4V2LA

Crystallographic structure of thioredoxin from litopenaeus vannamei: radiation damage effect at 3.4 mgy, focused in disulfide bonds.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
b'MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystallographic Studies Evidencing the High Energy Tolerance to Disrupting the Interface Disulfide Bond of Thioredoxin 1 from White Leg Shrimp Litopenaeus Vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Oxidoreductase
total genus 35
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4v2lA00
1O6JA 3FZ9A 3BOAA 1MD3A 1GTAA 5LD0A 4IQ1A 1VF3A 4LA1A 2G2QA 4GQCA 2GS3A 3C7MA 2IN3A 1K0AA 1B4PA 4KDXA 2EIQA 2ON7A 4PNFA 4TXVA 3UAPA 2ON5A 5ID2B 3ZFBA 2P5RA 2LRNA 2N5AA 3GH6A 2ZNMA 3KGKA 2KLXA 4ULXA 4OFTA 4J57E 4RQXA 1MTCA 1F3AA 2VM2A 2CZ2A 3APOA 5JCWA 3IAM2 2V6OA 1LBKA 2RM5A 4BL7A 1G7EA 1OYJA 4EXJA 1SJIA 3TOTA 3GRXA 1A8YA 5KN3A 4FYCA 1DBYA 2CAQA 3VPQA 2KP1A 4GTUA 2EIRA 5JCUA 5C04A 2IFQA 2FWFA 3I69A 3P7XA 2YZHA 3PH9A 5AGYA 4AJ6A 5D9VA 4ZB9A 5IOXA 3HZ8A 4MJCA 2VCWA 3I43A 4ZL9A 2AJQB 1JFUA 4QL7A 2OJLA 4MF5A 3ZITA 1W4VA 5A4VA 1JLVA 2LJAA 5D8IA 2WGRA 1F2EA 3IPZA 2HXKA 1TP9A 4HUAA 6GSXA 1PX7A 3C1SA 3TKSA 4NHZA 5LCZA 1EGRA 2VCXA 2NBSA 1ZOFA 3RPPA 3A2WA 22GSA 5F07A 3H1NA 4FIWA 2F8AA 3VURA 1TI3A 2E2MA 4IJ3A 5E4WA 4F0CA 3E3EA 4QL9A 2F3MA 1PSQA 3FRCA 4G9HA 4KE3A 1JZRA 2WS2A 5EVOA 3ZL5A 2DMLA 4HU7A 3TKPA 5H5QA 1B48A 1ML6A 3TJKA 5DQSA 1H4OA 4XRDA 4TKYA 4GF0A 5DAKB 2CT6A 2PGTA 4V2LA 3TDGA 1GWCA 1XOBA 3QFAC 1O81A 4ISDA 1Z5YE 2XHFA 2K9FA 2X99A 3IOSA 2OA7A 5IMAA 3HHVA 1BJXA 1VF2A 14GSA 4MJEA 1O7UA 1GNWA 1IYIA 1M0UA 3F4RA 5CP1A 4MDCA 2FGXA 1USBA 1B8XA 3RBTA 1TW9A 3QAVA 4YAPA 1O8XA 1EZKA 4TW5A 2JADA 3GSSA 2B5XA 2ES7A 3KCMA 1Z3EA 3KP9A 6GSVA 3UBKA 4F0BA 3NIVA 2DJ2A 5ELGA 3OR5A 4TR3A 3FK8A 1YF1A 4MCUA 1YF0A 3F6DA 3DKSA 3ZREA 3E9JB 2CVDA 1Z6MA 1GH2A 2RM6A 4P3YB 5ENUA 3QFBC 4MK3A 5CREA 3MWHA 1AXDA 3D22A 3F8UA 3NOFA 2J9HA 2REMA 1WOUA 2H8LA 1XWGA 4Q5QA 3EU4A 1Z7RA 4RUVA 2DLXA 4IP1A 5HFKA 3TOUA 1N2AA 1PMTA 3CRTA 3GKKA 5IMVA 5AIXA 1DE2A 2GQKA 1B9XC 1VRSD 2C0EA 4L0UA 4MMMA 4O92A 3N9JA 4GCIA 5GSTA 1HYUA 2CX3A 5LNKe 3I9V2 3IV4A 1XWKA 5FT3A 1XXUA 19GSA 5KEJA 2FWGA 4AJ7A 5JWOB 2LNSA 1EP7A 1U6TA 1R5PA 2GSSA 6GSUA 1EOGA 2LQQA 1T7PB 8GSSA 2OE3A 5IO2A 3F0IA 4PNGA 1QXHA 1V40A 3G7YA 4KGIA 2MMAA 2ALBA 20GSA 3U6VA 4NWYA 3C8EA 3PGTA 4DSQA 2O89A 1E2YA 1V57A 1FAAA 3LXZA 5KN2A 1O73A 1FVKA 2O85A 4HZ2A 2JZRA 2LV3A 1OAZA 1I5GA 4XS6A 1FG4A 4KB3A 1Q4JA 2I4AA 3WT1A 5DALA 4GQFA 2MMOA 3EINA 4QQ7A 3EVIA 2XC2A 1PX6A 4EDZA 4XTSA 1ZL9A 4XS1A 3UIWA 3LYKA 3GX0A 4XS4B 3GKNA 1G0TA 1A0RP 16GSA 3W8JA 4ACSA 2DMMA 1V9WA 5ECNB 2YZUA 1J9BA 2GZPA 5ECMB 1T3BA 1XCCA 1EP8A 6GSYA 2H66A 4TOPA 3ISOA 3R2QA 2IMIA 3HJOA 3TJJA 4MJBA 3IK7A 4CW9A 3DIEA 4IVFA 1T4ZA 3US3A 1O8WA 3UMAA 2FY6A 3QD9A 1HNCA 2K6VA 2DIYA 2AHEA 3CTGA 5KN0A 4N0ZA 4N10A 4X43A 5IMDA 2LRCA 1AAZA 4HJ2A 1XPVA 1SYRA 3GSTA 3P8WA 2MMZA 1JHBA 3J7Yk 5C00A 1AW9A 3J7Yb 3Q18A 2DSAA 1XW6A 5G2ZA 5HFIA 1TOFA 5CRDA 2HYXA 2CAIA 2A4VA 1WWJA 2B5YA 4WETA 3M0FA 2G0FA 2O8VB 3HKRA 3BCKA 1FOVA 5A4UA 5CAXA 3EC3A 1EWXA 1M9AA 1ZYQB 1WJKA 3TCOA 5IMZA 3LQ7A 4IGJA 1Y25A 2GGTA 1TU7A 3DMLA 5CRHA 5GAND 1FB0A 2QC7A 5AIVA 3VLNA 2HE3A 3RPNA 4WF5A 1CQGA 1X9SB 4OCEA 1NW2A 1GLPA 4AGSA 2L5OA 4IKHA 5FWGA 2QSIA 2J23A 5J41A 3IC4A 2HRNA 1GTIA 4KCEA 3ZRDA 1XWCA 1YY7A 4PGTA 4OCFA 5G31A 2AAWA 3ME7A 2LNTA 4KDUA 1SJ6A 2DBCA 2N5FA 5CRGA 4LLRA 2YWMA 3EMXA 1A24A 1LU4A 1AQWA 4POLA 3A5WA 1QFNA 1V2AA 1A23A 3L78A 3KTLA 2K8VA 4FYBA 4K2DA 2DJKA 2TRXA 1M2AA 1GLQA 2B3SA 5G30A 3A3TA 2EC4A 2VCTA 4EKZA 3LYPA 1QK8A 4TR4A 5ID2A 1GSYA 1ERWA 2X8GA 3P2AA 2NDOA 4EO3A 1PL2A 3M3MA 6GSTA 3Q6OA 1TK0B 2X64A 4ZL7A 2MBSA 4N11A 3IBHA 1Q98A 2FLSA 5ECKB 1R7HA 1UC7A 3IR4A 2FA4A 3ZVJA 4F2IA 3GH9A 4JBBA 2DIZA 1HNAA 3BD2A 3TKQA 1WRYA 3GYKA 4NHWA 3KMNA 3VFIA 4TR1B 4Z7XA 2IJYA 4JR6A 4HJMA 1I9DA 4ZBBA 5CO3A 1SU9A 2V32A 1OC9B 2C3TA 4MPFA 2EIOA 2YOIA 2PN8A 2IWTA 3QOUA 4JR4A 3UEMA 4ZXGA 4EVMA 2H1DA 3GHAA 2HZFA 2ZUPA 5G1LA 2L4QA 4IN0A 12GSA 4NMUA 3DVXA 4NPBA 1ERUA 2HI7A 4N30A 2FUG2 3BBYA 1OVNA 2B5EA 5D93A 3G7IA 1XFLA 4MH2A 3KIJA 1G6YA 1GNEA 3G9BA 1CQHA 2JACA 6GSWA 1E6BA 3ZLPA 3GUSA 4LMVA 2LSTA 2IL3A 10GSA 1A2MA 2AUVA 2DJ1A 1T00A 1F6MC 4GLTA 4O32A 3MNGA 4DVCA 4I2UA 3F3QA 1YQ1A 1ZMAA 2FWHA 2GQMA 2LTKA 3FR9A 5DAKA 4PXOA 3ERGA 3LFLA 1TK5B 2H1BA 2XPEA 5JCGA 4YQUA 2R6KA 5EPFA 2DJJA 3CRUA 2GSRA 3KXOA 1K3LA 4DSSB 2LRTA 4ZB8A 3QR6A 1BQ7A 4CHSA 4MZCA 5IM9A 1UA5A 4IBPA 3DVWA 1EV4A 1XOAA 2E7PA 1WP0A 5DCHA 2AV4A 1TU8A 1U3IA 3UVTA 2OBIA 1QUWA 2VLUA 2XBQA 2CVKA 1YEPA 1X5DA 1BAYA 4L8EA 3M9KA 4MA9A 1TI1A 1EV9A 1M2BA 1SK1A 2R37A 1PKZA 5HR0A 1URMA 3HCZA 5IQYA 5HQPA 4IELA 1TRUA 1YZXA 5D9XA 3UL3A 4ZILA 2KOKA 4POKA 4H86A 4IJIA 2KP2A 1TK8B 1X5EA 2LS5A 3ERFA 1Z6NA 3KZQA 4K0NA 3DGQA 5J4UA 3C73A 3VWWA 2QKEA 5JWQB 3GFKA 3M8NA 4WF4A 2GZZA 3LEFA 2H72A 3EWLA 3TKSE 2X8HA 2GVPA 2GDRA 2H73A 4HOJA 1SL1B 3ZVJD 2LUSA 1FW1A 4IHUA 2WCIA 2XPDA 3FYGA 3HZ4A 4GSSA 7GSSA 2RIIA 4WEYA 3GL5A 4AJ8A 1YDKA 1SKWB 2YJHA 3ED3A 3LORA 3RAZA 3F3RA 2FHEA 3VI7A 5IPHA 1JZDA 3G7JA 5DDLA 5J9CA 2C0FA 1MD4A 2AB6A 3TJBA 5ECRB 4L5OA 4KSOA 2VL2A 1KNGA 1TRVA 2HFDA 5B7CA 1WE0A 4EE0A 5ECPB 1EEMA 2F8FA 4WXTA 1XZOA 2BTOT 3ZYWA 3MSZA 2YNXA 1U3AA 4I2TA 4BWSA 1XWBA 1NSWA 1GTBA 2HNLA 1QQ2A 3GV1A 1M2DA 3U5RE 2D2ZA 1SK0A 1GSDA 3HYPA 5DJMA 1PA3A 1FHEA 4XIHA 2VLVA 3ZIVA 3H4KA 4JEDA 1LJRA 3FZ4A 4KDYA 3CYNA 1TRSA 4XS4A 5DCGA 2QGVA 1SD9A 5AISA 1BEDA 2C80A 2VIMA 5IOWA 3TRXA 1M9BA 4K1FA 3GKMA 4EF0A 1TJDA 3HVVA 4E8EA 1JZOA 4WR4A 1GTUA 3CSIA 2L6DA 3V1WA 1EGOA 4PQIA 5EY6A 3F63A 3LJRA 3FZ5A 3GX8A 4LMWA 1EOHA 2VO4A 3FEUA 2RUFA 3APSA 3W6GA 5D73A 3IXRA 4TR0A 2H19A 5G5EA 3CBUA 4WBRD 1YJ6A 1A2LA 1KBNA 5CNWA 1NHOA 3H8QA 3TKSC 3O76A 1GSEA 4V2MA 3IHQA 2MMNA 1OE7A 2CVBA 5J5NA 4YQMA 1PD21 3FR6A 5DQYA 4G2EA 6GSSA 4PUFC 4GSTA 1ACVA 2C0GA 2YWNA 2GSTA 4Q5FA 4PURA 3K8NA 4MZBA 5HR1A 4HDEA 1SJZA 1Z7PA 1MDKA 3HXSA 1TDIA 4TXOB 2PU9C 3GURA 1SKSB 1B4QA 1T4YA 4MF6A 4HS1A 1AIUA 1YKCA 3IE3A 3UVHA 3DRNA 2PBJA 5GAPD 2YJ7A 4MH3A 1TRWA 2CV4A 5H5SA 2C0DA 2GSQA 3IRAA 1YKAA 2YWOA 4K0GA 4GSNA 1RQMA 4DEJA 5HR3A 4BWQA 2OE0A 3QAWA 4BPYA 3S9FA 1TXXA 2R3XA 2LJRA 5DBQA 1EEJA 2JL4A 1K0NA 1XVWA 5ABRA 2L4CA 4RQRA 1SL2B 4HI7A 4RI6A 3UBLA 2H0HA 1HNBA 1K0OA 2WB9A 3WGEA 2H6ZA 3VI5A 2L59A 4OFNA 2VD0A 3VWVA 3Q74A 2IMFA 3DXBA 3CTFA 2GZYA 2B1LA 3HVXA 4JE1A 3C1RA 3F4TA 4JU5A 2H70A 2C8UA 1AUCA 2JU5A 2M80A 1X0RA 1GRXA 1U87A 3MAKA 4KX4A 2AYTA 1ILOA 4K7NA 1X9MB 5DJLA 4WKWA 3ME8A 2P0GA 1UVZA 13GSA 1QMVA 4XRAA 4D73B 1Z9HA 3LG6A 2FWEA 2H6XA 2H75A 4K8MA 1ERTA 2JSZA 2C1YA 3H79A 2WFCA 2E0QA 5ECQB 2B1KA 4TR1A 1K3OA 4O7HA 4OO5A 4KSMA 2HRFA 3F4SA 5F05A 3HA9A 5HFGA 4J56E 3LSZA 5DVBA 1F37A 1OC9A 1PN9A 3WD6A 4GWRA 2B7KA 3L4NA 2H1GA 2BJXA 1ZZYA 4EUYA 2A2RA 3D4MA 3IDVA 1S3AA 5G1KA 4WBJA 4XHMA 2R5GA 1GSFA 4ZB6A 4FH8A 2H74A 2FCHA 1X9WB 4OFMA 3GTUB 2I9HA 3TJGA 1VF1A 1XW9A 1G6WA 1VF4A 5L71A 1DSBA 2H0IA 4AF2A 5IO0A 2VCVA 1W89A 4KUNA 2HZEB 3FW2A 1SKRB 3W8SA 1BG5A 4ECIA 1ZCPA 3RHCA 1A8LA 4ML6A 3A2VA 4MP4A 2PWJA 4FYUA 2I1UA 1S3DA 4K9ZA 4X0XA 2JZSA 3H93A 2Z9SA 2PPTA 1OKDA 1M7TA 3LWAA 5IIZA 3TUEA 4IP6A 17GSA 1RK4A 3O6TA 1M99A 3ZZXA 3WGXA 1ERVA 2RLIA 1NHYA 3GMFA 2RUEA 5E59A 1J0FA 2I81A 2MYGA 3D21A 3D5JA 3KEBA 2VUPA 3M1GA 4IQAA 4J2FA 2GT6A 2OACA 2V2GA 4ZL8A 4DSSA 2IIYA 3QMXA 1BYEA 1AC1A 5INYA 3APQA 4I5QA 1HQOA 1XVQA 2CZ3A 4KCAA 3KH7A 5EL8A 4PQ1A 2IMEA 2YWIA 3IA1A 3DEXA 3GN3A 5J3RA 4I97A 1S3CA 1WMJA 3HD5A 4NXIA 3UOMA 4NV2A 2M72A 3ERWA 3KM6A 1C72A 5GZZB 5KN1A 4KAEA 3CXGA 4LL1B 4L5LA 4BVYA 2YV7A 2L6CA 2P5QA 2B7JA 4OO4A 2VCZA 1Y6EA 1G7OA 3IK9A 1KTEA 1PRXA 2L5LA 1R5AA 2K18A 2HSHA 3ZTLA 1ZGNA 2M46A 2X8CA 4K7IA 4ECJA 3IAS2 4TN8A 2IMDA 1PL1A 2IFQB 2O7KA 4N0VA 4YAVA 2PERA 2LEGA 4K6XA 1GUKA 4O5RA 3GIXA 4XCSA 4CDOA 2WZ9A 1GUHA 5F8BA 1K0MA 1XWAA 1R26A 2B6MA 2DJ0A 1ZYEA 3FHKA 5ECLB 1R4WA 2WRTA 5ELAA 5D9WA 3ZFLA 2NVLA 3LGCA 1SD8A 1OE8A 4L0WA 5ECIB 3HDCA 3PR8A 3VWUA 2YV9A 3HJPA 2H76A 3NZNA 2L57A 4HZ4A 1F3BA 1GSSA 5JWRB 2LJKA 4POMA 2H30A 3WT2A 4E8HA 3QDNA 1BX9A 4ID0A 4HQZA 2V41A 2LKUA 3M9JA 3O3TA 1AQVA 4GXZA 4I8BA 4KA0A 3AY8A 1K0DA 2GLRA 3WYWA 1XIYA 18GSA 4TRXA 4LL4B 2YANA 5F06A 2KUCA 2OADA 3PINA 1ST9A 3L0HA 2WJUA 3P90A 4ZIJA 2OKAA 5HR2A 1X5CA 4JRRA 4OMVA 5B8BA 2C3QA 1GL8A 2VL9A 5F0GA 3DD3A 1KEBA 1RW1A 1XW5A 2A2SA 3TRPA 1YEXA 2C3NA 1A2JA 3ZMKA 2YCDA 2O87A 3CSHA 4PUAA 4EL1A 1F9MA 3FZAA 5B8AA 2V1MA 4F9ZA 2VAFA 1V58A 4ECCA 1DE1A 1OKTA 1WPIA 3QAGA 4GRFA 3GNJA 2PVOC 4I6XA 4PX1A 3GA4A 1J08A 4KW6A 3WGDA 1N8JA 4G10A 4BVXA 3N5OA 1PGTA 5IMCA 3ZMLA 3VPTA 2NTOA 1XBSA 5H5RA 2PUKC 2DJ3A 3C71A 5ECOB 4EC0A 2YPMA 3KJYA 1SL0B 4Q5RA 2HT9A 2VD1A 4JZQA 1O85A 3UJ1A 1MDIA 3QCPA 3KH9A 3EYTA 5A4WA 1K0CA 1B9YC 2BMXA 4TVEA 1NM3A 3BCIA 1VGLA 5IMFA 1SK2A 4V1Ap 2IMKA 3BJ5A 3F6FA 3F9UA 1ABAA 5COHA 3GL3A 4EDYA 4Q5NA 3EURA 4TXOA 3RHBA 2YN1A 1IYHA 1TKDB 2FA8A 3KMOA 1SYXA 5J9BA 1GUMA 4MPGA 1PQNA 2LQOA 2N5BA 3TRQA 4OD7A 4ZBAA 5B6MA 2K8SA 2H1AA 5D9TA 4ECBA 3D4TA 2MZCA 1WIKA 3TGZA 3DYRA 5AN1A 5A5KA 2VLTA 2FD3A 1GSQA 4HU9A 3LXTA 1K3YA 3KP8A 3MDKA 4PQHA 4MLYA 2H0GA 5DALB 2C4JA 4HEA2 4G19A 1T1VA 2V6KA 1TTZA 2E2GA 1JZWA 2CQ9A 2PMTA 1UN2A 4K7OA 1QGVA 4X1UA 1FO5A 1MEKA 1PKWA 2TIRA 9GSSA 3HY2A 3HJMA 1OC3A 3SWLA 2OE1A 2P31A 2NPBA 1GP1A 3A2XA 4MF7A 1A0FA 1H75A 2R2JA 2YP6A 1GSUA 2F51A 5G5FA 3VWXA 3L9VA 11GSA 3E0UA 3TB2A 2FNOA 3EMPA 2JSYA 4V1Ag 4YQVA 5GSSA 3DWVA 4D73A 3CMIA 3D0ZA 2HSYA 3KTBA 2GQLA 4MJAA 1K0BA 3L9SA 3QPMA 4WR5A 2VM1A 5CYYA 5CRWA 3TJFA 2XBIA 1GULA 3SBCA 4MZWA 5ECSA 1T8EB 2I3YA 3UARA 4BA7A 1THOA 2GTUA 2F9SA 2GT5A 3EU3A 1DUGA 1OC8A 1AQXA 2KHPA 3FR3A 3HVSA 4MABA 4KNDA 2H6YA 2VL2C 2PVQA 3VK9A 3D6IA 5B6NA 5FHIA 3GTUA 1FVJA 4ML1A 4IW9A 4DSRA 2DC5A 2WULA 3FY7A 2HLSA 2HZEA 1V98A 2IPAA 2JZTA 1THXA 4FO5A 1FB6A 2H71A 4ILFA 4YH2A 1MDJA 1JLWA 1SENA 3JCML 4NV5A 4F03A 3CSJA 3ZIJA 5ECHB 3Q19A 2TRCP 3GKXA 4HQSA 4OWYA 5D96A 3TKRA 2WDUA 4POBA 5IPGA 3EE2A 4KH7A 3RDWA 3L9UA 2VOCA 2VL3A 4IS0A 1U88A 1ON4A 4ZBDA 2ZCTA 4RI7A 1HD2A 4V2NA 4F82A 3KD0A 2R4VA 2CA8A 2CX4A 2OBKA 3I6AA 2VCQA 2H01A 3FKFA 4NAXA 2MBTA
