5CNWA

Crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
KIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FrnE protein
publication title drFrnE Represents a Hitherto Unknown Class of Eubacterial Cytoplasmic Disulfide Oxido-Reductases.
pubmed doi rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Oxidoreductase
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2015-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cnwA01
3IK7A 1ERTA 1A2LA 3U6VA 2VL2C 5AN1A 3UIWA 4EL1A 1ILOA 1XZOA 3P2AA 2ON5A 3FY7A 3RPPA 3ZREA 3TJFA 5H5SA 3ISOA 3QPMA 4LLRA 1XBSA 1XWBA 4NXIA 1XVQA 2LQQA 1T1VA 3IK9A 2YZUA 4OMVA 1AW9A 1G6WA 1PD21 2FNOA 1WMJA 3LJRA 1SKWB 4BL7A 2IIYA 4HU7A 5DJLA 2VCTA 4JBBA 2B6MA 1ZCPA 2GS3A 5D9XA 4IJIA 2GSRA 2C0EA 1V58A 4HS1A 1PN9A 3DRNA 3ME7A 5D93A 5G1KA 1ZZYA 4EXJA 3FEUA 3MDKA 1SYRA 5IM9A 1VF1A 3A2WA 4HUAA 3W8SA 5D8IA 2L4CA 1Z3EA 2L5LA 1QK8A 1UVZA 1K3OA 5J9BA 3C1SA 1TRVA 4YQUA 1PRXA 1GSEA 3WT2A 1M9BA 5JCGA 5E4WA 4K7OA 4IGJA 2DMLA 4MDCA 3KMNA 2GZPA 1GSUA 5HFIA 3ZYWA 2F51A 1THOA 3BOAA 5JWRB 5DDLA 1J0FA 2HNLA 1GUMA 4GSNA 5B6NA 4TXOB 2GSQA 3PR8A 5JWOB 3TKQA 1BAYA 5ID2A 4E8EA 2EIOA 3CBUA 1F6MC 1PKZA 2GSTA 4HZ4A 1O85A 5IO0A 3GH9A 2CX3A 4WEYA 1LJRA 2PVQA 5KEJA 2AJQB 5IMDA 5J3RA 1WP0A 1GTUA 3FZ5A 1OKDA 1X9SB 2IFQA 2CZ3A 1O8XA 2H0IA 1I5GA 2V2GA 3I43A 3ZL5A 2IMDA 1J08A 2GQLA 3TKSA 1SJZA 1XWAA 5HR1A 5CRGA 3JCML 3BCKA 1XW9A 2O87A 5IOWA 4LA1A 5CYYA 4J56E 4NWYA 5ENUA 5A4VA 1EEJA 2LS5A 3FZAA 3A2VA 1A8LA 2YP6A 4IELA 3UVTA 1K3YA 2J9HA 1VF4A 2MMOA 4ECIA 5J4UA 1QQ2A 4WBRD 14GSA 2LV3A 1H75A 3DXBA 1PL1A 3SWLA 2AB6A 3IAM2 1EV4A 4MZBA 4IP1A 3HCZA 1ERWA 1YF0A 4KUNA 1RQMA 3EINA 2PERA 2VIMA 3H79A 4PUFC 2NPBA 1THXA 4IBPA 1DSBA 4FIWA 1GTBA 1GWCA 2LQOA 1EGOA 3ZVJD 3L9SA 3D21A 1JZOA 2AYTA 3QFAC 1U6TA 2CVDA 4KGIA 1SKSB 4IHUA 3Q19A 5LD0A 4ZL9A 2TRXA 1YKAA 2B7JA 1TRUA 2H74A 4G19A 5C04A 3TJBA 3EMXA 4BWQA 4MA9A 3KGKA 3KXOA 2HI7A 4FYCA 2XBQA 3VLNA 2JL4A 3MSZA 2JACA 1EP7A 4L5LA 1SK0A 2XBIA 3IC4A 5CREA 1XXUA 2YN1A 2OE3A 2QKEA 2C0DA 3Q6OA 3TOUA 4PUAA 3A3TA 2EIRA 5JCUA 3APQA 3H4KA 1OC9A 1XPVA 4POLA 3GV1A 2VL3A 2R3XA 4H86A 2X99A 4WF4A 3M8NA 2V6KA 4F9ZA 8GSSA 1PKWA 4DVCA 2H75A 1FVKA 1AQVA 2L57A 3ZIVA 4I5QA 1PX7A 2CAIA 2PWJA 4XS4A 5IMZA 3EE2A 5HFKA 3EU4A 1TP9A 4KAEA 4KE3A 1R7HA 4JEDA 2NTOA 3IRAA 3RDWA 1FB0A 5L71A 1M2AA 4KDUA 3TUEA 4EKZA 3D22A 1GSFA 1PX6A 2YWOA 4OO5A 2R37A 4AF2A 1UN2A 1TI3A 1R26A 4DSRA 2LRNA 3TKPA 3M9JA 1ERUA 1Z6MA 2C3TA 2NVLA 1TU7A 4EE0A 1GNEA 2C0FA 1DE1A 1JLWA 1WRYA 1GL8A 1EOHA 4Q5FA 2GLRA 4XS1A 4N30A 1X5EA 2DJ2A 5HR0A 5FWGA 3QAGA 3KZQA 2E7PA 4YAVA 4ZILA 4O92A 3GN3A 1PSQA 20GSA 3IV4A 3M3MA 1NHYA 2K8SA 3BD2A 2VL2A 3APSA 3LORA 3UARA 4FYUA 4V1Ag 2REMA 2VUPA 5D9WA 3DWVA 16GSA 2GQMA 3HD5A 3I9V2 2ZCTA 2JZSA 4XCSA 2V1MA 5KN3A 2MBTA 2RM5A 5C00A 5ABRA 3CXGA 4ZB8A 4MPFA 3N9JA 1O6JA 4HU9A 2YWIA 4I97A 1W4VA 2V32A 3ZZXA 4TXVA 3TOTA 5DBQA 5ID2B 2HZFA 5D96A 2VCZA 5JWQB 5ECHB 1GP1A 3A5WA 1ABAA 4MK3A 2BJXA 4TN8A 4RUVA 4GF0A 1U87A 2LJKA 3VI7A 4I2UA 2VCXA 4PQHA 2HSYA 2IFQB 5J5NA 5AISA 1NHOA 4WBJA 1E6BA 4TR4A 3TJJA 2B3SA 4GSSA 2QC7A 3M9KA 2VCWA 3IR4A 1LBKA 4DEJA 1BG5A 5B8AA 6GSUA 2P5QA 4XRAA 3LYKA 3LXTA 4PURA 1KEBA 4IVFA 1A2MA 2A4VA 1TXXA 1AC1A 4K2DA 1BJXA 3QD9A 1T7PB 2DJ0A 2PPTA 1QUWA 1HNCA 3FKFA 3GKNA 3C1RA 4J57E 4EC0A 1MDIA 4ZB9A 2X64A 1Q98A 4TVEA 1MD4A 2YWMA 3FRCA 2LSTA 5ECSA 5B6MA 1F37A 4MZCA 4AJ6A 2H8LA 4HJ2A 4OD7A 2HT9A 18GSA 2OE1A 1HD2A 4FH8A 2GQKA 2JZRA 4PGTA 3M0FA 3I69A 3KH7A 4NHWA 1OKTA 3QAVA 2KP2A 1ZL9A 2LRTA 2KP1A 1QFNA 3P90A 1Z6NA 1G0TA 3GA4A 2N5FA 2IPAA 5ECRB 5IMFA 2OBKA 2TIRA 1SENA 5CP1A 2KUCA 4PXOA 3WGXA 4BA7A 4PQIA 1S3DA 1HNBA 5F06A 2O7KA 2V41A 1M9AA 4K6XA 3QDNA 5CNWA 5LNKe 12GSA 2HE3A 1J9BA 1M2DA 3GHAA 4IN0A 2H6ZA 2YCDA 1TI1A 1HQOA 5DCHA 4D73A 6GSSA 5D73A 3LFLA 17GSA 4PNGA 2VD0A 3O6TA 4GWRA 1GSYA 3E9JB 4ECCA 1Y25A 3HJMA 2FGXA 2CT6A 2GT6A 22GSA 3UBKA 2I9HA 1YEPA 1E2YA 3QCPA 4KX4A 3GL3A 1OC9B 3ZLPA 1M7TA 2ALBA 4JR4A 2H0HA 3NOFA 2YV7A 3RHBA 3I6AA 5IMCA 3GFKA 4KCEA 2M72A 2MBSA 2GTUA 2QGVA 1HYUA 5IIZA 3M1GA 1U3AA 2H71A 4XS4B 3GTUA 5GAND 1FO5A 2LTKA 1XCCA 1F9MA 3GRXA 5DCGA 3QOUA 2IMIA 3TGZA 3ZIJA 5GAPD 3EMPA 3F4RA 3VWWA 3KD0A 1YKCA 3WT1A 2WFCA 4KDYA 1WJKA 3MAKA 2DBCA 2MYGA 4MH3A 4K7IA 5H5RA 4LMWA 1V57A 2H1BA 1GH2A 4N0VA 1OE8A 4F2IA 4GXZA 3UEMA 3C7MA 3DEXA 1Q4JA 4N10A 1C72A 2CX4A 1JZRA 2AUVA 4HI7A 3KMOA 2A2SA 3L0HA 4BPYA 2DC5A 2L4QA 3KP9A 1TK0B 1PMTA 5IO2A 5A4UA 2ZNMA 3ZTLA 3IA1A 2IWTA 1I9DA 3ED3A 5HQPA 2VLVA 1V40A 2E0QA 2H01A 1O7UA 2O85A 1F2EA 2CQ9A 2H76A 4K0NA 4P3YB 2H0GA 5HFGA 4LL1B 1ZGNA 4EVMA 1YF1A 1U3IA 3RHCA 4IQAA 2XC2A 2IMEA 3FK8A 2JSYA 1FW1A 4XIHA 2H70A 2VL9A 5HR2A 4I2TA 2RLIA 5ECMB 1OAZA 1UA5A 2LNTA 2ZUPA 1CQHA 1X9WB 2LNSA 4O5RA 4GRFA 5ECNB 2GT5A 3KTBA 4L0WA 3GSTA 2N5AA 3E3EA 4L5OA 2FLSA 4MZWA 3GYKA 4MJBA 3LSZA 5EPFA 3UMAA 2OBIA 1TJDA 3ERFA 3TRQA 4ILFA 1EOGA 4TKYA 3G7JA 5JCWA 4OCEA 3G9BA 1NSWA 5G31A 3F3QA 2B5YA 1DUGA 3CTGA 4OFTA 2FY6A 2QSIA 3FZ9A 4KH7A 4BVYA 5ECPB 2MZCA 1BYEA 1K0CA 3C73A 2FA8A 2DIYA 3GSSA 1MEKA 1OVNA 1T3BA 5IPGA 1O8WA 2ON7A 1MDJA 3F4TA 1GLQA 1GNWA 1XFLA 3D6IA 2GSSA 3IHQA 3C71A 1B48A 3ZMLA 4WR5A 3VPTA 2WJUA 3F3RA 4JR6A 2FWGA 2R5GA 3HYPA 1TRWA 1V9WA 2WGRA 4WR4A 4MF5A 5IPHA 2DJKA 1K3LA 1R5AA 3APOA 2VLUA 1A24A 1T4ZA 4YH2A 2HXKA 9GSSA 5A5KA 2B1KA 19GSA 1A0RP 1JFUA 1XWGA 4WKWA 2F9SA 3GURA 11GSA 4ZBBA 2FWFA 2YJ7A 2CZ2A 2B5EA 1V2AA 3CYNA 5CRDA 2H72A 4KA0A 3GKXA 4MMMA 4IJ3A 4K9ZA 3GIXA 1Z5YE 1JZWA 3DMLA 10GSA 1EZKA 1WPIA 4JRRA 2VAFA 1XVWA 3W8JA 3L9VA 2DIZA 3GKMA 2C8UA 4N0ZA 3TRXA 2PVOC 1VGLA 3FR9A 4D73B 1TKDB 1XOAA 4ZL7A 4WETA 1EWXA 3C8EA 2VM2A 2I81A 4MH2A 1MDKA 3IOSA 4NPBA 2JSZA 2HSHA 3HVVA 2IN3A 2M80A 1G7OA 5ECQB 4DSSA 4Q5NA 6GSXA 3NIVA 4MP4A 2BTOT 2H30A 4GSTA 3FR3A 1ZYEA 5GZZB 1LU4A 3KCMA 2FD3A 3IPZA 1RK4A 5GSTA 1TRSA 2DMMA 2VOCA 3GTUB 4TR3A 1GULA 4MCUA 3F4SA 2H66A 2BMXA 1O73A 4POMA 3H1NA 3UBLA 5EVOA 4IP6A 2NBSA 4O32A 13GSA 3VPQA 1SYXA 2DJ3A 5B8BA 4YQVA 4Q5QA 1OC8A 2RM6A 2P31A 4G10A 3KTLA 2WRTA 4V2NA 2PUKC 2H73A 1GUKA 3ME8A 4K7NA 2I4AA 1PGTA 5DQSA 1A2JA 3GX8A 1AQWA 3HZ4A 3A2XA 3UVHA 1JHBA 4XTSA 3J7Yb 3VWXA 1SKRB 5AIVA 2H19A 2KHPA 1W89A 3ERWA 1UC7A 4F0CA 3OR5A 4BWSA 5EY6A 4OWYA 4NAXA 4HQSA 3LQ7A 2FCHA 3F9UA 2FUG2 4ID0A 4X43A 1YEXA 1SJIA 3L78A 1ACVA 1S3CA 3HVSA 3LG6A 3CSIA 4O7HA 5DQYA 2H1AA 4IKHA 1B8XA 2VCQA 1XWCA 5CRHA 3SBCA 5G2ZA 4LL4B 2XHFA 2X8HA 2JADA 4IS0A 4KSOA 5AGYA 3HZ8A 2HFDA 1VF3A 5DALA 1VRSD 5CAXA 3QAWA 2OKAA 1FAAA 1TU8A 5D9TA 4YAPA 4JE1A 5G5FA 3IE3A 4F0BA 4CW9A 3ERGA 3VURA 1K0DA 5G1LA 4XRDA 3LXZA 6GSVA 2ES7A 3V1WA 7GSSA 2HRFA 1YQ1A 2XPDA 4MLYA 1X5CA 1GRXA 2OA7A 3U5RE 1SL1B 2YV9A 3QFBC 1OC3A 1FVJA 3DVXA 1N2AA 2Z9SA 3VWVA 3AY8A 3O3TA 2I1UA 3MWHA 3PINA 5F07A 1ON4A 4ML6A 4GLTA 3IBHA 1GTIA 2YJHA 1AQXA 2MMNA 2IJYA 3ZITA 3PGTA 1YDKA 3GL5A 1X9MB 1M0UA 3G7YA 1B9YC 3GKKA 2F8AA 1EGRA 4ZIJA 3Q18A 3IDVA 1B4PA 3EU3A 2MMZA 3GNJA 3WYWA 4K8MA 1XWKA 3VI5A 1GSSA 2F8FA 4TR1A 2GZZA 1GTAA 2CV4A 3EVIA 2OJLA 2AAWA 1ZMAA 4NV2A 1AXDA 4KCAA 5AIXA 2I3YA 4MF7A 4ECJA 1KTEA 5FHIA 3ZFBA 2EIQA 4KSMA 2CVBA 3L9UA 3H8QA 3VK9A 3DIEA 3P8WA 5ECKB 4CHSA 4F82A 4QL7A 2IMFA 3CTFA 3US3A 1GSDA 5B7CA 3TJKA 4IQ1A 1XW5A 4ZXGA 1ZYQB 5G5EA 2KOKA 1YY7A 4HEA2 5KN0A 2K6VA 3NZNA 2CAQA 3GUSA 3BCIA 1NW2A 4Z7XA 2JZTA 2H1GA 4JZQA 1B4QA 1Y6EA 3KM6A 4GQFA 5H5QA 1RW1A 4CDOA 3KP8A 4OO4A 3KH9A 3GMFA 3MNGA 3CRTA 1TDIA 1TK5B 2CVKA 1TK8B 2XPEA 1ML6A 2K9FA 2B1LA 3ZMKA 2VLTA 3F8UA 1FB6A 4MPGA 1YZXA 4ZL8A 5HR3A 4WF5A 5ELGA 2WB9A 2B7KA 5GSSA 1YJ6A 2PMTA 1G7EA 3F63A 4IW9A 4RI6A 2WZ9A 4ULXA 3HJOA 1BX9A 3ZRDA 3ZFLA 4K1FA 4MJCA 4DSSB 2IL3A 4Q5RA 1U88A 2L6DA 1QXHA 1KBNA 3TJGA 2OE0A 2R4VA 1JLVA 1SJ6A 4V2LA 2FWEA 2GVPA 3DGQA 3FZ4A 4GQCA 3D4TA 2E2GA 2RUFA 2HRNA 4ZBDA 2PN8A 3TKSE 1ERVA 4ACSA 4NMUA 4PNFA 4KB3A 1K0NA 3HVXA 2X8CA 3DKSA 2H6XA 4N11A 2PGTA 3VWUA 3UL3A 2LKUA 4TR0A 2GGTA 2HZEA 2PBJA 2WULA 4BVXA 4TW5A 5DAKA 1S3AA 4XHMA 4POKA 1TW9A 4KNDA 3KJYA 3F6DA 3FW2A 3CRUA 4NV5A 3UJ1A 2RIIA 3EWLA 2YANA 2HLSA 1KNGA 1VF2A 2WCIA 1BQ7A 1EV9A 2N5BA 3HHVA 3KEBA 5IOXA 3RPNA 2O8VB 1DBYA 1GUHA 1TOFA 4OFNA 5IMVA 1AAZA 1OYJA 2IMKA 4RQXA 1FG4A 3TCOA 3CMIA 5J41A 3FHKA 6GSTA 3HXSA 1WE0A 2K8VA 3LYPA 5FT3A 4G9HA 1EP8A 1Z7PA 1SK2A 4L0UA 4EF0A 3EC3A 1K0OA 3CSJA 2H1DA 2GZYA 4XS6A 3LGCA 4KW6A 4MABA 4F03A 1QGVA 2YZHA 2X8GA 1SL0B 3J7Yk 2GDRA 5DALB 2EC4A 1R5PA 1SU9A 4PX1A 2J23A 3QMXA 4KDXA 4NHZA 4AJ8A 4GCIA 1DE2A 3FYGA 5ELAA 1M99A 4HOJA 4RI7A 1F3AA 2YPMA 4AGSA 2NDOA 3TB2A 2F3MA 3HKRA 5COHA 4EDZA 3DD3A 5F0GA 1MTCA 3HA9A 2V6OA 5F05A 1N8JA 1SD9A 2C80A 2OACA 4PQ1A 3L4NA 4QQ7A 4MJEA 2L6CA 2FHEA 4ML1A 3TKSC 6GSWA 4X1UA 3VFIA 2WS2A 2DSAA 2YOIA 4FYBA 1T8EB 3PH9A 3RAZA 3KIJA 2A2RA 1IYHA 3K8NA 5IQYA 3D4MA 1R4WA 4DSQA 1GSQA 3WGDA 1XIYA 1K0MA 3E0UA 1XOBA 3DVWA 4X0XA 4ISDA 2DJJA 5CO3A 5CRWA 1H4OA 4OFMA 5J9CA 4LMVA 1X0RA 4TR1B 2C4JA 3LWAA 4ZBAA 4TXOA 2JU5A 1PL2A 1TTZA 3P7XA 2MMAA 2DLXA 3DYRA 2LJRA 3HJPA 1HNAA 4POBA 1XW6A 1ZOFA 3UAPA 2L59A 2L5OA 2TRCP 2C3NA 5E59A 2H6YA 1F3BA 2M46A 2DJ1A 1EEMA 2KLXA 2VM1A 4HZ2A 3IXRA 1Z7RA 4MF6A 4HDEA 4AJ7A 3QR6A 3BBYA 4I8BA 1FOVA 3LEFA 2R6KA 1CQGA 1GLPA 2C1YA 3TKRA 4HJMA 1M2BA 2O89A 4J2FA 4K0GA 3O76A 2VD1A 5ECLB 1QMVA 1G6YA 3N5OA 2P0GA 3ZVJA 2G2QA 1X5DA 4L8EA 4RQRA 2E2MA 4GTUA 5INYA 1K0AA 5F8BA 1SD8A 5A4WA 3HY2A 4ZB6A 3EYTA 3RBTA 1AIUA 2OADA 1NM3A 2VO4A 4EUYA 1A8YA 5DJMA 5ECIB 3HDCA 3FR6A 2LUSA 3BJ5A 5G30A 1IYIA 3F0IA 4EO3A 4YQMA 3GH6A 3CSHA 2K18A 2C0GA 4OCFA 3G7IA 2B5XA 2VCVA 4TRXA 3H93A 2AHEA 2RUEA 1OE7A 4G2EA 4FO5A 1BEDA 1FHEA 4TOPA 4EDYA 2R2JA 3IAS2 1T00A 3EURA 2PU9C 2LJAA 5KN2A 3F6FA 5DVBA 2C3QA 1O81A 2D2ZA 2FA4A 3W6GA 2P5RA 1A23A 1AUCA 1URMA 1B9XC 3D0ZA 1A0FA 5LCZA 3GX0A 3TDGA 5KN1A 1USBA 2AV4A 3R2QA 1WWJA 1WIKA 1SL2B 1Z9HA 1T4YA 1PQNA 4JU5A 2HZEB 4V1Ap 2YNXA 2YWNA 5DAKB 2LRCA 3D5JA 4E8HA 2WDUA 5D9VA 1K0BA 1PA3A 3TRPA 6GSYA 2HYXA 1JZDA 3Q74A 2G0FA 2FWHA 5ECOB 1V98A 4ECBA 3S9FA 1WOUA 4WXTA 5EL8A 2LEGA 5IMAA 4MJAA 1ST9A 3WD6A 2CA8A 1SK1A 4V2MA 4HQZA 1MD3A 3UOMA 3WGEA 4QL9A 4I6XA
