4V2LA

Crystallographic structure of thioredoxin from litopenaeus vannamei: radiation damage effect at 3.4 mgy, focused in disulfide bonds.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Crystallographic Studies Evidencing the High Energy Tolerance to Disrupting the Interface Disulfide Bond of Thioredoxin 1 from White Leg Shrimp Litopenaeus Vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 35
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4v2lA00
4K7NA 1KTEA 11GSA 4LA1A 2YANA 2B7JA 1SYRA 3GTUA 1GWCA 1I9DA 3UVHA 3KGKA 4EL1A 4N0ZA 4HZ2A 1ZCPA 3KEBA 2QC7A 3GKMA 4OO5A 4X0XA 4MJEA 1F37A 2LTKA 4TW5A 2WDUA 4QQ7A 2CZ2A 2P0GA 5C04A 1B4PA 1QUWA 4KAEA 3TKSE 2H19A 4ZB9A 4MLYA 4MF6A 2OACA 3J7Yk 1YZXA 1TW9A 1DBYA 3TKSA 3ZZXA 1A8LA 1UC7A 2CVDA 3ME8A 1YEPA 2M80A 4XS1A 1PA3A 2C3QA 3UAPA 1SL1B 3GTUB 5AIVA 3FR9A 4WETA 3APOA 4BWSA 1YKAA 1GLQA 2HYXA 2LJKA 1Y6EA 1JZRA 3MSZA 1TI1A 1VRSD 1RQMA 2X8HA 3CSHA 4ZIJA 3QFAC 1AXDA 18GSA 1GLPA 10GSA 3WD6A 1R4WA 3IE3A 3BCIA 1EZKA 2VD1A 2LRCA 2LNSA 2PUKC 3H79A 3EU3A 5F06A 2AB6A 3IHQA 4YAPA 5DCHA 1PD21 3A3TA 2L4CA 5B7CA 3C1SA 1EP7A 1V58A 2N5BA 5G31A 2GTUA 4EF0A 2VL9A 4TR3A 1ERTA 3I9V2 1SJZA 5ECMB 3MNGA 3LYKA 4DEJA 1MDJA 3SWLA 1WWJA 3UJ1A 3VURA 1Z7PA 1BEDA 2YJHA 1GH2A 2KP1A 5IMFA 1TU8A 2D2ZA 1Z6NA 4IKHA 4HU7A 3AY8A 1B48A 1X5DA 1A2LA 3G7JA 4XS6A 3H4KA 3D5JA 2REMA 2AAWA 4WEYA 4FYCA 4G2EA 5JWOB 1B4QA 3U6VA 3FY7A 2WCIA 3FR3A 4F2IA 2HE3A 1MDIA 2H73A 1XOBA 2HT9A 6GSYA 3VWXA 5G1LA 4ML1A 2F51A 4MJCA 2E2GA 3IK7A 1Q98A 4N11A 5DJMA 2L6DA 5ECPB 1T00A 1MTCA 4KE3A 5CREA 4LL4B 2HSYA 1NHYA 4G19A 5H5SA 1ZZYA 3F6DA 3GSTA 3QAVA 4HQSA 3TJFA 3TJBA 2H75A 3DRNA 4FIWA 1SL2B 3CRTA 2JSYA 1SJ6A 5EL8A 3HVVA 2H1AA 3D4TA 3IR4A 2MZCA 5HR0A 4HQZA 5D93A 3KZQA 2CQ9A 4NV5A 1A0FA 4TR0A 3U5RE 1TTZA 3V1WA 1CQGA 4ECBA 2GQMA 3IDVA 4F0CA 2Z9SA 2GGTA 3TKRA 1G0TA 5DBQA 2C1YA 1PKZA 2LSTA 2V41A 5IOXA 1ZGNA 2PPTA 1B9YC 1ABAA 2IMIA 1SJIA 4POLA 3GFKA 1N2AA 3DVXA 1V9WA 1ZMAA 3ERWA 4CDOA 5J41A 1FG4A 1ERUA 5DJLA 3IAM2 2G2QA 4DVCA 1PRXA 5D96A 3F3QA 2FD3A 2V32A 2C4JA 4AJ6A 3I6AA 2M46A 3FZ5A 5IO2A 5L71A 1G6YA 2FGXA 2C0EA 1BX9A 2VLTA 1VF1A 4BWQA 4JZQA 1PL1A 3FW2A 1XOAA 4Z7XA 3GV1A 3N9JA 1GTUA 2LJRA 4O7HA 2B3SA 2B7KA 2RLIA 2GT6A 2C3TA 1K0NA 4HJMA 4N30A 1SD9A 1JLWA 4NXIA 3D4MA 2O87A 2LQQA 3A2XA 5DDLA 4K7OA 2V6KA 3UARA 4DSSA 1Y25A 2CVBA 2KLXA 5G30A 1TOFA 5CAXA 1XPVA 2VCQA 4GLTA 1K0CA 2IMFA 1WIKA 4HS1A 4LMWA 1A23A 3D21A 3IRAA 2MMAA 3GHAA 1EGRA 3H93A 4MCUA 3DEXA 4IN0A 4ISDA 4DSQA 4K2DA 4ZBBA 2XBIA 4F9ZA 5F05A 1FO5A 4MABA 2HXKA 4K0GA 2VCVA 2X99A 2VCTA 5ECLB 3HA9A 3DGQA 2GDRA 4BPYA 1QMVA 3GX8A 2FCHA 1WE0A 4JRRA 3HDCA 2GQKA 2CZ3A 3L9UA 1V40A 3W8SA 2OBKA 4L5OA 3D22A 2B1LA 4XS4A 4DSSB 2H30A 1GP1A 4RQXA 2LS5A 4TOPA 2C0GA 5KN2A 1XBSA 2WB9A 4FO5A 1K0BA 2G0FA 3P90A 3VWUA 2MMZA 4JR4A 1M9AA 4KA0A 2QKEA 4XTSA 3Q74A 1ZL9A 2GQLA 3LWAA 2L4QA 3HZ4A 3IA1A 5J3RA 2DJ1A 1QQ2A 3QAGA 1AW9A 1M2BA 2I81A 4KX4A 3QFBC 1H4OA 6GSWA 1K3LA 2OA7A 1WPIA 1DE2A 1TRUA 5B8AA 1H75A 4TKYA 3EINA 4CHSA 1V57A 3PGTA 3ZIJA 3ERFA 3L9SA 1PL2A 1YF0A 4Q5FA 1F3AA 2IL3A 2R37A 3GKXA 3TJGA 1W89A 3QCPA 5ENUA 2VOCA 4L5LA 3C1RA 2H0HA 3TUEA 1SKWB 2K8SA 4H86A 2I4AA 3F3RA 2YNXA 1FB0A 5G5EA 4TXOA 2QGVA 2YWIA 3TDGA 1I5GA 4ECIA 3M8NA 5KN3A 4OFTA 5ECNB 2K9FA 1XIYA 2H6XA 2ON7A 5IPGA 3E9JB 1PX7A 4RI6A 4IQAA 12GSA 1ON4A 2VCWA 1U6TA 3EWLA 3F4TA 2JZSA 3GL5A 1FOVA 3GRXA 4ZB8A 5IIZA 4OFMA 4IHUA 2JZTA 4D73B 4OMVA 1U88A 2VLUA 2AUVA 1OE7A 3TKSC 2YWMA 1J08A 1DUGA 3ZTLA 3H1NA 1WMJA 4EC0A 5HQPA 2C0DA 2OADA 4O32A 4TXOB 3ZMLA 1JZOA 3KD0A 4E8HA 3KM6A 5IMZA 3F8UA 2WZ9A 3F6FA 3TOTA 1THXA 3M9KA 1TP9A 2K6VA 1S3DA 2DMLA 4HJ2A 3TRQA 5DALA 1OC8A 5H5QA 5J9BA 1WRYA 2CT6A 4GQCA 2DJ2A 2PU9C 4IVFA 3RPPA 1M7TA 1WOUA 1OKDA 2CAQA 4NV2A 1ERVA 1ZOFA 2LEGA 1YJ6A 2MMNA 3IK9A 1GSUA 3GL3A 5AN1A 2HRFA 1VF2A 1T4ZA 2HRNA 2R6KA 2IMEA 1YDKA 2QSIA 3F9UA 5KN1A 2LNTA 2VCXA 1F2EA 1LJRA 2FWFA 4G9HA 2YWNA 1OE8A 1W4VA 1O8XA 5DALB 3WYWA 2I1UA 2A4VA 1DE1A 3KMOA 4PXOA 2JL4A 4MZWA 1XWAA 2I9HA 3KH9A 4IS0A 3CMIA 1GNEA 1QGVA 1TK8B 2IFQA 3C71A 5CRDA 3NOFA 4N10A 2B5YA 4PUAA 4YQMA 3LSZA 1TRVA 4KGIA 2H0GA 2YZHA 1AC1A 5GZZB 5ABRA 5J9CA 5JCWA 3O3TA 1EWXA 3Q6OA 4BVXA 5LNKe 3VPTA 5ELGA 3IXRA 4PGTA 2XHFA 5G1KA 2DIZA 3VLNA 2NVLA 8GSSA 4POKA 1C72A 3QOUA 2YV7A 3CSJA 3MDKA 4J56E 5CRWA 2IFQB 3S9FA 2H01A 1G6WA 2WRTA 2MBSA 5H5RA 4XCSA 2M72A 4GRFA 2OKAA 1PGTA 3HVSA 2ZUPA 4MPFA 4HU9A 2KP2A 4HUAA 2DSAA 1O73A 2RIIA 6GSSA 2MMOA 9GSSA 4WBJA 4MJAA 1X5EA 20GSA 4NHZA 4DSRA 4EDZA 3GIXA 1M99A 2AHEA 3HJMA 4TR1B 1BG5A 3HCZA 3BJ5A 3ZITA 1HNBA 2EIOA 4TR4A 3FHKA 2DJKA 2LRNA 2F3MA 4K1FA 4NPBA 2WJUA 5DCGA 2J23A 1V98A 4HEA2 1AIUA 2L59A 3I69A 2IJYA 1XW5A 2B1KA 3NIVA 3TJKA 3GNJA 5HR3A 4MF5A 4OCEA 3IV4A 3M9JA 4F03A 4KB3A 4CW9A 2GSTA 4V1Ap 3LEFA 2VAFA 4K6XA 1R5PA 5ECKB 3GUSA 1Z3EA 2X8CA 3L4NA 1FAAA 3DXBA 1GSSA 1XW9A 2H8LA 4HI7A 2E2MA 2LKUA 3LQ7A 4ML6A 1XWCA 4HOJA 4EDYA 3GH6A 2H6YA 2I3YA 1SKRB 4I8BA 3TCOA 1K0AA 1FB6A 3A5WA 2AJQB 1F6MC 3DMLA 5ELAA 3I43A 3VWWA 3GN3A 4LMVA 3CXGA 3G9BA 3FZ9A 2YV9A 3BCKA 3BBYA 4I97A 4XRAA 2DJJA 3EE2A 4O5RA 4I5QA 4N0VA 2VL3A 2GVPA 3CYNA 3GA4A 5E59A 4QL9A 3WT2A 2PVQA 2TRCP 4MDCA 1ERWA 1RW1A 4XIHA 3M1GA 2IMDA 1M9BA 2TRXA 4QL7A 1VF3A 4YQVA 1TI3A 4PQ1A 3ERGA 4IW9A 5IMVA 1PSQA 5KEJA 4EVMA 3FKFA 3HZ8A 1GNWA 1WJKA 4KCEA 2KHPA 5ECHB 3FK8A 2CA8A 4MMMA 4GSSA 2JZRA 1ACVA 2XPEA 1V2AA 2PVOC 3O6TA 3ZIVA 5G5FA 4J2FA 3ZVJA 1OVNA 2WULA 1TU7A 2F8FA 3UBLA 2OE1A 2C80A 1LBKA 4FYUA 2LUSA 4OO4A 5ECRB 4GSTA 4PNFA 1GULA 3GSSA 2GZPA 3L0HA 4TRXA 3FEUA 3APSA 3UBKA 2WS2A 4AJ7A 1GRXA 2F9SA 4IGJA 4IJIA 4RI7A 2OJLA 2L5LA 3CBUA 1JHBA 1SKSB 5COHA 2YJ7A 5ECQB 2DJ0A 1U3AA 1O6JA 4I6XA 5EPFA 4J57E 3PINA 4KUNA 1F9MA 3DVWA 2H74A 2H71A 4KH7A 5B6NA 1IYIA 2OE0A 2VL2C 2YCDA 2YZUA 4MA9A 5IPHA 3MAKA 4K7IA 4IBPA 2VCZA 2FA8A 4X1UA 2DLXA 1PX6A 1TDIA 3DIEA 1PN9A 4ZL8A 2P5QA 3GH9A 5GSTA 4EKZA 1SD8A 5J4UA 4F0BA 1X5CA 1NW2A 1BJXA 3ZVJD 3O76A 3IAS2 3UVTA 1SENA 3CTGA 3P2AA 1JFUA 2H1GA 4D73A 1SK1A 1XWGA 3NZNA 3RHCA 1Q4JA 2FWHA 2B5EA 2VIMA 4Q5RA 2NTOA 3Q18A 1GUMA 4LL1B 1NSWA 3A2VA 1QFNA 4YH2A 1AUCA 3VI5A 5A5KA 4MK3A 1OC9A 2K18A 1T8EB 16GSA 2O7KA 4MH2A 3E3EA 17GSA 3VI7A 3DD3A 5B8BA 1A2JA 2C8UA 2VLVA 1UVZA 3R2QA 4NMUA 4K0NA 2ZCTA 4IQ1A 1T4YA 1PMTA 3F0IA 4V2NA 4BVYA 2O89A 3HVXA 2J9HA 5AISA 2ZNMA 4MF7A 4ID0A 1M2AA 2FA4A 2PERA 5DAKA 1SL0B 5IO0A 2JACA 2MBTA 1TXXA 4ZB6A 1A0RP 3LG6A 3EMXA 4MJBA 1OC9B 1S3AA 3L9VA 1WP0A 4WR5A 3HJPA 3HD5A 3D0ZA 5E4WA 5A4VA 4G10A 4ILFA 4IJ3A 1X0RA 4YAVA 2LQOA 1X9WB 2E7PA 2P5RA 5D9XA 4BA7A 4NWYA 1TK0B 5FT3A 2HFDA 3TKPA 3MWHA 4WF4A 5DAKB 2NBSA 3EU4A 3UIWA 4PQIA 4IELA 5IMDA 1YKCA 3C8EA 5DQSA 4MPGA 5HFGA 3LYPA 1TJDA 4O92A 2C0FA 3BOAA 4OCFA 4YQUA 2DBCA 5F8BA 4ACSA 3GURA 2YP6A 1VF4A 3M0FA 4BL7A 3QR6A 4I2UA 2R3XA 4KDXA 2XPDA 1GSDA 2ALBA 2A2SA 4L0UA 2VUPA 2N5FA 4RQRA 5F07A 5ID2A 3TOUA 1GSFA 4GCIA 2DC5A 1QK8A 3ZL5A 2VO4A 3EMPA 4PX1A 2XBQA 4AF2A 2FNOA 4EO3A 5CNWA 1HQOA 2O85A 2AYTA 1OAZA 2FY6A 4WKWA 1E2YA 2EC4A 5CRHA 4WBRD 2YN1A 3H8QA 3TKQA 2CAIA 4ECJA 2CV4A 4K9ZA 1HNAA 1HD2A 2NDOA 3VFIA 3GYKA 3IOSA 1J0FA 5ECOB 1KEBA 5FWGA 2CVKA 1EEJA 2H1BA 5FHIA 2BJXA 2B6MA 3DKSA 5ID2B 2L6CA 2TIRA 2WFCA 1UA5A 2H66A 5ECIB 5HFKA 2FWEA 2OE3A 1K0MA 4TR1A 4GQFA 4KDYA 1UN2A 2GZZA 3HYPA 2YOIA 2IPAA 1F3BA 3LORA 3ISOA 22GSA 1EP8A 1MD3A 5HFIA 1ILOA 4MP4A 2YPMA 4F82A 1OYJA 3SBCA 1MEKA 2PBJA 3LGCA 2H0IA 1G7EA 2BTOT 1A24A 2HZFA 2WGRA 1JZDA 1JZWA 3F4SA 3LXZA 1XWKA 3G7YA 2H76A 3QPMA 1GUKA 2FLSA 3A2WA 4RUVA 5GAPD 4WXTA 1QXHA 3CSIA 1Z6MA 4ZXGA 5GAND 4L8EA 1K0OA 1XZOA 2JSZA 1R5AA 3KCMA 2EIRA 2H70A 3DWVA 1ZYQB 1ZYEA 2RM6A 1NHOA 3IBHA 5JCGA 3LFLA 1O7UA 3QAWA 5IMCA 1NM3A 3US3A 3CTFA 3G7IA 3LXTA 1CQHA 1J9BA 1K3OA 4WR4A 3QD9A 4ZBDA 3CRUA 1R7HA 1ST9A 1TK5B 4OWYA 4ECCA 1KBNA 2R5GA 1MD4A 5A4UA 3ZFLA 2DIYA 2H1DA 4V2LA 1XXUA 1URMA 3GMFA 3M3MA 2CX3A 3HKRA 4PUFC 3EVIA 2C3NA 3QDNA 3RAZA 1T1VA 2GT5A 4V2MA 2GS3A 2RM5A 1IYHA 4PNGA 1EV9A 3HJOA 1FVKA 2PN8A 2OBIA 3TRPA 1XVWA 4KNDA 19GSA 3FZAA 3E0UA 3KIJA 3RPNA 2GZYA 1GSQA 3L78A 1Z7RA 1A8YA 1XCCA 3IPZA 1GSYA 3FYGA 2PMTA 3EYTA 3FRCA 6GSUA 1SK0A 5CP1A 6GSTA 1O81A 1YEXA 6GSXA 5D9WA 2L57A 3BD2A 4JE1A 6GSVA 3KP8A 5IMAA 3LJRA 5JWQB 2ON5A 2N5AA 1JLVA 1AQXA 2K8VA 2FUG2 2H72A 5D8IA 2VD0A 4OD7A 5IOWA 4KSOA 3W6GA 3VWVA 2HNLA 1OKTA 3TB2A 4K8MA 1B9XC 5D9TA 2B5XA 2LRTA 4GSNA 1BQ7A 4LLRA 3UMAA 4PURA 1RK4A 1B8XA 1GTIA 3ZMKA 4GXZA 1MDKA 1AQVA 4KDUA 4TN8A 2IMKA 2IIYA 3KTBA 2V1MA 3JCML 4MZCA 1G7OA 1FHEA 1M0UA 1TRWA 3DYRA 2CX4A 4HZ4A 2HLSA 4GF0A 1USBA 3KH7A 4POMA 3W8JA 3UOMA 4KSMA 2GSQA 3UL3A 4ZL9A 5KN0A 1O8WA 3P7XA 4TXVA 1X9SB 4WF5A 1Z5YE 2F8AA 1VGLA 4MZBA 1YF1A 3K8NA 5GSSA 1EOGA 2HI7A 1A2MA 4NHWA 1SK2A 3WGXA 1DSBA 1HNCA 3PR8A 4XRDA 3ZLPA 5HR2A 3IC4A 4TVEA 1S3CA 3FR6A 1N8JA 5JWRB 4E8EA 1X9MB 2GSSA 4ZILA 3FZ4A 3TRXA 4ULXA 1SYXA 3F4RA 4Q5QA 4GTUA 1O85A 2X64A 4FYBA 2R2JA 4KCAA 2JADA 2P31A 3KTLA 3KXOA 1BYEA 2H6ZA 3Q19A 4PQHA 2RUFA 1AQWA 5EY6A 1XWBA 4HDEA 1LU4A 5CO3A 1GSEA 2EIQA 4XHMA 5ECSA 2X8GA 4KW6A 2R4VA 1FVJA 1YQ1A 3KP9A 1M2DA 3P8WA 4GWRA 3ZREA 2YWOA 4NAXA 1E6BA 3ME7A 3HY2A 3J7Yb 3VPQA 2VM1A 2JU5A 3HHVA 3GX0A 2IN3A 3WGDA 5DQYA 1KNGA 13GSA 1Z9HA 2FHEA 4MH3A 1GUHA 2XC2A 4POBA 3GKNA 2ES7A 7GSSA 4P3YB 2LV3A 2O8VB 4X43A 2L5OA 1T7PB 2AV4A 5CYYA 3ZYWA 1AAZA 1XW6A 3KJYA 5A4WA 1TKDB 4AGSA 3WT1A 5LD0A 1THOA 3TGZA 2E0QA 1YY7A 5JCUA 3GKKA 1PQNA 2GLRA 3EC3A 3KMNA 4JU5A 4XS4B 1GL8A 5EVOA 3TJJA 4ZBAA 4L0WA 4IP1A 4Q5NA 2RUEA 3EURA 3APQA 5IQYA 5IM9A 3UEMA 4OFNA 2KOKA 5HR1A 1T3BA 2PGTA 2IWTA 3WGEA 1GTAA 2V6OA 4EUYA 4FH8A 2HZEA 5C00A 1HYUA 5J5NA 3OR5A 1EOHA 1GTBA 2NPBA 1FW1A 3RBTA 4EE0A 1XFLA 1ML6A 1XVQA 3HXSA 5AIXA 1OC3A 2FWGA 5F0GA 4JBBA 3C73A 1K0DA 3ED3A 5CRGA 2LJAA 2BMXA 2V2GA 4EXJA 4JR6A 5B6MA 5D73A 3QMXA 5D9VA 3ZRDA 3ZFBA 2VL2A 1U3IA 2KUCA 1EEMA 2HSHA 1K3YA 4AJ8A 1BAYA 2MYGA 3N5OA 3RHBA 3C7MA 2HZEB 1R26A 1TRSA 5DVBA 1PKWA 3D6IA 5AGYA 1U87A 2DMMA 2PWJA 5INYA 4IP6A 2VM2A 2GSRA 3RDWA 4ZL7A 4I2TA 3F63A 5LCZA 4V1Ag 2A2RA 14GSA 5G2ZA 2DJ3A 3VK9A 3PH9A 1EV4A 4JEDA 1EGOA 1SU9A
