMA 5HQPA 4TOPA 4D73B 3GMFA 2GZZA 1OKDA 4QL7A 1W4VA 3FR3A 1SJZA 1GWCA 2ON5A 1SYRA 3F6FA 2VL2A 5ECLB 4D73A 6GSXA 5GAPD 4PNGA 4MF5A 1DUGA 1XOBA 4EL1A 2FUG2 3CBUA 2JU5A 1X5CA 1T1VA 4MP4A 3ERGA 4OO4A 3UARA 4G9HA 4YH2A 5ABRA 3HVVA 4XTSA 3ZITA 1K0DA 4YQMA 1ERTA 1GSDA 4FQUA 2OE1A 1V2AA 1TK0B 4ZIJA 4CW9A 3TKPA 3US3A 2H73A 1PX7A 1VF3A 1FOHA 2HSMA 3WGXA 1GLQA 4IS0A 1EOGA 1KBNA 1R4WA 1YKCA 3IC8A 3FRCA 2PU9C 1GSQA 4JEDA 3HKRA 2CAQA 2GQKA 4ISDA 3VWUA 4OMVA 4IGJA 2VIMA 4HQSA 3BCKA 4GF0A 4HJMA 1K0BA 3L9VA 4EKZA 1IYIA 1F3BA 1YF1A 2LKUA 3EPTA 4ZILA 1NHOA 2PVQA 1FAAA 1WMJA 3MYDA 4G0LA 4TR3A 4XRDA 2VO4A 4YQUA 1O7UA 3QR6A 5GAND 5D9WA 4XS4B 3IK7A 3KP8A 4ML6A 3F3RA 1A23A 2N5AA 6GSYA 2HXKA 1U3IA 1GNWA 2WS2A 3CMIA 1EOHA 5DCGA 2VUPA 1EEJA 3APOA 2XHFA 1AIUA 3KM6A 1ZL9A 4LMVA 2VCZA 1R5AA 3H4KA 2OACA 2PMTA 1B48A 2H0IA 5ECKB 3DKSA 8GSSA 5ECPB 2P0GA 5EY6A 2LV3A 2VCWA 12GSA 2PVOC 4MZCA 1B8XA 4HOJA 2WCIA 2GZYA 3IAM2 5F8BA 3GFKA 3HXSA 1MDKA 4PURA 5GSTA 5KN0A 2NVLA 2VAFA 2I9HA 5J41A 1Z6NA 2L5OA 1T8EB 3HA9A 4MJAA 4BL7B 1KTEA 1BAYA 3GL3A 1DSBA 4K2XA 2IMDA 4NV5A 3P7XA 2FLSA 1USBA 3GUSA 2OBKA 1I9DA 5G30A 1F37A 2YWNA 3LG6A 4HS1A 3S9FA 5FHIA 2J9HA 1EP7A 3VPQA 3HJPA 4MLYA 17GSA 3TOTA 2HLSA 2WFCA 3MAKA 4OWYA 4I8BA 2R3XA 3FY7A 4GQFA 1QFNA 3ZFBA 2BTOT 2JSZA 1RK4A 2VD0A 2XBIA 5BMUA 5CYYA 3Q18A 3WGDA 1BG5A 4IVFA 1FB0A 4XIHA 2IL3A 2MYGA 3FW2A 1JLVA 4DEJA 2AJQB 4GSTA 1WRYA 2YJ7A 1HNCA 4E8EA 2RLIA 3LQ7A 1BX9A 4ECBA 5ECQB 2DJJA 3A2XA 1URMA 1Z3EA 4PQIA 3TB2A 4K6XA 2I81A 2C0DA 3IA1A 4IQ1A 1HNAA 4KDXA 2IIYA 4KDYA 22GSA 4PQHA 4EDZA 4OCFA 4POBA 4ULXA 1WJKA 4K7OA 2G0FA 1A8YA 4K0NA 2L6DA 3WD6A 4E8HA 7GSSA 4PTSA 4TXVA 5G5EA 1TU8A 1HQOA 2H6YA 4PX1A 1TJDA 4FYBA 5D9VA 1SK0A 3KZQA 4NWYA 5IO2A 2H30A 1U88A 1EGOA 2AAWA 1N8JA 1BEDA 2AHEA 1X5DA 3UBKA 3A5IA 4ECIA 3TKQA 1DE1A 2B3SA 1GL8A 1B4QA 2YOIA 2O8VB 2PERA 2O89A 3N5OA 1TRVA 2LTKA 6GSTA 2DKHA 3D22A 4ZBAA 1SL1B 4HDEA 3GL5A 3D4TA 4MK3A 4TRXA 2ALBA 1AUCA 2KHPA 2YWIA 5IIZA 5DVBA 1ZYNA 2WDUA 2DKIA 5FT3A 3ED3A 5ECMB 2X8CA 3GA4A 4KNDA 3APSA 1A8LA 3RPPA 2P5RA 2I4AA 3IC4A 5F07A 20GSA 4J2FA 3TJBA 4Z2TA 3MIXA 1TK5B 4WF5A 2B7JA 1XW9A 1QXHA 4F9ZA 4ZL9A 1J9BA 1Z7PA 3IHQA 2YZHA 3D6IA 1WWJA 3F63A 2AB6A 3EE2A 3IK9A 4GQCA 4ZBDA 4K2DA 4F2IA 1QQ2A 3HJMA 1GSSA 4MPFA 3H8QA 1GSFA 4XS1A 1YEXA 2CX4A 3GTUB 4J57E 1GH2A 3C71A 5KEJA 3KD0A 5ECRB 1HYUA 3LFLA 4MJCA 3N9JA 19GSA 4K9ZA 4KH7A 5CRGA 2FY6A 3GTUA 1H75A 3O76A 1V58A 4L0UA 3K8NA 5ECHB 4NAXA 3RDWA 4V2MA 2KUCA 1LU4A 2FWEA 1VF4A 1B9XC 1FB6A 2DJ0A 5HR2A 3W6GA 2VL3A 3ME7A 6GSWA 4TVEA 2F8FA 4ILFA 1M99A 4CY8A 4GWRA 4Q5QA 4K8MA 4DVCA 5IMDA 3QOUA 2IWTA 3GHAA 1SL2B 4WBJA 1EZKA 3CTFA 3MSZA 2JADA 2OBIA 4JE1A 5D9XA 3ZRDA 5D8IA 1OC8A 2L4CA 3CTGA 4JBBA 4OO5A 3ME8A 2H19A 1XFLA 5G1LA 3SBCA 3VI7A 2C0GA 2CT6A 3A2VA 2AUVA 2V2GA 4HJ2A 1PMTA 1OVNA 2DBCA 1EWXA 4X1UA 2H6ZA 5B6NA 4GSSA 3GSSA 1G6WA 5B6MA 4EE0A 3F0IA 1S3DA 3GH6A 3FHKA 1QK8A 2YWMA 2VOCA 3P2AA 4BPYA 4I2UA 2REMA 2RM6A 5KOXA 2NPBA 2CVKA 1GNEA 4L5OA 4CY6A 3U5RE 4NHWA 4USSA 2LQOA 4F03A 1GULA 3CRUA 2VCTA 1AQXA 3VWVA 3FR9A 3VFIA 3TKSA 4OFMA 2YV9A 1THXA 3GRXA 1A2LA 3C8EA 3IAS2 3Q6OA 2M72A 4JRRA 5A4VA 3GKKA 2DJ1A 4IELA 3KMOA 4BA7A 4YKGA 4XCSA 5ECNB 2C3TA 5DALB 4HZ4A 2LRNA 1ZZYA 1GUKA 1A0RP 2LNTA 2WULA 3KIJA 4IW9A 3QFAC 4MH3A 1GSYA 1O8WA 4KDUA 1X9SB 5DALA 5ECIB 3IE3A 1WE0A 2C8UA 3FZ5A 4FYCA 3ZYWA 2MZCA 4FYUA 1J08A 2HFDA 4MJEA 4Z2RA 2GTUA 2GSRA 2YV7A 4TR1B 2FGXA 1O81A 3TJGA 1MDIA 2HZEB 4XRAA 1AXDA 3LW9A 2A2PA 1QUWA 2DJ2A 5H5SA 4TR1A 4HU7A 1SL0B 3LEFA 5ECSA 4BVXB 2HZEA 3D0ZA 3UBLA 1A24A 2V6KA 2VCVA 1RQMA 1SKSB 3RHCA 1FO5A 3VK9A 1ERWA 1XWAA 5IMAA 2VD1A 3H79A 4NHZA 1XWBA 5CNWA 4BVXA 2WJUA 2LS5A 1XWGA 1V9WA 5CRWA 2H71A 1ERVA 2EIRA 5FWGA 1ZYQB 3G7JA 5JWRB 5JCWA 1TRWA 2RUFA 3M8NA 1H4OA 3HY2A 2KOKA 1SD9A 1V57A 4V1Ag 4OCEA 1F3AA 1FW1A 1SJ6A 4NV2A 5B8AA 5DBQA 3EU4A 1AAZA 3ERFA 4ACSA 5IMCA 1M9AA 2I3YA 1OYJA 4Q5FA 4IJIA 3ZTLA 2OE3A 2E0QA 1RW1A 1EV4A 2L4QA 5CO3A 2HRKA 5INYA 4AJ6A 3VLNA 2YP6A 3D5JA 1OC3A 6GSUA 2OA7A 3G9BA 2B6MA 2D2ZA 2CX3A 3P90A 2ES7A 1HD2A 4X4JA 3VI5A 2H0HA 4N30A 1U87A 1PL2A 1WPIA 3QFBC 1WIKA 2J23A 3WT1A 1W89A 3D4MA 3E3EA 1TI3A 2OJLA 1Q98A 1PQNA 4PXOA 1K0MA 3I69A 2X8HA 1GRXA 1Y25A 2R0PA 1XWKA 3ERWA 5AGYA 3LWAA 1SU9A 2GLRA 4EO3A 1K3LA 5JWOB 1OAZA 5B7CA 4EIPA 4PQ1A 3M0FA 2IMFA 3KTBA 2H66A 4Z2UA 3UAPA 2WB9A 11GSA 2H1GA 4LMWA 5E4WA 1NW2A 5L71A 1BQ7A 2X64A 1TKDB 2H0GA 5J4UA 1K0CA 1SENA 3G7YA 2VCXA 3TJJA 1ST9A 4FIWA 2YNXA 3C73A 2CZ2A 5DJLA 2LQQA 3LORA 3BJ5A 4AGSA 3PGTA 4KF9A 3M1GA 2B1LA 4PUFC 4WXTA 1K3YA 5ID2A 2R0CA 2FWFA 2EIOA 1K0NA 2B7KA 4XHMA 3FK8A 2LRCA 1YY7A 5ECOB 3ISOA 3TJKA 2AV4A 6GSSA 5JCGA 1IYHA 2VCQA 3QMXA 4MCUA 1QGVA 4KGIA 3M3MA 5H5QA 1T4YA 2C80A 4RI6A 3EWLA 3TUEA 3F8UA 3KEBA 4I2TA 4ZL7A 2VM2A 4MNNA 1PA3A 2MMOA 2L57A 2TRCP 3DVXA 1PKWA 5D93A 2RM5A 3RPNA 2QKEA 4MMMA 2N5FA 2H8LA 2AYTA 5KN1A 3EC3A 3HZ4A 1UVZA 4KA0A 2VLTA 13GSA 4MPGA 5IOXA 2FA8A 4AJ7A 4G0IA 1PD21 2LNSA 3VPTA 2FHEA 1E2YA 1E6BA 4IBPA 1PN9A 1GTAA 4MDCA 2CV4A 3CRTA 3MNGA 1XCCA 1B4PA 4WETA 4DSRA 5DAKA 1ABAA 5A5KA 4KUNA 4F0CA 3KH7A 2DLXA 1ILOA 4RQRA 2K18A 2XBQA 3IOSA 3EVIA 2FNOA 4L5LA 1TRSA 3Q19A 3VURA 3IPZA 4BVYA 5CRHA 2JSYA 2XPEA 3J7Yk 3IR4A 4TR4A 2KLXA 4YAVA 5A4WA 1SKRB 4LLRA 1XBSA 2YANA 1XWCA 4WBRD 2CAIA 1PX6A 2Z9SA 3PR8A 2DJ3A 1YZXA 1WP0A 1EEMA 3ZREA 4HEA2 5J5NA 4POMA 4HQZA 3L4NA 2YN1A 3L9SA 1TI1A 2I1UA 1XVWA 5E59A 3TCOA 3CXGA 4WR4A 4NPBA 2GSTA 3DVWA 1FHEA 4BWQA 3HVXA 2IPAA 4PGTA 1AQVA 2PUKC 4FO5A 4MZBA 4O5UA 2B5XA 2GSQA 1LJRA 1FVJA 1GP1A 2XC2A 2IJYA 2GSSA 1YDKA 3KCMA 4NXIA 1DBYA 5F0GA 3M9JA 2OKAA 3VWXA 5DCHA 2JZRA 4K5RA 2E2MA 5BRTA 3U6VA 1Z5YE 1M2BA 1ZMAA 4BWSA 5LNKe 2NTOA 3R2QA 1JHBA 2ON7A 2F3MA 4TW5A 1AW9A 2V32A 2KP2A 3FZAA 1MTCA 3HCZA 3TKSE 2K6VA 4O5QA 1PSQA 3P8WA 4N11A 5J9CA 4FH8A 5CREA 4ZB6A 1UA5A 1PN0A 3GNJA 4KSOA 2PGTA 1X0RA 3GV1A 4DSSB 2CA8A 2X99A 3QCPA 5AN1A 5CRDA 1MD4A 2BJXA 4N0VA 1NHYA 1EP8A 3ZVJD 2C0FA 4EXJA 2JL4A 2G2QA 3O3TA 4DSSA 1GUHA 4L0WA 2FD3A 2R0GA 4ZBBA 3A2WA 2DC5A 1X5EA 1X9WB 3UL3A 5H5RA 4F82A 4N10A 4K0GA 2M46A 2XPDA 3IHGA 2E2GA 1THOA 4IKHA 2GQLA 4K5SA 3GSTA 5AIVA 5IM9A 1PGTA 2FWGA 1UC7A 5EPFA 1TK8B 1MDJA 4KCAA 5HR1A 1GTBA 1XOAA 2QA2A 1BYEA 4RI7A 1M2DA 4IP1A 3UIWA 1OC9B 2YCDA 1KNGA 1QMVA 4Z7XA 1R5PA 4HU9A 1XW5A 3DGQA 2OE0A 3AY8A 3DIEA 2O7KA 1CQGA 3ZMLA 2B5YA 3KH9A 1LBKA 1OC9A 2V1MA 5IMFA 4LL4B 3LSZA 5IOWA 1FOVA 3TDGA 2R5GA 3TRXA 2EC4A 1O73A 2MMAA 9GSSA 4AJ8A 1HNBA 3QD9A 2HSYA 3KGKA 1F2EA 1Z6MA 2GS3A 1U6TA 2FCHA 3NOFA 3Q74A 2WGRA 4CDOA 2B5EA 1VGLA 3CSIA 1XW6A 2QA1A 1A2MA 1U3AA 4YQVA 4G2EA 1YQ1A 4I5QA 4QQ7A 2JACA 3IBHA 3M9KA 2IFQA 4ICYA 3ZLPA 4MA9A 2IN3A 3UMAA 2VLVA 1ZOFA 