chains in the Genus database with same CATH superfamily
3IK7A 1ERTA 1A2LA 3U6VA 2VL2C 5AN1A 1ZYPA 3UIWA 4EL1A 1ILOA 1XZOA 3P2AA 2ON5A 3FY7A 3RPPA 3ZREA 3TJFA 5H5SA 3ISOA 3QPMA 4LLRA 1XBSA 1XWBA 4NXIA 1XVQA 2LQQA 1T1VA 3IK9A 2YZUA 4OMVA 1AW9A 1G6WA 1PN0A 1PD21 2A4HA 2FNOA 1WMJA 3LJRA 1SKWB 4BL7A 2IIYA 4HU7A 5DJLA 2VCTA 4JBBA 2B6MA 1ZCPA 2GS3A 5D9XA 4IJIA 2GSRA 2C0EA 1V58A 4HS1A 1PN9A 3DRNA 3ME7A 5D93A 5G1KA 1ZZYA 4EXJA 3FEUA 3MDKA 1SYRA 5IM9A 1VF1A 3A2WA 4HUAA 4YKGA 3W8SA 5D8IA 2L4CA 1Z3EA 2L5LA 1QK8A 1UVZA 1K3OA 5J9BA 3C1SA 1TRVA 4YQUA 1PRXA 1GSEA 3WT2A 1M9BA 5JCGA 5E4WA 4K7OA 4IGJA 2DMLA 4MDCA 3KMNA 2GZPA 1GSUA 5HFIA 3ZYWA 4Z2TA 2F51A 1THOA 3BOAA 5JWRB 5DDLA 1J0FA 2HNLA 2HSMA 1GUMA 4GSNA 5B6NA 4TXOB 2GSQA 3PR8A 5JWOB 3TKQA 1BAYA 5ID2A 4E8EA 2EIOA 3CBUA 1F6MC 1PKZA 2GSTA 4HZ4A 1O85A 5IO0A 3GH9A 2CX3A 4WEYA 1LJRA 2PVQA 5KEJA 2AJQB 5IMDA 5J3RA 1WP0A 3MIXA 1GTUA 3FZ5A 1OKDA 1X9SB 2IFQA 2CZ3A 1O8XA 2H0IA 1I5GA 2V2GA 3I43A 3ZL5A 2IMDA 1J08A 2GQLA 3TKSA 1SJZA 1XWAA 5HR1A 5CRGA 3JCML 3BCKA 1XW9A 2O87A 5IOWA 4LA1A 5CYYA 4J56E 4NWYA 5ENUA 5A4VA 1EEJA 2LS5A 3FZAA 3A2VA 1A8LA 2YP6A 4IELA 3UVTA 1K3YA 3IHGA 2J9HA 1VF4A 2MMOA 4ECIA 5J4UA 1QQ2A 4WBRD 14GSA 2LV3A 1H75A 3DXBA 1PL1A 3SWLA 2AB6A 2R0CA 3IAM2 1EV4A 4MZBA 4IP1A 3HCZA 1ERWA 1YF0A 4KUNA 1RQMA 3EINA 2PERA 2VIMA 3H79A 4PUFC 2NPBA 1THXA 4IBPA 1DSBA 4CY8A 4FIWA 1GTBA 1GWCA 2LQOA 1EGOA 3ZVJD 3L9SA 3D21A 1JZOA 2AYTA 3QFAC 1U6TA 2CVDA 1M3IA 4KGIA 1SKSB 4IHUA 3Q19A 5LD0A 4ZL9A 2TRXA 1YKAA 2B7JA 1TRUA 2H74A 4G19A 5C04A 4G0LA 3TJBA 3EMXA 4BWQA 4MA9A 3KGKA 3KXOA 2HI7A 4FYCA 2XBQA 3VLNA 2JL4A 3MSZA 2JACA 1EP7A 4L5LA 1SK0A 2XBIA 3IC4A 5CREA 1XXUA 2YN1A 2OE3A 2QKEA 2C0DA 3Q6OA 3TOUA 4PUAA 3A3TA 2EIRA 5JCUA 3APQA 4ICYA 3H4KA 1OC9A 1XPVA 4POLA 3GV1A 2VL3A 2R3XA 4H86A 2X99A 4WF4A 3M8NA 2V6KA 4F9ZA 8GSSA 1PKWA 4DVCA 2H75A 1FVKA 1AQVA 2L57A 3ZIVA 4I5QA 1PX7A 2CAIA 2PWJA 4XS4A 5IMZA 3EE2A 5HFKA 3EU4A 1TP9A 4KAEA 4KE3A 1R7HA 4JEDA 2NTOA 3IRAA 3RDWA 1FB0A 5L71A 1M2AA 4KDUA 3CQFA 3TUEA 4EKZA 3D22A 1GSFA 1PX6A 2YWOA 4OO5A 2R37A 4AF2A 1UN2A 1TI3A 1R26A 4DSRA 2LRNA 3TKPA 4BL7B 3M9JA 1ERUA 1Z6MA 2C3TA 2NVLA 1TU7A 4EE0A 1GNEA 2C0FA 1DE1A 1JLWA 1WRYA 1GL8A 1EOHA 4Z2UA 4Q5FA 2GLRA 4XS1A 4N30A 1X5EA 2DJ2A 5HR0A 5FWGA 3QAGA 3KZQA 2E7PA 4YAVA 4ZILA 4O92A 3GN3A 1PSQA 20GSA 3IV4A 3M3MA 1NHYA 2K8SA 3BD2A 2VL2A 3APSA 3LORA 3UARA 4FYUA 4V1Ag 2REMA 2VUPA 5D9WA 3DWVA 16GSA 2GQMA 3HD5A 3I9V2 2ZCTA 2JZSA 4XCSA 2V1MA 5KN3A 2MBTA 2RM5A 5C00A 5ABRA 3CXGA 4ZB8A 4MPFA 3N9JA 4G0IA 1O6JA 4HU9A 2YWIA 4I97A 1W4VA 2V32A 3ZZXA 4TXVA 3IC8A 3TOTA 5DBQA 5ID2B 2HZFA 5D96A 2VCZA 5JWQB 2X4AA 5ECHB 1GP1A 3A5WA 1ABAA 4MK3A 2BJXA 4TN8A 4RUVA 4GF0A 1FOHA 1U87A 2LJKA 3VI7A 4I2UA 2VCXA 4PQHA 2HSYA 2IFQB 5J5NA 2X49A 5AISA 1NHOA 4WBJA 1E6BA 4TR4A 3TJJA 2B3SA 4GSSA 2QC7A 3M9KA 2VCWA 3IR4A 1LBKA 4DEJA 1BG5A 5B8AA 6GSUA 2P5QA 4XRAA 3LYKA 3LXTA 4PURA 1KEBA 4IVFA 1A2MA 2A4VA 1TXXA 1AC1A 4K2DA 1BJXA 3QD9A 1T7PB 2DJ0A 2PPTA 1QUWA 1HNCA 3FKFA 3GKNA 3C1RA 4J57E 4EC0A 1MDIA 4ZB9A 2X64A 1Q98A 4TVEA 1MD4A 2YWMA 3FRCA 2LSTA 5ECSA 5B6MA 1F37A 4MZCA 4AJ6A 2H8LA 4HJ2A 4OD7A 2HT9A 18GSA 2OE1A 1HD2A 4FH8A 2A2PA 2GQKA 2JZRA 4PGTA 3M0FA 3I69A 3KH7A 4NHWA 1OKTA 3QAVA 2KP2A 1ZL9A 2LRTA 2KP1A 1QFNA 3P90A 1Z6NA 1G0TA 3GA4A 2N5FA 2IPAA 5ECRB 5IMFA 2OBKA 2TIRA 1SENA 5CP1A 2KUCA 4PXOA 3WGXA 4BA7A 4PQIA 1S3DA 1HNBA 5F06A 2O7KA 2V41A 1M9AA 4K6XA 3QDNA 5CNWA 5LNKe 12GSA 2HE3A 1J9BA 2HRKA 1M2DA 3GHAA 4IN0A 2H6ZA 2YCDA 1TI1A 1HQOA 5DCHA 4D73A 6GSSA 5D73A 3LFLA 17GSA 4PNGA 4O5QA 2VD0A 3O6TA 4GWRA 1GSYA 3E9JB 4ECCA 1Y25A 3HJMA 2FGXA 2CT6A 2GT6A 22GSA 3UBKA 2I9HA 1YEPA 1E2YA 3QCPA 4KX4A 3GL3A 1OC9B 3ZLPA 1M7TA 2ALBA 4JR4A 2H0HA 3NOFA 2YV7A 3RHBA 3I6AA 5IMCA 3GFKA 4KCEA 2M72A 2MBSA 2GTUA 2QGVA 4K2XA 1HYUA 2DKIA 5IIZA 3M1GA 1U3AA 2H71A 4XS4B 3GTUA 5GAND 1FO5A 2LTKA 1XCCA 1F9MA 3GRXA 5DCGA 3QOUA 2IMIA 3TGZA 3ZIJA 5GAPD 3EMPA 3F4RA 3VWWA 3KD0A 1YKCA 3WT1A 2WFCA 4KDYA 1WJKA 3MAKA 2DBCA 2MYGA 4MH3A 4USSA 4K7IA 5H5RA 4LMWA 1V57A 2H1BA 4K5SA 1GH2A 4N0VA 1OE8A 4F2IA 4GXZA 3UEMA 3C7MA 3DEXA 1Q4JA 4N10A 4KF9A 1C72A 2CX4A 1JZRA 2AUVA 4HI7A 3KMOA 2A2SA 3L0HA 4BPYA 2DC5A 2L4QA 3KP9A 1TK0B 4G0KA 1PMTA 5IO2A 5A4UA 2ZNMA 3ZTLA 3IA1A 2IWTA 1I9DA 3ED3A 5HQPA 2VLVA 1V40A 2E0QA 2H01A 1O7UA 2O85A 1F2EA 2CQ9A 2H76A 4K0NA 4P3YB 2H0GA 5HFGA 4LL1B 1ZGNA 4EVMA 1YF1A 1U3IA 3RHCA 4IQAA 2XC2A 2IMEA 1S3RA 3FK8A 2JSYA 1FW1A 4XIHA 2H70A 2VL9A 5HR2A 4I2TA 2RLIA 5ECMB 1OAZA 1UA5A 2LNTA 2ZUPA 1CQHA 1X9WB 2LNSA 4O5RA 4GRFA 5ECNB 2GT5A 3KTBA 4L0WA 3LW9A 3GSTA 2N5AA 3E3EA 4L5OA 2FLSA 3EPTA 4MZWA 3GYKA 4MJBA 3LSZA 5EPFA 3UMAA 2OBIA 1TJDA 2HRAA 3ERFA 3TRQA 4ILFA 1EOGA 4TKYA 3G7JA 5JCWA 4OCEA 3G9BA 1NSWA 5G31A 5BMUA 3F3QA 2B5YA 1DUGA 3CTGA 4OFTA 2FY6A 2QSIA 3FZ9A 4KH7A 4BVYA 3MYDA 5ECPB 2MZCA 1BYEA 1K0CA 3C73A 2FA8A 2DIYA 3GSSA 1MEKA 1OVNA 1T3BA 5IPGA 1O8WA 2ON7A 1MDJA 3F4TA 1GLQA 1GNWA 1XFLA 3D6IA 2GSSA 3IHQA 3C71A 1B48A 3ZMLA 4WR5A 3VPTA 2WJUA 3F3RA 4JR6A 2FWGA 2R5GA 3HYPA 1TRWA 1V9WA 1XG8A 2WGRA 4WR4A 4MF5A 5IPHA 2DJKA 1K3LA 1R5AA 3APOA 2VLUA 1A24A 1T4ZA 4YH2A 2HXKA 9GSSA 5A5KA 2B1KA 19GSA 1A0RP 1JFUA 1XWGA 4WKWA 2F9SA 3GURA 11GSA 4ZBBA 2FWFA 2YJ7A 2CZ2A 2B5EA 1V2AA 5BRTA 3CYNA 5CRDA 2H72A 4KA0A 3GKXA 4MMMA 4IJ3A 4K9ZA 3GIXA 1Z5YE 1JZWA 3DMLA 10GSA 1EZKA 4BIKA 1WPIA 4JRRA 2VAFA 1XVWA 3W8JA 3L9VA 2DIZA 3GKMA 2C8UA 4N0ZA 3TRXA 2PVOC 1VGLA 3FR9A 4D73B 1TKDB 1XOAA 1PFOA 4ZL7A 4WETA 1EWXA 3C8EA 2VM2A 2I81A 4MH2A 1MDKA 3IOSA 4NPBA 2JSZA 2HSHA 3HVVA 2IN3A 2M80A 4A5PA 5ECQB 1G7OA 4DSSA 4Q5NA 6GSXA 4EIQA 3NIVA 3A5IA 4MP4A 2BTOT 2H30A 4GSTA 3FR3A 1ZYEA 5GZZB 1LU4A 3KCMA 2FD3A 3IPZA 1RK4A 5GSTA 1TRSA 2DMMA 4YKFA 2VOCA 3GTUB 4TR3A 1GULA 4MCUA 3F4SA 2H66A 2BMXA 1O73A 4POMA 3H1NA 3UBLA 5EVOA 4IP6A 2NBSA 4O32A 13GSA 3VPQA 1SYXA 4MNNA 2DJ3A 5B8BA 2QA2A 4YQVA 4Q5QA 1OC8A 2RM6A 2P31A 4G10A 3KTLA 2WRTA 4V2NA 2PUKC 2H73A 1GUKA 4K5RA 3ME8A 4K7NA 2I4AA 1PGTA 5DQSA 1A2JA 3GX8A 1AQWA 3HZ4A 3A2XA 3UVHA 1JHBA 4XTSA 3J7Yb 3VWXA 1SKRB 5AIVA 2H19A 2KHPA 1W89A 3ERWA 1UC7A 4F0CA 3OR5A 4BWSA 5EY6A 2R0GA 4OWYA 4NAXA 4HQSA 3LQ7A 2FCHA 3F9UA 2FUG2 4ID0A 4X43A 1YEXA 1SJIA 3L78A 1ACVA 1S3CA 3HVSA 3LG6A 3CSIA 4O7HA 5DQYA 2H1AA 4IKHA 1B8XA 2VCQA 1XWCA 5CRHA 3SBCA 5G2ZA 4LL4B 2XHFA 2X8HA 2JADA 4IS0A 4KSOA 5AGYA 3HZ8A 2HFDA 1VF3A 5DALA 1VRSD 5CAXA 3QAWA 2OKAA 1FAAA 1TU8A 5D9TA 4YAPA 4JE1A 5G5FA 3IE3A 4F0BA 4Z2RA 4CW9A 2R0PA 3ERGA 3VURA 1K0DA 5G1LA 4XRDA 3LXZA 6GSVA 2ES7A 3V1WA 7GSSA 2HRFA 1YQ1A 2XPDA 4MLYA 1X5CA 1GRXA 2OA7A 3U5RE 1SL1B 2YV9A 3QFBC 1OC3A 1FVJA 3DVXA 3R3EA 1N2AA 2UZ8A 2Z9SA 3VWVA 3AY8A 3O3TA 2I1UA 3MWHA 3PINA 5F07A 1ON4A 4ML6A 4GLTA 3IBHA 1GTIA 2YJHA 1AQXA 2MMNA 4PTSA 2IJYA 3ZITA 3PGTA 1YDKA 3GL5A 1X9MB 1M0UA 3G7YA 1B9YC 3GKKA 2F8AA 1EGRA 4ZIJA 3Q18A 3IDVA 1B4PA 3EU3A 2MMZA 3GNJA 4BVYB 3WYWA 4HSCX 4K8MA 1XWKA 4O5UA 3VI5A 1GSSA 2F8FA 4TR1A 2GZZA 1GTAA 2CV4A 3EVIA 2OJLA 2AAWA 1ZMAA 4NV2A 1AXDA 4KCAA 5AIXA 2I3YA 4MF7A 4ECJA 1KTEA 5FHIA 3ZFBA 2EIQA 4KSMA 2CVBA 3L9UA 3H8QA 3FMWA 3VK9A 3DIEA 3P8WA 5ECKB 4CHSA 4F82A 4QL7A 2IMFA 3CTFA 3US3A 1GSDA 5B7CA 3TJKA 2QA1A 4IQ1A 1XW5A 4ZXGA 1ZYQB 5G5EA 2KOKA 1YY7A 4HEA2 4EIPA 5KN0A 2K6VA 3NZNA 2CAQA 3GUSA 3BCIA 1NW2A 4Z7XA 2JZTA 2H1GA 4JZQA 1B4QA 1Y6EA 3KM6A 4GQFA 5H5QA 1RW1A 4CDOA 3KP8A 4OO4A 3KH9A 3GMFA 3MNGA 3CRTA 1TDIA 1TK5B 2CVKA 1TK8B 2XPEA 1ML6A 2K9FA 2B1LA 3ZMKA 2VLTA 3F8UA 1FB6A 4MPGA 1YZXA 4ZL8A 5HR3A 4WF5A 5ELGA 2WB9A 2B7KA 5GSSA 1YJ6A 2PMTA 1G7EA 3F63A 4IW9A 4RI6A 2WZ9A 4ULXA 3HJOA 1BX9A 3ZRDA 3ZFLA 4K1FA 4MJCA 4DSSB 2IL3A 4Q5RA 1U88A 2L6DA 1QXHA 1KBNA 3TJGA 2OE0A 2R4VA 1JLVA 1SJ6A 4V2LA 2FWEA 2GVPA 3DGQA 3FZ4A 4GQCA 3D4TA 2E2GA 2RUFA 2HRNA 4ZBDA 2PN8A 3TKSE 1ERVA 4ACSA 4NMUA 4PNFA 4KB3A 1K0NA 3HVXA 2X8CA 3DKSA 2H6XA 4N11A 2PGTA 3VWUA 3UL3A 2LKUA 4TR0A 2GGTA 2HZEA 2PBJA 2WULA 4BVXA 4TW5A 5DAKA 1S3AA 4XHMA 4POKA 1TW9A 4KNDA 3KJYA 3F6DA 3FW2A 3CRUA 4NV5A 3UJ1A 2RIIA 3EWLA 2YANA 2HLSA 1KNGA 1VF2A 2WCIA 1BQ7A 1EV9A 2N5BA 3HHVA 3KEBA 5IOXA 3RPNA 2O8VB 1DBYA 5KOXA 1GUHA 1TOFA 4OFNA 5IMVA 1AAZA 1OYJA 2IMKA 4RQXA 1FG4A 3TCOA 3CMIA 5J41A 3FHKA 6GSTA 3HXSA 1WE0A 2K8VA 3LYPA 5FT3A 4G9HA 1EP8A 1Z7PA 1SK2A 4L0UA 4EF0A 3EC3A 1K0OA 3CSJA 2H1DA 2GZYA 4XS6A 3LGCA 4KW6A 4MABA 2DKHA 4F03A 1QGVA 2YZHA 2X8GA 1SL0B 3J7Yk 2GDRA 5DALB 2EC4A 1R5PA 1SU9A 4PX1A 2J23A 3QMXA 4KDXA 4NHZA 4AJ8A 4GCIA 1DE2A 3FYGA 5ELAA 1M99A 4HOJA 4RI7A 1F3AA 2YPMA 4AGSA 2NDOA 3TB2A 2F3MA 3HKRA 5COHA 4EDZA 3DD3A 5F0GA 1MTCA 3HA9A 2V6OA 5F05A 1N8JA 1SD9A 2C80A 2OACA 4PQ1A 3L4NA 4QQ7A 4MJEA 2L6CA 3HVNA 2FHEA 4ML1A 3TKSC 6GSWA 