chains in the Genus database with same CATH superfamily
4K7NA 1KTEA 11GSA 4LA1A 4EIQA 2YANA 2B7JA 1SYRA 3GTUA 1GWCA 1I9DA 3UVHA 3KGKA 4EL1A 4N0ZA 4HZ2A 1ZCPA 3KEBA 2X4AA 2QC7A 3GKMA 4OO5A 4X0XA 4MJEA 1F37A 2LTKA 4TW5A 2WDUA 4QQ7A 2CZ2A 2P0GA 5C04A 1B4PA 1QUWA 4KAEA 3TKSE 2H19A 4ZB9A 4MLYA 4MF6A 2OACA 3J7Yk 1YZXA 1TW9A 1DBYA 3TKSA 3ZZXA 1A8LA 1UC7A 2CVDA 3ME8A 1YEPA 2M80A 4XS1A 1PA3A 2C3QA 3UAPA 1SL1B 3GTUB 5AIVA 3FR9A 4WETA 3APOA 4BWSA 1YKAA 1GLQA 2HYXA 2LJKA 1Y6EA 1JZRA 3PPUA 3MSZA 1TI1A 1VRSD 1RQMA 2X8HA 3CSHA 4ZIJA 3QFAC 1AXDA 18GSA 1GLPA 10GSA 3WD6A 1R4WA 3IE3A 3BCIA 1EZKA 2VD1A 2LRCA 2LNSA 2PUKC 3H79A 3EU3A 5F06A 2AB6A 3IHQA 4YAPA 5DCHA 1PD21 3A3TA 2L4CA 5B7CA 3C1SA 1EP7A 1V58A 2N5BA 5G31A 2GTUA 4EF0A 2VL9A 4TR3A 1ERTA 3I9V2 1SJZA 5ECMB 3MNGA 3LYKA 4DEJA 1MDJA 3SWLA 1WWJA 3UJ1A 3VURA 1Z7PA 1BEDA 2YJHA 1GH2A 2KP1A 5IMFA 1TU8A 2D2ZA 1Z6NA 4IKHA 4HU7A 3AY8A 1B48A 1X5DA 1A2LA 3G7JA 4XS6A 3H4KA 3D5JA 2REMA 2AAWA 4WEYA 4FYCA 4G2EA 5JWOB 1B4QA 3U6VA 3FY7A 2WCIA 3FR3A 4F2IA 2HE3A 1MDIA 2H73A 1XOBA 2HT9A 6GSYA 3VWXA 5G1LA 4ML1A 2F51A 4MJCA 2E2GA 3IK7A 1Q98A 4N11A 5DJMA 2L6DA 5ECPB 1T00A 1MTCA 4KE3A 5CREA 4LL4B 2HSYA 1NHYA 4G19A 5H5SA 1ZZYA 3F6DA 2R0PA 3GSTA 3QAVA 4HQSA 3TJFA 3TJBA 2H75A 3DRNA 4FIWA 1SL2B 3CRTA 2JSYA 1SJ6A 5EL8A 3HVVA 2H1AA 3D4TA 3IR4A 2MZCA 5HR0A 4HQZA 5D93A 3KZQA 2CQ9A 4NV5A 1A0FA 4TR0A 3U5RE 1TTZA 3V1WA 1CQGA 4ECBA 2GQMA 3IDVA 4F0CA 2Z9SA 2GGTA 3TKRA 1G0TA 5DBQA 2C1YA 1PKZA 2LSTA 2V41A 5IOXA 1ZGNA 2PPTA 1B9YC 1ABAA 2IMIA 1SJIA 4POLA 3GFKA 1N2AA 3DVXA 1V9WA 1ZMAA 3ERWA 4CDOA 5J41A 1FG4A 1ERUA 5DJLA 3IAM2 2G2QA 4DVCA 1PRXA 5D96A 3F3QA 2FD3A 2V32A 2C4JA 4AJ6A 3I6AA 2M46A 3FZ5A 5IO2A 5L71A 1G6YA 2FGXA 2C0EA 1BX9A 2VLTA 1VF1A 4BWQA 4JZQA 1PL1A 3FW2A 1XOAA 4Z7XA 3GV1A 3N9JA 1GTUA 2LJRA 4O7HA 2B3SA 2B7KA 2RLIA 2GT6A 2C3TA 1K0NA 4HJMA 4N30A 1SD9A 1JLWA 4NXIA 3D4MA 2O87A 2LQQA 3A2XA 5DDLA 4K7OA 2V6KA 3UARA 4DSSA 1Y25A 2CVBA 2KLXA 5G30A 1TOFA 5CAXA 1XPVA 2VCQA 4GLTA 1K0CA 2IMFA 1WIKA 4HS1A 4LMWA 1A23A 3D21A 3IRAA 2MMAA 3GHAA 1EGRA 3H93A 4MCUA 3DEXA 1M3IA 4IN0A 4ISDA 4DSQA 4K2DA 4ZBBA 2XBIA 4F9ZA 5F05A 1FO5A 2R0CA 4MABA 2HXKA 4K0GA 2VCVA 2X99A 2VCTA 5ECLB 3HA9A 3DGQA 2GDRA 4BPYA 1QMVA 3GX8A 2FCHA 4CY6A 1WE0A 4JRRA 3HDCA 2GQKA 2CZ3A 3L9UA 1V40A 3W8SA 2OBKA 4L5OA 3D22A 2B1LA 4XS4A 4DSSB 1PN0A 2H30A 1GP1A 4RQXA 2LS5A 4TOPA 2C0GA 5KN2A 1XBSA 2WB9A 4FO5A 1K0BA 2G0FA 3P90A 3VWUA 2MMZA 4JR4A 1M9AA 4KA0A 2QKEA 4XTSA 3Q74A 1ZL9A 2GQLA 3LWAA 2L4QA 3HZ4A 3IA1A 5J3RA 2DJ1A 1QQ2A 3QAGA 1AW9A 1M2BA 2I81A 4KX4A 3QFBC 1H4OA 6GSWA 1K3LA 2OA7A 1WPIA 1DE2A 1TRUA 5B8AA 1H75A 4TKYA 3EINA 4CHSA 1V57A 3PGTA 3ZIJA 3ERFA 3L9SA 1PL2A 1YF0A 4Q5FA 1F3AA 2IL3A 2R37A 3GKXA 3TJGA 1W89A 3QCPA 5ENUA 2VOCA 4L5LA 3C1RA 2H0HA 3TUEA 1SKWB 2K8SA 4H86A 2I4AA 3F3RA 2YNXA 1FB0A 5G5EA 4TXOA 2QGVA 2YWIA 3TDGA 1I5GA 4ECIA 3M8NA 5KN3A 4OFTA 5ECNB 2K9FA 1XIYA 2H6XA 2ON7A 5IPGA 3E9JB 1PX7A 4RI6A 4IQAA 12GSA 1ON4A 2VCWA 1U6TA 3EWLA 3F4TA 2JZSA 3GL5A 1FOVA 3GRXA 4ZB8A 5IIZA 4OFMA 4IHUA 2JZTA 4D73B 4OMVA 1U88A 2VLUA 2AUVA 1OE7A 3TKSC 2YWMA 1J08A 1DUGA 3ZTLA 3H1NA 1WMJA 4EC0A 5HQPA 2C0DA 2OADA 4O32A 4TXOB 3ZMLA 1JZOA 4Z2RA 3KD0A 4E8HA 3KM6A 5IMZA 3F8UA 2WZ9A 3F6FA 3TOTA 1THXA 3M9KA 1TP9A 2K6VA 1S3DA 2DMLA 4HJ2A 3TRQA 5DALA 1OC8A 5H5QA 5J9BA 1WRYA 2CT6A 4GQCA 2DKHA 2DJ2A 2PU9C 4IVFA 3RPPA 1FOHA 1M7TA 4BVYB 1WOUA 1OKDA 2CAQA 4NV2A 4O5QA 1ERVA 1ZOFA 2LEGA 1YJ6A 2MMNA 3IK9A 1GSUA 3GL3A 5AN1A 2HRFA 1VF2A 1T4ZA 2HRNA 2R6KA 2IMEA 1YDKA 2QSIA 3F9UA 5KN1A 2LNTA 2VCXA 1F2EA 1LJRA 2FWFA 4G9HA 2YWNA 1OE8A 1W4VA 1O8XA 5DALB 3WYWA 2I1UA 2A4VA 1DE1A 3KMOA 4PXOA 2JL4A 4MZWA 1XWAA 2I9HA 3KH9A 4G0KA 4IS0A 3CMIA 1GNEA 4CY8A 1QGVA 1TK8B 2IFQA 3C71A 5CRDA 3NOFA 4N10A 2B5YA 4PUAA 4YQMA 5BMUA 3LSZA 1TRVA 3A5IA 4KGIA 2H0GA 2YZHA 1AC1A 5GZZB 5ABRA 5J9CA 5JCWA 3O3TA 1EWXA 3Q6OA 4BVXA 5LNKe 3VPTA 5ELGA 3IXRA 4PGTA 2XHFA 5G1KA 2DIZA 3VLNA 4G0LA 2NVLA 8GSSA 4G0IA 4POKA 1C72A 3QOUA 3MIXA 2YV7A 3CSJA 3MDKA 4J56E 5CRWA 2IFQB 3S9FA 2H01A 1G6WA 4USSA 2WRTA 2MBSA 5H5RA 4XCSA 2M72A 4GRFA 2OKAA 1PGTA 3HVSA 2ZUPA 4MPFA 4HU9A 2KP2A 4HUAA 2DSAA 1O73A 2RIIA 6GSSA 2MMOA 9GSSA 4BVXB 4WBJA 4MJAA 1X5EA 20GSA 4NHZA 4DSRA 4EDZA 3GIXA 1M99A 2AHEA 3HJMA 4TR1B 1BG5A 3HCZA 3BJ5A 3ZITA 1HNBA 2EIOA 4TR4A 3FHKA 2DJKA 2LRNA 2F3MA 4K1FA 4NPBA 2WJUA 4K5RA 5DCGA 2J23A 1V98A 4HEA2 1AIUA 2L59A 3I69A 2IJYA 1XW5A 2B1KA 3NIVA 3TJKA 3GNJA 5HR3A 4MF5A 4OCEA 3IV4A 3M9JA 4F03A 4KB3A 4CW9A 2GSTA 4V1Ap 1ZYNA 3LEFA 2VAFA 4K6XA 1R5PA 5ECKB 3GUSA 1Z3EA 2X8CA 3L4NA 1FAAA 3DXBA 1GSSA 4Z2TA 1XW9A 2H8LA 4HI7A 2E2MA 2LKUA 3LQ7A 4ML6A 1XWCA 4HOJA 4EDYA 3GH6A 2A4HA 2H6YA 4YKFA 2I3YA 1SKRB 4I8BA 3TCOA 1K0AA 1FB6A 3A5WA 2AJQB 1F6MC 3DMLA 5ELAA 3I43A 3VWWA 3GN3A 4LMVA 3CXGA 2HRKA 3G9BA 3FZ9A 2YV9A 3BCKA 3BBYA 4I97A 4XRAA 2DJJA 3EE2A 4O5RA 4I5QA 4N0VA 2VL3A 2GVPA 3CYNA 3GA4A 5E59A 4QL9A 3WT2A 2PVQA 2TRCP 4MDCA 1ERWA 1RW1A 4XIHA 3M1GA 2IMDA 1M9BA 2TRXA 4QL7A 1VF3A 4YQVA 1TI3A 4PQ1A 3ERGA 4IW9A 5IMVA 1PSQA 5KEJA 4EVMA 3FKFA 3HZ8A 1GNWA 1WJKA 4KCEA 2KHPA 5ECHB 3FK8A 2CA8A 4MMMA 4GSSA 2JZRA 1ACVA 2XPEA 1V2AA 2PVOC 3O6TA 3ZIVA 5G5FA 4J2FA 3ZVJA 1OVNA 2WULA 1TU7A 2F8FA 3UBLA 2OE1A 2C80A 1LBKA 4FYUA 2LUSA 4OO4A 5ECRB 4GSTA 4PNFA 4BIKA 1GULA 3GSSA 2GZPA 3L0HA 4TRXA 3FEUA 3APSA 3UBKA 2HRAA 2WS2A 4AJ7A 1GRXA 2F9SA 4IGJA 4IJIA 4RI7A 2OJLA 2L5LA 3CBUA 1JHBA 5BRTA 1SKSB 5COHA 2YJ7A 5ECQB 2DJ0A 1U3AA 1O6JA 4I6XA 5EPFA 4J57E 3PINA 4KUNA 1F9MA 3DVWA 2H74A 2H71A 4KH7A 5B6NA 1IYIA 2OE0A 2VL2C 2YCDA 2YZUA 4MA9A 5IPHA 3MAKA 4K7IA 4IBPA 2VCZA 2FA8A 4X1UA 2DLXA 1PX6A 1TDIA 3DIEA 1PN9A 4ZL8A 2P5QA 3GH9A 5GSTA 4EKZA 1SD8A 5J4UA 4F0BA 3LW9A 1X5CA 1NW2A 1BJXA 3ZVJD 3O76A 3IAS2 3UVTA 1SENA 3CTGA 3P2AA 1JFUA 2H1GA 3MYDA 4D73A 1SK1A 1XWGA 3NZNA 3RHCA 1Q4JA 2FWHA 2B5EA 2VIMA 4Q5RA 2NTOA 3Q18A 1GUMA 4LL1B 1NSWA 3A2VA 2QA2A 1QFNA 4YH2A 1AUCA 3VI5A 5A5KA 4MK3A 1OC9A 2K18A 1T8EB 16GSA 2O7KA 4MH2A 3E3EA 17GSA 3VI7A 3DD3A 5B8BA 1A2JA 2C8UA 4O5UA 2VLVA 1UVZA 3R2QA 4NMUA 4K0NA 2ZCTA 4IQ1A 1T4YA 1PMTA 3F0IA 4V2NA 4K2XA 4BVYA 2O89A 3HVXA 2J9HA 5AISA 2ZNMA 4MF7A 4ID0A 1M2AA 2FA4A 2PERA 4KF9A 5DAKA 1SL0B 5IO0A 2JACA 2MBTA 1TXXA 4ZB6A 4FQUA 1A0RP 3LG6A 3EMXA 4MJBA 1OC9B 1S3AA 3L9VA 1WP0A 4WR5A 3HJPA 3HD5A 3D0ZA 5E4WA 5A4VA 4G10A 4ILFA 4IJ3A 3EPTA 1X0RA 4YAVA 2LQOA 1X9WB 2E7PA 2P5RA 5D9XA 4BA7A 4NWYA 1TK0B 5FT3A 2HFDA 3TKPA 3MWHA 4WF4A 5DAKB 2NBSA 3EU4A 3UIWA 4PQIA 4IELA 5IMDA 1YKCA 3C8EA 5DQSA 4MPGA 5HFGA 3LYPA 1TJDA 4O92A 2C0FA 3BOAA 4OCFA 4YQUA 2DBCA 5F8BA 4ACSA 3GURA 2YP6A 1VF4A 3M0FA 2QA1A 4BL7A 3QR6A 4I2UA 2R3XA 4KDXA 2XPDA 1GSDA 2ALBA 2A2SA 4L0UA 2VUPA 2N5FA 4RQRA 5F07A 4HSCX 5ID2A 3TOUA 1GSFA 4GCIA 2DC5A 1QK8A 3ZL5A 2VO4A 3EMPA 4PX1A 2XBQA 4AF2A 4MNNA 2FNOA 4EO3A 5CNWA 1HQOA 2O85A 2AYTA 1OAZA 2FY6A 4WKWA 1E2YA 2EC4A 5CRHA 4WBRD 2YN1A 3H8QA 3TKQA 2CAIA 4ECJA 2CV4A 4K9ZA 4Z2UA 1HNAA 1HD2A 4BL7B 2NDOA 3VFIA 3GYKA 3IOSA 1J0FA 5ECOB 1KEBA 5FWGA 2CVKA 1EEJA 2H1BA 4YKGA 5FHIA 2BJXA 2B6MA 3DKSA 5ID2B 2L6CA 2TIRA 2WFCA 1UA5A 2H66A 5ECIB 5HFKA 2DKIA 2FWEA 2OE3A 1K0MA 4TR1A 4GQFA 4KDYA 1UN2A 2GZZA 3HYPA 2YOIA 2IPAA 3CQFA 1F3BA 3LORA 3ISOA 4K5SA 22GSA 1EP8A 1MD3A 5HFIA 1ILOA 4MP4A 2YPMA 4F82A 1OYJA 3SBCA 1MEKA 2PBJA 3LGCA 2H0IA 1G7EA 2BTOT 1A24A 2HZFA 2WGRA 1JZDA 1JZWA 3F4SA 3LXZA 1XWKA 3FMWA 3G7YA 2H76A 3QPMA 1GUKA 2FLSA 3A2WA 4RUVA 5GAPD 4WXTA 1QXHA 3CSIA 1Z6MA 4ZXGA 5GAND 4L8EA 1K0OA 1XZOA 2JSZA 1R5AA 3KCMA 2EIRA 2H70A 3DWVA 1ZYQB 1ZYEA 2R0GA 1ZYPA 2RM6A 1NHOA 3IBHA 5JCGA 3LFLA 1O7UA 3QAWA 5IMCA 1NM3A 3US3A 3CTFA 3G7IA 3LXTA 1CQHA 1J9BA 1K3OA 4WR4A 3QD9A 4ZBDA 3CRUA 1R7HA 1ST9A 1TK5B 4OWYA 2A2PA 4ECCA 1KBNA 2R5GA 1MD4A 5A4UA 3ZFLA 2DIYA 2H1DA 4V2LA 1XXUA 1URMA 2HSMA 3GMFA 3M3MA 2CX3A 3HKRA 4PUFC 3EVIA 2C3NA 3QDNA 3RAZA 1T1VA 1S3RA 2GT5A 4V2MA 2GS3A 2RM5A 1IYHA 4PNGA 1EV9A 3HJOA 1FVKA 2PN8A 2OBIA 3TRPA 1XVWA 4KNDA 19GSA 3FZAA 3E0UA 3KIJA 3RPNA 2GZYA 1GSQA 3L78A 1Z7RA 1A8YA 1XCCA 3IPZA 1GSYA 3FYGA 2PMTA 3EYTA 3FRCA 6GSUA 1SK0A 5CP1A 6GSTA 1O81A 1YEXA 6GSXA 5D9WA 2L57A 3BD2A 4JE1A 6GSVA 3KP8A 5IMAA 3LJRA 5JWQB 2ON5A 2N5AA 1JLVA 1AQXA 2K8VA 2FUG2 2H72A 5D8IA 2VD0A 4OD7A 5KOWA 5IOWA 4KSOA 3W6GA 3VWVA 2HNLA 1OKTA 3TB2A 4K8MA 1B9XC 5D9TA 2B5XA 4PTSA 2LRTA 4GSNA 1BQ7A 4LLRA 3UMAA 4PURA 1RK4A 1B8XA 1GTIA 3ZMKA 4GXZA 1MDKA 1AQVA 1PFOA 4KDUA 4TN8A 2IMKA 2IIYA 3KTBA 2V1MA 3JCML 4MZCA 1G7OA 1FHEA 1M0UA 1TRWA 3DYRA 2CX4A 4HZ4A 2HLSA 4GF0A 1USBA 3KH7A 4POMA 3W8JA 3UOMA 4KSMA 2GSQA 3UL3A 4ZL9A 5KOXA 5KN0A 1O8WA 3P7XA 4TXVA 1X9SB 4WF5A 1Z5YE 2F8AA 1VGLA 4MZBA 1YF1A 3K8NA 