chains in the Genus database with same CATH superfamily
1O6JA 3FZ9A 3BOAA 1MD3A 1GTAA 5LD0A 4IQ1A 1VF3A 4LA1A 2G2QA 4GQCA 2GS3A 3C7MA 2IN3A 1K0AA 1B4PA 4KDXA 2EIQA 2ON7A 4PNFA 4TXVA 3UAPA 2ON5A 5ID2B 3ZFBA 2P5RA 2LRNA 2N5AA 3GH6A 2ZNMA 3KGKA 2KLXA 4ULXA 4OFTA 4X4JA 4J57E 4RQXA 1MTCA 1F3AA 2VM2A 2CZ2A 3APOA 5JCWA 3IAM2 2V6OA 1LBKA 2RM5A 4BL7A 1G7EA 1OYJA 4EXJA 1SJIA 3TOTA 3GRXA 1A8YA 5KN3A 4FYCA 1DBYA 2CAQA 3VPQA 2KP1A 4GTUA 2EIRA 5JCUA 5C04A 2X49A 2IFQA 2FWFA 3I69A 3P7XA 2YZHA 3PH9A 5AGYA 4AJ6A 5D9VA 4ZB9A 5IOXA 3HZ8A 4MJCA 2VCWA 3I43A 4A5PA 4ZL9A 2AJQB 1JFUA 4QL7A 2OJLA 4MF5A 3ZITA 1W4VA 5A4VA 1JLVA 2LJAA 5D8IA 2A2PA 2WGRA 1F2EA 3IPZA 2HXKA 1TP9A 4HUAA 6GSXA 1PX7A 3C1SA 3TKSA 4NHZA 5LCZA 1EGRA 2VCXA 2NBSA 4CY6A 1ZOFA 3RPPA 3A2WA 22GSA 5F07A 3H1NA 4FIWA 2F8AA 3VURA 1TI3A 2R0CA 2E2MA 4IJ3A 5E4WA 4F0CA 3E3EA 4QL9A 1PN0A 2F3MA 1PSQA 3FRCA 4G9HA 4KE3A 1JZRA 2WS2A 5EVOA 3ZL5A 2DMLA 4HU7A 3TKPA 5H5QA 1B48A 1ML6A 3TJKA 5DQSA 1H4OA 4XRDA 1PFOA 4TKYA 4GF0A 5DAKB 2CT6A 2PGTA 4V2LA 3TDGA 1GWCA 1XOBA 3QFAC 1O81A 4ISDA 1Z5YE 2XHFA 2K9FA 2X99A 3IOSA 2OA7A 5IMAA 3HHVA 1BJXA 1VF2A 14GSA 4MJEA 1O7UA 1GNWA 1IYIA 1M0UA 3F4RA 5CP1A 4MDCA 2FGXA 1USBA 1B8XA 3RBTA 1TW9A 3QAVA 4YAPA 1O8XA 1EZKA 4TW5A 2JADA 3GSSA 2B5XA 2ES7A 3KCMA 1Z3EA 4PTSA 3KP9A 6GSVA 3UBKA 4F0BA 3NIVA 2DJ2A 5ELGA 3OR5A 4TR3A 3FK8A 1YF1A 4MCUA 1YF0A 3F6DA 3DKSA 3ZREA 3E9JB 2CVDA 1Z6MA 1GH2A 2RM6A 4P3YB 5ENUA 3QFBC 4MK3A 5CREA 3MWHA 1AXDA 3D22A 3F8UA 3NOFA 2J9HA 1S3RA 2REMA 1WOUA 2H8LA 1XWGA 4Q5QA 3EU4A 1Z7RA 4RUVA 2DLXA 4IP1A 5HFKA 3TOUA 1N2AA 1PMTA 3CRTA 3GKKA 2HRAA 5AIXA 5IMVA 1DE2A 2GQKA 4ICYA 1B9XC 1VRSD 2C0EA 4L0UA 4MMMA 4O92A 2R0PA 3N9JA 4GCIA 5GSTA 4K2XA 1HYUA 2CX3A 5LNKe 3I9V2 3IV4A 1XWKA 5FT3A 1XXUA 19GSA 5KEJA 2FWGA 4AJ7A 5JWOB 2LNSA 1EP7A 1U6TA 1R5PA 2GSSA 6GSUA 1EOGA 2LQQA 1T7PB 8GSSA 2OE3A 5IO2A 3F0IA 4PNGA 1QXHA 3CQFA 1V40A 3G7YA 3MIXA 4KGIA 2MMAA 2ALBA 20GSA 3U6VA 4NWYA 3C8EA 3PGTA 4DSQA 2O89A 1E2YA 1V57A 1FAAA 3LXZA 5KN2A 1O73A 1FVKA 2O85A 4HZ2A 2JZRA 2LV3A 1OAZA 1I5GA 4XS6A 1FG4A 4KB3A 1Q4JA 2I4AA 3WT1A 5DALA 4GQFA 2MMOA 3EINA 4QQ7A 3EVIA 2XC2A 1PX6A 4EDZA 4XTSA 1ZL9A 4XS1A 3UIWA 3LYKA 3GX0A 4XS4B 3GKNA 1G0TA 1A0RP 16GSA 3W8JA 4ACSA 2DMMA 1V9WA 5ECNB 2YZUA 1J9BA 2GZPA 5ECMB 1T3BA 1XCCA 1EP8A 6GSYA 2H66A 4TOPA 3ISOA 3R2QA 2IMIA 3HJOA 3TJJA 4MJBA 3IK7A 4CW9A 2DKIA 3DIEA 4IVFA 1T4ZA 3US3A 1O8WA 3UMAA 2FY6A 3QD9A 1HNCA 2K6VA 2DIYA 2AHEA 3CTGA 5BRTA 5KN0A 4N0ZA 4N10A 4X43A 5IMDA 2LRCA 1AAZA 4HJ2A 1XPVA 1SYRA 3GSTA 3P8WA 2MMZA 1JHBA 3J7Yk 5C00A 1AW9A 3J7Yb 3Q18A 2DSAA 1XW6A 5G2ZA 5HFIA 1TOFA 5CRDA 2HYXA 2CAIA 2A4VA 1WWJA 4K5RA 2B5YA 4WETA 3M0FA 2G0FA 2O8VB 3HKRA 3BCKA 1FOVA 5A4UA 5CAXA 3EC3A 1EWXA 1M9AA 1ZYQB 1WJKA 3TCOA 5IMZA 3LQ7A 4IGJA 1Y25A 2GGTA 1TU7A 3DMLA 5CRHA 5GAND 1FB0A 2QC7A 5AIVA 3VLNA 2HE3A 3RPNA 4WF5A 1CQGA 1X9SB 4OCEA 1NW2A 1GLPA 4AGSA 2L5OA 4IKHA 5FWGA 2QSIA 2J23A 5J41A 3IC4A 2HRNA 1GTIA 4KCEA 3ZRDA 1XWCA 1YY7A 4PGTA 4OCFA 5G31A 2AAWA 3ME7A 2LNTA 4KDUA 1SJ6A 4G0IA 2DBCA 2N5FA 5CRGA 4LLRA 2YWMA 3EMXA 1A24A 1LU4A 1AQWA 4POLA 3A5WA 1QFNA 1V2AA 1A23A 3L78A 3KTLA 2K8VA 4FYBA 4K2DA 2DJKA 2TRXA 1M2AA 1GLQA 2B3SA 5G30A 3A3TA 2EC4A 2VCTA 4EKZA 3LYPA 1QK8A 4TR4A 5ID2A 1GSYA 1ERWA 2X8GA 3P2AA 2NDOA 4EO3A 1PL2A 3M3MA 6GSTA 3Q6OA 1TK0B 2X64A 4ZL7A 2MBSA 4N11A 3IBHA 1Q98A 2FLSA 5ECKB 1R7HA 1UC7A 3IR4A 2FA4A 3ZVJA 4F2IA 3GH9A 4JBBA 2DIZA 1HNAA 3BD2A 3TKQA 1WRYA 3GYKA 4NHWA 3KMNA 3VFIA 4TR1B 4Z7XA 2IJYA 4JR6A 4HJMA 1I9DA 4ZBBA 5CO3A 1SU9A 2V32A 1OC9B 2C3TA 4MPFA 2EIOA 2YOIA 2PN8A 2IWTA 3QOUA 4JR4A 3UEMA 4ZXGA 4EVMA 2H1DA 3GHAA 2HZFA 2ZUPA 5G1LA 2L4QA 4IN0A 12GSA 4NMUA 3DVXA 4NPBA 1ERUA 2HI7A 4N30A 2FUG2 3BBYA 1OVNA 2DKHA 2B5EA 5D93A 3G7IA 1XFLA 4MH2A 3KIJA 1G6YA 1GNEA 3G9BA 1CQHA 2JACA 6GSWA 4USSA 1E6BA 3ZLPA 3GUSA 4LMVA 4EIQA 2LSTA 2IL3A 10GSA 1A2MA 4KF9A 2AUVA 2DJ1A 1T00A 1F6MC 4GLTA 4O32A 3MNGA 4DVCA 4I2UA 3F3QA 1YQ1A 1ZMAA 2FWHA 2GQMA 2LTKA 3FR9A 3IHGA 5DAKA 4PXOA 3ERGA 3LFLA 2R0GA 1TK5B 2H1BA 2XPEA 5JCGA 4YQUA 2R6KA 5EPFA 2DJJA 3CRUA 2GSRA 3KXOA 1FOHA 1K3LA 4DSSB 2LRTA 4ZB8A 4K5SA 3QR6A 1BQ7A 4CHSA 4MZCA 2HSMA 4O5QA 5IM9A 1UA5A 4IBPA 3DVWA 1EV4A 1XOAA 2E7PA 1WP0A 5DCHA 3HVNA 2AV4A 1TU8A 1U3IA 3UVTA 2OBIA 1QUWA 2VLUA 2XBQA 2CVKA 1YEPA 1X5DA 1BAYA 4L8EA 3M9KA 4MA9A 1TI1A 1EV9A 1M2BA 4BVYB 1SK1A 2R37A 1PKZA 5HR0A 1URMA 3HCZA 5IQYA 5HQPA 4IELA 1TRUA 1YZXA 5D9XA 3UL3A 4ZILA 2KOKA 4POKA 4H86A 4IJIA 2KP2A 1TK8B 1X5EA 2LS5A 3ERFA 1Z6NA 3KZQA 4K0NA 3DGQA 5J4UA 3C73A 3VWWA 2QKEA 5JWQB 3GFKA 3M8NA 4WF4A 2GZZA 3LEFA 2H72A 3EWLA 3TKSE 2X8HA 2GVPA 2GDRA 2H73A 4HOJA 1SL1B 3ZVJD 2LUSA 1FW1A 4IHUA 4Z2RA 2WCIA 2XPDA 3FYGA 3HZ4A 4GSSA 7GSSA 1M3IA 2RIIA 4WEYA 3GL5A 4AJ8A 1YDKA 1SKWB 2YJHA 3ED3A 3LORA 3RAZA 3F3RA 2FHEA 3VI7A 5IPHA 1JZDA 3G7JA 5DDLA 5J9CA 2C0FA 1MD4A 2AB6A 3TJBA 5ECRB 4YKGA 4L5OA 4KSOA 2VL2A 1KNGA 1TRVA 2HFDA 5B7CA 1WE0A 4EE0A 5ECPB 1EEMA 2F8FA 4WXTA 1XZOA 2BTOT 3ZYWA 4Z2UA 3MSZA 2YNXA 1U3AA 4I2TA 4BWSA 1XWBA 1NSWA 1GTBA 2HNLA 1QQ2A 3GV1A 1M2DA 3U5RE 2D2ZA 1SK0A 1GSDA 3HYPA 3MYDA 5DJMA 1PA3A 1FHEA 4XIHA 2VLVA 3ZIVA 3H4KA 4JEDA 1LJRA 3FZ4A 4KDYA 3CYNA 1TRSA 4XS4A 5DCGA 2QGVA 1SD9A 5AISA 1BEDA 2C80A 2VIMA 5IOWA 3TRXA 1M9BA 4K1FA 3GKMA 4EF0A 1TJDA 3HVVA 4E8EA 1JZOA 4WR4A 1GTUA 3CSIA 2L6DA 3V1WA 1EGOA 4PQIA 5EY6A 3F63A 3LJRA 3FZ5A 3GX8A 4LMWA 1EOHA 2VO4A 3FEUA 2RUFA 3APSA 3W6GA 5D73A 3IXRA 4TR0A 2H19A 5G5EA 3CBUA 4WBRD 1YJ6A 1A2LA 1KBNA 5CNWA 4BVXB 1NHOA 3H8QA 3TKSC 1ZYPA 3O76A 1GSEA 4V2MA 3IHQA 2UZ8A 2MMNA 1OE7A 2CVBA 5J5NA 4YQMA 4BIKA 1PD21 3FR6A 5DQYA 4G2EA 6GSSA 4PUFC 4GSTA 1ACVA 2C0GA 2YWNA 2GSTA 4Q5FA 4PURA 3K8NA 4MZBA 5HR1A 4HDEA 1SJZA 1Z7PA 1MDKA 3HXSA 1TDIA 4TXOB 2PU9C 3GURA 1SKSB 1B4QA 1T4YA 1M3JA 4MF6A 3A5IA 4HS1A 5KOXA 1AIUA 1YKCA 3IE3A 3UVHA 3DRNA 2PBJA 5GAPD 2YJ7A 4MH3A 1TRWA 2CV4A 5H5SA 2C0DA 2GSQA 3IRAA 1YKAA 2YWOA 4K0GA 4GSNA 1RQMA 4DEJA 5HR3A 4BWQA 2OE0A 3QAWA 4BPYA 3S9FA 1TXXA 2R3XA 2LJRA 5DBQA 1EEJA 2JL4A 1K0NA 1XVWA 5ABRA 2L4CA 4RQRA 1SL2B 4HI7A 4RI6A 3UBLA 2H0HA 1HNBA 1K0OA 2WB9A 3WGEA 2H6ZA 3VI5A 2L59A 4OFNA 2VD0A 3VWVA 3LW9A 3Q74A 2IMFA 3DXBA 3CTFA 2GZYA 2B1LA 3HVXA 4JE1A 3C1RA 3F4TA 4JU5A 2H70A 2C8UA 1AUCA 2JU5A 2M80A 1X0RA 1GRXA 1U87A 3MAKA 4KX4A 2AYTA 1ILOA 4K7NA 1X9MB 5DJLA 4WKWA 3ME8A 2P0GA 1UVZA 13GSA 1QMVA 4XRAA 4D73B 1Z9HA 3LG6A 2FWEA 2H6XA 2H75A 4K8MA 1ERTA 3PPUA 2JSZA 2C1YA 3H79A 2WFCA 2E0QA 5ECQB 2B1KA 4TR1A 1K3OA 4O7HA 4OO5A 4KSMA 2HRFA 2A4HA 3F4SA 5F05A 3HA9A 5HFGA 4J56E 3LSZA 5DVBA 1F37A 1OC9A 1PN9A 3WD6A 4GWRA 2B7KA 3L4NA 2H1GA 2BJXA 1ZZYA 4EUYA 2A2RA 4CY8A 3D4MA 3IDVA 1S3AA 5G1KA 4WBJA 4XHMA 2R5GA 1GSFA 4ZB6A 4FH8A 2H74A 2FCHA 1X9WB 4OFMA 3GTUB 2I9HA 3TJGA 1VF1A 1XW9A 1G6WA 1VF4A 5L71A 1DSBA 2H0IA 4AF2A 5IO0A 2VCVA 1W89A 4KUNA 2HZEB 3FW2A 1SKRB 3W8SA 1BG5A 4ECIA 1ZCPA 3RHCA 1A8LA 4ML6A 3A2VA 4MP4A 2PWJA 4FYUA 2I1UA 1S3DA 4K9ZA 4X0XA 2JZSA 3H93A 2Z9SA 2PPTA 1OKDA 1M7TA 3LWAA 5IIZA 3TUEA 4IP6A 17GSA 1RK4A 3O6TA 1M99A 3ZZXA 3WGXA 1ERVA 2HRKA 2RLIA 1NHYA 3GMFA 2RUEA 5E59A 1J0FA 2I81A 2MYGA 3D21A 3D5JA 3KEBA 3R3EA 2VUPA 3M1GA 4IQAA 4J2FA 2GT6A 2OACA 2V2GA 4ZL8A 4DSSA 2IIYA 3QMXA 1BYEA 1AC1A 5INYA 3APQA 4I5QA 1HQOA 1XVQA 2CZ3A 4KCAA 3KH7A 5EL8A 4PQ1A 2IMEA 2YWIA 3IA1A 3DEXA 3GN3A 5J3RA 4I97A 1S3CA 1WMJA 3HD5A 4NXIA 3UOMA 4NV2A 4EIPA 2M72A 3ERWA 3KM6A 1C72A 5GZZB 5KN1A 4KAEA 3CXGA 4LL1B 4L5LA 4BVYA 2YV7A 2L6CA 2P5QA 2B7JA 4OO4A 2VCZA 1Y6EA 1G7OA 3IK9A 1KTEA 1PRXA 2L5LA 1R5AA 2K18A 2HSHA 4BL7B 3ZTLA 1ZGNA 2M46A 2X8CA 4K7IA 4ECJA 3IAS2 4TN8A 2IMDA 1PL1A 2IFQB 2O7KA 4N0VA 4YAVA 2PERA 2LEGA 4K6XA 1GUKA 4O5RA 3GIXA 4XCSA 4CDOA 2WZ9A 1GUHA 5F8BA 1K0MA 1XWAA 1R26A 2B6MA 2DJ0A 1ZYEA 3FHKA 5ECLB 1R4WA 2WRTA 5ELAA 5D9WA 3ZFLA 2NVLA 3LGCA 1SD8A 1OE8A 4L0WA 5ECIB 3HDCA 3PR8A 3VWUA 2YV9A 3HJPA 2H76A 3NZNA 2L57A 4MNNA 4HZ4A 1F3BA 1GSSA 5JWRB 2LJKA 4POMA 2H30A 3WT2A 4E8HA 3QDNA 1BX9A 4ID0A 4HQZA 2V41A 2LKUA 3M9JA 3O3TA 1AQVA 4GXZA 4I8BA 4KA0A 3AY8A 1K0DA 2GLRA 3WYWA 1XIYA 18GSA 4TRXA 4LL4B 2YANA 5F06A 2KUCA 2OADA 3PINA 1ST9A 1XG8A 3L0HA 2WJUA 3P90A 4ZIJA 2OKAA 5HR2A 1X5CA 4JRRA 4OMVA 5B8BA 2C3QA 1GL8A 2VL9A 5F0GA 3DD3A 1KEBA 1RW1A 1XW5A 2A2SA 3TRPA 1YEXA 2C3NA 4O5UA 1A2JA 3ZMKA 2YCDA 2O87A 3CSHA 4PUAA 4EL1A 1F9MA 3FZAA 5B8AA 2V1MA 4F9ZA 2VAFA 1V58A 4ECCA 1DE1A 1OKTA 1WPIA 3QAGA 4GRFA 3GNJA 2PVOC 4I6XA 4PX1A 3GA4A 1J08A 4KW6A 3WGDA 1N8JA 4G10A 4BVXA 3N5OA 1PGTA 5IMCA 3ZMLA 3VPTA 2NTOA 1XBSA 5H5RA 2PUKC 2DJ3A 5KOWA 3C71A 5ECOB 4EC0A 2YPMA 3KJYA 1SL0B 4Q5RA 