4X1UA 3VFIA 2WS2A 2DSAA 2YOIA 4FYBA 1T8EB 3PH9A 3RAZA 3KIJA 2A2RA 1IYHA 3K8NA 5IQYA 3D4MA 1R4WA 4DSQA 1GSQA 3WGDA 1XIYA 1K0MA 3E0UA 1XOBA 3DVWA 4X0XA 4ISDA 2DJJA 5CO3A 5CRWA 1H4OA 4OFMA 4CY6A 5J9CA 4LMVA 1X0RA 4TR1B 2C4JA 3LWAA 4ZBAA 4TXOA 2JU5A 1PL2A 1TTZA 3P7XA 2MMAA 2DLXA 3DYRA 2LJRA 3HJPA 1HNAA 4POBA 1XW6A 1ZOFA 3UAPA 2L59A 2L5OA 2TRCP 2C3NA 2H6YA 5E59A 4FQUA 1F3BA 2M46A 2DJ1A 1EEMA 2KLXA 2VM1A 4HZ2A 3IXRA 1Z7RA 4MF6A 4HDEA 4AJ7A 3QR6A 3BBYA 4I8BA 1FOVA 3LEFA 2R6KA 1CQGA 1GLPA 2C1YA 3TKRA 4HJMA 1M2BA 2O89A 4J2FA 4K0GA 3O76A 2VD1A 5ECLB 1QMVA 1G6YA 3N5OA 2P0GA 3ZVJA 2G2QA 1X5DA 4L8EA 4RQRA 2E2MA 4GTUA 5INYA 1K0AA 5F8BA 1SD8A 5A4WA 3HY2A 4ZB6A 3EYTA 3RBTA 1AIUA 2OADA 1NM3A 2VO4A 4EUYA 1A8YA 5DJMA 5ECIB 3HDCA 3FR6A 2LUSA 3BJ5A 5G30A 1IYIA 3F0IA 4EO3A 4YQMA 3GH6A 3CSHA 2K18A 2C0GA 4OCFA 3G7IA 2B5XA 2VCVA 4TRXA 3H93A 2AHEA 3PPUA 2RUEA 1OE7A 4G2EA 4FO5A 1BEDA 1FHEA 4TOPA 4EDYA 2R2JA 3IAS2 1T00A 3EURA 2PU9C 2LJAA 5KN2A 3F6FA 5DVBA 2C3QA 1O81A 2D2ZA 2FA4A 3W6GA 2P5RA 1A23A 1AUCA 1URMA 1B9XC 3D0ZA 1A0FA 4X4JA 5LCZA 3GX0A 3TDGA 5KN1A 1USBA 2AV4A 3R2QA 1WWJA 1WIKA 1SL2B 1Z9HA 1T4YA 1PQNA 4JU5A 2HZEB 4V1Ap 2YNXA 4BVXB 2YWNA 5DAKB 2LRCA 1ZYNA 3D5JA 4E8HA 2WDUA 5D9VA 5KOWA 1K0BA 1M3JA 1PA3A 3TRPA 6GSYA 2HYXA 1JZDA 3Q74A 2G0FA 2FWHA 5ECOB 1V98A 4ECBA 3S9FA 1WOUA 4WXTA 5EL8A 2LEGA 5IMAA 4MJAA 1ST9A 3WD6A 2CA8A 1SK1A 4V2MA 4HQZA 1MD3A 3UOMA 3WGEA 4QL9A 4I6XA
chains in the Genus database with same CATH topology
3IK7A 1ERTA 1A2LA 3U6VA 2VL2C 5AN1A 1ZYPA 3UIWA 4EL1A 1ILOA 1XZOA 3P2AA 2ON5A 3FY7A 3RPPA 3ZREA 3TJFA 5H5SA 3ISOA 3QPMA 4LLRA 1XBSA 1XWBA 4NXIA 1XVQA 2LQQA 1T1VA 3IK9A 2YZUA 4OMVA 1AW9A 1G6WA 1PN0A 1PD21 2A4HA 2FNOA 1WMJA 3LJRA 1SKWB 4BL7A 2IIYA 4HU7A 5DJLA 2VCTA 4JBBA 2B6MA 1ZCPA 2GS3A 5D9XA 4IJIA 2GSRA 2C0EA 1V58A 4HS1A 1PN9A 3DRNA 3ME7A 5D93A 5G1KA 1ZZYA 4EXJA 3FEUA 3MDKA 1SYRA 5IM9A 1VF1A 3A2WA 4HUAA 4YKGA 3W8SA 5D8IA 2L4CA 1Z3EA 2L5LA 1QK8A 1UVZA 1K3OA 5J9BA 3C1SA 1TRVA 4YQUA 1PRXA 1GSEA 3WT2A 1M9BA 5JCGA 5E4WA 4K7OA 4IGJA 2DMLA 4MDCA 3KMNA 2GZPA 1GSUA 5HFIA 3ZYWA 4Z2TA 2F51A 1THOA 3BOAA 5JWRB 5DDLA 1J0FA 2HNLA 2HSMA 1GUMA 4GSNA 5B6NA 4TXOB 2GSQA 3PR8A 5JWOB 3TKQA 1BAYA 5ID2A 4E8EA 2EIOA 3CBUA 1F6MC 1PKZA 2GSTA 4HZ4A 1O85A 5IO0A 3GH9A 2CX3A 4WEYA 1LJRA 2PVQA 5KEJA 2AJQB 5IMDA 5J3RA 1WP0A 3MIXA 1GTUA 3FZ5A 1OKDA 1X9SB 2IFQA 2CZ3A 1O8XA 2H0IA 1I5GA 2V2GA 3I43A 3ZL5A 2IMDA 1J08A 2GQLA 3TKSA 1SJZA 1XWAA 5HR1A 5CRGA 3JCML 3BCKA 1XW9A 2O87A 5IOWA 4LA1A 5CYYA 4J56E 4NWYA 5ENUA 5A4VA 1EEJA 2LS5A 3FZAA 3A2VA 1A8LA 2YP6A 4IELA 3UVTA 1K3YA 3IHGA 2J9HA 1VF4A 2MMOA 4ECIA 5J4UA 1QQ2A 4WBRD 14GSA 2LV3A 1H75A 3DXBA 1PL1A 3SWLA 2AB6A 2R0CA 3IAM2 1EV4A 4MZBA 4IP1A 3HCZA 1ERWA 1YF0A 4KUNA 1RQMA 3EINA 2PERA 2VIMA 3H79A 4PUFC 2NPBA 1THXA 4IBPA 1DSBA 4CY8A 4FIWA 1GTBA 1GWCA 2LQOA 1EGOA 3ZVJD 3L9SA 3D21A 1JZOA 2AYTA 3QFAC 1U6TA 2CVDA 4KGIA 1SKSB 4IHUA 3Q19A 5LD0A 4ZL9A 2TRXA 1YKAA 2B7JA 1TRUA 2H74A 4G19A 5C04A 4G0LA 3TJBA 3EMXA 4BWQA 4MA9A 3KGKA 3KXOA 2HI7A 4FYCA 2XBQA 3VLNA 2JL4A 3MSZA 2JACA 1EP7A 4L5LA 1SK0A 2XBIA 3IC4A 5CREA 1XXUA 2YN1A 2OE3A 2QKEA 2C0DA 3Q6OA 3TOUA 4PUAA 3A3TA 2EIRA 5JCUA 3APQA 4ICYA 3H4KA 1OC9A 1XPVA 4POLA 3GV1A 2VL3A 2R3XA 4H86A 2X99A 4WF4A 3M8NA 2V6KA 4F9ZA 8GSSA 1PKWA 4DVCA 2H75A 1FVKA 1AQVA 2L57A 3ZIVA 4I5QA 1PX7A 2CAIA 2PWJA 4XS4A 5IMZA 3EE2A 5HFKA 3EU4A 1TP9A 4KAEA 4KE3A 1R7HA 4JEDA 2NTOA 3IRAA 3RDWA 1FB0A 5L71A 1M2AA 4KDUA 3TUEA 4EKZA 3D22A 1GSFA 1PX6A 2YWOA 4OO5A 2R37A 4AF2A 1UN2A 1TI3A 1R26A 4DSRA 2LRNA 3TKPA 4BL7B 3M9JA 1ERUA 1Z6MA 2C3TA 2NVLA 1TU7A 4EE0A 1GNEA 2C0FA 1DE1A 1JLWA 1WRYA 1GL8A 1EOHA 4Z2UA 4Q5FA 2GLRA 4XS1A 4N30A 1X5EA 2DJ2A 5HR0A 5FWGA 3QAGA 3KZQA 2E7PA 4YAVA 4ZILA 4O92A 3GN3A 1PSQA 20GSA 3IV4A 3M3MA 1NHYA 2K8SA 3BD2A 2VL2A 3APSA 3LORA 3UARA 4FYUA 4V1Ag 2REMA 2VUPA 5D9WA 3DWVA 16GSA 2GQMA 3HD5A 3I9V2 2ZCTA 2JZSA 4XCSA 2V1MA 5KN3A 2MBTA 2RM5A 5C00A 5ABRA 3CXGA 4ZB8A 4MPFA 3N9JA 4G0IA 1O6JA 4HU9A 2YWIA 4I97A 1W4VA 2V32A 3ZZXA 4TXVA 3IC8A 3TOTA 5DBQA 5ID2B 2HZFA 5D96A 2VCZA 5JWQB 2X4AA 5ECHB 1GP1A 3A5WA 1ABAA 4MK3A 2BJXA 4TN8A 4RUVA 4GF0A 1FOHA 1U87A 2LJKA 3VI7A 4I2UA 2VCXA 4PQHA 2HSYA 2IFQB 5J5NA 2X49A 5AISA 1NHOA 4WBJA 1E6BA 4TR4A 3TJJA 2B3SA 4GSSA 2QC7A 3M9KA 2VCWA 3IR4A 1LBKA 4DEJA 1BG5A 5B8AA 6GSUA 2P5QA 4XRAA 3LYKA 3LXTA 4PURA 1KEBA 4IVFA 1A2MA 2A4VA 1TXXA 1AC1A 4K2DA 1BJXA 3QD9A 1T7PB 2DJ0A 2PPTA 1QUWA 1HNCA 3FKFA 3GKNA 3C1RA 4J57E 4EC0A 1MDIA 4ZB9A 2X64A 1Q98A 4TVEA 1MD4A 2YWMA 3FRCA 2LSTA 5ECSA 5B6MA 1F37A 4MZCA 4AJ6A 2H8LA 4HJ2A 4OD7A 2HT9A 18GSA 2OE1A 1HD2A 4FH8A 2A2PA 2GQKA 2JZRA 4PGTA 3M0FA 3I69A 3KH7A 4NHWA 1OKTA 3QAVA 2KP2A 1ZL9A 2LRTA 2KP1A 1QFNA 3P90A 1Z6NA 1G0TA 3GA4A 2N5FA 2IPAA 5ECRB 5IMFA 2OBKA 2TIRA 1SENA 5CP1A 2KUCA 4PXOA 3WGXA 4BA7A 4PQIA 1S3DA 1HNBA 5F06A 2O7KA 2V41A 1M9AA 4K6XA 3QDNA 5CNWA 5LNKe 12GSA 2HE3A 1J9BA 2HRKA 1M2DA 3GHAA 4IN0A 2H6ZA 2YCDA 1TI1A 1HQOA 5DCHA 4D73A 6GSSA 5D73A 3LFLA 17GSA 4PNGA 4O5QA 2VD0A 3O6TA 4GWRA 1GSYA 3E9JB 4ECCA 1Y25A 3HJMA 2FGXA 2CT6A 2GT6A 22GSA 3UBKA 2I9HA 1YEPA 1E2YA 3QCPA 4KX4A 3GL3A 1OC9B 3ZLPA 1M7TA 2ALBA 4JR4A 2H0HA 3NOFA 2YV7A 3RHBA 3I6AA 5IMCA 3GFKA 4KCEA 2M72A 2MBSA 2GTUA 2QGVA 4K2XA 1HYUA 2DKIA 5IIZA 3M1GA 1U3AA 2H71A 4XS4B 3GTUA 5GAND 1FO5A 2LTKA 1XCCA 1F9MA 3GRXA 5DCGA 3QOUA 2IMIA 3TGZA 3ZIJA 5GAPD 3EMPA 3F4RA 3VWWA 3KD0A 1YKCA 3WT1A 2WFCA 4KDYA 1WJKA 3MAKA 2DBCA 2MYGA 4MH3A 4USSA 4K7IA 5H5RA 4LMWA 1V57A 2H1BA 4K5SA 1GH2A 4N0VA 1OE8A 4F2IA 4GXZA 3UEMA 3C7MA 3DEXA 1Q4JA 4N10A 4KF9A 1C72A 2CX4A 1JZRA 2AUVA 4HI7A 3KMOA 2A2SA 3L0HA 4BPYA 2DC5A 2L4QA 3KP9A 1TK0B 4G0KA 1PMTA 5IO2A 5A4UA 2ZNMA 3ZTLA 3IA1A 2IWTA 1I9DA 3ED3A 5HQPA 2VLVA 1V40A 2E0QA 2H01A 1O7UA 2O85A 1F2EA 2CQ9A 2H76A 4K0NA 4P3YB 2H0GA 5HFGA 4LL1B 1ZGNA 4EVMA 1YF1A 1U3IA 3RHCA 4IQAA 2XC2A 2IMEA 3FK8A 2JSYA 1FW1A 4XIHA 2H70A 2VL9A 5HR2A 4I2TA 2RLIA 5ECMB 1OAZA 1UA5A 2LNTA 2ZUPA 1CQHA 1X9WB 2LNSA 4O5RA 4GRFA 5ECNB 2GT5A 3KTBA 4L0WA 3LW9A 3GSTA 2N5AA 3E3EA 4L5OA 2FLSA 3EPTA 4MZWA 3GYKA 4MJBA 3LSZA 5EPFA 3UMAA 2OBIA 1TJDA 2HRAA 3ERFA 3TRQA 4ILFA 1EOGA 4TKYA 3G7JA 5JCWA 4OCEA 3G9BA 1NSWA 5G31A 5BMUA 3F3QA 2B5YA 1DUGA 3CTGA 4OFTA 2FY6A 2QSIA 3FZ9A 4KH7A 4BVYA 3MYDA 5ECPB 2MZCA 1BYEA 1K0CA 3C73A 2FA8A 2DIYA 3GSSA 1MEKA 1OVNA 1T3BA 5IPGA 1O8WA 2ON7A 1MDJA 3F4TA 1GLQA 1GNWA 1XFLA 3D6IA 2GSSA 3IHQA 3C71A 1B48A 3ZMLA 4WR5A 3VPTA 2WJUA 3F3RA 4JR6A 2FWGA 2R5GA 3HYPA 1TRWA 1V9WA 2WGRA 4WR4A 4MF5A 5IPHA 2DJKA 1K3LA 1R5AA 3APOA 2VLUA 1A24A 1T4ZA 4YH2A 2HXKA 9GSSA 5A5KA 2B1KA 19GSA 1A0RP 1JFUA 1XWGA 4WKWA 2F9SA 3GURA 11GSA 4ZBBA 2FWFA 2YJ7A 2CZ2A 2B5EA 1V2AA 5BRTA 3CYNA 5CRDA 2H72A 4KA0A 3GKXA 4MMMA 4IJ3A 4K9ZA 3GIXA 1Z5YE 1JZWA 3DMLA 10GSA 1EZKA 1WPIA 4JRRA 2VAFA 1XVWA 3W8JA 3L9VA 2DIZA 3GKMA 2C8UA 4N0ZA 3TRXA 2PVOC 1VGLA 3FR9A 4D73B 1TKDB 1XOAA 4ZL7A 4WETA 1EWXA 3C8EA 2VM2A 2I81A 4MH2A 1MDKA 3IOSA 4NPBA 2JSZA 2HSHA 3HVVA 2IN3A 2M80A 4A5PA 5ECQB 1G7OA 4DSSA 4Q5NA 6GSXA 4EIQA 3NIVA 3A5IA 4MP4A 2BTOT 2H30A 4GSTA 3FR3A 1ZYEA 5GZZB 1LU4A 3KCMA 2FD3A 3IPZA 1RK4A 5GSTA 1TRSA 2DMMA 4YKFA 2VOCA 3GTUB 4TR3A 1GULA 4MCUA 3F4SA 2H66A 2BMXA 1O73A 4POMA 3H1NA 3UBLA 5EVOA 4IP6A 2NBSA 4O32A 13GSA 3VPQA 1SYXA 4MNNA 2DJ3A 5B8BA 2QA2A 4YQVA 4Q5QA 1OC8A 2RM6A 2P31A 4G10A 3KTLA 2WRTA 4V2NA 2PUKC 2H73A 1GUKA 4K5RA 3ME8A 4K7NA 2I4AA 1PGTA 5DQSA 1A2JA 3GX8A 1AQWA 3HZ4A 3A2XA 3UVHA 1JHBA 4XTSA 3J7Yb 3VWXA 1SKRB 5AIVA 2H19A 2KHPA 1W89A 3ERWA 1UC7A 4F0CA 3OR5A 4BWSA 5EY6A 2R0GA 4OWYA 4NAXA 4HQSA 3LQ7A 2FCHA 3F9UA 2FUG2 4ID0A 4X43A 1YEXA 1SJIA 3L78A 1ACVA 1S3CA 3HVSA 3LG6A 3CSIA 4O7HA 5DQYA 2H1AA 4IKHA 1B8XA 2VCQA 1XWCA 5CRHA 3SBCA 5G2ZA 4LL4B 2XHFA 2X8HA 2JADA 4IS0A 4KSOA 5AGYA 3HZ8A 2HFDA 1VF3A 5DALA 1VRSD 5CAXA 3QAWA 2OKAA 1FAAA 1TU8A 5D9TA 4YAPA 4JE1A 5G5FA 3IE3A 4F0BA 4Z2RA 4CW9A 2R0PA 3ERGA 3VURA 1K0DA 5G1LA 4XRDA 3LXZA 6GSVA 2ES7A 3V1WA 7GSSA 2HRFA 1YQ1A 2XPDA 4MLYA 1X5CA 1GRXA 2OA7A 3U5RE 1SL1B 2YV9A 3QFBC 1OC3A 1FVJA 3DVXA 3R3EA 1N2AA 2UZ8A 2Z9SA 3VWVA 3AY8A 3O3TA 2I1UA 3MWHA 3PINA 5F07A 1ON4A 4ML6A 4GLTA 3IBHA 1GTIA 2YJHA 1AQXA 2MMNA 4PTSA 2IJYA 3ZITA 3PGTA 1YDKA 3GL5A 1X9MB 1M0UA 3G7YA 1B9YC 3GKKA 2F8AA 1EGRA 4ZIJA 3Q18A 3IDVA 1B4PA 3EU3A 2MMZA 3GNJA 4BVYB 3WYWA 4K8MA 1XWKA 4O5UA 3VI5A 1GSSA 2F8FA 4TR1A 2GZZA 1GTAA 2CV4A 3EVIA 2OJLA 2AAWA 1ZMAA 4NV2A 1AXDA 4KCAA 5AIXA 2I3YA 4MF7A 4ECJA 1KTEA 5FHIA 3ZFBA 2EIQA 4KSMA 2CVBA 3L9UA 3H8QA 3FMWA 3VK9A 3DIEA 3P8WA 5ECKB 4CHSA 4F82A 4QL7A 2IMFA 3CTFA 3US3A 1GSDA 5B7CA 3TJKA 2QA1A 4IQ1A 1XW5A 4ZXGA 1ZYQB 5G5EA 2KOKA 1YY7A 4HEA2 4EIPA 5KN0A 2K6VA 3NZNA 2CAQA 3GUSA 3BCIA 1NW2A 4Z7XA 2JZTA 2H1GA 4JZQA 1B4QA 1Y6EA 3KM6A 4GQFA 5H5QA 1RW1A 4CDOA 3KP8A 4OO4A 3KH9A 3GMFA 3MNGA 3CRTA 1TDIA 1TK5B 2CVKA 1TK8B 2XPEA 1ML6A 2K9FA 2B1LA 3ZMKA 2VLTA 3F8UA 1FB6A 4MPGA 1YZXA 4ZL8A 5HR3A 4WF5A 5ELGA 2WB9A 2B7KA 5GSSA 1YJ6A 2PMTA 1G7EA 3F63A 4IW9A 4RI6A 2WZ9A 4ULXA 3HJOA 1BX9A 3ZRDA 3ZFLA 4K1FA 4MJCA 4DSSB 2IL3A 4Q5RA 1U88A 2L6DA 1QXHA 1KBNA 3TJGA 2OE0A 2R4VA 1JLVA 1SJ6A 4V2LA 2FWEA 2GVPA 3DGQA 3FZ4A 4GQCA 3D4TA 2E2GA 2RUFA 2HRNA 4ZBDA 2PN8A 3TKSE 1ERVA 4ACSA 4NMUA 4PNFA 4KB3A 1K0NA 3HVXA 2X8CA 3DKSA 2H6XA 4N11A 2PGTA 3VWUA 3UL3A 2LKUA 4TR0A 2GGTA 2HZEA 2PBJA 2WULA 4BVXA 4TW5A 5DAKA 1S3AA 4XHMA 4POKA 1TW9A 4KNDA 3KJYA 