5GSSA 1EOGA 2HI7A 1A2MA 4NHWA 1SK2A 3R3EA 3WGXA 1DSBA 1HNCA 3PR8A 4XRDA 3ZLPA 5HR2A 3IC4A 4TVEA 1S3CA 3FR6A 1N8JA 5JWRB 4E8EA 1X9MB 2GSSA 4ZILA 3FZ4A 3TRXA 4ULXA 1SYXA 3F4RA 4Q5QA 4GTUA 1O85A 2X64A 4FYBA 2R2JA 4KCAA 2JADA 2P31A 3KTLA 3KXOA 1BYEA 2H6ZA 3Q19A 4PQHA 2RUFA 1AQWA 5EY6A 1XWBA 4HDEA 1LU4A 5CO3A 1GSEA 2EIQA 4XHMA 5ECSA 2X8GA 4KW6A 2R4VA 1FVJA 1YQ1A 3KP9A 1M2DA 3P8WA 4GWRA 3ZREA 2YWOA 4NAXA 1E6BA 3ME7A 3HY2A 3J7Yb 3VPQA 2VM1A 2JU5A 3HHVA 3GX0A 4EIPA 2IN3A 3WGDA 5DQYA 1KNGA 3IHGA 13GSA 1Z9HA 2FHEA 4MH3A 1GUHA 2XC2A 4POBA 4A5PA 3GKNA 2ES7A 7GSSA 4P3YB 2LV3A 2O8VB 4X43A 2L5OA 1T7PB 2AV4A 5CYYA 3ZYWA 1AAZA 1XW6A 3KJYA 5A4WA 1TKDB 4AGSA 3WT1A 5LD0A 2X49A 1THOA 3TGZA 2E0QA 1YY7A 5JCUA 3GKKA 4X4JA 1PQNA 2GLRA 3EC3A 3KMNA 4ICYA 4JU5A 4XS4B 1GL8A 5EVOA 3TJJA 4ZBAA 4L0WA 4IP1A 4Q5NA 2RUEA 3EURA 3APQA 5IQYA 5IM9A 3UEMA 4OFNA 2KOKA 5HR1A 1T3BA 3HVNA 2PGTA 2IWTA 3WGEA 1GTAA 2V6OA 4EUYA 2UZ8A 4FH8A 2HZEA 5C00A 1HYUA 5J5NA 3OR5A 1EOHA 1GTBA 2NPBA 1FW1A 3RBTA 4EE0A 1M3JA 1XFLA 1ML6A 1XVQA 3HXSA 5AIXA 1OC3A 2FWGA 5F0GA 4JBBA 3C73A 1K0DA 3ED3A 5CRGA 2LJAA 2BMXA 2V2GA 4EXJA 4JR6A 5B6MA 5D73A 3QMXA 5D9VA 3ZRDA 3ZFBA 2VL2A 1U3IA 2KUCA 1EEMA 2HSHA 1K3YA 4AJ8A 3IC8A 1BAYA 2MYGA 3N5OA 3RHBA 3C7MA 2HZEB 1R26A 1TRSA 5DVBA 1PKWA 3D6IA 5AGYA 1U87A 2DMMA 2PWJA 5INYA 4IP6A 2VM2A 2GSRA 3RDWA 4ZL7A 4I2TA 3F63A 5LCZA 4V1Ag 2A2RA 14GSA 5G2ZA 1XG8A 2DJ3A 3VK9A 3PH9A 1EV4A 4JEDA 1EGOA 1SU9A
chains in the Genus database with same CATH topology
4K7NA 1KTEA 11GSA 4LA1A 4EIQA 2YANA 2B7JA 1SYRA 3GTUA 1GWCA 1I9DA 3UVHA 3KGKA 4EL1A 4N0ZA 4HZ2A 1ZCPA 3KEBA 2X4AA 2QC7A 3GKMA 4OO5A 4X0XA 4MJEA 1F37A 2LTKA 4TW5A 2WDUA 4QQ7A 2CZ2A 2P0GA 5C04A 1B4PA 1QUWA 4KAEA 3TKSE 2H19A 4ZB9A 4MLYA 4MF6A 2OACA 3J7Yk 1YZXA 1TW9A 1DBYA 3TKSA 3ZZXA 1A8LA 1UC7A 2CVDA 3ME8A 1YEPA 2M80A 4XS1A 1PA3A 2C3QA 3UAPA 1SL1B 3GTUB 5AIVA 3FR9A 4WETA 3APOA 4BWSA 1YKAA 1GLQA 2HYXA 2LJKA 1Y6EA 1JZRA 3PPUA 3MSZA 1TI1A 1VRSD 1RQMA 2X8HA 3CSHA 4ZIJA 3QFAC 1AXDA 18GSA 1GLPA 10GSA 3WD6A 1R4WA 3IE3A 3BCIA 1EZKA 2VD1A 2LRCA 2LNSA 2PUKC 3H79A 3EU3A 5F06A 2AB6A 3IHQA 4YAPA 5DCHA 1PD21 3A3TA 2L4CA 5B7CA 3C1SA 1EP7A 1V58A 2N5BA 5G31A 2GTUA 4EF0A 2VL9A 4TR3A 1ERTA 3I9V2 1SJZA 5ECMB 3MNGA 3LYKA 4DEJA 1MDJA 3SWLA 1WWJA 3UJ1A 3VURA 1Z7PA 1BEDA 2YJHA 1GH2A 2KP1A 5IMFA 1TU8A 2D2ZA 1Z6NA 4IKHA 4HU7A 3AY8A 1B48A 1X5DA 1A2LA 3G7JA 4XS6A 3H4KA 3D5JA 2REMA 2AAWA 4WEYA 4FYCA 4G2EA 5JWOB 1B4QA 3U6VA 3FY7A 2WCIA 3FR3A 4F2IA 2HE3A 1MDIA 2H73A 1XOBA 2HT9A 6GSYA 3VWXA 5G1LA 4ML1A 2F51A 4MJCA 2E2GA 3IK7A 1Q98A 4N11A 5DJMA 2L6DA 5ECPB 1T00A 1MTCA 4KE3A 5CREA 4LL4B 2HSYA 1NHYA 4G19A 5H5SA 1ZZYA 3F6DA 2R0PA 3GSTA 3QAVA 4HQSA 3TJFA 3TJBA 2H75A 3DRNA 4FIWA 1SL2B 3CRTA 2JSYA 1SJ6A 5EL8A 3HVVA 2H1AA 3D4TA 3IR4A 2MZCA 5HR0A 4HQZA 5D93A 3KZQA 2CQ9A 4NV5A 1A0FA 4TR0A 3U5RE 1TTZA 3V1WA 1CQGA 4ECBA 2GQMA 3IDVA 4F0CA 2Z9SA 2GGTA 3TKRA 1G0TA 5DBQA 2C1YA 1PKZA 2LSTA 2V41A 5IOXA 1ZGNA 2PPTA 1B9YC 1ABAA 2IMIA 1SJIA 4POLA 3GFKA 1N2AA 3DVXA 1V9WA 1ZMAA 3ERWA 4CDOA 5J41A 1FG4A 1ERUA 5DJLA 3IAM2 2G2QA 4DVCA 1PRXA 5D96A 3F3QA 2FD3A 2V32A 2C4JA 4AJ6A 3I6AA 2M46A 3FZ5A 5IO2A 5L71A 1G6YA 2FGXA 2C0EA 1BX9A 2VLTA 1VF1A 4BWQA 4JZQA 1PL1A 3FW2A 1XOAA 4Z7XA 3GV1A 3N9JA 1GTUA 2LJRA 4O7HA 2B3SA 2B7KA 2RLIA 2GT6A 2C3TA 1K0NA 4HJMA 4N30A 1SD9A 1JLWA 4NXIA 3D4MA 2O87A 2LQQA 3A2XA 5DDLA 4K7OA 2V6KA 3UARA 4DSSA 1Y25A 2CVBA 2KLXA 5G30A 1TOFA 5CAXA 1XPVA 2VCQA 4GLTA 1K0CA 2IMFA 1WIKA 4HS1A 4LMWA 1A23A 3D21A 3IRAA 2MMAA 3GHAA 1EGRA 3H93A 4MCUA 3DEXA 4IN0A 4ISDA 4DSQA 4K2DA 4ZBBA 2XBIA 4F9ZA 5F05A 1FO5A 2R0CA 4MABA 2HXKA 4K0GA 2VCVA 2X99A 2VCTA 5ECLB 3HA9A 3DGQA 2GDRA 4BPYA 1QMVA 3GX8A 2FCHA 4CY6A 1WE0A 4JRRA 3HDCA 2GQKA 2CZ3A 3L9UA 1V40A 3W8SA 2OBKA 4L5OA 3D22A 2B1LA 4XS4A 4DSSB 1PN0A 2H30A 1GP1A 4RQXA 2LS5A 4TOPA 2C0GA 5KN2A 1XBSA 2WB9A 4FO5A 1K0BA 2G0FA 3P90A 3VWUA 2MMZA 4JR4A 1M9AA 4KA0A 2QKEA 4XTSA 3Q74A 1ZL9A 2GQLA 3LWAA 2L4QA 3HZ4A 3IA1A 5J3RA 2DJ1A 1QQ2A 3QAGA 1AW9A 1M2BA 2I81A 4KX4A 3QFBC 1H4OA 6GSWA 1K3LA 2OA7A 1WPIA 1DE2A 1TRUA 5B8AA 1H75A 4TKYA 3EINA 4CHSA 1V57A 3PGTA 3ZIJA 3ERFA 3L9SA 1PL2A 1YF0A 4Q5FA 1F3AA 2IL3A 2R37A 3GKXA 3TJGA 1W89A 3QCPA 5ENUA 2VOCA 4L5LA 3C1RA 2H0HA 3TUEA 1SKWB 2K8SA 4H86A 2I4AA 3F3RA 2YNXA 1FB0A 5G5EA 4TXOA 2QGVA 2YWIA 3TDGA 1I5GA 4ECIA 3M8NA 5KN3A 4OFTA 5ECNB 2K9FA 1XIYA 2H6XA 2ON7A 5IPGA 3E9JB 1PX7A 4RI6A 4IQAA 12GSA 1ON4A 2VCWA 1U6TA 3EWLA 3F4TA 2JZSA 3GL5A 1FOVA 3GRXA 4ZB8A 5IIZA 4OFMA 4IHUA 2JZTA 4D73B 4OMVA 1U88A 2VLUA 2AUVA 1OE7A 3TKSC 2YWMA 1J08A 1DUGA 3ZTLA 3H1NA 1WMJA 4EC0A 5HQPA 2C0DA 2OADA 4O32A 4TXOB 3ZMLA 1JZOA 4Z2RA 3KD0A 4E8HA 3KM6A 5IMZA 3F8UA 2WZ9A 3F6FA 3TOTA 1THXA 3M9KA 1TP9A 2K6VA 1S3DA 2DMLA 4HJ2A 3TRQA 5DALA 1OC8A 5H5QA 5J9BA 1WRYA 2CT6A 4GQCA 2DKHA 2DJ2A 2PU9C 4IVFA 3RPPA 1FOHA 1M7TA 4BVYB 1WOUA 1OKDA 2CAQA 4NV2A 4O5QA 1ERVA 1ZOFA 2LEGA 1YJ6A 2MMNA 3IK9A 1GSUA 3GL3A 5AN1A 2HRFA 1VF2A 1T4ZA 2HRNA 2R6KA 2IMEA 1YDKA 2QSIA 3F9UA 5KN1A 2LNTA 2VCXA 1F2EA 1LJRA 2FWFA 4G9HA 2YWNA 1OE8A 1W4VA 1O8XA 5DALB 3WYWA 2I1UA 2A4VA 1DE1A 3KMOA 4PXOA 2JL4A 4MZWA 1XWAA 2I9HA 3KH9A 4G0KA 4IS0A 3CMIA 1GNEA 4CY8A 1QGVA 1TK8B 2IFQA 3C71A 5CRDA 3NOFA 4N10A 2B5YA 4PUAA 4YQMA 5BMUA 3LSZA 1TRVA 3A5IA 4KGIA 2H0GA 2YZHA 1AC1A 5GZZB 5ABRA 5J9CA 5JCWA 3O3TA 1EWXA 3Q6OA 4BVXA 5LNKe 3VPTA 5ELGA 3IXRA 4PGTA 2XHFA 5G1KA 2DIZA 3VLNA 4G0LA 2NVLA 8GSSA 4G0IA 4POKA 1C72A 3QOUA 3MIXA 2YV7A 3CSJA 3MDKA 4J56E 5CRWA 2IFQB 3S9FA 2H01A 1G6WA 4USSA 2WRTA 2MBSA 5H5RA 4XCSA 2M72A 4GRFA 2OKAA 1PGTA 3HVSA 2ZUPA 4MPFA 4HU9A 2KP2A 4HUAA 2DSAA 1O73A 2RIIA 6GSSA 2MMOA 9GSSA 4BVXB 4WBJA 4MJAA 1X5EA 20GSA 4NHZA 4DSRA 4EDZA 3GIXA 1M99A 2AHEA 3HJMA 4TR1B 1BG5A 3HCZA 3BJ5A 3ZITA 1HNBA 2EIOA 4TR4A 3FHKA 2DJKA 2LRNA 2F3MA 4K1FA 4NPBA 2WJUA 4K5RA 5DCGA 2J23A 1V98A 4HEA2 1AIUA 2L59A 3I69A 2IJYA 1XW5A 2B1KA 3NIVA 3TJKA 3GNJA 5HR3A 4MF5A 4OCEA 3IV4A 3M9JA 4F03A 4KB3A 4CW9A 2GSTA 4V1Ap 1ZYNA 3LEFA 2VAFA 4K6XA 1R5PA 5ECKB 3GUSA 1Z3EA 2X8CA 3L4NA 1FAAA 3DXBA 1GSSA 4Z2TA 1XW9A 2H8LA 4HI7A 2E2MA 2LKUA 3LQ7A 4ML6A 1XWCA 4HOJA 4EDYA 3GH6A 2A4HA 2H6YA 4YKFA 2I3YA 1SKRB 4I8BA 3TCOA 1K0AA 1FB6A 3A5WA 2AJQB 1F6MC 3DMLA 5ELAA 3I43A 3VWWA 3GN3A 4LMVA 3CXGA 2HRKA 3G9BA 3FZ9A 2YV9A 3BCKA 3BBYA 4I97A 4XRAA 2DJJA 3EE2A 4O5RA 4I5QA 4N0VA 2VL3A 2GVPA 3CYNA 3GA4A 5E59A 4QL9A 3WT2A 2PVQA 2TRCP 4MDCA 1ERWA 1RW1A 4XIHA 3M1GA 2IMDA 1M9BA 2TRXA 4QL7A 1VF3A 4YQVA 1TI3A 4PQ1A 3ERGA 4IW9A 5IMVA 1PSQA 5KEJA 4EVMA 3FKFA 3HZ8A 1GNWA 1WJKA 4KCEA 2KHPA 5ECHB 3FK8A 2CA8A 4MMMA 4GSSA 2JZRA 1ACVA 2XPEA 1V2AA 2PVOC 3O6TA 3ZIVA 5G5FA 4J2FA 3ZVJA 1OVNA 2WULA 1TU7A 2F8FA 3UBLA 2OE1A 2C80A 1LBKA 4FYUA 2LUSA 4OO4A 5ECRB 4GSTA 4PNFA 1GULA 3GSSA 2GZPA 3L0HA 4TRXA 3FEUA 3APSA 3UBKA 2HRAA 2WS2A 4AJ7A 1GRXA 2F9SA 4IGJA 4IJIA 4RI7A 2OJLA 2L5LA 3CBUA 1JHBA 5BRTA 1SKSB 5COHA 2YJ7A 5ECQB 2DJ0A 1U3AA 1O6JA 4I6XA 5EPFA 4J57E 3PINA 4KUNA 1F9MA 3DVWA 2H74A 2H71A 4KH7A 5B6NA 1IYIA 2OE0A 2VL2C 2YCDA 2YZUA 4MA9A 5IPHA 3MAKA 4K7IA 4IBPA 2VCZA 2FA8A 4X1UA 2DLXA 1PX6A 1TDIA 3DIEA 1PN9A 4ZL8A 2P5QA 3GH9A 5GSTA 4EKZA 1SD8A 5J4UA 4F0BA 3LW9A 1X5CA 1NW2A 1BJXA 3ZVJD 3O76A 3IAS2 3UVTA 1SENA 3CTGA 3P2AA 1JFUA 2H1GA 3MYDA 4D73A 1SK1A 1XWGA 3NZNA 3RHCA 1Q4JA 2FWHA 2B5EA 2VIMA 4Q5RA 2NTOA 3Q18A 1GUMA 4LL1B 1NSWA 3A2VA 2QA2A 1QFNA 4YH2A 1AUCA 3VI5A 5A5KA 4MK3A 1OC9A 2K18A 1T8EB 16GSA 2O7KA 4MH2A 3E3EA 17GSA 3VI7A 3DD3A 5B8BA 1A2JA 2C8UA 4O5UA 2VLVA 1UVZA 3R2QA 4NMUA 4K0NA 2ZCTA 4IQ1A 1T4YA 1PMTA 3F0IA 4V2NA 4K2XA 4BVYA 2O89A 3HVXA 2J9HA 5AISA 2ZNMA 4MF7A 4ID0A 1M2AA 2FA4A 2PERA 4KF9A 5DAKA 1SL0B 5IO0A 2JACA 2MBTA 1TXXA 4ZB6A 4FQUA 1A0RP 3LG6A 3EMXA 4MJBA 1OC9B 1S3AA 3L9VA 1WP0A 4WR5A 3HJPA 3HD5A 3D0ZA 5E4WA 5A4VA 4G10A 4ILFA 4IJ3A 3EPTA 1X0RA 4YAVA 2LQOA 1X9WB 2E7PA 2P5RA 5D9XA 4BA7A 4NWYA 1TK0B 5FT3A 2HFDA 3TKPA 3MWHA 4WF4A 5DAKB 2NBSA 3EU4A 3UIWA 4PQIA 4IELA 5IMDA 1YKCA 3C8EA 5DQSA 4MPGA 5HFGA 3LYPA 1TJDA 4O92A 2C0FA 3BOAA 4OCFA 4YQUA 2DBCA 5F8BA 4ACSA 3GURA 2YP6A 1VF4A 3M0FA 2QA1A 4BL7A 3QR6A 4I2UA 2R3XA 4KDXA 2XPDA 1GSDA 2ALBA 2A2SA 4L0UA 2VUPA 2N5FA 4RQRA 5F07A 5ID2A 3TOUA 1GSFA 4GCIA 2DC5A 1QK8A 3ZL5A 2VO4A 3EMPA 4PX1A 2XBQA 4AF2A 4MNNA 2FNOA 4EO3A 5CNWA 1HQOA 2O85A 2AYTA 1OAZA 2FY6A 4WKWA 1E2YA 2EC4A 5CRHA 4WBRD 2YN1A 3H8QA 3TKQA 2CAIA 4ECJA 2CV4A 4K9ZA 4Z2UA 1HNAA 1HD2A 4BL7B 2NDOA 3VFIA 3GYKA 3IOSA 1J0FA 5ECOB 1KEBA 5FWGA 2CVKA 1EEJA 2H1BA 4YKGA 5FHIA 2BJXA 2B6MA 3DKSA 5ID2B 2L6CA 2TIRA 2WFCA 1UA5A 2H66A 5ECIB 5HFKA 2DKIA 2FWEA 2OE3A 1K0MA 4TR1A 4GQFA 4KDYA 1UN2A 2GZZA 3HYPA 2YOIA 2IPAA 1F3BA 3LORA 3ISOA 4K5SA 22GSA 1EP8A 1MD3A 5HFIA 1ILOA 4MP4A 2YPMA 4F82A 1OYJA 3SBCA 1MEKA 2PBJA 3LGCA 2H0IA 1G7EA 2BTOT 1A24A 2HZFA 2WGRA 1JZDA 1JZWA 3F4SA 3LXZA 1XWKA 3FMWA 3G7YA 2H76A 3QPMA 1GUKA 2FLSA 3A2WA 4RUVA 5GAPD 4WXTA 1QXHA 3CSIA 1Z6MA 4ZXGA 5GAND 4L8EA 1K0OA 1XZOA 2JSZA 1R5AA 3KCMA 2EIRA 2H70A 3DWVA 1ZYQB 1ZYEA 2R0GA 1ZYPA 2RM6A 1NHOA 3IBHA 5JCGA 3LFLA 1O7UA 3QAWA 5IMCA 1NM3A 3US3A 3CTFA 3G7IA 3LXTA 1CQHA 1J9BA 1K3OA 4WR4A 3QD9A 4ZBDA 3CRUA 1R7HA 1ST9A 1TK5B 4OWYA 2A2PA 4ECCA 1KBNA 2R5GA 1MD4A 5A4UA 3ZFLA 2DIYA 2H1DA 4V2LA 1XXUA 1URMA 2HSMA 3GMFA 3M3MA 2CX3A 3HKRA 4PUFC 3EVIA 2C3NA 3QDNA 3RAZA 1T1VA 2GT5A 4V2MA 2GS3A 2RM5A 1IYHA 4PNGA 1EV9A 3HJOA 1FVKA 2PN8A 2OBIA 3TRPA 