5CNWA

Crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
KIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FrnE protein
publication title drFrnE Represents a Hitherto Unknown Class of Eubacterial Cytoplasmic Disulfide Oxido-Reductases.
pubmed doi rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Oxidoreductase
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2015-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cnwA01
4I6XA 3ZIJA 5GAND 4FIWA 3GNJA 4F0BA 4ZBAA 4GQCA 4JR4A 1TDIA 3O76A 4DSRA 3HDCA 3TUEA 2K8VA 1JLVA 4FYUA 3VWWA 4KB3A 3DVXA 5CRGA 5IMVA 1ML6A 3CYNA 3UAPA 1AQVA 4OMVA 2MZCA 3ZYWA 5HR3A 4BA7A 1MTCA 1O6JA 2GT6A 1O73A 4N0VA 2A2SA 3ZVJA 1THOA 2L5LA 1HNAA 2LEGA 2O7KA 5KN3A 4XS1A 2YOIA 2D2ZA 5F0GA 2K18A 1IYIA 3L4NA 2C0FA 3R2QA 2JZTA 3ZMKA 2R37A 5H5SA 1A8LA 4F03A 2K9FA 1B4PA 1E6BA 5L71A 1XWAA 4K7IA 3P7XA 3QAVA 3LEFA 1Q4JA 1OC8A 1R26A 1X9WB 1XIYA 3RDWA 1FVJA 4RI6A 2WGRA 1TJDA 1OE7A 2A4VA 2VL2C 4I2TA 2KHPA 1XW5A 2VCWA 1X5CA 5B6MA 4KDYA 4JRRA 1G7OA 3F3QA 1TRVA 4HZ4A 4ML1A 2B5EA 1O81A 2YV9A 1ACVA 1RK4A 4OFTA 4KAEA 5CYYA 3EU3A 3NZNA 1J0FA 1UA5A 2HRNA 2PERA 20GSA 1PX7A 3EU4A 1SJIA 4BVYA 2KLXA 1K3OA 3TOUA 1TP9A 1AQWA 4IHUA 2RIIA 3ZFBA 4D73B 3TKPA 3CBUA 4JEDA 4PNFA 4WKWA 3KTBA 3E9JB 2H1BA 3WT2A 2HZFA 4RQXA 3IE3A 4DVCA 4MJBA 3J7Yb 5IMZA 5A4WA 4PQIA 1TRWA 3P90A 3GSTA 17GSA 4XCSA 4EO3A 3F63A 2FNOA 1EP8A 2ON5A 2N5BA 4MP4A 3QFBC 1BYEA 3GKXA 2YWMA 4WR4A 1K0AA 4HU7A 3GN3A 2DSAA 1UVZA 4GSTA 5DALB 3M9KA 1J08A 3DXBA 3WYWA 3TJGA 3D5JA 2CVBA 4O5RA 3KEBA 4IELA 2H30A 5D9TA 2OE3A 1Z3EA 2H01A 4ID0A 4KA0A 4PQHA 4YQUA 2JACA 2YCDA 4KNDA 4AJ7A 3VPTA 4N30A 4POBA 2LRTA 4AGSA 1SL1B 2LJKA 3ERGA 3FR3A 3IK9A 5D9VA 4YQMA 3N5OA 2DIZA 3KIJA 2ALBA 2FY6A 3KCMA 2KOKA 2CZ3A 6GSXA 1Z9HA 3G7JA 3EE2A 3LJRA 3AY8A 4NPBA 2MBTA 1F2EA 4MJAA 2GSQA 5H5QA 4PQ1A 3HZ8A 3SWLA 4EC0A 1X9MB 2G0FA 1PN9A 1PKWA 2IMIA 4I8BA 3N9JA 4OD7A 1GSYA 3VWVA 1GTBA 1KNGA 2GVPA 1H75A 3FR6A 1AW9A 1LBKA 5F07A 3IC4A 3PGTA 4FYCA 2CA8A 2IMFA 4EXJA 4V1Ag 1TI3A 4PXOA 2C3TA 3ZTLA 2V6KA 1XW9A 1Z5YE 1ZYQB 4IW9A 4PUFC 1ZYEA 1NHYA 1K0DA 2MMOA 2IMEA 1VF1A 2VUPA 2FWHA 4XRDA 5ECIB 4TW5A 1WMJA 4ECBA 4EL1A 1SD9A 1C72A 1SYRA 4WETA 4JU5A 5G1KA 1X5DA 4MCUA 1G7EA 2Z9SA 4WF4A 1G6YA 3UOMA 4KX4A 1YF1A 4P3YB 2I3YA 1BQ7A 1PL1A 4GLTA 2B5XA 1M9AA 2ZCTA 2IFQB 2M72A 1SKRB 2JADA 2HE3A 4XTSA 2E7PA 3EC3A 3P8WA 4HQZA 1SKSB 5LCZA 1Z6MA 1HNCA 2C80A 2H8LA 2LKUA 5C04A 2C8UA 2PPTA 2YNXA 2MBSA 2OJLA 2WS2A 4ILFA 1V9WA 3A5WA 3K8NA 1V57A 1Y25A 3TGZA 3D0ZA 3IPZA 3H93A 2JU5A 1PQNA 2LJAA 5IPHA 3C71A 4HU9A 1XW6A 3TKSC 5HFGA 2KUCA 1DE2A 1JLWA 1VRSD 3KM6A 3KMOA 3ZIVA 4L0UA 4F0CA 2VOCA 3HY2A 4MDCA 5DQSA 4TXVA 2LSTA 5AN1A 6GSWA 3KP9A 4MH3A 4TR4A 4POMA 3BD2A 2YJHA 3UBKA 5B8BA 3GRXA 1ZCPA 2XBQA 2QKEA 1JZRA 14GSA 2E2GA 4X1UA 4NAXA 5DAKB 2VIMA 4MZCA 5INYA 4OFMA 3KH7A 2DBCA 5J41A 2MMAA 3L9UA 1ERWA 2GSRA 3UJ1A 1KTEA 1AXDA 2LJRA 1YJ6A 4WBJA 1R5AA 4IP6A 4L5LA 3CSIA 1E2YA 4E8HA 3NOFA 1X0RA 1QXHA 1XWKA 4HDEA 4HUAA 2H6XA 4ZBBA 3GKMA 2H1DA 1T7PB 3G7IA 1XWGA 3S9FA 2C3QA 5D73A 10GSA 5AIXA 1VGLA 1I9DA 4LMWA 5IOWA 1SJ6A 4PUAA 1GUMA 2GT5A 2RLIA 3G9BA 4D73A 2CZ2A 2BTOT 1X5EA 4V2LA 5ECHB 1W89A 2YZUA 5FWGA 2JL4A 2V32A 1DSBA 2IWTA 4MK3A 3CMIA 2PVOC 3LXZA 4XS6A 4WEYA 1XVWA 3GIXA 2VCVA 3TOTA 5A4VA 2H1GA 2PGTA 3TB2A 3RHBA 3C8EA 2IIYA 6GSUA 5DALA 1F37A 3IR4A 1NHOA 1DUGA 1PX6A 1UC7A 1M7TA 2H6ZA 5B8AA 4KUNA 1GLPA 2OBKA 2VL9A 1RW1A 4I5QA 3A2XA 1FVKA 5JWRB 2LNSA 4FH8A 1V2AA 1GSQA 3HVVA 3UVTA 4HZ2A 2H66A 1BAYA 6GSVA 2L59A 1THXA 4KSMA 1USBA 3DD3A 2LQQA 1TI1A 5HR2A 4TN8A 3PR8A 3DVWA 1QFNA 1UN2A 5HR1A 5C00A 1BJXA 3ZLPA 1GUHA 4J2FA 2VCZA 4Z7XA 1PSQA 3RPNA 2KP1A 4POLA 4IBPA 4X0XA 3DEXA 3KTLA 2B1KA 1TKDB 4HOJA 4LMVA 2DC5A 4LL1B 3F6FA 2H74A 2JSZA 3J7Yk 2HSYA 2GDRA 1A23A 1ST9A 4KE3A 3QD9A 4JR6A 1PA3A 2YJ7A 2HYXA 2VD0A 4HS1A 5E59A 3CSHA 2F3MA 1GRXA 1YY7A 2X99A 2H0GA 3QCPA 1AIUA 3QDNA 3IXRA 2HZEB 3HKRA 2FA8A 2L6DA 4XIHA 4HJMA 3TRQA 3W6GA 1HNBA 4NV5A 2WZ9A 1GLQA 3FW2A 2VLTA 3GMFA 2F8FA 1EGRA 5D9XA 1T4ZA 3APQA 2C4JA 5A5KA 2X64A 3APOA 4NHZA 1K0MA 1EZKA 3IK7A 1J9BA 3QR6A 2DJ3A 4K1FA 5IMFA 2R2JA 4TR3A 1GNWA 4K0GA 1FG4A 2IFQA 4L5OA 1EP7A 2R4VA 4J57E 4O92A 3GA4A 1OVNA 3FR9A 4HI7A 4IVFA 2HSHA 2J9HA 2CV4A 2VLVA 5IM9A 1QQ2A 1JHBA 1FHEA 1OYJA 2FWGA 1YF0A 4NMUA 1CQGA 2YPMA 4IQAA 3L0HA 4BL7A 3LFLA 3BCKA 3QPMA 1ZOFA 2FCHA 1H4OA 4IN0A 1YEPA 1V98A 4EUYA 1IYHA 4EVMA 3Q19A 4TVEA 5ENUA 2AV4A 2CQ9A 5G5FA 1ILOA 2IPAA 4PNGA 3LXTA 5D93A 4ZL8A 1NM3A 2GZYA 2VAFA 3P2AA 4TR0A 3VURA 1M99A 3Q6OA 3QOUA 3CRUA 2X8CA 4IS0A 2V1MA 4Q5QA 2CX3A 2DJ1A 2FD3A 3UEMA 1T4YA 3ZFLA 2H75A 4ZL9A 3CTGA 1U87A 2PVQA 3LQ7A 4DSQA 2LNTA 3ZL5A 2QC7A 4IJ3A 3GTUB 2A2RA 2LS5A 1TTZA 2B6MA 1VF3A 2GLRA 1M2DA 2RUEA 1XOBA 2P5RA 1U3IA 2B7KA 2XBIA 4GSNA 2IL3A 2XHFA 3IDVA 2FHEA 3FYGA 3BJ5A 2FUG2 4CDOA 4TKYA 2DJKA 5G31A 4V2NA 5AISA 3CRTA 5DQYA 1O7UA 4N10A 4MZWA 4OCEA 1ABAA 3LGCA 4TXOB 2PU9C 4MPFA 1GSDA 4PURA 4PGTA 1V58A 1BEDA 4KCEA 1PGTA 3F4SA 3TCOA 4ISDA 2V41A 2VLUA 1YZXA 4POKA 2GGTA 2G2QA 1SD8A 1XXUA 1QMVA 2I9HA 3QAGA 4Q5FA 2J23A 4ZL7A 2LQOA 1WIKA 3V1WA 4GXZA 2GTUA 1K0NA 2ES7A 2YANA 2V2GA 5G30A 3LSZA 3KD0A 1DBYA 4NWYA 1ZL9A 1TK8B 1XCCA 4EKZA 3D21A 1ERVA 5ID2B 2OACA 1YKCA 1A2MA 2YV7A 2H72A 5G2ZA 4EE0A 4NXIA 4ZB8A 2PBJA 2NVLA 3ZVJD 1JZOA 4K6XA 1F6MC 1WOUA 5D9WA 3FK8A 5CO3A 4TOPA 4TR1A 4HJ2A 1TW9A 4IJIA 3FY7A 2ON7A 2DMMA 5FT3A 2H0HA 2O89A 1TK5B 4CW9A 1GTAA 4WXTA 5F06A 1RQMA 4LLRA 5F8BA 2BMXA 5J9BA 1SU9A 5IOXA 2CX4A 4ZB6A 1HQOA 1FB6A 5AGYA 4QL9A 2PUKC 1JFUA 3ERWA 5IO2A 2VCTA 3G7YA 1WP0A 2MMNA 2VO4A 1AUCA 2P0GA 3GKNA 2YP6A 1U6TA 2AHEA 3IV4A 4OO5A 1DE1A 1ERTA 1MDJA 2AAWA 3HJPA 3FRCA 1SJZA 3MAKA 5A4UA 3EMPA 1MDKA 2V6OA 1EV9A 3IHQA 5B7CA 4K7NA 3WT1A 18GSA 1WPIA 4BVXA 5COHA 3M8NA 4ECIA 2FWFA 1B8XA 5JCGA 4GRFA 4LL4B 8GSSA 5F05A 3TJFA 3M9JA 3BOAA 1PKZA 4KW6A 1W4VA 3ED3A 1PL2A 2VL2A 1K0BA 4KH7A 4F2IA 1MD4A 1K3LA 4IQ1A 3H79A 3ISOA 3O6TA 4IGJA 2YZHA 3BBYA 4OWYA 5ECKB 5EL8A 2HI7A 3E0UA 3ZMLA 3TDGA 5GAPD 5DCGA 1PMTA 3F0IA 3HVSA 1GH2A 2CVDA 2CVKA 4WR5A 1XZOA 1ZGNA 1TU8A 5ECSA 5HQPA 1AAZA 5CAXA 2L6CA 5GSTA 3I9V2 4GWRA 2BJXA 3DGQA 3M3MA 4ZB9A 2XC2A 3C1RA 5DJMA 3PINA 1G0TA 4MJCA 4I2UA 2NPBA 2YWOA 5J9CA 1SL0B 3TJBA 2I4AA 5GZZB 1TRSA 5JWQB 5CP1A 2L4QA 1A0FA 2H0IA 4XS4B 2H1AA 3VPQA 3D6IA 1B9YC 3MDKA 1U3AA 1M2BA 5FHIA 4EDZA 1NW2A 2H73A 4Q5RA 1JZWA 3F3RA 3DRNA 4XHMA 5ECNB 3U6VA 3HVXA 4IP1A 2EIQA 4GTUA 1XPVA 3PH9A 4KCAA 2O8VB 3VLNA 3VFIA 2XPEA 3L9VA 1XWBA 5IMAA 4MA9A 2M46A 3DYRA 3F4TA 3KGKA 4G9HA 2PN8A 3FKFA 2OA7A 2LRNA 2VCQA 3GKKA 1Z6NA 2XPDA 2K8SA 1PRXA 3UIWA 1TXXA 5B6NA 4O32A 1G6WA 3FZ9A 4AJ8A 1GUKA 2H70A 2M80A 1T8EB 3OR5A 3GX8A 3APSA 1N8JA 3GH9A 3GYKA 3H4KA 3EINA 3VI7A 3CSJA 1SK0A 6GSSA 2MYGA 4E8EA 2DJJA 4K7OA 3GTUA 2N5FA 5CREA 2I1UA 4JBBA 3WD6A 2YWNA 1GSSA 1ON4A 2CT6A 2LRCA 3LWAA 3F4RA 1WE0A 5JCUA 3RPPA 1OE8A 1XVQA 4TRXA 3HJMA 4ZIJA 1XFLA 4LA1A 1Q98A 5G1LA 4NHWA 1O8WA 4H86A 3C7MA 4OCFA 3HZ4A 4BWQA 1GSFA 1S3AA 1GP1A 1K0OA 4ML6A 4ZBDA 2X8HA 2WB9A 2C0GA 2O87A 3LYKA 1TOFA 4ACSA 1YKAA 2O85A 4TXOA 5HR0A 5D96A 16GSA 4L8EA 1ZZYA 2R5GA 5KN1A 1GNEA 2EIRA 4AF2A 3L9SA 4HEA2 1Z7PA 4RUVA 4ECCA 3GL3A 1AQXA 2OE1A 3E3EA 2L57A 1TK0B 3GX0A 3HJOA 1GSUA 2B7JA 3TKQA 2AB6A 3A2VA 2GSTA 1FO5A 3A2WA 3TKSE 3VI5A 4F9ZA 2HRFA 2IMDA 2R3XA 1HD2A 1LJRA 3ME7A 5DJLA 4DEJA 4KGIA 1QGVA 1VF4A 3GUSA 3TJJA 1A2JA 2QGVA 5IQYA 3TKRA 5ID2A 2K6VA 2IMKA 5DDLA 4G19A 5IPGA 2GSSA 1FAAA 5KN0A 2YWIA 1K3YA 4G10A 4MF6A 2R6KA 1NSWA 3KP8A 4WBRD 1B48A 2HXKA 4DSSB 4ULXA 4OO4A 1SENA 5HFIA 5KEJA 5ELGA 2NDOA 11GSA 1B4QA 4RQRA 3UMAA 4F82A 1Y6EA 4YAVA 4K0NA 2OADA 5LNKe 2VL3A 1XWCA 4RI7A 1S3DA 4MF7A 1GL8A 2JZSA 3EURA 1YEXA 4QL7A 1T00A 2REMA 3IOSA 3BCIA 3TKSA 3VWUA 1F3AA 3ZZXA 3GSSA 1OC9B 3DWVA 1OKDA 3ZRDA 1N2AA 4V1Ap 1I5GA 4OFNA 1OC3A 1GULA 2RM6A 1A2LA 3HCZA 5J4UA 3ZREA 1TRUA 1R4WA 4FO5A 2ZNMA 5ECQB 5KN2A 3F8UA 1TU7A 3TRXA 2AUVA 5JCWA 1EGOA 3ERFA 1JZDA 2L5OA 3FZAA 2AJQB 3MSZA 3QAWA 4I97A 2HNLA 3KH9A 4MPGA 1CQHA 4MZBA 2IN3A 4N11A 1XOAA 5J5NA 5CNWA 3W8SA 3FEUA 1F9MA 1X9SB 1BX9A 4PX1A 5ECLB 4K9ZA 2FA4A 4BWSA 2VM1A 3IBHA 4K2DA 3UARA 3GHAA 3TRPA 4KSOA 4KDUA 5DAKA 2GS3A 4FYBA 1BG5A 2JSYA 1O85A 1R5PA 4MABA 5IMDA 5ECPB 2FWEA 1PD21 3I69A 5E4WA 2B3SA 3MNGA 2CAQA 1WRYA 2F9SA 2N5AA 2B5YA 3EWLA 3GURA 5D8IA 3DMLA 5HFKA 1ERUA 4KDXA 5DVBA 5CRHA 3LYPA 4CHSA 2TRXA 1GTUA 2DIYA 3NIVA 1XBSA 2L4CA 2MMZA 2C1YA 3TJKA 2WFCA 4XS4A 1KEBA 4MH2A 3H1NA 4J56E 1MEKA 3IRAA 5J3RA 2TRCP 3UBLA 2H76A 2OBIA 1ZMAA 5ECOB 6GSYA 3LORA 3FZ5A 2C0DA 2EC4A 1Z7RA 3UL3A 2DJ0A 2VM2A 2DJ2A 3EMXA 2FLSA 3UVHA 3DKSA 2WULA 4MMMA 3IAM2 3C1SA 1WJKA 3WGEA 3FHKA 1EWXA 4ZXGA 3C73A 3SBCA 3WGXA 2LUSA 3MWHA 2NBSA 4YH2A 1R7HA 1OKTA 2KP2A 3D4TA 1T1VA 4MF5A 4O7HA 2X8GA 3D22A 3GL5A 4MLYA 2E2MA 3ME8A 1SL2B 4XRAA 3QMXA 2WRTA 6GSTA 4Q5NA 2NTOA 2PWJA 2GQKA 2HFDA 5G5EA 2F51A 5IIZA 3EYTA 2FGXA 5ABRA 1EEJA 4HQSA 4NV2A 3ZITA 2EIOA 4GQFA 3LG6A 4BPYA 1K0CA 3GV1A 2WJUA 3W8JA 2LV3A 1F3BA 1SYXA 2B1LA 2DMLA 2GZPA 4EDYA 3L78A 1QUWA 4JZQA 1GWCA 4L0WA 1B9XC 4AJ6A 7GSSA 3F9UA 1WWJA 4QQ7A 2H6YA 3CXGA 3I43A 5CRDA 3M0FA 3VWXA 2DLXA 2YN1A 2ZUPA 1MD3A 3F6DA 3EVIA 1A24A 2AYTA 4N0ZA 4YQVA 4ZILA 3CTFA 2WCIA 3DIEA 2RM5A 5EY6A 3KMNA 3GH6A 1A0RP 3I6AA 1YQ1A 3HD5A 1KBNA 3D4MA 1T3BA 4JE1A 1SK2A 2HZEA 1SK1A 4EF0A 5CRWA 2HLSA 1A8YA 1U88A 5ECRB 2H19A 3RHCA 3US3A 4WF5A 5EVOA 1S3CA 2QSIA 3IA1A 22GSA 5DCHA 2HT9A 1URMA 3RAZA 13GSA 1GSEA 2TIRA 3KZQA 4DSSA 1HYUA 3VK9A 3GFKA 5JWOB 2IJYA 19GSA 2WDUA 4X43A 3KXOA 1SKWB 4V2MA 2P31A 4G2EA 3KJYA 3A3TA 3HHVA 5ELAA 2GQLA 2LTKA 1YDKA 2C3NA 1M2AA 5ECMB 1EEMA 1FB0A 2GZZA 2RUFA 4IKHA 2OE0A 1GTIA 1OC9A 2PMTA 3WGDA 2F8AA 3U5RE 2OKAA 3M1GA 3O3TA 9GSSA 2JZRA 3QFAC 4ECJA 12GSA 1M0UA 1MDIA 2C0EA 1V40A 5IMCA 3Q74A 1VF2A 3HA9A 2CAIA 1EOHA 5LD0A 2VD1A 3Q18A 1FW1A 1EOGA 1OAZA 3HXSA 3FZ4A 2H71A 5EPFA 4YAPA 3H8QA 5GSSA 3HYPA 5DBQA 4GSSA 1FOVA 5AIVA 1M9BA 2VCXA 4GF0A 4MJEA 2I81A 2E0QA 4GCIA 1O8XA 1EV4A 1AC1A 1QK8A 4TR1B 2P5QA 1LU4A 3IAS2 5H5RA 4K8MA 5IO0A 3JCML 3RBTA 2GQMA