3F6DA 3FW2A 3CRUA 4NV5A 3UJ1A 2RIIA 3EWLA 2YANA 2HLSA 1KNGA 1VF2A 2WCIA 1BQ7A 1EV9A 2N5BA 3HHVA 3KEBA 5IOXA 3RPNA 2O8VB 1DBYA 5KOXA 1GUHA 1TOFA 4OFNA 5IMVA 1AAZA 1OYJA 2IMKA 4RQXA 1FG4A 3TCOA 3CMIA 5J41A 3FHKA 6GSTA 3HXSA 1WE0A 2K8VA 3LYPA 5FT3A 4G9HA 1EP8A 1Z7PA 1SK2A 4L0UA 4EF0A 3EC3A 1K0OA 3CSJA 2H1DA 2GZYA 4XS6A 3LGCA 4KW6A 4MABA 2DKHA 4F03A 1QGVA 2YZHA 2X8GA 1SL0B 3J7Yk 2GDRA 5DALB 2EC4A 1R5PA 1SU9A 4PX1A 2J23A 3QMXA 4KDXA 4NHZA 4AJ8A 4GCIA 1DE2A 3FYGA 5ELAA 1M99A 4HOJA 4RI7A 1F3AA 2YPMA 4AGSA 2NDOA 3TB2A 2F3MA 3HKRA 5COHA 4EDZA 3DD3A 5F0GA 1MTCA 3HA9A 2V6OA 5F05A 1N8JA 1SD9A 2C80A 2OACA 4PQ1A 3L4NA 4QQ7A 4MJEA 2L6CA 2FHEA 4ML1A 3TKSC 6GSWA 4X1UA 3VFIA 2WS2A 2DSAA 2YOIA 4FYBA 1T8EB 3PH9A 3RAZA 3KIJA 2A2RA 1IYHA 3K8NA 5IQYA 3D4MA 1R4WA 4DSQA 1GSQA 3WGDA 1XIYA 1K0MA 3E0UA 1XOBA 3DVWA 4X0XA 4ISDA 2DJJA 5CO3A 5CRWA 1H4OA 4OFMA 4CY6A 5J9CA 4LMVA 1X0RA 4TR1B 2C4JA 3LWAA 4ZBAA 4TXOA 2JU5A 1PL2A 1TTZA 3P7XA 2MMAA 2DLXA 3DYRA 2LJRA 3HJPA 1HNAA 4POBA 1XW6A 1ZOFA 3UAPA 2L59A 2L5OA 2TRCP 2C3NA 2H6YA 5E59A 4FQUA 1F3BA 2M46A 2DJ1A 1EEMA 2KLXA 2VM1A 4HZ2A 3IXRA 1Z7RA 4MF6A 4HDEA 4AJ7A 3QR6A 3BBYA 4I8BA 1FOVA 3LEFA 2R6KA 1CQGA 1GLPA 2C1YA 3TKRA 4HJMA 1M2BA 2O89A 4J2FA 4K0GA 3O76A 2VD1A 5ECLB 1QMVA 1G6YA 3N5OA 2P0GA 3ZVJA 2G2QA 1X5DA 4L8EA 4RQRA 2E2MA 4GTUA 5INYA 1K0AA 5F8BA 1SD8A 5A4WA 3HY2A 4ZB6A 3EYTA 3RBTA 1AIUA 2OADA 1NM3A 2VO4A 4EUYA 1A8YA 5DJMA 5ECIB 3HDCA 3FR6A 2LUSA 3BJ5A 5G30A 1IYIA 3F0IA 4EO3A 4YQMA 3GH6A 3CSHA 2K18A 2C0GA 4OCFA 3G7IA 2B5XA 2VCVA 4TRXA 3H93A 2AHEA 3PPUA 2RUEA 1OE7A 4G2EA 4FO5A 1BEDA 1FHEA 4TOPA 4EDYA 2R2JA 3IAS2 1T00A 3EURA 2PU9C 2LJAA 5KN2A 3F6FA 5DVBA 2C3QA 1O81A 2D2ZA 2FA4A 3W6GA 2P5RA 1A23A 1AUCA 1URMA 1B9XC 3D0ZA 1A0FA 4X4JA 5LCZA 3GX0A 3TDGA 5KN1A 1USBA 2AV4A 3R2QA 1WWJA 1WIKA 1SL2B 1Z9HA 1T4YA 1PQNA 4JU5A 2HZEB 4V1Ap 2YNXA 4BVXB 2YWNA 5DAKB 2LRCA 1ZYNA 3D5JA 4E8HA 2WDUA 5D9VA 5KOWA 1K0BA 1PA3A 3TRPA 6GSYA 2HYXA 1JZDA 3Q74A 2G0FA 2FWHA 5ECOB 1V98A 4ECBA 3S9FA 1WOUA 4WXTA 5EL8A 2LEGA 5IMAA 4MJAA 1ST9A 3WD6A 2CA8A 1SK1A 4V2MA 4HQZA 1MD3A 3UOMA 3WGEA 4QL9A 4I6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK7 A;  1ERT A;  1A2L A;  3U6V A;  2VL2 C;  5AN1 A;  3UIW A;  4EL1 A;  1ILO A;  1XZO A;  3P2A A;  2ON5 A;  3FY7 A;  3RPP A;  3ZRE A;  3TJF A;  5H5S A;  3ISO A;  3QPM A;  4LLR A;  1XBS A;  1XWB A;  4NXI A;  1XVQ A;  2LQQ A;  1T1V A;  3IK9 A;  2YZU A;  4OMV A;  1AW9 A;  1G6W A;  1PD2 1;  2FNO A;  1WMJ A;  3LJR A;  1SKW B;  4BL7 A;  2IIY A;  4HU7 A;  5DJL A;  2VCT A;  4JBB A;  2B6M A;  1ZCP A;  2GS3 A;  5D9X A;  4IJI A;  2GSR A;  2C0E A;  1V58 A;  4HS1 A;  1PN9 A;  3DRN A;  3ME7 A;  5D93 A;  5G1K A;  1ZZY A;  4EXJ A;  3FEU A;  3MDK A;  1SYR A;  5IM9 A;  1VF1 A;  3A2W A;  4HUA A;  3W8S A;  5D8I A;  2L4C A;  1Z3E A;  2L5L A;  1QK8 A;  1UVZ A;  1K3O A;  5J9B A;  3C1S A;  1TRV A;  4YQU A;  1PRX A;  1GSE A;  3WT2 A;  1M9B A;  5JCG A;  5E4W A;  4K7O A;  4IGJ A;  2DML A;  4MDC A;  3KMN A;  2GZP A;  1GSU A;  5HFI A;  3ZYW A;  2F51 A;  1THO A;  3BOA A;  5JWR B;  5DDL A;  1J0F A;  2HNL A;  1GUM A;  4GSN A;  5B6N A;  4TXO B;  2GSQ A;  3PR8 A;  5JWO B;  3TKQ A;  1BAY A;  5ID2 A;  4E8E A;  2EIO A;  3CBU A;  1F6M C;  1PKZ A;  2GST A;  4HZ4 A;  1O85 A;  5IO0 A;  3GH9 A;  2CX3 A;  4WEY A;  1LJR A;  2PVQ A;  5KEJ A;  2AJQ B;  5IMD A;  5J3R A;  1WP0 A;  1GTU A;  3FZ5 A;  1OKD A;  1X9S B;  2IFQ A;  2CZ3 A;  1O8X A;  2H0I A;  1I5G A;  2V2G A;  3I43 A;  3ZL5 A;  2IMD A;  1J08 A;  2GQL A;  3TKS A;  1SJZ A;  1XWA A;  5HR1 A;  5CRG A;  3JCM L;  3BCK A;  1XW9 A;  2O87 A;  5IOW A;  4LA1 A;  5CYY A;  4J56 E;  4NWY A;  5ENU A;  5A4V A;  1EEJ A;  2LS5 A;  3FZA A;  3A2V A;  1A8L A;  2YP6 A;  4IEL A;  3UVT A;  1K3Y A;  2J9H A;  1VF4 A;  2MMO A;  4ECI A;  5J4U A;  1QQ2 A;  4WBR D;  14GS A;  2LV3 A;  1H75 A;  3DXB A;  1PL1 A;  3SWL A;  2AB6 A;  3IAM 2;  1EV4 A;  4MZB A;  4IP1 A;  3HCZ A;  1ERW A;  1YF0 A;  4KUN A;  1RQM A;  3EIN A;  2PER A;  2VIM A;  3H79 A;  4PUF C;  2NPB A;  1THX A;  4IBP A;  1DSB A;  4FIW A;  1GTB A;  1GWC A;  2LQO A;  1EGO A;  3ZVJ D;  3L9S A;  3D21 A;  1JZO A;  2AYT A;  3QFA C;  1U6T A;  2CVD A;  4KGI A;  1SKS B;  4IHU A;  3Q19 A;  5LD0 A;  4ZL9 A;  2TRX A;  1YKA A;  2B7J A;  1TRU A;  2H74 A;  4G19 A;  5C04 A;  3TJB A;  3EMX A;  4BWQ A;  4MA9 A;  3KGK A;  3KXO A;  2HI7 A;  4FYC A;  2XBQ A;  3VLN A;  2JL4 A;  3MSZ A;  2JAC A;  1EP7 A;  4L5L A;  1SK0 A;  2XBI A;  3IC4 A;  5CRE A;  1XXU A;  2YN1 A;  2OE3 A;  2QKE A;  2C0D A;  3Q6O A;  3TOU A;  4PUA A;  3A3T A;  2EIR A;  5JCU A;  3APQ A;  3H4K A;  1OC9 A;  1XPV A;  4POL A;  3GV1 A;  2VL3 A;  2R3X A;  4H86 A;  2X99 A;  4WF4 A;  3M8N A;  2V6K A;  4F9Z A;  8GSS A;  1PKW A;  4DVC A;  2H75 A;  1FVK A;  1AQV A;  2L57 A;  3ZIV A;  4I5Q A;  1PX7 A;  2CAI A;  2PWJ A;  4XS4 A;  5IMZ A;  3EE2 A;  5HFK A;  3EU4 A;  1TP9 A;  4KAE A;  4KE3 A;  1R7H A;  4JED A;  2NTO A;  3IRA A;  3RDW A;  1FB0 A;  5L71 A;  1M2A A;  4KDU A;  3TUE A;  4EKZ A;  3D22 A;  1GSF A;  1PX6 A;  2YWO A;  4OO5 A;  2R37 A;  4AF2 A;  1UN2 A;  1TI3 A;  1R26 A;  4DSR A;  2LRN A;  3TKP A;  3M9J A;  1ERU A;  1Z6M A;  2C3T A;  2NVL A;  1TU7 A;  4EE0 A;  1GNE A;  2C0F A;  1DE1 A;  1JLW A;  1WRY A;  1GL8 A;  1EOH A;  4Q5F A;  2GLR A;  4XS1 A;  4N30 A;  1X5E A;  2DJ2 A;  5HR0 A;  5FWG A;  3QAG A;  3KZQ A;  2E7P A;  4YAV A;  4ZIL A;  4O92 A;  3GN3 A;  1PSQ A;  20GS A;  3IV4 A;  3M3M A;  1NHY A;  2K8S A;  3BD2 A;  2VL2 A;  3APS A;  3LOR A;  3UAR A;  4FYU A;  4V1A g;  2REM A;  2VUP A;  5D9W A;  3DWV A;  16GS A;  2GQM A;  3HD5 A;  3I9V 2;  2ZCT A;  2JZS A;  4XCS A;  2V1M A;  5KN3 A;  2MBT A;  2RM5 A;  5C00 A;  5ABR A;  3CXG A;  4ZB8 A;  4MPF A;  3N9J A;  1O6J A;  4HU9 A;  2YWI A;  4I97 A;  1W4V A;  2V32 A;  3ZZX A;  4TXV A;  3TOT A;  5DBQ A;  5ID2 B;  2HZF A;  5D96 A;  2VCZ A;  5JWQ B;  5ECH B;  1GP1 A;  3A5W A;  1ABA A;  4MK3 A;  2BJX A;  4TN8 A;  4RUV A;  4GF0 A;  1U87 A;  2LJK A;  3VI7 A;  4I2U A;  2VCX A;  4PQH A;  2HSY A;  2IFQ B;  5J5N A;  5AIS A;  1NHO A;  4WBJ A;  1E6B A;  4TR4 A;  3TJJ A;  2B3S A;  4GSS A;  2QC7 A;  3M9K A;  2VCW A;  3IR4 A;  1LBK A;  4DEJ A;  1BG5 A;  5B8A A;  6GSU A;  2P5Q A;  4XRA A;  3LYK A;  3LXT A;  4PUR A;  1KEB A;  4IVF A;  1A2M A;  2A4V A;  1TXX A;  1AC1 A;  4K2D A;  1BJX A;  3QD9 A;  1T7P B;  2DJ0 A;  2PPT A;  1QUW A;  1HNC A;  3FKF A;  3GKN A;  3C1R A;  4J57 E;  4EC0 A;  1MDI A;  4ZB9 A;  2X64 A;  1Q98 A;  4TVE A;  1MD4 A;  2YWM A;  3FRC A;  2LST A;  5ECS A;  5B6M A;  1F37 A;  4MZC A;  4AJ6 A;  2H8L A;  4HJ2 A;  4OD7 A;  2HT9 A;  18GS A;  2OE1 A;  1HD2 A;  4FH8 A;  2GQK A;  2JZR A;  4PGT A;  3M0F A;  3I69 A;  3KH7 A;  4NHW A;  1OKT A;  3QAV A;  2KP2 A;  1ZL9 A;  2LRT A;  2KP1 A;  1QFN A;  3P90 A;  1Z6N A;  1G0T A;  3GA4 A;  2N5F A;  2IPA A;  5ECR B;  5IMF A;  2OBK A;  2TIR A;  1SEN A;  5CP1 A;  2KUC A;  4PXO A;  3WGX A;  4BA7 A;  4PQI A;  1S3D A;  1HNB A;  5F06 A;  2O7K A;  2V41 A;  1M9A A;  4K6X A;  3QDN A;  5CNW A;  5LNK e;  12GS A;  2HE3 A;  1J9B A;  1M2D A;  3GHA A;  4IN0 A;  2H6Z A;  2YCD A;  1TI1 A;  1HQO A;  5DCH A;  4D73 A;  6GSS A;  5D73 A;  3LFL A;  17GS A;  4PNG A;  2VD0 A;  3O6T A;  4GWR A;  1GSY A;  3E9J B;  4ECC A;  1Y25 A;  3HJM A;  2FGX A;  2CT6 A;  2GT6 A;  22GS A;  3UBK A;  2I9H A;  1YEP A;  1E2Y A;  3QCP A;  4KX4 A;  3GL3 A;  1OC9 B;  3ZLP A;  1M7T A;  2ALB A;  4JR4 A;  2H0H A;  3NOF A;  2YV7 A;  3RHB A;  3I6A A;  5IMC A;  3GFK A;  4KCE A;  2M72 A;  2MBS A;  2GTU A;  2QGV A;  1HYU A;  5IIZ A;  3M1G A;  1U3A A;  2H71 A;  4XS4 B;  3GTU A;  5GAN D;  1FO5 A;  2LTK A;  1XCC A;  1F9M A;  3GRX A;  5DCG A;  3QOU A;  2IMI A;  3TGZ A;  3ZIJ A;  5GAP D;  3EMP A;  3F4R A;  3VWW A;  3KD0 A;  1YKC A;  3WT1 A;  2WFC A;  4KDY A;  1WJK A;  3MAK A;  2DBC A;  2MYG A;  4MH3 A;  4K7I A;  5H5R A;  4LMW A;  1V57 A;  2H1B A;  1GH2 A;  4N0V A;  1OE8 A;  4F2I A;  4GXZ A;  3UEM A;  3C7M A;  3DEX A;  1Q4J A;  4N10 A;  1C72 A;  2CX4 A;  1JZR A;  2AUV A;  4HI7 A;  3KMO A;  2A2S A;  3L0H A;  4BPY A;  2DC5 A;  2L4Q A;  3KP9 A;  1TK0 B;  1PMT A;  5IO2 A;  5A4U A;  2ZNM A;  3ZTL A;  3IA1 A;  2IWT A;  1I9D A;  3ED3 A;  5HQP A;  2VLV A;  1V40 A;  2E0Q A;  2H01 A;  1O7U A;  2O85 A;  1F2E A;  2CQ9 A;  2H76 A;  4K0N A;  4P3Y B;  2H0G A;  5HFG A;  4LL1 B;  1ZGN A;  4EVM A;  1YF1 A;  1U3I A;  3RHC A;  4IQA A;  2XC2 A;  2IME A;  3FK8 A;  2JSY A;  1FW1 A;  4XIH A;  2H70 A;  2VL9 A;  5HR2 A;  4I2T A;  2RLI A;  5ECM B;  1OAZ A;  1UA5 A;  2LNT A;  2ZUP A;  1CQH A;  1X9W B;  2LNS A;  4O5R A;  4GRF A;  5ECN B;  2GT5 A;  3KTB A;  4L0W A;  3GST A;  2N5A A;  3E3E A;  4L5O A;  2FLS A;  4MZW A;  3GYK A;  4MJB A;  3LSZ A;  5EPF A;  3UMA A;  2OBI A;  1TJD A;  3ERF A;  3TRQ A;  4ILF A;  1EOG A;  4TKY A;  3G7J A;  5JCW A;  4OCE A;  3G9B A;  1NSW A;  5G31 A;  3F3Q A;  2B5Y A;  1DUG A;  3CTG A;  4OFT A;  2FY6 A;  2QSI A;  3FZ9 A;  4KH7 A;  4BVY A;  5ECP B;  2MZC A;  1BYE A;  1K0C A;  3C73 A;  2FA8 A;  2DIY A;  3GSS A;  1MEK A;  1OVN A;  1T3B A;  5IPG A;  1O8W A;  2ON7 A;  1MDJ A;  3F4T A;  1GLQ A;  1GNW A;  1XFL A;  3D6I A;  2GSS A;  3IHQ A;  3C71 A;  1B48 A;  3ZML A;  4WR5 A;  3VPT A;  2WJU A;  3F3R A;  4JR6 A;  2FWG A;  2R5G A;  3HYP A;  1TRW A;  1V9W A;  