2HT9A 2VD1A 4JZQA 1O85A 3UJ1A 1MDIA 3QCPA 3KH9A 3EYTA 5A4WA 1K0CA 1B9YC 2BMXA 4G0KA 4TVEA 1NM3A 3BCIA 1VGLA 5IMFA 1SK2A 4V1Ap 2IMKA 3BJ5A 3F6FA 3F9UA 1ABAA 5COHA 3GL3A 4EDYA 4Q5NA 3EURA 4TXOA 3RHBA 2YN1A 1IYHA 1TKDB 2FA8A 3KMOA 4Z2TA 1SYXA 5J9BA 1GUMA 4MPGA 1PQNA 2LQOA 2N5BA 3TRQA 4OD7A 3IC8A 4ZBAA 5B6MA 2K8SA 2H1AA 5D9TA 4ECBA 3D4TA 2MZCA 1WIKA 3TGZA 3DYRA 5AN1A 5A5KA 2VLTA 2FD3A 1GSQA 4HU9A 3LXTA 1K3YA 3KP8A 3MDKA 2QA1A 4PQHA 4MLYA 2H0GA 5DALB 2C4JA 4HEA2 4HSCX 4G19A 1T1VA 2V6KA 1TTZA 2E2GA 1JZWA 2CQ9A 2PMTA 2QA2A 1UN2A 4K7OA 1QGVA 4X1UA 1FO5A 1MEKA 1PKWA 2TIRA 9GSSA 3HY2A 3HJMA 4YKFA 1OC3A 3SWLA 2OE1A 2P31A 2NPBA 1GP1A 3A2XA 4MF7A 1A0FA 1H75A 2R2JA 2YP6A 1GSUA 2F51A 5G5FA 3VWXA 3L9VA 11GSA 3E0UA 3TB2A 2FNOA 3EMPA 2JSYA 4V1Ag 4YQVA 5GSSA 3DWVA 4D73A 3CMIA 3D0ZA 2HSYA 3KTBA 2GQLA 4MJAA 1K0BA 3L9SA 3QPMA 4WR5A 2VM1A 5CYYA 5CRWA 3TJFA 2XBIA 1GULA 3SBCA 4MZWA 5ECSA 5BMUA 1T8EB 2I3YA 3UARA 4BA7A 1THOA 2GTUA 2F9SA 2GT5A 3EU3A 1DUGA 1OC8A 1AQXA 2KHPA 3FR3A 3HVSA 4MABA 4KNDA 2H6YA 2VL2C 2PVQA 3VK9A 3D6IA 5B6NA 5FHIA 3GTUA 1FVJA 4ML1A 4IW9A 4DSRA 2DC5A 2WULA 3FY7A 2HLSA 2HZEA 1V98A 2IPAA 2JZTA 1THXA 4FO5A 1FB6A 2H71A 2X4AA 4ILFA 4YH2A 1MDJA 1JLWA 1SENA 3JCML 4NV5A 4F03A 3CSJA 3FMWA 3ZIJA 5ECHB 3Q19A 2TRCP 3GKXA 4HQSA 1ZYNA 4OWYA 5D96A 4FQUA 3TKRA 2WDUA 4POBA 5IPGA 3EE2A 4KH7A 3RDWA 3L9UA 2VOCA 2VL3A 4IS0A 1U88A 1ON4A 4ZBDA 2ZCTA 4G0LA 4RI7A 1HD2A 4V2NA 3EPTA 4F82A 3KD0A 2R4VA 2CA8A 2CX4A 2OBKA 3I6AA 2VCQA 2H01A 3FKFA 4NAXA 2MBTA
chains in the Genus database with same CATH topology
1O6JA 3FZ9A 3BOAA 1MD3A 1GTAA 5LD0A 4IQ1A 1VF3A 4LA1A 2G2QA 4GQCA 2GS3A 3C7MA 2IN3A 1K0AA 1B4PA 4KDXA 2EIQA 2ON7A 4PNFA 4TXVA 3UAPA 2ON5A 5ID2B 3ZFBA 2P5RA 2LRNA 2N5AA 3GH6A 2ZNMA 3KGKA 2KLXA 4ULXA 4OFTA 4X4JA 4J57E 4RQXA 1MTCA 1F3AA 2VM2A 2CZ2A 3APOA 5JCWA 3IAM2 2V6OA 1LBKA 2RM5A 4BL7A 1G7EA 1OYJA 4EXJA 1SJIA 3TOTA 3GRXA 1A8YA 5KN3A 4FYCA 1DBYA 2CAQA 3VPQA 2KP1A 4GTUA 2EIRA 5JCUA 5C04A 2X49A 2IFQA 2FWFA 3I69A 3P7XA 2YZHA 3PH9A 5AGYA 4AJ6A 5D9VA 4ZB9A 5IOXA 3HZ8A 4MJCA 2VCWA 3I43A 4A5PA 4ZL9A 2AJQB 1JFUA 4QL7A 2OJLA 4MF5A 3ZITA 1W4VA 5A4VA 1JLVA 2LJAA 5D8IA 2A2PA 2WGRA 1F2EA 3IPZA 2HXKA 1TP9A 4HUAA 6GSXA 1PX7A 3C1SA 3TKSA 4NHZA 5LCZA 1EGRA 2VCXA 2NBSA 4CY6A 1ZOFA 3RPPA 3A2WA 22GSA 5F07A 3H1NA 4FIWA 2F8AA 3VURA 1TI3A 2R0CA 2E2MA 4IJ3A 5E4WA 4F0CA 3E3EA 4QL9A 1PN0A 2F3MA 1PSQA 3FRCA 4G9HA 4KE3A 1JZRA 2WS2A 5EVOA 3ZL5A 2DMLA 4HU7A 3TKPA 5H5QA 1B48A 1ML6A 3TJKA 5DQSA 1H4OA 4XRDA 4TKYA 4GF0A 5DAKB 2CT6A 2PGTA 4V2LA 3TDGA 1GWCA 1XOBA 3QFAC 1O81A 4ISDA 1Z5YE 2XHFA 2K9FA 2X99A 3IOSA 2OA7A 5IMAA 3HHVA 1BJXA 1VF2A 14GSA 4MJEA 1O7UA 1GNWA 1IYIA 1M0UA 3F4RA 5CP1A 4MDCA 2FGXA 1USBA 1B8XA 3RBTA 1TW9A 3QAVA 4YAPA 1O8XA 1EZKA 4TW5A 2JADA 3GSSA 2B5XA 2ES7A 3KCMA 1Z3EA 4PTSA 3KP9A 6GSVA 3UBKA 4F0BA 3NIVA 2DJ2A 5ELGA 3OR5A 4TR3A 3FK8A 1YF1A 4MCUA 1YF0A 3F6DA 3DKSA 3ZREA 3E9JB 2CVDA 1Z6MA 1GH2A 2RM6A 4P3YB 5ENUA 3QFBC 4MK3A 5CREA 3MWHA 1AXDA 3D22A 3F8UA 3NOFA 2J9HA 2REMA 1WOUA 2H8LA 1XWGA 4Q5QA 3EU4A 1Z7RA 4RUVA 2DLXA 4IP1A 5HFKA 3TOUA 1N2AA 1PMTA 3CRTA 3GKKA 2HRAA 5AIXA 5IMVA 1DE2A 2GQKA 4ICYA 1B9XC 1VRSD 2C0EA 4L0UA 4MMMA 4O92A 2R0PA 3N9JA 4GCIA 5GSTA 4K2XA 1HYUA 2CX3A 5LNKe 3I9V2 3IV4A 1XWKA 5FT3A 1XXUA 19GSA 5KEJA 2FWGA 4AJ7A 5JWOB 2LNSA 1EP7A 1U6TA 1R5PA 2GSSA 6GSUA 1EOGA 2LQQA 1T7PB 8GSSA 2OE3A 5IO2A 3F0IA 4PNGA 1QXHA 1V40A 3G7YA 3MIXA 4KGIA 2MMAA 2ALBA 20GSA 3U6VA 4NWYA 3C8EA 3PGTA 4DSQA 2O89A 1E2YA 1V57A 1FAAA 3LXZA 5KN2A 1O73A 1FVKA 2O85A 4HZ2A 2JZRA 2LV3A 1OAZA 1I5GA 4XS6A 1FG4A 4KB3A 1Q4JA 2I4AA 3WT1A 5DALA 4GQFA 2MMOA 3EINA 4QQ7A 3EVIA 2XC2A 1PX6A 4EDZA 4XTSA 1ZL9A 4XS1A 3UIWA 3LYKA 3GX0A 4XS4B 3GKNA 1G0TA 1A0RP 16GSA 3W8JA 4ACSA 2DMMA 1V9WA 5ECNB 2YZUA 1J9BA 2GZPA 5ECMB 1T3BA 1XCCA 1EP8A 6GSYA 2H66A 4TOPA 3ISOA 3R2QA 2IMIA 3HJOA 3TJJA 4MJBA 3IK7A 4CW9A 2DKIA 3DIEA 4IVFA 1T4ZA 3US3A 1O8WA 3UMAA 2FY6A 3QD9A 1HNCA 2K6VA 2DIYA 2AHEA 3CTGA 5BRTA 5KN0A 4N0ZA 4N10A 4X43A 5IMDA 2LRCA 1AAZA 4HJ2A 1XPVA 1SYRA 3GSTA 3P8WA 2MMZA 1JHBA 3J7Yk 5C00A 1AW9A 3J7Yb 3Q18A 2DSAA 1XW6A 5G2ZA 5HFIA 1TOFA 5CRDA 2HYXA 2CAIA 2A4VA 1WWJA 4K5RA 2B5YA 4WETA 3M0FA 2G0FA 2O8VB 3HKRA 3BCKA 1FOVA 5A4UA 5CAXA 3EC3A 1EWXA 1M9AA 1ZYQB 1WJKA 3TCOA 5IMZA 3LQ7A 4IGJA 1Y25A 2GGTA 1TU7A 3DMLA 5CRHA 5GAND 1FB0A 2QC7A 5AIVA 3VLNA 2HE3A 3RPNA 4WF5A 1CQGA 1X9SB 4OCEA 1NW2A 1GLPA 4AGSA 2L5OA 4IKHA 5FWGA 2QSIA 2J23A 5J41A 3IC4A 2HRNA 1GTIA 4KCEA 3ZRDA 1XWCA 1YY7A 4PGTA 4OCFA 5G31A 2AAWA 3ME7A 2LNTA 4KDUA 1SJ6A 4G0IA 2DBCA 2N5FA 5CRGA 4LLRA 2YWMA 3EMXA 1A24A 1LU4A 1AQWA 4POLA 3A5WA 1QFNA 1V2AA 1A23A 3L78A 3KTLA 2K8VA 4FYBA 4K2DA 2DJKA 2TRXA 1M2AA 1GLQA 2B3SA 5G30A 3A3TA 2EC4A 2VCTA 4EKZA 3LYPA 1QK8A 4TR4A 5ID2A 1GSYA 1ERWA 2X8GA 3P2AA 2NDOA 4EO3A 1PL2A 3M3MA 6GSTA 3Q6OA 1TK0B 2X64A 4ZL7A 2MBSA 4N11A 3IBHA 1Q98A 2FLSA 5ECKB 1R7HA 1UC7A 3IR4A 2FA4A 3ZVJA 4F2IA 3GH9A 4JBBA 2DIZA 1HNAA 3BD2A 3TKQA 1WRYA 3GYKA 4NHWA 3KMNA 3VFIA 4TR1B 4Z7XA 2IJYA 4JR6A 4HJMA 1I9DA 4ZBBA 5CO3A 1SU9A 2V32A 1OC9B 2C3TA 4MPFA 2EIOA 2YOIA 2PN8A 2IWTA 3QOUA 4JR4A 3UEMA 4ZXGA 4EVMA 2H1DA 3GHAA 2HZFA 2ZUPA 5G1LA 2L4QA 4IN0A 12GSA 4NMUA 3DVXA 4NPBA 1ERUA 2HI7A 4N30A 2FUG2 3BBYA 1OVNA 2DKHA 2B5EA 5D93A 3G7IA 1XFLA 4MH2A 3KIJA 1G6YA 1GNEA 3G9BA 1CQHA 2JACA 6GSWA 4USSA 1E6BA 3ZLPA 3GUSA 4LMVA 4EIQA 2LSTA 2IL3A 10GSA 1A2MA 4KF9A 2AUVA 2DJ1A 1T00A 1F6MC 4GLTA 4O32A 3MNGA 4DVCA 4I2UA 3F3QA 1YQ1A 1ZMAA 2FWHA 2GQMA 2LTKA 3FR9A 3IHGA 5DAKA 4PXOA 3ERGA 3LFLA 2R0GA 1TK5B 2H1BA 2XPEA 5JCGA 4YQUA 2R6KA 5EPFA 2DJJA 3CRUA 2GSRA 3KXOA 1FOHA 1K3LA 4DSSB 2LRTA 4ZB8A 4K5SA 3QR6A 1BQ7A 4CHSA 4MZCA 2HSMA 4O5QA 5IM9A 1UA5A 4IBPA 3DVWA 1EV4A 1XOAA 2E7PA 1WP0A 5DCHA 2AV4A 1TU8A 1U3IA 3UVTA 2OBIA 1QUWA 2VLUA 2XBQA 2CVKA 1YEPA 1X5DA 1BAYA 4L8EA 3M9KA 4MA9A 1TI1A 1EV9A 1M2BA 4BVYB 1SK1A 2R37A 1PKZA 5HR0A 1URMA 3HCZA 5IQYA 5HQPA 4IELA 1TRUA 1YZXA 5D9XA 3UL3A 4ZILA 2KOKA 4POKA 4H86A 4IJIA 2KP2A 1TK8B 1X5EA 2LS5A 3ERFA 1Z6NA 3KZQA 4K0NA 3DGQA 5J4UA 3C73A 3VWWA 2QKEA 5JWQB 3GFKA 3M8NA 4WF4A 2GZZA 3LEFA 2H72A 3EWLA 3TKSE 2X8HA 2GVPA 2GDRA 2H73A 4HOJA 1SL1B 3ZVJD 2LUSA 1FW1A 4IHUA 4Z2RA 2WCIA 2XPDA 3FYGA 3HZ4A 4GSSA 7GSSA 2RIIA 4WEYA 3GL5A 4AJ8A 1YDKA 1SKWB 2YJHA 3ED3A 3LORA 3RAZA 3F3RA 2FHEA 3VI7A 5IPHA 1JZDA 3G7JA 5DDLA 5J9CA 2C0FA 1MD4A 2AB6A 3TJBA 5ECRB 4YKGA 4L5OA 4KSOA 2VL2A 1KNGA 1TRVA 2HFDA 5B7CA 1WE0A 4EE0A 5ECPB 1EEMA 2F8FA 4WXTA 1XZOA 2BTOT 3ZYWA 4Z2UA 3MSZA 2YNXA 1U3AA 4I2TA 4BWSA 1XWBA 1NSWA 1GTBA 2HNLA 1QQ2A 3GV1A 1M2DA 3U5RE 2D2ZA 1SK0A 1GSDA 3HYPA 3MYDA 5DJMA 1PA3A 1FHEA 4XIHA 2VLVA 3ZIVA 3H4KA 4JEDA 1LJRA 3FZ4A 4KDYA 3CYNA 1TRSA 4XS4A 5DCGA 2QGVA 1SD9A 5AISA 1BEDA 2C80A 2VIMA 5IOWA 3TRXA 1M9BA 4K1FA 3GKMA 4EF0A 1TJDA 3HVVA 4E8EA 1JZOA 4WR4A 1GTUA 3CSIA 2L6DA 3V1WA 1EGOA 4PQIA 5EY6A 3F63A 3LJRA 3FZ5A 3GX8A 4LMWA 1EOHA 2VO4A 3FEUA 2RUFA 3APSA 3W6GA 5D73A 3IXRA 4TR0A 2H19A 5G5EA 3CBUA 4WBRD 1YJ6A 1A2LA 1KBNA 5CNWA 4BVXB 1NHOA 3H8QA 3TKSC 1ZYPA 3O76A 1GSEA 4V2MA 3IHQA 2UZ8A 2MMNA 1OE7A 2CVBA 5J5NA 4YQMA 1PD21 3FR6A 5DQYA 4G2EA 6GSSA 4PUFC 4GSTA 1ACVA 2C0GA 2YWNA 2GSTA 4Q5FA 4PURA 3K8NA 4MZBA 5HR1A 4HDEA 1SJZA 1Z7PA 1MDKA 3HXSA 1TDIA 4TXOB 2PU9C 3GURA 1SKSB 1B4QA 1T4YA 4MF6A 3A5IA 4HS1A 5KOXA 1AIUA 1YKCA 3IE3A 3UVHA 3DRNA 2PBJA 5GAPD 2YJ7A 4MH3A 1TRWA 2CV4A 5H5SA 2C0DA 2GSQA 3IRAA 1YKAA 2YWOA 4K0GA 4GSNA 1RQMA 4DEJA 5HR3A 4BWQA 2OE0A 3QAWA 4BPYA 3S9FA 1TXXA 2R3XA 2LJRA 5DBQA 1EEJA 2JL4A 1K0NA 1XVWA 5ABRA 2L4CA 4RQRA 1SL2B 4HI7A 4RI6A 3UBLA 2H0HA 1HNBA 1K0OA 2WB9A 3WGEA 2H6ZA 3VI5A 2L59A 4OFNA 2VD0A 3VWVA 3LW9A 3Q74A 2IMFA 3DXBA 3CTFA 2GZYA 2B1LA 3HVXA 4JE1A 3C1RA 3F4TA 4JU5A 2H70A 2C8UA 1AUCA 2JU5A 2M80A 1X0RA 1GRXA 1U87A 3MAKA 4KX4A 2AYTA 1ILOA 4K7NA 1X9MB 5DJLA 4WKWA 3ME8A 2P0GA 1UVZA 13GSA 1QMVA 4XRAA 4D73B 1Z9HA 3LG6A 2FWEA 2H6XA 2H75A 4K8MA 1ERTA 3PPUA 2JSZA 2C1YA 3H79A 2WFCA 2E0QA 5ECQB 2B1KA 4TR1A 1K3OA 4O7HA 4OO5A 4KSMA 2HRFA 2A4HA 3F4SA 5F05A 3HA9A 5HFGA 4J56E 3LSZA 5DVBA 1F37A 1OC9A 1PN9A 3WD6A 4GWRA 2B7KA 3L4NA 2H1GA 2BJXA 1ZZYA 4EUYA 2A2RA 4CY8A 3D4MA 3IDVA 1S3AA 5G1KA 4WBJA 4XHMA 2R5GA 1GSFA 4ZB6A 4FH8A 2H74A 2FCHA 1X9WB 4OFMA 3GTUB 2I9HA 3TJGA 1VF1A 1XW9A 1G6WA 1VF4A 5L71A 1DSBA 2H0IA 4AF2A 5IO0A 2VCVA 1W89A 4KUNA 2HZEB 3FW2A 1SKRB 3W8SA 1BG5A 4ECIA 1ZCPA 3RHCA 1A8LA 4ML6A 3A2VA 4MP4A 2PWJA 4FYUA 2I1UA 1S3DA 4K9ZA 4X0XA 2JZSA 3H93A 2Z9SA 2PPTA 1OKDA 1M7TA 3LWAA 5IIZA 3TUEA 4IP6A 17GSA 1RK4A 3O6TA 1M99A 3ZZXA 3WGXA 1ERVA 2HRKA 2RLIA 1NHYA 3GMFA 2RUEA 5E59A 1J0FA 2I81A 2MYGA 3D21A 3D5JA 3KEBA 3R3EA 2VUPA 3M1GA 4IQAA 4J2FA 2GT6A 2OACA 2V2GA 4ZL8A 4DSSA 2IIYA 3QMXA 1BYEA 1AC1A 5INYA 3APQA 4I5QA 1HQOA 1XVQA 2CZ3A 4KCAA 3KH7A 5EL8A 4PQ1A 2IMEA 2YWIA 3IA1A 3DEXA 3GN3A 5J3RA 4I97A 1S3CA 1WMJA 3HD5A 4NXIA 3UOMA 4NV2A 4EIPA 2M72A 3ERWA 3KM6A 1C72A 5GZZB 5KN1A 4KAEA 3CXGA 4LL1B 4L5LA 4BVYA 2YV7A 2L6CA 2P5QA 2B7JA 4OO4A 2VCZA 1Y6EA 1G7OA 3IK9A 1KTEA 1PRXA 2L5LA 1R5AA 2K18A 2HSHA 4BL7B 3ZTLA 1ZGNA 2M46A 2X8CA 4K7IA 4ECJA 3IAS2 4TN8A 2IMDA 1PL1A 2IFQB 2O7KA 4N0VA 4YAVA 2PERA 2LEGA 4K6XA 1GUKA 4O5RA 3GIXA 4XCSA 4CDOA 2WZ9A 1GUHA 5F8BA 1K0MA 1XWAA 1R26A 2B6MA 2DJ0A 1ZYEA 3FHKA 5ECLB 1R4WA 2WRTA 5ELAA 5D9WA 3ZFLA 2NVLA 3LGCA 1SD8A 1OE8A 4L0WA 5ECIB 3HDCA 3PR8A 3VWUA 2YV9A 3HJPA 2H76A 3NZNA 2L57A 4MNNA 4HZ4A 