chains in the Genus database with same CATH superfamily
4I6XA 3ZIJA 5GAND 4FIWA 3GNJA 4F0BA 4ZBAA 4GQCA 4JR4A 4X4JA 1TDIA 3O76A 4DSRA 3HDCA 3TUEA 4MNNA 2K8VA 1JLVA 4FYUA 3VWWA 4KB3A 3DVXA 5CRGA 1FOHA 5IMVA 1ML6A 3CYNA 3UAPA 1AQVA 4OMVA 2MZCA 4G0KA 3ZYWA 5HR3A 4BA7A 1MTCA 1O6JA 2GT6A 1O73A 4N0VA 2A2SA 3ZVJA 1THOA 2L5LA 1HNAA 2LEGA 2O7KA 5KN3A 4XS1A 2YOIA 2D2ZA 5F0GA 2K18A 1IYIA 3L4NA 2C0FA 3R2QA 2JZTA 3ZMKA 2R37A 4G0LA 5H5SA 1A8LA 4F03A 2K9FA 1B4PA 1E6BA 5L71A 1XWAA 4K7IA 3P7XA 3QAVA 3LEFA 1Q4JA 1OC8A 1R26A 1X9WB 1XIYA 3RDWA 1FVJA 4RI6A 2WGRA 1TJDA 1OE7A 2A4VA 2VL2C 4I2TA 2KHPA 1XW5A 2VCWA 1X5CA 5B6MA 4KDYA 4CY6A 4JRRA 1G7OA 3F3QA 1TRVA 4HZ4A 4ML1A 2B5EA 1O81A 2YV9A 1ACVA 1RK4A 4OFTA 4KAEA 5CYYA 3EU3A 3NZNA 1J0FA 1UA5A 2HRNA 2PERA 20GSA 1PX7A 3EU4A 1SJIA 4BVYA 2KLXA 1K3OA 3TOUA 1TP9A 4IHUA 1AQWA 2RIIA 3ZFBA 4D73B 3TKPA 3CBUA 4JEDA 4PNFA 4WKWA 3KTBA 3E9JB 2H1BA 3WT2A 2HZFA 4RQXA 3IE3A 4DVCA 4MJBA 3J7Yb 5IMZA 5A4WA 4O5QA 4PQIA 1TRWA 3P90A 3GSTA 17GSA 4XCSA 4EO3A 3F63A 2FNOA 1EP8A 2ON5A 2N5BA 4MP4A 3QFBC 1BYEA 3GKXA 2YWMA 4WR4A 1K0AA 4HU7A 3GN3A 2DSAA 1UVZA 4GSTA 5DALB 3M9KA 1J08A 3DXBA 3WYWA 3TJGA 3D5JA 3A5IA 2CVBA 4O5RA 3KEBA 4IELA 2H30A 5D9TA 2OE3A 1Z3EA 2H01A 4ID0A 4KA0A 4PQHA 4YQUA 2JACA 2YCDA 4KNDA 4AJ7A 3VPTA 4ICYA 4N30A 4POBA 2LRTA 4AGSA 1SL1B 2LJKA 3MIXA 3ERGA 3FR3A 3IK9A 5D9VA 4YQMA 3N5OA 2DIZA 2DKIA 3KIJA 2ALBA 2FY6A 3KCMA 2KOKA 2QA2A 2CZ3A 6GSXA 1Z9HA 3G7JA 3EE2A 3LJRA 3AY8A 4NPBA 2MBTA 1F2EA 4MJAA 2GSQA 5H5QA 4PQ1A 3HZ8A 3SWLA 4EC0A 1X9MB 2G0FA 1PN9A 1PKWA 2IMIA 4I8BA 3N9JA 4OD7A 1GSYA 3VWVA 1GTBA 1KNGA 2GVPA 1H75A 3FR6A 1AW9A 4YKGA 1LBKA 5F07A 3IC4A 3PGTA 4FYCA 2CA8A 2IMFA 4EXJA 4V1Ag 3PPUA 1TI3A 4PXOA 2C3TA 3ZTLA 2V6KA 1XW9A 1Z5YE 1ZYQB 4IW9A 4PUFC 1ZYEA 1NHYA 1K0DA 2MMOA 2IMEA 1VF1A 2X4AA 2VUPA 2FWHA 4XRDA 5ECIB 4TW5A 1WMJA 4ECBA 4EL1A 1SD9A 1C72A 2UZ8A 1SYRA 4WETA 4JU5A 5G1KA 1X5DA 4MCUA 1G7EA 2Z9SA 4WF4A 1G6YA 3UOMA 4KX4A 1YF1A 4P3YB 2I3YA 1BQ7A 1PL1A 4GLTA 2B5XA 1M9AA 2ZCTA 1ZYPA 2IFQB 2M72A 1SKRB 2JADA 2HE3A 4XTSA 2E7PA 3EC3A 2QA1A 3P8WA 4HQZA 1SKSB 5LCZA 1Z6MA 1HNCA 2C80A 2H8LA 2LKUA 5C04A 2C8UA 2PPTA 2YNXA 2MBSA 2OJLA 2WS2A 4ILFA 1V9WA 3A5WA 3K8NA 1V57A 1Y25A 3TGZA 3D0ZA 3IPZA 3H93A 2JU5A 1PQNA 4BL7B 2LJAA 5IPHA 3C71A 4HU9A 1XW6A 3TKSC 5HFGA 2KUCA 1DE2A 1JLWA 1VRSD 3KM6A 3KMOA 3ZIVA 4L0UA 4F0CA 2VOCA 3HY2A 4MDCA 5DQSA 4TXVA 2LSTA 5AN1A 6GSWA 3KP9A 4MH3A 4TR4A 4POMA 3BD2A 2YJHA 3UBKA 5B8BA 3GRXA 1ZCPA 2XBQA 2QKEA 1JZRA 14GSA 2E2GA 4X1UA 4NAXA 5DAKB 2VIMA 4MZCA 5INYA 4OFMA 3KH7A 2DBCA 5J41A 2MMAA 3L9UA 1ERWA 2GSRA 3UJ1A 1KTEA 1AXDA 2LJRA 1YJ6A 4WBJA 1R5AA 4IP6A 4L5LA 3CSIA 1E2YA 4E8HA 4USSA 3NOFA 1X0RA 1QXHA 1XWKA 4HDEA 4HUAA 2H6XA 4ZBBA 3GKMA 1S3RA 2H1DA 1T7PB 3G7IA 1XWGA 2A2PA 3S9FA 2C3QA 5D73A 10GSA 5AIXA 1VGLA 1I9DA 4LMWA 5IOWA 4HSCX 1SJ6A 4PUAA 1GUMA 2GT5A 2RLIA 3G9BA 4D73A 2CZ2A 2BTOT 1X5EA 4V2LA 5ECHB 1W89A 2YZUA 5FWGA 2JL4A 2V32A 1DSBA 2IWTA 4MK3A 3CMIA 2PVOC 3LXZA 4XS6A 4WEYA 4A5PA 1XVWA 3GIXA 2VCVA 3TOTA 5A4VA 2H1GA 2PGTA 3TB2A 3RHBA 3C8EA 2IIYA 6GSUA 1F37A 3IR4A 5DALA 1NHOA 1DUGA 1PX6A 1UC7A 1M7TA 2H6ZA 5B8AA 4KUNA 1GLPA 2OBKA 2VL9A 1RW1A 3MYDA 4I5QA 3A2XA 1FVKA 5JWRB 2LNSA 4FH8A 1V2AA 1GSQA 3HVVA 3UVTA 4HZ2A 2H66A 1BAYA 6GSVA 2L59A 1THXA 4KSMA 1USBA 3DD3A 2LQQA 1TI1A 5HR2A 4BVXB 4K2XA 4TN8A 3PR8A 3DVWA 1QFNA 1UN2A 5HR1A 5C00A 1BJXA 3ZLPA 1GUHA 4J2FA 2VCZA 4Z7XA 1PSQA 3RPNA 2KP1A 4POLA 4IBPA 4X0XA 3DEXA 3KTLA 2B1KA 1TKDB 4HOJA 4LMVA 2DC5A 4LL1B 3F6FA 2H74A 2JSZA 3J7Yk 2HSYA 2GDRA 1A23A 1ST9A 4KE3A 3QD9A 4JR6A 1PA3A 2YJ7A 2HYXA 2VD0A 4HS1A 5E59A 3CSHA 2F3MA 1GRXA 1YY7A 2X99A 2H0GA 3QCPA 1AIUA 3QDNA 3IXRA 2HZEB 3HKRA 2FA8A 2L6DA 4XIHA 4HJMA 3TRQA 3W6GA 1HNBA 4NV5A 2WZ9A 1GLQA 3FW2A 2VLTA 3GMFA 2F8FA 1EGRA 5D9XA 1T4ZA 3APQA 2C4JA 5A5KA 2X64A 3APOA 4NHZA 1K0MA 1EZKA 3IK7A 1J9BA 3QR6A 2DJ3A 4K1FA 5IMFA 2R2JA 4TR3A 1GNWA 4K0GA 2R0PA 1FG4A 2IFQA 4L5OA 1EP7A 2R4VA 4J57E 4O92A 3GA4A 1OVNA 3FR9A 4HI7A 4IVFA 2HSHA 2J9HA 2CV4A 2VLVA 5IM9A 1QQ2A 1JHBA 1ZYNA 1FHEA 1OYJA 2FWGA 1YF0A 4NMUA 1CQGA 2YPMA 4IQAA 3L0HA 4BL7A 3LFLA 3BCKA 3QPMA 1ZOFA 2FCHA 1H4OA 4IN0A 1YEPA 1V98A 4EUYA 1IYHA 4EVMA 3Q19A 4TVEA 5ENUA 2AV4A 2CQ9A 5G5FA 1ILOA 2IPAA 4PNGA 3LXTA 5D93A 4ZL8A 1NM3A 2GZYA 2VAFA 3P2AA 4TR0A 3VURA 1M99A 3Q6OA 3QOUA 3CRUA 2X8CA 4IS0A 2V1MA 4Q5QA 2CX3A 2DJ1A 2FD3A 3UEMA 1T4YA 3ZFLA 2H75A 4ZL9A 3CTGA 1U87A 2PVQA 3LQ7A 4DSQA 2LNTA 3ZL5A 2QC7A 4IJ3A 3GTUB 2A2RA 2LS5A 1TTZA 2B6MA 1VF3A 2GLRA 1M2DA 2RUEA 1XOBA 2P5RA 1U3IA 2B7KA 2XBIA 4GSNA 2IL3A 2XHFA 3IDVA 2FHEA 3FYGA 3BJ5A 2FUG2 4CDOA 4TKYA 2DJKA 5G31A 4V2NA 5AISA 3CRTA 2X49A 5DQYA 1O7UA 4N10A 4MZWA 4OCEA 1ABAA 3LGCA 4TXOB 2PU9C 4MPFA 1GSDA 4PURA 4PGTA 1XG8A 1V58A 1BEDA 4KCEA 1PGTA 3F4SA 1M3IA 3TCOA 4ISDA 2V41A 2VLUA 1YZXA 4POKA 2GGTA 2G2QA 1SD8A 1XXUA 1QMVA 2I9HA 3QAGA 4Q5FA 2J23A 4ZL7A 2LQOA 1WIKA 3V1WA 4GXZA 2GTUA 1K0NA 2ES7A 2YANA 2V2GA 5G30A 3LSZA 3KD0A 1DBYA 4NWYA 1ZL9A 1TK8B 1XCCA 4EKZA 3D21A 1ERVA 5ID2B 2OACA 1YKCA 1A2MA 2YV7A 2H72A 5G2ZA 4EE0A 4NXIA 4ZB8A 2PBJA 2NVLA 3ZVJD 1JZOA 4K6XA 1F6MC 1WOUA 5D9WA 3FK8A 5CO3A 4TOPA 4TR1A 4HJ2A 4EIPA 1TW9A 4IJIA 3FY7A 2ON7A 2DMMA 5FT3A 2H0HA 2O89A 1TK5B 4CW9A 1GTAA 4WXTA 5F06A 1RQMA 4LLRA 5F8BA 2BMXA 5J9BA 1SU9A 5IOXA 2CX4A 4ZB6A 1HQOA 1FB6A 5AGYA 4QL9A 2PUKC 1JFUA 3ERWA 5IO2A 2VCTA 3G7YA 1WP0A 2MMNA 2VO4A 1AUCA 2P0GA 3GKNA 2YP6A 1U6TA 2AHEA 3IV4A 4OO5A 1DE1A 1ERTA 1MDJA 2AAWA 3HJPA 3FRCA 1SJZA 3MAKA 5A4UA 3EMPA 1MDKA 2V6OA 1EV9A 3IHQA 5B7CA 4K7NA 3WT1A 18GSA 1WPIA 4BVXA 5COHA 3M8NA 4ECIA 2FWFA 1B8XA 5JCGA 4GRFA 4Z2RA 4LL4B 8GSSA 5F05A 3TJFA 3M9JA 3BOAA 1PKZA 4KW6A 1W4VA 3ED3A 1PL2A 3LW9A 2VL2A 1K0BA 4KH7A 4F2IA 1MD4A 1K3LA 4IQ1A 3H79A 3ISOA 3O6TA 4IGJA 2YZHA 3BBYA 4OWYA 5ECKB 5EL8A 2HI7A 2R0GA 3E0UA 3IC8A 3ZMLA 3TDGA 5GAPD 5DCGA 1PMTA 3F0IA 3HVSA 1GH2A 2CVDA 2CVKA 4WR5A 1XZOA 2R0CA 1ZGNA 1TU8A 5ECSA 5HQPA 1AAZA 5CAXA 2L6CA 5GSTA 3I9V2 4GWRA 2BJXA 3DGQA 3M3MA 4ZB9A 2XC2A 3C1RA 4FQUA 5DJMA 3PINA 1G0TA 4MJCA 4I2UA 2NPBA 2YWOA 5J9CA 1SL0B 3TJBA 2I4AA 5GZZB 1TRSA 5JWQB 5CP1A 2L4QA 1A0FA 2H0IA 4XS4B 2H1AA 3VPQA 3D6IA 1B9YC 3MDKA 1U3AA 1M2BA 5FHIA 4EDZA 1NW2A 2H73A 4Q5RA 1JZWA 3F3RA 3DRNA 4XHMA 5ECNB 3U6VA 3HVXA 4Z2UA 4IP1A 2EIQA 4GTUA 1XPVA 3PH9A 4KCAA 2O8VB 3VLNA 3VFIA 2XPEA 3L9VA 1XWBA 5IMAA 4MA9A 2M46A 3DYRA 3EPTA 3F4TA 3KGKA 4G9HA 1PN0A 2PN8A 4KF9A 3FKFA 2OA7A 2LRNA 2VCQA 3GKKA 1Z6NA 2XPDA 2K8SA 1PRXA 3UIWA 1TXXA 5B6NA 4O32A 1G6WA 3FZ9A 4AJ8A 1GUKA 2H70A 2M80A 1T8EB 3OR5A 3GX8A 3APSA 1N8JA 3GH9A 3GYKA 3H4KA 3EINA 3VI7A 3CSJA 1SK0A 6GSSA 2MYGA 4E8EA 2DJJA 4K7OA 3GTUA 2N5FA 5CREA 2I1UA 2A4HA 4JBBA 2YWNA 1GSSA 3WD6A 1ON4A 2CT6A 2LRCA 3LWAA 3F4RA 3HVNA 1WE0A 5JCUA 1PFOA 3RPPA 1OE8A 1XVQA 4TRXA 3HJMA 4ZIJA 1XFLA 4LA1A 5KOXA 1Q98A 5G1LA 4NHWA 1O8WA 2HRKA 4H86A 3C7MA 4OCFA 3HZ4A 4BWQA 1GSFA 1S3AA 1GP1A 1K0OA 4ML6A 4ZBDA 2X8HA 2WB9A 2C0GA 2O87A 3LYKA 1TOFA 4ACSA 1YKAA 2O85A 4TXOA 5HR0A 5D96A 16GSA 4L8EA 1ZZYA 2R5GA 5KN1A 1GNEA 2EIRA 4AF2A 3L9SA 4HEA2 1Z7PA 4RUVA 4ECCA 3CQFA 3GL3A 1AQXA 2OE1A 3E3EA 2L57A 1TK0B 4CY8A 3GX0A 3HJOA 1GSUA 2B7JA 3TKQA 2AB6A 3A2VA 2GSTA 1FO5A 3A2WA 3TKSE 3VI5A 4F9ZA 2HRFA 2IMDA 2R3XA 1HD2A 1LJRA 3ME7A 5DJLA 4DEJA 4KGIA 1QGVA 1VF4A 3GUSA 3TJJA 1A2JA 2QGVA 5IQYA 3TKRA 5ID2A 2K6VA 2IMKA 5DDLA 4G19A 5IPGA 2GSSA 1FAAA 5KN0A 2YWIA 4Z2TA 1K3YA 4G10A 4MF6A 2R6KA 1NSWA 3KP8A 4WBRD 1B48A 2HXKA 4DSSB 4ULXA 4OO4A 1SENA 5HFIA 5KEJA 5ELGA 2NDOA 11GSA 1B4QA 4RQRA 3UMAA 4F82A 1Y6EA 4YAVA 4K0NA 2OADA 5LNKe 2VL3A 1XWCA 4RI7A 1S3DA 4MF7A 1GL8A 2JZSA 3EURA 4PTSA 1YEXA 4QL7A 1T00A 2REMA 3IOSA 3BCIA 3TKSA 3VWUA 1F3AA 3ZZXA 3GSSA 4EIQA 1OC9B 3DWVA 1OKDA 3ZRDA 1N2AA 4V1Ap 1I5GA 4OFNA 1OC3A 1GULA 2RM6A 1A2LA 3HCZA 5J4UA 3ZREA 1TRUA 1R4WA 4FO5A 2ZNMA 5ECQB 5KN2A 3F8UA 1TU7A 3TRXA 2AUVA 5JCWA 1EGOA 3ERFA 1JZDA 2L5OA 3FZAA 2AJQB 3MSZA 3QAWA 4I97A 2HNLA 3KH9A 4MPGA 1CQHA 4MZBA 2IN3A 4N11A 1XOAA 5J5NA 5CNWA 3W8SA 3FEUA 1F9MA 1X9SB 1BX9A 4PX1A 5ECLB 4K9ZA 2FA4A 4BWSA 2VM1A 3IBHA 4K2DA 3UARA 3GHAA 3TRPA 4KSOA 4KDUA 5DAKA 2GS3A 4FYBA 1BG5A 2JSYA 1O85A 4K5RA 1R5PA 4MABA 5BMUA 5IMDA 5ECPB 2FWEA 1PD21 3I69A 5E4WA 2B3SA 3MNGA 2CAQA 1WRYA 2F9SA 2N5AA 2B5YA 3EWLA 3GURA 5D8IA 3DMLA 5HFKA 1ERUA 4KDXA 5DVBA 5CRHA 2HSMA 3LYPA 4CHSA 2TRXA 1GTUA 2DIYA 3NIVA 1XBSA 2L4CA 2MMZA 2C1YA 3TJKA 2WFCA 4XS4A 1KEBA 4MH2A 3H1NA 4J56E 1MEKA 3IRAA 5J3RA 4O5UA 2TRCP 3UBLA 2H76A 2OBIA 1ZMAA 2HRAA 5ECOB 6GSYA 3LORA 3FZ5A 2C0DA 2EC4A 1Z7RA 3UL3A 2DJ0A 2VM2A 2DJ2A 3EMXA 2FLSA 3UVHA 3DKSA 2WULA 4MMMA 3IAM2 3C1SA 1WJKA 3WGEA 3FHKA 1EWXA 4ZXGA 3C73A 