1O85A 3CSHA 3GKNA 2BMXA 5GZZB 2NDOA 1N2AA 3TRQA 5KOWA 5B8BA 4PNFA 3ZL5A 1JFUA 5IMZA 3EU3A 3NZNA 10GSA 2PN8A 3HYPA 5G2ZA 3O6TA 5D96A 3LGCA 4ZB8A 3DWVA 1TTZA 1I5GA 1YEPA 3C7MA 4TKYA 4TN8A 3LXTA 1ON4A 4IQAA 5JCUA 3MWHA 3HJOA 1Q4JA 2VL2C 3GX8A 2DSAA 2HNLA 1T3BA 5ELGA 1TDIA 1FVKA 3IV4A 2GT5A 1GUMA 3FZ9A 4Q5NA 5DDLA 1VF2A 2GGTA 1XPVA 5EVOA 4CHSA 1O8XA 2R4VA 2H1DA 4POLA 3EYTA 4MF7A 2PPTA 4A5PA 1X9MB 1DE2A 4G19A 3WYWA 3BOAA 1O6JA 1AQWA 1CQHA 3FZ4A 2HRNA 4G0KA 2UZ8A 5A4UA 5G1KA 4GXZA 5G31A 2K9FA 5HR0A 4YAPA 3KMNA 2YPMA 2C3QA 2L5LA 2PWJA 1SK2A 5CAXA 1GSEA 3IDVA 1EV9A 4ECJA 4POKA 3EMXA 4IJ3A 2LUSA 4H86A 4V1Ap 2YZUA 4JR6A 2H1BA 3CSJA 3GH9A 2EIQA 3TRPA 5IMVA 2LJKA 4TR0A 5ENUA 3F3QA 3BD2A 1Z7RA 4WKWA 1A2JA 5C00A 1JZRA 2FA4A 5KN3A 4L8EA 1VRSD 1EGRA 1YF0A 3L9UA 4XS4A 3L78A 3PH9A 2RUEA 3TKRA 2H1AA 1MD3A 4OD7A 2H01A 3LYKA 5F05A 5HFGA 1Y6EA 2HYXA 4EC0A 2F8AA 2MBTA 16GSA 5ID2B 1Z9HA 1G6YA 5IPHA 4K1FA 2CQ9A 3CYNA 4O5RA 3DD3A 2ZCTA 4K7NA 4KCEA 2HSHA 2QC7A 3H1NA 4QL9A 2K8VA 3GKXA 3FYGA 1SYXA 4KW6A 4ML1A 2X4AA 2MMZA 3QAGA 5G5FA 1XVQA 3BCIA 2MMNA 2O85A 2WRTA 4PUAA 2H76A 3RAZA 1SD8A 4KX4A 4BL7A 18GSA 2MBSA 1G7EA 3LXZA 3FKFA 5COHA 1F6MC 2JZSA 4GTUA 4YKFA 2X49A 3HHVA 4HI7A 3UVHA 3UOMA 3GYKA 2VL9A 1A0FA 3QAWA 4MH2A 4V2NA 2H6XA 5D9TA 14GSA 3I6AA 2A2RA 3F9UA 4GCIA 4EDYA 1YJ6A 3FMWA 2F9SA 2HRAA 5D73A 4RQXA 3C1RA 4X43A 2YWOA 4V2LA 1TW9A 4IP6A 1R7HA 2GZPA 1B9YC 4KAEA 3GIXA 2NBSA 3ZIVA 5DAKB 3MDKA 3DMLA 3VWWA 2ZNMA 4EUYA 2QGVA 2A2SA 1TOFA 1XZOA 2H74A 3H93A 3LYPA 3JCML 1ACVA 5IPGA 2HZFA 3APQA 1YKAA 4K7IA 3HZ8A 3ZIJA 1T7PB 2C4JA 3ZFLA 4BVYB 2IMEA 1ML6A 3OR5A 3KXOA 4O92A 2LEGA 1UN2A 5AIXA 2E7PA 1M9BA 3EINA 2TIRA 5C04A 1GLPA 1S3CA 1SK1A 4ZL8A 1SKWB 5IQYA 3FR6A 1T4ZA 1ZCPA 3WGEA 1K0AA 4I97A 2V6OA 1F9MA 3HDCA 4ID0A 3KJYA 4JR4A 2VLUA 3PPUA 3C1SA 1T00A 3WT2A 2GT6A 4OFNA 3UJ1A 2CVBA 2CVDA 3ZZXA 3A5WA 3EMPA 5AISA 2R2JA 4GSNA 2HE3A 4EIQA 2P5QA 4G10A 1JZWA 3TGZA 2IMKA 5J9BA 3UVTA 2TRXA 4MJBA 1JLWA 3V1WA 1BJXA 1ZYEA 3F4TA 3FEUA 2LJRA 1C72A 3PINA 3RHBA 1WOUA 1GTUA 4F0BA 4O7HA 3QDNA 3ZMKA 5EL8A 3KP9A 1V98A 4ECCA 5J3RA 3G7IA 5LD0A 2P31A 1JZDA 1M7TA 1TP9A 5GSSA 2DMLA 1SJIA 4J56E 4RUVA 4WEYA 5HR3A 2R6KA 2V41A 5LCZA 2HRFA 4DSQA 4LL1B 2L59A 3F6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3Y B;  1M2A A;  1K3O A;  2R37 A;  1GTI A;  1GSU A;  4I6X A;  4MZW A;  3BBY A;  1G7O A;  1XXU A;  5ELA A;  4XS6 A;  3QAV A;  2X8G A;  3DEX A;  2YJH A;  3F4R A;  5IO0 A;  2IMI A;  1AC1 A;  4WF4 A;  1PRX A;  1ZGN A;  4TXO B;  1J0F A;  3E0U A;  2HI7 A;  2VM1 A;  1PL1 A;  1S3A A;  2QSI A;  2LJA A;  3J7Y b;  3D21 A;  2F51 A;  4TXO A;  5HFK A;  3W8S A;  2CZ3 A;  4ZB9 A;  2PBJ A;  1OE7 A;  3TOU A;  3HD5 A;  2B1K A;  2JZT A;  3L0H A;  5CP1 A;  3GX0 A;  2C3N A;  2L6C A;  4EVM A;  2A4V A;  1OE8 A;  2GVP A;  4X0X A;  4HZ2 A;  4JU5 A;  4EF0 A;  2C1Y A;  3UEM A;  2LRT A;  3ZVJ A;  3NIV A;  1ERU A;  3IRA A;  2DIZ A;  4HUA A;  1MEK A;  3LJR A;  2C0E A;  3GUR A;  4Q5R A;  2H70 A;  4LA1 A;  3F4S A;  3GKM A;  2M80 A;  1NM3 A;  2K8S A;  3HVS A;  3E9J B;  4JZQ A;  4N0Z A;  5JWQ B;  2N5B A;  3DYR A;  2KP1 A;  1NSW A;  3EUR A;  1TXX A;  3I9V 2;  1XIY A;  3DRN A;  2GDR A;  2OAD A;  4OFT A;  1FG4 A;  4IN0 A;  1M0U A;  1KEB A;  6GSV A;  4GRF A;  3SWL A;  2H75 A;  3IXR A;  3TKS C;  2GQM A;  1G0T A;  2DMM A;  4KSM A;  3QPM A;  1TRU A;  2WZ9 A;  3I43 A;  5DQS A;  2O87 A;  1VF1 A;  3W8J A;  1OKT A;  4ZXG A;  4AF2 A;  2IFQ B;  1R26 A;  3KTL A;  1K0O A;  2ZUP A;  2FWH A;  5DQY A;  1JZO A;  4NMU A;  3GN3 A;  3DXB A;  3TJF A;  4MF6 A;  3RBT A;  5F06 A;  4WR5 A;  4KE3 A;  4O32 A;  5HFI A;  1PKZ A;  4MAB A;  1TU7 A;  2DJK A;  2H72 A;  2RII A;  2DIY A;  5KN2 A;  2LST A;  3A3T A;  4IHU A;  4GLT A;  1V40 A;  2HT9 A;  4KB3 A;  5DJM A;  5HQP A;  4TOP A;  4D73 B;  3GMF A;  2GZZ A;  1OKD A;  4QL7 A;  1W4V A;  3FR3 A;  1SJZ A;  1GWC A;  2ON5 A;  1SYR A;  3F6F A;  2VL2 A;  5ECL B;  4D73 A;  6GSX A;  5GAP D;  4PNG A;  4MF5 A;  1DUG A;  1XOB A;  4EL1 A;  2FUG 2;  3CBU A;  2JU5 A;  1X5C A;  1T1V A;  4MP4 A;  3ERG A;  4OO4 A;  3UAR A;  4G9H A;  4YH2 A;  5ABR A;  3HVV A;  4XTS A;  3ZIT A;  1K0D A;  4YQM A;  1ERT A;  1GSD A;  2OE1 A;  1V2A A;  1TK0 B;  4ZIJ A;  4CW9 A;  3TKP A;  3US3 A;  2H73 A;  1PX7 A;  1VF3 A;  3WGX A;  1GLQ A;  4IS0 A;  1EOG A;  1KBN A;  1R4W A;  1YKC A;  3FRC A;  2PU9 C;  1GSQ A;  4JED A;  3HKR A;  2CAQ A;  2GQK A;  4ISD A;  3VWU A;  4OMV A;  4IGJ A;  2VIM A;  4HQS A;  3BCK A;  4GF0 A;  4HJM A;  1K0B A;  3L9V A;  4EKZ A;  1IYI A;  1F3B A;  1YF1 A;  2LKU A;  4ZIL A;  1NHO A;  2PVQ A;  1FAA A;  1WMJ A;  4TR3 A;  4XRD A;  2VO4 A;  4YQU A;  1O7U A;  3QR6 A;  5GAN D;  5D9W A;  4XS4 B;  3IK7 A;  3KP8 A;  4ML6 A;  3F3R A;  1A23 A;  2N5A A;  6GSY A;  2HXK A;  1U3I A;  1GNW A;  2WS2 A;  3CMI A;  1EOH A;  5DCG A;  2VUP A;  1EEJ A;  3APO A;  2XHF A;  1AIU A;  3KM6 A;  1ZL9 A;  4LMV A;  2VCZ A;  1R5A A;  3H4K A;  2OAC A;  2PMT A;  1B48 A;  2H0I A;  5ECK B;  3DKS A;  8GSS A;  5ECP B;  2P0G A;  5EY6 A;  2LV3 A;  2VCW A;  12GS A;  2PVO C;  4MZC A;  1B8X A;  4HOJ A;  2WCI A;  2GZY A;  3IAM 2;  5F8B A;  3GFK A;  3HXS A;  1MDK A;  4PUR A;  5GST A;  5KN0 A;  2NVL A;  2VAF A;  2I9H A;  5J41 A;  1Z6N A;  2L5O A;  1T8E B;  3HA9 A;  4MJA A;  1KTE A;  1BAY A;  3GL3 A;  1DSB A;  2IMD A;  4NV5 A;  3P7X A;  2FLS A;  1USB A;  3GUS A;  2OBK A;  1I9D A;  5G30 A;  1F37 A;  2YWN A;  3LG6 A;  4HS1 A;  3S9F A;  5FHI A;  2J9H A;  1EP7 A;  3VPQ A;  3HJP A;  4MLY A;  17GS A;  3TOT A;  2HLS A;  2WFC A;  3MAK A;  4OWY A;  4I8B A;  2R3X A;  3FY7 A;  4GQF A;  1QFN A;  3ZFB A;  2BTO T;  2JSZ A;  1RK4 A;  2VD0 A;  2XBI A;  5CYY A;  3Q18 A;  3WGD A;  1BG5 A;  4IVF A;  1FB0 A;  4XIH A;  2IL3 A;  2MYG A;  3FW2 A;  1JLV A;  4DEJ A;  2AJQ B;  4GST A;  1WRY A;  2YJ7 A;  1HNC A;  4E8E A;  2RLI A;  3LQ7 A;  1BX9 A;  4ECB A;  5ECQ B;  2DJJ A;  3A2X A;  1URM A;  1Z3E A;  4PQI A;  3TB2 A;  4K6X A;  2I81 A;  2C0D A;  3IA1 A;  4IQ1 A;  1HNA A;  4KDX A;  2IIY A;  4KDY A;  22GS A;  4PQH A;  4EDZ A;  4OCF A;  4POB A;  4ULX A;  1WJK A;  4K7O A;  2G0F A;  1A8Y A;  4K0N A;  2L6D A;  3WD6 A;  4E8H A;  7GSS A;  4TXV A;  5G5E A;  1TU8 A;  1HQO A;  2H6Y A;  4PX1 A;  1TJD A;  4FYB A;  5D9V A;  1SK0 A;  3KZQ A;  4NWY A;  5IO2 A;  2H30 A;  1U88 A;  1EGO A;  2AAW A;  1N8J A;  1BED A;  2AHE A;  1X5D A;  3UBK A;  4ECI A;  3TKQ A;  1DE1 A;  2B3S A;  1GL8 A;  1B4Q A;  2YOI A;  2O8V B;  2PER A;  2O89 A;  3N5O A;  1TRV A;  2LTK A;  6GST A;  3D22 A;  4ZBA A;  1SL1 B;  4HDE A;  3GL5 A;  3D4T A;  4MK3 A;  4TRX A;  2ALB A;  1AUC A;  2KHP A;  2YWI A;  5IIZ A;  5DVB A;  