5CNWA

Crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
KIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FrnE protein
publication title drFrnE Represents a Hitherto Unknown Class of Eubacterial Cytoplasmic Disulfide Oxido-Reductases.
pubmed doi rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2015-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cnwA01
1EP7A 3QAVA 2O85A 3LJRA 4DSRA 4TR1A 3ZL5A 1V2AA 2QGVA 3HHVA 3CTGA 6GSWA 1B8XA 3GTUA 3A2XA 1XZOA 2RIIA 1M9BA 1C72A 2CT6A 5G5EA 1ABAA 4O32A 2BTOT 1YF0A 4YQMA 4HZ2A 4PURA 1XCCA 2P5RA 5DALB 4KH7A 4QQ7A 1AQWA 4DSQA 3NIVA 3M0FA 4Z7XA 4N11A 4NHZA 5G1LA 5IOWA 5J4UA 4TXOB 2L6CA 2BJXA 3FHKA 2JSYA 3WD6A 3HJPA 4HU7A 3L9UA 4EDZA 1U3AA 3GTUB 4LL1B 4K2DA 3S9FA 4PQHA 2D2ZA 4EXJA 2C3NA 3QCPA 4IHUA 4NWYA 1OKDA 1FG4A 1XOAA 4IN0A 3TKQA 2MMZA 4DSSB 1Z9HA 3GH9A 3HZ4A 3VURA 4KUNA 5D96A 4FIWA 1R26A 4WXTA 3KD0A 2CX4A 4HZ4A 3U5RE 1XFLA 1HNCA 1CQGA 5CNWA 5D9TA 2CVDA 5IMFA 2CV4A 4KX4A 2O89A 3C71A 3ED3A 1K0CA 4MJBA 4MZBA 2N5FA 5F8BA 5B6MA 3L0HA 1B4PA 3VWWA 1K0DA 1V40A 5ECLB 1DUGA 4LL4B 1EWXA 3PGTA 2TRCP 2REMA 5D8IA 2PGTA 3TCOA 1SD9A 1SENA 1G6WA 3J7Yk 3GKNA 3HVSA 1ZCPA 3O3TA 1GWCA 3C7MA 2PVQA 5B8BA 3EVIA 4MK3A 4TRXA 1M2BA 1GSYA 5IPHA 3CXGA 4KA0A 1YY7A 1SU9A 3RHCA 2VD1A 5ELGA 1BYEA 1K0MA 1MDIA 2CZ3A 2VLTA 1X9WB 5KN1A 4F0CA 2HLSA 3BD2A 2LTKA 3VFIA 3A3TA 4ZL7A 1WPIA 6GSYA 5CP1A 1TK8B 5ECHB 6GSUA 2HRNA 4EF0A 1JLVA 5IM9A 3IXRA 5F07A 4I5QA 2H01A 4F82A 3QOUA 5IPGA 1KNGA 3VI7A 4F9ZA 4PUFC 2V1MA 2JADA 1GL8A 3C1SA 2M46A 3TKRA 2X8CA 3ME7A 2IN3A 1XWGA 4XRAA 1FW1A 3GNJA 2H1AA 5HR3A 1EV4A 4V2NA 2FLSA 1BG5A 5ID2A 1R5AA 3IC4A 2HNLA 2EC4A 1SKRB 3HCZA 2WFCA 2MMOA 2P31A 3ZFLA 1SL2B 2EIRA 3TJBA 1GSUA 3K8NA 3QDNA 2QKEA 4ZBDA 1GSSA 2K9FA 1T1VA 1GTAA 4RUVA 3RAZA 4K1FA 4ZB8A 1PMTA 4ZIJA 2X64A 2FUG2 2VM1A 5JCWA 1X9MB 4KCEA 1EOHA 4MPGA 1GLQA 1S3CA 2NVLA 3CSJA 1JZWA 1SD8A 1YQ1A 1OVNA 2H19A 5HFKA 1V57A 1F6MC 3FZAA 5D73A 2Z9SA 2ON7A 4HDEA 4KNDA 2H70A 2V6KA 2IFQB 3UIWA 4TXVA 1EV9A 4KGIA 3F0IA 3TKPA 4J2FA 4WBJA 2IMKA 2CAQA 3E0UA 1K3YA 1TRVA 3DWVA 2VM2A 5G1KA 3D21A 3IBHA 1R5PA 3L9SA 2HZEB 3LORA 4EVMA 3BBYA 2PVOC 1IYHA 5IOXA 3QPMA 2O7KA 1YJ6A 1JHBA 1XIYA 3QMXA 5DVBA 2WCIA 1SJZA 1TJDA 1G7OA 3UBKA 1TI1A 2GSSA 4ULXA 2VCVA 2C0EA 1AIUA 1EEMA 1X0RA 1O6JA 1M7TA 4D73A 2LS5A 