3SBCA 3WGXA 2LUSA 3MWHA 2NBSA 5BRTA 4YH2A 1R7HA 1OKTA 2KP2A 3D4TA 1T1VA 4MF5A 4O7HA 2X8GA 3D22A 3GL5A 4MLYA 2E2MA 3ME8A 1SL2B 4XRAA 3QMXA 2WRTA 6GSTA 4Q5NA 2NTOA 2PWJA 2GQKA 2HFDA 5G5EA 2F51A 5IIZA 3EYTA 2FGXA 5ABRA 4BVYB 1EEJA 4HQSA 4NV2A 4YKFA 2EIOA 3ZITA 4GQFA 3LG6A 4BPYA 1K0CA 3GV1A 2WJUA 3W8JA 2LV3A 1F3BA 1SYXA 5KOWA 1M3JA 2B1LA 2DMLA 2GZPA 4EDYA 3L78A 1QUWA 4JZQA 1GWCA 3R3EA 4L0WA 1B9XC 4AJ6A 7GSSA 3F9UA 1WWJA 4QQ7A 2H6YA 3CXGA 3I43A 5CRDA 3M0FA 3VWXA 2DLXA 2YN1A 2ZUPA 1MD3A 3F6DA 3EVIA 1A24A 2AYTA 4N0ZA 4YQVA 4ZILA 3CTFA 2WCIA 3DIEA 2RM5A 5EY6A 3KMNA 3GH6A 1A0RP 3I6AA 1YQ1A 3HD5A 1KBNA 3D4MA 1T3BA 4JE1A 4G0IA 1SK2A 2HZEA 1SK1A 4EF0A 5CRWA 2HLSA 1A8YA 1U88A 5ECRB 2H19A 3RHCA 3US3A 4WF5A 5EVOA 1S3CA 2QSIA 3IA1A 22GSA 5DCHA 3FMWA 2HT9A 1URMA 3RAZA 13GSA 1GSEA 2TIRA 3KZQA 4DSSA 1HYUA 3VK9A 3GFKA 5JWOB 2IJYA 19GSA 2WDUA 4X43A 3KXOA 1SKWB 4V2MA 2P31A 4G2EA 3KJYA 4K5SA 3A3TA 3HHVA 5ELAA 2GQLA 2LTKA 1YDKA 2C3NA 1M2AA 5ECMB 1EEMA 4BIKA 1FB0A 2GZZA 2RUFA 4IKHA 2DKHA 2OE0A 3IHGA 1GTIA 1OC9A 2PMTA 3WGDA 2F8AA 3U5RE 2OKAA 3M1GA 3O3TA 9GSSA 2JZRA 3QFAC 4ECJA 12GSA 1M0UA 1MDIA 2C0EA 1V40A 5IMCA 3Q74A 1VF2A 3HA9A 2CAIA 1EOHA 5LD0A 2VD1A 3Q18A 1FW1A 1EOGA 1OAZA 3HXSA 3FZ4A 2H71A 5EPFA 4YAPA 3H8QA 5GSSA 3HYPA 5DBQA 4GSSA 1FOVA 5AIVA 1M9BA 2VCXA 4GF0A 4MJEA 2I81A 2E0QA 4GCIA 1O8XA 1EV4A 1AC1A 1QK8A 4TR1B 2P5QA 1LU4A 3IAS2 5H5RA 4K8MA 5IO0A 3JCML 3RBTA 2GQMA
chains in the Genus database with same CATH topology
4I6XA 3ZIJA 5GAND 4FIWA 3GNJA 4F0BA 4ZBAA 4GQCA 4JR4A 4X4JA 1TDIA 3O76A 4DSRA 3HDCA 3TUEA 4MNNA 2K8VA 1JLVA 4FYUA 3VWWA 4KB3A 3DVXA 5CRGA 1FOHA 5IMVA 1ML6A 3CYNA 3UAPA 1AQVA 4OMVA 2MZCA 4G0KA 3ZYWA 5HR3A 4BA7A 1MTCA 1O6JA 2GT6A 1O73A 4N0VA 2A2SA 3ZVJA 1THOA 2L5LA 1HNAA 2LEGA 2O7KA 5KN3A 4XS1A 2YOIA 2D2ZA 5F0GA 2K18A 1IYIA 3L4NA 2C0FA 3R2QA 2JZTA 3ZMKA 2R37A 4G0LA 5H5SA 1A8LA 4F03A 2K9FA 1B4PA 1E6BA 5L71A 1XWAA 4K7IA 3P7XA 3QAVA 3LEFA 1Q4JA 1OC8A 1R26A 1X9WB 1XIYA 3RDWA 1FVJA 4RI6A 2WGRA 1TJDA 1OE7A 2A4VA 2VL2C 4I2TA 2KHPA 1XW5A 2VCWA 1X5CA 5B6MA 4KDYA 4CY6A 4JRRA 1G7OA 3F3QA 1TRVA 4HZ4A 4ML1A 2B5EA 1O81A 2YV9A 1ACVA 1RK4A 4OFTA 4KAEA 5CYYA 3EU3A 3NZNA 1J0FA 1UA5A 2HRNA 2PERA 20GSA 1PX7A 3EU4A 1SJIA 4BVYA 2KLXA 1K3OA 3TOUA 1TP9A 4IHUA 1AQWA 2RIIA 3ZFBA 4D73B 3TKPA 3CBUA 4JEDA 4PNFA 4WKWA 3KTBA 3E9JB 2H1BA 3WT2A 2HZFA 4RQXA 3IE3A 4DVCA 4MJBA 3J7Yb 5IMZA 5A4WA 4O5QA 4PQIA 1TRWA 3P90A 3GSTA 17GSA 4XCSA 4EO3A 3F63A 2FNOA 1EP8A 2ON5A 2N5BA 4MP4A 3QFBC 1BYEA 3GKXA 2YWMA 4WR4A 1K0AA 4HU7A 3GN3A 2DSAA 1UVZA 4GSTA 5DALB 3M9KA 1J08A 3DXBA 3WYWA 3TJGA 3D5JA 3A5IA 2CVBA 4O5RA 3KEBA 4IELA 2H30A 5D9TA 2OE3A 1Z3EA 2H01A 4ID0A 4KA0A 4PQHA 4YQUA 2JACA 2YCDA 4KNDA 4AJ7A 3VPTA 4ICYA 4N30A 4POBA 2LRTA 4AGSA 1SL1B 2LJKA 3MIXA 3ERGA 3FR3A 3IK9A 5D9VA 4YQMA 3N5OA 2DIZA 2DKIA 3KIJA 2ALBA 2FY6A 3KCMA 2KOKA 2QA2A 2CZ3A 6GSXA 1Z9HA 3G7JA 3EE2A 3LJRA 3AY8A 4NPBA 2MBTA 1F2EA 4MJAA 2GSQA 5H5QA 4PQ1A 3HZ8A 3SWLA 4EC0A 1X9MB 2G0FA 1PN9A 1PKWA 2IMIA 4I8BA 3N9JA 4OD7A 1GSYA 3VWVA 1GTBA 1KNGA 2GVPA 1H75A 3FR6A 1AW9A 4YKGA 1LBKA 5F07A 3IC4A 3PGTA 4FYCA 2CA8A 2IMFA 4EXJA 4V1Ag 3PPUA 1TI3A 4PXOA 2C3TA 3ZTLA 2V6KA 1XW9A 1Z5YE 1ZYQB 4IW9A 4PUFC 1ZYEA 1NHYA 1K0DA 2MMOA 2IMEA 1VF1A 2X4AA 2VUPA 2FWHA 4XRDA 5ECIB 4TW5A 1WMJA 4ECBA 4EL1A 1SD9A 1C72A 2UZ8A 1SYRA 4WETA 4JU5A 5G1KA 1X5DA 4MCUA 1G7EA 2Z9SA 4WF4A 1G6YA 3UOMA 4KX4A 1YF1A 4P3YB 2I3YA 1BQ7A 1PL1A 4GLTA 2B5XA 1M9AA 2ZCTA 1ZYPA 2IFQB 2M72A 1SKRB 2JADA 2HE3A 4XTSA 2E7PA 3EC3A 2QA1A 3P8WA 4HQZA 1SKSB 5LCZA 1Z6MA 1HNCA 2C80A 2H8LA 2LKUA 5C04A 2C8UA 2PPTA 2YNXA 2MBSA 2OJLA 2WS2A 4ILFA 1V9WA 3A5WA 3K8NA 1V57A 1Y25A 3TGZA 3D0ZA 3IPZA 3H93A 2JU5A 1PQNA 4BL7B 2LJAA 5IPHA 3C71A 4HU9A 1XW6A 3TKSC 5HFGA 2KUCA 1DE2A 1JLWA 1VRSD 3KM6A 3KMOA 3ZIVA 4L0UA 4F0CA 2VOCA 3HY2A 4MDCA 5DQSA 4TXVA 2LSTA 5AN1A 6GSWA 3KP9A 4MH3A 4TR4A 4POMA 3BD2A 2YJHA 3UBKA 5B8BA 3GRXA 1ZCPA 2XBQA 2QKEA 1JZRA 14GSA 2E2GA 4X1UA 4NAXA 5DAKB 2VIMA 4MZCA 5INYA 4OFMA 3KH7A 2DBCA 5J41A 2MMAA 3L9UA 1ERWA 2GSRA 3UJ1A 1KTEA 1AXDA 2LJRA 1YJ6A 4WBJA 1R5AA 4IP6A 4L5LA 3CSIA 1E2YA 4E8HA 4USSA 3NOFA 1X0RA 1QXHA 1XWKA 4HDEA 4HUAA 2H6XA 4ZBBA 3GKMA 2H1DA 1T7PB 3G7IA 1XWGA 2A2PA 3S9FA 2C3QA 5D73A 10GSA 5AIXA 1VGLA 1I9DA 4LMWA 5IOWA 1SJ6A 4PUAA 1GUMA 2GT5A 2RLIA 3G9BA 4D73A 2CZ2A 2BTOT 1X5EA 4V2LA 5ECHB 1W89A 2YZUA 5FWGA 2JL4A 2V32A 1DSBA 2IWTA 4MK3A 3CMIA 2PVOC 3LXZA 4XS6A 4WEYA 4A5PA 1XVWA 3GIXA 2VCVA 3TOTA 5A4VA 2H1GA 2PGTA 3TB2A 3RHBA 3C8EA 2IIYA 6GSUA 1F37A 3IR4A 5DALA 1NHOA 1DUGA 1PX6A 1UC7A 1M7TA 2H6ZA 5B8AA 4KUNA 1GLPA 2OBKA 2VL9A 1RW1A 3MYDA 4I5QA 3A2XA 1FVKA 5JWRB 2LNSA 4FH8A 1V2AA 1GSQA 3HVVA 3UVTA 4HZ2A 2H66A 1BAYA 6GSVA 2L59A 1THXA 4KSMA 1USBA 3DD3A 2LQQA 1TI1A 5HR2A 4BVXB 4K2XA 4TN8A 3PR8A 3DVWA 1QFNA 1UN2A 5HR1A 5C00A 1BJXA 3ZLPA 1GUHA 4J2FA 2VCZA 4Z7XA 1PSQA 3RPNA 2KP1A 4POLA 4IBPA 4X0XA 3DEXA 3KTLA 2B1KA 1TKDB 4HOJA 4LMVA 2DC5A 4LL1B 3F6FA 2H74A 2JSZA 3J7Yk 2HSYA 2GDRA 1A23A 1ST9A 4KE3A 3QD9A 4JR6A 1PA3A 2YJ7A 2HYXA 2VD0A 4HS1A 5E59A 3CSHA 2F3MA 1GRXA 1YY7A 2X99A 2H0GA 3QCPA 1AIUA 3QDNA 3IXRA 2HZEB 3HKRA 2FA8A 2L6DA 4XIHA 4HJMA 3TRQA 3W6GA 1HNBA 4NV5A 2WZ9A 1GLQA 3FW2A 2VLTA 3GMFA 2F8FA 1EGRA 5D9XA 1T4ZA 3APQA 2C4JA 5A5KA 2X64A 3APOA 4NHZA 1K0MA 1EZKA 3IK7A 1J9BA 3QR6A 2DJ3A 4K1FA 5IMFA 2R2JA 4TR3A 1GNWA 4K0GA 2R0PA 1FG4A 2IFQA 4L5OA 1EP7A 2R4VA 4J57E 4O92A 3GA4A 1OVNA 3FR9A 4HI7A 4IVFA 2HSHA 2J9HA 2CV4A 2VLVA 5IM9A 1QQ2A 1JHBA 1ZYNA 1FHEA 1OYJA 2FWGA 1YF0A 4NMUA 1CQGA 2YPMA 4IQAA 3L0HA 4BL7A 3LFLA 3BCKA 3QPMA 1ZOFA 2FCHA 1H4OA 4IN0A 1YEPA 1V98A 4EUYA 1IYHA 4EVMA 3Q19A 4TVEA 5ENUA 2AV4A 2CQ9A 5G5FA 1ILOA 2IPAA 4PNGA 3LXTA 5D93A 4ZL8A 1NM3A 2GZYA 2VAFA 3P2AA 4TR0A 3VURA 1M99A 3Q6OA 3QOUA 3CRUA 2X8CA 4IS0A 2V1MA 4Q5QA 2CX3A 2DJ1A 2FD3A 3UEMA 1T4YA 3ZFLA 2H75A 4ZL9A 3CTGA 1U87A 2PVQA 3LQ7A 4DSQA 2LNTA 3ZL5A 2QC7A 4IJ3A 3GTUB 2A2RA 2LS5A 1TTZA 2B6MA 1VF3A 2GLRA 1M2DA 2RUEA 1XOBA 2P5RA 1U3IA 2B7KA 2XBIA 4GSNA 2IL3A 2XHFA 3IDVA 2FHEA 3FYGA 3BJ5A 2FUG2 4CDOA 4TKYA 2DJKA 5G31A 4V2NA 5AISA 3CRTA 2X49A 5DQYA 1O7UA 4N10A 4MZWA 4OCEA 1ABAA 3LGCA 4TXOB 2PU9C 4MPFA 1GSDA 4PURA 4PGTA 1V58A 1BEDA 4KCEA 1PGTA 3F4SA 3TCOA 4ISDA 2V41A 2VLUA 1YZXA 4POKA 2GGTA 2G2QA 1SD8A 1XXUA 1QMVA 2I9HA 3QAGA 4Q5FA 2J23A 4ZL7A 2LQOA 1WIKA 3V1WA 4GXZA 2GTUA 1K0NA 2ES7A 2YANA 2V2GA 5G30A 3LSZA 3KD0A 1DBYA 4NWYA 1ZL9A 1TK8B 1XCCA 4EKZA 3D21A 1ERVA 5ID2B 2OACA 1YKCA 1A2MA 2YV7A 2H72A 5G2ZA 4EE0A 4NXIA 4ZB8A 2PBJA 2NVLA 3ZVJD 1JZOA 4K6XA 1F6MC 1WOUA 5D9WA 3FK8A 5CO3A 4TOPA 4TR1A 4HJ2A 4EIPA 1TW9A 4IJIA 3FY7A 2ON7A 2DMMA 5FT3A 2H0HA 2O89A 1TK5B 4CW9A 1GTAA 4WXTA 5F06A 1RQMA 4LLRA 5F8BA 2BMXA 5J9BA 1SU9A 5IOXA 2CX4A 4ZB6A 1HQOA 1FB6A 5AGYA 4QL9A 2PUKC 1JFUA 3ERWA 5IO2A 2VCTA 3G7YA 1WP0A 2MMNA 2VO4A 1AUCA 2P0GA 3GKNA 2YP6A 1U6TA 2AHEA 3IV4A 4OO5A 1DE1A 1ERTA 1MDJA 2AAWA 3HJPA 3FRCA 1SJZA 3MAKA 5A4UA 3EMPA 1MDKA 2V6OA 1EV9A 3IHQA 5B7CA 4K7NA 3WT1A 18GSA 1WPIA 4BVXA 5COHA 3M8NA 4ECIA 2FWFA 1B8XA 5JCGA 4GRFA 4Z2RA 4LL4B 8GSSA 5F05A 3TJFA 3M9JA 3BOAA 1PKZA 4KW6A 1W4VA 3ED3A 1PL2A 3LW9A 2VL2A 1K0BA 4KH7A 4F2IA 1MD4A 1K3LA 4IQ1A 3H79A 3ISOA 3O6TA 4IGJA 2YZHA 3BBYA 4OWYA 5ECKB 5EL8A 2HI7A 2R0GA 3E0UA 3IC8A 3ZMLA 3TDGA 5GAPD 5DCGA 1PMTA 3F0IA 3HVSA 1GH2A 2CVDA 2CVKA 4WR5A 1XZOA 2R0CA 1ZGNA 1TU8A 5ECSA 5HQPA 1AAZA 5CAXA 2L6CA 5GSTA 3I9V2 4GWRA 2BJXA 3DGQA 3M3MA 4ZB9A 2XC2A 3C1RA 4FQUA 5DJMA 3PINA 1G0TA 4MJCA 4I2UA 2NPBA 2YWOA 5J9CA 1SL0B 3TJBA 2I4AA 5GZZB 1TRSA 5JWQB 5CP1A 2L4QA 1A0FA 2H0IA 4XS4B 2H1AA 3VPQA 3D6IA 1B9YC 3MDKA 1U3AA 1M2BA 5FHIA 4EDZA 1NW2A 2H73A 4Q5RA 1JZWA 3F3RA 3DRNA 4XHMA 5ECNB 3U6VA 3HVXA 4Z2UA 4IP1A 2EIQA 4GTUA 1XPVA 3PH9A 4KCAA 2O8VB 3VLNA 3VFIA 2XPEA 3L9VA 1XWBA 5IMAA 4MA9A 2M46A 3DYRA 3EPTA 3F4TA 3KGKA 4G9HA 1PN0A 2PN8A 4KF9A 3FKFA 2OA7A 2LRNA 2VCQA 3GKKA 1Z6NA 2XPDA 2K8SA 1PRXA 3UIWA 1TXXA 5B6NA 4O32A 1G6WA 3FZ9A 4AJ8A 1GUKA 2H70A 2M80A 1T8EB 3OR5A 3GX8A 3APSA 1N8JA 3GH9A 3GYKA 3H4KA 3EINA 3VI7A 3CSJA 1SK0A 6GSSA 2MYGA 4E8EA 2DJJA 4K7OA 3GTUA 2N5FA 5CREA 2I1UA 2A4HA 4JBBA 2YWNA 1GSSA 3WD6A 1ON4A 2CT6A 2LRCA 3LWAA 3F4RA 1WE0A 5JCUA 3RPPA 1OE8A 1XVQA 4TRXA 3HJMA 4ZIJA 1XFLA 4LA1A 5KOXA 1Q98A 5G1LA 4NHWA 1O8WA 2HRKA 4H86A 3C7MA 4OCFA 3HZ4A 4BWQA 1GSFA 1S3AA 1GP1A 1K0OA 4ML6A 4ZBDA 2X8HA 2WB9A 2C0GA 2O87A 3LYKA 1TOFA 4ACSA 1YKAA 2O85A 4TXOA 5HR0A 5D96A 16GSA 4L8EA 1ZZYA 2R5GA 5KN1A 1GNEA 2EIRA 4AF2A 3L9SA 4HEA2 1Z7PA 4RUVA 4ECCA 3GL3A 1AQXA 2OE1A 3E3EA 2L57A 1TK0B 4CY8A 3GX0A 3HJOA 1GSUA 2B7JA 3TKQA 2AB6A 3A2VA 2GSTA 1FO5A 3A2WA 3TKSE 3VI5A 4F9ZA 2HRFA 2IMDA 2R3XA 1HD2A 1LJRA 3ME7A 5DJLA 4DEJA 4KGIA 1QGVA 1VF4A 3GUSA 3TJJA 1A2JA 2QGVA 5IQYA 3TKRA 5ID2A 2K6VA 2IMKA 5DDLA 4G19A 5IPGA 2GSSA 1FAAA 5KN0A 2YWIA 4Z2TA 1K3YA 4G10A 4MF6A 2R6KA 1NSWA 3KP8A 4WBRD 1B48A 2HXKA 4DSSB 4ULXA 4OO4A 1SENA 5HFIA 5KEJA 5ELGA 2NDOA 11GSA 1B4QA 4RQRA 3UMAA 4F82A 1Y6EA 4YAVA 4K0NA 2OADA 5LNKe 2VL3A 1XWCA 4RI7A 1S3DA 4MF7A 1GL8A 2JZSA 3EURA 4PTSA 1YEXA 4QL7A 1T00A 2REMA 3IOSA 3BCIA 3TKSA 3VWUA 1F3AA 3ZZXA 3GSSA 4EIQA 1OC9B 3DWVA 1OKDA 3ZRDA 1N2AA 4V1Ap 1I5GA 4OFNA 1OC3A 1GULA 2RM6A 1A2LA 3HCZA 5J4UA 3ZREA 1TRUA 1R4WA 4FO5A 2ZNMA 5ECQB 5KN2A 3F8UA 1TU7A 3TRXA 2AUVA 5JCWA 1EGOA 3ERFA 1JZDA 2L5OA 3FZAA 2AJQB 3MSZA 3QAWA 4I97A 2HNLA 3KH9A 4MPGA 