2WGR A;  4WR4 A;  4MF5 A;  5IPH A;  2DJK A;  1K3L A;  1R5A A;  3APO A;  2VLU A;  1A24 A;  1T4Z A;  4YH2 A;  2HXK A;  9GSS A;  5A5K A;  2B1K A;  19GS A;  1A0R P;  1JFU A;  1XWG A;  4WKW A;  2F9S A;  3GUR A;  11GS A;  4ZBB A;  2FWF A;  2YJ7 A;  2CZ2 A;  2B5E A;  1V2A A;  3CYN A;  5CRD A;  2H72 A;  4KA0 A;  3GKX A;  4MMM A;  4IJ3 A;  4K9Z A;  3GIX A;  1Z5Y E;  1JZW A;  3DML A;  10GS A;  1EZK A;  1WPI A;  4JRR A;  2VAF A;  1XVW A;  3W8J A;  3L9V A;  2DIZ A;  3GKM A;  2C8U A;  4N0Z A;  3TRX A;  2PVO C;  1VGL A;  3FR9 A;  4D73 B;  1TKD B;  1XOA A;  4ZL7 A;  4WET A;  1EWX A;  3C8E A;  2VM2 A;  2I81 A;  4MH2 A;  1MDK A;  3IOS A;  4NPB A;  2JSZ A;  2HSH A;  3HVV A;  2IN3 A;  2M80 A;  1G7O A;  5ECQ B;  4DSS A;  4Q5N A;  6GSX A;  3NIV A;  4MP4 A;  2BTO T;  2H30 A;  4GST A;  3FR3 A;  1ZYE A;  5GZZ B;  1LU4 A;  3KCM A;  2FD3 A;  3IPZ A;  1RK4 A;  5GST A;  1TRS A;  2DMM A;  2VOC A;  3GTU B;  4TR3 A;  1GUL A;  4MCU A;  3F4S A;  2H66 A;  2BMX A;  1O73 A;  4POM A;  3H1N A;  3UBL A;  5EVO A;  4IP6 A;  2NBS A;  4O32 A;  13GS A;  3VPQ A;  1SYX A;  2DJ3 A;  5B8B A;  4YQV A;  4Q5Q A;  1OC8 A;  2RM6 A;  2P31 A;  4G10 A;  3KTL A;  2WRT A;  4V2N A;  2PUK C;  2H73 A;  1GUK A;  3ME8 A;  4K7N A;  2I4A A;  1PGT A;  5DQS A;  1A2J A;  3GX8 A;  1AQW A;  3HZ4 A;  3A2X A;  3UVH A;  1JHB A;  4XTS A;  3J7Y b;  3VWX A;  1SKR B;  5AIV A;  2H19 A;  2KHP A;  1W89 A;  3ERW A;  1UC7 A;  4F0C A;  3OR5 A;  4BWS A;  5EY6 A;  4OWY A;  4NAX A;  4HQS A;  3LQ7 A;  2FCH A;  3F9U A;  2FUG 2;  4ID0 A;  4X43 A;  1YEX A;  1SJI A;  3L78 A;  1ACV A;  1S3C A;  3HVS A;  3LG6 A;  3CSI A;  4O7H A;  5DQY A;  2H1A A;  4IKH A;  1B8X A;  2VCQ A;  1XWC A;  5CRH A;  3SBC A;  5G2Z A;  4LL4 B;  2XHF A;  2X8H A;  2JAD A;  4IS0 A;  4KSO A;  5AGY A;  3HZ8 A;  2HFD A;  1VF3 A;  5DAL A;  1VRS D;  5CAX A;  3QAW A;  2OKA A;  1FAA A;  1TU8 A;  5D9T A;  4YAP A;  4JE1 A;  5G5F A;  3IE3 A;  4F0B A;  4CW9 A;  3ERG A;  3VUR A;  1K0D A;  5G1L A;  4XRD A;  3LXZ A;  6GSV A;  2ES7 A;  3V1W A;  7GSS A;  2HRF A;  1YQ1 A;  2XPD A;  4MLY A;  1X5C A;  1GRX A;  2OA7 A;  3U5R E;  1SL1 B;  2YV9 A;  3QFB C;  1OC3 A;  1FVJ A;  3DVX A;  1N2A A;  2Z9S A;  3VWV A;  3AY8 A;  3O3T A;  2I1U A;  3MWH A;  3PIN A;  5F07 A;  1ON4 A;  4ML6 A;  4GLT A;  3IBH A;  1GTI A;  2YJH A;  1AQX A;  2MMN A;  2IJY A;  3ZIT A;  3PGT A;  1YDK A;  3GL5 A;  1X9M B;  1M0U A;  3G7Y A;  1B9Y C;  3GKK A;  2F8A A;  1EGR A;  4ZIJ A;  3Q18 A;  3IDV A;  1B4P A;  3EU3 A;  2MMZ A;  3GNJ A;  3WYW A;  4K8M A;  1XWK A;  3VI5 A;  1GSS A;  2F8F A;  4TR1 A;  2GZZ A;  1GTA A;  2CV4 A;  3EVI A;  2OJL A;  2AAW A;  1ZMA A;  4NV2 A;  1AXD A;  4KCA A;  5AIX A;  2I3Y A;  4MF7 A;  4ECJ A;  1KTE A;  5FHI A;  3ZFB A;  2EIQ A;  4KSM A;  2CVB A;  3L9U A;  3H8Q A;  3VK9 A;  3DIE A;  3P8W A;  5ECK B;  4CHS A;  4F82 A;  4QL7 A;  2IMF A;  3CTF A;  3US3 A;  1GSD A;  5B7C A;  3TJK A;  4IQ1 A;  1XW5 A;  4ZXG A;  1ZYQ B;  5G5E A;  2KOK A;  1YY7 A;  4HEA 2;  5KN0 A;  2K6V A;  3NZN A;  2CAQ A;  3GUS A;  3BCI A;  1NW2 A;  4Z7X A;  2JZT A;  2H1G A;  4JZQ A;  1B4Q A;  1Y6E A;  3KM6 A;  4GQF A;  5H5Q A;  1RW1 A;  4CDO A;  3KP8 A;  4OO4 A;  3KH9 A;  3GMF A;  3MNG A;  3CRT A;  1TDI A;  1TK5 B;  2CVK A;  1TK8 B;  2XPE A;  1ML6 A;  2K9F A;  2B1L A;  3ZMK A;  2VLT A;  3F8U A;  1FB6 A;  4MPG A;  1YZX A;  4ZL8 A;  5HR3 A;  4WF5 A;  5ELG A;  2WB9 A;  2B7K A;  5GSS A;  1YJ6 A;  2PMT A;  1G7E A;  3F63 A;  4IW9 A;  4RI6 A;  2WZ9 A;  4ULX A;  3HJO A;  1BX9 A;  3ZRD A;  3ZFL A;  4K1F A;  4MJC A;  4DSS B;  2IL3 A;  4Q5R A;  1U88 A;  2L6D A;  1QXH A;  1KBN A;  3TJG A;  2OE0 A;  2R4V A;  1JLV A;  1SJ6 A;  4V2L A;  2FWE A;  2GVP A;  3DGQ A;  3FZ4 A;  4GQC A;  3D4T A;  2E2G A;  2RUF A;  2HRN A;  4ZBD A;  2PN8 A;  3TKS E;  1ERV A;  4ACS A;  4NMU A;  4PNF A;  4KB3 A;  1K0N A;  3HVX A;  2X8C A;  3DKS A;  2H6X A;  4N11 A;  2PGT A;  3VWU A;  3UL3 A;  2LKU A;  4TR0 A;  2GGT A;  2HZE A;  2PBJ A;  2WUL A;  4BVX A;  4TW5 A;  5DAK A;  1S3A A;  4XHM A;  4POK A;  1TW9 A;  4KND A;  3KJY A;  3F6D A;  3FW2 A;  3CRU A;  4NV5 A;  3UJ1 A;  2RII A;  3EWL A;  2YAN A;  2HLS A;  1KNG A;  1VF2 A;  2WCI A;  1BQ7 A;  1EV9 A;  2N5B A;  3HHV A;  3KEB A;  5IOX A;  3RPN A;  2O8V B;  1DBY A;  1GUH A;  1TOF A;  4OFN A;  5IMV A;  1AAZ A;  1OYJ A;  2IMK A;  4RQX A;  1FG4 A;  3TCO A;  3CMI A;  5J41 A;  3FHK A;  6GST A;  3HXS A;  1WE0 A;  2K8V A;  3LYP A;  5FT3 A;  4G9H A;  1EP8 A;  1Z7P A;  1SK2 A;  4L0U A;  4EF0 A;  3EC3 A;  1K0O A;  3CSJ A;  2H1D A;  2GZY A;  4XS6 A;  3LGC A;  4KW6 A;  4MAB A;  4F03 A;  1QGV A;  2YZH A;  2X8G A;  1SL0 B;  3J7Y k;  2GDR A;  5DAL B;  2EC4 A;  1R5P A;  1SU9 A;  4PX1 A;  2J23 A;  3QMX A;  4KDX A;  4NHZ A;  4AJ8 A;  4GCI A;  1DE2 A;  3FYG A;  5ELA A;  1M99 A;  4HOJ A;  4RI7 A;  1F3A A;  2YPM A;  4AGS A;  2NDO A;  3TB2 A;  2F3M A;  3HKR A;  5COH A;  4EDZ A;  3DD3 A;  5F0G A;  1MTC A;  3HA9 A;  2V6O A;  5F05 A;  1N8J A;  1SD9 A;  2C80 A;  2OAC A;  4PQ1 A;  3L4N A;  4QQ7 A;  4MJE A;  2L6C A;  2FHE A;  4ML1 A;  3TKS C;  6GSW A;  4X1U A;  3VFI A;  2WS2 A;  2DSA A;  2YOI A;  4FYB A;  1T8E B;  3PH9 A;  3RAZ A;  3KIJ A;  2A2R A;  1IYH A;  3K8N A;  5IQY A;  3D4M A;  1R4W A;  4DSQ A;  1GSQ A;  3WGD A;  1XIY A;  1K0M A;  3E0U A;  1XOB A;  3DVW A;  4X0X A;  4ISD A;  2DJJ A;  5CO3 A;  5CRW A;  1H4O A;  4OFM A;  5J9C A;  4LMV A;  1X0R A;  4TR1 B;  2C4J A;  3LWA A;  4ZBA A;  4TXO A;  2JU5 A;  1PL2 A;  1TTZ A;  3P7X A;  2MMA A;  2DLX A;  3DYR A;  2LJR A;  3HJP A;  1HNA A;  4POB A;  1XW6 A;  1ZOF A;  3UAP A;  2L59 A;  2L5O A;  2TRC P;  2C3N A;  5E59 A;  2H6Y A;  1F3B A;  2M46 A;  2DJ1 A;  1EEM A;  2KLX A;  2VM1 A;  4HZ2 A;  3IXR A;  1Z7R A;  4MF6 A;  4HDE A;  4AJ7 A;  3QR6 A;  3BBY A;  4I8B A;  1FOV A;  3LEF A;  2R6K A;  1CQG A;  1GLP A;  2C1Y A;  3TKR A;  4HJM A;  1M2B A;  2O89 A;  4J2F A;  4K0G A;  3O76 A;  2VD1 A;  5ECL B;  1QMV A;  1G6Y A;  3N5O A;  2P0G A;  3ZVJ A;  2G2Q A;  1X5D A;  4L8E A;  4RQR A;  2E2M A;  4GTU A;  5INY A;  1K0A A;  5F8B A;  1SD8 A;  5A4W A;  3HY2 A;  4ZB6 A;  3EYT A;  3RBT A;  1AIU A;  2OAD A;  1NM3 A;  2VO4 A;  4EUY A;  1A8Y A;  5DJM A;  5ECI B;  3HDC A;  3FR6 A;  2LUS A;  3BJ5 A;  5G30 A;  1IYI A;  3F0I A;  4EO3 A;  4YQM A;  3GH6 A;  3CSH A;  2K18 A;  2C0G A;  4OCF A;  3G7I A;  2B5X A;  2VCV A;  4TRX A;  3H93 A;  2AHE A;  2RUE A;  1OE7 A;  4G2E A;  4FO5 A;  1BED A;  1FHE A;  4TOP A;  4EDY A;  2R2J A;  3IAS 2;  1T00 A;  3EUR A;  2PU9 C;  2LJA A;  5KN2 A;  3F6F A;  5DVB A;  2C3Q A;  1O81 A;  2D2Z A;  2FA4 A;  3W6G A;  2P5R A;  1A23 A;  1AUC A;  1URM A;  1B9X C;  3D0Z A;  1A0F A;  5LCZ A;  3GX0 A;  3TDG A;  5KN1 A;  1USB A;  2AV4 A;  3R2Q A;  1WWJ A;  1WIK A;  1SL2 B;  1Z9H A;  1T4Y A;  1PQN A;  4JU5 A;  2HZE B;  4V1A p;  2YNX A;  2YWN A;  5DAK B;  2LRC A;  3D5J A;  4E8H A;  2WDU A;  5D9V A;  1K0B A;  1PA3 A;  3TRP A;  6GSY A;  2HYX A;  1JZD A;  3Q74 A;  2G0F A;  2FWH A;  5ECO B;  1V98 A;  4ECB A;  3S9F A;  1WOU A;  4WXT A;  5EL8 A;  2LEG A;  5IMA A;  4MJA A;  1ST9 A;  3WD6 A;  2CA8 A;  1SK1 A;  4V2M A;  4HQZ A;  1MD3 A;  3UOM A;  3WGE A;  4QL9 A;  4I6X A; 
#chains in the Genus database with same CATH topology
 3IK7 A;  1ERT A;  1A2L A;  3U6V A;  2VL2 C;  5AN1 A;  1ZYP A;  3UIW A;  4EL1 A;  1ILO A;  1XZO A;  3P2A A;  2ON5 A;  3FY7 A;  3RPP A;  3ZRE A;  3TJF A;  5H5S A;  3ISO A;  3QPM A;  4LLR A;  1XBS A;  1XWB A;  4NXI A;  1XVQ A;  2LQQ A;  1T1V A;  3IK9 A;  2YZU A;  4OMV A;  1AW9 A;  1G6W A;  1PN0 A;  1PD2 1;  2A4H A;  2FNO A;  1WMJ A;  3LJR A;  1SKW B;  4BL7 A;  2IIY A;  4HU7 A;  5DJL A;  2VCT A;  4JBB A;  2B6M A;  1ZCP A;  2GS3 A;  5D9X A;  4IJI A;  2GSR A;  2C0E A;  1V58 A;  4HS1 A;  1PN9 A;  3DRN A;  3ME7 A;  5D93 A;  5G1K A;  1ZZY A;  4EXJ A;  3FEU A;  3MDK A;  1SYR A;  5IM9 A;  1VF1 A;  3A2W A;  4HUA A;  4YKG A;  3W8S A;  5D8I A;  2L4C A;  1Z3E A;  2L5L A;  1QK8 A;  1UVZ A;  1K3O A;  5J9B A;  3C1S A;  1TRV A;  4YQU A;  1PRX A;  1GSE A;  3WT2 A;  1M9B A;  5JCG A;  5E4W A;  4K7O A;  4IGJ A;  2DML A;  4MDC A;  3KMN A;  2GZP A;  1GSU A;  5HFI A;  3ZYW A;  4Z2T A;  2F51 A;  1THO A;  3BOA A;  5JWR B;  5DDL A;  1J0F A;  2HNL A;  2HSM A;  1GUM A;  4GSN A;  5B6N A;  4TXO B;  2GSQ A;  3PR8 A;  5JWO B;  3TKQ A;  1BAY A;  5ID2 A;  4E8E A;  2EIO A;  3CBU A;  1F6M C;  1PKZ A;  2GST A;  4HZ4 A;  1O85 A;  5IO0 A;  3GH9 A;  2CX3 A;  4WEY A;  1LJR A;  2PVQ A;  5KEJ A;  2AJQ B;  5IMD A;  5J3R A;  1WP0 A;  3MIX A;  1GTU A;  3FZ5 A;  1OKD A;  1X9S B;  2IFQ A;  2CZ3 A;  1O8X A;  2H0I A;  1I5G A;  2V2G A;  3I43 A;  3ZL5 A;  2IMD A;  1J08 A;  2GQL A;  3TKS A;  1SJZ A;  1XWA A;  5HR1 A;  5CRG A;  3JCM L;  3BCK A;  1XW9 A;  2O87 A;  5IOW A;  4LA1 A;  5CYY A;  4J56 E;  4NWY A;  5ENU A;  5A4V A;  1EEJ A;  2LS5 A;  3FZA A;  3A2V A;  1A8L A;  2YP6 A;  4IEL A;  3UVT A;  1K3Y A;  3IHG A;  2J9H A;  1VF4 A;  2MMO A;  4ECI A;  5J4U A;  1QQ2 A;  4WBR D;  14GS A;  2LV3 A;  1H75 A;  3DXB A;  1PL1 A;  3SWL A;  2AB6 A;  2R0C A;  3IAM 2;  1EV4 A;  4MZB A;  4IP1 A;  3HCZ A;  1ERW A;  1YF0 A;  4KUN A;  1RQM A;  3EIN A;  2PER A;  2VIM A;  3H79 A;  4PUF C;  2NPB A;  1THX A;  4IBP A;  1DSB A;  4CY8 A;  4FIW A;  1GTB A;  1GWC A;  2LQO A;  1EGO A;  3ZVJ D;  3L9S A;  3D21 