1XVWA 4KNDA 19GSA 3FZAA 3E0UA 3KIJA 3RPNA 2GZYA 1GSQA 3L78A 1Z7RA 1A8YA 1XCCA 3IPZA 1GSYA 3FYGA 2PMTA 3EYTA 3FRCA 6GSUA 1SK0A 5CP1A 6GSTA 1O81A 1YEXA 6GSXA 5D9WA 2L57A 3BD2A 4JE1A 6GSVA 3KP8A 5IMAA 3LJRA 5JWQB 2ON5A 2N5AA 1JLVA 1AQXA 2K8VA 2FUG2 2H72A 5D8IA 2VD0A 4OD7A 5KOWA 5IOWA 4KSOA 3W6GA 3VWVA 2HNLA 1OKTA 3TB2A 4K8MA 1B9XC 5D9TA 2B5XA 4PTSA 2LRTA 4GSNA 1BQ7A 4LLRA 3UMAA 4PURA 1RK4A 1B8XA 1GTIA 3ZMKA 4GXZA 1MDKA 1AQVA 4KDUA 4TN8A 2IMKA 2IIYA 3KTBA 2V1MA 3JCML 4MZCA 1G7OA 1FHEA 1M0UA 1TRWA 3DYRA 2CX4A 4HZ4A 2HLSA 4GF0A 1USBA 3KH7A 4POMA 3W8JA 3UOMA 4KSMA 2GSQA 3UL3A 4ZL9A 5KOXA 5KN0A 1O8WA 3P7XA 4TXVA 1X9SB 4WF5A 1Z5YE 2F8AA 1VGLA 4MZBA 1YF1A 3K8NA 5GSSA 1EOGA 2HI7A 1A2MA 4NHWA 1SK2A 3R3EA 3WGXA 1DSBA 1HNCA 3PR8A 4XRDA 3ZLPA 5HR2A 3IC4A 4TVEA 1S3CA 3FR6A 1N8JA 5JWRB 4E8EA 1X9MB 2GSSA 4ZILA 3FZ4A 3TRXA 4ULXA 1SYXA 3F4RA 4Q5QA 4GTUA 1O85A 2X64A 4FYBA 2R2JA 4KCAA 2JADA 2P31A 3KTLA 3KXOA 1BYEA 2H6ZA 3Q19A 4PQHA 2RUFA 1AQWA 5EY6A 1XWBA 4HDEA 1LU4A 5CO3A 1GSEA 2EIQA 4XHMA 5ECSA 2X8GA 4KW6A 2R4VA 1FVJA 1YQ1A 3KP9A 1M2DA 3P8WA 4GWRA 3ZREA 2YWOA 4NAXA 1E6BA 3ME7A 3HY2A 3J7Yb 3VPQA 2VM1A 2JU5A 3HHVA 3GX0A 4EIPA 2IN3A 3WGDA 5DQYA 1KNGA 3IHGA 13GSA 1Z9HA 2FHEA 4MH3A 1GUHA 2XC2A 4POBA 4A5PA 3GKNA 2ES7A 7GSSA 4P3YB 2LV3A 2O8VB 4X43A 2L5OA 1T7PB 2AV4A 5CYYA 3ZYWA 1AAZA 1XW6A 3KJYA 5A4WA 1TKDB 4AGSA 3WT1A 5LD0A 2X49A 1THOA 3TGZA 2E0QA 1YY7A 5JCUA 3GKKA 4X4JA 1PQNA 2GLRA 3EC3A 3KMNA 4ICYA 4JU5A 4XS4B 1GL8A 5EVOA 3TJJA 4ZBAA 4L0WA 4IP1A 4Q5NA 2RUEA 3EURA 3APQA 5IQYA 5IM9A 3UEMA 4OFNA 2KOKA 5HR1A 1T3BA 2PGTA 2IWTA 3WGEA 1GTAA 2V6OA 4EUYA 2UZ8A 4FH8A 2HZEA 5C00A 1HYUA 5J5NA 3OR5A 1EOHA 1GTBA 2NPBA 1FW1A 3RBTA 4EE0A 1XFLA 1ML6A 1XVQA 3HXSA 5AIXA 1OC3A 2FWGA 5F0GA 4JBBA 3C73A 1K0DA 3ED3A 5CRGA 2LJAA 2BMXA 2V2GA 4EXJA 4JR6A 5B6MA 5D73A 3QMXA 5D9VA 3ZRDA 3ZFBA 2VL2A 1U3IA 2KUCA 1EEMA 2HSHA 1K3YA 4AJ8A 3IC8A 1BAYA 2MYGA 3N5OA 3RHBA 3C7MA 2HZEB 1R26A 1TRSA 5DVBA 1PKWA 3D6IA 5AGYA 1U87A 2DMMA 2PWJA 5INYA 4IP6A 2VM2A 2GSRA 3RDWA 4ZL7A 4I2TA 3F63A 5LCZA 4V1Ag 2A2RA 14GSA 5G2ZA 2DJ3A 3VK9A 3PH9A 1EV4A 4JEDA 1EGOA 1SU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7N A;  1KTE A;  11GS A;  4LA1 A;  2YAN A;  2B7J A;  1SYR A;  3GTU A;  1GWC A;  1I9D A;  3UVH A;  3KGK A;  4EL1 A;  4N0Z A;  4HZ2 A;  1ZCP A;  3KEB A;  2QC7 A;  3GKM A;  4OO5 A;  4X0X A;  4MJE A;  1F37 A;  2LTK A;  4TW5 A;  2WDU A;  4QQ7 A;  2CZ2 A;  2P0G A;  5C04 A;  1B4P A;  1QUW A;  4KAE A;  3TKS E;  2H19 A;  4ZB9 A;  4MLY A;  4MF6 A;  2OAC A;  3J7Y k;  1YZX A;  1TW9 A;  1DBY A;  3TKS A;  3ZZX A;  1A8L A;  1UC7 A;  2CVD A;  3ME8 A;  1YEP A;  2M80 A;  4XS1 A;  1PA3 A;  2C3Q A;  3UAP A;  1SL1 B;  3GTU B;  5AIV A;  3FR9 A;  4WET A;  3APO A;  4BWS A;  1YKA A;  1GLQ A;  2HYX A;  2LJK A;  1Y6E A;  1JZR A;  3MSZ A;  1TI1 A;  1VRS D;  1RQM A;  2X8H A;  3CSH A;  4ZIJ A;  3QFA C;  1AXD A;  18GS A;  1GLP A;  10GS A;  3WD6 A;  1R4W A;  3IE3 A;  3BCI A;  1EZK A;  2VD1 A;  2LRC A;  2LNS A;  2PUK C;  3H79 A;  3EU3 A;  5F06 A;  2AB6 A;  3IHQ A;  4YAP A;  5DCH A;  1PD2 1;  3A3T A;  2L4C A;  5B7C A;  3C1S A;  1EP7 A;  1V58 A;  2N5B A;  5G31 A;  2GTU A;  4EF0 A;  2VL9 A;  4TR3 A;  1ERT A;  3I9V 2;  1SJZ A;  5ECM B;  3MNG A;  3LYK A;  4DEJ A;  1MDJ A;  3SWL A;  1WWJ A;  3UJ1 A;  3VUR A;  1Z7P A;  1BED A;  2YJH A;  1GH2 A;  2KP1 A;  5IMF A;  1TU8 A;  2D2Z A;  1Z6N A;  4IKH A;  4HU7 A;  3AY8 A;  1B48 A;  1X5D A;  1A2L A;  3G7J A;  4XS6 A;  3H4K A;  3D5J A;  2REM A;  2AAW A;  4WEY A;  4FYC A;  4G2E A;  5JWO B;  1B4Q A;  3U6V A;  3FY7 A;  2WCI A;  3FR3 A;  4F2I A;  2HE3 A;  1MDI A;  2H73 A;  1XOB A;  2HT9 A;  6GSY A;  3VWX A;  5G1L A;  4ML1 A;  2F51 A;  4MJC A;  2E2G A;  3IK7 A;  1Q98 A;  4N11 A;  5DJM A;  2L6D A;  5ECP B;  1T00 A;  1MTC A;  4KE3 A;  5CRE A;  4LL4 B;  2HSY A;  1NHY A;  4G19 A;  5H5S A;  1ZZY A;  3F6D A;  3GST A;  3QAV A;  4HQS A;  3TJF A;  3TJB A;  2H75 A;  3DRN A;  4FIW A;  1SL2 B;  3CRT A;  2JSY A;  1SJ6 A;  5EL8 A;  3HVV A;  2H1A A;  3D4T A;  3IR4 A;  2MZC A;  5HR0 A;  4HQZ A;  5D93 A;  3KZQ A;  2CQ9 A;  4NV5 A;  1A0F A;  4TR0 A;  3U5R E;  1TTZ A;  3V1W A;  1CQG A;  4ECB A;  2GQM A;  3IDV A;  4F0C A;  2Z9S A;  2GGT A;  3TKR A;  1G0T A;  5DBQ A;  2C1Y A;  1PKZ A;  2LST A;  2V41 A;  5IOX A;  1ZGN A;  2PPT A;  1B9Y C;  1ABA A;  2IMI A;  1SJI A;  4POL A;  3GFK A;  1N2A A;  3DVX A;  1V9W A;  1ZMA A;  3ERW A;  4CDO A;  5J41 A;  1FG4 A;  1ERU A;  5DJL A;  3IAM 2;  2G2Q A;  4DVC A;  1PRX A;  5D96 A;  3F3Q A;  2FD3 A;  2V32 A;  2C4J A;  4AJ6 A;  3I6A A;  2M46 A;  3FZ5 A;  5IO2 A;  5L71 A;  1G6Y A;  2FGX A;  2C0E A;  1BX9 A;  2VLT A;  1VF1 A;  4BWQ A;  4JZQ A;  1PL1 A;  3FW2 A;  1XOA A;  4Z7X A;  3GV1 A;  3N9J A;  1GTU A;  2LJR A;  4O7H A;  2B3S A;  2B7K A;  2RLI A;  2GT6 A;  2C3T A;  1K0N A;  4HJM A;  4N30 A;  1SD9 A;  1JLW A;  4NXI A;  3D4M A;  2O87 A;  2LQQ A;  3A2X A;  5DDL A;  4K7O A;  2V6K A;  3UAR A;  4DSS A;  1Y25 A;  2CVB A;  2KLX A;  5G30 A;  1TOF A;  5CAX A;  1XPV A;  2VCQ A;  4GLT A;  1K0C A;  2IMF A;  1WIK A;  4HS1 A;  4LMW A;  1A23 A;  3D21 A;  3IRA A;  2MMA A;  3GHA A;  1EGR A;  3H93 A;  4MCU A;  3DEX A;  4IN0 A;  4ISD A;  4DSQ A;  4K2D A;  4ZBB A;  2XBI A;  4F9Z A;  5F05 A;  1FO5 A;  4MAB A;  2HXK A;  4K0G A;  2VCV A;  2X99 A;  2VCT A;  5ECL B;  3HA9 A;  3DGQ A;  2GDR A;  4BPY A;  1QMV A;  3GX8 A;  2FCH A;  1WE0 A;  4JRR A;  3HDC A;  2GQK A;  2CZ3 A;  3L9U A;  1V40 A;  3W8S A;  2OBK A;  4L5O A;  3D22 A;  2B1L A;  4XS4 A;  4DSS B;  2H30 A;  1GP1 A;  4RQX A;  2LS5 A;  4TOP A;  2C0G A;  5KN2 A;  1XBS A;  2WB9 A;  4FO5 A;  1K0B A;  2G0F A;  3P90 A;  3VWU A;  2MMZ A;  4JR4 A;  1M9A A;  4KA0 A;  2QKE A;  4XTS A;  3Q74 A;  1ZL9 A;  2GQL A;  3LWA A;  2L4Q A;  3HZ4 A;  3IA1 A;  5J3R A;  2DJ1 A;  1QQ2 A;  3QAG A;  1AW9 A;  1M2B A;  2I81 A;  4KX4 A;  3QFB C;  1H4O A;  6GSW A;  1K3L A;  2OA7 A;  1WPI A;  1DE2 A;  1TRU A;  5B8A A;  1H75 A;  4TKY A;  3EIN A;  4CHS A;  1V57 A;  3PGT A;  3ZIJ A;  3ERF A;  3L9S A;  1PL2 A;  1YF0 A;  4Q5F A;  1F3A A;  2IL3 A;  2R37 A;  3GKX A;  3TJG A;  1W89 A;  3QCP A;  5ENU A;  2VOC A;  4L5L A;  3C1R A;  2H0H A;  3TUE A;  1SKW B;  2K8S A;  4H86 A;  2I4A A;  3F3R A;  2YNX A;  1FB0 A;  5G5E A;  4TXO A;  2QGV A;  2YWI A;  3TDG A;  1I5G A;  4ECI A;  3M8N A;  5KN3 A;  4OFT A;  5ECN B;  2K9F A;  1XIY A;  2H6X A;  2ON7 A;  5IPG A;  3E9J B;  1PX7 A;  4RI6 A;  4IQA A;  12GS A;  1ON4 A;  2VCW A;  1U6T A;  3EWL A;  3F4T A;  2JZS A;  3GL5 A;  1FOV A;  3GRX A;  4ZB8 A;  5IIZ A;  4OFM A;  4IHU A;  2JZT A;  4D73 B;  4OMV A;  1U88 A;  2VLU A;  2AUV A;  1OE7 A;  3TKS C;  2YWM A;  1J08 A;  1DUG A;  3ZTL A;  3H1N A;  1WMJ A;  4EC0 A;  5HQP A;  2C0D A;  2OAD A;  4O32 A;  4TXO B;  3ZML A;  1JZO A;  3KD0 A;  4E8H A;  3KM6 A;  5IMZ A;  3F8U A;  2WZ9 A;  3F6F A;  3TOT A;  1THX A;  3M9K A;  1TP9 A;  2K6V A;  1S3D A;  2DML A;  4HJ2 A;  3TRQ A;  5DAL A;  1OC8 A;  5H5Q A;  5J9B A;  1WRY A;  2CT6 A;  4GQC A;  2DJ2 A;  2PU9 C;  4IVF A;  3RPP A;  1M7T A;  1WOU A;  1OKD A;  2CAQ A;  4NV2 A;  1ERV A;  1ZOF A;  2LEG A;  1YJ6 A;  2MMN A;  3IK9 A;  1GSU A;  3GL3 A;  5AN1 A;  2HRF A;  1VF2 A;  1T4Z A;  2HRN A;  2R6K A;  2IME A;  1YDK A;  2QSI A;  3F9U A;  5KN1 A;  2LNT A;  2VCX A;  1F2E A;  1LJR A;  2FWF A;  4G9H A;  2YWN A;  1OE8 A;  1W4V A;  1O8X A;  5DAL B;  3WYW A;  2I1U A;  2A4V A;  1DE1 A;  3KMO A;  4PXO A;  2JL4 A;  4MZW A;  1XWA A;  2I9H A;  3KH9 A;  4IS0 A;  3CMI A;  1GNE A;  1QGV A;  1TK8 B;  2IFQ A;  3C71 A;  5CRD A;  3NOF A;  4N10 A;  2B5Y A;  4PUA A;  4YQM A;  3LSZ A;  1TRV A;  4KGI A;  2H0G A;  2YZH A;  1AC1 A;  5GZZ B;  5ABR A;  5J9C A;  5JCW A;  3O3T A;  1EWX A;  3Q6O A;  4BVX A;  5LNK e;  3VPT A;  5ELG A;  3IXR A;  4PGT A;  2XHF A;  5G1K A;  2DIZ A;  3VLN A;  2NVL A;  8GSS A;  4POK A;  1C72 A;  3QOU A;  2YV7 A;  3CSJ A;  3MDK A;  4J56 E;  5CRW A;  2IFQ B;  3S9F A;  2H01 A;  1G6W A;  2WRT A;  2MBS A;  5H5R A;  4XCS A;  2M72 A;  4GRF A;  2OKA A;  1PGT A;  3HVS A;  2ZUP A;  4MPF A;  4HU9 A;  2KP2 A;  4HUA A;  2DSA A;  1O73 A;  2RII A;  6GSS A;  2MMO A;  9GSS A;  4WBJ A;  4MJA A;  1X5E A;  20GS A;  4NHZ A;  4DSR A;  4EDZ A;  3GIX A;  1M99 A;  2AHE A;  3HJM A;  4TR1 B;  1BG5 A;  3HCZ A;  3BJ5 A;  3ZIT A;  1HNB A;  2EIO A;  4TR4 A;  3FHK A;  2DJK A;  2LRN A;  2F3M A;  4K1F A;  4NPB A;  2WJU A;  5DCG A;  2J23 A;  1V98 A;  4HEA 2;  1AIU A;  2L59 A;  3I69 A;  2IJY A;  1XW5 A;  2B1K A;  3NIV A;  3TJK A;  3GNJ A;  5HR3 A;  4MF5 A;  4OCE A;  3IV4 A;  3M9J A;  4F03 A;  4KB3 A;  4CW9 A;  2GST A;  4V1A p;  3LEF A;  2VAF A;  4K6X A;  1R5P A;  5ECK B;  3GUS A;  1Z3E A;  2X8C A;  3L4N A;  1FAA A;  3DXB A;  1GSS A;  1XW9 A;  2H8L A;  4HI7 A;  2E2M A;  2LKU A;  3LQ7 A;  4ML6 A;  1XWC A;  4HOJ A;  4EDY A;  3GH6 A;  2H6Y A;  2I3Y A;  1SKR B;  4I8B A;  3TCO A;  1K0A A;  1FB6 A;  3A5W A;  2AJQ B;  1F6M C;  3DML A;  5ELA A;  3I43 A;  3VWW A;  3GN3 A;  4LMV A;  3CXG A;  3G9B A;  3FZ9 A;  2YV9 A;  3BCK A;  3BBY A;  4I97 A;  4XRA A;  2DJJ A;  3EE2 A;  4O5R A;  4I5Q A;  4N0V A;  2VL3 A;  2GVP A;  3CYN A;  3GA4 A;  5E59 A;  4QL9 A;  3WT2 A;  2PVQ A;  2TRC P;  4MDC A;  1ERW A;  1RW1 A;  4XIH A;  3M1G A;  2IMD A;  1M9B A;  2TRX A;  4QL7 A;  1VF3 A;  