1CQHA 4MZBA 2IN3A 4N11A 1XOAA 5J5NA 5CNWA 3W8SA 3FEUA 1F9MA 1X9SB 1BX9A 4PX1A 5ECLB 4K9ZA 2FA4A 4BWSA 2VM1A 3IBHA 4K2DA 3UARA 3GHAA 3TRPA 4KSOA 4KDUA 5DAKA 2GS3A 4FYBA 1BG5A 2JSYA 1O85A 4K5RA 1R5PA 4MABA 5BMUA 5IMDA 5ECPB 2FWEA 1PD21 3I69A 5E4WA 2B3SA 3MNGA 2CAQA 1WRYA 2F9SA 2N5AA 2B5YA 3EWLA 3GURA 5D8IA 3DMLA 5HFKA 1ERUA 4KDXA 5DVBA 5CRHA 2HSMA 3LYPA 4CHSA 2TRXA 1GTUA 2DIYA 3NIVA 1XBSA 2L4CA 2MMZA 2C1YA 3TJKA 2WFCA 4XS4A 1KEBA 4MH2A 3H1NA 4J56E 1MEKA 3IRAA 5J3RA 4O5UA 2TRCP 3UBLA 2H76A 2OBIA 1ZMAA 2HRAA 5ECOB 6GSYA 3LORA 3FZ5A 2C0DA 2EC4A 1Z7RA 3UL3A 2DJ0A 2VM2A 2DJ2A 3EMXA 2FLSA 3UVHA 3DKSA 2WULA 4MMMA 3IAM2 3C1SA 1WJKA 3WGEA 3FHKA 1EWXA 4ZXGA 3C73A 3SBCA 3WGXA 2LUSA 3MWHA 2NBSA 5BRTA 4YH2A 1R7HA 1OKTA 2KP2A 3D4TA 1T1VA 4MF5A 4O7HA 2X8GA 3D22A 3GL5A 4MLYA 2E2MA 3ME8A 1SL2B 4XRAA 3QMXA 2WRTA 6GSTA 4Q5NA 2NTOA 2PWJA 2GQKA 2HFDA 5G5EA 2F51A 5IIZA 3EYTA 2FGXA 5ABRA 4BVYB 1EEJA 4HQSA 4NV2A 4YKFA 2EIOA 3ZITA 4GQFA 3LG6A 4BPYA 1K0CA 3GV1A 2WJUA 3W8JA 2LV3A 1F3BA 1SYXA 5KOWA 2B1LA 2DMLA 2GZPA 4EDYA 3L78A 1QUWA 4JZQA 1GWCA 3R3EA 4L0WA 1B9XC 4AJ6A 7GSSA 3F9UA 1WWJA 4QQ7A 2H6YA 3CXGA 3I43A 5CRDA 3M0FA 3VWXA 2DLXA 2YN1A 2ZUPA 1MD3A 3F6DA 3EVIA 1A24A 2AYTA 4N0ZA 4YQVA 4ZILA 3CTFA 2WCIA 3DIEA 2RM5A 5EY6A 3KMNA 3GH6A 1A0RP 3I6AA 1YQ1A 3HD5A 1KBNA 3D4MA 1T3BA 4JE1A 4G0IA 1SK2A 2HZEA 1SK1A 4EF0A 5CRWA 2HLSA 1A8YA 1U88A 5ECRB 2H19A 3RHCA 3US3A 4WF5A 5EVOA 1S3CA 2QSIA 3IA1A 22GSA 5DCHA 3FMWA 2HT9A 1URMA 3RAZA 13GSA 1GSEA 2TIRA 3KZQA 4DSSA 1HYUA 3VK9A 3GFKA 5JWOB 2IJYA 19GSA 2WDUA 4X43A 3KXOA 1SKWB 4V2MA 2P31A 4G2EA 3KJYA 4K5SA 3A3TA 3HHVA 5ELAA 2GQLA 2LTKA 1YDKA 2C3NA 1M2AA 5ECMB 1EEMA 1FB0A 2GZZA 2RUFA 4IKHA 2DKHA 2OE0A 3IHGA 1GTIA 1OC9A 2PMTA 3WGDA 2F8AA 3U5RE 2OKAA 3M1GA 3O3TA 9GSSA 2JZRA 3QFAC 4ECJA 12GSA 1M0UA 1MDIA 2C0EA 1V40A 5IMCA 3Q74A 1VF2A 3HA9A 2CAIA 1EOHA 5LD0A 2VD1A 3Q18A 1FW1A 1EOGA 1OAZA 3HXSA 3FZ4A 2H71A 5EPFA 4YAPA 3H8QA 5GSSA 3HYPA 5DBQA 4GSSA 1FOVA 5AIVA 1M9BA 2VCXA 4GF0A 4MJEA 2I81A 2E0QA 4GCIA 1O8XA 1EV4A 1AC1A 1QK8A 4TR1B 2P5QA 1LU4A 3IAS2 5H5RA 4K8MA 5IO0A 3JCML 3RBTA 2GQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6X A;  3ZIJ A;  5GAN D;  4FIW A;  3GNJ A;  4F0B A;  4ZBA A;  4GQC A;  4JR4 A;  1TDI A;  3O76 A;  4DSR A;  3HDC A;  3TUE A;  2K8V A;  1JLV A;  4FYU A;  3VWW A;  4KB3 A;  3DVX A;  5CRG A;  5IMV A;  1ML6 A;  3CYN A;  3UAP A;  1AQV A;  4OMV A;  2MZC A;  3ZYW A;  5HR3 A;  4BA7 A;  1MTC A;  1O6J A;  2GT6 A;  1O73 A;  4N0V A;  2A2S A;  3ZVJ A;  1THO A;  2L5L A;  1HNA A;  2LEG A;  2O7K A;  5KN3 A;  4XS1 A;  2YOI A;  2D2Z A;  5F0G A;  2K18 A;  1IYI A;  3L4N A;  2C0F A;  3R2Q A;  2JZT A;  3ZMK A;  2R37 A;  5H5S A;  1A8L A;  4F03 A;  2K9F A;  1B4P A;  1E6B A;  5L71 A;  1XWA A;  4K7I A;  3P7X A;  3QAV A;  3LEF A;  1Q4J A;  1OC8 A;  1R26 A;  1X9W B;  1XIY A;  3RDW A;  1FVJ A;  4RI6 A;  2WGR A;  1TJD A;  1OE7 A;  2A4V A;  2VL2 C;  4I2T A;  2KHP A;  1XW5 A;  2VCW A;  1X5C A;  5B6M A;  4KDY A;  4JRR A;  1G7O A;  3F3Q A;  1TRV A;  4HZ4 A;  4ML1 A;  2B5E A;  1O81 A;  2YV9 A;  1ACV A;  1RK4 A;  4OFT A;  4KAE A;  5CYY A;  3EU3 A;  3NZN A;  1J0F A;  1UA5 A;  2HRN A;  2PER A;  20GS A;  1PX7 A;  3EU4 A;  1SJI A;  4BVY A;  2KLX A;  1K3O A;  3TOU A;  1TP9 A;  1AQW A;  4IHU A;  2RII A;  3ZFB A;  4D73 B;  3TKP A;  3CBU A;  4JED A;  4PNF A;  4WKW A;  3KTB A;  3E9J B;  2H1B A;  3WT2 A;  2HZF A;  4RQX A;  3IE3 A;  4DVC A;  4MJB A;  3J7Y b;  5IMZ A;  5A4W A;  4PQI A;  1TRW A;  3P90 A;  3GST A;  17GS A;  4XCS A;  4EO3 A;  3F63 A;  2FNO A;  1EP8 A;  2ON5 A;  2N5B A;  4MP4 A;  3QFB C;  1BYE A;  3GKX A;  2YWM A;  4WR4 A;  1K0A A;  4HU7 A;  3GN3 A;  2DSA A;  1UVZ A;  4GST A;  5DAL B;  3M9K A;  1J08 A;  3DXB A;  3WYW A;  3TJG A;  3D5J A;  2CVB A;  4O5R A;  3KEB A;  4IEL A;  2H30 A;  5D9T A;  2OE3 A;  1Z3E A;  2H01 A;  4ID0 A;  4KA0 A;  4PQH A;  4YQU A;  2JAC A;  2YCD A;  4KND A;  4AJ7 A;  3VPT A;  4N30 A;  4POB A;  2LRT A;  4AGS A;  1SL1 B;  2LJK A;  3ERG A;  3FR3 A;  3IK9 A;  5D9V A;  4YQM A;  3N5O A;  2DIZ A;  3KIJ A;  2ALB A;  2FY6 A;  3KCM A;  2KOK A;  2CZ3 A;  6GSX A;  1Z9H A;  3G7J A;  3EE2 A;  3LJR A;  3AY8 A;  4NPB A;  2MBT A;  1F2E A;  4MJA A;  2GSQ A;  5H5Q A;  4PQ1 A;  3HZ8 A;  3SWL A;  4EC0 A;  1X9M B;  2G0F A;  1PN9 A;  1PKW A;  2IMI A;  4I8B A;  3N9J A;  4OD7 A;  1GSY A;  3VWV A;  1GTB A;  1KNG A;  2GVP A;  1H75 A;  3FR6 A;  1AW9 A;  1LBK A;  5F07 A;  3IC4 A;  3PGT A;  4FYC A;  2CA8 A;  2IMF A;  4EXJ A;  4V1A g;  1TI3 A;  4PXO A;  2C3T A;  3ZTL A;  2V6K A;  1XW9 A;  1Z5Y E;  1ZYQ B;  4IW9 A;  4PUF C;  1ZYE A;  1NHY A;  1K0D A;  2MMO A;  2IME A;  1VF1 A;  2VUP A;  2FWH A;  4XRD A;  5ECI B;  4TW5 A;  1WMJ A;  4ECB A;  4EL1 A;  1SD9 A;  1C72 A;  1SYR A;  4WET A;  4JU5 A;  5G1K A;  1X5D A;  4MCU A;  1G7E A;  2Z9S A;  4WF4 A;  1G6Y A;  3UOM A;  4KX4 A;  1YF1 A;  4P3Y B;  2I3Y A;  1BQ7 A;  1PL1 A;  4GLT A;  2B5X A;  1M9A A;  2ZCT A;  2IFQ B;  2M72 A;  1SKR B;  2JAD A;  2HE3 A;  4XTS A;  2E7P A;  3EC3 A;  3P8W A;  4HQZ A;  1SKS B;  5LCZ A;  1Z6M A;  1HNC A;  2C80 A;  2H8L A;  2LKU A;  5C04 A;  2C8U A;  2PPT A;  2YNX A;  2MBS A;  2OJL A;  2WS2 A;  4ILF A;  1V9W A;  3A5W A;  3K8N A;  1V57 A;  1Y25 A;  3TGZ A;  3D0Z A;  3IPZ A;  3H93 A;  2JU5 A;  1PQN A;  2LJA A;  5IPH A;  3C71 A;  4HU9 A;  1XW6 A;  3TKS C;  5HFG A;  2KUC A;  1DE2 A;  1JLW A;  1VRS D;  3KM6 A;  3KMO A;  3ZIV A;  4L0U A;  4F0C A;  2VOC A;  3HY2 A;  4MDC A;  5DQS A;  4TXV A;  2LST A;  5AN1 A;  6GSW A;  3KP9 A;  4MH3 A;  4TR4 A;  4POM A;  3BD2 A;  2YJH A;  3UBK A;  5B8B A;  3GRX A;  1ZCP A;  2XBQ A;  2QKE A;  1JZR A;  14GS A;  2E2G A;  4X1U A;  4NAX A;  5DAK B;  2VIM A;  4MZC A;  5INY A;  4OFM A;  3KH7 A;  2DBC A;  5J41 A;  2MMA A;  3L9U A;  1ERW A;  2GSR A;  3UJ1 A;  1KTE A;  1AXD A;  2LJR A;  1YJ6 A;  4WBJ A;  1R5A A;  4IP6 A;  4L5L A;  3CSI A;  1E2Y A;  4E8H A;  3NOF A;  1X0R A;  1QXH A;  1XWK A;  4HDE A;  4HUA A;  2H6X A;  4ZBB A;  3GKM A;  2H1D A;  1T7P B;  3G7I A;  1XWG A;  3S9F A;  2C3Q A;  5D73 A;  10GS A;  5AIX A;  1VGL A;  1I9D A;  4LMW A;  5IOW A;  1SJ6 A;  4PUA A;  1GUM A;  2GT5 A;  2RLI A;  3G9B A;  4D73 A;  2CZ2 A;  2BTO T;  1X5E A;  4V2L A;  5ECH B;  1W89 A;  2YZU A;  5FWG A;  2JL4 A;  2V32 A;  1DSB A;  2IWT A;  4MK3 A;  3CMI A;  2PVO C;  3LXZ A;  4XS6 A;  4WEY A;  1XVW A;  3GIX A;  2VCV A;  3TOT A;  5A4V A;  2H1G A;  2PGT A;  3TB2 A;  3RHB A;  3C8E A;  2IIY A;  6GSU A;  5DAL A;  1F37 A;  3IR4 A;  1NHO A;  1DUG A;  1PX6 A;  1UC7 A;  1M7T A;  2H6Z A;  5B8A A;  4KUN A;  1GLP A;  2OBK A;  2VL9 A;  1RW1 A;  4I5Q A;  3A2X A;  1FVK A;  5JWR B;  2LNS A;  4FH8 A;  1V2A A;  1GSQ A;  3HVV A;  3UVT A;  4HZ2 A;  2H66 A;  1BAY A;  6GSV A;  2L59 A;  1THX A;  4KSM A;  1USB A;  3DD3 A;  2LQQ A;  1TI1 A;  5HR2 A;  4TN8 A;  3PR8 A;  3DVW A;  1QFN A;  1UN2 A;  5HR1 A;  5C00 A;  1BJX A;  3ZLP A;  1GUH A;  4J2F A;  2VCZ A;  4Z7X A;  1PSQ A;  3RPN A;  2KP1 A;  4POL A;  4IBP A;  4X0X A;  3DEX A;  3KTL A;  2B1K A;  1TKD B;  4HOJ A;  4LMV A;  2DC5 A;  4LL1 B;  3F6F A;  2H74 A;  2JSZ A;  3J7Y k;  2HSY A;  2GDR A;  1A23 A;  1ST9 A;  4KE3 A;  3QD9 A;  4JR6 A;  1PA3 A;  2YJ7 A;  2HYX A;  2VD0 A;  4HS1 A;  5E59 A;  3CSH A;  2F3M A;  1GRX A;  1YY7 A;  2X99 A;  2H0G A;  3QCP A;  1AIU A;  3QDN A;  3IXR A;  2HZE B;  3HKR A;  2FA8 A;  2L6D A;  4XIH A;  4HJM A;  3TRQ A;  3W6G A;  1HNB A;  4NV5 A;  2WZ9 A;  1GLQ A;  3FW2 A;  2VLT A;  3GMF A;  2F8F A;  1EGR A;  5D9X A;  1T4Z A;  3APQ A;  2C4J A;  5A5K A;  2X64 A;  3APO A;  4NHZ A;  1K0M A;  1EZK A;  3IK7 A;  1J9B A;  3QR6 A;  2DJ3 A;  4K1F A;  5IMF A;  2R2J A;  4TR3 A;  1GNW A;  4K0G A;  1FG4 A;  2IFQ A;  4L5O A;  1EP7 A;  2R4V A;  4J57 E;  4O92 A;  3GA4 A;  1OVN A;  3FR9 A;  4HI7 A;  4IVF A;  2HSH A;  2J9H A;  2CV4 A;  2VLV A;  5IM9 A;  1QQ2 A;  1JHB A;  1FHE A;  1OYJ A;  2FWG A;  1YF0 A;  4NMU A;  1CQG A;  2YPM A;  4IQA A;  3L0H A;  4BL7 A;  3LFL A;  3BCK A;  3QPM A;  1ZOF A;  2FCH A;  1H4O A;  4IN0 A;  1YEP A;  1V98 A;  4EUY A;  1IYH A;  4EVM A;  3Q19 A;  4TVE A;  5ENU A;  2AV4 A;  2CQ9 A;  5G5F A;  1ILO A;  2IPA A;  4PNG A;  3LXT A;  5D93 A;  4ZL8 A;  1NM3 A;  2GZY A;  2VAF A;  3P2A A;  4TR0 A;  3VUR A;  1M99 A;  3Q6O A;  3QOU A;  3CRU A;  2X8C A;  4IS0 A;  2V1M A;  4Q5Q A;  2CX3 A;  2DJ1 A;  2FD3 A;  3UEM A;  1T4Y A;  3ZFL A;  2H75 A;  4ZL9 A;  3CTG A;  1U87 A;  2PVQ A;  3LQ7 A;  4DSQ A;  2LNT A;  3ZL5 A;  2QC7 A;  4IJ3 A;  3GTU B;  2A2R A;  2LS5 A;  1TTZ A;  2B6M A;  1VF3 A;  2GLR A;  1M2D A;  2RUE A;  1XOB A;  2P5R A;  1U3I A;  2B7K A;  2XBI A;  4GSN A;  2IL3 A;  2XHF A;  3IDV A;  2FHE A;  3FYG A;  3BJ5 A;  2FUG 2;  4CDO A;  4TKY A;  2DJK A;  5G31 A;  4V2N A;  5AIS A;  3CRT A;  5DQY A;  1O7U A;  4N10 A;  4MZW A;  4OCE A;  1ABA A;  3LGC A;  4TXO B;  2PU9 C;  4MPF A;  1GSD A;  4PUR A;  4PGT A;  1V58 A;  1BED A;  4KCE A;  1PGT A;  3F4S A;  3TCO A;  4ISD A;  2V41 A;  2VLU A;  1YZX A;  4POK A;  2GGT A;  2G2Q A;  1SD8 A;  1XXU A;  1QMV A;  2I9H A;  3QAG A;  4Q5F A;  2J23 A;  4ZL7 A;  2LQO A;  1WIK A;  3V1W A;  4GXZ A;  2GTU A;  1K0N A;  2ES7 A;  2YAN A;  2V2G A;  5G30 A;  3LSZ A;  3KD0 A;  1DBY A;  4NWY A;  1ZL9 A;  1TK8 B;  1XCC A;  4EKZ A;  3D21 A;  1ERV A;  5ID2 B;  