1F3BA 1GSSA 5JWRB 2LJKA 4POMA 2H30A 3WT2A 4E8HA 3QDNA 1BX9A 4ID0A 4HQZA 2V41A 2LKUA 3M9JA 3O3TA 1AQVA 4GXZA 4I8BA 4KA0A 3AY8A 1K0DA 2GLRA 3WYWA 1XIYA 18GSA 4TRXA 4LL4B 2YANA 5F06A 2KUCA 2OADA 3PINA 1ST9A 3L0HA 2WJUA 3P90A 4ZIJA 2OKAA 5HR2A 1X5CA 4JRRA 4OMVA 5B8BA 2C3QA 1GL8A 2VL9A 5F0GA 3DD3A 1KEBA 1RW1A 1XW5A 2A2SA 3TRPA 1YEXA 2C3NA 4O5UA 1A2JA 3ZMKA 2YCDA 2O87A 3CSHA 4PUAA 4EL1A 1F9MA 3FZAA 5B8AA 2V1MA 4F9ZA 2VAFA 1V58A 4ECCA 1DE1A 1OKTA 1WPIA 3QAGA 4GRFA 3GNJA 2PVOC 4I6XA 4PX1A 3GA4A 1J08A 4KW6A 3WGDA 1N8JA 4G10A 4BVXA 3N5OA 1PGTA 5IMCA 3ZMLA 3VPTA 2NTOA 1XBSA 5H5RA 2PUKC 2DJ3A 5KOWA 3C71A 5ECOB 4EC0A 2YPMA 3KJYA 1SL0B 4Q5RA 2HT9A 2VD1A 4JZQA 1O85A 3UJ1A 1MDIA 3QCPA 3KH9A 3EYTA 5A4WA 1K0CA 1B9YC 2BMXA 4G0KA 4TVEA 1NM3A 3BCIA 1VGLA 5IMFA 1SK2A 4V1Ap 2IMKA 3BJ5A 3F6FA 3F9UA 1ABAA 5COHA 3GL3A 4EDYA 4Q5NA 3EURA 4TXOA 3RHBA 2YN1A 1IYHA 1TKDB 2FA8A 3KMOA 4Z2TA 1SYXA 5J9BA 1GUMA 4MPGA 1PQNA 2LQOA 2N5BA 3TRQA 4OD7A 3IC8A 4ZBAA 5B6MA 2K8SA 2H1AA 5D9TA 4ECBA 3D4TA 2MZCA 1WIKA 3TGZA 3DYRA 5AN1A 5A5KA 2VLTA 2FD3A 1GSQA 4HU9A 3LXTA 1K3YA 3KP8A 3MDKA 2QA1A 4PQHA 4MLYA 2H0GA 5DALB 2C4JA 4HEA2 4G19A 1T1VA 2V6KA 1TTZA 2E2GA 1JZWA 2CQ9A 2PMTA 2QA2A 1UN2A 4K7OA 1QGVA 4X1UA 1FO5A 1MEKA 1PKWA 2TIRA 9GSSA 3HY2A 3HJMA 4YKFA 1OC3A 3SWLA 2OE1A 2P31A 2NPBA 1GP1A 3A2XA 4MF7A 1A0FA 1H75A 2R2JA 2YP6A 1GSUA 2F51A 5G5FA 3VWXA 3L9VA 11GSA 3E0UA 3TB2A 2FNOA 3EMPA 2JSYA 4V1Ag 4YQVA 5GSSA 3DWVA 4D73A 3CMIA 3D0ZA 2HSYA 3KTBA 2GQLA 4MJAA 1K0BA 3L9SA 3QPMA 4WR5A 2VM1A 5CYYA 5CRWA 3TJFA 2XBIA 1GULA 3SBCA 4MZWA 5ECSA 5BMUA 1T8EB 2I3YA 3UARA 4BA7A 1THOA 2GTUA 2F9SA 2GT5A 3EU3A 1DUGA 1OC8A 1AQXA 2KHPA 3FR3A 3HVSA 4MABA 4KNDA 2H6YA 2VL2C 2PVQA 3VK9A 3D6IA 5B6NA 5FHIA 3GTUA 1FVJA 4ML1A 4IW9A 4DSRA 2DC5A 2WULA 3FY7A 2HLSA 2HZEA 1V98A 2IPAA 2JZTA 1THXA 4FO5A 1FB6A 2H71A 2X4AA 4ILFA 4YH2A 1MDJA 1JLWA 1SENA 3JCML 4NV5A 4F03A 3CSJA 3FMWA 3ZIJA 5ECHB 3Q19A 2TRCP 3GKXA 4HQSA 1ZYNA 4OWYA 5D96A 4FQUA 3TKRA 2WDUA 4POBA 5IPGA 3EE2A 4KH7A 3RDWA 3L9UA 2VOCA 2VL3A 4IS0A 1U88A 1ON4A 4ZBDA 2ZCTA 4G0LA 4RI7A 1HD2A 4V2NA 3EPTA 4F82A 3KD0A 2R4VA 2CA8A 2CX4A 2OBKA 3I6AA 2VCQA 2H01A 3FKFA 4NAXA 2MBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6J A;  3FZ9 A;  3BOA A;  1MD3 A;  1GTA A;  5LD0 A;  4IQ1 A;  1VF3 A;  4LA1 A;  2G2Q A;  4GQC A;  2GS3 A;  3C7M A;  2IN3 A;  1K0A A;  1B4P A;  4KDX A;  2EIQ A;  2ON7 A;  4PNF A;  4TXV A;  3UAP A;  2ON5 A;  5ID2 B;  3ZFB A;  2P5R A;  2LRN A;  2N5A A;  3GH6 A;  2ZNM A;  3KGK A;  2KLX A;  4ULX A;  4OFT A;  4J57 E;  4RQX A;  1MTC A;  1F3A A;  2VM2 A;  2CZ2 A;  3APO A;  5JCW A;  3IAM 2;  2V6O A;  1LBK A;  2RM5 A;  4BL7 A;  1G7E A;  1OYJ A;  4EXJ A;  1SJI A;  3TOT A;  3GRX A;  1A8Y A;  5KN3 A;  4FYC A;  1DBY A;  2CAQ A;  3VPQ A;  2KP1 A;  4GTU A;  2EIR A;  5JCU A;  5C04 A;  2IFQ A;  2FWF A;  3I69 A;  3P7X A;  2YZH A;  3PH9 A;  5AGY A;  4AJ6 A;  5D9V A;  4ZB9 A;  5IOX A;  3HZ8 A;  4MJC A;  2VCW A;  3I43 A;  4ZL9 A;  2AJQ B;  1JFU A;  4QL7 A;  2OJL A;  4MF5 A;  3ZIT A;  1W4V A;  5A4V A;  1JLV A;  2LJA A;  5D8I A;  2WGR A;  1F2E A;  3IPZ A;  2HXK A;  1TP9 A;  4HUA A;  6GSX A;  1PX7 A;  3C1S A;  3TKS A;  4NHZ A;  5LCZ A;  1EGR A;  2VCX A;  2NBS A;  1ZOF A;  3RPP A;  3A2W A;  22GS A;  5F07 A;  3H1N A;  4FIW A;  2F8A A;  3VUR A;  1TI3 A;  2E2M A;  4IJ3 A;  5E4W A;  4F0C A;  3E3E A;  4QL9 A;  2F3M A;  1PSQ A;  3FRC A;  4G9H A;  4KE3 A;  1JZR A;  2WS2 A;  5EVO A;  3ZL5 A;  2DML A;  4HU7 A;  3TKP A;  5H5Q A;  1B48 A;  1ML6 A;  3TJK A;  5DQS A;  1H4O A;  4XRD A;  4TKY A;  4GF0 A;  5DAK B;  2CT6 A;  2PGT A;  4V2L A;  3TDG A;  1GWC A;  1XOB A;  3QFA C;  1O81 A;  4ISD A;  1Z5Y E;  2XHF A;  2K9F A;  2X99 A;  3IOS A;  2OA7 A;  5IMA A;  3HHV A;  1BJX A;  1VF2 A;  14GS A;  4MJE A;  1O7U A;  1GNW A;  1IYI A;  1M0U A;  3F4R A;  5CP1 A;  4MDC A;  2FGX A;  1USB A;  1B8X A;  3RBT A;  1TW9 A;  3QAV A;  4YAP A;  1O8X A;  1EZK A;  4TW5 A;  2JAD A;  3GSS A;  2B5X A;  2ES7 A;  3KCM A;  1Z3E A;  3KP9 A;  6GSV A;  3UBK A;  4F0B A;  3NIV A;  2DJ2 A;  5ELG A;  3OR5 A;  4TR3 A;  3FK8 A;  1YF1 A;  4MCU A;  1YF0 A;  3F6D A;  3DKS A;  3ZRE A;  3E9J B;  2CVD A;  1Z6M A;  1GH2 A;  2RM6 A;  4P3Y B;  5ENU A;  3QFB C;  4MK3 A;  5CRE A;  3MWH A;  1AXD A;  3D22 A;  3F8U A;  3NOF A;  2J9H A;  2REM A;  1WOU A;  2H8L A;  1XWG A;  4Q5Q A;  3EU4 A;  1Z7R A;  4RUV A;  2DLX A;  4IP1 A;  5HFK A;  3TOU A;  1N2A A;  1PMT A;  3CRT A;  3GKK A;  5IMV A;  5AIX A;  1DE2 A;  2GQK A;  1B9X C;  1VRS D;  2C0E A;  4L0U A;  4MMM A;  4O92 A;  3N9J A;  4GCI A;  5GST A;  1HYU A;  2CX3 A;  5LNK e;  3I9V 2;  3IV4 A;  1XWK A;  5FT3 A;  1XXU A;  19GS A;  5KEJ A;  2FWG A;  4AJ7 A;  5JWO B;  2LNS A;  1EP7 A;  1U6T A;  1R5P A;  2GSS A;  6GSU A;  1EOG A;  2LQQ A;  1T7P B;  8GSS A;  2OE3 A;  5IO2 A;  3F0I A;  4PNG A;  1QXH A;  1V40 A;  3G7Y A;  4KGI A;  2MMA A;  2ALB A;  20GS A;  3U6V A;  4NWY A;  3C8E A;  3PGT A;  4DSQ A;  2O89 A;  1E2Y A;  1V57 A;  1FAA A;  3LXZ A;  5KN2 A;  1O73 A;  1FVK A;  2O85 A;  4HZ2 A;  2JZR A;  2LV3 A;  1OAZ A;  1I5G A;  4XS6 A;  1FG4 A;  4KB3 A;  1Q4J A;  2I4A A;  3WT1 A;  5DAL A;  4GQF A;  2MMO A;  3EIN A;  4QQ7 A;  3EVI A;  2XC2 A;  1PX6 A;  4EDZ A;  4XTS A;  1ZL9 A;  4XS1 A;  3UIW A;  3LYK A;  3GX0 A;  4XS4 B;  3GKN A;  1G0T A;  1A0R P;  16GS A;  3W8J A;  4ACS A;  2DMM A;  1V9W A;  5ECN B;  2YZU A;  1J9B A;  2GZP A;  5ECM B;  1T3B A;  1XCC A;  1EP8 A;  6GSY A;  2H66 A;  4TOP A;  3ISO A;  3R2Q A;  2IMI A;  3HJO A;  3TJJ A;  4MJB A;  3IK7 A;  4CW9 A;  3DIE A;  4IVF A;  1T4Z A;  3US3 A;  1O8W A;  3UMA A;  2FY6 A;  3QD9 A;  1HNC A;  2K6V A;  2DIY A;  2AHE A;  3CTG A;  5KN0 A;  4N0Z A;  4N10 A;  4X43 A;  5IMD A;  2LRC A;  1AAZ A;  4HJ2 A;  1XPV A;  1SYR A;  3GST A;  3P8W A;  2MMZ A;  1JHB A;  3J7Y k;  5C00 A;  1AW9 A;  3J7Y b;  3Q18 A;  2DSA A;  1XW6 A;  5G2Z A;  5HFI A;  1TOF A;  5CRD A;  2HYX A;  2CAI A;  2A4V A;  1WWJ A;  2B5Y A;  4WET A;  3M0F A;  2G0F A;  2O8V B;  3HKR A;  3BCK A;  1FOV A;  5A4U A;  5CAX A;  3EC3 A;  1EWX A;  1M9A A;  1ZYQ B;  1WJK A;  3TCO A;  5IMZ A;  3LQ7 A;  4IGJ A;  1Y25 A;  2GGT A;  1TU7 A;  3DML A;  5CRH A;  5GAN D;  1FB0 A;  2QC7 A;  5AIV A;  3VLN A;  2HE3 A;  3RPN A;  4WF5 A;  1CQG A;  1X9S B;  4OCE A;  1NW2 A;  1GLP A;  4AGS A;  2L5O A;  4IKH A;  5FWG A;  2QSI A;  2J23 A;  5J41 A;  3IC4 A;  2HRN A;  1GTI A;  4KCE A;  3ZRD A;  1XWC A;  1YY7 A;  4PGT A;  4OCF A;  5G31 A;  2AAW A;  3ME7 A;  2LNT A;  4KDU A;  1SJ6 A;  2DBC A;  2N5F A;  5CRG A;  4LLR A;  2YWM A;  3EMX A;  1A24 A;  1LU4 A;  1AQW A;  4POL A;  3A5W A;  1QFN A;  1V2A A;  1A23 A;  3L78 A;  3KTL A;  2K8V A;  4FYB A;  4K2D A;  2DJK A;  2TRX A;  1M2A A;  1GLQ A;  2B3S A;  5G30 A;  3A3T A;  2EC4 A;  2VCT A;  4EKZ A;  3LYP A;  1QK8 A;  4TR4 A;  5ID2 A;  1GSY A;  1ERW A;  2X8G A;  3P2A A;  2NDO A;  4EO3 A;  1PL2 A;  3M3M A;  6GST A;  3Q6O A;  1TK0 B;  2X64 A;  4ZL7 A;  2MBS A;  4N11 A;  3IBH A;  1Q98 A;  2FLS A;  5ECK B;  1R7H A;  1UC7 A;  3IR4 A;  2FA4 A;  3ZVJ A;  4F2I A;  3GH9 A;  4JBB A;  2DIZ A;  1HNA A;  3BD2 A;  3TKQ A;  1WRY A;  3GYK A;  4NHW A;  3KMN A;  3VFI A;  4TR1 B;  4Z7X A;  2IJY A;  4JR6 A;  4HJM A;  1I9D A;  4ZBB A;  5CO3 A;  1SU9 A;  2V32 A;  1OC9 B;  2C3T A;  4MPF A;  2EIO A;  2YOI A;  2PN8 A;  2IWT A;  3QOU A;  4JR4 A;  3UEM A;  4ZXG A;  4EVM A;  2H1D A;  3GHA A;  2HZF A;  2ZUP A;  5G1L A;  2L4Q A;  4IN0 A;  12GS A;  4NMU A;  3DVX A;  4NPB A;  1ERU A;  2HI7 A;  4N30 A;  2FUG 2;  3BBY A;  1OVN A;  2B5E A;  5D93 A;  3G7I A;  1XFL A;  4MH2 A;  3KIJ A;  1G6Y A;  1GNE A;  3G9B A;  1CQH A;  2JAC A;  6GSW A;  1E6B A;  3ZLP A;  3GUS A;  4LMV A;  2LST A;  2IL3 A;  10GS A;  1A2M A;  2AUV A;  2DJ1 A;  1T00 A;  1F6M C;  4GLT A;  4O32 A;  3MNG A;  4DVC A;  4I2U A;  3F3Q A;  1YQ1 A;  1ZMA A;  2FWH A;  2GQM A;  2LTK A;  3FR9 A;  5DAK A;  4PXO A;  3ERG A;  3LFL A;  1TK5 B;  2H1B A;  2XPE A;  5JCG A;  4YQU A;  2R6K A;  5EPF A;  2DJJ A;  3CRU A;  2GSR A;  3KXO A;  1K3L A;  4DSS B;  2LRT A;  4ZB8 A;  3QR6 A;  1BQ7 A;  4CHS A;  4MZC A;  5IM9 A;  1UA5 A;  4IBP A;  3DVW A;  1EV4 A;  1XOA A;  2E7P A;  1WP0 A;  5DCH A;  2AV4 A;  1TU8 A;  1U3I A;  3UVT A;  2OBI A;  1QUW A;  2VLU A;  2XBQ A;  2CVK A;  1YEP A;  1X5D A;  1BAY A;  4L8E A;  3M9K A;  4MA9 A;  1TI1 A;  1EV9 A;  1M2B A;  1SK1 A;  2R37 A;  1PKZ A;  5HR0 A;  1URM A;  3HCZ A;  5IQY A;  5HQP A;  4IEL A;  1TRU A;  1YZX A;  5D9X A;  3UL3 A;  4ZIL A;  2KOK A;  4POK A;  4H86 A;  4IJI A;  2KP2 A;  1TK8 B;  1X5E A;  2LS5 A;  3ERF A;  1Z6N A;  3KZQ A;  4K0N A;  3DGQ A;  5J4U A;  3C73 A;  3VWW A;  2QKE A;  5JWQ B;  3GFK A;  3M8N A;  4WF4 A;  2GZZ A;  3LEF A;  2H72 A;  3EWL A;  3TKS E;  2X8H A;  2GVP A;  2GDR A;  2H73 A;  4HOJ A;  1SL1 B;  3ZVJ D;  2LUS A;  1FW1 A;  4IHU A;  2WCI A;  2XPD A;  3FYG A;  3HZ4 A;  4GSS A;  7GSS A;  2RII A;  4WEY A;  3GL5 A;  4AJ8 A;  1YDK A;  1SKW B;  2YJH A;  3ED3 A;  3LOR A;  3RAZ A;  3F3R A;  2FHE A;  3VI7 A;  5IPH A;  1JZD A;  3G7J A;  5DDL A;  5J9C A;  2C0F A;  1MD4 A;  2AB6 A;  3TJB A;  5ECR B;  4L5O A;  4KSO A;  2VL2 A;  1KNG A;  1TRV A;  2HFD A;  5B7C A;  1WE0 A;  4EE0 A;  5ECP B;  1EEM A;  2F8F A;  4WXT A;  1XZO A;  2BTO T;  3ZYW A;  3MSZ A;  2YNX A;  1U3A A;  4I2T A;  4BWS