1O81A 3LGCA 1X9SB 11GSA 2FNOA 1GUHA 2FWHA 2HSYA 4X0XA 3IHQA 2DJ2A 2WB9A 2KLXA 2M80A 2J9HA 2VUPA 4X1UA 1PX6A 2KP2A 4O7HA 4ZL8A 1K0NA 1GSFA 1U87A 3GIXA 3I43A 4EDYA 4V2LA 1VGLA 3E3EA 4Q5QA 4GSSA 1O85A 1FHEA 2E7PA 2VOCA 3LXZA 5IMZA 6GSSA 1YDKA 1HNAA 3D5JA 5CRWA 2DIYA 4XIHA 4AJ6A 2MYGA 2C0DA 1JFUA 1WE0A 3MWHA 1QUWA 2VL2C 3DD3A 3KP8A 1WOUA 2OE3A 4KCAA 3APQA 2WDUA 5GZZB 2GZZA 2C8UA 3HVVA 3KH7A 1ERVA 1JZDA 4MH2A 1PD21 2WZ9A 3EINA 2XBIA 5ENUA 5A4VA 3TGZA 3VWUA 3F3RA 4OWYA 3KMNA 2H6YA 1PL2A 1A0FA 3P2AA 3QFBC 4HEA2 1FVKA 4I2TA 4ZB6A 4WEYA 3GA4A 4XS6A 2PMTA 3A5WA 4ML6A 3ZRDA 1MTCA 4IJIA 2FA8A 2VO4A 2LQOA 2V32A 2IMIA 1OE8A 4K9ZA 3KTBA 4WBRD 2R5GA 3LYPA 1I9DA 1PL1A 4TR4A 3HYPA 1JZOA 3TKSA 1M2DA 4G2EA 3I69A 3FRCA 4O92A 5KN3A 1WRYA 4CDOA 1YF1A 4Q5FA 2YWOA 4LMVA 4KB3A 2KHPA 3KGKA 1ZOFA 2A2SA 1XVQA 3GHAA 4FYBA 1T4YA 2DMLA 4GXZA 5LD0A 1VRSD 2OACA 2TRXA 3ZREA 3KM6A 1H75A 2HSHA 5DJLA 3C73A 3O6TA 5HFGA 5GAPD 3HDCA 2ALBA 1LJRA 5DQSA 3G7JA 5GSTA 3IA1A 1GTIA 5IQYA 2KP1A 1TRUA 4IKHA 2YZUA 2WJUA 2V6OA 3GMFA 5FWGA 3LYKA 2RM6A 1TP9A 4PQIA 3L4NA 2CVKA 4TN8A 4ECIA 2L6DA 6GSXA 3TB2A 3APSA 4TR0A 2ZNMA 3ZFBA 2H0GA 1PX7A 2LRNA 4CHSA 1XPVA 3BOAA 3ZITA 3VPTA 5HQPA 2AHEA 4IJ3A 2PN8A 4ECJA 1JLWA 1XBSA 4XS4B 2H8LA 1YEXA 1K0OA 2HFDA 1ERWA 2GSQA 2PBJA 3Q19A 4TR1B 4WKWA 5J9CA 5AN1A 1G0TA 4ML1A 1BAYA 1OAZA 2XC2A 1VF4A 1U6TA 1IYIA 1ZYQB 1T3BA 3F6FA 1WJKA 3WT1A 4PXOA 1OYJA 5EPFA 2ON5A 2LEGA 4I2UA 2C3QA 16GSA 2LNSA 2FA4A 2MMAA 2YZHA 2GQKA 3IK7A 1GTBA 2OE1A 4POKA 2H30A 5ECPB 2R2JA 2IMEA 1WMJA 2IWTA 5B6NA 2H73A 1I5GA 1R4WA 2GQMA 2AB6A 1TXXA 1A2MA 2X8GA 1NHOA 1YZXA 3F4RA 3UOMA 1SKWB 2K8VA 5CREA 1ACVA 2L57A 5AIXA 4KDYA 5EVOA 2IJYA 4IVFA 2LNTA 2YOIA 1Y25A 3TJFA 3CSIA 3GRXA 1TRSA 1T00A 4KE3A 1ERUA 5HFIA 20GSA 7GSSA 1VF1A 4OFTA 1V98A 1XOBA 2IL3A 1X5EA 1LU4A 2H6ZA 2VIMA 3IE3A 2F8FA 4K6XA 2JU5A 4GLTA 3IRAA 2LJRA 3TUEA 3VPQA 3CYNA 3HZ8A 2HE3A 3FZ5A 3TJJA 4TOPA 3DRNA 3GKMA 1GTUA 4L8EA 3GSSA 2MBTA 1AAZA 5ELAA 4RQRA 2AAWA 1QFNA 5J41A 1BQ7A 3M3MA 3CRUA 2RLIA 4OD7A 5D9VA 3M1GA 5B7CA 3EYTA 3RBTA 3IPZA 2H75A 3OR5A 4PGTA 3EU4A 4PQ1A 4PUAA 1SKSB 4PX1A 2DJ1A 3W6GA 3SWLA 5A4UA 17GSA 2EIQA 2K8SA 5DAKA 3HY2A 2H66A 4WF5A 5GSSA 1AUCA 3GYKA 4L0WA 1PN9A 2C1YA 5F05A 2YWNA 5C00A 3ZVJA 3HXSA 4HJMA 5FHIA 4X43A 22GSA 2IPAA 4ZB9A 5DJMA 5H5SA 1A24A 2GT6A 