4YQV A;  1TI3 A;  4PQ1 A;  3ERG A;  4IW9 A;  5IMV A;  1PSQ A;  5KEJ A;  4EVM A;  3FKF A;  3HZ8 A;  1GNW A;  1WJK A;  4KCE A;  2KHP A;  5ECH B;  3FK8 A;  2CA8 A;  4MMM A;  4GSS A;  2JZR A;  1ACV A;  2XPE A;  1V2A A;  2PVO C;  3O6T A;  3ZIV A;  5G5F A;  4J2F A;  3ZVJ A;  1OVN A;  2WUL A;  1TU7 A;  2F8F A;  3UBL A;  2OE1 A;  2C80 A;  1LBK A;  4FYU A;  2LUS A;  4OO4 A;  5ECR B;  4GST A;  4PNF A;  1GUL A;  3GSS A;  2GZP A;  3L0H A;  4TRX A;  3FEU A;  3APS A;  3UBK A;  2WS2 A;  4AJ7 A;  1GRX A;  2F9S A;  4IGJ A;  4IJI A;  4RI7 A;  2OJL A;  2L5L A;  3CBU A;  1JHB A;  1SKS B;  5COH A;  2YJ7 A;  5ECQ B;  2DJ0 A;  1U3A A;  1O6J A;  4I6X A;  5EPF A;  4J57 E;  3PIN A;  4KUN A;  1F9M A;  3DVW A;  2H74 A;  2H71 A;  4KH7 A;  5B6N A;  1IYI A;  2OE0 A;  2VL2 C;  2YCD A;  2YZU A;  4MA9 A;  5IPH A;  3MAK A;  4K7I A;  4IBP A;  2VCZ A;  2FA8 A;  4X1U A;  2DLX A;  1PX6 A;  1TDI A;  3DIE A;  1PN9 A;  4ZL8 A;  2P5Q A;  3GH9 A;  5GST A;  4EKZ A;  1SD8 A;  5J4U A;  4F0B A;  1X5C A;  1NW2 A;  1BJX A;  3ZVJ D;  3O76 A;  3IAS 2;  3UVT A;  1SEN A;  3CTG A;  3P2A A;  1JFU A;  2H1G A;  4D73 A;  1SK1 A;  1XWG A;  3NZN A;  3RHC A;  1Q4J A;  2FWH A;  2B5E A;  2VIM A;  4Q5R A;  2NTO A;  3Q18 A;  1GUM A;  4LL1 B;  1NSW A;  3A2V A;  1QFN A;  4YH2 A;  1AUC A;  3VI5 A;  5A5K A;  4MK3 A;  1OC9 A;  2K18 A;  1T8E B;  16GS A;  2O7K A;  4MH2 A;  3E3E A;  17GS A;  3VI7 A;  3DD3 A;  5B8B A;  1A2J A;  2C8U A;  2VLV A;  1UVZ A;  3R2Q A;  4NMU A;  4K0N A;  2ZCT A;  4IQ1 A;  1T4Y A;  1PMT A;  3F0I A;  4V2N A;  4BVY A;  2O89 A;  3HVX A;  2J9H A;  5AIS A;  2ZNM A;  4MF7 A;  4ID0 A;  1M2A A;  2FA4 A;  2PER A;  5DAK A;  1SL0 B;  5IO0 A;  2JAC A;  2MBT A;  1TXX A;  4ZB6 A;  1A0R P;  3LG6 A;  3EMX A;  4MJB A;  1OC9 B;  1S3A A;  3L9V A;  1WP0 A;  4WR5 A;  3HJP A;  3HD5 A;  3D0Z A;  5E4W A;  5A4V A;  4G10 A;  4ILF A;  4IJ3 A;  1X0R A;  4YAV A;  2LQO A;  1X9W B;  2E7P A;  2P5R A;  5D9X A;  4BA7 A;  4NWY A;  1TK0 B;  5FT3 A;  2HFD A;  3TKP A;  3MWH A;  4WF4 A;  5DAK B;  2NBS A;  3EU4 A;  3UIW A;  4PQI A;  4IEL A;  5IMD A;  1YKC A;  3C8E A;  5DQS A;  4MPG A;  5HFG A;  3LYP A;  1TJD A;  4O92 A;  2C0F A;  3BOA A;  4OCF A;  4YQU A;  2DBC A;  5F8B A;  4ACS A;  3GUR A;  2YP6 A;  1VF4 A;  3M0F A;  4BL7 A;  3QR6 A;  4I2U A;  2R3X A;  4KDX A;  2XPD A;  1GSD A;  2ALB A;  2A2S A;  4L0U A;  2VUP A;  2N5F A;  4RQR A;  5F07 A;  5ID2 A;  3TOU A;  1GSF A;  4GCI A;  2DC5 A;  1QK8 A;  3ZL5 A;  2VO4 A;  3EMP A;  4PX1 A;  2XBQ A;  4AF2 A;  2FNO A;  4EO3 A;  5CNW A;  1HQO A;  2O85 A;  2AYT A;  1OAZ A;  2FY6 A;  4WKW A;  1E2Y A;  2EC4 A;  5CRH A;  4WBR D;  2YN1 A;  3H8Q A;  3TKQ A;  2CAI A;  4ECJ A;  2CV4 A;  4K9Z A;  1HNA A;  1HD2 A;  2NDO A;  3VFI A;  3GYK A;  3IOS A;  1J0F A;  5ECO B;  1KEB A;  5FWG A;  2CVK A;  1EEJ A;  2H1B A;  5FHI A;  2BJX A;  2B6M A;  3DKS A;  5ID2 B;  2L6C A;  2TIR A;  2WFC A;  1UA5 A;  2H66 A;  5ECI B;  5HFK A;  2FWE A;  2OE3 A;  1K0M A;  4TR1 A;  4GQF A;  4KDY A;  1UN2 A;  2GZZ A;  3HYP A;  2YOI A;  2IPA A;  1F3B A;  3LOR A;  3ISO A;  22GS A;  1EP8 A;  1MD3 A;  5HFI A;  1ILO A;  4MP4 A;  2YPM A;  4F82 A;  1OYJ A;  3SBC A;  1MEK A;  2PBJ A;  3LGC A;  2H0I A;  1G7E A;  2BTO T;  1A24 A;  2HZF A;  2WGR A;  1JZD A;  1JZW A;  3F4S A;  3LXZ A;  1XWK A;  3G7Y A;  2H76 A;  3QPM A;  1GUK A;  2FLS A;  3A2W A;  4RUV A;  5GAP D;  4WXT A;  1QXH A;  3CSI A;  1Z6M A;  4ZXG A;  5GAN D;  4L8E A;  1K0O A;  1XZO A;  2JSZ A;  1R5A A;  3KCM A;  2EIR A;  2H70 A;  3DWV A;  1ZYQ B;  1ZYE A;  2RM6 A;  1NHO A;  3IBH A;  5JCG A;  3LFL A;  1O7U A;  3QAW A;  5IMC A;  1NM3 A;  3US3 A;  3CTF A;  3G7I A;  3LXT A;  1CQH A;  1J9B A;  1K3O A;  4WR4 A;  3QD9 A;  4ZBD A;  3CRU A;  1R7H A;  1ST9 A;  1TK5 B;  4OWY A;  4ECC A;  1KBN A;  2R5G A;  1MD4 A;  5A4U A;  3ZFL A;  2DIY A;  2H1D A;  4V2L A;  1XXU A;  1URM A;  3GMF A;  3M3M A;  2CX3 A;  3HKR A;  4PUF C;  3EVI A;  2C3N A;  3QDN A;  3RAZ A;  1T1V A;  2GT5 A;  4V2M A;  2GS3 A;  2RM5 A;  1IYH A;  4PNG A;  1EV9 A;  3HJO A;  1FVK A;  2PN8 A;  2OBI A;  3TRP A;  1XVW A;  4KND A;  19GS A;  3FZA A;  3E0U A;  3KIJ A;  3RPN A;  2GZY A;  1GSQ A;  3L78 A;  1Z7R A;  1A8Y A;  1XCC A;  3IPZ A;  1GSY A;  3FYG A;  2PMT A;  3EYT A;  3FRC A;  6GSU A;  1SK0 A;  5CP1 A;  6GST A;  1O81 A;  1YEX A;  6GSX A;  5D9W A;  2L57 A;  3BD2 A;  4JE1 A;  6GSV A;  3KP8 A;  5IMA A;  3LJR A;  5JWQ B;  2ON5 A;  2N5A A;  1JLV A;  1AQX A;  2K8V A;  2FUG 2;  2H72 A;  5D8I A;  2VD0 A;  4OD7 A;  5IOW A;  4KSO A;  3W6G A;  3VWV A;  2HNL A;  1OKT A;  3TB2 A;  4K8M A;  1B9X C;  5D9T A;  2B5X A;  2LRT A;  4GSN A;  1BQ7 A;  4LLR A;  3UMA A;  4PUR A;  1RK4 A;  1B8X A;  1GTI A;  3ZMK A;  4GXZ A;  1MDK A;  1AQV A;  4KDU A;  4TN8 A;  2IMK A;  2IIY A;  3KTB A;  2V1M A;  3JCM L;  4MZC A;  1G7O A;  1FHE A;  1M0U A;  1TRW A;  3DYR A;  2CX4 A;  4HZ4 A;  2HLS A;  4GF0 A;  1USB A;  3KH7 A;  4POM A;  3W8J A;  3UOM A;  4KSM A;  2GSQ A;  3UL3 A;  4ZL9 A;  5KN0 A;  1O8W A;  3P7X A;  4TXV A;  1X9S B;  4WF5 A;  1Z5Y E;  2F8A A;  1VGL A;  4MZB A;  1YF1 A;  3K8N A;  5GSS A;  1EOG A;  2HI7 A;  1A2M A;  4NHW A;  1SK2 A;  3WGX A;  1DSB A;  1HNC A;  3PR8 A;  4XRD A;  3ZLP A;  5HR2 A;  3IC4 A;  4TVE A;  1S3C A;  3FR6 A;  1N8J A;  5JWR B;  4E8E A;  1X9M B;  2GSS A;  4ZIL A;  3FZ4 A;  3TRX A;  4ULX A;  1SYX A;  3F4R A;  4Q5Q A;  4GTU A;  1O85 A;  2X64 A;  4FYB A;  2R2J A;  4KCA A;  2JAD A;  2P31 A;  3KTL A;  3KXO A;  1BYE A;  2H6Z A;  3Q19 A;  4PQH A;  2RUF A;  1AQW A;  5EY6 A;  1XWB A;  4HDE A;  1LU4 A;  5CO3 A;  1GSE A;  2EIQ A;  4XHM A;  5ECS A;  2X8G A;  4KW6 A;  2R4V A;  1FVJ A;  1YQ1 A;  3KP9 A;  1M2D A;  3P8W A;  4GWR A;  3ZRE A;  2YWO A;  4NAX A;  1E6B A;  3ME7 A;  3HY2 A;  3J7Y b;  3VPQ A;  2VM1 A;  2JU5 A;  3HHV A;  3GX0 A;  2IN3 A;  3WGD A;  5DQY A;  1KNG A;  13GS A;  1Z9H A;  2FHE A;  4MH3 A;  1GUH A;  2XC2 A;  4POB A;  3GKN A;  2ES7 A;  7GSS A;  4P3Y B;  2LV3 A;  2O8V B;  4X43 A;  2L5O A;  1T7P B;  2AV4 A;  5CYY A;  3ZYW A;  1AAZ A;  1XW6 A;  3KJY A;  5A4W A;  1TKD B;  4AGS A;  3WT1 A;  5LD0 A;  1THO A;  3TGZ A;  2E0Q A;  1YY7 A;  5JCU A;  3GKK A;  1PQN A;  2GLR A;  3EC3 A;  3KMN A;  4JU5 A;  4XS4 B;  1GL8 A;  5EVO A;  3TJJ A;  4ZBA A;  4L0W A;  4IP1 A;  4Q5N A;  2RUE A;  3EUR A;  3APQ A;  5IQY A;  5IM9 A;  3UEM A;  4OFN A;  2KOK A;  5HR1 A;  1T3B A;  2PGT A;  2IWT A;  3WGE A;  1GTA A;  2V6O A;  4EUY A;  4FH8 A;  2HZE A;  5C00 A;  1HYU A;  5J5N A;  3OR5 A;  1EOH A;  1GTB A;  2NPB A;  1FW1 A;  3RBT A;  4EE0 A;  1XFL A;  1ML6 A;  1XVQ A;  3HXS A;  5AIX A;  1OC3 A;  2FWG A;  5F0G A;  4JBB A;  3C73 A;  1K0D A;  3ED3 A;  5CRG A;  2LJA A;  2BMX A;  2V2G A;  4EXJ A;  4JR6 A;  5B6M A;  5D73 A;  3QMX A;  5D9V A;  3ZRD A;  3ZFB A;  2VL2 A;  1U3I A;  2KUC A;  1EEM A;  2HSH A;  1K3Y A;  4AJ8 A;  1BAY A;  2MYG A;  3N5O A;  3RHB A;  3C7M A;  2HZE B;  1R26 A;  1TRS A;  5DVB A;  1PKW A;  3D6I A;  5AGY A;  1U87 A;  2DMM A;  2PWJ A;  5INY A;  4IP6 A;  2VM2 A;  2GSR A;  3RDW A;  4ZL7 A;  4I2T A;  3F63 A;  5LCZ A;  4V1A g;  2A2R A;  14GS A;  5G2Z A;  2DJ3 A;  3VK9 A;  3PH9 A;  1EV4 A;  4JED A;  1EGO A;  1SU9 A; 
#chains in the Genus database with same CATH topology
 4K7N A;  1KTE A;  11GS A;  4LA1 A;  4EIQ A;  2YAN A;  2B7J A;  1SYR A;  3GTU A;  1GWC A;  1I9D A;  3UVH A;  3KGK A;  4EL1 A;  4N0Z A;  4HZ2 A;  1ZCP A;  3KEB A;  2X4A A;  2QC7 A;  3GKM A;  4OO5 A;  4X0X A;  4MJE A;  1F37 A;  2LTK A;  4TW5 A;  2WDU A;  4QQ7 A;  2CZ2 A;  2P0G A;  5C04 A;  1B4P A;  1QUW A;  4KAE A;  3TKS E;  2H19 A;  4ZB9 A;  4MLY A;  4MF6 A;  2OAC A;  3J7Y k;  1YZX A;  1TW9 A;  1DBY A;  3TKS A;  3ZZX A;  1A8L A;  1UC7 A;  2CVD A;  3ME8 A;  1YEP A;  2M80 A;  4XS1 A;  1PA3 A;  2C3Q A;  3UAP A;  1SL1 B;  3GTU B;  5AIV A;  3FR9 A;  4WET A;  3APO A;  4BWS A;  1YKA A;  1GLQ A;  2HYX A;  2LJK A;  1Y6E A;  1JZR A;  3PPU A;  3MSZ A;  1TI1 A;  1VRS D;  1RQM A;  2X8H A;  3CSH A;  4ZIJ A;  3QFA C;  1AXD A;  18GS A;  1GLP A;  10GS A;  3WD6 A;  1R4W A;  3IE3 A;  3BCI A;  1EZK A;  2VD1 A;  2LRC A;  2LNS A;  2PUK C;  3H79 A;  3EU3 A;  5F06 A;  2AB6 A;  3IHQ A;  4YAP A;  5DCH A;  1PD2 1;  3A3T A;  2L4C A;  5B7C A;  3C1S A;  1EP7 A;  1V58 A;  2N5B A;  5G31 A;  2GTU A;  4EF0 A;  2VL9 A;  4TR3 A;  1ERT A;  3I9V 2;  1SJZ A;  5ECM B;  3MNG A;  3LYK A;  4DEJ A;  1MDJ A;  3SWL A;  1WWJ A;  3UJ1 A;  3VUR A;  1Z7P A;  1BED A;  2YJH A;  1GH2 A;  2KP1 A;  5IMF A;  1TU8 A;  2D2Z A;  1Z6N A;  4IKH A;  4HU7 A;  3AY8 A;  1B48 A;  1X5D A;  1A2L A;  3G7J A;  4XS6 A;  3H4K A;  3D5J A;  2REM A;  2AAW A;  4WEY A;  4FYC A;  4G2E A;  5JWO B;  1B4Q A;  3U6V A;  3FY7 A;  2WCI A;  3FR3 A;  4F2I A;  2HE3 A;  1MDI A;  2H73 A;  1XOB A;  2HT9 A;  6GSY A;  3VWX A;  5G1L A;  4ML1 A;  2F51 A;  4MJC A;  2E2G A;  3IK7 A;  1Q98 A;  4N11 A;  5DJM A;  2L6D A;  5ECP B;  1T00 A;  1MTC A;  4KE3 A;  5CRE A;  4LL4 B;  2HSY A;  1NHY A;  4G19 A;  5H5S A;  1ZZY A;  3F6D A;  2R0P A;  3GST A;  3QAV A;  4HQS A;  3TJF A;  3TJB A;  2H75 A;  3DRN A;  4FIW A;  1SL2 B;  3CRT A;  2JSY A;  1SJ6 A;  5EL8 A;  3HVV A;  2H1A A;  3D4T A;  3IR4 A;  2MZC A;  5HR0 A;  4HQZ A;  5D93 A;  3KZQ A;  2CQ9 A;  4NV5 A;  1A0F A;  4TR0 A;  3U5R E;  1TTZ A;  3V1W A;  1CQG A;  4ECB A;  2GQM