2WDU A;  5FT3 A;  3ED3 A;  5ECM B;  2X8C A;  3GA4 A;  4KND A;  3APS A;  1A8L A;  3RPP A;  2P5R A;  2I4A A;  3IC4 A;  5F07 A;  20GS A;  4J2F A;  3TJB A;  1TK5 B;  4WF5 A;  2B7J A;  1XW9 A;  1QXH A;  4F9Z A;  4ZL9 A;  1J9B A;  1Z7P A;  3IHQ A;  2YZH A;  3D6I A;  1WWJ A;  3F63 A;  2AB6 A;  3EE2 A;  3IK9 A;  4GQC A;  4ZBD A;  4K2D A;  4F2I A;  1QQ2 A;  3HJM A;  1GSS A;  4MPF A;  3H8Q A;  1GSF A;  4XS1 A;  1YEX A;  2CX4 A;  3GTU B;  4J57 E;  1GH2 A;  3C71 A;  5KEJ A;  3KD0 A;  5ECR B;  1HYU A;  3LFL A;  4MJC A;  3N9J A;  19GS A;  4K9Z A;  4KH7 A;  5CRG A;  2FY6 A;  3GTU A;  1H75 A;  3O76 A;  1V58 A;  4L0U A;  3K8N A;  5ECH B;  4NAX A;  3RDW A;  4V2M A;  2KUC A;  1LU4 A;  2FWE A;  1VF4 A;  1B9X C;  1FB6 A;  2DJ0 A;  5HR2 A;  3W6G A;  2VL3 A;  3ME7 A;  6GSW A;  4TVE A;  2F8F A;  4ILF A;  1M99 A;  4GWR A;  4Q5Q A;  4K8M A;  4DVC A;  5IMD A;  3QOU A;  2IWT A;  3GHA A;  1SL2 B;  4WBJ A;  1EZK A;  3CTF A;  3MSZ A;  2JAD A;  2OBI A;  4JE1 A;  5D9X A;  3ZRD A;  5D8I A;  1OC8 A;  2L4C A;  3CTG A;  4JBB A;  4OO5 A;  3ME8 A;  2H19 A;  1XFL A;  5G1L A;  3SBC A;  3VI7 A;  2C0G A;  2CT6 A;  3A2V A;  2AUV A;  2V2G A;  4HJ2 A;  1PMT A;  1OVN A;  2DBC A;  1EWX A;  4X1U A;  2H6Z A;  5B6N A;  4GSS A;  3GSS A;  1G6W A;  5B6M A;  4EE0 A;  3F0I A;  1S3D A;  3GH6 A;  3FHK A;  1QK8 A;  2YWM A;  2VOC A;  3P2A A;  4BPY A;  4I2U A;  2REM A;  2RM6 A;  2NPB A;  2CVK A;  1GNE A;  4L5O A;  3U5R E;  4NHW A;  2LQO A;  4F03 A;  1GUL A;  3CRU A;  2VCT A;  1AQX A;  3VWV A;  3FR9 A;  3VFI A;  3TKS A;  4OFM A;  2YV9 A;  1THX A;  3GRX A;  1A2L A;  3C8E A;  3IAS 2;  3Q6O A;  2M72 A;  4JRR A;  5A4V A;  3GKK A;  2DJ1 A;  4IEL A;  3KMO A;  4BA7 A;  4XCS A;  5ECN B;  2C3T A;  5DAL B;  4HZ4 A;  2LRN A;  1ZZY A;  1GUK A;  1A0R P;  2LNT A;  2WUL A;  3KIJ A;  4IW9 A;  3QFA C;  4MH3 A;  1GSY A;  1O8W A;  4KDU A;  1X9S B;  5DAL A;  5ECI B;  3IE3 A;  1WE0 A;  2C8U A;  3FZ5 A;  4FYC A;  3ZYW A;  2MZC A;  4FYU A;  1J08 A;  2HFD A;  4MJE A;  2GTU A;  2GSR A;  2YV7 A;  4TR1 B;  2FGX A;  1O81 A;  3TJG A;  1MDI A;  2HZE B;  4XRA A;  1AXD A;  1QUW A;  2DJ2 A;  5H5S A;  4TR1 A;  4HU7 A;  1SL0 B;  3LEF A;  5ECS A;  2HZE A;  3D0Z A;  3UBL A;  1A24 A;  2V6K A;  2VCV A;  1RQM A;  1SKS B;  3RHC A;  1FO5 A;  3VK9 A;  1ERW A;  1XWA A;  5IMA A;  2VD1 A;  3H79 A;  4NHZ A;  1XWB A;  5CNW A;  4BVX A;  2WJU A;  2LS5 A;  1XWG A;  1V9W A;  5CRW A;  2H71 A;  1ERV A;  2EIR A;  5FWG A;  1ZYQ B;  3G7J A;  5JWR B;  5JCW A;  1TRW A;  2RUF A;  3M8N A;  1H4O A;  3HY2 A;  2KOK A;  1SD9 A;  1V57 A;  4V1A g;  4OCE A;  1F3A A;  1FW1 A;  1SJ6 A;  4NV2 A;  5B8A A;  5DBQ A;  3EU4 A;  1AAZ A;  3ERF A;  4ACS A;  5IMC A;  1M9A A;  2I3Y A;  1OYJ A;  4Q5F A;  4IJI A;  3ZTL A;  2OE3 A;  2E0Q A;  1RW1 A;  1EV4 A;  2L4Q A;  5CO3 A;  5INY A;  4AJ6 A;  3VLN A;  2YP6 A;  3D5J A;  1OC3 A;  6GSU A;  2OA7 A;  3G9B A;  2B6M A;  2D2Z A;  2CX3 A;  3P90 A;  2ES7 A;  1HD2 A;  3VI5 A;  2H0H A;  4N30 A;  1U87 A;  1PL2 A;  1WPI A;  3QFB C;  1WIK A;  2J23 A;  3WT1 A;  1W89 A;  3D4M A;  3E3E A;  1TI3 A;  2OJL A;  1Q98 A;  1PQN A;  4PXO A;  1K0M A;  3I69 A;  2X8H A;  1GRX A;  1Y25 A;  1XWK A;  3ERW A;  5AGY A;  3LWA A;  1SU9 A;  2GLR A;  4EO3 A;  1K3L A;  5JWO B;  1OAZ A;  5B7C A;  4PQ1 A;  3M0F A;  2IMF A;  3KTB A;  2H66 A;  3UAP A;  2WB9 A;  11GS A;  2H1G A;  4LMW A;  5E4W A;  1NW2 A;  5L71 A;  1BQ7 A;  2X64 A;  1TKD B;  2H0G A;  5J4U A;  1K0C A;  1SEN A;  3G7Y A;  2VCX A;  3TJJ A;  1ST9 A;  4FIW A;  2YNX A;  3C73 A;  2CZ2 A;  5DJL A;  2LQQ A;  3LOR A;  3BJ5 A;  4AGS A;  3PGT A;  3M1G A;  2B1L A;  4PUF C;  4WXT A;  1K3Y A;  5ID2 A;  2FWF A;  2EIO A;  1K0N A;  2B7K A;  4XHM A;  3FK8 A;  2LRC A;  1YY7 A;  5ECO B;  3ISO A;  3TJK A;  2AV4 A;  6GSS A;  5JCG A;  1IYH A;  2VCQ A;  3QMX A;  4MCU A;  1QGV A;  4KGI A;  3M3M A;  5H5Q A;  1T4Y A;  2C80 A;  4RI6 A;  3EWL A;  3TUE A;  3F8U A;  3KEB A;  4I2T A;  4ZL7 A;  2VM2 A;  1PA3 A;  2MMO A;  2L57 A;  2TRC P;  3DVX A;  1PKW A;  5D93 A;  2RM5 A;  3RPN A;  2QKE A;  4MMM A;  2N5F A;  2H8L A;  2AYT A;  5KN1 A;  3EC3 A;  3HZ4 A;  1UVZ A;  4KA0 A;  2VLT A;  13GS A;  4MPG A;  5IOX A;  2FA8 A;  4AJ7 A;  1PD2 1;  2LNS A;  3VPT A;  2FHE A;  1E2Y A;  1E6B A;  4IBP A;  1PN9 A;  1GTA A;  4MDC A;  2CV4 A;  3CRT A;  3MNG A;  1XCC A;  1B4P A;  4WET A;  4DSR A;  5DAK A;  1ABA A;  5A5K A;  4KUN A;  4F0C A;  3KH7 A;  2DLX A;  1ILO A;  4RQR A;  2K18 A;  2XBQ A;  3IOS A;  3EVI A;  2FNO A;  4L5L A;  1TRS A;  3Q19 A;  3VUR A;  3IPZ A;  4BVY A;  5CRH A;  2JSY A;  2XPE A;  3J7Y k;  3IR4 A;  4TR4 A;  2KLX A;  4YAV A;  5A4W A;  1SKR B;  4LLR A;  1XBS A;  2YAN A;  1XWC A;  4WBR D;  2CAI A;  1PX6 A;  2Z9S A;  3PR8 A;  2DJ3 A;  1YZX A;  1WP0 A;  1EEM A;  3ZRE A;  4HEA 2;  5J5N A;  4POM A;  4HQZ A;  3L4N A;  2YN1 A;  3L9S A;  1TI1 A;  2I1U A;  1XVW A;  5E59 A;  3TCO A;  3CXG A;  4WR4 A;  4NPB A;  2GST A;  3DVW A;  1FHE A;  4BWQ A;  3HVX A;  2IPA A;  4PGT A;  1AQV A;  2PUK C;  4FO5 A;  4MZB A;  2B5X A;  2GSQ A;  1LJR A;  1FVJ A;  1GP1 A;  2XC2 A;  2IJY A;  2GSS A;  1YDK A;  3KCM A;  4NXI A;  1DBY A;  5F0G A;  3M9J A;  2OKA A;  3VWX A;  5DCH A;  2JZR A;  2E2M A;  3U6V A;  1Z5Y E;  1M2B A;  1ZMA A;  4BWS A;  5LNK e;  2NTO A;  3R2Q A;  1JHB A;  2ON7 A;  2F3M A;  4TW5 A;  1AW9 A;  2V32 A;  2KP2 A;  3FZA A;  1MTC A;  3HCZ A;  3TKS E;  2K6V A;  1PSQ A;  3P8W A;  4N11 A;  5J9C A;  4FH8 A;  5CRE A;  4ZB6 A;  1UA5 A;  3GNJ A;  4KSO A;  2PGT A;  1X0R A;  3GV1 A;  4DSS B;  2CA8 A;  2X99 A;  3QCP A;  5AN1 A;  5CRD A;  1MD4 A;  2BJX A;  4N0V A;  1NHY A;  1EP8 A;  3ZVJ D;  2C0F A;  4EXJ A;  2JL4 A;  2G2Q A;  3O3T A;  4DSS A;  1GUH A;  4L0W A;  2FD3 A;  4ZBB A;  3A2W A;  2DC5 A;  1X5E A;  1X9W B;  3UL3 A;  5H5R A;  4F82 A;  4N10 A;  4K0G A;  2M46 A;  2XPD A;  2E2G A;  1THO A;  4IKH A;  2GQL A;  3GST A;  5AIV A;  5IM9 A;  1PGT A;  2FWG A;  1UC7 A;  5EPF A;  1TK8 B;  1MDJ A;  4KCA A;  5HR1 A;  1GTB A;  1XOA A;  1BYE A;  4RI7 A;  1M2D A;  4IP1 A;  3UIW A;  1OC9 B;  2YCD A;  1KNG A;  1QMV A;  4Z7X A;  1R5P A;  4HU9 A;  1XW5 A;  3DGQ A;  2OE0 A;  3AY8 A;  3DIE A;  2O7K A;  1CQG A;  3ZML A;  2B5Y A;  3KH9 A;  1LBK A;  1OC9 A;  2V1M A;  5IMF A;  4LL4 B;  3LSZ A;  5IOW A;  1FOV A;  3TDG A;  2R5G A;  3TRX A;  2EC4 A;  1O73 A;  2MMA A;  9GSS A;  4AJ8 A;  1HNB A;  3QD9 A;  2HSY A;  3KGK A;  1F2E A;  1Z6M A;  2GS3 A;  1U6T A;  2FCH A;  3NOF A;  3Q74 A;  2WGR A;  4CDO A;  2B5E A;  1VGL A;  3CSI A;  1XW6 A;  1A2M A;  1U3A A;  4YQV A;  4G2E A;  1YQ1 A;  4I5Q A;  4QQ7 A;  2JAC A;  3IBH A;  3M9K A;  2IFQ A;  3ZLP A;  4MA9 A;  2IN3 A;  