2OAC A;  1YKC A;  1A2M A;  2YV7 A;  2H72 A;  5G2Z A;  4EE0 A;  4NXI A;  4ZB8 A;  2PBJ A;  2NVL A;  3ZVJ D;  1JZO A;  4K6X A;  1F6M C;  1WOU A;  5D9W A;  3FK8 A;  5CO3 A;  4TOP A;  4TR1 A;  4HJ2 A;  1TW9 A;  4IJI A;  3FY7 A;  2ON7 A;  2DMM A;  5FT3 A;  2H0H A;  2O89 A;  1TK5 B;  4CW9 A;  1GTA A;  4WXT A;  5F06 A;  1RQM A;  4LLR A;  5F8B A;  2BMX A;  5J9B A;  1SU9 A;  5IOX A;  2CX4 A;  4ZB6 A;  1HQO A;  1FB6 A;  5AGY A;  4QL9 A;  2PUK C;  1JFU A;  3ERW A;  5IO2 A;  2VCT A;  3G7Y A;  1WP0 A;  2MMN A;  2VO4 A;  1AUC A;  2P0G A;  3GKN A;  2YP6 A;  1U6T A;  2AHE A;  3IV4 A;  4OO5 A;  1DE1 A;  1ERT A;  1MDJ A;  2AAW A;  3HJP A;  3FRC A;  1SJZ A;  3MAK A;  5A4U A;  3EMP A;  1MDK A;  2V6O A;  1EV9 A;  3IHQ A;  5B7C A;  4K7N A;  3WT1 A;  18GS A;  1WPI A;  4BVX A;  5COH A;  3M8N A;  4ECI A;  2FWF A;  1B8X A;  5JCG A;  4GRF A;  4LL4 B;  8GSS A;  5F05 A;  3TJF A;  3M9J A;  3BOA A;  1PKZ A;  4KW6 A;  1W4V A;  3ED3 A;  1PL2 A;  2VL2 A;  1K0B A;  4KH7 A;  4F2I A;  1MD4 A;  1K3L A;  4IQ1 A;  3H79 A;  3ISO A;  3O6T A;  4IGJ A;  2YZH A;  3BBY A;  4OWY A;  5ECK B;  5EL8 A;  2HI7 A;  3E0U A;  3ZML A;  3TDG A;  5GAP D;  5DCG A;  1PMT A;  3F0I A;  3HVS A;  1GH2 A;  2CVD A;  2CVK A;  4WR5 A;  1XZO A;  1ZGN A;  1TU8 A;  5ECS A;  5HQP A;  1AAZ A;  5CAX A;  2L6C A;  5GST A;  3I9V 2;  4GWR A;  2BJX A;  3DGQ A;  3M3M A;  4ZB9 A;  2XC2 A;  3C1R A;  5DJM A;  3PIN A;  1G0T A;  4MJC A;  4I2U A;  2NPB A;  2YWO A;  5J9C A;  1SL0 B;  3TJB A;  2I4A A;  5GZZ B;  1TRS A;  5JWQ B;  5CP1 A;  2L4Q A;  1A0F A;  2H0I A;  4XS4 B;  2H1A A;  3VPQ A;  3D6I A;  1B9Y C;  3MDK A;  1U3A A;  1M2B A;  5FHI A;  4EDZ A;  1NW2 A;  2H73 A;  4Q5R A;  1JZW A;  3F3R A;  3DRN A;  4XHM A;  5ECN B;  3U6V A;  3HVX A;  4IP1 A;  2EIQ A;  4GTU A;  1XPV A;  3PH9 A;  4KCA A;  2O8V B;  3VLN A;  3VFI A;  2XPE A;  3L9V A;  1XWB A;  5IMA A;  4MA9 A;  2M46 A;  3DYR A;  3F4T A;  3KGK A;  4G9H A;  2PN8 A;  3FKF A;  2OA7 A;  2LRN A;  2VCQ A;  3GKK A;  1Z6N A;  2XPD A;  2K8S A;  1PRX A;  3UIW A;  1TXX A;  5B6N A;  4O32 A;  1G6W A;  3FZ9 A;  4AJ8 A;  1GUK A;  2H70 A;  2M80 A;  1T8E B;  3OR5 A;  3GX8 A;  3APS A;  1N8J A;  3GH9 A;  3GYK A;  3H4K A;  3EIN A;  3VI7 A;  3CSJ A;  1SK0 A;  6GSS A;  2MYG A;  4E8E A;  2DJJ A;  4K7O A;  3GTU A;  2N5F A;  5CRE A;  2I1U A;  4JBB A;  3WD6 A;  2YWN A;  1GSS A;  1ON4 A;  2CT6 A;  2LRC A;  3LWA A;  3F4R A;  1WE0 A;  5JCU A;  3RPP A;  1OE8 A;  1XVQ A;  4TRX A;  3HJM A;  4ZIJ A;  1XFL A;  4LA1 A;  1Q98 A;  5G1L A;  4NHW A;  1O8W A;  4H86 A;  3C7M A;  4OCF A;  3HZ4 A;  4BWQ A;  1GSF A;  1S3A A;  1GP1 A;  1K0O A;  4ML6 A;  4ZBD A;  2X8H A;  2WB9 A;  2C0G A;  2O87 A;  3LYK A;  1TOF A;  4ACS A;  1YKA A;  2O85 A;  4TXO A;  5HR0 A;  5D96 A;  16GS A;  4L8E A;  1ZZY A;  2R5G A;  5KN1 A;  1GNE A;  2EIR A;  4AF2 A;  3L9S A;  4HEA 2;  1Z7P A;  4RUV A;  4ECC A;  3GL3 A;  1AQX A;  2OE1 A;  3E3E A;  2L57 A;  1TK0 B;  3GX0 A;  3HJO A;  1GSU A;  2B7J A;  3TKQ A;  2AB6 A;  3A2V A;  2GST A;  1FO5 A;  3A2W A;  3TKS E;  3VI5 A;  4F9Z A;  2HRF A;  2IMD A;  2R3X A;  1HD2 A;  1LJR A;  3ME7 A;  5DJL A;  4DEJ A;  4KGI A;  1QGV A;  1VF4 A;  3GUS A;  3TJJ A;  1A2J A;  2QGV A;  5IQY A;  3TKR A;  5ID2 A;  2K6V A;  2IMK A;  5DDL A;  4G19 A;  5IPG A;  2GSS A;  1FAA A;  5KN0 A;  2YWI A;  1K3Y A;  4G10 A;  4MF6 A;  2R6K A;  1NSW A;  3KP8 A;  4WBR D;  1B48 A;  2HXK A;  4DSS B;  4ULX A;  4OO4 A;  1SEN A;  5HFI A;  5KEJ A;  5ELG A;  2NDO A;  11GS A;  1B4Q A;  4RQR A;  3UMA A;  4F82 A;  1Y6E A;  4YAV A;  4K0N A;  2OAD A;  5LNK e;  2VL3 A;  1XWC A;  4RI7 A;  1S3D A;  4MF7 A;  1GL8 A;  2JZS A;  3EUR A;  1YEX A;  4QL7 A;  1T00 A;  2REM A;  3IOS A;  3BCI A;  3TKS A;  3VWU A;  1F3A A;  3ZZX A;  3GSS A;  1OC9 B;  3DWV A;  1OKD A;  3ZRD A;  1N2A A;  4V1A p;  1I5G A;  4OFN A;  1OC3 A;  1GUL A;  2RM6 A;  1A2L A;  3HCZ A;  5J4U A;  3ZRE A;  1TRU A;  1R4W A;  4FO5 A;  2ZNM A;  5ECQ B;  5KN2 A;  3F8U A;  1TU7 A;  3TRX A;  2AUV A;  5JCW A;  1EGO A;  3ERF A;  1JZD A;  2L5O A;  3FZA A;  2AJQ B;  3MSZ A;  3QAW A;  4I97 A;  2HNL A;  3KH9 A;  4MPG A;  1CQH A;  4MZB A;  2IN3 A;  4N11 A;  1XOA A;  5J5N A;  5CNW A;  3W8S A;  3FEU A;  1F9M A;  1X9S B;  1BX9 A;  4PX1 A;  5ECL B;  4K9Z A;  2FA4 A;  4BWS A;  2VM1 A;  3IBH A;  4K2D A;  3UAR A;  3GHA A;  3TRP A;  4KSO A;  4KDU A;  5DAK A;  2GS3 A;  4FYB A;  1BG5 A;  2JSY A;  1O85 A;  1R5P A;  4MAB A;  5IMD A;  5ECP B;  2FWE A;  1PD2 1;  3I69 A;  5E4W A;  2B3S A;  3MNG A;  2CAQ A;  1WRY A;  2F9S A;  2N5A A;  2B5Y A;  3EWL A;  3GUR A;  5D8I A;  3DML A;  5HFK A;  1ERU A;  4KDX A;  5DVB A;  5CRH A;  3LYP A;  4CHS A;  2TRX A;  1GTU A;  2DIY A;  3NIV A;  1XBS A;  2L4C A;  2MMZ A;  2C1Y A;  3TJK A;  2WFC A;  4XS4 A;  1KEB A;  4MH2 A;  3H1N A;  4J56 E;  1MEK A;  3IRA A;  5J3R A;  2TRC P;  3UBL A;  2H76 A;  2OBI A;  1ZMA A;  5ECO B;  6GSY A;  3LOR A;  3FZ5 A;  2C0D A;  2EC4 A;  1Z7R A;  3UL3 A;  2DJ0 A;  2VM2 A;  2DJ2 A;  3EMX A;  2FLS A;  3UVH A;  3DKS A;  2WUL A;  4MMM A;  3IAM 2;  3C1S A;  1WJK A;  3WGE A;  3FHK A;  1EWX A;  4ZXG A;  3C73 A;  3SBC A;  3WGX A;  2LUS A;  3MWH A;  2NBS A;  4YH2 A;  1R7H A;  1OKT A;  2KP2 A;  3D4T A;  1T1V A;  4MF5 A;  4O7H A;  2X8G A;  3D22 A;  3GL5 A;  4MLY A;  2E2M A;  3ME8 A;  1SL2 B;  4XRA A;  3QMX A;  2WRT A;  6GST A;  4Q5N A;  2NTO A;  2PWJ A;  2GQK A;  2HFD A;  5G5E A;  2F51 A;  5IIZ A;  3EYT A;  2FGX A;  5ABR A;  1EEJ A;  4HQS A;  4NV2 A;  3ZIT A;  2EIO A;  4GQF A;  3LG6 A;  4BPY A;  1K0C A;  3GV1 A;  2WJU A;  3W8J A;  2LV3 A;  1F3B A;  1SYX A;  2B1L A;  2DML A;  2GZP A;  4EDY A;  3L78 A;  1QUW A;  4JZQ A;  1GWC A;  4L0W A;  1B9X C;  4AJ6 A;  7GSS A;  3F9U A;  1WWJ A;  4QQ7 A;  2H6Y A;  3CXG A;  3I43 A;  5CRD A;  3M0F A;  3VWX A;  2DLX A;  2YN1 A;  2ZUP A;  1MD3 A;  3F6D A;  3EVI A;  1A24 A;  2AYT A;  4N0Z A;  4YQV A;  4ZIL A;  3CTF A;  2WCI A;  3DIE A;  2RM5 A;  5EY6 A;  3KMN A;  3GH6 A;  1A0R P;  3I6A A;  1YQ1 A;  3HD5 A;  1KBN A;  3D4M A;  1T3B A;  4JE1 A;  1SK2 A;  2HZE A;  1SK1 A;  4EF0 A;  5CRW A;  2HLS A;  1A8Y A;  1U88 A;  5ECR B;  2H19 A;  3RHC A;  3US3 A;  4WF5 A;  5EVO A;  1S3C A;  2QSI A;  3IA1 A;  22GS A;  5DCH A;  2HT9 A;  1URM A;  3RAZ A;  13GS A;  1GSE A;  2TIR A;  3KZQ A;  4DSS A;  1HYU A;  3VK9 A;  3GFK A;  5JWO B;  2IJY A;  19GS A;  2WDU A;  4X43 A;  3KXO A;  1SKW B;  4V2M A;  2P31 A;  4G2E A;  3KJY A;  3A3T A;  3HHV A;  5ELA A;  2GQL A;  2LTK A;  1YDK A;  2C3N A;  1M2A A;  5ECM B;  1EEM A;  1FB0 A;  2GZZ A;  2RUF A;  4IKH A;  2OE0 A;  1GTI A;  1OC9 A;  2PMT A;  3WGD A;  2F8A A;  3U5R E;  2OKA A;  3M1G A;  3O3T A;  9GSS A;  2JZR A;  3QFA C;  4ECJ A;  12GS A;  1M0U A;  1MDI A;  2C0E A;  1V40 A;  5IMC A;  3Q74 A;  1VF2 A;  3HA9 A;  2CAI A;  1EOH A;  5LD0 A;  2VD1 A;  3Q18 A;  1FW1 A;  1EOG A;  1OAZ A;  3HXS A;  3FZ4 A;  2H71 A;  5EPF A;  4YAP A;  3H8Q A;  5GSS A;  3HYP A;  5DBQ A;  4GSS A;  1FOV A;  5AIV A;  1M9B A;  2VCX A;  4GF0 A;  4MJE A;  2I81 A;  2E0Q A;  4GCI A;  1O8X A;  1EV4 A;  1AC1 A;  1QK8 A;  4TR1 B;  2P5Q A;  1LU4 A;  3IAS 2;  5H5R A;  4K8M A;  5IO0 A;  3JCM L;  3RBT A;  2GQM A; 
#chains in the Genus database with same CATH topology
 4I6X A;  3ZIJ A;  5GAN D;  4FIW A;  3GNJ A;  4F0B A;  4ZBA A;  4GQC A;  4JR4 A;  4X4J A;  1TDI A;  3O76 A;  4DSR A;  3HDC A;  3TUE A;  4MNN A;  2K8V A;  1JLV A;  4FYU A;  3VWW A;  4KB3 A;  3DVX A;  5CRG A;  1FOH A;  5IMV A;  1ML6 A;  3CYN A;  3UAP A;  1AQV A;  4OMV A;  2MZC A;  4G0K A;  3ZYW A;  5HR3 A;  4BA7 A;  1MTC A;  1O6J A;  2GT6 A;  1O73 A;  4N0V A;  2A2S A;  3ZVJ A;  1THO A;  2L5L A;  1HNA A;  2LEG A;  2O7K A;  5KN3 A;  4XS1 A;  2YOI A;  2D2Z A;  5F0G A;  2K18 A;  1IYI A;  3L4N A;  2C0F A;  3R2Q A;  2JZT A;  3ZMK A;  2R37 A;  4G0L A;  5H5S A;  1A8L A;  4F03 A;  2K9F A;  1B4P A;  1E6B A;  5L71 A;  1XWA A;  4K7I A;  3P7X A;  3QAV A;  3LEF A;  1Q4J A;  1OC8 A;  1R26 A;  1X9W B;  1XIY A;  3RDW A;  1FVJ A;  4RI6 A;  2WGR A;  1TJD A;  1OE7 A;  2A4V A;  2VL2 C;  4I2T A;  2KHP A;  1XW5 A;  2VCW A;  1X5C A;  5B6M A;  4KDY A;  4CY6 A;  4JRR A;  1G7O A;  3F3Q A;  1TRV A;  4HZ4 A;  4ML1 A;  2B5E A;  1O81 A;  2YV9 A;  1ACV A;  1RK4 A;  4OFT A;  4KAE A;  5CYY A;  3EU3 A;  3NZN A;  1J0F A;  1UA5 A;  2HRN A;  2PER A;  20GS A;  1PX7 A;  3EU4 A;  1SJI A;  4BVY A;  2KLX A;  1K3O A;  3TOU A;  1TP9 A;  4IHU A;  1AQW A;  2RII A;  3ZFB A;  4D73 B;  3TKP A;  3CBU A;  4JED A;  4PNF A;  4WKW A;  3KTB A;  3E9J B;  2H1B A;  3WT2 A;  2HZF A;  4RQX A;  3IE3 A;  4DVC A;  4MJB A;  3J7Y b;  5IMZ A;  5A4W A;  4O5Q A;  4PQI A;  1TRW A;  3P90 A;  3GST A;  17GS A;  4XCS A;  4EO3 A;  3F63 A;  2FNO A;  1EP8 A;  2ON5 A;  2N5B A;  4MP4 A;  3QFB C;  1BYE A;  3GKX A;  2YWM A;  4WR4 A;  1K0A A;  4HU7 A;  3GN3 A;  2DSA A;  1UVZ A;  4GST A;  5DAL B;  3M9K A;  1J08 A;  3DXB A;  3WYW A;  3TJG A;  3D5J A;  3A5I A;  2CVB A;  4O5R A;  3KEB A;  4IEL A;  2H30 A;  5D9T A;  2OE3 A;  1Z3E A;  2H01 A;  4ID0 A;  4KA0 A;  4PQH A;  4YQU A;  2JAC A;  2YCD A;  4KND A;  4AJ7 A;  3VPT A;  4ICY A;  4N30 A;  4POB A;  2LRT A;  4AGS A;  1SL1 B;  2LJK A;  3MIX A;  3ERG A;  3FR3 A;  3IK9 A;  5D9V A;  4YQM A;  3N5O A;  2DIZ A;  2DKI A;  3KIJ A;  2ALB A;  2FY6 A;  3KCM A;  2KOK A;  2QA2 