A;  3IDV A;  4F0C A;  2Z9S A;  2GGT A;  3TKR A;  1G0T A;  5DBQ A;  2C1Y A;  1PKZ A;  2LST A;  2V41 A;  5IOX A;  1ZGN A;  2PPT A;  1B9Y C;  1ABA A;  2IMI A;  1SJI A;  4POL A;  3GFK A;  1N2A A;  3DVX A;  1V9W A;  1ZMA A;  3ERW A;  4CDO A;  5J41 A;  1FG4 A;  1ERU A;  5DJL A;  3IAM 2;  2G2Q A;  4DVC A;  1PRX A;  5D96 A;  3F3Q A;  2FD3 A;  2V32 A;  2C4J A;  4AJ6 A;  3I6A A;  2M46 A;  3FZ5 A;  5IO2 A;  5L71 A;  1G6Y A;  2FGX A;  2C0E A;  1BX9 A;  2VLT A;  1VF1 A;  4BWQ A;  4JZQ A;  1PL1 A;  3FW2 A;  1XOA A;  4Z7X A;  3GV1 A;  3N9J A;  1GTU A;  2LJR A;  4O7H A;  2B3S A;  2B7K A;  2RLI A;  2GT6 A;  2C3T A;  1K0N A;  4HJM A;  4N30 A;  1SD9 A;  1JLW A;  4NXI A;  3D4M A;  2O87 A;  2LQQ A;  3A2X A;  5DDL A;  4K7O A;  2V6K A;  3UAR A;  4DSS A;  1Y25 A;  2CVB A;  2KLX A;  5G30 A;  1TOF A;  5CAX A;  1XPV A;  2VCQ A;  4GLT A;  1K0C A;  2IMF A;  1WIK A;  4HS1 A;  4LMW A;  1A23 A;  3D21 A;  3IRA A;  2MMA A;  3GHA A;  1EGR A;  3H93 A;  4MCU A;  3DEX A;  1M3I A;  4IN0 A;  4ISD A;  4DSQ A;  4K2D A;  4ZBB A;  2XBI A;  4F9Z A;  5F05 A;  1FO5 A;  2R0C A;  4MAB A;  2HXK A;  4K0G A;  2VCV A;  2X99 A;  2VCT A;  5ECL B;  3HA9 A;  3DGQ A;  2GDR A;  4BPY A;  1QMV A;  3GX8 A;  2FCH A;  4CY6 A;  1WE0 A;  4JRR A;  3HDC A;  2GQK A;  2CZ3 A;  3L9U A;  1V40 A;  3W8S A;  2OBK A;  4L5O A;  3D22 A;  2B1L A;  4XS4 A;  4DSS B;  1PN0 A;  2H30 A;  1GP1 A;  4RQX A;  2LS5 A;  4TOP A;  2C0G A;  5KN2 A;  1XBS A;  2WB9 A;  4FO5 A;  1K0B A;  2G0F A;  3P90 A;  3VWU A;  2MMZ A;  4JR4 A;  1M9A A;  4KA0 A;  2QKE A;  4XTS A;  3Q74 A;  1ZL9 A;  2GQL A;  3LWA A;  2L4Q A;  3HZ4 A;  3IA1 A;  5J3R A;  2DJ1 A;  1QQ2 A;  3QAG A;  1AW9 A;  1M2B A;  2I81 A;  4KX4 A;  3QFB C;  1H4O A;  6GSW A;  1K3L A;  2OA7 A;  1WPI A;  1DE2 A;  1TRU A;  5B8A A;  1H75 A;  4TKY A;  3EIN A;  4CHS A;  1V57 A;  3PGT A;  3ZIJ A;  3ERF A;  3L9S A;  1PL2 A;  1YF0 A;  4Q5F A;  1F3A A;  2IL3 A;  2R37 A;  3GKX A;  3TJG A;  1W89 A;  3QCP A;  5ENU A;  2VOC A;  4L5L A;  3C1R A;  2H0H A;  3TUE A;  1SKW B;  2K8S A;  4H86 A;  2I4A A;  3F3R A;  2YNX A;  1FB0 A;  5G5E A;  4TXO A;  2QGV A;  2YWI A;  3TDG A;  1I5G A;  4ECI A;  3M8N A;  5KN3 A;  4OFT A;  5ECN B;  2K9F A;  1XIY A;  2H6X A;  2ON7 A;  5IPG A;  3E9J B;  1PX7 A;  4RI6 A;  4IQA A;  12GS A;  1ON4 A;  2VCW A;  1U6T A;  3EWL A;  3F4T A;  2JZS A;  3GL5 A;  1FOV A;  3GRX A;  4ZB8 A;  5IIZ A;  4OFM A;  4IHU A;  2JZT A;  4D73 B;  4OMV A;  1U88 A;  2VLU A;  2AUV A;  1OE7 A;  3TKS C;  2YWM A;  1J08 A;  1DUG A;  3ZTL A;  3H1N A;  1WMJ A;  4EC0 A;  5HQP A;  2C0D A;  2OAD A;  4O32 A;  4TXO B;  3ZML A;  1JZO A;  4Z2R A;  3KD0 A;  4E8H A;  3KM6 A;  5IMZ A;  3F8U A;  2WZ9 A;  3F6F A;  3TOT A;  1THX A;  3M9K A;  1TP9 A;  2K6V A;  1S3D A;  2DML A;  4HJ2 A;  3TRQ A;  5DAL A;  1OC8 A;  5H5Q A;  5J9B A;  1WRY A;  2CT6 A;  4GQC A;  2DKH A;  2DJ2 A;  2PU9 C;  4IVF A;  3RPP A;  1FOH A;  1M7T A;  4BVY B;  1WOU A;  1OKD A;  2CAQ A;  4NV2 A;  4O5Q A;  1ERV A;  1ZOF A;  2LEG A;  1YJ6 A;  2MMN A;  3IK9 A;  1GSU A;  3GL3 A;  5AN1 A;  2HRF A;  1VF2 A;  1T4Z A;  2HRN A;  2R6K A;  2IME A;  1YDK A;  2QSI A;  3F9U A;  5KN1 A;  2LNT A;  2VCX A;  1F2E A;  1LJR A;  2FWF A;  4G9H A;  2YWN A;  1OE8 A;  1W4V A;  1O8X A;  5DAL B;  3WYW A;  2I1U A;  2A4V A;  1DE1 A;  3KMO A;  4PXO A;  2JL4 A;  4MZW A;  1XWA A;  2I9H A;  3KH9 A;  4G0K A;  4IS0 A;  3CMI A;  1GNE A;  4CY8 A;  1QGV A;  1TK8 B;  2IFQ A;  3C71 A;  5CRD A;  3NOF A;  4N10 A;  2B5Y A;  4PUA A;  4YQM A;  5BMU A;  3LSZ A;  1TRV A;  3A5I A;  4KGI A;  2H0G A;  2YZH A;  1AC1 A;  5GZZ B;  5ABR A;  5J9C A;  5JCW A;  3O3T A;  1EWX A;  3Q6O A;  4BVX A;  5LNK e;  3VPT A;  5ELG A;  3IXR A;  4PGT A;  2XHF A;  5G1K A;  2DIZ A;  3VLN A;  4G0L A;  2NVL A;  8GSS A;  4G0I A;  4POK A;  1C72 A;  3QOU A;  3MIX A;  2YV7 A;  3CSJ A;  3MDK A;  4J56 E;  5CRW A;  2IFQ B;  3S9F A;  2H01 A;  1G6W A;  4USS A;  2WRT A;  2MBS A;  5H5R A;  4XCS A;  2M72 A;  4GRF A;  2OKA A;  1PGT A;  3HVS A;  2ZUP A;  4MPF A;  4HU9 A;  2KP2 A;  4HUA A;  2DSA A;  1O73 A;  2RII A;  6GSS A;  2MMO A;  9GSS A;  4BVX B;  4WBJ A;  4MJA A;  1X5E A;  20GS A;  4NHZ A;  4DSR A;  4EDZ A;  3GIX A;  1M99 A;  2AHE A;  3HJM A;  4TR1 B;  1BG5 A;  3HCZ A;  3BJ5 A;  3ZIT A;  1HNB A;  2EIO A;  4TR4 A;  3FHK A;  2DJK A;  2LRN A;  2F3M A;  4K1F A;  4NPB A;  2WJU A;  4K5R A;  5DCG A;  2J23 A;  1V98 A;  4HEA 2;  1AIU A;  2L59 A;  3I69 A;  2IJY A;  1XW5 A;  2B1K A;  3NIV A;  3TJK A;  3GNJ A;  5HR3 A;  4MF5 A;  4OCE A;  3IV4 A;  3M9J A;  4F03 A;  4KB3 A;  4CW9 A;  2GST A;  4V1A p;  1ZYN A;  3LEF A;  2VAF A;  4K6X A;  1R5P A;  5ECK B;  3GUS A;  1Z3E A;  2X8C A;  3L4N A;  1FAA A;  3DXB A;  1GSS A;  4Z2T A;  1XW9 A;  2H8L A;  4HI7 A;  2E2M A;  2LKU A;  3LQ7 A;  4ML6 A;  1XWC A;  4HOJ A;  4EDY A;  3GH6 A;  2A4H A;  2H6Y A;  4YKF A;  2I3Y A;  1SKR B;  4I8B A;  3TCO A;  1K0A A;  1FB6 A;  3A5W A;  2AJQ B;  1F6M C;  3DML A;  5ELA A;  3I43 A;  3VWW A;  3GN3 A;  4LMV A;  3CXG A;  2HRK A;  3G9B A;  3FZ9 A;  2YV9 A;  3BCK A;  3BBY A;  4I97 A;  4XRA A;  2DJJ A;  3EE2 A;  4O5R A;  4I5Q A;  4N0V A;  2VL3 A;  2GVP A;  3CYN A;  3GA4 A;  5E59 A;  4QL9 A;  3WT2 A;  2PVQ A;  2TRC P;  4MDC A;  1ERW A;  1RW1 A;  4XIH A;  3M1G A;  2IMD A;  1M9B A;  2TRX A;  4QL7 A;  1VF3 A;  4YQV A;  1TI3 A;  4PQ1 A;  3ERG A;  4IW9 A;  5IMV A;  1PSQ A;  5KEJ A;  4EVM A;  3FKF A;  3HZ8 A;  1GNW A;  1WJK A;  4KCE A;  2KHP A;  5ECH B;  3FK8 A;  2CA8 A;  4MMM A;  4GSS A;  2JZR A;  1ACV A;  2XPE A;  1V2A A;  2PVO C;  3O6T A;  3ZIV A;  5G5F A;  4J2F A;  3ZVJ A;  1OVN A;  2WUL A;  1TU7 A;  2F8F A;  3UBL A;  2OE1 A;  2C80 A;  1LBK A;  4FYU A;  2LUS A;  4OO4 A;  5ECR B;  4GST A;  4PNF A;  4BIK A;  1GUL A;  3GSS A;  2GZP A;  3L0H A;  4TRX A;  3FEU A;  3APS A;  3UBK A;  2HRA A;  2WS2 A;  4AJ7 A;  1GRX A;  2F9S A;  4IGJ A;  4IJI A;  4RI7 A;  2OJL A;  2L5L A;  3CBU A;  1JHB A;  5BRT A;  1SKS B;  5COH A;  2YJ7 A;  5ECQ B;  2DJ0 A;  1U3A A;  1O6J A;  4I6X A;  5EPF A;  4J57 E;  3PIN A;  4KUN A;  1F9M A;  3DVW A;  2H74 A;  2H71 A;  4KH7 A;  5B6N A;  1IYI A;  2OE0 A;  2VL2 C;  2YCD A;  2YZU A;  4MA9 A;  5IPH A;  3MAK A;  4K7I A;  4IBP A;  2VCZ A;  2FA8 A;  4X1U A;  2DLX A;  1PX6 A;  1TDI A;  3DIE A;  1PN9 A;  4ZL8 A;  2P5Q A;  3GH9 A;  5GST A;  4EKZ A;  1SD8 A;  5J4U A;  4F0B A;  3LW9 A;  1X5C A;  1NW2 A;  1BJX A;  3ZVJ D;  3O76 A;  3IAS 2;  3UVT A;  1SEN A;  3CTG A;  3P2A A;  1JFU A;  2H1G A;  3MYD A;  4D73 A;  1SK1 A;  1XWG A;  3NZN A;  3RHC A;  1Q4J A;  2FWH A;  2B5E A;  2VIM A;  4Q5R A;  2NTO A;  3Q18 A;  1GUM A;  4LL1 B;  1NSW A;  3A2V A;  2QA2 A;  1QFN A;  4YH2 A;  1AUC A;  3VI5 A;  5A5K A;  4MK3 A;  1OC9 A;  2K18 A;  1T8E B;  16GS A;  2O7K A;  4MH2 A;  3E3E A;  17GS A;  3VI7 A;  3DD3 A;  5B8B A;  1A2J A;  2C8U A;  4O5U A;  2VLV A;  1UVZ A;  3R2Q A;  4NMU A;  4K0N A;  2ZCT A;  4IQ1 A;  1T4Y A;  1PMT A;  3F0I A;  4V2N A;  4K2X A;  4BVY A;  2O89 A;  3HVX A;  2J9H A;  5AIS A;  2ZNM A;  4MF7 A;  4ID0 A;  1M2A A;  2FA4 A;  2PER A;  4KF9 A;  5DAK A;  1SL0 B;  5IO0 A;  2JAC A;  2MBT A;  1TXX A;  4ZB6 A;  4FQU A;  1A0R P;  3LG6 A;  3EMX A;  4MJB A;  1OC9 B;  1S3A A;  3L9V A;  1WP0 A;  4WR5 A;  3HJP A;  3HD5 A;  3D0Z A;  5E4W A;  5A4V A;  4G10 A;  4ILF A;  4IJ3 A;  3EPT A;  1X0R A;  4YAV A;  2LQO A;  1X9W B;  2E7P A;  2P5R A;  5D9X A;  4BA7 A;  4NWY A;  1TK0 B;  5FT3 A;  2HFD A;  3TKP A;  3MWH A;  4WF4 A;  5DAK B;  2NBS A;  3EU4 A;  3UIW A;  4PQI A;  4IEL A;  5IMD A;  1YKC A;  3C8E A;  5DQS A;  4MPG A;  5HFG A;  3LYP A;  1TJD A;  4O92 A;  2C0F A;  3BOA A;  4OCF A;  4YQU A;  2DBC A;  5F8B A;  4ACS A;  3GUR A;  2YP6 A;  1VF4 A;  3M0F A;  2QA1 A;  4BL7 A;  3QR6 A;  4I2U A;  2R3X A;  4KDX A;  2XPD A;  1GSD A;  2ALB A;  2A2S A;  4L0U A;  2VUP A;  2N5F A;  4RQR A;  5F07 A;  4HSC X;  5ID2 A;  3TOU A;  1GSF A;  4GCI A;  2DC5 A;  1QK8 A;  3ZL5 A;  2VO4 A;  3EMP A;  4PX1 A;  2XBQ A;  4AF2 A;  4MNN A;  2FNO A;  4EO3 A;  5CNW A;  1HQO A;  2O85 A;  2AYT A;  1OAZ A;  2FY6 A;  4WKW A;  1E2Y A;  2EC4 A;  5CRH A;  4WBR D;  2YN1 A;  3H8Q A;  3TKQ A;  2CAI A;  4ECJ A;  2CV4 A;  4K9Z A;  4Z2U A;  1HNA A;  1HD2 A;  4BL7 B;  2NDO A;  3VFI A;  3GYK A;  3IOS A;  1J0F A;  5ECO B;  1KEB A;  5FWG A;  2CVK A;  1EEJ A;  2H1B A;  4YKG A;  5FHI A;  2BJX A;  2B6M A;  3DKS A;  5ID2 B;  2L6C A;  2TIR A;  2WFC A;  1UA5 A;  2H66 A;  5ECI B;  5HFK A;  2DKI A;  2FWE A;  2OE3 A;  1K0M A;  4TR1 A;  4GQF A;  4KDY A;  1UN2 A;  2GZZ A;  3HYP A;  2YOI A;  2IPA A;  3CQF A;  1F3B A;  3LOR A;  3ISO A;  4K5S A;  22GS A;  1EP8 A;  1MD3 A;  5HFI A;  1ILO A;  4MP4 A;  2YPM A;  4F82 A;  1OYJ A;  3SBC A;  1MEK A;  2PBJ A;  3LGC A;  2H0I A;  1G7E A;  2BTO T;  1A24 A;  2HZF A;  2WGR A;  1JZD A;  1JZW A;  3F4S A;  3LXZ A;  1XWK A;  3FMW A;  3G7Y A;  2H76 A;  3QPM A;  1GUK A;  2FLS A;  3A2W A;  4RUV A;  5GAP D;  4WXT A;  1QXH A;  3CSI A;  1Z6M A;  4ZXG A;  5GAN D;  4L8E A;  1K0O A;  1XZO A;  2JSZ A;  1R5A A;  3KCM A;  2EIR A;  2H70 A;  3DWV A;  1ZYQ B;  1ZYE A;  2R0G A;  1ZYP A;  2RM6 A;  1NHO A;  3IBH A;  5JCG A;  3LFL A;  1O7U A;  3QAW A;  5IMC A;  1NM3 A;  3US3 A;  3CTF A;  3G7I A;  3LXT A;  1CQH A;  1J9B A;  1K3O A;  4WR4 A;  3QD9 A;  4ZBD A;  3CRU A;  1R7H A;  1ST9 