3FK8A 3BCKA 3DVWA 1JZRA 3F4SA 3VK9A 3CBUA 5A5KA 4OFNA 1GH2A 3QAWA 3QR6A 1ON4A 3KMOA 3ERFA 2DJKA 3RDWA 1FO5A 1CQHA 1SK1A 3ERGA 1E2YA 1TRWA 5DAKB 10GSA 4HQZA 3PH9A 8GSSA 4HOJA 1GUMA 1TK0B 1UN2A 4MJAA 3H1NA 5C04A 3DMLA 2HZFA 1XWAA 1O7UA 3UAPA 3DIEA 5F06A 1AQXA 1DSBA 1PKZA 3TRPA 3U6VA 5CRDA 1DE2A 5ID2B 2YN1A 2IMFA 2G0FA 1T8EB 5E4WA 4BWSA 5DQYA 14GSA 1HNBA 1GNWA 4JRRA 4Q5RA 1GLPA 4HS1A 4KW6A 2J23A 2L5LA 3BJ5A 5HR2A 4K0NA 3H4KA 5ECQB 1EGRA 2O87A 4Q5NA 5ECSA 1TOFA 1B9XC 2P5QA 4GSTA 1A23A 4XRDA 2OJLA 4I97A 3KJYA 5FT3A 2L59A 1EZKA 3IAS2 3WGDA 4POBA 2AYTA 1S3AA 4IS0A 5KN0A 2B5YA 3J7Yb 1PKWA 3DVXA 1FB6A 4EUYA 1ERTA 4E8HA 18GSA 2I3YA 2N5AA 3FKFA 3WYWA 3H8QA 2YPMA 2FD3A 2ES7A 2LRTA 5ECMB 3W8SA 1ZZYA 1E6BA 1TKDB 4YAPA 4EE0A 4OO5A 4F0BA 4MPFA 2K6VA 1TTZA 2DLXA 4L5LA 2LJKA 3EC3A 3UVHA 1USBA 3FW2A 3KEBA 4G10A 2NTOA 2RUFA 1J0FA 3IR4A 1DBYA 3ZMLA 3F6DA 2R37A 1M0UA 4ZBAA 1G7EA 1THXA 1SK0A 2YANA 3DEXA 5IO2A 5CRHA 3LXTA 2L5OA 2IMDA 3CSHA 2PU9C 2QSIA 3RPPA 4YAVA 2JZRA 2PERA 5HR1A 2H1GA 2DIZA 2JZSA 1QMVA 3CRTA 2YJ7A 3V1WA 4V1Ag 3HVXA 4D73B 1NM3A 1O8XA 2PUKC 2NPBA 4BWQA 2A4VA 4NV5A 2RUEA 1B48A 1R7HA 2OE0A 3KXOA 1F2EA 3WGEA 2GSRA 3NOFA 2DBCA 2OADA 4TR3A 2JL4A 2VL9A 3A2VA 2RM5A 5E59A 1A8LA 1UA5A 1X5CA 2CX3A 4JZQA 3LG6A 2OA7A 3UJ1A 1YEPA 2HI7A 1TW9A 4POMA 1M9AA 2DJ3A 5ECKB 5KEJA 1A2LA 2H76A 4KSMA 2L4QA 1NSWA 4YQVA 3W8JA 4OFMA 2YV9A 4AJ8A 1XWKA 2DJ0A 1Z6NA 2GT5A 3F9UA 5CRGA 3VI5A 1TI3A 4NV2A 1XW5A 1Q4JA 3ISOA 3IAM2 3EMXA 3GSTA 5J9BA 5DBQA 3GKXA 3O76A 1KBNA 2VL3A 1EOGA 5AGYA 3D22A 3A2WA 2GGTA 3TKSE 3ERWA 1QQ2A 2GTUA 1SL1B 4IQ1A 1ZL9A 3GX8A 1XW9A 3FR3A 3TOTA 3VWXA 2DJJA 3LSZA 1Z5YE 4BVYA 4GSNA 1U3IA 3GFKA 2YWMA 4DEJA 5H5QA 2YCDA 4NAXA 4MJEA 2PPTA 3ZLPA 2E2GA 3MAKA 3FZ9A 3UARA 5IO0A 2V2GA 3L9VA 4FO5A 1G6YA 2I4AA 3FR9A 3M8NA 2IIYA 5AISA 1F37A 1O73A 1A0RP 4IP1A 1ILOA 1EP8A 1PA3A 1AC1A 1U88A 2B5EA 2GQLA 1ZGNA 4ID0A 4CW9A 1V9WA 4BA7A 2FY6A 3RHBA 2DMMA 2N5BA 5DALA 3HD5A 3ZZXA 3TRQA 1H4OA 1BX9A 1X5DA 5A4WA 4MF6A 1GP1A 2VCTA 2OBKA 3LEFA 3FZ4A 3PINA 2H1BA 2YWIA 2E2MA 4TXOA 4IELA 4XCSA 3I9V2 5EY6A 1KEBA 1K0BA 4EL1A 4K0GA 2H0HA 3H93A 1Y6EA 3LFLA 2GZYA 1A2JA 4EC0A 3KP9A 2YP6A 3MSZA 4K7NA 1SJIA 6GSVA 2NBSA 3D4TA 1MEKA 3FEUA 4RI6A 4LMWA 2P0GA 3C1RA 1OC9A 4DSSA 5CYYA 3GH6A 1LBKA 2FWGA 2PWJA 1ZMAA 4KSOA 5IMCA 12GSA 3P90A 