A;  2CZ3 A;  6GSX A;  1Z9H A;  3G7J A;  3EE2 A;  3LJR A;  3AY8 A;  4NPB A;  2MBT A;  1F2E A;  4MJA A;  2GSQ A;  5H5Q A;  4PQ1 A;  3HZ8 A;  3SWL A;  4EC0 A;  1X9M B;  2G0F A;  1PN9 A;  1PKW A;  2IMI A;  4I8B A;  3N9J A;  4OD7 A;  1GSY A;  3VWV A;  1GTB A;  1KNG A;  2GVP A;  1H75 A;  3FR6 A;  1AW9 A;  4YKG A;  1LBK A;  5F07 A;  3IC4 A;  3PGT A;  4FYC A;  2CA8 A;  2IMF A;  4EXJ A;  4V1A g;  3PPU A;  1TI3 A;  4PXO A;  2C3T A;  3ZTL A;  2V6K A;  1XW9 A;  1Z5Y E;  1ZYQ B;  4IW9 A;  4PUF C;  1ZYE A;  1NHY A;  1K0D A;  2MMO A;  2IME A;  1VF1 A;  2X4A A;  2VUP A;  2FWH A;  4XRD A;  5ECI B;  4TW5 A;  1WMJ A;  4ECB A;  4EL1 A;  1SD9 A;  1C72 A;  2UZ8 A;  1SYR A;  4WET A;  4JU5 A;  5G1K A;  1X5D A;  4MCU A;  1G7E A;  2Z9S A;  4WF4 A;  1G6Y A;  3UOM A;  4KX4 A;  1YF1 A;  4P3Y B;  2I3Y A;  1BQ7 A;  1PL1 A;  4GLT A;  2B5X A;  1M9A A;  2ZCT A;  1ZYP A;  2IFQ B;  2M72 A;  1SKR B;  2JAD A;  2HE3 A;  4XTS A;  2E7P A;  3EC3 A;  2QA1 A;  3P8W A;  4HQZ A;  1SKS B;  5LCZ A;  1Z6M A;  1HNC A;  2C80 A;  2H8L A;  2LKU A;  5C04 A;  2C8U A;  2PPT A;  2YNX A;  2MBS A;  2OJL A;  2WS2 A;  4ILF A;  1V9W A;  3A5W A;  3K8N A;  1V57 A;  1Y25 A;  3TGZ A;  3D0Z A;  3IPZ A;  3H93 A;  2JU5 A;  1PQN A;  4BL7 B;  2LJA A;  5IPH A;  3C71 A;  4HU9 A;  1XW6 A;  3TKS C;  5HFG A;  2KUC A;  1DE2 A;  1JLW A;  1VRS D;  3KM6 A;  3KMO A;  3ZIV A;  4L0U A;  4F0C A;  2VOC A;  3HY2 A;  4MDC A;  5DQS A;  4TXV A;  2LST A;  5AN1 A;  6GSW A;  3KP9 A;  4MH3 A;  4TR4 A;  4POM A;  3BD2 A;  2YJH A;  3UBK A;  5B8B A;  3GRX A;  1ZCP A;  2XBQ A;  2QKE A;  1JZR A;  14GS A;  2E2G A;  4X1U A;  4NAX A;  5DAK B;  2VIM A;  4MZC A;  5INY A;  4OFM A;  3KH7 A;  2DBC A;  5J41 A;  2MMA A;  3L9U A;  1ERW A;  2GSR A;  3UJ1 A;  1KTE A;  1AXD A;  2LJR A;  1YJ6 A;  4WBJ A;  1R5A A;  4IP6 A;  4L5L A;  3CSI A;  1E2Y A;  4E8H A;  4USS A;  3NOF A;  1X0R A;  1QXH A;  1XWK A;  4HDE A;  4HUA A;  2H6X A;  4ZBB A;  3GKM A;  1S3R A;  2H1D A;  1T7P B;  3G7I A;  1XWG A;  2A2P A;  3S9F A;  2C3Q A;  5D73 A;  10GS A;  5AIX A;  1VGL A;  1I9D A;  4LMW A;  5IOW A;  4HSC X;  1SJ6 A;  4PUA A;  1GUM A;  2GT5 A;  2RLI A;  3G9B A;  4D73 A;  2CZ2 A;  2BTO T;  1X5E A;  4V2L A;  5ECH B;  1W89 A;  2YZU A;  5FWG A;  2JL4 A;  2V32 A;  1DSB A;  2IWT A;  4MK3 A;  3CMI A;  2PVO C;  3LXZ A;  4XS6 A;  4WEY A;  4A5P A;  1XVW A;  3GIX A;  2VCV A;  3TOT A;  5A4V A;  2H1G A;  2PGT A;  3TB2 A;  3RHB A;  3C8E A;  2IIY A;  6GSU A;  1F37 A;  3IR4 A;  5DAL A;  1NHO A;  1DUG A;  1PX6 A;  1UC7 A;  1M7T A;  2H6Z A;  5B8A A;  4KUN A;  1GLP A;  2OBK A;  2VL9 A;  1RW1 A;  3MYD A;  4I5Q A;  3A2X A;  1FVK A;  5JWR B;  2LNS A;  4FH8 A;  1V2A A;  1GSQ A;  3HVV A;  3UVT A;  4HZ2 A;  2H66 A;  1BAY A;  6GSV A;  2L59 A;  1THX A;  4KSM A;  1USB A;  3DD3 A;  2LQQ A;  1TI1 A;  5HR2 A;  4BVX B;  4K2X A;  4TN8 A;  3PR8 A;  3DVW A;  1QFN A;  1UN2 A;  5HR1 A;  5C00 A;  1BJX A;  3ZLP A;  1GUH A;  4J2F A;  2VCZ A;  4Z7X A;  1PSQ A;  3RPN A;  2KP1 A;  4POL A;  4IBP A;  4X0X A;  3DEX A;  3KTL A;  2B1K A;  1TKD B;  4HOJ A;  4LMV A;  2DC5 A;  4LL1 B;  3F6F A;  2H74 A;  2JSZ A;  3J7Y k;  2HSY A;  2GDR A;  1A23 A;  1ST9 A;  4KE3 A;  3QD9 A;  4JR6 A;  1PA3 A;  2YJ7 A;  2HYX A;  2VD0 A;  4HS1 A;  5E59 A;  3CSH A;  2F3M A;  1GRX A;  1YY7 A;  2X99 A;  2H0G A;  3QCP A;  1AIU A;  3QDN A;  3IXR A;  2HZE B;  3HKR A;  2FA8 A;  2L6D A;  4XIH A;  4HJM A;  3TRQ A;  3W6G A;  1HNB A;  4NV5 A;  2WZ9 A;  1GLQ A;  3FW2 A;  2VLT A;  3GMF A;  2F8F A;  1EGR A;  5D9X A;  1T4Z A;  3APQ A;  2C4J A;  5A5K A;  2X64 A;  3APO A;  4NHZ A;  1K0M A;  1EZK A;  3IK7 A;  1J9B A;  3QR6 A;  2DJ3 A;  4K1F A;  5IMF A;  2R2J A;  4TR3 A;  1GNW A;  4K0G A;  2R0P A;  1FG4 A;  2IFQ A;  4L5O A;  1EP7 A;  2R4V A;  4J57 E;  4O92 A;  3GA4 A;  1OVN A;  3FR9 A;  4HI7 A;  4IVF A;  2HSH A;  2J9H A;  2CV4 A;  2VLV A;  5IM9 A;  1QQ2 A;  1JHB A;  1ZYN A;  1FHE A;  1OYJ A;  2FWG A;  1YF0 A;  4NMU A;  1CQG A;  2YPM A;  4IQA A;  3L0H A;  4BL7 A;  3LFL A;  3BCK A;  3QPM A;  1ZOF A;  2FCH A;  1H4O A;  4IN0 A;  1YEP A;  1V98 A;  4EUY A;  1IYH A;  4EVM A;  3Q19 A;  4TVE A;  5ENU A;  2AV4 A;  2CQ9 A;  5G5F A;  1ILO A;  2IPA A;  4PNG A;  3LXT A;  5D93 A;  4ZL8 A;  1NM3 A;  2GZY A;  2VAF A;  3P2A A;  4TR0 A;  3VUR A;  1M99 A;  3Q6O A;  3QOU A;  3CRU A;  2X8C A;  4IS0 A;  2V1M A;  4Q5Q A;  2CX3 A;  2DJ1 A;  2FD3 A;  3UEM A;  1T4Y A;  3ZFL A;  2H75 A;  4ZL9 A;  3CTG A;  1U87 A;  2PVQ A;  3LQ7 A;  4DSQ A;  2LNT A;  3ZL5 A;  2QC7 A;  4IJ3 A;  3GTU B;  2A2R A;  2LS5 A;  1TTZ A;  2B6M A;  1VF3 A;  2GLR A;  1M2D A;  2RUE A;  1XOB A;  2P5R A;  1U3I A;  2B7K A;  2XBI A;  4GSN A;  2IL3 A;  2XHF A;  3IDV A;  2FHE A;  3FYG A;  3BJ5 A;  2FUG 2;  4CDO A;  4TKY A;  2DJK A;  5G31 A;  4V2N A;  5AIS A;  3CRT A;  2X49 A;  5DQY A;  1O7U A;  4N10 A;  4MZW A;  4OCE A;  1ABA A;  3LGC A;  4TXO B;  2PU9 C;  4MPF A;  1GSD A;  4PUR A;  4PGT A;  1XG8 A;  1V58 A;  1BED A;  4KCE A;  1PGT A;  3F4S A;  1M3I A;  3TCO A;  4ISD A;  2V41 A;  2VLU A;  1YZX A;  4POK A;  2GGT A;  2G2Q A;  1SD8 A;  1XXU A;  1QMV A;  2I9H A;  3QAG A;  4Q5F A;  2J23 A;  4ZL7 A;  2LQO A;  1WIK A;  3V1W A;  4GXZ A;  2GTU A;  1K0N A;  2ES7 A;  2YAN A;  2V2G A;  5G30 A;  3LSZ A;  3KD0 A;  1DBY A;  4NWY A;  1ZL9 A;  1TK8 B;  1XCC A;  4EKZ A;  3D21 A;  1ERV A;  5ID2 B;  2OAC A;  1YKC A;  1A2M A;  2YV7 A;  2H72 A;  5G2Z A;  4EE0 A;  4NXI A;  4ZB8 A;  2PBJ A;  2NVL A;  3ZVJ D;  1JZO A;  4K6X A;  1F6M C;  1WOU A;  5D9W A;  3FK8 A;  5CO3 A;  4TOP A;  4TR1 A;  4HJ2 A;  4EIP A;  1TW9 A;  4IJI A;  3FY7 A;  2ON7 A;  2DMM A;  5FT3 A;  2H0H A;  2O89 A;  1TK5 B;  4CW9 A;  1GTA A;  4WXT A;  5F06 A;  1RQM A;  4LLR A;  5F8B A;  2BMX A;  5J9B A;  1SU9 A;  5IOX A;  2CX4 A;  4ZB6 A;  1HQO A;  1FB6 A;  5AGY A;  4QL9 A;  2PUK C;  1JFU A;  3ERW A;  5IO2 A;  2VCT A;  3G7Y A;  1WP0 A;  2MMN A;  2VO4 A;  1AUC A;  2P0G A;  3GKN A;  2YP6 A;  1U6T A;  2AHE A;  3IV4 A;  4OO5 A;  1DE1 A;  1ERT A;  1MDJ A;  2AAW A;  3HJP A;  3FRC A;  1SJZ A;  3MAK A;  5A4U A;  3EMP A;  1MDK A;  2V6O A;  1EV9 A;  3IHQ A;  5B7C A;  4K7N A;  3WT1 A;  18GS A;  1WPI A;  4BVX A;  5COH A;  3M8N A;  4ECI A;  2FWF A;  1B8X A;  5JCG A;  4GRF A;  4Z2R A;  4LL4 B;  8GSS A;  5F05 A;  3TJF A;  3M9J A;  3BOA A;  1PKZ A;  4KW6 A;  1W4V A;  3ED3 A;  1PL2 A;  3LW9 A;  2VL2 A;  1K0B A;  4KH7 A;  4F2I A;  1MD4 A;  1K3L A;  4IQ1 A;  3H79 A;  3ISO A;  3O6T A;  4IGJ A;  2YZH A;  3BBY A;  4OWY A;  5ECK B;  5EL8 A;  2HI7 A;  2R0G A;  3E0U A;  3IC8 A;  3ZML A;  3TDG A;  5GAP D;  5DCG A;  1PMT A;  3F0I A;  3HVS A;  1GH2 A;  2CVD A;  2CVK A;  4WR5 A;  1XZO A;  2R0C A;  1ZGN A;  1TU8 A;  5ECS A;  5HQP A;  1AAZ A;  5CAX A;  2L6C A;  5GST A;  3I9V 2;  4GWR A;  2BJX A;  3DGQ A;  3M3M A;  4ZB9 A;  2XC2 A;  3C1R A;  4FQU A;  5DJM A;  3PIN A;  1G0T A;  4MJC A;  4I2U A;  2NPB A;  2YWO A;  5J9C A;  1SL0 B;  3TJB A;  2I4A A;  5GZZ B;  1TRS A;  5JWQ B;  5CP1 A;  2L4Q A;  1A0F A;  2H0I A;  4XS4 B;  2H1A A;  3VPQ A;  3D6I A;  1B9Y C;  3MDK A;  1U3A A;  1M2B A;  5FHI A;  4EDZ A;  1NW2 A;  2H73 A;  4Q5R A;  1JZW A;  3F3R A;  3DRN A;  4XHM A;  5ECN B;  3U6V A;  3HVX A;  4Z2U A;  4IP1 A;  2EIQ A;  4GTU A;  1XPV A;  3PH9 A;  4KCA A;  2O8V B;  3VLN A;  3VFI A;  2XPE A;  3L9V A;  1XWB A;  5IMA A;  4MA9 A;  2M46 A;  3DYR A;  3EPT A;  3F4T A;  3KGK A;  4G9H A;  1PN0 A;  2PN8 A;  4KF9 A;  3FKF A;  2OA7 A;  2LRN A;  2VCQ A;  3GKK A;  1Z6N A;  2XPD A;  2K8S A;  1PRX A;  3UIW A;  1TXX A;  5B6N A;  4O32 A;  1G6W A;  3FZ9 A;  4AJ8 A;  1GUK A;  2H70 A;  2M80 A;  1T8E B;  3OR5 A;  3GX8 A;  3APS A;  1N8J A;  3GH9 A;  3GYK A;  3H4K A;  3EIN A;  3VI7 A;  3CSJ A;  1SK0 A;  6GSS A;  2MYG A;  4E8E A;  2DJJ A;  4K7O A;  3GTU A;  2N5F A;  5CRE A;  2I1U A;  2A4H A;  4JBB A;  2YWN A;  1GSS A;  3WD6 A;  1ON4 A;  2CT6 A;  2LRC A;  3LWA A;  3F4R A;  3HVN A;  1WE0 A;  5JCU A;  1PFO A;  3RPP A;  1OE8 A;  1XVQ A;  4TRX A;  3HJM A;  4ZIJ A;  1XFL A;  4LA1 A;  5KOX A;  1Q98 A;  5G1L A;  4NHW A;  1O8W A;  2HRK A;  4H86 A;  3C7M A;  4OCF A;  3HZ4 A;  4BWQ A;  1GSF A;  1S3A A;  1GP1 A;  1K0O A;  4ML6 A;  4ZBD A;  2X8H A;  2WB9 A;  2C0G A;  2O87 A;  3LYK A;  1TOF A;  4ACS A;  1YKA A;  2O85 A;  4TXO A;  5HR0 A;  5D96 A;  16GS A;  4L8E A;  1ZZY A;  2R5G A;  5KN1 A;  1GNE A;  2EIR A;  4AF2 A;  3L9S A;  4HEA 2;  1Z7P A;  4RUV A;  4ECC A;  3CQF A;  3GL3 A;  1AQX A;  2OE1 A;  3E3E A;  2L57 A;  1TK0 B;  4CY8 A;  3GX0 A;  3HJO A;  1GSU A;  2B7J A;  3TKQ A;  2AB6 A;  3A2V A;  2GST A;  1FO5 A;  3A2W A;  3TKS E;  3VI5 A;  4F9Z A;  2HRF A;  2IMD A;  2R3X A;  1HD2 A;  1LJR A;  3ME7 A;  5DJL A;  4DEJ A;  4KGI A;  1QGV A;  1VF4 A;  3GUS A;  3TJJ A;  1A2J A;  2QGV A;  5IQY A;  3TKR A;  5ID2 A;  2K6V A;  2IMK A;  5DDL A;  4G19 A;  5IPG A;  2GSS A;  1FAA A;  5KN0 A;  2YWI A;  4Z2T A;  1K3Y A;  4G10 A;  4MF6 A;  2R6K A;  1NSW A;  3KP8 A;  4WBR D;  1B48 A;  2HXK A;  4DSS B;  4ULX A;  4OO4 A;  1SEN A;  5HFI A;  5KEJ A;  5ELG A;  2NDO A;  11GS A;  1B4Q A;  4RQR A;  3UMA A;  4F82 A;  1Y6E A;  4YAV A;  4K0N A;  2OAD A;  5LNK e;  2VL3 A;  1XWC A;  4RI7 A;  1S3D A;  4MF7 A;  1GL8 A;  2JZS A;  3EUR A;  4PTS A;  1YEX A;  4QL7 A;  1T00 A;  2REM A;  3IOS A;  3BCI A;  3TKS A;  3VWU A;  