3UMA A;  2VLV A;  1ZOF A;  1O85 A;  3CSH A;  3GKN A;  2BMX A;  5GZZ B;  2NDO A;  1N2A A;  3TRQ A;  5B8B A;  4PNF A;  3ZL5 A;  1JFU A;  5IMZ A;  3EU3 A;  3NZN A;  10GS A;  2PN8 A;  3HYP A;  5G2Z A;  3O6T A;  5D96 A;  3LGC A;  4ZB8 A;  3DWV A;  1TTZ A;  1I5G A;  1YEP A;  3C7M A;  4TKY A;  4TN8 A;  3LXT A;  1ON4 A;  4IQA A;  5JCU A;  3MWH A;  3HJO A;  1Q4J A;  2VL2 C;  3GX8 A;  2DSA A;  2HNL A;  1T3B A;  5ELG A;  1TDI A;  1FVK A;  3IV4 A;  2GT5 A;  1GUM A;  3FZ9 A;  4Q5N A;  5DDL A;  1VF2 A;  2GGT A;  1XPV A;  5EVO A;  4CHS A;  1O8X A;  2R4V A;  2H1D A;  4POL A;  3EYT A;  4MF7 A;  2PPT A;  1X9M B;  1DE2 A;  4G19 A;  3WYW A;  3BOA A;  1O6J A;  1AQW A;  1CQH A;  3FZ4 A;  2HRN A;  5A4U A;  5G1K A;  4GXZ A;  5G31 A;  2K9F A;  5HR0 A;  4YAP A;  3KMN A;  2YPM A;  2C3Q A;  2L5L A;  2PWJ A;  1SK2 A;  5CAX A;  1GSE A;  3IDV A;  1EV9 A;  4ECJ A;  4POK A;  3EMX A;  4IJ3 A;  2LUS A;  4H86 A;  4V1A p;  2YZU A;  4JR6 A;  2H1B A;  3CSJ A;  3GH9 A;  2EIQ A;  3TRP A;  5IMV A;  2LJK A;  4TR0 A;  5ENU A;  3F3Q A;  3BD2 A;  1Z7R A;  4WKW A;  1A2J A;  5C00 A;  1JZR A;  2FA4 A;  5KN3 A;  4L8E A;  1VRS D;  1EGR A;  1YF0 A;  3L9U A;  4XS4 A;  3L78 A;  3PH9 A;  2RUE A;  3TKR A;  2H1A A;  1MD3 A;  4OD7 A;  2H01 A;  3LYK A;  5F05 A;  5HFG A;  1Y6E A;  2HYX A;  4EC0 A;  2F8A A;  2MBT A;  16GS A;  5ID2 B;  1Z9H A;  1G6Y A;  5IPH A;  4K1F A;  2CQ9 A;  3CYN A;  4O5R A;  3DD3 A;  2ZCT A;  4K7N A;  4KCE A;  2HSH A;  2QC7 A;  3H1N A;  4QL9 A;  2K8V A;  3GKX A;  3FYG A;  1SYX A;  4KW6 A;  4ML1 A;  2MMZ A;  3QAG A;  5G5F A;  1XVQ A;  3BCI A;  2MMN A;  2O85 A;  2WRT A;  4PUA A;  2H76 A;  3RAZ A;  1SD8 A;  4KX4 A;  4BL7 A;  18GS A;  2MBS A;  1G7E A;  3LXZ A;  3FKF A;  5COH A;  1F6M C;  2JZS A;  4GTU A;  3HHV A;  4HI7 A;  3UVH A;  3UOM A;  3GYK A;  2VL9 A;  1A0F A;  3QAW A;  4MH2 A;  4V2N A;  2H6X A;  5D9T A;  14GS A;  3I6A A;  2A2R A;  3F9U A;  4GCI A;  4EDY A;  1YJ6 A;  2F9S A;  5D73 A;  4RQX A;  3C1R A;  4X43 A;  2YWO A;  4V2L A;  1TW9 A;  4IP6 A;  1R7H A;  2GZP A;  1B9Y C;  4KAE A;  3GIX A;  2NBS A;  3ZIV A;  5DAK B;  3MDK A;  3DML A;  3VWW A;  2ZNM A;  4EUY A;  2QGV A;  2A2S A;  1TOF A;  1XZO A;  2H74 A;  3H93 A;  3LYP A;  3JCM L;  1ACV A;  5IPG A;  2HZF A;  3APQ A;  1YKA A;  4K7I A;  3HZ8 A;  3ZIJ A;  1T7P B;  2C4J A;  3ZFL A;  2IME A;  1ML6 A;  3OR5 A;  3KXO A;  4O92 A;  2LEG A;  1UN2 A;  5AIX A;  2E7P A;  1M9B A;  3EIN A;  2TIR A;  5C04 A;  1GLP A;  1S3C A;  1SK1 A;  4ZL8 A;  1SKW B;  5IQY A;  3FR6 A;  1T4Z A;  1ZCP A;  3WGE A;  1K0A A;  4I97 A;  2V6O A;  1F9M A;  3HDC A;  4ID0 A;  3KJY A;  4JR4 A;  2VLU A;  3C1S A;  1T00 A;  3WT2 A;  2GT6 A;  4OFN A;  3UJ1 A;  2CVB A;  2CVD A;  3ZZX A;  3A5W A;  3EMP A;  5AIS A;  2R2J A;  4GSN A;  2HE3 A;  2P5Q A;  4G10 A;  1JZW A;  3TGZ A;  2IMK A;  5J9B A;  3UVT A;  2TRX A;  4MJB A;  1JLW A;  3V1W A;  1BJX A;  1ZYE A;  3F4T A;  3FEU A;  2LJR A;  1C72 A;  3PIN A;  3RHB A;  1WOU A;  1GTU A;  4F0B A;  4O7H A;  3QDN A;  3ZMK A;  5EL8 A;  3KP9 A;  1V98 A;  4ECC A;  5J3R A;  3G7I A;  5LD0 A;  2P31 A;  1JZD A;  1M7T A;  1TP9 A;  5GSS A;  2DML A;  1SJI A;  4J56 E;  4RUV A;  4WEY A;  5HR3 A;  2R6K A;  2V41 A;  5LCZ A;  2HRF A;  4DSQ A;  4LL1 B;  2L59 A;  3F6D A; 
#chains in the Genus database with same CATH topology
 4P3Y B;  1M2A A;  1K3O A;  2R37 A;  1GTI A;  1GSU A;  4I6X A;  4MZW A;  3BBY A;  1G7O A;  1XXU A;  5ELA A;  4XS6 A;  3QAV A;  2X8G A;  3DEX A;  2YJH A;  3F4R A;  5IO0 A;  2IMI A;  1AC1 A;  4WF4 A;  1PRX A;  1ZGN A;  4TXO B;  1J0F A;  3E0U A;  2HI7 A;  2VM1 A;  1PL1 A;  1S3A A;  2QSI A;  2LJA A;  3J7Y b;  3D21 A;  2F51 A;  4TXO A;  5HFK A;  3W8S A;  2CZ3 A;  4ZB9 A;  2PBJ A;  1OE7 A;  3TOU A;  3HD5 A;  2B1K A;  2JZT A;  3L0H A;  5CP1 A;  3GX0 A;  2C3N A;  2L6C A;  4EVM A;  2A4V A;  1OE8 A;  2GVP A;  4X0X A;  4HZ2 A;  4BIK A;  4JU5 A;  4EF0 A;  2C1Y A;  3UEM A;  2LRT A;  3ZVJ A;  3NIV A;  1ERU A;  3IRA A;  2DIZ A;  4HUA A;  1MEK A;  3LJR A;  2C0E A;  3GUR A;  4Q5R A;  2H70 A;  4LA1 A;  1ZYP A;  3F4S A;  3GKM A;  2M80 A;  1NM3 A;  2K8S A;  3HVS A;  3E9J B;  4JZQ A;  4N0Z A;  5JWQ B;  2N5B A;  3DYR A;  2KP1 A;  1NSW A;  3EUR A;  1TXX A;  3I9V 2;  3R3E A;  1XIY A;  3DRN A;  2GDR A;  2OAD A;  4OFT A;  1FG4 A;  4IN0 A;  1M0U A;  1KEB A;  6GSV A;  4GRF A;  3SWL A;  2H75 A;  3IXR A;  3TKS C;  2GQM A;  1G0T A;  2DMM A;  4KSM A;  3QPM A;  1TRU A;  2WZ9 A;  3I43 A;  5DQS A;  2O87 A;  1VF1 A;  3W8J A;  1OKT A;  4ZXG A;  4AF2 A;  2IFQ B;  1R26 A;  3KTL A;  1K0O A;  2ZUP A;  2FWH A;  5DQY A;  1JZO A;  4NMU A;  3GN3 A;  3DXB A;  3TJF A;  4MF6 A;  3RBT A;  5F06 A;  4WR5 A;  4KE3 A;  4O32 A;  5HFI A;  1PKZ A;  4MAB A;  1TU7 A;  2DJK A;  2H72 A;  2RII A;  2DIY A;  2A4H A;  5KN2 A;  2LST A;  3A3T A;  4IHU A;  4GLT A;  1V40 A;  2HT9 A;  4KB3 A;  5DJM A;  5HQP A;  4TOP A;  4D73 B;  3GMF A;  2GZZ A;  1OKD A;  4QL7 A;  1W4V A;  3FR3 A;  1SJZ A;  1GWC A;  2ON5 A;  1SYR A;  3F6F A;  2VL2 A;  5ECL B;  4D73 A;  6GSX A;  5GAP D;  4PNG A;  4MF5 A;  1DUG A;  1XOB A;  4EL1 A;  2FUG 2;  3CBU A;  2JU5 A;  1X5C A;  1T1V A;  4MP4 A;  3ERG A;  4OO4 A;  3UAR A;  4G9H A;  4YH2 A;  5ABR A;  3HVV A;  4XTS A;  3ZIT A;  1K0D A;  4YQM A;  1ERT A;  1GSD A;  4FQU A;  2OE1 A;  1V2A A;  1TK0 B;  4ZIJ A;  4CW9 A;  3TKP A;  3US3 A;  2H73 A;  1PX7 A;  1VF3 A;  1FOH A;  2HSM A;  3WGX A;  1GLQ A;  4IS0 A;  1EOG A;  1KBN A;  1R4W A;  1YKC A;  3IC8 A;  3FRC A;  2PU9 C;  1GSQ A;  4JED A;  3HKR A;  2CAQ A;  2GQK A;  4ISD A;  3VWU A;  4OMV A;  4IGJ A;  2VIM A;  4HQS A;  3BCK A;  4GF0 A;  4HJM A;  1K0B A;  3L9V A;  4EKZ A;  1IYI A;  1F3B A;  1YF1 A;  2LKU A;  3EPT A;  4ZIL A;  1NHO A;  2PVQ A;  1FAA A;  1WMJ A;  3MYD A;  4G0L A;  4TR3 A;  4XRD A;  2VO4 A;  4YQU A;  1O7U A;  3QR6 A;  5GAN D;  5D9W A;  4XS4 B;  3IK7 A;  3KP8 A;  4ML6 A;  3F3R A;  1A23 A;  2N5A A;  6GSY A;  2HXK A;  1U3I A;  1GNW A;  2WS2 A;  3CMI A;  1EOH A;  5DCG A;  2VUP A;  1EEJ A;  3APO A;  2XHF A;  1AIU A;  3KM6 A;  1ZL9 A;  4LMV A;  2VCZ A;  1R5A A;  3H4K A;  2OAC A;  2PMT A;  1B48 A;  2H0I A;  1M3I A;  5ECK B;  3DKS A;  8GSS A;  5ECP B;  2P0G A;  5EY6 A;  2LV3 A;  2VCW A;  12GS A;  2PVO C;  4MZC A;  1B8X A;  4HOJ A;  2WCI A;  2GZY A;  3IAM 2;  5F8B A;  3GFK A;  3HXS A;  1MDK A;  4PUR A;  5GST A;  5KN0 A;  2NVL A;  2VAF A;  2I9H A;  5J41 A;  1Z6N A;  2L5O A;  1T8E B;  3HA9 A;  4MJA A;  4BL7 B;  1KTE A;  1BAY A;  3GL3 A;  1DSB A;  4K2X A;  2IMD A;  4NV5 A;  3P7X A;  2FLS A;  1USB A;  3GUS A;  2OBK A;  1I9D A;  5G30 A;  1F37 A;  2YWN A;  3LG6 A;  4HS1 A;  3S9F A;  5FHI A;  2J9H A;  