4P3YB 1PQNA 5JWRB 2R4VA 5EL8A 1TU7A 3WGXA 2H0IA 2VL2A 4MA9A 4MMMA 1PRXA 3BCIA 4KAEA 1OC8A 4TKYA 5D9WA 5ECRB 2VLVA 1ST9A 4JBBA 3ZVJD 5B8AA 1YKAA 4XS1A 1M2AA 4DVCA 13GSA 1KTEA 4K7IA 3Q18A 4WR4A 4ILFA 2X8HA 5ECIB 5G31A 1J9BA 4FH8A 3IDVA 4GCIA 1THOA 3TJGA 1AW9A 1OC9B 3KH9A 3F4TA 1HYUA 3R2QA 3M9JA 4GQFA 4MDCA 5IIZA 2HRFA 3L78A 2CA8A 1TK5B 4WETA 3UL3A 5LNKe 1XXUA 4HQSA 4HI7A 5D9XA 4N0ZA 2JACA 1FB0A 2C3TA 4N10A 2FWFA 1GUKA 2K18A 1SYXA 2H72A 5ECNB 2R3XA 3ME8A 1K3LA 2QC7A 1FAAA 4BVXA 3F8UA 2KUCA 4JEDA 2FCHA 2B7KA 1K3OA 3F63A 4O5RA 2VCZA 1RQMA 4JR4A 3UBLA 2ZCTA 3CMIA 2AV4A 3RPNA 2X99A 5KN2A 3VWVA 2F51A 4QL9A 4K7OA 1Z3EA 2XPDA 2VLUA 5JWQB 3ZYWA 3FYGA 3GN3A 5DDLA 3VLNA 1PGTA 3ZIVA 1GNEA 4IBPA 4GQCA 1F3AA 4F03A 5LCZA 1ZYEA 1TU8A 2KOKA 3GKKA 4ECCA 1MD4A 4TW5A 2A2RA 2DC5A 3ZIJA 1XVWA 2I1UA 3DYRA 4ZILA 2JSZA 4HU9A 2YV7A 5CO3A 3UEMA 1DE1A 3Q6OA 3HJOA 2CZ2A 1GSDA 3N5OA 4RI7A 1FVJA 1OKTA 4I8BA 1Z7RA 3KCMA 1URMA 5CAXA 5AIVA 4QL7A 2CVBA 2B7JA 3KZQA 4YQUA 5JCUA 4YH2A 3JCML 4AGSA 1AQVA 5J3RA 2WGRA 1Z7PA 2IFQA 2XBQA 2B1KA 3DXBA 3TOUA 3GX0A 2GS3A 2GLRA 3TJKA 2AJQB 4EO3A 2WULA 5INYA 2TIRA 5H5RA 1N8JA 2C80A 1S3DA 3D0ZA 2YNXA 1VF2A 3MDKA 3QAGA 2C0GA 2LUSA 4LLRA 1QGVA 4NHWA 4XHMA 4ZL9A 1OC3A 4AF2A 5IMVA 2MBSA 1QK8A 2VCXA 4J56E 1Q98A 2HZEA 3FR6A 3EURA 2MZCA 1FOVA 5GAND 3D6IA 2LV3A 1NW2A 3IOSA 1WWJA 1M99A 5D93A 3TKSC 1A8YA 3IK9A 2DSAA 4FYCA 3QFAC 3PR8A 3GURA 1O8WA 1VF3A 3M9KA 3LWAA 3ZMKA 1GULA 1RW1A 4E8EA 2BMXA 3GL5A 4MP4A 2AUVA 1EGOA 2EIOA 4MABA 3P8WA 4MZWA 4LA1A 4OCEA 4ISDA 2JZTA 3NZNA 4HUAA 3I6AA 1BEDA 3G7IA 5ABRA 2F3MA 1HD2A 2GDRA 2M72A 1J08A 2WRTA 2O8VB 2C4JA 4MF5A 5IMAA 4MLYA 2G2QA 3P7XA 4F2IA 1PSQA 1GSQA 3HA9A 4NPBA 4PNGA 3DGQA 3IV4A 3SBCA 4OCFA 2HXKA 1ML6A 1MD3A 3TDGA 3EE2A 3QD9A 4WF4A 3GV1A 5HR0A 4MF7A 4GF0A 2ZUPA 2VCWA 4OO4A 3US3A 3UMAA 2GVPA 1AXDA 3G7YA 1UVZA 2B1LA 1K0AA 1BJXA 2FGXA 3GUSA 4IW9A 5F0GA 5JWOB 4NMUA 2WS2A 1Z6MA 2V41A 4IGJA 3H79A 1MDJA 2LJAA 4BL7A 1SK2A 1YKCA 3EU3A 2B6MA 4V1Ap 3HKRA 2MMNA 4G9HA 1V58A 4ZXGA 2HT9A 4OMVA 1XW6A 4GTUA 4AJ7A 1N2AA 2H1DA 3G9BA 1B4QA 2YJHA 4ACSA 2CAIA 4L0UA 2CQ9A 4N0VA 1T7PB 1GSEA 5DCGA 1NHYA 1XWBA 2LKUA 3CTFA 5G2ZA 3D4MA 1F9MA 3EMPA 2XPEA 4WR5A 2OBIA 2H74A 1SJ6A 4L5OA 4G19A 4GWRA 2LSTA 3F3QA 3C8EA 1SYRA 2GZPA 4H86A 3MNGA 4TVEA 3HJMA 1HQOA 2C0FA 4K8MA 