A;  1XWB A;  1NSW A;  1GTB A;  2HNL A;  1QQ2 A;  3GV1 A;  1M2D A;  3U5R E;  2D2Z A;  1SK0 A;  1GSD A;  3HYP A;  5DJM A;  1PA3 A;  1FHE A;  4XIH A;  2VLV A;  3ZIV A;  3H4K A;  4JED A;  1LJR A;  3FZ4 A;  4KDY A;  3CYN A;  1TRS A;  4XS4 A;  5DCG A;  2QGV A;  1SD9 A;  5AIS A;  1BED A;  2C80 A;  2VIM A;  5IOW A;  3TRX A;  1M9B A;  4K1F A;  3GKM A;  4EF0 A;  1TJD A;  3HVV A;  4E8E A;  1JZO A;  4WR4 A;  1GTU A;  3CSI A;  2L6D A;  3V1W A;  1EGO A;  4PQI A;  5EY6 A;  3F63 A;  3LJR A;  3FZ5 A;  3GX8 A;  4LMW A;  1EOH A;  2VO4 A;  3FEU A;  2RUF A;  3APS A;  3W6G A;  5D73 A;  3IXR A;  4TR0 A;  2H19 A;  5G5E A;  3CBU A;  4WBR D;  1YJ6 A;  1A2L A;  1KBN A;  5CNW A;  1NHO A;  3H8Q A;  3TKS C;  3O76 A;  1GSE A;  4V2M A;  3IHQ A;  2MMN A;  1OE7 A;  2CVB A;  5J5N A;  4YQM A;  1PD2 1;  3FR6 A;  5DQY A;  4G2E A;  6GSS A;  4PUF C;  4GST A;  1ACV A;  2C0G A;  2YWN A;  2GST A;  4Q5F A;  4PUR A;  3K8N A;  4MZB A;  5HR1 A;  4HDE A;  1SJZ A;  1Z7P A;  1MDK A;  3HXS A;  1TDI A;  4TXO B;  2PU9 C;  3GUR A;  1SKS B;  1B4Q A;  1T4Y A;  4MF6 A;  4HS1 A;  1AIU A;  1YKC A;  3IE3 A;  3UVH A;  3DRN A;  2PBJ A;  5GAP D;  2YJ7 A;  4MH3 A;  1TRW A;  2CV4 A;  5H5S A;  2C0D A;  2GSQ A;  3IRA A;  1YKA A;  2YWO A;  4K0G A;  4GSN A;  1RQM A;  4DEJ A;  5HR3 A;  4BWQ A;  2OE0 A;  3QAW A;  4BPY A;  3S9F A;  1TXX A;  2R3X A;  2LJR A;  5DBQ A;  1EEJ A;  2JL4 A;  1K0N A;  1XVW A;  5ABR A;  2L4C A;  4RQR A;  1SL2 B;  4HI7 A;  4RI6 A;  3UBL A;  2H0H A;  1HNB A;  1K0O A;  2WB9 A;  3WGE A;  2H6Z A;  3VI5 A;  2L59 A;  4OFN A;  2VD0 A;  3VWV A;  3Q74 A;  2IMF A;  3DXB A;  3CTF A;  2GZY A;  2B1L A;  3HVX A;  4JE1 A;  3C1R A;  3F4T A;  4JU5 A;  2H70 A;  2C8U A;  1AUC A;  2JU5 A;  2M80 A;  1X0R A;  1GRX A;  1U87 A;  3MAK A;  4KX4 A;  2AYT A;  1ILO A;  4K7N A;  1X9M B;  5DJL A;  4WKW A;  3ME8 A;  2P0G A;  1UVZ A;  13GS A;  1QMV A;  4XRA A;  4D73 B;  1Z9H A;  3LG6 A;  2FWE A;  2H6X A;  2H75 A;  4K8M A;  1ERT A;  2JSZ A;  2C1Y A;  3H79 A;  2WFC A;  2E0Q A;  5ECQ B;  2B1K A;  4TR1 A;  1K3O A;  4O7H A;  4OO5 A;  4KSM A;  2HRF A;  3F4S A;  5F05 A;  3HA9 A;  5HFG A;  4J56 E;  3LSZ A;  5DVB A;  1F37 A;  1OC9 A;  1PN9 A;  3WD6 A;  4GWR A;  2B7K A;  3L4N A;  2H1G A;  2BJX A;  1ZZY A;  4EUY A;  2A2R A;  3D4M A;  3IDV A;  1S3A A;  5G1K A;  4WBJ A;  4XHM A;  2R5G A;  1GSF A;  4ZB6 A;  4FH8 A;  2H74 A;  2FCH A;  1X9W B;  4OFM A;  3GTU B;  2I9H A;  3TJG A;  1VF1 A;  1XW9 A;  1G6W A;  1VF4 A;  5L71 A;  1DSB A;  2H0I A;  4AF2 A;  5IO0 A;  2VCV A;  1W89 A;  4KUN A;  2HZE B;  3FW2 A;  1SKR B;  3W8S A;  1BG5 A;  4ECI A;  1ZCP A;  3RHC A;  1A8L A;  4ML6 A;  3A2V A;  4MP4 A;  2PWJ A;  4FYU A;  2I1U A;  1S3D A;  4K9Z A;  4X0X A;  2JZS A;  3H93 A;  2Z9S A;  2PPT A;  1OKD A;  1M7T A;  3LWA A;  5IIZ A;  3TUE A;  4IP6 A;  17GS A;  1RK4 A;  3O6T A;  1M99 A;  3ZZX A;  3WGX A;  1ERV A;  2RLI A;  1NHY A;  3GMF A;  2RUE A;  5E59 A;  1J0F A;  2I81 A;  2MYG A;  3D21 A;  3D5J A;  3KEB A;  2VUP A;  3M1G A;  4IQA A;  4J2F A;  2GT6 A;  2OAC A;  2V2G A;  4ZL8 A;  4DSS A;  2IIY A;  3QMX A;  1BYE A;  1AC1 A;  5INY A;  3APQ A;  4I5Q A;  1HQO A;  1XVQ A;  2CZ3 A;  4KCA A;  3KH7 A;  5EL8 A;  4PQ1 A;  2IME A;  2YWI A;  3IA1 A;  3DEX A;  3GN3 A;  5J3R A;  4I97 A;  1S3C A;  1WMJ A;  3HD5 A;  4NXI A;  3UOM A;  4NV2 A;  2M72 A;  3ERW A;  3KM6 A;  1C72 A;  5GZZ B;  5KN1 A;  4KAE A;  3CXG A;  4LL1 B;  4L5L A;  4BVY A;  2YV7 A;  2L6C A;  2P5Q A;  2B7J A;  4OO4 A;  2VCZ A;  1Y6E A;  1G7O A;  3IK9 A;  1KTE A;  1PRX A;  2L5L A;  1R5A A;  2K18 A;  2HSH A;  3ZTL A;  1ZGN A;  2M46 A;  2X8C A;  4K7I A;  4ECJ A;  3IAS 2;  4TN8 A;  2IMD A;  1PL1 A;  2IFQ B;  2O7K A;  4N0V A;  4YAV A;  2PER A;  2LEG A;  4K6X A;  1GUK A;  4O5R A;  3GIX A;  4XCS A;  4CDO A;  2WZ9 A;  1GUH A;  5F8B A;  1K0M A;  1XWA A;  1R26 A;  2B6M A;  2DJ0 A;  1ZYE A;  3FHK A;  5ECL B;  1R4W A;  2WRT A;  5ELA A;  5D9W A;  3ZFL A;  2NVL A;  3LGC A;  1SD8 A;  1OE8 A;  4L0W A;  5ECI B;  3HDC A;  3PR8 A;  3VWU A;  2YV9 A;  3HJP A;  2H76 A;  3NZN A;  2L57 A;  4HZ4 A;  1F3B A;  1GSS A;  5JWR B;  2LJK A;  4POM A;  2H30 A;  3WT2 A;  4E8H A;  3QDN A;  1BX9 A;  4ID0 A;  4HQZ A;  2V41 A;  2LKU A;  3M9J A;  3O3T A;  1AQV A;  4GXZ A;  4I8B A;  4KA0 A;  3AY8 A;  1K0D A;  2GLR A;  3WYW A;  1XIY A;  18GS A;  4TRX A;  4LL4 B;  2YAN A;  5F06 A;  2KUC A;  2OAD A;  3PIN A;  1ST9 A;  3L0H A;  2WJU A;  3P90 A;  4ZIJ A;  2OKA A;  5HR2 A;  1X5C A;  4JRR A;  4OMV A;  5B8B A;  2C3Q A;  1GL8 A;  2VL9 A;  5F0G A;  3DD3 A;  1KEB A;  1RW1 A;  1XW5 A;  2A2S A;  3TRP A;  1YEX A;  2C3N A;  1A2J A;  3ZMK A;  2YCD A;  2O87 A;  3CSH A;  4PUA A;  4EL1 A;  1F9M A;  3FZA A;  5B8A A;  2V1M A;  4F9Z A;  2VAF A;  1V58 A;  4ECC A;  1DE1 A;  1OKT A;  1WPI A;  3QAG A;  4GRF A;  3GNJ A;  2PVO C;  4I6X A;  4PX1 A;  3GA4 A;  1J08 A;  4KW6 A;  3WGD A;  1N8J A;  4G10 A;  4BVX A;  3N5O A;  1PGT A;  5IMC A;  3ZML A;  3VPT A;  2NTO A;  1XBS A;  5H5R A;  2PUK C;  2DJ3 A;  3C71 A;  5ECO B;  4EC0 A;  2YPM A;  3KJY A;  1SL0 B;  4Q5R A;  2HT9 A;  2VD1 A;  4JZQ A;  1O85 A;  3UJ1 A;  1MDI A;  3QCP A;  3KH9 A;  3EYT A;  5A4W A;  1K0C A;  1B9Y C;  2BMX A;  4TVE A;  1NM3 A;  3BCI A;  1VGL A;  5IMF A;  1SK2 A;  4V1A p;  2IMK A;  3BJ5 A;  3F6F A;  3F9U A;  1ABA A;  5COH A;  3GL3 A;  4EDY A;  4Q5N A;  3EUR A;  4TXO A;  3RHB A;  2YN1 A;  1IYH A;  1TKD B;  2FA8 A;  3KMO A;  1SYX A;  5J9B A;  1GUM A;  4MPG A;  1PQN A;  2LQO A;  2N5B A;  3TRQ A;  4OD7 A;  4ZBA A;  5B6M A;  2K8S A;  2H1A A;  5D9T A;  4ECB A;  3D4T A;  2MZC A;  1WIK A;  3TGZ A;  3DYR A;  5AN1 A;  5A5K A;  2VLT A;  2FD3 A;  1GSQ A;  4HU9 A;  3LXT A;  1K3Y A;  3KP8 A;  3MDK A;  4PQH A;  4MLY A;  2H0G A;  5DAL B;  2C4J A;  4HEA 2;  4G19 A;  1T1V A;  2V6K A;  1TTZ A;  2E2G A;  1JZW A;  2CQ9 A;  2PMT A;  1UN2 A;  4K7O A;  1QGV A;  4X1U A;  1FO5 A;  1MEK A;  1PKW A;  2TIR A;  9GSS A;  3HY2 A;  3HJM A;  1OC3 A;  3SWL A;  2OE1 A;  2P31 A;  2NPB A;  1GP1 A;  3A2X A;  4MF7 A;  1A0F A;  1H75 A;  2R2J A;  2YP6 A;  1GSU A;  2F51 A;  5G5F A;  3VWX A;  3L9V A;  11GS A;  3E0U A;  3TB2 A;  2FNO A;  3EMP A;  2JSY A;  4V1A g;  4YQV A;  5GSS A;  3DWV A;  4D73 A;  3CMI A;  3D0Z A;  2HSY A;  3KTB A;  2GQL A;  4MJA A;  1K0B A;  3L9S A;  3QPM A;  4WR5 A;  2VM1 A;  5CYY A;  5CRW A;  3TJF A;  2XBI A;  1GUL A;  3SBC A;  4MZW A;  5ECS A;  1T8E B;  2I3Y A;  3UAR A;  4BA7 A;  1THO A;  2GTU A;  2F9S A;  2GT5 A;  3EU3 A;  1DUG A;  1OC8 A;  1AQX A;  2KHP A;  3FR3 A;  3HVS A;  4MAB A;  4KND A;  2H6Y A;  2VL2 C;  2PVQ A;  3VK9 A;  3D6I A;  5B6N A;  5FHI A;  3GTU A;  1FVJ A;  4ML1 A;  4IW9 A;  4DSR A;  2DC5 A;  2WUL A;  3FY7 A;  2HLS A;  2HZE A;  1V98 A;  2IPA A;  2JZT A;  1THX A;  4FO5 A;  1FB6 A;  2H71 A;  4ILF A;  4YH2 A;  1MDJ A;  1JLW A;  1SEN A;  3JCM L;  4NV5 A;  4F03 A;  3CSJ A;  3ZIJ A;  5ECH B;  3Q19 A;  2TRC P;  3GKX A;  4HQS A;  4OWY A;  5D96 A;  3TKR A;  2WDU A;  4POB A;  5IPG A;  3EE2 A;  4KH7 A;  3RDW A;  3L9U A;  2VOC A;  2VL3 A;  4IS0 A;  1U88 A;  1ON4 A;  4ZBD A;  2ZCT A;  4RI7 A;  1HD2 A;  4V2N A;  4F82 A;  3KD0 A;  2R4V A;  2CA8 A;  2CX4 A;  2OBK A;  3I6A A;  2VCQ A;  2H01 A;  3FKF A;  4NAX A;  2MBT A; 
#chains in the Genus database with same CATH topology
 1O6J A;  3FZ9 A;  3BOA A;  1MD3 A;  1GTA A;  5LD0 A;  4IQ1 A;  1VF3 A;  4LA1 A;  2G2Q A;  4GQC A;  2GS3 A;  3C7M A;  2IN3 A;  1K0A A;  1B4P A;  4KDX A;  2EIQ A;  2ON7 A;  4PNF A;  4TXV A;  3UAP A;  2ON5 A;  5ID2 B;  3ZFB A;  2P5R A;  2LRN A;  2N5A A;  3GH6 A;  2ZNM A;  3KGK A;  2KLX A;  4ULX A;  4OFT A;  4X4J A;  4J57 E;  4RQX A;  1MTC A;  1F3A A;  2VM2 A;  2CZ2 A;  3APO A;  5JCW A;  3IAM 2;  2V6O A;  1LBK A;  2RM5 A;  4BL7 A;  1G7E A;  1OYJ A;  4EXJ A;  1SJI A;  3TOT A;  3GRX A;  1A8Y A;  5KN3 A;  4FYC A;  1DBY A;  2CAQ A;  3VPQ A;  2KP1 A;  4GTU A;  2EIR A;  5JCU A;  5C04 A;  2X49 A;  2IFQ A;  2FWF A;  3I69 A;  3P7X A;  2YZH A;  3PH9 A;  5AGY A;  4AJ6 A;  5D9V A;  4ZB9 A;  5IOX A;  3HZ8 A;  4MJC A;  2VCW A;  3I43 A;  4A5P A;  4ZL9 A;  2AJQ B;  1JFU A;  4QL7 A;  2OJL A;  4MF5 A;  3ZIT A;  1W4V A;  5A4V A;  1JLV A;  2LJA A;  5D8I A;  2A2P A;  2WGR A;  1F2E A;  3IPZ A;  2HXK A;  1TP9 A;  4HUA A;  6GSX A;  1PX7 A;  3C1S A;  3TKS A;  4NHZ A;  5LCZ A;  1EGR A;  2VCX A;  2NBS A;  4CY6 A;  1ZOF A;  3RPP A;  3A2W A;  22GS A;  5F07 A;  3H1N A;  4FIW A;  2F8A A;  3VUR A;  1TI3 A;  2R0C A;  2E2M A;  4IJ3 A;  5E4W A;  4F0C A;  3E3E A;  4QL9 A;  1PN0 A;  2F3M A;  1PSQ A;  3FRC A;  4G9H A;  4KE3 A;  1JZR A;  2WS2 A;  5EVO A;  3ZL5 A;  2DML A;  4HU7 A;  3TKP A;  5H5Q A;  1B48 A;  1ML6 A;  3TJK A;  5DQS A;  1H4O A;  4XRD A;  1PFO A;  4TKY A;  4GF0 A;  5DAK B;  2CT6 A;  2PGT A;  4V2L A;  3TDG A;  1GWC A;  1XOB A;  3QFA C;  1O81 A;  4ISD A;  1Z5Y E;  2XHF A;  2K9F A;  2X99 A;  3IOS A;  2OA7 A;  5IMA A;  3HHV A;  1BJX A;  1VF2 A;  14GS A;  4MJE A;  1O7U A;  1GNW A;  1IYI A;  1M0U A;  3F4R A;  5CP1 A;  4MDC A;  2FGX A;  1USB A;  1B8X A;  3RBT A;  1TW9 A;  3QAV A;  4YAP A;  1O8X A;  1EZK A;  4TW5 A;  2JAD A;  3GSS A;  2B5X A;  2ES7 A;  3KCM A;  1Z3E A;  4PTS A;  3KP9 A;  6GSV A;  3UBK A;  4F0B A;  3NIV A;  2DJ2 A;  5ELG A;  3OR5 A;  4TR3 A;  3FK8 A;  1YF1 A;  4MCU A;  1YF0 A;  3F6D A;  3DKS A;  3ZRE A;  