1EP7 A;  3VPQ A;  3HJP A;  4MLY A;  17GS A;  3TOT A;  2HLS A;  2WFC A;  3MAK A;  4OWY A;  4I8B A;  2R3X A;  3FY7 A;  4GQF A;  1QFN A;  3ZFB A;  2BTO T;  2JSZ A;  1RK4 A;  2VD0 A;  2XBI A;  5BMU A;  5CYY A;  3Q18 A;  3WGD A;  1BG5 A;  4IVF A;  1FB0 A;  4XIH A;  2IL3 A;  2MYG A;  3FW2 A;  1JLV A;  4DEJ A;  2AJQ B;  4GST A;  1WRY A;  2YJ7 A;  1HNC A;  4E8E A;  2RLI A;  3LQ7 A;  1BX9 A;  4ECB A;  5ECQ B;  2DJJ A;  3A2X A;  1URM A;  1Z3E A;  4PQI A;  3TB2 A;  4K6X A;  2I81 A;  2C0D A;  3IA1 A;  4IQ1 A;  1HNA A;  4KDX A;  2IIY A;  4KDY A;  22GS A;  4PQH A;  4EDZ A;  4OCF A;  4POB A;  4ULX A;  1WJK A;  4K7O A;  2G0F A;  1A8Y A;  4K0N A;  2L6D A;  3WD6 A;  4E8H A;  7GSS A;  4PTS A;  4TXV A;  5G5E A;  1TU8 A;  1HQO A;  2H6Y A;  4PX1 A;  1TJD A;  4FYB A;  5D9V A;  1SK0 A;  3KZQ A;  4NWY A;  5IO2 A;  2H30 A;  1U88 A;  1EGO A;  2AAW A;  1N8J A;  1BED A;  2AHE A;  1X5D A;  3UBK A;  3A5I A;  4ECI A;  3TKQ A;  1DE1 A;  2B3S A;  1GL8 A;  1B4Q A;  2YOI A;  2O8V B;  2PER A;  2O89 A;  3N5O A;  1TRV A;  2LTK A;  6GST A;  2DKH A;  3D22 A;  1M3J A;  4ZBA A;  1SL1 B;  4HDE A;  3GL5 A;  3D4T A;  4MK3 A;  4TRX A;  2ALB A;  1AUC A;  2KHP A;  2YWI A;  5IIZ A;  5DVB A;  1ZYN A;  2WDU A;  2DKI A;  5FT3 A;  3ED3 A;  5ECM B;  2X8C A;  3GA4 A;  4KND A;  3APS A;  1A8L A;  3RPP A;  2P5R A;  2I4A A;  3IC4 A;  5F07 A;  20GS A;  4J2F A;  3TJB A;  4Z2T A;  3MIX A;  1TK5 B;  4WF5 A;  2B7J A;  1XW9 A;  1QXH A;  4F9Z A;  4ZL9 A;  1J9B A;  1Z7P A;  3IHQ A;  2YZH A;  3D6I A;  1WWJ A;  3F63 A;  2AB6 A;  3EE2 A;  3IK9 A;  4GQC A;  4ZBD A;  4K2D A;  4F2I A;  1QQ2 A;  3HJM A;  1GSS A;  4MPF A;  3H8Q A;  1GSF A;  4XS1 A;  1YEX A;  2CX4 A;  3GTU B;  4J57 E;  1GH2 A;  3C71 A;  5KEJ A;  3KD0 A;  5ECR B;  1HYU A;  3LFL A;  4MJC A;  3N9J A;  19GS A;  4K9Z A;  4KH7 A;  5CRG A;  2FY6 A;  3GTU A;  1H75 A;  3O76 A;  1V58 A;  4L0U A;  3K8N A;  5ECH B;  4NAX A;  3RDW A;  4V2M A;  2KUC A;  1LU4 A;  2FWE A;  1VF4 A;  1B9X C;  1FB6 A;  2DJ0 A;  5HR2 A;  3W6G A;  2VL3 A;  3ME7 A;  6GSW A;  4TVE A;  2F8F A;  4ILF A;  1M99 A;  4CY8 A;  4GWR A;  4Q5Q A;  4K8M A;  4DVC A;  5IMD A;  3QOU A;  2IWT A;  3GHA A;  1SL2 B;  4WBJ A;  1EZK A;  3CTF A;  3MSZ A;  2JAD A;  2OBI A;  4JE1 A;  5D9X A;  3ZRD A;  5D8I A;  1OC8 A;  2L4C A;  3CTG A;  4JBB A;  4OO5 A;  3ME8 A;  2H19 A;  1XFL A;  5G1L A;  3SBC A;  3VI7 A;  2C0G A;  2CT6 A;  3A2V A;  2AUV A;  2V2G A;  4HJ2 A;  1PMT A;  1OVN A;  2DBC A;  1EWX A;  3CQF A;  4X1U A;  2H6Z A;  5B6N A;  4GSS A;  3GSS A;  1G6W A;  5B6M A;  4EE0 A;  3F0I A;  1S3D A;  3GH6 A;  3FHK A;  1QK8 A;  2YWM A;  2VOC A;  3P2A A;  4BPY A;  4I2U A;  2REM A;  2RM6 A;  5KOX A;  2NPB A;  2CVK A;  1GNE A;  4L5O A;  4CY6 A;  3U5R E;  4NHW A;  4USS A;  2LQO A;  4F03 A;  1GUL A;  3CRU A;  2VCT A;  1AQX A;  3VWV A;  3FR9 A;  3VFI A;  3TKS A;  4OFM A;  2YV9 A;  1THX A;  3GRX A;  1A2L A;  3C8E A;  3IAS 2;  3Q6O A;  2M72 A;  4JRR A;  5A4V A;  3GKK A;  2DJ1 A;  4IEL A;  3KMO A;  4BA7 A;  4YKG A;  4XCS A;  5ECN B;  2C3T A;  5DAL B;  4HZ4 A;  2LRN A;  1ZZY A;  1GUK A;  1A0R P;  2LNT A;  2WUL A;  3KIJ A;  4IW9 A;  3QFA C;  4MH3 A;  1GSY A;  1O8W A;  4KDU A;  1X9S B;  5DAL A;  5ECI B;  3IE3 A;  1WE0 A;  2C8U A;  3FZ5 A;  4FYC A;  3ZYW A;  2MZC A;  4FYU A;  1J08 A;  2HFD A;  4MJE A;  4Z2R A;  2GTU A;  2GSR A;  2YV7 A;  4TR1 B;  2FGX A;  1O81 A;  3TJG A;  1MDI A;  2HZE B;  4XRA A;  1AXD A;  3LW9 A;  2A2P A;  1QUW A;  2DJ2 A;  5H5S A;  4TR1 A;  4HU7 A;  1SL0 B;  3LEF A;  5ECS A;  4BVX B;  2HZE A;  3D0Z A;  3UBL A;  1A24 A;  2V6K A;  2VCV A;  1RQM A;  1SKS B;  3RHC A;  1FO5 A;  3VK9 A;  1ERW A;  1XWA A;  5IMA A;  2VD1 A;  3H79 A;  4NHZ A;  1XWB A;  5CNW A;  4BVX A;  2WJU A;  2LS5 A;  1XWG A;  1V9W A;  5CRW A;  2H71 A;  1ERV A;  2EIR A;  5FWG A;  1ZYQ B;  3G7J A;  5JWR B;  5JCW A;  1TRW A;  2RUF A;  3M8N A;  1H4O A;  3HY2 A;  2KOK A;  1SD9 A;  1V57 A;  4V1A g;  4OCE A;  1F3A A;  1FW1 A;  1SJ6 A;  4NV2 A;  5B8A A;  5DBQ A;  3EU4 A;  1AAZ A;  3ERF A;  4ACS A;  5IMC A;  1M9A A;  2I3Y A;  1OYJ A;  4Q5F A;  4IJI A;  3ZTL A;  2OE3 A;  2E0Q A;  1RW1 A;  1EV4 A;  2L4Q A;  5CO3 A;  2HRK A;  5INY A;  4AJ6 A;  3VLN A;  2YP6 A;  3D5J A;  1OC3 A;  6GSU A;  2OA7 A;  3G9B A;  2B6M A;  2D2Z A;  2CX3 A;  3P90 A;  2ES7 A;  1HD2 A;  4X4J A;  3VI5 A;  2H0H A;  4N30 A;  1U87 A;  1PL2 A;  1WPI A;  3QFB C;  1WIK A;  2J23 A;  3WT1 A;  1W89 A;  3D4M A;  3E3E A;  1TI3 A;  2OJL A;  1Q98 A;  1PQN A;  4PXO A;  1K0M A;  3I69 A;  2X8H A;  1GRX A;  1Y25 A;  2R0P A;  1XWK A;  3ERW A;  5AGY A;  3LWA A;  1SU9 A;  2GLR A;  4EO3 A;  1K3L A;  5JWO B;  1OAZ A;  5B7C A;  4EIP A;  4PQ1 A;  3M0F A;  2IMF A;  3KTB A;  2H66 A;  4Z2U A;  3UAP A;  2WB9 A;  11GS A;  2H1G A;  4LMW A;  5E4W A;  1NW2 A;  5L71 A;  1BQ7 A;  2X64 A;  1TKD B;  2H0G A;  5J4U A;  1K0C A;  1SEN A;  3G7Y A;  2VCX A;  3TJJ A;  1ST9 A;  4FIW A;  2YNX A;  3C73 A;  2CZ2 A;  5DJL A;  2LQQ A;  3LOR A;  3BJ5 A;  4AGS A;  3PGT A;  4KF9 A;  3M1G A;  2B1L A;  4PUF C;  4WXT A;  1K3Y A;  5ID2 A;  2R0C A;  2FWF A;  2EIO A;  1K0N A;  2B7K A;  4XHM A;  3FK8 A;  2LRC A;  1YY7 A;  5ECO B;  3ISO A;  3TJK A;  2AV4 A;  6GSS A;  5JCG A;  1IYH A;  2VCQ A;  3QMX A;  4MCU A;  1QGV A;  4KGI A;  3M3M A;  5H5Q A;  1T4Y A;  2C80 A;  4RI6 A;  3EWL A;  3TUE A;  3F8U A;  3KEB A;  1S3R A;  4I2T A;  4ZL7 A;  2VM2 A;  4MNN A;  1PA3 A;  2MMO A;  2L57 A;  2TRC P;  3DVX A;  1PKW A;  5D93 A;  2RM5 A;  3RPN A;  2QKE A;  4MMM A;  2N5F A;  2H8L A;  2AYT A;  5KN1 A;  3EC3 A;  3HZ4 A;  1UVZ A;  4KA0 A;  2VLT A;  13GS A;  4MPG A;  5IOX A;  2FA8 A;  4AJ7 A;  4G0I A;  1PD2 1;  2LNS A;  3VPT A;  2FHE A;  1E2Y A;  1E6B A;  4IBP A;  1PN9 A;  1GTA A;  4MDC A;  2CV4 A;  3CRT A;  3MNG A;  1XCC A;  1B4P A;  4WET A;  4DSR A;  5DAK A;  1ABA A;  5A5K A;  4KUN A;  4F0C A;  3KH7 A;  2DLX A;  1ILO A;  4RQR A;  2K18 A;  2XBQ A;  3IOS A;  3EVI A;  2FNO A;  4L5L A;  1TRS A;  3Q19 A;  3VUR A;  3IPZ A;  4BVY A;  5CRH A;  2JSY A;  2XPE A;  3J7Y k;  3IR4 A;  4TR4 A;  2KLX A;  4YAV A;  5A4W A;  1SKR B;  4LLR A;  1XBS A;  2YAN A;  1XWC A;  4WBR D;  2CAI A;  1PX6 A;  2Z9S A;  3PR8 A;  2DJ3 A;  1YZX A;  1WP0 A;  1EEM A;  3ZRE A;  4HEA 2;  5J5N A;  4POM A;  4HQZ A;  3L4N A;  2YN1 A;  3L9S A;  1TI1 A;  2I1U A;  1XVW A;  5E59 A;  3TCO A;  3CXG A;  4WR4 A;  4NPB A;  2GST A;  3DVW A;  1FHE A;  4BWQ A;  3HVX A;  2IPA A;  4PGT A;  1AQV A;  2PUK C;  4FO5 A;  4MZB A;  4O5U A;  2B5X A;  2GSQ A;  1LJR A;  1FVJ A;  1GP1 A;  2XC2 A;  2IJY A;  2GSS A;  1YDK A;  3KCM A;  4NXI A;  1DBY A;  5F0G A;  3M9J A;  2OKA A;  3VWX A;  5DCH A;  