A;  1JZO A;  2AYT A;  3QFA C;  1U6T A;  2CVD A;  1M3I A;  4KGI A;  1SKS B;  4IHU A;  3Q19 A;  5LD0 A;  4ZL9 A;  2TRX A;  1YKA A;  2B7J A;  1TRU A;  2H74 A;  4G19 A;  5C04 A;  4G0L A;  3TJB A;  3EMX A;  4BWQ A;  4MA9 A;  3KGK A;  3KXO A;  2HI7 A;  4FYC A;  2XBQ A;  3VLN A;  2JL4 A;  3MSZ A;  2JAC A;  1EP7 A;  4L5L A;  1SK0 A;  2XBI A;  3IC4 A;  5CRE A;  1XXU A;  2YN1 A;  2OE3 A;  2QKE A;  2C0D A;  3Q6O A;  3TOU A;  4PUA A;  3A3T A;  2EIR A;  5JCU A;  3APQ A;  4ICY A;  3H4K A;  1OC9 A;  1XPV A;  4POL A;  3GV1 A;  2VL3 A;  2R3X A;  4H86 A;  2X99 A;  4WF4 A;  3M8N A;  2V6K A;  4F9Z A;  8GSS A;  1PKW A;  4DVC A;  2H75 A;  1FVK A;  1AQV A;  2L57 A;  3ZIV A;  4I5Q A;  1PX7 A;  2CAI A;  2PWJ A;  4XS4 A;  5IMZ A;  3EE2 A;  5HFK A;  3EU4 A;  1TP9 A;  4KAE A;  4KE3 A;  1R7H A;  4JED A;  2NTO A;  3IRA A;  3RDW A;  1FB0 A;  5L71 A;  1M2A A;  4KDU A;  3CQF A;  3TUE A;  4EKZ A;  3D22 A;  1GSF A;  1PX6 A;  2YWO A;  4OO5 A;  2R37 A;  4AF2 A;  1UN2 A;  1TI3 A;  1R26 A;  4DSR A;  2LRN A;  3TKP A;  4BL7 B;  3M9J A;  1ERU A;  1Z6M A;  2C3T A;  2NVL A;  1TU7 A;  4EE0 A;  1GNE A;  2C0F A;  1DE1 A;  1JLW A;  1WRY A;  1GL8 A;  1EOH A;  4Z2U A;  4Q5F A;  2GLR A;  4XS1 A;  4N30 A;  1X5E A;  2DJ2 A;  5HR0 A;  5FWG A;  3QAG A;  3KZQ A;  2E7P A;  4YAV A;  4ZIL A;  4O92 A;  3GN3 A;  1PSQ A;  20GS A;  3IV4 A;  3M3M A;  1NHY A;  2K8S A;  3BD2 A;  2VL2 A;  3APS A;  3LOR A;  3UAR A;  4FYU A;  4V1A g;  2REM A;  2VUP A;  5D9W A;  3DWV A;  16GS A;  2GQM A;  3HD5 A;  3I9V 2;  2ZCT A;  2JZS A;  4XCS A;  2V1M A;  5KN3 A;  2MBT A;  2RM5 A;  5C00 A;  5ABR A;  3CXG A;  4ZB8 A;  4MPF A;  3N9J A;  4G0I A;  1O6J A;  4HU9 A;  2YWI A;  4I97 A;  1W4V A;  2V32 A;  3ZZX A;  4TXV A;  3IC8 A;  3TOT A;  5DBQ A;  5ID2 B;  2HZF A;  5D96 A;  2VCZ A;  5JWQ B;  2X4A A;  5ECH B;  1GP1 A;  3A5W A;  1ABA A;  4MK3 A;  2BJX A;  4TN8 A;  4RUV A;  4GF0 A;  1FOH A;  1U87 A;  2LJK A;  3VI7 A;  4I2U A;  2VCX A;  4PQH A;  2HSY A;  2IFQ B;  5J5N A;  2X49 A;  5AIS A;  1NHO A;  4WBJ A;  1E6B A;  4TR4 A;  3TJJ A;  2B3S A;  4GSS A;  2QC7 A;  3M9K A;  2VCW A;  3IR4 A;  1LBK A;  4DEJ A;  1BG5 A;  5B8A A;  6GSU A;  2P5Q A;  4XRA A;  3LYK A;  3LXT A;  4PUR A;  1KEB A;  4IVF A;  1A2M A;  2A4V A;  1TXX A;  1AC1 A;  4K2D A;  1BJX A;  3QD9 A;  1T7P B;  2DJ0 A;  2PPT A;  1QUW A;  1HNC A;  3FKF A;  3GKN A;  3C1R A;  4J57 E;  4EC0 A;  1MDI A;  4ZB9 A;  2X64 A;  1Q98 A;  4TVE A;  1MD4 A;  2YWM A;  3FRC A;  2LST A;  5ECS A;  5B6M A;  1F37 A;  4MZC A;  4AJ6 A;  2H8L A;  4HJ2 A;  4OD7 A;  2HT9 A;  18GS A;  2OE1 A;  1HD2 A;  4FH8 A;  2A2P A;  2GQK A;  2JZR A;  4PGT A;  3M0F A;  3I69 A;  3KH7 A;  4NHW A;  1OKT A;  3QAV A;  2KP2 A;  1ZL9 A;  2LRT A;  2KP1 A;  1QFN A;  3P90 A;  1Z6N A;  1G0T A;  3GA4 A;  2N5F A;  2IPA A;  5ECR B;  5IMF A;  2OBK A;  2TIR A;  1SEN A;  5CP1 A;  2KUC A;  4PXO A;  3WGX A;  4BA7 A;  4PQI A;  1S3D A;  1HNB A;  5F06 A;  2O7K A;  2V41 A;  1M9A A;  4K6X A;  3QDN A;  5CNW A;  5LNK e;  12GS A;  2HE3 A;  1J9B A;  2HRK A;  1M2D A;  3GHA A;  4IN0 A;  2H6Z A;  2YCD A;  1TI1 A;  1HQO A;  5DCH A;  4D73 A;  6GSS A;  5D73 A;  3LFL A;  17GS A;  4PNG A;  4O5Q A;  2VD0 A;  3O6T A;  4GWR A;  1GSY A;  3E9J B;  4ECC A;  1Y25 A;  3HJM A;  2FGX A;  2CT6 A;  2GT6 A;  22GS A;  3UBK A;  2I9H A;  1YEP A;  1E2Y A;  3QCP A;  4KX4 A;  3GL3 A;  1OC9 B;  3ZLP A;  1M7T A;  2ALB A;  4JR4 A;  2H0H A;  3NOF A;  2YV7 A;  3RHB A;  3I6A A;  5IMC A;  3GFK A;  4KCE A;  2M72 A;  2MBS A;  2GTU A;  2QGV A;  4K2X A;  1HYU A;  2DKI A;  5IIZ A;  3M1G A;  1U3A A;  2H71 A;  4XS4 B;  3GTU A;  5GAN D;  1FO5 A;  2LTK A;  1XCC A;  1F9M A;  3GRX A;  5DCG A;  3QOU A;  2IMI A;  3TGZ A;  3ZIJ A;  5GAP D;  3EMP A;  3F4R A;  3VWW A;  3KD0 A;  1YKC A;  3WT1 A;  2WFC A;  4KDY A;  1WJK A;  3MAK A;  2DBC A;  2MYG A;  4MH3 A;  4USS A;  4K7I A;  5H5R A;  4LMW A;  1V57 A;  2H1B A;  4K5S A;  1GH2 A;  4N0V A;  1OE8 A;  4F2I A;  4GXZ A;  3UEM A;  3C7M A;  3DEX A;  1Q4J A;  4N10 A;  4KF9 A;  1C72 A;  2CX4 A;  1JZR A;  2AUV A;  4HI7 A;  3KMO A;  2A2S A;  3L0H A;  4BPY A;  2DC5 A;  2L4Q A;  3KP9 A;  1TK0 B;  4G0K A;  1PMT A;  5IO2 A;  5A4U A;  2ZNM A;  3ZTL A;  3IA1 A;  2IWT A;  1I9D A;  3ED3 A;  5HQP A;  2VLV A;  1V40 A;  2E0Q A;  2H01 A;  1O7U A;  2O85 A;  1F2E A;  2CQ9 A;  2H76 A;  4K0N A;  4P3Y B;  2H0G A;  5HFG A;  4LL1 B;  1ZGN A;  4EVM A;  1YF1 A;  1U3I A;  3RHC A;  4IQA A;  2XC2 A;  2IME A;  1S3R A;  3FK8 A;  2JSY A;  1FW1 A;  4XIH A;  2H70 A;  2VL9 A;  5HR2 A;  4I2T A;  2RLI A;  5ECM B;  1OAZ A;  1UA5 A;  2LNT A;  2ZUP A;  1CQH A;  1X9W B;  2LNS A;  4O5R A;  4GRF A;  5ECN B;  2GT5 A;  3KTB A;  4L0W A;  3LW9 A;  3GST A;  2N5A A;  3E3E A;  4L5O A;  2FLS A;  3EPT A;  4MZW A;  3GYK A;  4MJB A;  3LSZ A;  5EPF A;  3UMA A;  2OBI A;  1TJD A;  2HRA A;  3ERF A;  3TRQ A;  4ILF A;  1EOG A;  4TKY A;  3G7J A;  5JCW A;  4OCE A;  3G9B A;  1NSW A;  5G31 A;  5BMU A;  3F3Q A;  2B5Y A;  1DUG A;  3CTG A;  4OFT A;  2FY6 A;  2QSI A;  3FZ9 A;  4KH7 A;  4BVY A;  3MYD A;  5ECP B;  2MZC A;  1BYE A;  1K0C A;  3C73 A;  2FA8 A;  2DIY A;  3GSS A;  1MEK A;  1OVN A;  1T3B A;  5IPG A;  1O8W A;  2ON7 A;  1MDJ A;  3F4T A;  1GLQ A;  1GNW A;  1XFL A;  3D6I A;  2GSS A;  3IHQ A;  3C71 A;  1B48 A;  3ZML A;  4WR5 A;  3VPT A;  2WJU A;  3F3R A;  4JR6 A;  2FWG A;  2R5G A;  3HYP A;  1TRW A;  1V9W A;  1XG8 A;  2WGR A;  4WR4 A;  4MF5 A;  5IPH A;  2DJK A;  1K3L A;  1R5A A;  3APO A;  2VLU A;  1A24 A;  1T4Z A;  4YH2 A;  2HXK A;  9GSS A;  5A5K A;  2B1K A;  19GS A;  1A0R P;  1JFU A;  1XWG A;  4WKW A;  2F9S A;  3GUR A;  11GS A;  4ZBB A;  2FWF A;  2YJ7 A;  2CZ2 A;  2B5E A;  1V2A A;  5BRT A;  3CYN A;  5CRD A;  2H72 A;  4KA0 A;  3GKX A;  4MMM A;  4IJ3 A;  4K9Z A;  3GIX A;  1Z5Y E;  1JZW A;  3DML A;  10GS A;  1EZK A;  4BIK A;  1WPI A;  4JRR A;  2VAF A;  1XVW A;  3W8J A;  3L9V A;  2DIZ A;  3GKM A;  2C8U A;  4N0Z A;  3TRX A;  2PVO C;  1VGL A;  3FR9 A;  4D73 B;  1TKD B;  1XOA A;  1PFO A;  4ZL7 A;  4WET A;  1EWX A;  3C8E A;  2VM2 A;  2I81 A;  4MH2 A;  1MDK A;  3IOS A;  4NPB A;  2JSZ A;  2HSH A;  3HVV A;  2IN3 A;  2M80 A;  4A5P A;  5ECQ B;  1G7O A;  4DSS A;  4Q5N A;  6GSX A;  4EIQ A;  3NIV A;  3A5I A;  4MP4 A;  2BTO T;  2H30 A;  4GST A;  3FR3 A;  1ZYE A;  5GZZ B;  1LU4 A;  3KCM A;  2FD3 A;  3IPZ A;  1RK4 A;  5GST A;  1TRS A;  2DMM A;  4YKF A;  2VOC A;  3GTU B;  4TR3 A;  1GUL A;  4MCU A;  3F4S A;  2H66 A;  2BMX A;  1O73 A;  4POM A;  3H1N A;  3UBL A;  5EVO A;  4IP6 A;  2NBS A;  4O32 A;  13GS A;  3VPQ A;  1SYX A;  4MNN A;  2DJ3 A;  5B8B A;  2QA2 A;  4YQV A;  4Q5Q A;  1OC8 A;  2RM6 A;  2P31 A;  4G10 A;  3KTL A;  2WRT A;  4V2N A;  2PUK C;  2H73 A;  1GUK A;  4K5R A;  3ME8 A;  4K7N A;  2I4A A;  1PGT A;  5DQS A;  1A2J A;  3GX8 A;  1AQW A;  3HZ4 A;  3A2X A;  3UVH A;  1JHB A;  4XTS A;  3J7Y b;  3VWX A;  1SKR B;  5AIV A;  2H19 A;  2KHP A;  1W89 A;  3ERW A;  1UC7 A;  4F0C A;  3OR5 A;  4BWS A;  5EY6 A;  2R0G A;  4OWY A;  4NAX A;  4HQS A;  3LQ7 A;  2FCH A;  3F9U A;  2FUG 2;  4ID0 A;  4X43 A;  1YEX A;  1SJI A;  3L78 A;  1ACV A;  1S3C A;  3HVS A;  3LG6 A;  3CSI A;  4O7H A;  5DQY A;  2H1A A;  4IKH A;  1B8X A;  2VCQ A;  1XWC A;  5CRH A;  3SBC A;  5G2Z A;  4LL4 B;  2XHF A;  2X8H A;  2JAD A;  4IS0 A;  4KSO A;  5AGY A;  3HZ8 A;  2HFD A;  1VF3 A;  5DAL A;  1VRS D;  5CAX A;  3QAW A;  2OKA A;  1FAA A;  1TU8 A;  5D9T A;  4YAP A;  4JE1 A;  5G5F A;  3IE3 A;  4F0B A;  4Z2R A;  4CW9 A;  2R0P A;  3ERG A;  3VUR A;  1K0D A;  5G1L A;  4XRD A;  3LXZ A;  6GSV A;  2ES7 A;  3V1W A;  7GSS A;  2HRF A;  1YQ1 A;  2XPD A;  4MLY A;  1X5C A;  1GRX A;  2OA7 A;  3U5R E;  1SL1 B;  2YV9 A;  3QFB C;  1OC3 A;  1FVJ A;  3DVX A;  3R3E A;  1N2A A;  2UZ8 A;  2Z9S A;  3VWV A;  3AY8 A;  3O3T A;  2I1U A;  3MWH A;  3PIN A;  5F07 A;  1ON4 A;  4ML6 A;  4GLT A;  3IBH A;  1GTI A;  2YJH A;  1AQX A;  2MMN A;  4PTS A;  2IJY A;  3ZIT A;  3PGT A;  1YDK A;  3GL5 A;  1X9M B;  1M0U A;  3G7Y A;  1B9Y C;  3GKK A;  2F8A A;  1EGR A;  4ZIJ A;  3Q18 A;  3IDV A;  1B4P A;  3EU3 A;  2MMZ A;  3GNJ A;  4BVY B;  3WYW A;  4HSC X;  4K8M A;  1XWK A;  4O5U A;  3VI5 A;  1GSS A;  2F8F A;  4TR1 A;  2GZZ A;  1GTA A;  2CV4 A;  3EVI A;  2OJL A;  2AAW A;  1ZMA A;  4NV2 A;  1AXD A;  4KCA A;  5AIX A;  2I3Y A;  4MF7 A;  4ECJ A;  1KTE A;  5FHI A;  3ZFB A;  2EIQ A;  4KSM A;  2CVB A;  3L9U A;  3H8Q A;  3FMW A;  3VK9 A;  3DIE A;  3P8W A;  5ECK B;  4CHS A;  4F82 A;  4QL7 A;  2IMF A;  3CTF A;  3US3 A;  1GSD A;  5B7C A;  3TJK A;  2QA1 A;  4IQ1 A;  1XW5 A;  4ZXG A;  1ZYQ B;  5G5E A;  2KOK A;  1YY7 A;  4HEA 2;  4EIP A;  5KN0 A;  2K6V A;  3NZN A;  2CAQ A;  3GUS A;  3BCI A;  1NW2 A;  4Z7X A;  2JZT A;  2H1G A;  4JZQ A;  1B4Q A;  1Y6E A;  3KM6 A;  4GQF A;  5H5Q A;  1RW1 A;  4CDO A;  3KP8 A;  4OO4 A;  3KH9 A;  3GMF A;  3MNG A;  3CRT A;  1TDI A;  1TK5 B;  2CVK A;  1TK8 B;  2XPE A;  1ML6 A;  2K9F A;  2B1L A;  3ZMK A;  2VLT A;  3F8U A;  1FB6 A;  4MPG A;  1YZX A;  4ZL8 A;  5HR3 A;  4WF5 A;  5ELG A;  2WB9 A;  2B7K A;  5GSS A;  1YJ6 A;  2PMT A;  1G7E A;  3F63 A;  4IW9 A;  4RI6 A;  2WZ9 A;  4ULX A;  3HJO A;  1BX9 A;  3ZRD A;  3ZFL A;  4K1F A;  4MJC A;  4DSS B;  2IL3 A;  4Q5R A;  1U88 A;  2L6D A;  1QXH A;  1KBN A;  3TJG A;  2OE0 A;  2R4V A;  1JLV A;  1SJ6 A;  