4MZCA 1EEJA 4RQXA 1WIKA 4I6XA 4ZBBA 9GSSA 3UVTA 1W4VA 3FY7A 1WP0A 4N30A 5DCHA 2VD0A 2R6KA 2GSTA 4KDUA 4GRFA 4NXIA 2FWEA 1RK4A 2H6XA 3GL3A 3TRXA 2VCQA 1GRXA 5ECOB 3APOA 5G5FA 4PNFA 2FHEA 2I9HA 4IQAA 4MJCA 1XWCA 5JCGA 2VAFA 2H71A 4V2MA 3N9JA 2LQQA 1T4ZA 5J5NA 3LQ7A 3E9JB 4HJ2A 4MCUA 1TDIA 4JE1A 4JU5A 3Q74A 6GSTA 1SL0B 19GSA 1W89A 4J57E 3WT2A 1OE7A 4FYUA 2XHFA 4BPYA 4IP6A 5IMDA 2F8AA 2B5XA 4ECBA 3DKSA 1QXHA 4POLA 3KIJA 1B9YC 2L4CA 1MDKA 3ZTLA 2HYXA 2LRCA 2B3SA 5L71A 4KDXA 1UC7A 5COHA 4MH3A 3AY8A 2NDOA 4XTSA 4EKZA 2E0QA 3EWLA 3KTLA 1F3BA 4XS4A 2F9SA 4JR6A 2I81A 2OKAA 5G30A
chains in the Genus database with same CATH superfamily
1EP7A 3QAVA 2O85A 3LJRA 4DSRA 4TR1A 3ZL5A 1V2AA 2QGVA 3HHVA 3CTGA 6GSWA 1B8XA 3GTUA 3A2XA 1XZOA 2RIIA 3EPTA 1M9BA 1C72A 2CT6A 5G5EA 1ABAA 4O32A 2BTOT 1YF0A 4YQMA 4O5UA 4HZ2A 4PURA 1XCCA 2P5RA 5DALB 4KH7A 4QQ7A 1AQWA 4DSQA 3NIVA 3M0FA 4Z7XA 4N11A 4NHZA 5G1LA 5IOWA 5J4UA 4TXOB 2L6CA 2BJXA 3FHKA 2JSYA 3WD6A 3HJPA 4HU7A 3L9UA 4EDZA 1U3AA 3GTUB 4LL1B 5KOXA 4K2DA 3S9FA 4PQHA 2D2ZA 4EXJA 2C3NA 3QCPA 4IHUA 4NWYA 1OKDA 1FG4A 1XOAA 4IN0A 3TKQA 2MMZA 4DSSB 1Z9HA 3GH9A 3HZ4A 3VURA 4KUNA 5D96A 4FIWA 1R26A 4WXTA 3KD0A 2CX4A 4HZ4A 3U5RE 1XFLA 1ZYPA 4G0KA 1HNCA 1CQGA 5CNWA 5D9TA 2CVDA 5IMFA 2CV4A 4KX4A 2O89A 3C71A 3ED3A 1K0CA 2QA1A 4MJBA 4MZBA 2N5FA 5F8BA 5B6MA 3L0HA 1B4PA 3VWWA 1K0DA 1V40A 5ECLB 1DUGA 4LL4B 1EWXA 3PGTA 2TRCP 2REMA 4Z2RA 5D8IA 2PGTA 3TCOA 1SD9A 1SENA 1G6WA 3J7Yk 3GKNA 3HVSA 1ZCPA 3O3TA 1GWCA 3C7MA 2PVQA 5B8BA 3EVIA 4MK3A 4TRXA 1M2BA 1GSYA 5IPHA 3CXGA 4KA0A 3MYDA 1YY7A 1SU9A 3RHCA 2VD1A 5ELGA 1BYEA 1K0MA 1MDIA 2CZ3A 2DKIA 2VLTA 1X9WB 5KN1A 4F0CA 2HLSA 3BD2A 2LTKA 3VFIA 3A3TA 4ZL7A 1WPIA 6GSYA 5CP1A 1TK8B 5ECHB 6GSUA 2HRNA 4EF0A 1JLVA 5IM9A 3IXRA 5F07A 2UZ8A 4I5QA 2H01A 4F82A 3QOUA 5IPGA 4BVXB 1KNGA 3VI7A 4F9ZA 4PUFC 2V1MA 2JADA 1GL8A 3C1SA 2M46A 3TKRA 2X8CA 3ME7A 2IN3A 1XWGA 4XRAA 1FW1A 3GNJA 2H1AA 5HR3A 1EV4A 4V2NA 2FLSA 1BG5A 5ID2A 1R5AA 3IC4A 2HNLA 2EC4A 1SKRB 3HCZA 2WFCA 2MMOA 2P31A 3ZFLA 1SL2B 2EIRA 3TJBA 1GSUA 3K8NA 3QDNA 2QKEA 4ZBDA 1GSSA 2K9FA 1T1VA 1GTAA 4RUVA 3RAZA 4K1FA 4ZB8A 1PMTA 4ZIJA 2X64A 2FUG2 2VM1A 5JCWA 1X9MB 4KCEA 1EOHA 4MPGA 1GLQA 1S3CA 2NVLA 3CSJA 1JZWA 1SD8A 1YQ1A 1OVNA 3HVNA 2H19A 5HFKA 1V57A 1F6MC 3FZAA 5D73A 2Z9SA 2ON7A 4HDEA 4KNDA 