2JZR A;  4K5R A;  2E2M A;  5BRT A;  3U6V A;  1Z5Y E;  1M2B A;  1ZMA A;  4BWS A;  4HSC X;  5LNK e;  2NTO A;  3R2Q A;  1JHB A;  2ON7 A;  2F3M A;  4TW5 A;  1AW9 A;  2V32 A;  2KP2 A;  3FZA A;  1MTC A;  3HCZ A;  3TKS E;  2K6V A;  4O5Q A;  1PSQ A;  3P8W A;  4N11 A;  5J9C A;  4FH8 A;  5CRE A;  4ZB6 A;  1UA5 A;  1PN0 A;  3GNJ A;  4KSO A;  2PGT A;  1X0R A;  3GV1 A;  4DSS B;  2CA8 A;  2X99 A;  3QCP A;  5AN1 A;  5CRD A;  1MD4 A;  2BJX A;  4N0V A;  1NHY A;  1EP8 A;  3ZVJ D;  2C0F A;  4EXJ A;  2JL4 A;  2G2Q A;  3O3T A;  4DSS A;  1GUH A;  4L0W A;  2FD3 A;  2R0G A;  4ZBB A;  3A2W A;  2DC5 A;  1X5E A;  1X9W B;  3UL3 A;  5H5R A;  4F82 A;  4N10 A;  4K0G A;  2M46 A;  2XPD A;  3IHG A;  2E2G A;  1THO A;  4IKH A;  2GQL A;  4K5S A;  3GST A;  5AIV A;  5IM9 A;  1PGT A;  2FWG A;  1UC7 A;  5EPF A;  1TK8 B;  1MDJ A;  4KCA A;  5HR1 A;  1GTB A;  1XOA A;  2QA2 A;  1BYE A;  4RI7 A;  1M2D A;  4IP1 A;  3UIW A;  1OC9 B;  2YCD A;  1KNG A;  1QMV A;  4Z7X A;  1R5P A;  4HU9 A;  1XW5 A;  3DGQ A;  2OE0 A;  3AY8 A;  3DIE A;  2O7K A;  1CQG A;  3ZML A;  2B5Y A;  3KH9 A;  1LBK A;  1OC9 A;  2V1M A;  5IMF A;  4LL4 B;  3LSZ A;  5IOW A;  1FOV A;  3TDG A;  2R5G A;  3TRX A;  2EC4 A;  1O73 A;  2MMA A;  9GSS A;  4AJ8 A;  1HNB A;  3QD9 A;  2HSY A;  3KGK A;  1F2E A;  1Z6M A;  2GS3 A;  1U6T A;  2FCH A;  3NOF A;  3Q74 A;  2WGR A;  4CDO A;  2B5E A;  1VGL A;  3CSI A;  1XW6 A;  2QA1 A;  1A2M A;  1U3A A;  4YQV A;  4G2E A;  1YQ1 A;  4I5Q A;  4QQ7 A;  2JAC A;  3IBH A;  3M9K A;  2IFQ A;  4ICY A;  3ZLP A;  4MA9 A;  2IN3 A;  3UMA A;  2VLV A;  1ZOF A;  1O85 A;  3CSH A;  3GKN A;  2BMX A;  5GZZ B;  2NDO A;  1N2A A;  3TRQ A;  5KOW A;  5B8B A;  4PNF A;  3ZL5 A;  1JFU A;  5IMZ A;  3EU3 A;  3NZN A;  10GS A;  2PN8 A;  3HYP A;  5G2Z A;  3O6T A;  5D96 A;  3LGC A;  4ZB8 A;  3DWV A;  1TTZ A;  1I5G A;  1YEP A;  3C7M A;  4TKY A;  4TN8 A;  3LXT A;  1ON4 A;  4IQA A;  5JCU A;  3MWH A;  3HJO A;  1Q4J A;  2VL2 C;  3GX8 A;  2DSA A;  2HNL A;  1T3B A;  5ELG A;  1TDI A;  1FVK A;  3IV4 A;  2GT5 A;  1GUM A;  3FZ9 A;  4Q5N A;  5DDL A;  1VF2 A;  2GGT A;  1XPV A;  5EVO A;  4CHS A;  1O8X A;  2R4V A;  2H1D A;  4POL A;  3EYT A;  4MF7 A;  2PPT A;  4A5P A;  1X9M B;  1DE2 A;  4G19 A;  3WYW A;  3BOA A;  1O6J A;  1AQW A;  1CQH A;  3FZ4 A;  2HRN A;  4G0K A;  2UZ8 A;  5A4U A;  5G1K A;  4GXZ A;  5G31 A;  2K9F A;  5HR0 A;  4YAP A;  3KMN A;  2YPM A;  2C3Q A;  2L5L A;  2PWJ A;  1SK2 A;  5CAX A;  1GSE A;  3IDV A;  1EV9 A;  4ECJ A;  4POK A;  3EMX A;  4IJ3 A;  2LUS A;  4H86 A;  4V1A p;  2YZU A;  4JR6 A;  2H1B A;  3CSJ A;  3GH9 A;  2EIQ A;  3TRP A;  5IMV A;  2LJK A;  4TR0 A;  5ENU A;  3F3Q A;  3BD2 A;  1Z7R A;  4WKW A;  1A2J A;  5C00 A;  1JZR A;  2FA4 A;  5KN3 A;  4L8E A;  1VRS D;  1EGR A;  1YF0 A;  3L9U A;  4XS4 A;  3L78 A;  3PH9 A;  2RUE A;  3TKR A;  2H1A A;  1MD3 A;  4OD7 A;  2H01 A;  3LYK A;  5F05 A;  5HFG A;  1Y6E A;  2HYX A;  4EC0 A;  2F8A A;  2MBT A;  16GS A;  5ID2 B;  1Z9H A;  1G6Y A;  5IPH A;  4K1F A;  2CQ9 A;  3CYN A;  4O5R A;  3DD3 A;  2ZCT A;  4K7N A;  4KCE A;  2HSH A;  2QC7 A;  3H1N A;  4QL9 A;  2K8V A;  3GKX A;  3FYG A;  1SYX A;  4KW6 A;  4ML1 A;  2X4A A;  2MMZ A;  3QAG A;  5G5F A;  1XVQ A;  3BCI A;  2MMN A;  2O85 A;  2WRT A;  4PUA A;  2H76 A;  3RAZ A;  1SD8 A;  4KX4 A;  4BL7 A;  18GS A;  2MBS A;  1G7E A;  3LXZ A;  3FKF A;  5COH A;  1F6M C;  2JZS A;  4GTU A;  4YKF A;  2X49 A;  3HHV A;  4HI7 A;  3UVH A;  3UOM A;  3GYK A;  2VL9 A;  1A0F A;  3QAW A;  4MH2 A;  4V2N A;  2H6X A;  5D9T A;  14GS A;  3I6A A;  2A2R A;  3F9U A;  4GCI A;  4EDY A;  1YJ6 A;  3FMW A;  2F9S A;  2HRA A;  5D73 A;  4RQX A;  3C1R A;  4X43 A;  2YWO A;  4V2L A;  1TW9 A;  4IP6 A;  1R7H A;  2GZP A;  1B9Y C;  4KAE A;  3GIX A;  2NBS A;  3ZIV A;  5DAK B;  3MDK A;  3DML A;  3VWW A;  2ZNM A;  4EUY A;  2QGV A;  2A2S A;  1TOF A;  1XZO A;  2H74 A;  3H93 A;  3LYP A;  3JCM L;  1ACV A;  5IPG A;  2HZF A;  3APQ A;  1YKA A;  4K7I A;  3HZ8 A;  3ZIJ A;  1T7P B;  2C4J A;  3ZFL A;  4BVY B;  2IME A;  1ML6 A;  3OR5 A;  3KXO A;  4O92 A;  1PFO A;  2LEG A;  1UN2 A;  5AIX A;  2E7P A;  1M9B A;  3EIN A;  2TIR A;  5C04 A;  1GLP A;  1S3C A;  1SK1 A;  4ZL8 A;  1SKW B;  5IQY A;  3FR6 A;  1T4Z A;  1ZCP A;  3WGE A;  1K0A A;  4I97 A;  2V6O A;  3HVN A;  1F9M A;  3HDC A;  4ID0 A;  3KJY A;  4JR4 A;  2VLU A;  3PPU A;  3C1S A;  1T00 A;  3WT2 A;  1XG8 A;  2GT6 A;  4OFN A;  3UJ1 A;  2CVB A;  2CVD A;  3ZZX A;  3A5W A;  3EMP A;  5AIS A;  2R2J A;  4GSN A;  2HE3 A;  4EIQ A;  2P5Q A;  4G10 A;  1JZW A;  3TGZ A;  2IMK A;  5J9B A;  3UVT A;  2TRX A;  4MJB A;  1JLW A;  3V1W A;  1BJX A;  1ZYE A;  3F4T A;  3FEU A;  2LJR A;  1C72 A;  3PIN A;  3RHB A;  1WOU A;  1GTU A;  4F0B A;  4O7H A;  3QDN A;  3ZMK A;  5EL8 A;  3KP9 A;  1V98 A;  4ECC A;  5J3R A;  3G7I A;  5LD0 A;  2P31 A;  1JZD A;  1M7T A;  1TP9 A;  5GSS A;  2DML A;  1SJI A;  4J56 E;  4RUV A;  4WEY A;  5HR3 A;  2R6K A;  2V41 A;  5LCZ A;  2HRF A;  4DSQ A;  4LL1 B;  2L59 A;  3F6D A; 
#chains in the Genus database with same CATH homology
 4P3Y B;  1M2A A;  1K3O A;  2R37 A;  1GTI A;  1GSU A;  4I6X A;  4MZW A;  3BBY A;  1G7O A;  1XXU A;  5ELA A;  4XS6 A;  3QAV A;  2X8G A;  3DEX A;  2YJH A;  3F4R A;  5IO0 A;  2IMI A;  1AC1 A;  4WF4 A;  1PRX A;  1ZGN A;  4TXO B;  1J0F A;  3E0U A;  2HI7 A;  2VM1 A;  1PL1 A;  1S3A A;  2QSI A;  2LJA A;  3J7Y b;  3D21 A;  2F51 A;  4TXO A;  5HFK A;  3W8S A;  2CZ3 A;  4ZB9 A;  2PBJ A;  1OE7 A;  3TOU A;  3HD5 A;  2B1K A;  2JZT A;  3L0H A;  5CP1 A;  3GX0 A;  2C3N A;  2L6C A;  4EVM A;  2A4V A;  1OE8 A;  2GVP A;  4X0X A;  4HZ2 A;  4JU5 A;  4EF0 A;  2C1Y A;  3UEM A;  2LRT A;  3ZVJ A;  3NIV A;  1ERU A;  3IRA A;  2DIZ A;  4HUA A;  1MEK A;  3LJR A;  2C0E A;  3GUR A;  4Q5R A;  2H70 A;  4LA1 A;  1ZYP A;  3F4S A;  3GKM A;  2M80 A;  1NM3 A;  2K8S A;  3HVS A;  3E9J B;  4JZQ A;  4N0Z A;  5JWQ B;  2N5B A;  3DYR A;  2KP1 A;  1NSW A;  3EUR A;  1TXX A;  3I9V 2;  3R3E A;  1XIY A;  3DRN A;  2GDR A;  2OAD A;  4OFT A;  1FG4 A;  4IN0 A;  1M0U A;  1KEB A;  6GSV A;  4GRF A;  3SWL A;  2H75 A;  3IXR A;  3TKS C;  2GQM A;  1G0T A;  2DMM A;  4KSM A;  3QPM A;  1TRU A;  2WZ9 A;  3I43 A;  5DQS A;  2O87 A;  1VF1 A;  3W8J A;  1OKT A;  4ZXG A;  4AF2 A;  2IFQ B;  1R26 A;  3KTL A;  1K0O A;  2ZUP A;  2FWH A;  5DQY A;  1JZO A;  4NMU A;  3GN3 A;  3DXB A;  3TJF A;  4MF6 A;  3RBT A;  5F06 A;  4WR5 A;  4KE3 A;  4O32 A;  5HFI A;  1PKZ A;  4MAB A;  1TU7 A;  2DJK A;  2H72 A;  2RII A;  2DIY A;  2A4H A;  5KN2 A;  2LST A;  3A3T A;  4IHU A;  4GLT A;  1V40 A;  2HT9 A;  4KB3 A;  5DJM A;  5HQP A;  4TOP A;  4D73 B;  3GMF A;  2GZZ A;  1OKD A;  4QL7 A;  1W4V A;  3FR3 A;  