4V2L A;  2FWE A;  2GVP A;  3DGQ A;  3FZ4 A;  4GQC A;  3D4T A;  2E2G A;  2RUF A;  2HRN A;  4ZBD A;  2PN8 A;  3TKS E;  1ERV A;  4ACS A;  4NMU A;  4PNF A;  4KB3 A;  1K0N A;  3HVX A;  2X8C A;  3DKS A;  2H6X A;  4N11 A;  2PGT A;  3VWU A;  3UL3 A;  2LKU A;  4TR0 A;  2GGT A;  2HZE A;  2PBJ A;  2WUL A;  4BVX A;  4TW5 A;  5DAK A;  1S3A A;  4XHM A;  4POK A;  1TW9 A;  4KND A;  3KJY A;  3F6D A;  3FW2 A;  3CRU A;  4NV5 A;  3UJ1 A;  2RII A;  3EWL A;  2YAN A;  2HLS A;  1KNG A;  1VF2 A;  2WCI A;  1BQ7 A;  1EV9 A;  2N5B A;  3HHV A;  3KEB A;  5IOX A;  3RPN A;  2O8V B;  1DBY A;  5KOX A;  1GUH A;  1TOF A;  4OFN A;  5IMV A;  1AAZ A;  1OYJ A;  2IMK A;  4RQX A;  1FG4 A;  3TCO A;  3CMI A;  5J41 A;  3FHK A;  6GST A;  3HXS A;  1WE0 A;  2K8V A;  3LYP A;  5FT3 A;  4G9H A;  1EP8 A;  1Z7P A;  1SK2 A;  4L0U A;  4EF0 A;  3EC3 A;  1K0O A;  3CSJ A;  2H1D A;  2GZY A;  4XS6 A;  3LGC A;  4KW6 A;  4MAB A;  2DKH A;  4F03 A;  1QGV A;  2YZH A;  2X8G A;  1SL0 B;  3J7Y k;  2GDR A;  5DAL B;  2EC4 A;  1R5P A;  1SU9 A;  4PX1 A;  2J23 A;  3QMX A;  4KDX A;  4NHZ A;  4AJ8 A;  4GCI A;  1DE2 A;  3FYG A;  5ELA A;  1M99 A;  4HOJ A;  4RI7 A;  1F3A A;  2YPM A;  4AGS A;  2NDO A;  3TB2 A;  2F3M A;  3HKR A;  5COH A;  4EDZ A;  3DD3 A;  5F0G A;  1MTC A;  3HA9 A;  2V6O A;  5F05 A;  1N8J A;  1SD9 A;  2C80 A;  2OAC A;  4PQ1 A;  3L4N A;  4QQ7 A;  4MJE A;  2L6C A;  3HVN A;  2FHE A;  4ML1 A;  3TKS C;  6GSW A;  4X1U A;  3VFI A;  2WS2 A;  2DSA A;  2YOI A;  4FYB A;  1T8E B;  3PH9 A;  3RAZ A;  3KIJ A;  2A2R A;  1IYH A;  3K8N A;  5IQY A;  3D4M A;  1R4W A;  4DSQ A;  1GSQ A;  3WGD A;  1XIY A;  1K0M A;  3E0U A;  1XOB A;  3DVW A;  4X0X A;  4ISD A;  2DJJ A;  5CO3 A;  5CRW A;  1H4O A;  4OFM A;  4CY6 A;  5J9C A;  4LMV A;  1X0R A;  4TR1 B;  2C4J A;  3LWA A;  4ZBA A;  4TXO A;  2JU5 A;  1PL2 A;  1TTZ A;  3P7X A;  2MMA A;  2DLX A;  3DYR A;  2LJR A;  3HJP A;  1HNA A;  4POB A;  1XW6 A;  1ZOF A;  3UAP A;  2L59 A;  2L5O A;  2TRC P;  2C3N A;  2H6Y A;  5E59 A;  4FQU A;  1F3B A;  2M46 A;  2DJ1 A;  1EEM A;  2KLX A;  2VM1 A;  4HZ2 A;  3IXR A;  1Z7R A;  4MF6 A;  4HDE A;  4AJ7 A;  3QR6 A;  3BBY A;  4I8B A;  1FOV A;  3LEF A;  2R6K A;  1CQG A;  1GLP A;  2C1Y A;  3TKR A;  4HJM A;  1M2B A;  2O89 A;  4J2F A;  4K0G A;  3O76 A;  2VD1 A;  5ECL B;  1QMV A;  1G6Y A;  3N5O A;  2P0G A;  3ZVJ A;  2G2Q A;  1X5D A;  4L8E A;  4RQR A;  2E2M A;  4GTU A;  5INY A;  1K0A A;  5F8B A;  1SD8 A;  5A4W A;  3HY2 A;  4ZB6 A;  3EYT A;  3RBT A;  1AIU A;  2OAD A;  1NM3 A;  2VO4 A;  4EUY A;  1A8Y A;  5DJM A;  5ECI B;  3HDC A;  3FR6 A;  2LUS A;  3BJ5 A;  5G30 A;  1IYI A;  3F0I A;  4EO3 A;  4YQM A;  3GH6 A;  3CSH A;  2K18 A;  2C0G A;  4OCF A;  3G7I A;  2B5X A;  2VCV A;  4TRX A;  3H93 A;  2AHE A;  3PPU A;  2RUE A;  1OE7 A;  4G2E A;  4FO5 A;  1BED A;  1FHE A;  4TOP A;  4EDY A;  2R2J A;  3IAS 2;  1T00 A;  3EUR A;  2PU9 C;  2LJA A;  5KN2 A;  3F6F A;  5DVB A;  2C3Q A;  1O81 A;  2D2Z A;  2FA4 A;  3W6G A;  2P5R A;  1A23 A;  1AUC A;  1URM A;  1B9X C;  3D0Z A;  1A0F A;  4X4J A;  5LCZ A;  3GX0 A;  3TDG A;  5KN1 A;  1USB A;  2AV4 A;  3R2Q A;  1WWJ A;  1WIK A;  1SL2 B;  1Z9H A;  1T4Y A;  1PQN A;  4JU5 A;  2HZE B;  4V1A p;  2YNX A;  4BVX B;  2YWN A;  5DAK B;  2LRC A;  1ZYN A;  3D5J A;  4E8H A;  2WDU A;  5D9V A;  5KOW A;  1K0B A;  1M3J A;  1PA3 A;  3TRP A;  6GSY A;  2HYX A;  1JZD A;  3Q74 A;  2G0F A;  2FWH A;  5ECO B;  1V98 A;  4ECB A;  3S9F A;  1WOU A;  4WXT A;  5EL8 A;  2LEG A;  5IMA A;  4MJA A;  1ST9 A;  3WD6 A;  2CA8 A;  1SK1 A;  4V2M A;  4HQZ A;  1MD3 A;  3UOM A;  3WGE A;  4QL9 A;  4I6X A; 
#chains in the Genus database with same CATH homology
 3IK7 A;  1ERT A;  1A2L A;  3U6V A;  2VL2 C;  5AN1 A;  1ZYP A;  3UIW A;  4EL1 A;  1ILO A;  1XZO A;  3P2A A;  2ON5 A;  3FY7 A;  3RPP A;  3ZRE A;  3TJF A;  5H5S A;  3ISO A;  3QPM A;  4LLR A;  1XBS A;  1XWB A;  4NXI A;  1XVQ A;  2LQQ A;  1T1V A;  3IK9 A;  2YZU A;  4OMV A;  1AW9 A;  1G6W A;  1PN0 A;  1PD2 1;  2A4H A;  2FNO A;  1WMJ A;  3LJR A;  1SKW B;  4BL7 A;  2IIY A;  4HU7 A;  5DJL A;  2VCT A;  4JBB A;  2B6M A;  1ZCP A;  2GS3 A;  5D9X A;  4IJI A;  2GSR A;  2C0E A;  1V58 A;  4HS1 A;  1PN9 A;  3DRN A;  3ME7 A;  5D93 A;  5G1K A;  1ZZY A;  4EXJ A;  3FEU A;  3MDK A;  1SYR A;  5IM9 A;  1VF1 A;  3A2W A;  4HUA A;  4YKG A;  3W8S A;  5D8I A;  2L4C A;  1Z3E A;  2L5L A;  1QK8 A;  1UVZ A;  1K3O A;  5J9B A;  3C1S A;  1TRV A;  4YQU A;  1PRX A;  1GSE A;  3WT2 A;  1M9B A;  5JCG A;  5E4W A;  4K7O A;  4IGJ A;  2DML A;  4MDC A;  3KMN A;  2GZP A;  1GSU A;  5HFI A;  3ZYW A;  4Z2T A;  2F51 A;  1THO A;  3BOA A;  5JWR B;  5DDL A;  1J0F A;  2HNL A;  2HSM A;  1GUM A;  4GSN A;  5B6N A;  4TXO B;  2GSQ A;  3PR8 A;  5JWO B;  3TKQ A;  1BAY A;  5ID2 A;  4E8E A;  2EIO A;  3CBU A;  1F6M C;  1PKZ A;  2GST A;  4HZ4 A;  1O85 A;  5IO0 A;  3GH9 A;  2CX3 A;  4WEY A;  1LJR A;  2PVQ A;  5KEJ A;  2AJQ B;  5IMD A;  5J3R A;  1WP0 A;  3MIX A;  1GTU A;  3FZ5 A;  1OKD A;  1X9S B;  2IFQ A;  2CZ3 A;  1O8X A;  2H0I A;  1I5G A;  2V2G A;  3I43 A;  3ZL5 A;  2IMD A;  1J08 A;  2GQL A;  3TKS A;  1SJZ A;  1XWA A;  5HR1 A;  5CRG A;  3JCM L;  3BCK A;  1XW9 A;  2O87 A;  5IOW A;  4LA1 A;  5CYY A;  4J56 E;  4NWY A;  5ENU A;  5A4V A;  1EEJ A;  2LS5 A;  3FZA A;  3A2V A;  1A8L A;  2YP6 A;  4IEL A;  3UVT A;  1K3Y A;  3IHG A;  2J9H A;  1VF4 A;  2MMO A;  4ECI A;  5J4U A;  1QQ2 A;  4WBR D;  14GS A;  2LV3 A;  1H75 A;  3DXB A;  1PL1 A;  3SWL A;  2AB6 A;  2R0C A;  3IAM 2;  1EV4 A;  4MZB A;  4IP1 A;  3HCZ A;  1ERW A;  1YF0 A;  4KUN A;  1RQM A;  3EIN A;  2PER A;  2VIM A;  3H79 A;  4PUF C;  2NPB A;  1THX A;  4IBP A;  1DSB A;  4CY8 A;  4FIW A;  1GTB A;  1GWC A;  2LQO A;  1EGO A;  3ZVJ D;  3L9S A;  3D21 A;  1JZO A;  2AYT A;  3QFA C;  1U6T A;  2CVD A;  4KGI A;  1SKS B;  4IHU A;  3Q19 A;  5LD0 A;  4ZL9 A;  2TRX A;  1YKA A;  2B7J A;  1TRU A;  2H74 A;  4G19 A;  5C04 A;  4G0L A;  3TJB A;  3EMX A;  4BWQ A;  4MA9 A;  3KGK A;  3KXO A;  2HI7 A;  4FYC A;  2XBQ A;  3VLN A;  2JL4 A;  3MSZ A;  2JAC A;  1EP7 A;  4L5L A;  1SK0 A;  2XBI A;  3IC4 A;  5CRE A;  1XXU A;  2YN1 A;  2OE3 A;  2QKE A;  2C0D A;  3Q6O A;  3TOU A;  4PUA A;  3A3T A;  2EIR A;  5JCU A;  3APQ A;  4ICY A;  3H4K A;  1OC9 A;  1XPV A;  4POL A;  3GV1 A;  2VL3 A;  2R3X A;  4H86 A;  2X99 A;  4WF4 A;  3M8N A;  2V6K A;  4F9Z A;  8GSS A;  1PKW A;  4DVC A;  2H75 A;  1FVK A;  1AQV A;  2L57 A;  3ZIV A;  4I5Q A;  1PX7 A;  2CAI A;  2PWJ A;  4XS4 A;  5IMZ A;  3EE2 A;  5HFK A;  3EU4 A;  1TP9 A;  4KAE A;  4KE3 A;  1R7H A;  4JED A;  2NTO A;  3IRA A;  3RDW A;  1FB0 A;  5L71 A;  1M2A A;  4KDU A;  3TUE A;  4EKZ A;  3D22 A;  1GSF A;  1PX6 A;  2YWO A;  4OO5 A;  2R37 A;  4AF2 A;  1UN2 A;  1TI3 A;  1R26 A;  4DSR A;  2LRN A;  3TKP A;  4BL7 B;  3M9J A;  1ERU A;  1Z6M A;  2C3T A;  2NVL A;  1TU7 A;  4EE0 A;  1GNE A;  2C0F A;  1DE1 A;  1JLW A;  1WRY A;  1GL8 A;  1EOH A;  4Z2U A;  4Q5F A;  2GLR A;  4XS1 A;  4N30 A;  1X5E A;  2DJ2 A;  5HR0 A;  5FWG A;  3QAG A;  3KZQ A;  2E7P A;  4YAV A;  4ZIL A;  4O92 A;  3GN3 A;  1PSQ A;  20GS A;  3IV4 A;  3M3M A;  1NHY A;  2K8S A;  3BD2 A;  2VL2 A;  3APS A;  3LOR A;  3UAR A;  4FYU A;  4V1A g;  2REM A;  2VUP A;  5D9W A;  3DWV A;  16GS A;  2GQM A;  3HD5 A;  3I9V 2;  2ZCT A;  2JZS A;  4XCS A;  2V1M A;  5KN3 A;  2MBT A;  2RM5 A;  5C00 A;  5ABR A;  3CXG A;  4ZB8 A;  4MPF A;  3N9J A;  4G0I A;  1O6J A;  4HU9 A;  2YWI A;  4I97 A;  1W4V A;  2V32 A;  3ZZX A;  4TXV A;  3IC8 A;  3TOT A;  5DBQ A;  5ID2 B;  2HZF A;  5D96 A;  2VCZ A;  5JWQ B;  2X4A A;  5ECH B;  1GP1 A;  3A5W A;  1ABA A;  4MK3 A;  2BJX A;  4TN8 A;  4RUV A;  4GF0 A;  1FOH A;  1U87 A;  2LJK A;  3VI7 A;  4I2U A;  2VCX A;  4PQH A;  2HSY A;  2IFQ B;  5J5N A;  2X49 A;  5AIS A;  1NHO A;  4WBJ A;  1E6B A;  4TR4 A;  3TJJ A;  2B3S A;  4GSS A;  2QC7 A;  3M9K A;  2VCW A;  3IR4 A;  1LBK A;  4DEJ A;  1BG5 A;  5B8A A;  6GSU A;  2P5Q A;  4XRA A;  3LYK A;  3LXT A;  4PUR A;  1KEB A;  4IVF A;  1A2M A;  2A4V A;  1TXX A;  1AC1 A;  4K2D A;  1BJX A;  3QD9 A;  1T7P B;  2DJ0 A;  2PPT A;  1QUW A;  1HNC A;  3FKF A;  3GKN A;  3C1R A;  4J57 E;  4EC0 A;  1MDI A;  4ZB9 A;  2X64 A;  1Q98 A;  4TVE A;  1MD4 A;  2YWM A;  3FRC A;  2LST A;  5ECS A;  5B6M A;  1F37 A;  4MZC A;  4AJ6 A;  2H8L A;  4HJ2 A;  4OD7 A;  2HT9 A;  18GS A;  2OE1 A;  1HD2 A;  4FH8 A;  2A2P A;  2GQK A;  2JZR A;  4PGT A;  3M0F A;  3I69 A;  3KH7 A;  4NHW A;  1OKT A;  3QAV A;  2KP2 A;  1ZL9 A;  2LRT A;  2KP1 A;  1QFN A;  3P90 A;  1Z6N A;  1G0T A;  3GA4 A;  2N5F A;  2IPA A;  5ECR B;  5IMF A;  2OBK A;  2TIR A;  1SEN A;  5CP1 A;  2KUC A;  4PXO A;  3WGX A;  4BA7 A;  4PQI A;  1S3D A;  1HNB A;  5F06 A;  2O7K A;  2V41 A;  1M9A A;  4K6X A;  3QDN A;  5CNW A;  5LNK e;  12GS A;  2HE3 A;  1J9B A;  2HRK A;  1M2D A;  3GHA A;  4IN0 A;  2H6Z A;  2YCD A;  1TI1 A;  1HQO A;  5DCH A;  4D73 A;  6GSS A;  5D73 A;  3LFL A;  17GS A;  4PNG A;  4O5Q A;  2VD0 A;  3O6T A;  4GWR A;  1GSY A;  3E9J B;  4ECC A;  1Y25 A;  3HJM A;  2FGX A;  2CT6 A;  2GT6 A;  22GS A;  3UBK A;  2I9H A;  1YEP A;  1E2Y A;  3QCP A;  4KX4 A;  3GL3 A;  1OC9 B;  3ZLP A;  1M7T A;  2ALB A;  4JR4 A;  2H0H A;  3NOF A;  2YV7 A;  3RHB A;  3I6A A;  5IMC A;  3GFK A;  4KCE A;  2M72 A;  2MBS A;  2GTU A;  2QGV A;  4K2X A;  1HYU A;  2DKI A;  5IIZ A;  3M1G A;  