2H70A 2V6KA 2IFQB 3UIWA 4TXVA 1EV9A 4KGIA 3F0IA 3TKPA 4J2FA 4WBJA 2IMKA 2CAQA 3E0UA 3CQFA 1K3YA 1TRVA 3DWVA 2VM2A 5G1KA 3D21A 3IBHA 1R5PA 3L9SA 2HZEB 3LORA 4EVMA 3BBYA 2PVOC 1IYHA 4BIKA 5IOXA 3QPMA 2O7KA 1YJ6A 1JHBA 1XIYA 3QMXA 5DVBA 2WCIA 1SJZA 1TJDA 1G7OA 3UBKA 1TI1A 2GSSA 4ULXA 2VCVA 2C0EA 1AIUA 1EEMA 1X0RA 1O6JA 2DKHA 1M7TA 4D73A 2LS5A 1O81A 3LGCA 1X9SB 11GSA 2FNOA 1GUHA 2FWHA 2HSYA 4X0XA 3IHQA 2DJ2A 2WB9A 2KLXA 2M80A 2J9HA 2VUPA 4X1UA 1PX6A 2KP2A 4O7HA 4ZL8A 1K0NA 1GSFA 1PFOA 1U87A 3GIXA 3I43A 4EDYA 4V2LA 1VGLA 3E3EA 4Q5QA 4GSSA 1O85A 1FHEA 2E7PA 2VOCA 3LXZA 5IMZA 6GSSA 1YDKA 1HNAA 3D5JA 5CRWA 2DIYA 4PTSA 4XIHA 4AJ6A 2MYGA 2C0DA 1JFUA 1WE0A 3MWHA 1QUWA 2VL2C 3DD3A 3KP8A 1WOUA 2OE3A 4KCAA 3APQA 2WDUA 5GZZB 2GZZA 2C8UA 3HVVA 4BL7B 3KH7A 1ERVA 2A4HA 1JZDA 4MH2A 1PD21 2WZ9A 3EINA 2XBIA 5ENUA 5A4VA 3TGZA 3VWUA 3F3RA 4OWYA 3KMNA 2H6YA 1PL2A 1A0FA 1S3RA 3P2AA 3QFBC 1FVKA 4HEA2 4I2TA 4ZB6A 4WEYA 3GA4A 4XS6A 2PMTA 3A5WA 4ML6A 3ZRDA 1MTCA 4IJIA 2FA8A 2VO4A 2LQOA 2V32A 2IMIA 1OE8A 4K9ZA 3KTBA 4WBRD 2R5GA 3LYPA 1I9DA 1PL1A 4TR4A 3HYPA 1JZOA 3TKSA 1M2DA 4G2EA 3I69A 3FRCA 4O92A 5KN3A 4CY8A 1WRYA 4CDOA 1YF1A 4Q5FA 2YWOA 4LMVA 4KB3A 2KHPA 3KGKA 1ZOFA 2A2SA 1XVQA 3GHAA 4FYBA 4A5PA 1T4YA 2DMLA 4GXZA 5LD0A 1VRSD 2OACA 2TRXA 3ZREA 3KM6A 1H75A 2HSHA 5DJLA 3C73A 3O6TA 4EIPA 5HFGA 5GAPD 3HDCA 2ALBA 1LJRA 3IHGA 5DQSA 3G7JA 5GSTA 3IA1A 1GTIA 5IQYA 2KP1A 1TRUA 4IKHA 2YZUA 2WJUA 2V6OA 3GMFA 5FWGA 2X49A 2RM6A 3LYKA 1TP9A 4PQIA 3L4NA 2CVKA 4TN8A 4ECIA 2L6DA 6GSXA 3TB2A 3APSA 4TR0A 2ZNMA 3ZFBA 2H0GA 1PX7A 2LRNA 4CHSA 1XPVA 3BOAA 4YKFA 3ZITA 3VPTA 5HQPA 2AHEA 4IJ3A 2PN8A 4ECJA 1JLWA 1XBSA 4XS4B 2H8LA 1YEXA 1K0OA 2HFDA 1ERWA 2GSQA 2PBJA 3Q19A 4TR1B 4WKWA 5J9CA 5AN1A 1G0TA 4ML1A 1BAYA 1OAZA 2XC2A 1VF4A 1U6TA 1IYIA 1ZYQB 1T3BA 3F6FA 1WJKA 3WT1A 4PXOA 1OYJA 2ON5A 2LEGA 5EPFA 4I2UA 2C3QA 16GSA 2LNSA 2FA4A 2MMAA 2YZHA 2GQKA 3IK7A 1GTBA 2OE1A 4POKA 2H30A 5ECPB 2R2JA 2IMEA 1WMJA 2IWTA 5B6NA 2H73A 1I5GA 1R4WA 2GQMA 2AB6A 1TXXA 1A2MA 2X8GA 1NHOA 1YZXA 3F4RA 3UOMA 1SKWB 2K8VA 5CREA 1ACVA 2L57A 5AIXA 4KDYA 5EVOA 2IJYA 4IVFA 2LNTA 2YOIA 1Y25A 3TJFA 3CSIA 3GRXA 1TRSA 1T00A 4KE3A 1ERUA 5HFIA 4FQUA 20GSA 7GSSA 1VF1A 4OFTA 1V98A 1XOBA 4EIQA 2IL3A 1X5EA 1LU4A 2H6ZA 2VIMA 3IE3A 2F8FA 4K6XA 2JU5A 4GLTA 3IRAA 2LJRA 3IC8A 