A;  1TK5 B;  4OWY A;  2A2P A;  4ECC A;  1KBN A;  2R5G A;  1MD4 A;  5A4U A;  3ZFL A;  2DIY A;  2H1D A;  4V2L A;  1XXU A;  1URM A;  2HSM A;  3GMF A;  3M3M A;  2CX3 A;  3HKR A;  4PUF C;  3EVI A;  2C3N A;  3QDN A;  3RAZ A;  1T1V A;  1S3R A;  2GT5 A;  4V2M A;  2GS3 A;  2RM5 A;  1IYH A;  4PNG A;  1EV9 A;  3HJO A;  1FVK A;  2PN8 A;  2OBI A;  3TRP A;  1XVW A;  4KND A;  19GS A;  3FZA A;  3E0U A;  3KIJ A;  3RPN A;  2GZY A;  1GSQ A;  3L78 A;  1Z7R A;  1A8Y A;  1XCC A;  3IPZ A;  1GSY A;  3FYG A;  2PMT A;  3EYT A;  3FRC A;  6GSU A;  1SK0 A;  5CP1 A;  6GST A;  1O81 A;  1YEX A;  6GSX A;  5D9W A;  2L57 A;  3BD2 A;  4JE1 A;  6GSV A;  3KP8 A;  5IMA A;  3LJR A;  5JWQ B;  2ON5 A;  2N5A A;  1JLV A;  1AQX A;  2K8V A;  2FUG 2;  2H72 A;  5D8I A;  2VD0 A;  4OD7 A;  5KOW A;  5IOW A;  4KSO A;  3W6G A;  3VWV A;  2HNL A;  1OKT A;  3TB2 A;  4K8M A;  1B9X C;  5D9T A;  2B5X A;  4PTS A;  2LRT A;  4GSN A;  1BQ7 A;  4LLR A;  3UMA A;  4PUR A;  1RK4 A;  1B8X A;  1GTI A;  3ZMK A;  4GXZ A;  1MDK A;  1AQV A;  1PFO A;  4KDU A;  4TN8 A;  2IMK A;  2IIY A;  3KTB A;  2V1M A;  3JCM L;  4MZC A;  1G7O A;  1FHE A;  1M0U A;  1TRW A;  3DYR A;  2CX4 A;  4HZ4 A;  2HLS A;  4GF0 A;  1USB A;  3KH7 A;  4POM A;  3W8J A;  3UOM A;  4KSM A;  2GSQ A;  3UL3 A;  4ZL9 A;  5KOX A;  5KN0 A;  1O8W A;  3P7X A;  4TXV A;  1X9S B;  4WF5 A;  1Z5Y E;  2F8A A;  1VGL A;  4MZB A;  1YF1 A;  3K8N A;  5GSS A;  1EOG A;  2HI7 A;  1A2M A;  4NHW A;  1SK2 A;  3R3E A;  3WGX A;  1DSB A;  1HNC A;  3PR8 A;  4XRD A;  3ZLP A;  5HR2 A;  3IC4 A;  4TVE A;  1S3C A;  3FR6 A;  1N8J A;  5JWR B;  4E8E A;  1X9M B;  2GSS A;  4ZIL A;  3FZ4 A;  3TRX A;  4ULX A;  1SYX A;  3F4R A;  4Q5Q A;  4GTU A;  1O85 A;  2X64 A;  4FYB A;  2R2J A;  4KCA A;  2JAD A;  2P31 A;  3KTL A;  3KXO A;  1BYE A;  2H6Z A;  3Q19 A;  4PQH A;  2RUF A;  1AQW A;  5EY6 A;  1XWB A;  4HDE A;  1LU4 A;  5CO3 A;  1GSE A;  2EIQ A;  4XHM A;  5ECS A;  2X8G A;  4KW6 A;  2R4V A;  1FVJ A;  1YQ1 A;  3KP9 A;  1M2D A;  3P8W A;  4GWR A;  3ZRE A;  2YWO A;  4NAX A;  1E6B A;  3ME7 A;  3HY2 A;  3J7Y b;  3VPQ A;  2VM1 A;  2JU5 A;  3HHV A;  3GX0 A;  4EIP A;  2IN3 A;  3WGD A;  5DQY A;  1KNG A;  3IHG A;  13GS A;  1Z9H A;  2FHE A;  4MH3 A;  1GUH A;  2XC2 A;  4POB A;  4A5P A;  3GKN A;  2ES7 A;  7GSS A;  4P3Y B;  2LV3 A;  2O8V B;  4X43 A;  2L5O A;  1T7P B;  2AV4 A;  5CYY A;  3ZYW A;  1AAZ A;  1XW6 A;  3KJY A;  5A4W A;  1TKD B;  4AGS A;  3WT1 A;  5LD0 A;  2X49 A;  1THO A;  3TGZ A;  2E0Q A;  1YY7 A;  5JCU A;  3GKK A;  4X4J A;  1PQN A;  2GLR A;  3EC3 A;  3KMN A;  4ICY A;  4JU5 A;  4XS4 B;  1GL8 A;  5EVO A;  3TJJ A;  4ZBA A;  4L0W A;  4IP1 A;  4Q5N A;  2RUE A;  3EUR A;  3APQ A;  5IQY A;  5IM9 A;  3UEM A;  4OFN A;  2KOK A;  5HR1 A;  1T3B A;  3HVN A;  2PGT A;  2IWT A;  3WGE A;  1GTA A;  2V6O A;  4EUY A;  2UZ8 A;  4FH8 A;  2HZE A;  5C00 A;  1HYU A;  5J5N A;  3OR5 A;  1EOH A;  1GTB A;  2NPB A;  1FW1 A;  3RBT A;  4EE0 A;  1M3J A;  1XFL A;  1ML6 A;  1XVQ A;  3HXS A;  5AIX A;  1OC3 A;  2FWG A;  5F0G A;  4JBB A;  3C73 A;  1K0D A;  3ED3 A;  5CRG A;  2LJA A;  2BMX A;  2V2G A;  4EXJ A;  4JR6 A;  5B6M A;  5D73 A;  3QMX A;  5D9V A;  3ZRD A;  3ZFB A;  2VL2 A;  1U3I A;  2KUC A;  1EEM A;  2HSH A;  1K3Y A;  4AJ8 A;  3IC8 A;  1BAY A;  2MYG A;  3N5O A;  3RHB A;  3C7M A;  2HZE B;  1R26 A;  1TRS A;  5DVB A;  1PKW A;  3D6I A;  5AGY A;  1U87 A;  2DMM A;  2PWJ A;  5INY A;  4IP6 A;  2VM2 A;  2GSR A;  3RDW A;  4ZL7 A;  4I2T A;  3F63 A;  5LCZ A;  4V1A g;  2A2R A;  14GS A;  5G2Z A;  1XG8 A;  2DJ3 A;  3VK9 A;  3PH9 A;  1EV4 A;  4JED A;  1EGO A;  1SU9 A; 
#chains in the Genus database with same CATH homology
 4K7N A;  1KTE A;  11GS A;  4LA1 A;  4EIQ A;  2YAN A;  2B7J A;  1SYR A;  3GTU A;  1GWC A;  1I9D A;  3UVH A;  3KGK A;  4EL1 A;  4N0Z A;  4HZ2 A;  1ZCP A;  3KEB A;  2X4A A;  2QC7 A;  3GKM A;  4OO5 A;  4X0X A;  4MJE A;  1F37 A;  2LTK A;  4TW5 A;  2WDU A;  4QQ7 A;  2CZ2 A;  2P0G A;  5C04 A;  1B4P A;  1QUW A;  4KAE A;  3TKS E;  2H19 A;  4ZB9 A;  4MLY A;  4MF6 A;  2OAC A;  3J7Y k;  1YZX A;  1TW9 A;  1DBY A;  3TKS A;  3ZZX A;  1A8L A;  1UC7 A;  2CVD A;  3ME8 A;  1YEP A;  2M80 A;  4XS1 A;  1PA3 A;  2C3Q A;  3UAP A;  1SL1 B;  3GTU B;  5AIV A;  3FR9 A;  4WET A;  3APO A;  4BWS A;  1YKA A;  1GLQ A;  2HYX A;  2LJK A;  1Y6E A;  1JZR A;  3PPU A;  3MSZ A;  1TI1 A;  1VRS D;  1RQM A;  2X8H A;  3CSH A;  4ZIJ A;  3QFA C;  1AXD A;  18GS A;  1GLP A;  10GS A;  3WD6 A;  1R4W A;  3IE3 A;  3BCI A;  1EZK A;  2VD1 A;  2LRC A;  2LNS A;  2PUK C;  3H79 A;  3EU3 A;  5F06 A;  2AB6 A;  3IHQ A;  4YAP A;  5DCH A;  1PD2 1;  3A3T A;  2L4C A;  5B7C A;  3C1S A;  1EP7 A;  1V58 A;  2N5B A;  5G31 A;  2GTU A;  4EF0 A;  2VL9 A;  4TR3 A;  1ERT A;  3I9V 2;  1SJZ A;  5ECM B;  3MNG A;  3LYK A;  4DEJ A;  1MDJ A;  3SWL A;  1WWJ A;  3UJ1 A;  3VUR A;  1Z7P A;  1BED A;  2YJH A;  1GH2 A;  2KP1 A;  5IMF A;  1TU8 A;  2D2Z A;  1Z6N A;  4IKH A;  4HU7 A;  3AY8 A;  1B48 A;  1X5D A;  1A2L A;  3G7J A;  4XS6 A;  3H4K A;  3D5J A;  2REM A;  2AAW A;  4WEY A;  4FYC A;  4G2E A;  5JWO B;  1B4Q A;  3U6V A;  3FY7 A;  2WCI A;  3FR3 A;  4F2I A;  2HE3 A;  1MDI A;  2H73 A;  1XOB A;  2HT9 A;  6GSY A;  3VWX A;  5G1L A;  4ML1 A;  2F51 A;  4MJC A;  2E2G A;  3IK7 A;  1Q98 A;  4N11 A;  5DJM A;  2L6D A;  5ECP B;  1T00 A;  1MTC A;  4KE3 A;  5CRE A;  4LL4 B;  2HSY A;  1NHY A;  4G19 A;  5H5S A;  1ZZY A;  3F6D A;  2R0P A;  3GST A;  3QAV A;  4HQS A;  3TJF A;  3TJB A;  2H75 A;  3DRN A;  4FIW A;  1SL2 B;  3CRT A;  2JSY A;  1SJ6 A;  5EL8 A;  3HVV A;  2H1A A;  3D4T A;  3IR4 A;  2MZC A;  5HR0 A;  4HQZ A;  5D93 A;  3KZQ A;  2CQ9 A;  4NV5 A;  1A0F A;  4TR0 A;  3U5R E;  1TTZ A;  3V1W A;  1CQG A;  4ECB A;  2GQM A;  3IDV A;  4F0C A;  2Z9S A;  2GGT A;  3TKR A;  1G0T A;  5DBQ A;  2C1Y A;  1PKZ A;  2LST A;  2V41 A;  5IOX A;  1ZGN A;  2PPT A;  1B9Y C;  1ABA A;  2IMI A;  1SJI A;  4POL A;  3GFK A;  1N2A A;  3DVX A;  1V9W A;  1ZMA A;  3ERW A;  4CDO A;  5J41 A;  1FG4 A;  1ERU A;  5DJL A;  3IAM 2;  2G2Q A;  4DVC A;  1PRX A;  5D96 A;  3F3Q A;  2FD3 A;  2V32 A;  2C4J A;  4AJ6 A;  3I6A A;  2M46 A;  3FZ5 A;  5IO2 A;  5L71 A;  1G6Y A;  2FGX A;  2C0E A;  1BX9 A;  2VLT A;  1VF1 A;  4BWQ A;  4JZQ A;  1PL1 A;  3FW2 A;  1XOA A;  4Z7X A;  3GV1 A;  3N9J A;  1GTU A;  2LJR A;  4O7H A;  2B3S A;  2B7K A;  2RLI A;  2GT6 A;  2C3T A;  1K0N A;  4HJM A;  4N30 A;  1SD9 A;  1JLW A;  4NXI A;  3D4M A;  2O87 A;  2LQQ A;  3A2X A;  5DDL A;  4K7O A;  2V6K A;  3UAR A;  4DSS A;  1Y25 A;  2CVB A;  2KLX A;  5G30 A;  1TOF A;  5CAX A;  1XPV A;  2VCQ A;  4GLT A;  1K0C A;  2IMF A;  1WIK A;  4HS1 A;  4LMW A;  1A23 A;  3D21 A;  3IRA A;  2MMA A;  3GHA A;  1EGR A;  3H93 A;  4MCU A;  3DEX A;  4IN0 A;  4ISD A;  4DSQ A;  4K2D A;  4ZBB A;  2XBI A;  4F9Z A;  5F05 A;  1FO5 A;  2R0C A;  4MAB A;  2HXK A;  4K0G A;  2VCV A;  2X99 A;  2VCT A;  5ECL B;  3HA9 A;  3DGQ A;  2GDR A;  4BPY A;  1QMV A;  3GX8 A;  2FCH A;  4CY6 A;  1WE0 A;  4JRR A;  3HDC A;  2GQK A;  2CZ3 A;  3L9U A;  1V40 A;  3W8S A;  2OBK A;  4L5O A;  3D22 A;  2B1L A;  4XS4 A;  4DSS B;  1PN0 A;  2H30 A;  1GP1 A;  4RQX A;  2LS5 A;  4TOP A;  2C0G A;  5KN2 A;  1XBS A;  2WB9 A;  4FO5 A;  1K0B A;  2G0F A;  3P90 A;  3VWU A;  2MMZ A;  4JR4 A;  1M9A A;  4KA0 A;  2QKE A;  4XTS A;  3Q74 A;  1ZL9 A;  2GQL A;  3LWA A;  2L4Q A;  3HZ4 A;  3IA1 A;  5J3R A;  2DJ1 A;  1QQ2 A;  3QAG A;  1AW9 A;  1M2B A;  2I81 A;  4KX4 A;  3QFB C;  1H4O A;  6GSW A;  1K3L A;  2OA7 A;  1WPI A;  1DE2 A;  1TRU A;  5B8A A;  1H75 A;  4TKY A;  3EIN A;  4CHS A;  1V57 A;  3PGT A;  3ZIJ A;  3ERF A;  3L9S A;  1PL2 A;  1YF0 A;  4Q5F A;  1F3A A;  2IL3 A;  2R37 A;  3GKX A;  3TJG A;  1W89 A;  3QCP A;  5ENU A;  2VOC A;  4L5L A;  3C1R A;  2H0H A;  3TUE A;  1SKW B;  2K8S A;  4H86 A;  2I4A A;  3F3R A;  2YNX A;  1FB0 A;  5G5E A;  4TXO A;  2QGV A;  2YWI A;  3TDG A;  1I5G A;  4ECI A;  3M8N A;  5KN3 A;  4OFT A;  5ECN B;  2K9F A;  1XIY A;  2H6X A;  2ON7 A;  5IPG A;  3E9J B;  1PX7 A;  4RI6 A;  4IQA A;  12GS A;  1ON4 A;  2VCW A;  1U6T A;  3EWL A;  3F4T A;  2JZS A;  3GL5 A;  1FOV A;  3GRX A;  4ZB8 A;  5IIZ A;  4OFM A;  4IHU A;  2JZT A;  4D73 B;  4OMV A;  1U88 A;  2VLU A;  2AUV A;  1OE7 A;  3TKS C;  2YWM A;  1J08 A;  1DUG A;  3ZTL A;  3H1N A;  1WMJ A;  4EC0 A;  5HQP A;  2C0D A;  2OAD A;  4O32 A;  4TXO B;  3ZML A;  1JZO A;  4Z2R A;  3KD0 A;  4E8H A;  3KM6 A;  5IMZ A;  3F8U A;  2WZ9 A;  3F6F A;  3TOT A;  1THX A;  3M9K A;  1TP9 A;  2K6V A;  1S3D A;  2DML A;  4HJ2 A;  3TRQ A;  5DAL A;  1OC8 A;  5H5Q A;  5J9B A;  1WRY A;  2CT6 A;  4GQC A;  2DKH A;  2DJ2 A;  2PU9 C;  4IVF A;  3RPP A;  1FOH A;  1M7T A;  4BVY B;  1WOU A;  1OKD A;  2CAQ A;  4NV2 A;  4O5Q A;  1ERV A;  1ZOF A;  2LEG A;  1YJ6 A;  2MMN A;  3IK9 A;  1GSU A;  3GL3 A;  5AN1 A;  2HRF A;  1VF2 A;  1T4Z A;  2HRN A;  2R6K A;  2IME A;  1YDK A;  2QSI A;  3F9U A;  5KN1 A;  2LNT A;  2VCX A;  1F2E A;  1LJR A;  2FWF A;  4G9H A;  2YWN A;  1OE8 A;  1W4V A;  1O8X A;  5DAL B;  3WYW A;  2I1U A;  2A4V A;  1DE1 A;  3KMO A;  4PXO A;  2JL4 A;  4MZW A;  1XWA A;  2I9H A;  3KH9 A;  4G0K A;  4IS0 A;  3CMI A;  1GNE A;  4CY8 A;  1QGV A;  1TK8 B;  2IFQ A;  3C71 A;  5CRD A;  3NOF A;  4N10 A;  2B5Y A;  4PUA A;  4YQM A;  5BMU A;  3LSZ A;  1TRV A;  3A5I A;  4KGI A;  2H0G A;  2YZH A;  