1U3A A;  2H71 A;  4XS4 B;  3GTU A;  5GAN D;  1FO5 A;  2LTK A;  1XCC A;  1F9M A;  3GRX A;  5DCG A;  3QOU A;  2IMI A;  3TGZ A;  3ZIJ A;  5GAP D;  3EMP A;  3F4R A;  3VWW A;  3KD0 A;  1YKC A;  3WT1 A;  2WFC A;  4KDY A;  1WJK A;  3MAK A;  2DBC A;  2MYG A;  4MH3 A;  4USS A;  4K7I A;  5H5R A;  4LMW A;  1V57 A;  2H1B A;  4K5S A;  1GH2 A;  4N0V A;  1OE8 A;  4F2I A;  4GXZ A;  3UEM A;  3C7M A;  3DEX A;  1Q4J A;  4N10 A;  4KF9 A;  1C72 A;  2CX4 A;  1JZR A;  2AUV A;  4HI7 A;  3KMO A;  2A2S A;  3L0H A;  4BPY A;  2DC5 A;  2L4Q A;  3KP9 A;  1TK0 B;  4G0K A;  1PMT A;  5IO2 A;  5A4U A;  2ZNM A;  3ZTL A;  3IA1 A;  2IWT A;  1I9D A;  3ED3 A;  5HQP A;  2VLV A;  1V40 A;  2E0Q A;  2H01 A;  1O7U A;  2O85 A;  1F2E A;  2CQ9 A;  2H76 A;  4K0N A;  4P3Y B;  2H0G A;  5HFG A;  4LL1 B;  1ZGN A;  4EVM A;  1YF1 A;  1U3I A;  3RHC A;  4IQA A;  2XC2 A;  2IME A;  3FK8 A;  2JSY A;  1FW1 A;  4XIH A;  2H70 A;  2VL9 A;  5HR2 A;  4I2T A;  2RLI A;  5ECM B;  1OAZ A;  1UA5 A;  2LNT A;  2ZUP A;  1CQH A;  1X9W B;  2LNS A;  4O5R A;  4GRF A;  5ECN B;  2GT5 A;  3KTB A;  4L0W A;  3LW9 A;  3GST A;  2N5A A;  3E3E A;  4L5O A;  2FLS A;  3EPT A;  4MZW A;  3GYK A;  4MJB A;  3LSZ A;  5EPF A;  3UMA A;  2OBI A;  1TJD A;  2HRA A;  3ERF A;  3TRQ A;  4ILF A;  1EOG A;  4TKY A;  3G7J A;  5JCW A;  4OCE A;  3G9B A;  1NSW A;  5G31 A;  5BMU A;  3F3Q A;  2B5Y A;  1DUG A;  3CTG A;  4OFT A;  2FY6 A;  2QSI A;  3FZ9 A;  4KH7 A;  4BVY A;  3MYD A;  5ECP B;  2MZC A;  1BYE A;  1K0C A;  3C73 A;  2FA8 A;  2DIY A;  3GSS A;  1MEK A;  1OVN A;  1T3B A;  5IPG A;  1O8W A;  2ON7 A;  1MDJ A;  3F4T A;  1GLQ A;  1GNW A;  1XFL A;  3D6I A;  2GSS A;  3IHQ A;  3C71 A;  1B48 A;  3ZML A;  4WR5 A;  3VPT A;  2WJU A;  3F3R A;  4JR6 A;  2FWG A;  2R5G A;  3HYP A;  1TRW A;  1V9W A;  2WGR A;  4WR4 A;  4MF5 A;  5IPH A;  2DJK A;  1K3L A;  1R5A A;  3APO A;  2VLU A;  1A24 A;  1T4Z A;  4YH2 A;  2HXK A;  9GSS A;  5A5K A;  2B1K A;  19GS A;  1A0R P;  1JFU A;  1XWG A;  4WKW A;  2F9S A;  3GUR A;  11GS A;  4ZBB A;  2FWF A;  2YJ7 A;  2CZ2 A;  2B5E A;  1V2A A;  5BRT A;  3CYN A;  5CRD A;  2H72 A;  4KA0 A;  3GKX A;  4MMM A;  4IJ3 A;  4K9Z A;  3GIX A;  1Z5Y E;  1JZW A;  3DML A;  10GS A;  1EZK A;  1WPI A;  4JRR A;  2VAF A;  1XVW A;  3W8J A;  3L9V A;  2DIZ A;  3GKM A;  2C8U A;  4N0Z A;  3TRX A;  2PVO C;  1VGL A;  3FR9 A;  4D73 B;  1TKD B;  1XOA A;  4ZL7 A;  4WET A;  1EWX A;  3C8E A;  2VM2 A;  2I81 A;  4MH2 A;  1MDK A;  3IOS A;  4NPB A;  2JSZ A;  2HSH A;  3HVV A;  2IN3 A;  2M80 A;  4A5P A;  5ECQ B;  1G7O A;  4DSS A;  4Q5N A;  6GSX A;  4EIQ A;  3NIV A;  3A5I A;  4MP4 A;  2BTO T;  2H30 A;  4GST A;  3FR3 A;  1ZYE A;  5GZZ B;  1LU4 A;  3KCM A;  2FD3 A;  3IPZ A;  1RK4 A;  5GST A;  1TRS A;  2DMM A;  4YKF A;  2VOC A;  3GTU B;  4TR3 A;  1GUL A;  4MCU A;  3F4S A;  2H66 A;  2BMX A;  1O73 A;  4POM A;  3H1N A;  3UBL A;  5EVO A;  4IP6 A;  2NBS A;  4O32 A;  13GS A;  3VPQ A;  1SYX A;  4MNN A;  2DJ3 A;  5B8B A;  2QA2 A;  4YQV A;  4Q5Q A;  1OC8 A;  2RM6 A;  2P31 A;  4G10 A;  3KTL A;  2WRT A;  4V2N A;  2PUK C;  2H73 A;  1GUK A;  4K5R A;  3ME8 A;  4K7N A;  2I4A A;  1PGT A;  5DQS A;  1A2J A;  3GX8 A;  1AQW A;  3HZ4 A;  3A2X A;  3UVH A;  1JHB A;  4XTS A;  3J7Y b;  3VWX A;  1SKR B;  5AIV A;  2H19 A;  2KHP A;  1W89 A;  3ERW A;  1UC7 A;  4F0C A;  3OR5 A;  4BWS A;  5EY6 A;  2R0G A;  4OWY A;  4NAX A;  4HQS A;  3LQ7 A;  2FCH A;  3F9U A;  2FUG 2;  4ID0 A;  4X43 A;  1YEX A;  1SJI A;  3L78 A;  1ACV A;  1S3C A;  3HVS A;  3LG6 A;  3CSI A;  4O7H A;  5DQY A;  2H1A A;  4IKH A;  1B8X A;  2VCQ A;  1XWC A;  5CRH A;  3SBC A;  5G2Z A;  4LL4 B;  2XHF A;  2X8H A;  2JAD A;  4IS0 A;  4KSO A;  5AGY A;  3HZ8 A;  2HFD A;  1VF3 A;  5DAL A;  1VRS D;  5CAX A;  3QAW A;  2OKA A;  1FAA A;  1TU8 A;  5D9T A;  4YAP A;  4JE1 A;  5G5F A;  3IE3 A;  4F0B A;  4Z2R A;  4CW9 A;  2R0P A;  3ERG A;  3VUR A;  1K0D A;  5G1L A;  4XRD A;  3LXZ A;  6GSV A;  2ES7 A;  3V1W A;  7GSS A;  2HRF A;  1YQ1 A;  2XPD A;  4MLY A;  1X5C A;  1GRX A;  2OA7 A;  3U5R E;  1SL1 B;  2YV9 A;  3QFB C;  1OC3 A;  1FVJ A;  3DVX A;  3R3E A;  1N2A A;  2UZ8 A;  2Z9S A;  3VWV A;  3AY8 A;  3O3T A;  2I1U A;  3MWH A;  3PIN A;  5F07 A;  1ON4 A;  4ML6 A;  4GLT A;  3IBH A;  1GTI A;  2YJH A;  1AQX A;  2MMN A;  4PTS A;  2IJY A;  3ZIT A;  3PGT A;  1YDK A;  3GL5 A;  1X9M B;  1M0U A;  3G7Y A;  1B9Y C;  3GKK A;  2F8A A;  1EGR A;  4ZIJ A;  3Q18 A;  3IDV A;  1B4P A;  3EU3 A;  2MMZ A;  3GNJ A;  4BVY B;  3WYW A;  4K8M A;  1XWK A;  4O5U A;  3VI5 A;  1GSS A;  2F8F A;  4TR1 A;  2GZZ A;  1GTA A;  2CV4 A;  3EVI A;  2OJL A;  2AAW A;  1ZMA A;  4NV2 A;  1AXD A;  4KCA A;  5AIX A;  2I3Y A;  4MF7 A;  4ECJ A;  1KTE A;  5FHI A;  3ZFB A;  2EIQ A;  4KSM A;  2CVB A;  3L9U A;  3H8Q A;  3FMW A;  3VK9 A;  3DIE A;  3P8W A;  5ECK B;  4CHS A;  4F82 A;  4QL7 A;  2IMF A;  3CTF A;  3US3 A;  1GSD A;  5B7C A;  3TJK A;  2QA1 A;  4IQ1 A;  1XW5 A;  4ZXG A;  1ZYQ B;  5G5E A;  2KOK A;  1YY7 A;  4HEA 2;  4EIP A;  5KN0 A;  2K6V A;  3NZN A;  2CAQ A;  3GUS A;  3BCI A;  1NW2 A;  4Z7X A;  2JZT A;  2H1G A;  4JZQ A;  1B4Q A;  1Y6E A;  3KM6 A;  4GQF A;  5H5Q A;  1RW1 A;  4CDO A;  3KP8 A;  4OO4 A;  3KH9 A;  3GMF A;  3MNG A;  3CRT A;  1TDI A;  1TK5 B;  2CVK A;  1TK8 B;  2XPE A;  1ML6 A;  2K9F A;  2B1L A;  3ZMK A;  2VLT A;  3F8U A;  1FB6 A;  4MPG A;  1YZX A;  4ZL8 A;  5HR3 A;  4WF5 A;  5ELG A;  2WB9 A;  2B7K A;  5GSS A;  1YJ6 A;  2PMT A;  1G7E A;  3F63 A;  4IW9 A;  4RI6 A;  2WZ9 A;  4ULX A;  3HJO A;  1BX9 A;  3ZRD A;  3ZFL A;  4K1F A;  4MJC A;  4DSS B;  2IL3 A;  4Q5R A;  1U88 A;  2L6D A;  1QXH A;  1KBN A;  3TJG A;  2OE0 A;  2R4V A;  1JLV A;  1SJ6 A;  4V2L A;  2FWE A;  2GVP A;  3DGQ A;  3FZ4 A;  4GQC A;  3D4T A;  2E2G A;  2RUF A;  2HRN A;  4ZBD A;  2PN8 A;  3TKS E;  1ERV A;  4ACS A;  4NMU A;  4PNF A;  4KB3 A;  1K0N A;  3HVX A;  2X8C A;  3DKS A;  2H6X A;  4N11 A;  2PGT A;  3VWU A;  3UL3 A;  2LKU A;  4TR0 A;  2GGT A;  2HZE A;  2PBJ A;  2WUL A;  4BVX A;  4TW5 A;  5DAK A;  1S3A A;  4XHM A;  4POK A;  1TW9 A;  4KND A;  3KJY A;  3F6D A;  3FW2 A;  3CRU A;  4NV5 A;  3UJ1 A;  2RII A;  3EWL A;  2YAN A;  2HLS A;  1KNG A;  1VF2 A;  2WCI A;  1BQ7 A;  1EV9 A;  2N5B A;  3HHV A;  3KEB A;  5IOX A;  3RPN A;  2O8V B;  1DBY A;  5KOX A;  1GUH A;  1TOF A;  4OFN A;  5IMV A;  1AAZ A;  1OYJ A;  2IMK A;  4RQX A;  1FG4 A;  3TCO A;  3CMI A;  5J41 A;  3FHK A;  6GST A;  3HXS A;  1WE0 A;  2K8V A;  3LYP A;  5FT3 A;  4G9H A;  1EP8 A;  1Z7P A;  1SK2 A;  4L0U A;  4EF0 A;  3EC3 A;  1K0O A;  3CSJ A;  2H1D A;  2GZY A;  4XS6 A;  3LGC A;  4KW6 A;  4MAB A;  2DKH A;  4F03 A;  1QGV A;  2YZH A;  2X8G A;  1SL0 B;  3J7Y k;  2GDR A;  5DAL B;  2EC4 A;  1R5P A;  1SU9 A;  4PX1 A;  2J23 A;  3QMX A;  4KDX A;  4NHZ A;  4AJ8 A;  4GCI A;  1DE2 A;  3FYG A;  5ELA A;  1M99 A;  4HOJ A;  4RI7 A;  1F3A A;  2YPM A;  4AGS A;  2NDO A;  3TB2 A;  2F3M A;  3HKR A;  5COH A;  4EDZ A;  3DD3 A;  5F0G A;  1MTC A;  3HA9 A;  2V6O A;  5F05 A;  1N8J A;  1SD9 A;  2C80 A;  2OAC A;  4PQ1 A;  3L4N A;  4QQ7 A;  4MJE A;  2L6C A;  2FHE A;  4ML1 A;  3TKS C;  6GSW A;  4X1U A;  3VFI A;  2WS2 A;  2DSA A;  2YOI A;  4FYB A;  1T8E B;  3PH9 A;  3RAZ A;  3KIJ A;  2A2R A;  1IYH A;  3K8N A;  5IQY A;  3D4M A;  1R4W A;  4DSQ A;  1GSQ A;  3WGD A;  1XIY A;  1K0M A;  3E0U A;  1XOB A;  3DVW A;  4X0X A;  4ISD A;  2DJJ A;  5CO3 A;  5CRW A;  1H4O A;  4OFM A;  4CY6 A;  5J9C A;  4LMV A;  1X0R A;  4TR1 B;  2C4J A;  3LWA A;  4ZBA A;  4TXO A;  2JU5 A;  1PL2 A;  1TTZ A;  3P7X A;  2MMA A;  2DLX A;  3DYR A;  2LJR A;  3HJP A;  1HNA A;  4POB A;  1XW6 A;  1ZOF A;  3UAP A;  2L59 A;  2L5O A;  2TRC P;  2C3N A;  2H6Y A;  5E59 A;  4FQU A;  1F3B A;  2M46 A;  2DJ1 A;  1EEM A;  2KLX A;  2VM1 A;  4HZ2 A;  3IXR A;  1Z7R A;  4MF6 A;  4HDE A;  4AJ7 A;  3QR6 A;  3BBY A;  4I8B A;  1FOV A;  3LEF A;  2R6K A;  1CQG A;  1GLP A;  2C1Y A;  3TKR A;  4HJM A;  1M2B A;  2O89 A;  4J2F A;  4K0G A;  3O76 A;  2VD1 A;  5ECL B;  1QMV A;  1G6Y A;  3N5O A;  2P0G A;  3ZVJ A;  2G2Q A;  1X5D A;  4L8E A;  4RQR A;  2E2M A;  4GTU A;  5INY A;  1K0A A;  5F8B A;  1SD8 A;  5A4W A;  3HY2 A;  4ZB6 A;  3EYT A;  3RBT A;  1AIU A;  2OAD A;  1NM3 A;  2VO4 A;  4EUY A;  1A8Y A;  5DJM A;  5ECI B;  3HDC A;  3FR6 A;  2LUS A;  3BJ5 A;  5G30 A;  1IYI A;  3F0I A;  4EO3 A;  4YQM A;  3GH6 A;  3CSH A;  2K18 A;  2C0G A;  4OCF A;  3G7I A;  2B5X A;  2VCV A;  4TRX A;  3H93 A;  2AHE A;  3PPU A;  2RUE A;  1OE7 A;  4G2E A;  4FO5 A;  1BED A;  1FHE A;  4TOP A;  4EDY A;  2R2J A;  3IAS 2;  1T00 A;  3EUR A;  2PU9 C;  2LJA A;  5KN2 A;  3F6F A;  5DVB A;  2C3Q A;  1O81 A;  2D2Z A;  2FA4 A;  3W6G A;  2P5R A;  1A23 A;  1AUC A;  1URM A;  1B9X C;  3D0Z A;  1A0F A;  4X4J A;  5LCZ A;  3GX0 A;  3TDG A;  5KN1 A;  1USB A;  2AV4 A;  3R2Q A;  1WWJ A;  1WIK A;  1SL2 B;  1Z9H A;  1T4Y A;  1PQN A;  4JU5 A;  2HZE B;  4V1A p;  2YNX A;  4BVX B;  2YWN A;  5DAK B;  2LRC A;  1ZYN A;  3D5J A;  4E8H A;  2WDU A;  5D9V A;  5KOW A;  1K0B A;  1PA3 A;  3TRP A;  6GSY A;  2HYX A;  1JZD A;  3Q74 A;  2G0F A;  2FWH A;  5ECO B;  1V98 A;  4ECB A;  3S9F A;  1WOU A;  4WXT A;  5EL8 A;  2LEG A;  5IMA A;  4MJA A;  1ST9 A;  3WD6 A;  2CA8 A;  1SK1 A;  4V2M A;  4HQZ A;  1MD3 A;  3UOM A;  3WGE A;  4QL9 A;  4I6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...