3TUEA 3VPQA 3CYNA 4CY6A 3HZ8A 2HE3A 3FZ5A 3TJJA 4TOPA 3DRNA 3GKMA 1GTUA 4L8EA 3GSSA 2MBTA 1AAZA 5ELAA 4RQRA 4K5SA 2AAWA 1QFNA 5J41A 1BQ7A 3M3MA 3CRUA 2RLIA 4OD7A 5D9VA 3M1GA 5B7CA 3EYTA 3RBTA 3IPZA 2H75A 3OR5A 4PGTA 3EU4A 4PQ1A 4PUAA 1SKSB 4PX1A 2DJ1A 3W6GA 3SWLA 5A4UA 17GSA 2EIQA 2K8SA 5DAKA 3HY2A 2H66A 4WF5A 5GSSA 1AUCA 3GYKA 4L0WA 1PN9A 2C1YA 5F05A 2YWNA 4X4JA 5C00A 3ZVJA 3HXSA 4HJMA 5FHIA 4X43A 22GSA 2IPAA 4ZB9A 5DJMA 5H5SA 1A24A 2GT6A 3FK8A 4G0LA 3BCKA 3DVWA 1JZRA 3F4SA 3VK9A 3CBUA 1PN0A 5A5KA 4OFNA 1GH2A 3QAWA 3QR6A 1ON4A 3KMOA 3ERFA 2DJKA 3RDWA 1FO5A 1CQHA 1SK1A 3ERGA 1E2YA 1TRWA 5DAKB 2HRKA 10GSA 4HQZA 3PH9A 8GSSA 4HOJA 1GUMA 5BMUA 1TK0B 1UN2A 4MJAA 3H1NA 5C04A 3DMLA 2HZFA 1XWAA 1O7UA 2A2PA 3UAPA 3DIEA 5F06A 1AQXA 1DSBA 1PKZA 3TRPA 3U6VA 5CRDA 1DE2A 5ID2B 2YN1A 2IMFA 2G0FA 2R0GA 1T8EB 5E4WA 4BWSA 5DQYA 14GSA 1HNBA 1GNWA 4JRRA 4Q5RA 1GLPA 4HS1A 4KW6A 2J23A 2L5LA 3BJ5A 5HR2A 4K0NA 3H4KA 5ECQB 1EGRA 2O87A 4Q5NA 5ECSA 1TOFA 1B9XC 2P5QA 4GSTA 1A23A 3R3EA 4XRDA 2OJLA 4I97A 3KJYA 5FT3A 2L59A 1EZKA 3IAS2 3WGDA 4POBA 2AYTA 1S3AA 4IS0A 5KN0A 2B5YA 3J7Yb 1PKWA 3DVXA 1FB6A 4EUYA 1ERTA 4E8HA 18GSA 2I3YA 2N5AA 3FKFA 3WYWA 3H8QA 2YPMA 2FD3A 2ES7A 2LRTA 5ECMB 3W8SA 1ZZYA 5KOWA 1E6BA 1TKDB 4YAPA 4EE0A 4OO5A 4F0BA 4MPFA 2K6VA 1TTZA 2DLXA 4L5LA 1M3IA 2LJKA 3EC3A 3UVHA 1USBA 3FW2A 3KEBA 4G10A 2NTOA 2RUFA 1J0FA 3IR4A 1DBYA 3ZMLA 3F6DA 2R37A 1M0UA 4ZBAA 1G7EA 1THXA 1SK0A 2YANA 3DEXA 5IO2A 5CRHA 3LXTA 2L5OA 2IMDA 3CSHA 2PU9C 2QSIA 3RPPA 4YAVA 2JZRA 2PERA 5HR1A 2H1GA 2DIZA 2JZSA 1QMVA 3CRTA 2YJ7A 3V1WA 4V1Ag 3HVXA 4D73B 1NM3A 1O8XA 2PUKC 2NPBA 4BWQA 2A4VA 4NV5A 2RUEA 1B48A 1R7HA 2OE0A 3KXOA 1F2EA 3WGEA 2GSRA 3NOFA 2DBCA 2OADA 4TR3A 2JL4A 2VL9A 3A2VA 2RM5A 5E59A 1A8LA 1UA5A 1X5CA 3MIXA 2CX3A 4JZQA 3LG6A 2R0CA 2OA7A 3UJ1A 1YEPA 2HI7A 1TW9A 4POMA 1M9AA 2DJ3A 5ECKB 5KEJA 1A2LA 2H76A 4KSMA 2L4QA 1NSWA 4YQVA 3W8JA 4OFMA 2YV9A 4AJ8A 1XWKA 2DJ0A 1Z6NA 2GT5A 3F9UA 5CRGA 3VI5A 1TI3A 1XG8A 4NV2A 1XW5A 1Q4JA 3ISOA 3IAM2 3EMXA 3GSTA 5J9BA 5DBQA 3GKXA 3O76A 1KBNA 2VL3A 1EOGA 5AGYA 3D22A 3A2WA 2GGTA 3TKSE 3ERWA 1QQ2A 2GTUA 1SL1B 4IQ1A 1ZL9A 3GX8A 1XW9A 3FR3A 3TOTA 3VWXA 2DJJA 3LSZA 1Z5YE 4BVYA 4GSNA 1U3IA 3GFKA 2YWMA 4DEJA 5H5QA 2YCDA 4NAXA 4MJEA 2PPTA 4Z2UA 3ZLPA 2E2GA 4HSCX 3MAKA 3FZ9A 3UARA 5IO0A 2V2GA 