1AC1 A;  5GZZ B;  5ABR A;  5J9C A;  5JCW A;  3O3T A;  1EWX A;  3Q6O A;  4BVX A;  5LNK e;  3VPT A;  5ELG A;  3IXR A;  4PGT A;  2XHF A;  5G1K A;  2DIZ A;  3VLN A;  4G0L A;  2NVL A;  8GSS A;  4G0I A;  4POK A;  1C72 A;  3QOU A;  3MIX A;  2YV7 A;  3CSJ A;  3MDK A;  4J56 E;  5CRW A;  2IFQ B;  3S9F A;  2H01 A;  1G6W A;  4USS A;  2WRT A;  2MBS A;  5H5R A;  4XCS A;  2M72 A;  4GRF A;  2OKA A;  1PGT A;  3HVS A;  2ZUP A;  4MPF A;  4HU9 A;  2KP2 A;  4HUA A;  2DSA A;  1O73 A;  2RII A;  6GSS A;  2MMO A;  9GSS A;  4BVX B;  4WBJ A;  4MJA A;  1X5E A;  20GS A;  4NHZ A;  4DSR A;  4EDZ A;  3GIX A;  1M99 A;  2AHE A;  3HJM A;  4TR1 B;  1BG5 A;  3HCZ A;  3BJ5 A;  3ZIT A;  1HNB A;  2EIO A;  4TR4 A;  3FHK A;  2DJK A;  2LRN A;  2F3M A;  4K1F A;  4NPB A;  2WJU A;  4K5R A;  5DCG A;  2J23 A;  1V98 A;  4HEA 2;  1AIU A;  2L59 A;  3I69 A;  2IJY A;  1XW5 A;  2B1K A;  3NIV A;  3TJK A;  3GNJ A;  5HR3 A;  4MF5 A;  4OCE A;  3IV4 A;  3M9J A;  4F03 A;  4KB3 A;  4CW9 A;  2GST A;  4V1A p;  1ZYN A;  3LEF A;  2VAF A;  4K6X A;  1R5P A;  5ECK B;  3GUS A;  1Z3E A;  2X8C A;  3L4N A;  1FAA A;  3DXB A;  1GSS A;  4Z2T A;  1XW9 A;  2H8L A;  4HI7 A;  2E2M A;  2LKU A;  3LQ7 A;  4ML6 A;  1XWC A;  4HOJ A;  4EDY A;  3GH6 A;  2A4H A;  2H6Y A;  4YKF A;  2I3Y A;  1SKR B;  4I8B A;  3TCO A;  1K0A A;  1FB6 A;  3A5W A;  2AJQ B;  1F6M C;  3DML A;  5ELA A;  3I43 A;  3VWW A;  3GN3 A;  4LMV A;  3CXG A;  2HRK A;  3G9B A;  3FZ9 A;  2YV9 A;  3BCK A;  3BBY A;  4I97 A;  4XRA A;  2DJJ A;  3EE2 A;  4O5R A;  4I5Q A;  4N0V A;  2VL3 A;  2GVP A;  3CYN A;  3GA4 A;  5E59 A;  4QL9 A;  3WT2 A;  2PVQ A;  2TRC P;  4MDC A;  1ERW A;  1RW1 A;  4XIH A;  3M1G A;  2IMD A;  1M9B A;  2TRX A;  4QL7 A;  1VF3 A;  4YQV A;  1TI3 A;  4PQ1 A;  3ERG A;  4IW9 A;  5IMV A;  1PSQ A;  5KEJ A;  4EVM A;  3FKF A;  3HZ8 A;  1GNW A;  1WJK A;  4KCE A;  2KHP A;  5ECH B;  3FK8 A;  2CA8 A;  4MMM A;  4GSS A;  2JZR A;  1ACV A;  2XPE A;  1V2A A;  2PVO C;  3O6T A;  3ZIV A;  5G5F A;  4J2F A;  3ZVJ A;  1OVN A;  2WUL A;  1TU7 A;  2F8F A;  3UBL A;  2OE1 A;  2C80 A;  1LBK A;  4FYU A;  2LUS A;  4OO4 A;  5ECR B;  4GST A;  4PNF A;  1GUL A;  3GSS A;  2GZP A;  3L0H A;  4TRX A;  3FEU A;  3APS A;  3UBK A;  2HRA A;  2WS2 A;  4AJ7 A;  1GRX A;  2F9S A;  4IGJ A;  4IJI A;  4RI7 A;  2OJL A;  2L5L A;  3CBU A;  1JHB A;  5BRT A;  1SKS B;  5COH A;  2YJ7 A;  5ECQ B;  2DJ0 A;  1U3A A;  1O6J A;  4I6X A;  5EPF A;  4J57 E;  3PIN A;  4KUN A;  1F9M A;  3DVW A;  2H74 A;  2H71 A;  4KH7 A;  5B6N A;  1IYI A;  2OE0 A;  2VL2 C;  2YCD A;  2YZU A;  4MA9 A;  5IPH A;  3MAK A;  4K7I A;  4IBP A;  2VCZ A;  2FA8 A;  4X1U A;  2DLX A;  1PX6 A;  1TDI A;  3DIE A;  1PN9 A;  4ZL8 A;  2P5Q A;  3GH9 A;  5GST A;  4EKZ A;  1SD8 A;  5J4U A;  4F0B A;  3LW9 A;  1X5C A;  1NW2 A;  1BJX A;  3ZVJ D;  3O76 A;  3IAS 2;  3UVT A;  1SEN A;  3CTG A;  3P2A A;  1JFU A;  2H1G A;  3MYD A;  4D73 A;  1SK1 A;  1XWG A;  3NZN A;  3RHC A;  1Q4J A;  2FWH A;  2B5E A;  2VIM A;  4Q5R A;  2NTO A;  3Q18 A;  1GUM A;  4LL1 B;  1NSW A;  3A2V A;  2QA2 A;  1QFN A;  4YH2 A;  1AUC A;  3VI5 A;  5A5K A;  4MK3 A;  1OC9 A;  2K18 A;  1T8E B;  16GS A;  2O7K A;  4MH2 A;  3E3E A;  17GS A;  3VI7 A;  3DD3 A;  5B8B A;  1A2J A;  2C8U A;  4O5U A;  2VLV A;  1UVZ A;  3R2Q A;  4NMU A;  4K0N A;  2ZCT A;  4IQ1 A;  1T4Y A;  1PMT A;  3F0I A;  4V2N A;  4K2X A;  4BVY A;  2O89 A;  3HVX A;  2J9H A;  5AIS A;  2ZNM A;  4MF7 A;  4ID0 A;  1M2A A;  2FA4 A;  2PER A;  4KF9 A;  5DAK A;  1SL0 B;  5IO0 A;  2JAC A;  2MBT A;  1TXX A;  4ZB6 A;  4FQU A;  1A0R P;  3LG6 A;  3EMX A;  4MJB A;  1OC9 B;  1S3A A;  3L9V A;  1WP0 A;  4WR5 A;  3HJP A;  3HD5 A;  3D0Z A;  5E4W A;  5A4V A;  4G10 A;  4ILF A;  4IJ3 A;  3EPT A;  1X0R A;  4YAV A;  2LQO A;  1X9W B;  2E7P A;  2P5R A;  5D9X A;  4BA7 A;  4NWY A;  1TK0 B;  5FT3 A;  2HFD A;  3TKP A;  3MWH A;  4WF4 A;  5DAK B;  2NBS A;  3EU4 A;  3UIW A;  4PQI A;  4IEL A;  5IMD A;  1YKC A;  3C8E A;  5DQS A;  4MPG A;  5HFG A;  3LYP A;  1TJD A;  4O92 A;  2C0F A;  3BOA A;  4OCF A;  4YQU A;  2DBC A;  5F8B A;  4ACS A;  3GUR A;  2YP6 A;  1VF4 A;  3M0F A;  2QA1 A;  4BL7 A;  3QR6 A;  4I2U A;  2R3X A;  4KDX A;  2XPD A;  1GSD A;  2ALB A;  2A2S A;  4L0U A;  2VUP A;  2N5F A;  4RQR A;  5F07 A;  5ID2 A;  3TOU A;  1GSF A;  4GCI A;  2DC5 A;  1QK8 A;  3ZL5 A;  2VO4 A;  3EMP A;  4PX1 A;  2XBQ A;  4AF2 A;  4MNN A;  2FNO A;  4EO3 A;  5CNW A;  1HQO A;  2O85 A;  2AYT A;  1OAZ A;  2FY6 A;  4WKW A;  1E2Y A;  2EC4 A;  5CRH A;  4WBR D;  2YN1 A;  3H8Q A;  3TKQ A;  2CAI A;  4ECJ A;  2CV4 A;  4K9Z A;  4Z2U A;  1HNA A;  1HD2 A;  4BL7 B;  2NDO A;  3VFI A;  3GYK A;  3IOS A;  1J0F A;  5ECO B;  1KEB A;  5FWG A;  2CVK A;  1EEJ A;  2H1B A;  4YKG A;  5FHI A;  2BJX A;  2B6M A;  3DKS A;  5ID2 B;  2L6C A;  2TIR A;  2WFC A;  1UA5 A;  2H66 A;  5ECI B;  5HFK A;  2DKI A;  2FWE A;  2OE3 A;  1K0M A;  4TR1 A;  4GQF A;  4KDY A;  1UN2 A;  2GZZ A;  3HYP A;  2YOI A;  2IPA A;  1F3B A;  3LOR A;  3ISO A;  4K5S A;  22GS A;  1EP8 A;  1MD3 A;  5HFI A;  1ILO A;  4MP4 A;  2YPM A;  4F82 A;  1OYJ A;  3SBC A;  1MEK A;  2PBJ A;  3LGC A;  2H0I A;  1G7E A;  2BTO T;  1A24 A;  2HZF A;  2WGR A;  1JZD A;  1JZW A;  3F4S A;  3LXZ A;  1XWK A;  3FMW A;  3G7Y A;  2H76 A;  3QPM A;  1GUK A;  2FLS A;  3A2W A;  4RUV A;  5GAP D;  4WXT A;  1QXH A;  3CSI A;  1Z6M A;  4ZXG A;  5GAN D;  4L8E A;  1K0O A;  1XZO A;  2JSZ A;  1R5A A;  3KCM A;  2EIR A;  2H70 A;  3DWV A;  1ZYQ B;  1ZYE A;  2R0G A;  1ZYP A;  2RM6 A;  1NHO A;  3IBH A;  5JCG A;  3LFL A;  1O7U A;  3QAW A;  5IMC A;  1NM3 A;  3US3 A;  3CTF A;  3G7I A;  3LXT A;  1CQH A;  1J9B A;  1K3O A;  4WR4 A;  3QD9 A;  4ZBD A;  3CRU A;  1R7H A;  1ST9 A;  1TK5 B;  4OWY A;  2A2P A;  4ECC A;  1KBN A;  2R5G A;  1MD4 A;  5A4U A;  3ZFL A;  2DIY A;  2H1D A;  4V2L A;  1XXU A;  1URM A;  2HSM A;  3GMF A;  3M3M A;  2CX3 A;  3HKR A;  4PUF C;  3EVI A;  2C3N A;  3QDN A;  3RAZ A;  1T1V A;  2GT5 A;  4V2M A;  2GS3 A;  2RM5 A;  1IYH A;  4PNG A;  1EV9 A;  3HJO A;  1FVK A;  2PN8 A;  2OBI A;  3TRP A;  1XVW A;  4KND A;  19GS A;  3FZA A;  3E0U A;  3KIJ A;  3RPN A;  2GZY A;  1GSQ A;  3L78 A;  1Z7R A;  1A8Y A;  1XCC A;  3IPZ A;  1GSY A;  3FYG A;  2PMT A;  3EYT A;  3FRC A;  6GSU A;  1SK0 A;  5CP1 A;  6GST A;  1O81 A;  1YEX A;  6GSX A;  5D9W A;  2L57 A;  3BD2 A;  4JE1 A;  6GSV A;  3KP8 A;  5IMA A;  3LJR A;  5JWQ B;  2ON5 A;  2N5A A;  1JLV A;  1AQX A;  2K8V A;  2FUG 2;  2H72 A;  5D8I A;  2VD0 A;  4OD7 A;  5KOW A;  5IOW A;  4KSO A;  3W6G A;  3VWV A;  2HNL A;  1OKT A;  3TB2 A;  4K8M A;  1B9X C;  5D9T A;  2B5X A;  4PTS A;  2LRT A;  4GSN A;  1BQ7 A;  4LLR A;  3UMA A;  4PUR A;  1RK4 A;  1B8X A;  1GTI A;  3ZMK A;  4GXZ A;  1MDK A;  1AQV A;  4KDU A;  4TN8 A;  2IMK A;  2IIY A;  3KTB A;  2V1M A;  3JCM L;  4MZC A;  1G7O A;  1FHE A;  1M0U A;  1TRW A;  3DYR A;  2CX4 A;  4HZ4 A;  2HLS A;  4GF0 A;  1USB A;  3KH7 A;  4POM A;  3W8J A;  3UOM A;  4KSM A;  2GSQ A;  3UL3 A;  4ZL9 A;  5KOX A;  5KN0 A;  1O8W A;  3P7X A;  4TXV A;  1X9S B;  4WF5 A;  1Z5Y E;  2F8A A;  1VGL A;  4MZB A;  1YF1 A;  3K8N A;  5GSS A;  1EOG A;  2HI7 A;  1A2M A;  4NHW A;  1SK2 A;  3R3E A;  3WGX A;  1DSB A;  1HNC A;  3PR8 A;  4XRD A;  3ZLP A;  5HR2 A;  3IC4 A;  4TVE A;  1S3C A;  3FR6 A;  1N8J A;  5JWR B;  4E8E A;  1X9M B;  2GSS A;  4ZIL A;  3FZ4 A;  3TRX A;  4ULX A;  1SYX A;  3F4R A;  4Q5Q A;  4GTU A;  1O85 A;  2X64 A;  4FYB A;  2R2J A;  4KCA A;  2JAD A;  2P31 A;  3KTL A;  3KXO A;  1BYE A;  2H6Z A;  3Q19 A;  4PQH A;  2RUF A;  1AQW A;  5EY6 A;  1XWB A;  4HDE A;  1LU4 A;  5CO3 A;  1GSE A;  2EIQ A;  4XHM A;  5ECS A;  2X8G A;  4KW6 A;  2R4V A;  1FVJ A;  1YQ1 A;  3KP9 A;  1M2D A;  3P8W A;  4GWR A;  3ZRE A;  2YWO A;  4NAX A;  1E6B A;  3ME7 A;  3HY2 A;  3J7Y b;  3VPQ A;  2VM1 A;  2JU5 A;  3HHV A;  3GX0 A;  4EIP A;  2IN3 A;  3WGD A;  5DQY A;  1KNG A;  3IHG A;  13GS A;  1Z9H A;  2FHE A;  4MH3 A;  1GUH A;  2XC2 A;  4POB A;  4A5P A;  3GKN A;  2ES7 A;  7GSS A;  4P3Y B;  2LV3 A;  2O8V B;  4X43 A;  2L5O A;  1T7P B;  2AV4 A;  5CYY A;  3ZYW A;  1AAZ A;  1XW6 A;  3KJY A;  5A4W A;  1TKD B;  4AGS A;  3WT1 A;  5LD0 A;  2X49 A;  1THO A;  3TGZ A;  2E0Q A;  1YY7 A;  5JCU A;  3GKK A;  4X4J A;  1PQN A;  2GLR A;  3EC3 A;  3KMN A;  4ICY A;  4JU5 A;  4XS4 B;  1GL8 A;  5EVO A;  3TJJ A;  4ZBA A;  4L0W A;  4IP1 A;  4Q5N A;  2RUE A;  3EUR A;  3APQ A;  5IQY A;  5IM9 A;  3UEM A;  4OFN A;  2KOK A;  5HR1 A;  1T3B A;  2PGT A;  2IWT A;  3WGE A;  1GTA A;  2V6O A;  4EUY A;  2UZ8 A;  4FH8 A;  2HZE A;  5C00 A;  1HYU A;  5J5N A;  3OR5 A;  1EOH A;  1GTB A;  2NPB A;  1FW1 A;  3RBT A;  4EE0 A;  1XFL A;  1ML6 A;  1XVQ A;  3HXS A;  5AIX A;  1OC3 A;  2FWG A;  5F0G A;  4JBB A;  3C73 A;  1K0D A;  3ED3 A;  5CRG A;  2LJA A;  2BMX A;  2V2G A;  4EXJ A;  4JR6 A;  5B6M A;  5D73 A;  3QMX A;  5D9V A;  3ZRD A;  3ZFB A;  2VL2 A;  1U3I A;  2KUC A;  1EEM A;  2HSH A;  1K3Y A;  4AJ8 A;  3IC8 A;  1BAY A;  2MYG A;  3N5O A;  3RHB A;  3C7M A;  2HZE B;  1R26 A;  1TRS A;  5DVB A;  1PKW A;  3D6I A;  5AGY A;  1U87 A;  2DMM A;  2PWJ A;  5INY A;  4IP6 A;  2VM2 A;  2GSR A;  3RDW A;  4ZL7 A;  4I2T A;  3F63 A;  5LCZ A;  4V1A g;  2A2R A;  14GS A;  5G2Z A;  2DJ3 A;  3VK9 A;  3PH9 A;  1EV4 A;  4JED A;  1EGO A;  1SU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...