1F3A A;  3ZZX A;  3GSS A;  4EIQ A;  1OC9 B;  3DWV A;  1OKD A;  3ZRD A;  1N2A A;  4V1A p;  1I5G A;  4OFN A;  1OC3 A;  1GUL A;  2RM6 A;  1A2L A;  3HCZ A;  5J4U A;  3ZRE A;  1TRU A;  1R4W A;  4FO5 A;  2ZNM A;  5ECQ B;  5KN2 A;  3F8U A;  1TU7 A;  3TRX A;  2AUV A;  5JCW A;  1EGO A;  3ERF A;  1JZD A;  2L5O A;  3FZA A;  2AJQ B;  3MSZ A;  3QAW A;  4I97 A;  2HNL A;  3KH9 A;  4MPG A;  1CQH A;  4MZB A;  2IN3 A;  4N11 A;  1XOA A;  5J5N A;  5CNW A;  3W8S A;  3FEU A;  1F9M A;  1X9S B;  1BX9 A;  4PX1 A;  5ECL B;  4K9Z A;  2FA4 A;  4BWS A;  2VM1 A;  3IBH A;  4K2D A;  3UAR A;  3GHA A;  3TRP A;  4KSO A;  4KDU A;  5DAK A;  2GS3 A;  4FYB A;  1BG5 A;  2JSY A;  1O85 A;  4K5R A;  1R5P A;  4MAB A;  5BMU A;  5IMD A;  5ECP B;  2FWE A;  1PD2 1;  3I69 A;  5E4W A;  2B3S A;  3MNG A;  2CAQ A;  1WRY A;  2F9S A;  2N5A A;  2B5Y A;  3EWL A;  3GUR A;  5D8I A;  3DML A;  5HFK A;  1ERU A;  4KDX A;  5DVB A;  5CRH A;  2HSM A;  3LYP A;  4CHS A;  2TRX A;  1GTU A;  2DIY A;  3NIV A;  1XBS A;  2L4C A;  2MMZ A;  2C1Y A;  3TJK A;  2WFC A;  4XS4 A;  1KEB A;  4MH2 A;  3H1N A;  4J56 E;  1MEK A;  3IRA A;  5J3R A;  4O5U A;  2TRC P;  3UBL A;  2H76 A;  2OBI A;  1ZMA A;  2HRA A;  5ECO B;  6GSY A;  3LOR A;  3FZ5 A;  2C0D A;  2EC4 A;  1Z7R A;  3UL3 A;  2DJ0 A;  2VM2 A;  2DJ2 A;  3EMX A;  2FLS A;  3UVH A;  3DKS A;  2WUL A;  4MMM A;  3IAM 2;  3C1S A;  1WJK A;  3WGE A;  3FHK A;  1EWX A;  4ZXG A;  3C73 A;  3SBC A;  3WGX A;  2LUS A;  3MWH A;  2NBS A;  5BRT A;  4YH2 A;  1R7H A;  1OKT A;  2KP2 A;  3D4T A;  1T1V A;  4MF5 A;  4O7H A;  2X8G A;  3D22 A;  3GL5 A;  4MLY A;  2E2M A;  3ME8 A;  1SL2 B;  4XRA A;  3QMX A;  2WRT A;  6GST A;  4Q5N A;  2NTO A;  2PWJ A;  2GQK A;  2HFD A;  5G5E A;  2F51 A;  5IIZ A;  3EYT A;  2FGX A;  5ABR A;  4BVY B;  1EEJ A;  4HQS A;  4NV2 A;  4YKF A;  2EIO A;  3ZIT A;  4GQF A;  3LG6 A;  4BPY A;  1K0C A;  3GV1 A;  2WJU A;  3W8J A;  2LV3 A;  1F3B A;  1SYX A;  5KOW A;  1M3J A;  2B1L A;  2DML A;  2GZP A;  4EDY A;  3L78 A;  1QUW A;  4JZQ A;  1GWC A;  3R3E A;  4L0W A;  1B9X C;  4AJ6 A;  7GSS A;  3F9U A;  1WWJ A;  4QQ7 A;  2H6Y A;  3CXG A;  3I43 A;  5CRD A;  3M0F A;  3VWX A;  2DLX A;  2YN1 A;  2ZUP A;  1MD3 A;  3F6D A;  3EVI A;  1A24 A;  2AYT A;  4N0Z A;  4YQV A;  4ZIL A;  3CTF A;  2WCI A;  3DIE A;  2RM5 A;  5EY6 A;  3KMN A;  3GH6 A;  1A0R P;  3I6A A;  1YQ1 A;  3HD5 A;  1KBN A;  3D4M A;  1T3B A;  4JE1 A;  4G0I A;  1SK2 A;  2HZE A;  1SK1 A;  4EF0 A;  5CRW A;  2HLS A;  1A8Y A;  1U88 A;  5ECR B;  2H19 A;  3RHC A;  3US3 A;  4WF5 A;  5EVO A;  1S3C A;  2QSI A;  3IA1 A;  22GS A;  5DCH A;  3FMW A;  2HT9 A;  1URM A;  3RAZ A;  13GS A;  1GSE A;  2TIR A;  3KZQ A;  4DSS A;  1HYU A;  3VK9 A;  3GFK A;  5JWO B;  2IJY A;  19GS A;  2WDU A;  4X43 A;  3KXO A;  1SKW B;  4V2M A;  2P31 A;  4G2E A;  3KJY A;  4K5S A;  3A3T A;  3HHV A;  5ELA A;  2GQL A;  2LTK A;  1YDK A;  2C3N A;  1M2A A;  5ECM B;  1EEM A;  4BIK A;  1FB0 A;  2GZZ A;  2RUF A;  4IKH A;  2DKH A;  2OE0 A;  3IHG A;  1GTI A;  1OC9 A;  2PMT A;  3WGD A;  2F8A A;  3U5R E;  2OKA A;  3M1G A;  3O3T A;  9GSS A;  2JZR A;  3QFA C;  4ECJ A;  12GS A;  1M0U A;  1MDI A;  2C0E A;  1V40 A;  5IMC A;  3Q74 A;  1VF2 A;  3HA9 A;  2CAI A;  1EOH A;  5LD0 A;  2VD1 A;  3Q18 A;  1FW1 A;  1EOG A;  1OAZ A;  3HXS A;  3FZ4 A;  2H71 A;  5EPF A;  4YAP A;  3H8Q A;  5GSS A;  3HYP A;  5DBQ A;  4GSS A;  1FOV A;  5AIV A;  1M9B A;  2VCX A;  4GF0 A;  4MJE A;  2I81 A;  2E0Q A;  4GCI A;  1O8X A;  1EV4 A;  1AC1 A;  1QK8 A;  4TR1 B;  2P5Q A;  1LU4 A;  3IAS 2;  5H5R A;  4K8M A;  5IO0 A;  3JCM L;  3RBT A;  2GQM A; 
#chains in the Genus database with same CATH homology
 4I6X A;  3ZIJ A;  5GAN D;  4FIW A;  3GNJ A;  4F0B A;  4ZBA A;  4GQC A;  4JR4 A;  4X4J A;  1TDI A;  3O76 A;  4DSR A;  3HDC A;  3TUE A;  4MNN A;  2K8V A;  1JLV A;  4FYU A;  3VWW A;  4KB3 A;  3DVX A;  5CRG A;  1FOH A;  5IMV A;  1ML6 A;  3CYN A;  3UAP A;  1AQV A;  4OMV A;  2MZC A;  4G0K A;  3ZYW A;  5HR3 A;  4BA7 A;  1MTC A;  1O6J A;  2GT6 A;  1O73 A;  4N0V A;  2A2S A;  3ZVJ A;  1THO A;  2L5L A;  1HNA A;  2LEG A;  2O7K A;  5KN3 A;  4XS1 A;  2YOI A;  2D2Z A;  5F0G A;  2K18 A;  1IYI A;  3L4N A;  2C0F A;  3R2Q A;  2JZT A;  3ZMK A;  2R37 A;  4G0L A;  5H5S A;  1A8L A;  4F03 A;  2K9F A;  1B4P A;  1E6B A;  5L71 A;  1XWA A;  4K7I A;  3P7X A;  3QAV A;  3LEF A;  1Q4J A;  1OC8 A;  1R26 A;  1X9W B;  1XIY A;  3RDW A;  1FVJ A;  4RI6 A;  2WGR A;  1TJD A;  1OE7 A;  2A4V A;  2VL2 C;  4I2T A;  2KHP A;  1XW5 A;  2VCW A;  1X5C A;  5B6M A;  4KDY A;  4CY6 A;  4JRR A;  1G7O A;  3F3Q A;  1TRV A;  4HZ4 A;  4ML1 A;  2B5E A;  1O81 A;  2YV9 A;  1ACV A;  1RK4 A;  4OFT A;  4KAE A;  5CYY A;  3EU3 A;  3NZN A;  1J0F A;  1UA5 A;  2HRN A;  2PER A;  20GS A;  1PX7 A;  3EU4 A;  1SJI A;  4BVY A;  2KLX A;  1K3O A;  3TOU A;  1TP9 A;  4IHU A;  1AQW A;  2RII A;  3ZFB A;  4D73 B;  3TKP A;  3CBU A;  4JED A;  4PNF A;  4WKW A;  3KTB A;  3E9J B;  2H1B A;  3WT2 A;  2HZF A;  4RQX A;  3IE3 A;  4DVC A;  4MJB A;  3J7Y b;  5IMZ A;  5A4W A;  4O5Q A;  4PQI A;  1TRW A;  3P90 A;  3GST A;  17GS A;  4XCS A;  4EO3 A;  3F63 A;  2FNO A;  1EP8 A;  2ON5 A;  2N5B A;  4MP4 A;  3QFB C;  1BYE A;  3GKX A;  2YWM A;  4WR4 A;  1K0A A;  4HU7 A;  3GN3 A;  2DSA A;  1UVZ A;  4GST A;  5DAL B;  3M9K A;  1J08 A;  3DXB A;  3WYW A;  3TJG A;  3D5J A;  3A5I A;  2CVB A;  4O5R A;  3KEB A;  4IEL A;  2H30 A;  5D9T A;  2OE3 A;  1Z3E A;  2H01 A;  4ID0 A;  4KA0 A;  4PQH A;  4YQU A;  2JAC A;  2YCD A;  4KND A;  4AJ7 A;  3VPT A;  4ICY A;  4N30 A;  4POB A;  2LRT A;  4AGS A;  1SL1 B;  2LJK A;  3MIX A;  3ERG A;  3FR3 A;  3IK9 A;  5D9V A;  4YQM A;  3N5O A;  2DIZ A;  2DKI A;  3KIJ A;  2ALB A;  2FY6 A;  3KCM A;  2KOK A;  2QA2 A;  2CZ3 A;  6GSX A;  1Z9H A;  3G7J A;  3EE2 A;  3LJR A;  3AY8 A;  4NPB A;  2MBT A;  1F2E A;  4MJA A;  2GSQ A;  5H5Q A;  4PQ1 A;  3HZ8 A;  3SWL A;  4EC0 A;  1X9M B;  2G0F A;  1PN9 A;  1PKW A;  2IMI A;  4I8B A;  3N9J A;  4OD7 A;  1GSY A;  3VWV A;  1GTB A;  1KNG A;  2GVP A;  1H75 A;  3FR6 A;  1AW9 A;  4YKG A;  1LBK A;  5F07 A;  3IC4 A;  3PGT A;  4FYC A;  2CA8 A;  2IMF A;  4EXJ A;  4V1A g;  3PPU A;  1TI3 A;  4PXO A;  2C3T A;  3ZTL A;  2V6K A;  1XW9 A;  1Z5Y E;  1ZYQ B;  4IW9 A;  4PUF C;  1ZYE A;  1NHY A;  1K0D A;  2MMO A;  2IME A;  1VF1 A;  2X4A A;  2VUP A;  2FWH A;  4XRD A;  5ECI B;  4TW5 A;  1WMJ A;  4ECB A;  4EL1 A;  1SD9 A;  1C72 A;  2UZ8 A;  1SYR A;  4WET A;  4JU5 A;  5G1K A;  1X5D A;  4MCU A;  1G7E A;  2Z9S A;  4WF4 A;  1G6Y A;  3UOM A;  4KX4 A;  1YF1 A;  4P3Y B;  2I3Y A;  1BQ7 A;  1PL1 A;  4GLT A;  2B5X A;  1M9A A;  2ZCT A;  1ZYP A;  2IFQ B;  2M72 A;  1SKR B;  2JAD A;  2HE3 A;  4XTS A;  2E7P A;  3EC3 A;  2QA1 A;  3P8W A;  4HQZ A;  1SKS B;  5LCZ A;  1Z6M A;  1HNC A;  2C80 A;  2H8L A;  2LKU A;  5C04 A;  2C8U A;  2PPT A;  2YNX A;  2MBS A;  2OJL A;  2WS2 A;  4ILF A;  1V9W A;  3A5W A;  3K8N A;  1V57 A;  1Y25 A;  3TGZ A;  3D0Z A;  3IPZ A;  3H93 A;  2JU5 A;  1PQN A;  4BL7 B;  2LJA A;  5IPH A;  3C71 A;  4HU9 A;  1XW6 A;  3TKS C;  5HFG A;  2KUC A;  1DE2 A;  1JLW A;  1VRS D;  3KM6 A;  3KMO A;  3ZIV A;  4L0U A;  4F0C A;  2VOC A;  3HY2 A;  4MDC A;  5DQS A;  4TXV A;  2LST A;  5AN1 A;  6GSW A;  3KP9 A;  4MH3 A;  4TR4 A;  4POM A;  3BD2 A;  2YJH A;  3UBK A;  5B8B A;  3GRX A;  1ZCP A;  2XBQ A;  2QKE A;  1JZR A;  14GS A;  2E2G A;  4X1U A;  4NAX A;  5DAK B;  2VIM A;  4MZC A;  5INY A;  4OFM A;  3KH7 A;  2DBC A;  5J41 A;  2MMA A;  3L9U A;  1ERW A;  2GSR A;  3UJ1 A;  1KTE A;  1AXD A;  2LJR A;  1YJ6 A;  4WBJ A;  1R5A A;  4IP6 A;  4L5L A;  3CSI A;  1E2Y A;  4E8H A;  4USS A;  3NOF A;  1X0R A;  1QXH A;  1XWK A;  4HDE A;  4HUA A;  2H6X A;  4ZBB A;  3GKM A;  2H1D A;  1T7P B;  3G7I A;  1XWG A;  2A2P A;  3S9F A;  2C3Q A;  5D73 A;  10GS A;  5AIX A;  1VGL A;  1I9D A;  4LMW A;  5IOW A;  1SJ6 A;  4PUA A;  1GUM A;  2GT5 A;  2RLI A;  3G9B A;  4D73 A;  2CZ2 A;  2BTO T;  1X5E A;  4V2L A;  5ECH B;  1W89 A;  2YZU A;  5FWG A;  2JL4 A;  2V32 A;  1DSB A;  2IWT A;  4MK3 A;  3CMI A;  2PVO C;  3LXZ A;  4XS6 A;  4WEY A;  4A5P A;  1XVW A;  3GIX A;  2VCV A;  3TOT A;  5A4V A;  2H1G A;  2PGT A;  3TB2 A;  3RHB A;  3C8E A;  2IIY A;  6GSU A;  1F37 A;  3IR4 A;  5DAL A;  1NHO A;  1DUG A;  1PX6 A;  1UC7 A;  1M7T A;  2H6Z A;  5B8A A;  4KUN A;  1GLP A;  2OBK A;  2VL9 A;  1RW1 A;  3MYD A;  4I5Q A;  3A2X A;  1FVK A;  5JWR B;  2LNS A;  4FH8 A;  1V2A A;  1GSQ A;  3HVV A;  3UVT A;  4HZ2 A;  2H66 A;  1BAY A;  6GSV A;  2L59 A;  1THX A;  4KSM A;  1USB A;  3DD3 A;  2LQQ A;  1TI1 A;  5HR2 A;  4BVX B;  4K2X A;  4TN8 A;  3PR8 A;  3DVW A;  1QFN A;  1UN2 A;  5HR1 A;  5C00 A;  1BJX A;  3ZLP A;  1GUH A;  4J2F A;  2VCZ A;  4Z7X A;  1PSQ A;  3RPN A;  2KP1 A;  4POL A;  4IBP A;  4X0X A;  3DEX A;  3KTL A;  2B1K A;  1TKD B;  4HOJ A;  4LMV A;  2DC5 A;  4LL1 B;  3F6F A;  2H74 A;  2JSZ A;  3J7Y k;  2HSY A;  2GDR A;  1A23 A;  1ST9 A;  4KE3 A;  3QD9 A;  4JR6 A;  1PA3 A;  2YJ7 A;  2HYX A;  2VD0 A;  4HS1 A;  5E59 A;  3CSH A;  2F3M A;  1GRX A;  1YY7 A;  2X99 A;  2H0G A;  3QCP A;  1AIU A;  3QDN A;  3IXR A;  2HZE B;  3HKR A;  2FA8 A;  2L6D A;  4XIH A;  4HJM A;  3TRQ A;  3W6G A;  1HNB A;  4NV5 A;  2WZ9 A;  1GLQ A;  3FW2 A;  2VLT A;  3GMF A;  2F8F A;  1EGR A;  5D9X A;  1T4Z A;  3APQ A;  2C4J A;  5A5K A;  2X64 A;  