3E9J B;  2CVD A;  1Z6M A;  1GH2 A;  2RM6 A;  4P3Y B;  5ENU A;  3QFB C;  4MK3 A;  5CRE A;  3MWH A;  1AXD A;  3D22 A;  3F8U A;  3NOF A;  2J9H A;  1S3R A;  2REM A;  1WOU A;  2H8L A;  1XWG A;  4Q5Q A;  3EU4 A;  1Z7R A;  4RUV A;  2DLX A;  4IP1 A;  5HFK A;  3TOU A;  1N2A A;  1PMT A;  3CRT A;  3GKK A;  2HRA A;  5AIX A;  5IMV A;  1DE2 A;  2GQK A;  4ICY A;  1B9X C;  1VRS D;  2C0E A;  4L0U A;  4MMM A;  4O92 A;  2R0P A;  3N9J A;  4GCI A;  5GST A;  4K2X A;  1HYU A;  2CX3 A;  5LNK e;  3I9V 2;  3IV4 A;  1XWK A;  5FT3 A;  1XXU A;  19GS A;  5KEJ A;  2FWG A;  4AJ7 A;  5JWO B;  2LNS A;  1EP7 A;  1U6T A;  1R5P A;  2GSS A;  6GSU A;  1EOG A;  2LQQ A;  1T7P B;  8GSS A;  2OE3 A;  5IO2 A;  3F0I A;  4PNG A;  1QXH A;  3CQF A;  1V40 A;  3G7Y A;  3MIX A;  4KGI A;  2MMA A;  2ALB A;  20GS A;  3U6V A;  4NWY A;  3C8E A;  3PGT A;  4DSQ A;  2O89 A;  1E2Y A;  1V57 A;  1FAA A;  3LXZ A;  5KN2 A;  1O73 A;  1FVK A;  2O85 A;  4HZ2 A;  2JZR A;  2LV3 A;  1OAZ A;  1I5G A;  4XS6 A;  1FG4 A;  4KB3 A;  1Q4J A;  2I4A A;  3WT1 A;  5DAL A;  4GQF A;  2MMO A;  3EIN A;  4QQ7 A;  3EVI A;  2XC2 A;  1PX6 A;  4EDZ A;  4XTS A;  1ZL9 A;  4XS1 A;  3UIW A;  3LYK A;  3GX0 A;  4XS4 B;  3GKN A;  1G0T A;  1A0R P;  16GS A;  3W8J A;  4ACS A;  2DMM A;  1V9W A;  5ECN B;  2YZU A;  1J9B A;  2GZP A;  5ECM B;  1T3B A;  1XCC A;  1EP8 A;  6GSY A;  2H66 A;  4TOP A;  3ISO A;  3R2Q A;  2IMI A;  3HJO A;  3TJJ A;  4MJB A;  3IK7 A;  4CW9 A;  2DKI A;  3DIE A;  4IVF A;  1T4Z A;  3US3 A;  1O8W A;  3UMA A;  2FY6 A;  3QD9 A;  1HNC A;  2K6V A;  2DIY A;  2AHE A;  3CTG A;  5BRT A;  5KN0 A;  4N0Z A;  4N10 A;  4X43 A;  5IMD A;  2LRC A;  1AAZ A;  4HJ2 A;  1XPV A;  1SYR A;  3GST A;  3P8W A;  2MMZ A;  1JHB A;  3J7Y k;  5C00 A;  1AW9 A;  3J7Y b;  3Q18 A;  2DSA A;  1XW6 A;  5G2Z A;  5HFI A;  1TOF A;  5CRD A;  2HYX A;  2CAI A;  2A4V A;  1WWJ A;  4K5R A;  2B5Y A;  4WET A;  3M0F A;  2G0F A;  2O8V B;  3HKR A;  3BCK A;  1FOV A;  5A4U A;  5CAX A;  3EC3 A;  1EWX A;  1M9A A;  1ZYQ B;  1WJK A;  3TCO A;  5IMZ A;  3LQ7 A;  4IGJ A;  1Y25 A;  2GGT A;  1TU7 A;  3DML A;  5CRH A;  5GAN D;  1FB0 A;  2QC7 A;  5AIV A;  3VLN A;  2HE3 A;  3RPN A;  4WF5 A;  1CQG A;  1X9S B;  4OCE A;  1NW2 A;  1GLP A;  4AGS A;  2L5O A;  4IKH A;  5FWG A;  2QSI A;  2J23 A;  5J41 A;  3IC4 A;  2HRN A;  1GTI A;  4KCE A;  3ZRD A;  1XWC A;  1YY7 A;  4PGT A;  4OCF A;  5G31 A;  2AAW A;  3ME7 A;  2LNT A;  4KDU A;  1SJ6 A;  4G0I A;  2DBC A;  2N5F A;  5CRG A;  4LLR A;  2YWM A;  3EMX A;  1A24 A;  1LU4 A;  1AQW A;  4POL A;  3A5W A;  1QFN A;  1V2A A;  1A23 A;  3L78 A;  3KTL A;  2K8V A;  4FYB A;  4K2D A;  2DJK A;  2TRX A;  1M2A A;  1GLQ A;  2B3S A;  5G30 A;  3A3T A;  2EC4 A;  2VCT A;  4EKZ A;  3LYP A;  1QK8 A;  4TR4 A;  5ID2 A;  1GSY A;  1ERW A;  2X8G A;  3P2A A;  2NDO A;  4EO3 A;  1PL2 A;  3M3M A;  6GST A;  3Q6O A;  1TK0 B;  2X64 A;  4ZL7 A;  2MBS A;  4N11 A;  3IBH A;  1Q98 A;  2FLS A;  5ECK B;  1R7H A;  1UC7 A;  3IR4 A;  2FA4 A;  3ZVJ A;  4F2I A;  3GH9 A;  4JBB A;  2DIZ A;  1HNA A;  3BD2 A;  3TKQ A;  1WRY A;  3GYK A;  4NHW A;  3KMN A;  3VFI A;  4TR1 B;  4Z7X A;  2IJY A;  4JR6 A;  4HJM A;  1I9D A;  4ZBB A;  5CO3 A;  1SU9 A;  2V32 A;  1OC9 B;  2C3T A;  4MPF A;  2EIO A;  2YOI A;  2PN8 A;  2IWT A;  3QOU A;  4JR4 A;  3UEM A;  4ZXG A;  4EVM A;  2H1D A;  3GHA A;  2HZF A;  2ZUP A;  5G1L A;  2L4Q A;  4IN0 A;  12GS A;  4NMU A;  3DVX A;  4NPB A;  1ERU A;  2HI7 A;  4N30 A;  2FUG 2;  3BBY A;  1OVN A;  2DKH A;  2B5E A;  5D93 A;  3G7I A;  1XFL A;  4MH2 A;  3KIJ A;  1G6Y A;  1GNE A;  3G9B A;  1CQH A;  2JAC A;  6GSW A;  4USS A;  1E6B A;  3ZLP A;  3GUS A;  4LMV A;  4EIQ A;  2LST A;  2IL3 A;  10GS A;  1A2M A;  4KF9 A;  2AUV A;  2DJ1 A;  1T00 A;  1F6M C;  4GLT A;  4O32 A;  3MNG A;  4DVC A;  4I2U A;  3F3Q A;  1YQ1 A;  1ZMA A;  2FWH A;  2GQM A;  2LTK A;  3FR9 A;  3IHG A;  5DAK A;  4PXO A;  3ERG A;  3LFL A;  2R0G A;  1TK5 B;  2H1B A;  2XPE A;  5JCG A;  4YQU A;  2R6K A;  5EPF A;  2DJJ A;  3CRU A;  2GSR A;  3KXO A;  1FOH A;  1K3L A;  4DSS B;  2LRT A;  4ZB8 A;  4K5S A;  3QR6 A;  1BQ7 A;  4CHS A;  4MZC A;  2HSM A;  4O5Q A;  5IM9 A;  1UA5 A;  4IBP A;  3DVW A;  1EV4 A;  1XOA A;  2E7P A;  1WP0 A;  5DCH A;  3HVN A;  2AV4 A;  1TU8 A;  1U3I A;  3UVT A;  2OBI A;  1QUW A;  2VLU A;  2XBQ A;  2CVK A;  1YEP A;  1X5D A;  1BAY A;  4L8E A;  3M9K A;  4MA9 A;  1TI1 A;  1EV9 A;  1M2B A;  4BVY B;  1SK1 A;  2R37 A;  1PKZ A;  5HR0 A;  1URM A;  3HCZ A;  5IQY A;  5HQP A;  4IEL A;  1TRU A;  1YZX A;  5D9X A;  3UL3 A;  4ZIL A;  2KOK A;  4POK A;  4H86 A;  4IJI A;  2KP2 A;  1TK8 B;  1X5E A;  2LS5 A;  3ERF A;  1Z6N A;  3KZQ A;  4K0N A;  3DGQ A;  5J4U A;  3C73 A;  3VWW A;  2QKE A;  5JWQ B;  3GFK A;  3M8N A;  4WF4 A;  2GZZ A;  3LEF A;  2H72 A;  3EWL A;  3TKS E;  2X8H A;  2GVP A;  2GDR A;  2H73 A;  4HOJ A;  1SL1 B;  3ZVJ D;  2LUS A;  1FW1 A;  4IHU A;  4Z2R A;  2WCI A;  2XPD A;  3FYG A;  3HZ4 A;  4GSS A;  7GSS A;  1M3I A;  2RII A;  4WEY A;  3GL5 A;  4AJ8 A;  1YDK A;  1SKW B;  2YJH A;  3ED3 A;  3LOR A;  3RAZ A;  3F3R A;  2FHE A;  3VI7 A;  5IPH A;  1JZD A;  3G7J A;  5DDL A;  5J9C A;  2C0F A;  1MD4 A;  2AB6 A;  3TJB A;  5ECR B;  4YKG A;  4L5O A;  4KSO A;  2VL2 A;  1KNG A;  1TRV A;  2HFD A;  5B7C A;  1WE0 A;  4EE0 A;  5ECP B;  1EEM A;  2F8F A;  4WXT A;  1XZO A;  2BTO T;  3ZYW A;  4Z2U A;  3MSZ A;  2YNX A;  1U3A A;  4I2T A;  4BWS A;  1XWB A;  1NSW A;  1GTB A;  2HNL A;  1QQ2 A;  3GV1 A;  1M2D A;  3U5R E;  2D2Z A;  1SK0 A;  1GSD A;  3HYP A;  3MYD A;  5DJM A;  1PA3 A;  1FHE A;  4XIH A;  2VLV A;  3ZIV A;  3H4K A;  4JED A;  1LJR A;  3FZ4 A;  4KDY A;  3CYN A;  1TRS A;  4XS4 A;  5DCG A;  2QGV A;  1SD9 A;  5AIS A;  1BED A;  2C80 A;  2VIM A;  5IOW A;  3TRX A;  1M9B A;  4K1F A;  3GKM A;  4EF0 A;  1TJD A;  3HVV A;  4E8E A;  1JZO A;  4WR4 A;  1GTU A;  3CSI A;  2L6D A;  3V1W A;  1EGO A;  4PQI A;  5EY6 A;  3F63 A;  3LJR A;  3FZ5 A;  3GX8 A;  4LMW A;  1EOH A;  2VO4 A;  3FEU A;  2RUF A;  3APS A;  3W6G A;  5D73 A;  3IXR A;  4TR0 A;  2H19 A;  5G5E A;  3CBU A;  4WBR D;  1YJ6 A;  1A2L A;  1KBN A;  5CNW A;  4BVX B;  1NHO A;  3H8Q A;  3TKS C;  1ZYP A;  3O76 A;  1GSE A;  4V2M A;  3IHQ A;  2UZ8 A;  2MMN A;  1OE7 A;  2CVB A;  5J5N A;  4YQM A;  4BIK A;  1PD2 1;  3FR6 A;  5DQY A;  4G2E A;  6GSS A;  4PUF C;  4GST A;  1ACV A;  2C0G A;  2YWN A;  2GST A;  4Q5F A;  4PUR A;  3K8N A;  4MZB A;  5HR1 A;  4HDE A;  1SJZ A;  1Z7P A;  1MDK A;  3HXS A;  1TDI A;  4TXO B;  2PU9 C;  3GUR A;  1SKS B;  1B4Q A;  1T4Y A;  1M3J A;  4MF6 A;  3A5I A;  4HS1 A;  5KOX A;  1AIU A;  1YKC A;  3IE3 A;  3UVH A;  3DRN A;  2PBJ A;  5GAP D;  2YJ7 A;  4MH3 A;  1TRW A;  2CV4 A;  5H5S A;  2C0D A;  2GSQ A;  3IRA A;  1YKA A;  2YWO A;  4K0G A;  4GSN A;  1RQM A;  4DEJ A;  5HR3 A;  4BWQ A;  2OE0 A;  3QAW A;  4BPY A;  3S9F A;  1TXX A;  2R3X A;  2LJR A;  5DBQ A;  1EEJ A;  2JL4 A;  1K0N A;  1XVW A;  5ABR A;  2L4C A;  4RQR A;  1SL2 B;  4HI7 A;  4RI6 A;  3UBL A;  2H0H A;  1HNB A;  1K0O A;  2WB9 A;  3WGE A;  2H6Z A;  3VI5 A;  2L59 A;  4OFN A;  2VD0 A;  3VWV A;  3LW9 A;  3Q74 A;  2IMF A;  3DXB A;  3CTF A;  2GZY A;  2B1L A;  3HVX A;  4JE1 A;  3C1R A;  3F4T A;  4JU5 A;  2H70 A;  2C8U A;  1AUC A;  2JU5 A;  2M80 A;  1X0R A;  1GRX A;  1U87 A;  3MAK A;  4KX4 A;  2AYT A;  1ILO A;  4K7N A;  1X9M B;  5DJL A;  4WKW A;  3ME8 A;  2P0G A;  1UVZ A;  13GS A;  1QMV A;  4XRA A;  4D73 B;  1Z9H A;  3LG6 A;  2FWE A;  2H6X A;  2H75 A;  4K8M A;  1ERT A;  3PPU A;  2JSZ A;  2C1Y A;  3H79 A;  2WFC A;  2E0Q A;  5ECQ B;  2B1K A;  4TR1 A;  1K3O A;  4O7H A;  4OO5 A;  4KSM A;  2HRF A;  2A4H A;  3F4S A;  5F05 A;  3HA9 A;  5HFG A;  4J56 E;  3LSZ A;  5DVB A;  1F37 A;  1OC9 A;  1PN9 A;  3WD6 A;  4GWR A;  2B7K A;  3L4N A;  2H1G A;  2BJX A;  1ZZY A;  4EUY A;  2A2R A;  4CY8 A;  3D4M A;  3IDV A;  1S3A A;  5G1K A;  4WBJ A;  4XHM A;  2R5G A;  1GSF A;  4ZB6 A;  4FH8 A;  2H74 A;  2FCH A;  1X9W B;  4OFM A;  3GTU B;  2I9H A;  3TJG A;  1VF1 A;  1XW9 A;  1G6W A;  1VF4 A;  5L71 A;  1DSB A;  2H0I A;  4AF2 A;  5IO0 A;  2VCV A;  1W89 A;  4KUN A;  2HZE B;  3FW2 A;  1SKR B;  3W8S A;  1BG5 A;  4ECI A;  1ZCP A;  3RHC A;  1A8L A;  4ML6 A;  3A2V A;  4MP4 A;  2PWJ A;  4FYU A;  2I1U A;  1S3D A;  4K9Z A;  4X0X A;  2JZS A;  3H93 A;  2Z9S A;  2PPT A;  1OKD A;  1M7T A;  3LWA A;  5IIZ A;  3TUE A;  4IP6 A;  17GS A;  1RK4 A;  3O6T A;  1M99 A;  3ZZX A;  3WGX A;  1ERV A;  2HRK A;  2RLI A;  1NHY A;  3GMF A;  2RUE A;  5E59 A;  1J0F A;  2I81 A;  2MYG A;  3D21 A;  3D5J A;  3KEB A;  3R3E A;  2VUP A;  3M1G A;  4IQA A;  4J2F A;  2GT6 A;  2OAC A;  2V2G A;  4ZL8 A;  4DSS A;  2IIY A;  3QMX A;  1BYE A;  1AC1 A;  5INY A;  3APQ A;  4I5Q A;  1HQO A;  1XVQ A;  2CZ3 A;  4KCA A;  3KH7 A;  5EL8 A;  4PQ1 A;  2IME A;  2YWI A;  3IA1 A;  3DEX A;  3GN3 A;  5J3R A;  4I97 A;  1S3C A;  1WMJ A;  3HD5 A;  4NXI A;  3UOM A;  4NV2 A;  4EIP A;  2M72 A;  3ERW A;  3KM6 A;  1C72 A;  5GZZ B;  5KN1 A;  4KAE A;  3CXG A;  4LL1 B;  4L5L A;  4BVY A;  2YV7 A;  2L6C A;  2P5Q A;  2B7J A;  4OO4 A;  2VCZ A;  1Y6E A;  1G7O A;  3IK9 A;  1KTE A;  1PRX A;  2L5L A;  1R5A A;  2K18 A;  2HSH A;  4BL7 B;  3ZTL A;  1ZGN A;  2M46 A;  2X8C A;  4K7I A;  4ECJ A;  3IAS 2;  4TN8 A;  2IMD A;  1PL1 A;  2IFQ B;  2O7K A;  4N0V A;  4YAV A;  2PER A;  2LEG A;  4K6X A;  1GUK A;  4O5R A;  