1SJZ A;  1GWC A;  2ON5 A;  1SYR A;  3F6F A;  2VL2 A;  5ECL B;  4D73 A;  6GSX A;  5GAP D;  4PNG A;  4MF5 A;  1DUG A;  1XOB A;  4EL1 A;  2FUG 2;  3CBU A;  2JU5 A;  1X5C A;  1T1V A;  4MP4 A;  3ERG A;  4OO4 A;  3UAR A;  4G9H A;  4YH2 A;  5ABR A;  3HVV A;  4XTS A;  3ZIT A;  1K0D A;  4YQM A;  1ERT A;  1GSD A;  4FQU A;  2OE1 A;  1V2A A;  1TK0 B;  4ZIJ A;  4CW9 A;  3TKP A;  3US3 A;  2H73 A;  1PX7 A;  1VF3 A;  1FOH A;  2HSM A;  3WGX A;  1GLQ A;  4IS0 A;  1EOG A;  1KBN A;  1R4W A;  1YKC A;  3IC8 A;  3FRC A;  2PU9 C;  1GSQ A;  4JED A;  3HKR A;  2CAQ A;  2GQK A;  4ISD A;  3VWU A;  4OMV A;  4IGJ A;  2VIM A;  4HQS A;  3BCK A;  4GF0 A;  4HJM A;  1K0B A;  3L9V A;  4EKZ A;  1IYI A;  1F3B A;  1YF1 A;  2LKU A;  3EPT A;  4ZIL A;  1NHO A;  2PVQ A;  1FAA A;  1WMJ A;  3MYD A;  4G0L A;  4TR3 A;  4XRD A;  2VO4 A;  4YQU A;  1O7U A;  3QR6 A;  5GAN D;  5D9W A;  4XS4 B;  3IK7 A;  3KP8 A;  4ML6 A;  3F3R A;  1A23 A;  2N5A A;  6GSY A;  2HXK A;  1U3I A;  1GNW A;  2WS2 A;  3CMI A;  1EOH A;  5DCG A;  2VUP A;  1EEJ A;  3APO A;  2XHF A;  1AIU A;  3KM6 A;  1ZL9 A;  4LMV A;  2VCZ A;  1R5A A;  3H4K A;  2OAC A;  2PMT A;  1B48 A;  2H0I A;  5ECK B;  3DKS A;  8GSS A;  5ECP B;  2P0G A;  5EY6 A;  2LV3 A;  2VCW A;  12GS A;  2PVO C;  4MZC A;  1B8X A;  4HOJ A;  2WCI A;  2GZY A;  3IAM 2;  5F8B A;  3GFK A;  3HXS A;  1MDK A;  4PUR A;  5GST A;  5KN0 A;  2NVL A;  2VAF A;  2I9H A;  5J41 A;  1Z6N A;  2L5O A;  1T8E B;  3HA9 A;  4MJA A;  4BL7 B;  1KTE A;  1BAY A;  3GL3 A;  1DSB A;  4K2X A;  2IMD A;  4NV5 A;  3P7X A;  2FLS A;  1USB A;  3GUS A;  2OBK A;  1I9D A;  5G30 A;  1F37 A;  2YWN A;  3LG6 A;  4HS1 A;  3S9F A;  5FHI A;  2J9H A;  1EP7 A;  3VPQ A;  3HJP A;  4MLY A;  17GS A;  3TOT A;  2HLS A;  2WFC A;  3MAK A;  4OWY A;  4I8B A;  2R3X A;  3FY7 A;  4GQF A;  1QFN A;  3ZFB A;  2BTO T;  2JSZ A;  1RK4 A;  2VD0 A;  2XBI A;  5BMU A;  5CYY A;  3Q18 A;  3WGD A;  1BG5 A;  4IVF A;  1FB0 A;  4XIH A;  2IL3 A;  2MYG A;  3FW2 A;  1JLV A;  4DEJ A;  2AJQ B;  4GST A;  1WRY A;  2YJ7 A;  1HNC A;  4E8E A;  2RLI A;  3LQ7 A;  1BX9 A;  4ECB A;  5ECQ B;  2DJJ A;  3A2X A;  1URM A;  1Z3E A;  4PQI A;  3TB2 A;  4K6X A;  2I81 A;  2C0D A;  3IA1 A;  4IQ1 A;  1HNA A;  4KDX A;  2IIY A;  4KDY A;  22GS A;  4PQH A;  4EDZ A;  4OCF A;  4POB A;  4ULX A;  1WJK A;  4K7O A;  2G0F A;  1A8Y A;  4K0N A;  2L6D A;  3WD6 A;  4E8H A;  7GSS A;  4PTS A;  4TXV A;  5G5E A;  1TU8 A;  1HQO A;  2H6Y A;  4PX1 A;  1TJD A;  4FYB A;  5D9V A;  1SK0 A;  3KZQ A;  4NWY A;  5IO2 A;  2H30 A;  1U88 A;  1EGO A;  2AAW A;  1N8J A;  1BED A;  2AHE A;  1X5D A;  3UBK A;  3A5I A;  4ECI A;  3TKQ A;  1DE1 A;  2B3S A;  1GL8 A;  1B4Q A;  2YOI A;  2O8V B;  2PER A;  2O89 A;  3N5O A;  1TRV A;  2LTK A;  6GST A;  2DKH A;  3D22 A;  4ZBA A;  1SL1 B;  4HDE A;  3GL5 A;  3D4T A;  4MK3 A;  4TRX A;  2ALB A;  1AUC A;  2KHP A;  2YWI A;  5IIZ A;  5DVB A;  1ZYN A;  2WDU A;  2DKI A;  5FT3 A;  3ED3 A;  5ECM B;  2X8C A;  3GA4 A;  4KND A;  3APS A;  1A8L A;  3RPP A;  2P5R A;  2I4A A;  3IC4 A;  5F07 A;  20GS A;  4J2F A;  3TJB A;  4Z2T A;  3MIX A;  1TK5 B;  4WF5 A;  2B7J A;  1XW9 A;  1QXH A;  4F9Z A;  4ZL9 A;  1J9B A;  1Z7P A;  3IHQ A;  2YZH A;  3D6I A;  1WWJ A;  3F63 A;  2AB6 A;  3EE2 A;  3IK9 A;  4GQC A;  4ZBD A;  4K2D A;  4F2I A;  1QQ2 A;  3HJM A;  1GSS A;  4MPF A;  3H8Q A;  1GSF A;  4XS1 A;  1YEX A;  2CX4 A;  3GTU B;  4J57 E;  1GH2 A;  3C71 A;  5KEJ A;  3KD0 A;  5ECR B;  1HYU A;  3LFL A;  4MJC A;  3N9J A;  19GS A;  4K9Z A;  4KH7 A;  5CRG A;  2FY6 A;  3GTU A;  1H75 A;  3O76 A;  1V58 A;  4L0U A;  3K8N A;  5ECH B;  4NAX A;  3RDW A;  4V2M A;  2KUC A;  1LU4 A;  2FWE A;  1VF4 A;  1B9X C;  1FB6 A;  2DJ0 A;  5HR2 A;  3W6G A;  2VL3 A;  3ME7 A;  6GSW A;  4TVE A;  2F8F A;  4ILF A;  1M99 A;  4CY8 A;  4GWR A;  4Q5Q A;  4K8M A;  4DVC A;  5IMD A;  3QOU A;  2IWT A;  3GHA A;  1SL2 B;  4WBJ A;  1EZK A;  3CTF A;  3MSZ A;  2JAD A;  2OBI A;  4JE1 A;  5D9X A;  3ZRD A;  5D8I A;  1OC8 A;  2L4C A;  3CTG A;  4JBB A;  4OO5 A;  3ME8 A;  2H19 A;  1XFL A;  5G1L A;  3SBC A;  3VI7 A;  2C0G A;  2CT6 A;  3A2V A;  2AUV A;  2V2G A;  4HJ2 A;  1PMT A;  1OVN A;  2DBC A;  1EWX A;  4X1U A;  2H6Z A;  5B6N A;  4GSS A;  3GSS A;  1G6W A;  5B6M A;  4EE0 A;  3F0I A;  1S3D A;  3GH6 A;  3FHK A;  1QK8 A;  2YWM A;  2VOC A;  3P2A A;  4BPY A;  4I2U A;  2REM A;  2RM6 A;  5KOX A;  2NPB A;  2CVK A;  1GNE A;  4L5O A;  4CY6 A;  3U5R E;  4NHW A;  4USS A;  2LQO A;  4F03 A;  1GUL A;  3CRU A;  2VCT A;  1AQX A;  3VWV A;  3FR9 A;  3VFI A;  3TKS A;  4OFM A;  2YV9 A;  1THX A;  3GRX A;  1A2L A;  3C8E A;  3IAS 2;  3Q6O A;  2M72 A;  4JRR A;  5A4V A;  3GKK A;  2DJ1 A;  4IEL A;  3KMO A;  4BA7 A;  4YKG A;  4XCS A;  5ECN B;  2C3T A;  5DAL B;  4HZ4 A;  2LRN A;  1ZZY A;  1GUK A;  1A0R P;  2LNT A;  2WUL A;  3KIJ A;  4IW9 A;  3QFA C;  4MH3 A;  1GSY A;  1O8W A;  4KDU A;  1X9S B;  5DAL A;  5ECI B;  3IE3 A;  1WE0 A;  2C8U A;  3FZ5 A;  4FYC A;  3ZYW A;  2MZC A;  4FYU A;  1J08 A;  2HFD A;  4MJE A;  4Z2R A;  2GTU A;  2GSR A;  2YV7 A;  4TR1 B;  2FGX A;  1O81 A;  3TJG A;  1MDI A;  2HZE B;  4XRA A;  1AXD A;  3LW9 A;  2A2P A;  1QUW A;  2DJ2 A;  5H5S A;  4TR1 A;  4HU7 A;  1SL0 B;  3LEF A;  5ECS A;  4BVX B;  2HZE A;  3D0Z A;  3UBL A;  1A24 A;  2V6K A;  2VCV A;  1RQM A;  1SKS B;  3RHC A;  1FO5 A;  3VK9 A;  1ERW A;  1XWA A;  5IMA A;  2VD1 A;  3H79 A;  4NHZ A;  1XWB A;  5CNW A;  4BVX A;  2WJU A;  2LS5 A;  1XWG A;  1V9W A;  5CRW A;  2H71 A;  1ERV A;  2EIR A;  5FWG A;  1ZYQ B;  3G7J A;  5JWR B;  5JCW A;  1TRW A;  2RUF A;  3M8N A;  1H4O A;  3HY2 A;  2KOK A;  1SD9 A;  1V57 A;  4V1A g;  4OCE A;  1F3A A;  1FW1 A;  1SJ6 A;  4NV2 A;  5B8A A;  5DBQ A;  3EU4 A;  1AAZ A;  3ERF A;  4ACS A;  5IMC A;  1M9A A;  2I3Y A;  1OYJ A;  4Q5F A;  4IJI A;  3ZTL A;  2OE3 A;  2E0Q A;  1RW1 A;  1EV4 A;  2L4Q A;  5CO3 A;  2HRK A;  5INY A;  4AJ6 A;  3VLN A;  2YP6 A;  3D5J A;  1OC3 A;  6GSU A;  2OA7 A;  3G9B A;  2B6M A;  2D2Z A;  2CX3 A;  3P90 A;  2ES7 A;  1HD2 A;  4X4J A;  3VI5 A;  2H0H A;  4N30 A;  1U87 A;  1PL2 A;  1WPI A;  3QFB C;  1WIK A;  2J23 A;  3WT1 A;  1W89 A;  3D4M A;  3E3E A;  1TI3 A;  2OJL A;  1Q98 A;  1PQN A;  4PXO A;  1K0M A;  3I69 A;  2X8H A;  1GRX A;  1Y25 A;  2R0P A;  1XWK A;  3ERW A;  5AGY A;  3LWA A;  1SU9 A;  2GLR A;  4EO3 A;  1K3L A;  5JWO B;  1OAZ A;  5B7C A;  4EIP A;  4PQ1 A;  3M0F A;  2IMF A;  3KTB A;  2H66 A;  4Z2U A;  3UAP A;  2WB9 A;  11GS A;  2H1G A;  4LMW A;  5E4W A;  1NW2 A;  5L71 A;  1BQ7 A;  2X64 A;  1TKD B;  2H0G A;  5J4U A;  1K0C A;  1SEN A;  3G7Y A;  2VCX A;  3TJJ A;  1ST9 A;  4FIW A;  2YNX A;  3C73 A;  2CZ2 A;  5DJL A;  2LQQ A;  3LOR A;  3BJ5 