3APO A;  4NHZ A;  1K0M A;  1EZK A;  3IK7 A;  1J9B A;  3QR6 A;  2DJ3 A;  4K1F A;  5IMF A;  2R2J A;  4TR3 A;  1GNW A;  4K0G A;  2R0P A;  1FG4 A;  2IFQ A;  4L5O A;  1EP7 A;  2R4V A;  4J57 E;  4O92 A;  3GA4 A;  1OVN A;  3FR9 A;  4HI7 A;  4IVF A;  2HSH A;  2J9H A;  2CV4 A;  2VLV A;  5IM9 A;  1QQ2 A;  1JHB A;  1ZYN A;  1FHE A;  1OYJ A;  2FWG A;  1YF0 A;  4NMU A;  1CQG A;  2YPM A;  4IQA A;  3L0H A;  4BL7 A;  3LFL A;  3BCK A;  3QPM A;  1ZOF A;  2FCH A;  1H4O A;  4IN0 A;  1YEP A;  1V98 A;  4EUY A;  1IYH A;  4EVM A;  3Q19 A;  4TVE A;  5ENU A;  2AV4 A;  2CQ9 A;  5G5F A;  1ILO A;  2IPA A;  4PNG A;  3LXT A;  5D93 A;  4ZL8 A;  1NM3 A;  2GZY A;  2VAF A;  3P2A A;  4TR0 A;  3VUR A;  1M99 A;  3Q6O A;  3QOU A;  3CRU A;  2X8C A;  4IS0 A;  2V1M A;  4Q5Q A;  2CX3 A;  2DJ1 A;  2FD3 A;  3UEM A;  1T4Y A;  3ZFL A;  2H75 A;  4ZL9 A;  3CTG A;  1U87 A;  2PVQ A;  3LQ7 A;  4DSQ A;  2LNT A;  3ZL5 A;  2QC7 A;  4IJ3 A;  3GTU B;  2A2R A;  2LS5 A;  1TTZ A;  2B6M A;  1VF3 A;  2GLR A;  1M2D A;  2RUE A;  1XOB A;  2P5R A;  1U3I A;  2B7K A;  2XBI A;  4GSN A;  2IL3 A;  2XHF A;  3IDV A;  2FHE A;  3FYG A;  3BJ5 A;  2FUG 2;  4CDO A;  4TKY A;  2DJK A;  5G31 A;  4V2N A;  5AIS A;  3CRT A;  2X49 A;  5DQY A;  1O7U A;  4N10 A;  4MZW A;  4OCE A;  1ABA A;  3LGC A;  4TXO B;  2PU9 C;  4MPF A;  1GSD A;  4PUR A;  4PGT A;  1V58 A;  1BED A;  4KCE A;  1PGT A;  3F4S A;  3TCO A;  4ISD A;  2V41 A;  2VLU A;  1YZX A;  4POK A;  2GGT A;  2G2Q A;  1SD8 A;  1XXU A;  1QMV A;  2I9H A;  3QAG A;  4Q5F A;  2J23 A;  4ZL7 A;  2LQO A;  1WIK A;  3V1W A;  4GXZ A;  2GTU A;  1K0N A;  2ES7 A;  2YAN A;  2V2G A;  5G30 A;  3LSZ A;  3KD0 A;  1DBY A;  4NWY A;  1ZL9 A;  1TK8 B;  1XCC A;  4EKZ A;  3D21 A;  1ERV A;  5ID2 B;  2OAC A;  1YKC A;  1A2M A;  2YV7 A;  2H72 A;  5G2Z A;  4EE0 A;  4NXI A;  4ZB8 A;  2PBJ A;  2NVL A;  3ZVJ D;  1JZO A;  4K6X A;  1F6M C;  1WOU A;  5D9W A;  3FK8 A;  5CO3 A;  4TOP A;  4TR1 A;  4HJ2 A;  4EIP A;  1TW9 A;  4IJI A;  3FY7 A;  2ON7 A;  2DMM A;  5FT3 A;  2H0H A;  2O89 A;  1TK5 B;  4CW9 A;  1GTA A;  4WXT A;  5F06 A;  1RQM A;  4LLR A;  5F8B A;  2BMX A;  5J9B A;  1SU9 A;  5IOX A;  2CX4 A;  4ZB6 A;  1HQO A;  1FB6 A;  5AGY A;  4QL9 A;  2PUK C;  1JFU A;  3ERW A;  5IO2 A;  2VCT A;  3G7Y A;  1WP0 A;  2MMN A;  2VO4 A;  1AUC A;  2P0G A;  3GKN A;  2YP6 A;  1U6T A;  2AHE A;  3IV4 A;  4OO5 A;  1DE1 A;  1ERT A;  1MDJ A;  2AAW A;  3HJP A;  3FRC A;  1SJZ A;  3MAK A;  5A4U A;  3EMP A;  1MDK A;  2V6O A;  1EV9 A;  3IHQ A;  5B7C A;  4K7N A;  3WT1 A;  18GS A;  1WPI A;  4BVX A;  5COH A;  3M8N A;  4ECI A;  2FWF A;  1B8X A;  5JCG A;  4GRF A;  4Z2R A;  4LL4 B;  8GSS A;  5F05 A;  3TJF A;  3M9J A;  3BOA A;  1PKZ A;  4KW6 A;  1W4V A;  3ED3 A;  1PL2 A;  3LW9 A;  2VL2 A;  1K0B A;  4KH7 A;  4F2I A;  1MD4 A;  1K3L A;  4IQ1 A;  3H79 A;  3ISO A;  3O6T A;  4IGJ A;  2YZH A;  3BBY A;  4OWY A;  5ECK B;  5EL8 A;  2HI7 A;  2R0G A;  3E0U A;  3IC8 A;  3ZML A;  3TDG A;  5GAP D;  5DCG A;  1PMT A;  3F0I A;  3HVS A;  1GH2 A;  2CVD A;  2CVK A;  4WR5 A;  1XZO A;  2R0C A;  1ZGN A;  1TU8 A;  5ECS A;  5HQP A;  1AAZ A;  5CAX A;  2L6C A;  5GST A;  3I9V 2;  4GWR A;  2BJX A;  3DGQ A;  3M3M A;  4ZB9 A;  2XC2 A;  3C1R A;  4FQU A;  5DJM A;  3PIN A;  1G0T A;  4MJC A;  4I2U A;  2NPB A;  2YWO A;  5J9C A;  1SL0 B;  3TJB A;  2I4A A;  5GZZ B;  1TRS A;  5JWQ B;  5CP1 A;  2L4Q A;  1A0F A;  2H0I A;  4XS4 B;  2H1A A;  3VPQ A;  3D6I A;  1B9Y C;  3MDK A;  1U3A A;  1M2B A;  5FHI A;  4EDZ A;  1NW2 A;  2H73 A;  4Q5R A;  1JZW A;  3F3R A;  3DRN A;  4XHM A;  5ECN B;  3U6V A;  3HVX A;  4Z2U A;  4IP1 A;  2EIQ A;  4GTU A;  1XPV A;  3PH9 A;  4KCA A;  2O8V B;  3VLN A;  3VFI A;  2XPE A;  3L9V A;  1XWB A;  5IMA A;  4MA9 A;  2M46 A;  3DYR A;  3EPT A;  3F4T A;  3KGK A;  4G9H A;  1PN0 A;  2PN8 A;  4KF9 A;  3FKF A;  2OA7 A;  2LRN A;  2VCQ A;  3GKK A;  1Z6N A;  2XPD A;  2K8S A;  1PRX A;  3UIW A;  1TXX A;  5B6N A;  4O32 A;  1G6W A;  3FZ9 A;  4AJ8 A;  1GUK A;  2H70 A;  2M80 A;  1T8E B;  3OR5 A;  3GX8 A;  3APS A;  1N8J A;  3GH9 A;  3GYK A;  3H4K A;  3EIN A;  3VI7 A;  3CSJ A;  1SK0 A;  6GSS A;  2MYG A;  4E8E A;  2DJJ A;  4K7O A;  3GTU A;  2N5F A;  5CRE A;  2I1U A;  2A4H A;  4JBB A;  2YWN A;  1GSS A;  3WD6 A;  1ON4 A;  2CT6 A;  2LRC A;  3LWA A;  3F4R A;  1WE0 A;  5JCU A;  3RPP A;  1OE8 A;  1XVQ A;  4TRX A;  3HJM A;  4ZIJ A;  1XFL A;  4LA1 A;  5KOX A;  1Q98 A;  5G1L A;  4NHW A;  1O8W A;  2HRK A;  4H86 A;  3C7M A;  4OCF A;  3HZ4 A;  4BWQ A;  1GSF A;  1S3A A;  1GP1 A;  1K0O A;  4ML6 A;  4ZBD A;  2X8H A;  2WB9 A;  2C0G A;  2O87 A;  3LYK A;  1TOF A;  4ACS A;  1YKA A;  2O85 A;  4TXO A;  5HR0 A;  5D96 A;  16GS A;  4L8E A;  1ZZY A;  2R5G A;  5KN1 A;  1GNE A;  2EIR A;  4AF2 A;  3L9S A;  4HEA 2;  1Z7P A;  4RUV A;  4ECC A;  3GL3 A;  1AQX A;  2OE1 A;  3E3E A;  2L57 A;  1TK0 B;  4CY8 A;  3GX0 A;  3HJO A;  1GSU A;  2B7J A;  3TKQ A;  2AB6 A;  3A2V A;  2GST A;  1FO5 A;  3A2W A;  3TKS E;  3VI5 A;  4F9Z A;  2HRF A;  2IMD A;  2R3X A;  1HD2 A;  1LJR A;  3ME7 A;  5DJL A;  4DEJ A;  4KGI A;  1QGV A;  1VF4 A;  3GUS A;  3TJJ A;  1A2J A;  2QGV A;  5IQY A;  3TKR A;  5ID2 A;  2K6V A;  2IMK A;  5DDL A;  4G19 A;  5IPG A;  2GSS A;  1FAA A;  5KN0 A;  2YWI A;  4Z2T A;  1K3Y A;  4G10 A;  4MF6 A;  2R6K A;  1NSW A;  3KP8 A;  4WBR D;  1B48 A;  2HXK A;  4DSS B;  4ULX A;  4OO4 A;  1SEN A;  5HFI A;  5KEJ A;  5ELG A;  2NDO A;  11GS A;  1B4Q A;  4RQR A;  3UMA A;  4F82 A;  1Y6E A;  4YAV A;  4K0N A;  2OAD A;  5LNK e;  2VL3 A;  1XWC A;  4RI7 A;  1S3D A;  4MF7 A;  1GL8 A;  2JZS A;  3EUR A;  4PTS A;  1YEX A;  4QL7 A;  1T00 A;  2REM A;  3IOS A;  3BCI A;  3TKS A;  3VWU A;  1F3A A;  3ZZX A;  3GSS A;  4EIQ A;  1OC9 B;  3DWV A;  1OKD A;  3ZRD A;  1N2A A;  4V1A p;  1I5G A;  4OFN A;  1OC3 A;  1GUL A;  2RM6 A;  1A2L A;  3HCZ A;  5J4U A;  3ZRE A;  1TRU A;  1R4W A;  4FO5 A;  2ZNM A;  5ECQ B;  5KN2 A;  3F8U A;  1TU7 A;  3TRX A;  2AUV A;  5JCW A;  1EGO A;  3ERF A;  1JZD A;  2L5O A;  3FZA A;  2AJQ B;  3MSZ A;  3QAW A;  4I97 A;  2HNL A;  3KH9 A;  4MPG A;  1CQH A;  4MZB A;  2IN3 A;  4N11 A;  1XOA A;  5J5N A;  5CNW A;  3W8S A;  3FEU A;  1F9M A;  1X9S B;  1BX9 A;  4PX1 A;  5ECL B;  4K9Z A;  2FA4 A;  4BWS A;  2VM1 A;  3IBH A;  4K2D A;  3UAR A;  3GHA A;  3TRP A;  4KSO A;  4KDU A;  5DAK A;  2GS3 A;  4FYB A;  1BG5 A;  2JSY A;  1O85 A;  4K5R A;  1R5P A;  4MAB A;  5BMU A;  5IMD A;  5ECP B;  2FWE A;  1PD2 1;  3I69 A;  5E4W A;  2B3S A;  3MNG A;  2CAQ A;  1WRY A;  2F9S A;  2N5A A;  2B5Y A;  3EWL A;  3GUR A;  5D8I A;  3DML A;  5HFK A;  1ERU A;  4KDX A;  5DVB A;  5CRH A;  2HSM A;  3LYP A;  4CHS A;  2TRX A;  1GTU A;  2DIY A;  3NIV A;  1XBS A;  2L4C A;  2MMZ A;  2C1Y A;  3TJK A;  2WFC A;  4XS4 A;  1KEB A;  4MH2 A;  3H1N A;  4J56 E;  1MEK A;  3IRA A;  5J3R A;  4O5U A;  2TRC P;  3UBL A;  2H76 A;  2OBI A;  1ZMA A;  2HRA A;  5ECO B;  6GSY A;  3LOR A;  3FZ5 A;  2C0D A;  2EC4 A;  1Z7R A;  3UL3 A;  2DJ0 A;  2VM2 A;  2DJ2 A;  3EMX A;  2FLS A;  3UVH A;  3DKS A;  2WUL A;  4MMM A;  3IAM 2;  3C1S A;  1WJK A;  3WGE A;  3FHK A;  1EWX A;  4ZXG A;  3C73 A;  3SBC A;  3WGX A;  2LUS A;  3MWH A;  2NBS A;  5BRT A;  4YH2 A;  1R7H A;  1OKT A;  2KP2 A;  3D4T A;  1T1V A;  4MF5 A;  4O7H A;  2X8G A;  3D22 A;  3GL5 A;  4MLY A;  2E2M A;  3ME8 A;  1SL2 B;  4XRA A;  3QMX A;  2WRT A;  6GST A;  4Q5N A;  2NTO A;  2PWJ A;  2GQK A;  2HFD A;  5G5E A;  2F51 A;  5IIZ A;  3EYT A;  2FGX A;  5ABR A;  4BVY B;  1EEJ A;  4HQS A;  4NV2 A;  4YKF A;  2EIO A;  3ZIT A;  4GQF A;  3LG6 A;  4BPY A;  1K0C A;  3GV1 A;  2WJU A;  3W8J A;  2LV3 A;  1F3B A;  1SYX A;  5KOW A;  2B1L A;  2DML A;  2GZP A;  4EDY A;  3L78 A;  1QUW A;  4JZQ A;  1GWC A;  3R3E A;  4L0W A;  1B9X C;  4AJ6 A;  7GSS A;  3F9U A;  1WWJ A;  4QQ7 A;  2H6Y A;  3CXG A;  3I43 A;  5CRD A;  3M0F A;  3VWX A;  2DLX A;  2YN1 A;  2ZUP A;  1MD3 A;  3F6D A;  3EVI A;  1A24 A;  2AYT A;  4N0Z A;  4YQV A;  4ZIL A;  3CTF A;  2WCI A;  3DIE A;  2RM5 A;  5EY6 A;  3KMN A;  3GH6 A;  1A0R P;  3I6A A;  1YQ1 A;  3HD5 A;  1KBN A;  3D4M A;  1T3B A;  4JE1 A;  4G0I A;  1SK2 A;  2HZE A;  1SK1 A;  4EF0 A;  5CRW A;  2HLS A;  1A8Y A;  1U88 A;  5ECR B;  2H19 A;  3RHC A;  3US3 A;  4WF5 A;  5EVO A;  1S3C A;  2QSI A;  3IA1 A;  22GS A;  5DCH A;  3FMW A;  2HT9 A;  1URM A;  3RAZ A;  13GS A;  1GSE A;  2TIR A;  3KZQ A;  4DSS A;  1HYU A;  3VK9 A;  3GFK A;  5JWO B;  2IJY A;  19GS A;  2WDU A;  4X43 A;  3KXO A;  1SKW B;  4V2M A;  2P31 A;  4G2E A;  3KJY A;  4K5S A;  3A3T A;  3HHV A;  5ELA A;  2GQL A;  2LTK A;  1YDK A;  2C3N A;  1M2A A;  5ECM B;  1EEM A;  1FB0 A;  2GZZ A;  2RUF A;  4IKH A;  2DKH A;  2OE0 A;  3IHG A;  1GTI A;  1OC9 A;  2PMT A;  3WGD A;  2F8A A;  3U5R E;  2OKA A;  3M1G A;  3O3T A;  9GSS A;  2JZR A;  3QFA C;  4ECJ A;  12GS A;  1M0U A;  1MDI A;  2C0E A;  1V40 A;  5IMC A;  3Q74 A;  1VF2 A;  3HA9 A;  2CAI A;  1EOH A;  5LD0 A;  2VD1 A;  3Q18 A;  1FW1 A;  1EOG A;  1OAZ A;  3HXS A;  3FZ4 A;  2H71 A;  5EPF A;  4YAP A;  3H8Q A;  5GSS A;  3HYP A;  5DBQ A;  4GSS A;  1FOV A;  5AIV A;  1M9B A;  2VCX A;  4GF0 A;  4MJE A;  2I81 A;  2E0Q A;  4GCI A;  1O8X A;  1EV4 A;  1AC1 A;  1QK8 A;  4TR1 B;  2P5Q A;  1LU4 A;  3IAS 2;  5H5R A;  4K8M A;  5IO0 A;  3JCM L;  3RBT A;  2GQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...