3GIX A;  4XCS A;  4CDO A;  2WZ9 A;  1GUH A;  5F8B A;  1K0M A;  1XWA A;  1R26 A;  2B6M A;  2DJ0 A;  1ZYE A;  3FHK A;  5ECL B;  1R4W A;  2WRT A;  5ELA A;  5D9W A;  3ZFL A;  2NVL A;  3LGC A;  1SD8 A;  1OE8 A;  4L0W A;  5ECI B;  3HDC A;  3PR8 A;  3VWU A;  2YV9 A;  3HJP A;  2H76 A;  3NZN A;  2L57 A;  4MNN A;  4HZ4 A;  1F3B A;  1GSS A;  5JWR B;  2LJK A;  4POM A;  2H30 A;  3WT2 A;  4E8H A;  3QDN A;  1BX9 A;  4ID0 A;  4HQZ A;  2V41 A;  2LKU A;  3M9J A;  3O3T A;  1AQV A;  4GXZ A;  4I8B A;  4KA0 A;  3AY8 A;  1K0D A;  2GLR A;  3WYW A;  1XIY A;  18GS A;  4TRX A;  4LL4 B;  2YAN A;  5F06 A;  2KUC A;  2OAD A;  3PIN A;  1ST9 A;  1XG8 A;  3L0H A;  2WJU A;  3P90 A;  4ZIJ A;  2OKA A;  5HR2 A;  1X5C A;  4JRR A;  4OMV A;  5B8B A;  2C3Q A;  1GL8 A;  2VL9 A;  5F0G A;  3DD3 A;  1KEB A;  1RW1 A;  1XW5 A;  2A2S A;  3TRP A;  1YEX A;  2C3N A;  4O5U A;  1A2J A;  3ZMK A;  2YCD A;  2O87 A;  3CSH A;  4PUA A;  4EL1 A;  1F9M A;  3FZA A;  5B8A A;  2V1M A;  4F9Z A;  2VAF A;  1V58 A;  4ECC A;  1DE1 A;  1OKT A;  1WPI A;  3QAG A;  4GRF A;  3GNJ A;  2PVO C;  4I6X A;  4PX1 A;  3GA4 A;  1J08 A;  4KW6 A;  3WGD A;  1N8J A;  4G10 A;  4BVX A;  3N5O A;  1PGT A;  5IMC A;  3ZML A;  3VPT A;  2NTO A;  1XBS A;  5H5R A;  2PUK C;  2DJ3 A;  5KOW A;  3C71 A;  5ECO B;  4EC0 A;  2YPM A;  3KJY A;  1SL0 B;  4Q5R A;  2HT9 A;  2VD1 A;  4JZQ A;  1O85 A;  3UJ1 A;  1MDI A;  3QCP A;  3KH9 A;  3EYT A;  5A4W A;  1K0C A;  1B9Y C;  2BMX A;  4G0K A;  4TVE A;  1NM3 A;  3BCI A;  1VGL A;  5IMF A;  1SK2 A;  4V1A p;  2IMK A;  3BJ5 A;  3F6F A;  3F9U A;  1ABA A;  5COH A;  3GL3 A;  4EDY A;  4Q5N A;  3EUR A;  4TXO A;  3RHB A;  2YN1 A;  1IYH A;  1TKD B;  2FA8 A;  3KMO A;  4Z2T A;  1SYX A;  5J9B A;  1GUM A;  4MPG A;  1PQN A;  2LQO A;  2N5B A;  3TRQ A;  4OD7 A;  3IC8 A;  4ZBA A;  5B6M A;  2K8S A;  2H1A A;  5D9T A;  4ECB A;  3D4T A;  2MZC A;  1WIK A;  3TGZ A;  3DYR A;  5AN1 A;  5A5K A;  2VLT A;  2FD3 A;  1GSQ A;  4HU9 A;  3LXT A;  1K3Y A;  3KP8 A;  3MDK A;  2QA1 A;  4PQH A;  4MLY A;  2H0G A;  5DAL B;  2C4J A;  4HEA 2;  4HSC X;  4G19 A;  1T1V A;  2V6K A;  1TTZ A;  2E2G A;  1JZW A;  2CQ9 A;  2PMT A;  2QA2 A;  1UN2 A;  4K7O A;  1QGV A;  4X1U A;  1FO5 A;  1MEK A;  1PKW A;  2TIR A;  9GSS A;  3HY2 A;  3HJM A;  4YKF A;  1OC3 A;  3SWL A;  2OE1 A;  2P31 A;  2NPB A;  1GP1 A;  3A2X A;  4MF7 A;  1A0F A;  1H75 A;  2R2J A;  2YP6 A;  1GSU A;  2F51 A;  5G5F A;  3VWX A;  3L9V A;  11GS A;  3E0U A;  3TB2 A;  2FNO A;  3EMP A;  2JSY A;  4V1A g;  4YQV A;  5GSS A;  3DWV A;  4D73 A;  3CMI A;  3D0Z A;  2HSY A;  3KTB A;  2GQL A;  4MJA A;  1K0B A;  3L9S A;  3QPM A;  4WR5 A;  2VM1 A;  5CYY A;  5CRW A;  3TJF A;  2XBI A;  1GUL A;  3SBC A;  4MZW A;  5ECS A;  5BMU A;  1T8E B;  2I3Y A;  3UAR A;  4BA7 A;  1THO A;  2GTU A;  2F9S A;  2GT5 A;  3EU3 A;  1DUG A;  1OC8 A;  1AQX A;  2KHP A;  3FR3 A;  3HVS A;  4MAB A;  4KND A;  2H6Y A;  2VL2 C;  2PVQ A;  3VK9 A;  3D6I A;  5B6N A;  5FHI A;  3GTU A;  1FVJ A;  4ML1 A;  4IW9 A;  4DSR A;  2DC5 A;  2WUL A;  3FY7 A;  2HLS A;  2HZE A;  1V98 A;  2IPA A;  2JZT A;  1THX A;  4FO5 A;  1FB6 A;  2H71 A;  2X4A A;  4ILF A;  4YH2 A;  1MDJ A;  1JLW A;  1SEN A;  3JCM L;  4NV5 A;  4F03 A;  3CSJ A;  3FMW A;  3ZIJ A;  5ECH B;  3Q19 A;  2TRC P;  3GKX A;  4HQS A;  1ZYN A;  4OWY A;  5D96 A;  4FQU A;  3TKR A;  2WDU A;  4POB A;  5IPG A;  3EE2 A;  4KH7 A;  3RDW A;  3L9U A;  2VOC A;  2VL3 A;  4IS0 A;  1U88 A;  1ON4 A;  4ZBD A;  2ZCT A;  4G0L A;  4RI7 A;  1HD2 A;  4V2N A;  3EPT A;  4F82 A;  3KD0 A;  2R4V A;  2CA8 A;  2CX4 A;  2OBK A;  3I6A A;  2VCQ A;  2H01 A;  3FKF A;  4NAX A;  2MBT A; 
#chains in the Genus database with same CATH homology
 1O6J A;  3FZ9 A;  3BOA A;  1MD3 A;  1GTA A;  5LD0 A;  4IQ1 A;  1VF3 A;  4LA1 A;  2G2Q A;  4GQC A;  2GS3 A;  3C7M A;  2IN3 A;  1K0A A;  1B4P A;  4KDX A;  2EIQ A;  2ON7 A;  4PNF A;  4TXV A;  3UAP A;  2ON5 A;  5ID2 B;  3ZFB A;  2P5R A;  2LRN A;  2N5A A;  3GH6 A;  2ZNM A;  3KGK A;  2KLX A;  4ULX A;  4OFT A;  4X4J A;  4J57 E;  4RQX A;  1MTC A;  1F3A A;  2VM2 A;  2CZ2 A;  3APO A;  5JCW A;  3IAM 2;  2V6O A;  1LBK A;  2RM5 A;  4BL7 A;  1G7E A;  1OYJ A;  4EXJ A;  1SJI A;  3TOT A;  3GRX A;  1A8Y A;  5KN3 A;  4FYC A;  1DBY A;  2CAQ A;  3VPQ A;  2KP1 A;  4GTU A;  2EIR A;  5JCU A;  5C04 A;  2X49 A;  2IFQ A;  2FWF A;  3I69 A;  3P7X A;  2YZH A;  3PH9 A;  5AGY A;  4AJ6 A;  5D9V A;  4ZB9 A;  5IOX A;  3HZ8 A;  4MJC A;  2VCW A;  3I43 A;  4A5P A;  4ZL9 A;  2AJQ B;  1JFU A;  4QL7 A;  2OJL A;  4MF5 A;  3ZIT A;  1W4V A;  5A4V A;  1JLV A;  2LJA A;  5D8I A;  2A2P A;  2WGR A;  1F2E A;  3IPZ A;  2HXK A;  1TP9 A;  4HUA A;  6GSX A;  1PX7 A;  3C1S A;  3TKS A;  4NHZ A;  5LCZ A;  1EGR A;  2VCX A;  2NBS A;  4CY6 A;  1ZOF A;  3RPP A;  3A2W A;  22GS A;  5F07 A;  3H1N A;  4FIW A;  2F8A A;  3VUR A;  1TI3 A;  2R0C A;  2E2M A;  4IJ3 A;  5E4W A;  4F0C A;  3E3E A;  4QL9 A;  1PN0 A;  2F3M A;  1PSQ A;  3FRC A;  4G9H A;  4KE3 A;  1JZR A;  2WS2 A;  5EVO A;  3ZL5 A;  2DML A;  4HU7 A;  3TKP A;  5H5Q A;  1B48 A;  1ML6 A;  3TJK A;  5DQS A;  1H4O A;  4XRD A;  4TKY A;  4GF0 A;  5DAK B;  2CT6 A;  2PGT A;  4V2L A;  3TDG A;  1GWC A;  1XOB A;  3QFA C;  1O81 A;  4ISD A;  1Z5Y E;  2XHF A;  2K9F A;  2X99 A;  3IOS A;  2OA7 A;  5IMA A;  3HHV A;  1BJX A;  1VF2 A;  14GS A;  4MJE A;  1O7U A;  1GNW A;  1IYI A;  1M0U A;  3F4R A;  5CP1 A;  4MDC A;  2FGX A;  1USB A;  1B8X A;  3RBT A;  1TW9 A;  3QAV A;  4YAP A;  1O8X A;  1EZK A;  4TW5 A;  2JAD A;  3GSS A;  2B5X A;  2ES7 A;  3KCM A;  1Z3E A;  4PTS A;  3KP9 A;  6GSV A;  3UBK A;  4F0B A;  3NIV A;  2DJ2 A;  5ELG A;  3OR5 A;  4TR3 A;  3FK8 A;  1YF1 A;  4MCU A;  1YF0 A;  3F6D A;  3DKS A;  3ZRE A;  3E9J B;  2CVD A;  1Z6M A;  1GH2 A;  2RM6 A;  4P3Y B;  5ENU A;  3QFB C;  4MK3 A;  5CRE A;  3MWH A;  1AXD A;  3D22 A;  3F8U A;  3NOF A;  2J9H A;  2REM A;  1WOU A;  2H8L A;  1XWG A;  4Q5Q A;  3EU4 A;  1Z7R A;  4RUV A;  2DLX A;  4IP1 A;  5HFK A;  3TOU A;  1N2A A;  1PMT A;  3CRT A;  3GKK A;  2HRA A;  5AIX A;  5IMV A;  1DE2 A;  2GQK A;  4ICY A;  1B9X C;  1VRS D;  2C0E A;  4L0U A;  4MMM A;  4O92 A;  2R0P A;  3N9J A;  4GCI A;  5GST A;  4K2X A;  1HYU A;  2CX3 A;  5LNK e;  3I9V 2;  3IV4 A;  1XWK A;  5FT3 A;  1XXU A;  19GS A;  5KEJ A;  2FWG A;  4AJ7 A;  5JWO B;  2LNS A;  1EP7 A;  1U6T A;  1R5P A;  2GSS A;  6GSU A;  1EOG A;  2LQQ A;  1T7P B;  8GSS A;  2OE3 A;  5IO2 A;  3F0I A;  4PNG A;  1QXH A;  1V40 A;  3G7Y A;  3MIX A;  4KGI A;  2MMA A;  2ALB A;  20GS A;  3U6V A;  4NWY A;  3C8E A;  3PGT A;  4DSQ A;  2O89 A;  1E2Y A;  1V57 A;  1FAA A;  3LXZ A;  5KN2 A;  1O73 A;  1FVK A;  2O85 A;  4HZ2 A;  2JZR A;  2LV3 A;  1OAZ A;  1I5G A;  4XS6 A;  1FG4 A;  4KB3 A;  1Q4J A;  2I4A A;  3WT1 A;  5DAL A;  4GQF A;  2MMO A;  3EIN A;  4QQ7 A;  3EVI A;  2XC2 A;  1PX6 A;  4EDZ A;  4XTS A;  1ZL9 A;  4XS1 A;  3UIW A;  3LYK A;  3GX0 A;  4XS4 B;  3GKN A;  1G0T A;  1A0R P;  16GS A;  3W8J A;  4ACS A;  2DMM A;  1V9W A;  5ECN B;  2YZU A;  1J9B A;  2GZP A;  5ECM B;  1T3B A;  1XCC A;  1EP8 A;  6GSY A;  2H66 A;  4TOP A;  3ISO A;  3R2Q A;  2IMI A;  3HJO A;  3TJJ A;  4MJB A;  3IK7 A;  4CW9 A;  2DKI A;  3DIE A;  4IVF A;  1T4Z A;  3US3 A;  1O8W A;  3UMA A;  2FY6 A;  3QD9 A;  1HNC A;  2K6V A;  2DIY A;  2AHE A;  3CTG A;  5BRT A;  5KN0 A;  4N0Z A;  4N10 A;  4X43 A;  5IMD A;  2LRC A;  1AAZ A;  4HJ2 A;  1XPV A;  1SYR A;  3GST A;  3P8W A;  2MMZ A;  1JHB A;  3J7Y k;  5C00 A;  1AW9 A;  3J7Y b;  3Q18 A;  2DSA A;  1XW6 A;  5G2Z A;  5HFI A;  1TOF A;  5CRD A;  2HYX A;  2CAI A;  2A4V A;  1WWJ A;  4K5R A;  2B5Y A;  4WET A;  3M0F A;  2G0F A;  2O8V B;  3HKR A;  3BCK A;  1FOV A;  5A4U A;  5CAX A;  3EC3 A;  1EWX A;  1M9A A;  1ZYQ B;  1WJK A;  3TCO A;  5IMZ A;  3LQ7 A;  4IGJ A;  1Y25 A;  2GGT A;  1TU7 A;  3DML A;  5CRH A;  5GAN D;  1FB0 A;  2QC7 A;  5AIV A;  3VLN A;  2HE3 A;  3RPN A;  4WF5 A;  1CQG A;  1X9S B;  4OCE A;  1NW2 A;  1GLP A;  4AGS A;  2L5O A;  4IKH A;  5FWG A;  2QSI A;  2J23 A;  5J41 A;  3IC4 A;  2HRN A;  1GTI A;  4KCE A;  3ZRD A;  1XWC A;  1YY7 A;  4PGT A;  4OCF A;  5G31 A;  2AAW A;  3ME7 A;  2LNT A;  4KDU A;  1SJ6 A;  4G0I A;  2DBC A;  2N5F A;  5CRG A;  4LLR A;  2YWM A;  3EMX A;  1A24 A;  1LU4 A;  1AQW A;  4POL A;  3A5W A;  1QFN A;  1V2A A;  1A23 A;  3L78 A;  3KTL A;  2K8V A;  4FYB A;  4K2D A;  2DJK A;  2TRX A;  1M2A A;  1GLQ A;  2B3S A;  5G30 A;  3A3T A;  2EC4 A;  2VCT A;  4EKZ A;  3LYP A;  1QK8 A;  4TR4 A;  5ID2 A;  1GSY A;  1ERW A;  2X8G A;  3P2A A;  2NDO A;  4EO3 A;  1PL2 A;  3M3M A;  6GST A;  3Q6O A;  1TK0 B;  2X64 A;  4ZL7 A;  2MBS A;  4N11 A;  3IBH A;  1Q98 A;  2FLS A;  5ECK B;  1R7H A;  1UC7 A;  3IR4 A;  2FA4 A;  3ZVJ A;  4F2I A;  3GH9 A;  4JBB A;  2DIZ A;  1HNA A;  3BD2 A;  3TKQ A;  1WRY A;  3GYK A;  4NHW A;  3KMN A;  3VFI A;  4TR1 B;  4Z7X A;  2IJY A;  4JR6 A;  4HJM A;  1I9D A;  4ZBB A;  5CO3 A;  1SU9 A;  2V32 A;  1OC9 B;  2C3T A;  4MPF A;  2EIO A;  2YOI A;  2PN8 A;  2IWT A;  3QOU A;  4JR4 A;  3UEM A;  4ZXG A;  4EVM A;  2H1D A;  3GHA A;  2HZF A;  2ZUP A;  5G1L A;  2L4Q A;  4IN0 A;  12GS A;  4NMU A;  3DVX A;  4NPB A;  1ERU A;  2HI7 A;  4N30 A;  2FUG 2;  3BBY A;  1OVN A;  2DKH A;  2B5E A;  5D93 A;  3G7I A;  1XFL A;  4MH2 A;  3KIJ A;  1G6Y A;  1GNE A;  3G9B A;  1CQH A;  2JAC A;  6GSW A;  4USS A;  1E6B A;  3ZLP