A;  4AGS A;  3PGT A;  4KF9 A;  3M1G A;  2B1L A;  4PUF C;  4WXT A;  1K3Y A;  5ID2 A;  2R0C A;  2FWF A;  2EIO A;  1K0N A;  2B7K A;  4XHM A;  3FK8 A;  2LRC A;  1YY7 A;  5ECO B;  3ISO A;  3TJK A;  2AV4 A;  6GSS A;  5JCG A;  1IYH A;  2VCQ A;  3QMX A;  4MCU A;  1QGV A;  4KGI A;  3M3M A;  5H5Q A;  1T4Y A;  2C80 A;  4RI6 A;  3EWL A;  3TUE A;  3F8U A;  3KEB A;  4I2T A;  4ZL7 A;  2VM2 A;  4MNN A;  1PA3 A;  2MMO A;  2L57 A;  2TRC P;  3DVX A;  1PKW A;  5D93 A;  2RM5 A;  3RPN A;  2QKE A;  4MMM A;  2N5F A;  2H8L A;  2AYT A;  5KN1 A;  3EC3 A;  3HZ4 A;  1UVZ A;  4KA0 A;  2VLT A;  13GS A;  4MPG A;  5IOX A;  2FA8 A;  4AJ7 A;  4G0I A;  1PD2 1;  2LNS A;  3VPT A;  2FHE A;  1E2Y A;  1E6B A;  4IBP A;  1PN9 A;  1GTA A;  4MDC A;  2CV4 A;  3CRT A;  3MNG A;  1XCC A;  1B4P A;  4WET A;  4DSR A;  5DAK A;  1ABA A;  5A5K A;  4KUN A;  4F0C A;  3KH7 A;  2DLX A;  1ILO A;  4RQR A;  2K18 A;  2XBQ A;  3IOS A;  3EVI A;  2FNO A;  4L5L A;  1TRS A;  3Q19 A;  3VUR A;  3IPZ A;  4BVY A;  5CRH A;  2JSY A;  2XPE A;  3J7Y k;  3IR4 A;  4TR4 A;  2KLX A;  4YAV A;  5A4W A;  1SKR B;  4LLR A;  1XBS A;  2YAN A;  1XWC A;  4WBR D;  2CAI A;  1PX6 A;  2Z9S A;  3PR8 A;  2DJ3 A;  1YZX A;  1WP0 A;  1EEM A;  3ZRE A;  4HEA 2;  5J5N A;  4POM A;  4HQZ A;  3L4N A;  2YN1 A;  3L9S A;  1TI1 A;  2I1U A;  1XVW A;  5E59 A;  3TCO A;  3CXG A;  4WR4 A;  4NPB A;  2GST A;  3DVW A;  1FHE A;  4BWQ A;  3HVX A;  2IPA A;  4PGT A;  1AQV A;  2PUK C;  4FO5 A;  4MZB A;  4O5U A;  2B5X A;  2GSQ A;  1LJR A;  1FVJ A;  1GP1 A;  2XC2 A;  2IJY A;  2GSS A;  1YDK A;  3KCM A;  4NXI A;  1DBY A;  5F0G A;  3M9J A;  2OKA A;  3VWX A;  5DCH A;  2JZR A;  4K5R A;  2E2M A;  5BRT A;  3U6V A;  1Z5Y E;  1M2B A;  1ZMA A;  4BWS A;  5LNK e;  2NTO A;  3R2Q A;  1JHB A;  2ON7 A;  2F3M A;  4TW5 A;  1AW9 A;  2V32 A;  2KP2 A;  3FZA A;  1MTC A;  3HCZ A;  3TKS E;  2K6V A;  4O5Q A;  1PSQ A;  3P8W A;  4N11 A;  5J9C A;  4FH8 A;  5CRE A;  4ZB6 A;  1UA5 A;  1PN0 A;  3GNJ A;  4KSO A;  2PGT A;  1X0R A;  3GV1 A;  4DSS B;  2CA8 A;  2X99 A;  3QCP A;  5AN1 A;  5CRD A;  1MD4 A;  2BJX A;  4N0V A;  1NHY A;  1EP8 A;  3ZVJ D;  2C0F A;  4EXJ A;  2JL4 A;  2G2Q A;  3O3T A;  4DSS A;  1GUH A;  4L0W A;  2FD3 A;  2R0G A;  4ZBB A;  3A2W A;  2DC5 A;  1X5E A;  1X9W B;  3UL3 A;  5H5R A;  4F82 A;  4N10 A;  4K0G A;  2M46 A;  2XPD A;  3IHG A;  2E2G A;  1THO A;  4IKH A;  2GQL A;  4K5S A;  3GST A;  5AIV A;  5IM9 A;  1PGT A;  2FWG A;  1UC7 A;  5EPF A;  1TK8 B;  1MDJ A;  4KCA A;  5HR1 A;  1GTB A;  1XOA A;  2QA2 A;  1BYE A;  4RI7 A;  1M2D A;  4IP1 A;  3UIW A;  1OC9 B;  2YCD A;  1KNG A;  1QMV A;  4Z7X A;  1R5P A;  4HU9 A;  1XW5 A;  3DGQ A;  2OE0 A;  3AY8 A;  3DIE A;  2O7K A;  1CQG A;  3ZML A;  2B5Y A;  3KH9 A;  1LBK A;  1OC9 A;  2V1M A;  5IMF A;  4LL4 B;  3LSZ A;  5IOW A;  1FOV A;  3TDG A;  2R5G A;  3TRX A;  2EC4 A;  1O73 A;  2MMA A;  9GSS A;  4AJ8 A;  1HNB A;  3QD9 A;  2HSY A;  3KGK A;  1F2E A;  1Z6M A;  2GS3 A;  1U6T A;  2FCH A;  3NOF A;  3Q74 A;  2WGR A;  4CDO A;  2B5E A;  1VGL A;  3CSI A;  1XW6 A;  2QA1 A;  1A2M A;  1U3A A;  4YQV A;  4G2E A;  1YQ1 A;  4I5Q A;  4QQ7 A;  2JAC A;  3IBH A;  3M9K A;  2IFQ A;  4ICY A;  3ZLP A;  4MA9 A;  2IN3 A;  3UMA A;  2VLV A;  1ZOF A;  1O85 A;  3CSH A;  3GKN A;  2BMX A;  5GZZ B;  2NDO A;  1N2A A;  3TRQ A;  5KOW A;  5B8B A;  4PNF A;  3ZL5 A;  1JFU A;  5IMZ A;  3EU3 A;  3NZN A;  10GS A;  2PN8 A;  3HYP A;  5G2Z A;  3O6T A;  5D96 A;  3LGC A;  4ZB8 A;  3DWV A;  1TTZ A;  1I5G A;  1YEP A;  3C7M A;  4TKY A;  4TN8 A;  3LXT A;  1ON4 A;  4IQA A;  5JCU A;  3MWH A;  3HJO A;  1Q4J A;  2VL2 C;  3GX8 A;  2DSA A;  2HNL A;  1T3B A;  5ELG A;  1TDI A;  1FVK A;  3IV4 A;  2GT5 A;  1GUM A;  3FZ9 A;  4Q5N A;  5DDL A;  1VF2 A;  2GGT A;  1XPV A;  5EVO A;  4CHS A;  1O8X A;  2R4V A;  2H1D A;  4POL A;  3EYT A;  4MF7 A;  2PPT A;  4A5P A;  1X9M B;  1DE2 A;  4G19 A;  3WYW A;  3BOA A;  1O6J A;  1AQW A;  1CQH A;  3FZ4 A;  2HRN A;  4G0K A;  2UZ8 A;  5A4U A;  5G1K A;  4GXZ A;  5G31 A;  2K9F A;  5HR0 A;  4YAP A;  3KMN A;  2YPM A;  2C3Q A;  2L5L A;  2PWJ A;  1SK2 A;  5CAX A;  1GSE A;  3IDV A;  1EV9 A;  4ECJ A;  4POK A;  3EMX A;  4IJ3 A;  2LUS A;  4H86 A;  4V1A p;  2YZU A;  4JR6 A;  2H1B A;  3CSJ A;  3GH9 A;  2EIQ A;  3TRP A;  5IMV A;  2LJK A;  4TR0 A;  5ENU A;  3F3Q A;  3BD2 A;  1Z7R A;  4WKW A;  1A2J A;  5C00 A;  1JZR A;  2FA4 A;  5KN3 A;  4L8E A;  1VRS D;  1EGR A;  1YF0 A;  3L9U A;  4XS4 A;  3L78 A;  3PH9 A;  2RUE A;  3TKR A;  2H1A A;  1MD3 A;  4OD7 A;  2H01 A;  3LYK A;  5F05 A;  5HFG A;  1Y6E A;  2HYX A;  4EC0 A;  2F8A A;  2MBT A;  16GS A;  5ID2 B;  1Z9H A;  1G6Y A;  5IPH A;  4K1F A;  2CQ9 A;  3CYN A;  4O5R A;  3DD3 A;  2ZCT A;  4K7N A;  4KCE A;  2HSH A;  2QC7 A;  3H1N A;  4QL9 A;  2K8V A;  3GKX A;  3FYG A;  1SYX A;  4KW6 A;  4ML1 A;  2X4A A;  2MMZ A;  3QAG A;  5G5F A;  1XVQ A;  3BCI A;  2MMN A;  2O85 A;  2WRT A;  4PUA A;  2H76 A;  3RAZ A;  1SD8 A;  4KX4 A;  4BL7 A;  18GS A;  2MBS A;  1G7E A;  3LXZ A;  3FKF A;  5COH A;  1F6M C;  2JZS A;  4GTU A;  4YKF A;  2X49 A;  3HHV A;  4HI7 A;  3UVH A;  3UOM A;  3GYK A;  2VL9 A;  1A0F A;  3QAW A;  4MH2 A;  4V2N A;  2H6X A;  5D9T A;  14GS A;  3I6A A;  2A2R A;  3F9U A;  4GCI A;  4EDY A;  1YJ6 A;  3FMW A;  2F9S A;  2HRA A;  5D73 A;  4RQX A;  3C1R A;  4X43 A;  2YWO A;  4V2L A;  1TW9 A;  4IP6 A;  1R7H A;  2GZP A;  1B9Y C;  4KAE A;  3GIX A;  2NBS A;  3ZIV A;  5DAK B;  3MDK A;  3DML A;  3VWW A;  2ZNM A;  4EUY A;  2QGV A;  2A2S A;  1TOF A;  1XZO A;  2H74 A;  3H93 A;  3LYP A;  3JCM L;  1ACV A;  5IPG A;  2HZF A;  3APQ A;  1YKA A;  4K7I A;  3HZ8 A;  3ZIJ A;  1T7P B;  2C4J A;  3ZFL A;  4BVY B;  2IME A;  1ML6 A;  3OR5 A;  3KXO A;  4O92 A;  2LEG A;  1UN2 A;  5AIX A;  2E7P A;  1M9B A;  3EIN A;  2TIR A;  5C04 A;  1GLP A;  1S3C A;  1SK1 A;  4ZL8 A;  1SKW B;  5IQY A;  3FR6 A;  1T4Z A;  1ZCP A;  3WGE A;  1K0A A;  4I97 A;  2V6O A;  1F9M A;  3HDC A;  4ID0 A;  3KJY A;  4JR4 A;  2VLU A;  3PPU A;  3C1S A;  1T00 A;  3WT2 A;  2GT6 A;  4OFN A;  3UJ1 A;  2CVB A;  2CVD A;  3ZZX A;  3A5W A;  3EMP A;  5AIS A;  2R2J A;  4GSN A;  2HE3 A;  4EIQ A;  2P5Q A;  4G10 A;  1JZW A;  3TGZ A;  2IMK A;  5J9B A;  3UVT A;  2TRX A;  4MJB A;  1JLW A;  3V1W A;  1BJX A;  1ZYE A;  3F4T A;  3FEU A;  2LJR A;  1C72 A;  3PIN A;  3RHB A;  1WOU A;  1GTU A;  4F0B A;  4O7H A;  3QDN A;  3ZMK A;  5EL8 A;  3KP9 A;  1V98 A;  4ECC A;  5J3R A;  3G7I A;  5LD0 A;  2P31 A;  1JZD A;  1M7T A;  1TP9 A;  5GSS A;  2DML A;  1SJI A;  4J56 E;  4RUV A;  4WEY A;  5HR3 A;  2R6K A;  2V41 A;  5LCZ A;  2HRF A;  4DSQ A;  4LL1 B;  2L59 A;  3F6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...