A;  3GUS A;  4LMV A;  4EIQ A;  2LST A;  2IL3 A;  10GS A;  1A2M A;  4KF9 A;  2AUV A;  2DJ1 A;  1T00 A;  1F6M C;  4GLT A;  4O32 A;  3MNG A;  4DVC A;  4I2U A;  3F3Q A;  1YQ1 A;  1ZMA A;  2FWH A;  2GQM A;  2LTK A;  3FR9 A;  3IHG A;  5DAK A;  4PXO A;  3ERG A;  3LFL A;  2R0G A;  1TK5 B;  2H1B A;  2XPE A;  5JCG A;  4YQU A;  2R6K A;  5EPF A;  2DJJ A;  3CRU A;  2GSR A;  3KXO A;  1FOH A;  1K3L A;  4DSS B;  2LRT A;  4ZB8 A;  4K5S A;  3QR6 A;  1BQ7 A;  4CHS A;  4MZC A;  2HSM A;  4O5Q A;  5IM9 A;  1UA5 A;  4IBP A;  3DVW A;  1EV4 A;  1XOA A;  2E7P A;  1WP0 A;  5DCH A;  2AV4 A;  1TU8 A;  1U3I A;  3UVT A;  2OBI A;  1QUW A;  2VLU A;  2XBQ A;  2CVK A;  1YEP A;  1X5D A;  1BAY A;  4L8E A;  3M9K A;  4MA9 A;  1TI1 A;  1EV9 A;  1M2B A;  4BVY B;  1SK1 A;  2R37 A;  1PKZ A;  5HR0 A;  1URM A;  3HCZ A;  5IQY A;  5HQP A;  4IEL A;  1TRU A;  1YZX A;  5D9X A;  3UL3 A;  4ZIL A;  2KOK A;  4POK A;  4H86 A;  4IJI A;  2KP2 A;  1TK8 B;  1X5E A;  2LS5 A;  3ERF A;  1Z6N A;  3KZQ A;  4K0N A;  3DGQ A;  5J4U A;  3C73 A;  3VWW A;  2QKE A;  5JWQ B;  3GFK A;  3M8N A;  4WF4 A;  2GZZ A;  3LEF A;  2H72 A;  3EWL A;  3TKS E;  2X8H A;  2GVP A;  2GDR A;  2H73 A;  4HOJ A;  1SL1 B;  3ZVJ D;  2LUS A;  1FW1 A;  4IHU A;  4Z2R A;  2WCI A;  2XPD A;  3FYG A;  3HZ4 A;  4GSS A;  7GSS A;  2RII A;  4WEY A;  3GL5 A;  4AJ8 A;  1YDK A;  1SKW B;  2YJH A;  3ED3 A;  3LOR A;  3RAZ A;  3F3R A;  2FHE A;  3VI7 A;  5IPH A;  1JZD A;  3G7J A;  5DDL A;  5J9C A;  2C0F A;  1MD4 A;  2AB6 A;  3TJB A;  5ECR B;  4YKG A;  4L5O A;  4KSO A;  2VL2 A;  1KNG A;  1TRV A;  2HFD A;  5B7C A;  1WE0 A;  4EE0 A;  5ECP B;  1EEM A;  2F8F A;  4WXT A;  1XZO A;  2BTO T;  3ZYW A;  4Z2U A;  3MSZ A;  2YNX A;  1U3A A;  4I2T A;  4BWS A;  1XWB A;  1NSW A;  1GTB A;  2HNL A;  1QQ2 A;  3GV1 A;  1M2D A;  3U5R E;  2D2Z A;  1SK0 A;  1GSD A;  3HYP A;  3MYD A;  5DJM A;  1PA3 A;  1FHE A;  4XIH A;  2VLV A;  3ZIV A;  3H4K A;  4JED A;  1LJR A;  3FZ4 A;  4KDY A;  3CYN A;  1TRS A;  4XS4 A;  5DCG A;  2QGV A;  1SD9 A;  5AIS A;  1BED A;  2C80 A;  2VIM A;  5IOW A;  3TRX A;  1M9B A;  4K1F A;  3GKM A;  4EF0 A;  1TJD A;  3HVV A;  4E8E A;  1JZO A;  4WR4 A;  1GTU A;  3CSI A;  2L6D A;  3V1W A;  1EGO A;  4PQI A;  5EY6 A;  3F63 A;  3LJR A;  3FZ5 A;  3GX8 A;  4LMW A;  1EOH A;  2VO4 A;  3FEU A;  2RUF A;  3APS A;  3W6G A;  5D73 A;  3IXR A;  4TR0 A;  2H19 A;  5G5E A;  3CBU A;  4WBR D;  1YJ6 A;  1A2L A;  1KBN A;  5CNW A;  4BVX B;  1NHO A;  3H8Q A;  3TKS C;  1ZYP A;  3O76 A;  1GSE A;  4V2M A;  3IHQ A;  2UZ8 A;  2MMN A;  1OE7 A;  2CVB A;  5J5N A;  4YQM A;  1PD2 1;  3FR6 A;  5DQY A;  4G2E A;  6GSS A;  4PUF C;  4GST A;  1ACV A;  2C0G A;  2YWN A;  2GST A;  4Q5F A;  4PUR A;  3K8N A;  4MZB A;  5HR1 A;  4HDE A;  1SJZ A;  1Z7P A;  1MDK A;  3HXS A;  1TDI A;  4TXO B;  2PU9 C;  3GUR A;  1SKS B;  1B4Q A;  1T4Y A;  4MF6 A;  3A5I A;  4HS1 A;  5KOX A;  1AIU A;  1YKC A;  3IE3 A;  3UVH A;  3DRN A;  2PBJ A;  5GAP D;  2YJ7 A;  4MH3 A;  1TRW A;  2CV4 A;  5H5S A;  2C0D A;  2GSQ A;  3IRA A;  1YKA A;  2YWO A;  4K0G A;  4GSN A;  1RQM A;  4DEJ A;  5HR3 A;  4BWQ A;  2OE0 A;  3QAW A;  4BPY A;  3S9F A;  1TXX A;  2R3X A;  2LJR A;  5DBQ A;  1EEJ A;  2JL4 A;  1K0N A;  1XVW A;  5ABR A;  2L4C A;  4RQR A;  1SL2 B;  4HI7 A;  4RI6 A;  3UBL A;  2H0H A;  1HNB A;  1K0O A;  2WB9 A;  3WGE A;  2H6Z A;  3VI5 A;  2L59 A;  4OFN A;  2VD0 A;  3VWV A;  3LW9 A;  3Q74 A;  2IMF A;  3DXB A;  3CTF A;  2GZY A;  2B1L A;  3HVX A;  4JE1 A;  3C1R A;  3F4T A;  4JU5 A;  2H70 A;  2C8U A;  1AUC A;  2JU5 A;  2M80 A;  1X0R A;  1GRX A;  1U87 A;  3MAK A;  4KX4 A;  2AYT A;  1ILO A;  4K7N A;  1X9M B;  5DJL A;  4WKW A;  3ME8 A;  2P0G A;  1UVZ A;  13GS A;  1QMV A;  4XRA A;  4D73 B;  1Z9H A;  3LG6 A;  2FWE A;  2H6X A;  2H75 A;  4K8M A;  1ERT A;  3PPU A;  2JSZ A;  2C1Y A;  3H79 A;  2WFC A;  2E0Q A;  5ECQ B;  2B1K A;  4TR1 A;  1K3O A;  4O7H A;  4OO5 A;  4KSM A;  2HRF A;  2A4H A;  3F4S A;  5F05 A;  3HA9 A;  5HFG A;  4J56 E;  3LSZ A;  5DVB A;  1F37 A;  1OC9 A;  1PN9 A;  3WD6 A;  4GWR A;  2B7K A;  3L4N A;  2H1G A;  2BJX A;  1ZZY A;  4EUY A;  2A2R A;  4CY8 A;  3D4M A;  3IDV A;  1S3A A;  5G1K A;  4WBJ A;  4XHM A;  2R5G A;  1GSF A;  4ZB6 A;  4FH8 A;  2H74 A;  2FCH A;  1X9W B;  4OFM A;  3GTU B;  2I9H A;  3TJG A;  1VF1 A;  1XW9 A;  1G6W A;  1VF4 A;  5L71 A;  1DSB A;  2H0I A;  4AF2 A;  5IO0 A;  2VCV A;  1W89 A;  4KUN A;  2HZE B;  3FW2 A;  1SKR B;  3W8S A;  1BG5 A;  4ECI A;  1ZCP A;  3RHC A;  1A8L A;  4ML6 A;  3A2V A;  4MP4 A;  2PWJ A;  4FYU A;  2I1U A;  1S3D A;  4K9Z A;  4X0X A;  2JZS A;  3H93 A;  2Z9S A;  2PPT A;  1OKD A;  1M7T A;  3LWA A;  5IIZ A;  3TUE A;  4IP6 A;  17GS A;  1RK4 A;  3O6T A;  1M99 A;  3ZZX A;  3WGX A;  1ERV A;  2HRK A;  2RLI A;  1NHY A;  3GMF A;  2RUE A;  5E59 A;  1J0F A;  2I81 A;  2MYG A;  3D21 A;  3D5J A;  3KEB A;  3R3E A;  2VUP A;  3M1G A;  4IQA A;  4J2F A;  2GT6 A;  2OAC A;  2V2G A;  4ZL8 A;  4DSS A;  2IIY A;  3QMX A;  1BYE A;  1AC1 A;  5INY A;  3APQ A;  4I5Q A;  1HQO A;  1XVQ A;  2CZ3 A;  4KCA A;  3KH7 A;  5EL8 A;  4PQ1 A;  2IME A;  2YWI A;  3IA1 A;  3DEX A;  3GN3 A;  5J3R A;  4I97 A;  1S3C A;  1WMJ A;  3HD5 A;  4NXI A;  3UOM A;  4NV2 A;  4EIP A;  2M72 A;  3ERW A;  3KM6 A;  1C72 A;  5GZZ B;  5KN1 A;  4KAE A;  3CXG A;  4LL1 B;  4L5L A;  4BVY A;  2YV7 A;  2L6C A;  2P5Q A;  2B7J A;  4OO4 A;  2VCZ A;  1Y6E A;  1G7O A;  3IK9 A;  1KTE A;  1PRX A;  2L5L A;  1R5A A;  2K18 A;  2HSH A;  4BL7 B;  3ZTL A;  1ZGN A;  2M46 A;  2X8C A;  4K7I A;  4ECJ A;  3IAS 2;  4TN8 A;  2IMD A;  1PL1 A;  2IFQ B;  2O7K A;  4N0V A;  4YAV A;  2PER A;  2LEG A;  4K6X A;  1GUK A;  4O5R A;  3GIX A;  4XCS A;  4CDO A;  2WZ9 A;  1GUH A;  5F8B A;  1K0M A;  1XWA A;  1R26 A;  2B6M A;  2DJ0 A;  1ZYE A;  3FHK A;  5ECL B;  1R4W A;  2WRT A;  5ELA A;  5D9W A;  3ZFL A;  2NVL A;  3LGC A;  1SD8 A;  1OE8 A;  4L0W A;  5ECI B;  3HDC A;  3PR8 A;  3VWU A;  2YV9 A;  3HJP A;  2H76 A;  3NZN A;  2L57 A;  4MNN A;  4HZ4 A;  1F3B A;  1GSS A;  5JWR B;  2LJK A;  4POM A;  2H30 A;  3WT2 A;  4E8H A;  3QDN A;  1BX9 A;  4ID0 A;  4HQZ A;  2V41 A;  2LKU A;  3M9J A;  3O3T A;  1AQV A;  4GXZ A;  4I8B A;  4KA0 A;  3AY8 A;  1K0D A;  2GLR A;  3WYW A;  1XIY A;  18GS A;  4TRX A;  4LL4 B;  2YAN A;  5F06 A;  2KUC A;  2OAD A;  3PIN A;  1ST9 A;  3L0H A;  2WJU A;  3P90 A;  4ZIJ A;  2OKA A;  5HR2 A;  1X5C A;  4JRR A;  4OMV A;  5B8B A;  2C3Q A;  1GL8 A;  2VL9 A;  5F0G A;  3DD3 A;  1KEB A;  1RW1 A;  1XW5 A;  2A2S A;  3TRP A;  1YEX A;  2C3N A;  4O5U A;  1A2J A;  3ZMK A;  2YCD A;  2O87 A;  3CSH A;  4PUA A;  4EL1 A;  1F9M A;  3FZA A;  5B8A A;  2V1M A;  4F9Z A;  2VAF A;  1V58 A;  4ECC A;  1DE1 A;  1OKT A;  1WPI A;  3QAG A;  4GRF A;  3GNJ A;  2PVO C;  4I6X A;  4PX1 A;  3GA4 A;  1J08 A;  4KW6 A;  3WGD A;  1N8J A;  4G10 A;  4BVX A;  3N5O A;  1PGT A;  5IMC A;  3ZML A;  3VPT A;  2NTO A;  1XBS A;  5H5R A;  2PUK C;  2DJ3 A;  5KOW A;  3C71 A;  5ECO B;  4EC0 A;  2YPM A;  3KJY A;  1SL0 B;  4Q5R A;  2HT9 A;  2VD1 A;  4JZQ A;  1O85 A;  3UJ1 A;  1MDI A;  3QCP A;  3KH9 A;  3EYT A;  5A4W A;  1K0C A;  1B9Y C;  2BMX A;  4G0K A;  4TVE A;  1NM3 A;  3BCI A;  1VGL A;  5IMF A;  1SK2 A;  4V1A p;  2IMK A;  3BJ5 A;  3F6F A;  3F9U A;  1ABA A;  5COH A;  3GL3 A;  4EDY A;  4Q5N A;  3EUR A;  4TXO A;  3RHB A;  2YN1 A;  1IYH A;  1TKD B;  2FA8 A;  3KMO A;  4Z2T A;  1SYX A;  5J9B A;  1GUM A;  4MPG A;  1PQN A;  2LQO A;  2N5B A;  3TRQ A;  4OD7 A;  3IC8 A;  4ZBA A;  5B6M A;  2K8S A;  2H1A A;  5D9T A;  4ECB A;  3D4T A;  2MZC A;  1WIK A;  3TGZ A;  3DYR A;  5AN1 A;  5A5K A;  2VLT A;  2FD3 A;  1GSQ A;  4HU9 A;  3LXT A;  1K3Y A;  3KP8 A;  3MDK A;  2QA1 A;  4PQH A;  4MLY A;  2H0G A;  5DAL B;  2C4J A;  4HEA 2;  4G19 A;  1T1V A;  2V6K A;  1TTZ A;  2E2G A;  1JZW A;  2CQ9 A;  2PMT A;  2QA2 A;  1UN2 A;  4K7O A;  1QGV A;  4X1U A;  1FO5 A;  1MEK A;  1PKW A;  2TIR A;  9GSS A;  3HY2 A;  3HJM A;  4YKF A;  1OC3 A;  3SWL A;  2OE1 A;  2P31 A;  2NPB A;  1GP1 A;  3A2X A;  4MF7 A;  1A0F A;  1H75 A;  2R2J A;  2YP6 A;  1GSU A;  2F51 A;  5G5F A;  3VWX A;  3L9V A;  11GS A;  3E0U A;  3TB2 A;  2FNO A;  3EMP A;  2JSY A;  4V1A g;  4YQV A;  5GSS A;  3DWV A;  4D73 A;  3CMI A;  3D0Z A;  2HSY A;  3KTB A;  2GQL A;  4MJA A;  1K0B A;  3L9S A;  3QPM A;  4WR5 A;  2VM1 A;  5CYY A;  5CRW A;  3TJF A;  2XBI A;  1GUL A;  3SBC A;  4MZW A;  5ECS A;  5BMU A;  1T8E B;  2I3Y A;  3UAR A;  4BA7 A;  1THO A;  2GTU A;  2F9S A;  2GT5 A;  3EU3 A;  1DUG A;  1OC8 A;  1AQX A;  2KHP A;  3FR3 A;  3HVS A;  4MAB A;  4KND A;  2H6Y A;  2VL2 C;  2PVQ A;  3VK9 A;  3D6I A;  5B6N A;  5FHI A;  3GTU A;  1FVJ A;  4ML1 A;  4IW9 A;  4DSR A;  2DC5 A;  2WUL A;  3FY7 A;  2HLS A;  2HZE A;  1V98 A;  2IPA A;  2JZT A;  1THX A;  4FO5 A;  1FB6 A;  2H71 A;  2X4A A;  4ILF A;  4YH2 A;  1MDJ A;  1JLW A;  1SEN A;  3JCM L;  4NV5 A;  4F03 A;  3CSJ A;  3FMW A;  3ZIJ A;  5ECH B;  3Q19 A;  2TRC P;  3GKX A;  4HQS A;  1ZYN A;  4OWY A;  5D96 A;  4FQU A;  3TKR A;  2WDU A;  4POB A;  5IPG A;  3EE2 A;  4KH7 A;  3RDW A;  3L9U A;  2VOC A;  2VL3 A;  4IS0 A;  1U88 A;  1ON4 A;  4ZBD A;  2ZCT A;  4G0L A;  4RI7 A;  1HD2 A;  4V2N A;  3EPT A;  4F82 A;  3KD0 A;  2R4V A;  2CA8 A;  2CX4 A;  2OBK A;  3I6A A;  2VCQ A;  2H01 A;  3FKF A;  4NAX A;  2MBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...