3L9VA 4FO5A 1G6YA 2I4AA 3FR9A 3M8NA 2IIYA 5AISA 1F37A 1O73A 1A0RP 4IP1A 1ILOA 1EP8A 1PA3A 1AC1A 1U88A 2B5EA 2GQLA 1ZGNA 4ID0A 4CW9A 1V9WA 4BA7A 2FY6A 3RHBA 2DMMA 2N5BA 5DALA 3HD5A 3ZZXA 3TRQA 1H4OA 1BX9A 1X5DA 5A4WA 4MF6A 1GP1A 2VCTA 2OBKA 3LEFA 3FZ4A 3PINA 2H1BA 2YWIA 2E2MA 4TXOA 4IELA 4XCSA 3I9V2 5EY6A 1KEBA 1K0BA 4EL1A 4K0GA 2H0HA 3H93A 1Y6EA 3LFLA 2GZYA 1A2JA 4EC0A 3KP9A 2YP6A 3MSZA 4K7NA 1SJIA 6GSVA 4K2XA 2NBSA 3D4TA 1MEKA 3FEUA 4RI6A 4LMWA 2P0GA 3C1RA 1OC9A 4DSSA 5CYYA 3GH6A 1LBKA 2FWGA 2PWJA 1ZMAA 4KSOA 5IMCA 12GSA 3P90A 4P3YB 1PQNA 5JWRB 2R4VA 5EL8A 1TU7A 3WGXA 2H0IA 2VL2A 4MA9A 4MMMA 1PRXA 3BCIA 4KAEA 1OC8A 4TKYA 5D9WA 5ECRB 2VLVA 1ST9A 4JBBA 3ZVJD 5B8AA 4K5RA 1YKAA 4XS1A 1M2AA 4DVCA 13GSA 1KTEA 4K7IA 3Q18A 4WR4A 4ILFA 2X8HA 5ECIB 5G31A 1J9BA 4FH8A 3IDVA 4GCIA 1THOA 3TJGA 1AW9A 1OC9B 3KH9A 3F4TA 1HYUA 3R2QA 3M9JA 4GQFA 1M3JA 4MDCA 5IIZA 2HRFA 4O5QA 3L78A 2CA8A 1TK5B 4WETA 3UL3A 5LNKe 1XXUA 4HQSA 4HI7A 5D9XA 4N0ZA 2JACA 1FB0A 2C3TA 4N10A 2FWFA 4Z2TA 1GUKA 2K18A 1SYXA 2H72A 1FOHA 5ECNB 3LW9A 2R3XA 3ME8A 1K3LA 2QC7A 1FAAA 4BVXA 3F8UA 2KUCA 4JEDA 2FCHA 2B7KA 1K3OA 3F63A 4O5RA 2VCZA 1RQMA 4JR4A 3UBLA 2ZCTA 3CMIA 2AV4A 3RPNA 2X99A 5KN2A 3VWVA 2F51A 4QL9A 4K7OA 1Z3EA 2XPDA 2VLUA 5JWQB 3ZYWA 3FYGA 3GN3A 5DDLA 3VLNA 1PGTA 3ZIVA 1GNEA 4IBPA 4GQCA 1F3AA 2QA2A 4F03A 5LCZA 1ZYEA 1TU8A 2KOKA 3GKKA 4ECCA 1MD4A 4TW5A 2A2RA 2DC5A 3ZIJA 1XVWA 2I1UA 4YKGA 3DYRA 4ZILA 2JSZA 4HU9A 2YV7A 5CO3A 3UEMA 1DE1A 3Q6OA 3HJOA 2CZ2A 1GSDA 3N5OA 4RI7A 1FVJA 1OKTA 4I8BA 1Z7RA 3KCMA 1URMA 5CAXA 2R0PA 5AIVA 4QL7A 2CVBA 2B7JA 3KZQA 4YQUA 5JCUA 4YH2A 3JCML 4AGSA 1AQVA 5J3RA 2WGRA 1Z7PA 2IFQA 2XBQA 2B1KA 3DXBA 3TOUA 3GX0A 2GS3A 2GLRA 3TJKA 2AJQB 4EO3A 2WULA 5INYA 2TIRA 5H5RA 1N8JA 2C80A 1S3DA 3D0ZA 5BRTA 2YNXA 1VF2A 3MDKA 3QAGA 2C0GA 2LUSA 4LLRA 1QGVA 4NHWA 4XHMA 4ZL9A 1OC3A 4AF2A 5IMVA 2MBSA 1QK8A 2VCXA 4J56E 1Q98A 2HZEA 4ICYA 3FR6A 3EURA 2MZCA 1FOVA 5GAND 3D6IA 2LV3A 1NW2A 3IOSA 1WWJA 1M99A 5D93A 3TKSC 1A8YA 3IK9A 2DSAA 4FYCA 3QFAC 3PR8A 3GURA 1O8WA 1VF3A 3M9KA 3LWAA 3ZMKA 1GULA 1RW1A 4E8EA 2BMXA 4MNNA 3GL5A 4MP4A 2AUVA 1EGOA 2EIOA 4MABA 3P8WA 4MZWA 4LA1A 4OCEA 4ISDA 2JZTA 3NZNA 4HUAA 3I6AA 1BEDA 3G7IA 5ABRA 2F3MA 1HD2A 2GDRA 2M72A 1J08A 2WRTA 2O8VB 2C4JA 4MF5A 5IMAA 4MLYA 2G2QA 3P7XA 4F2IA 1PSQA 1GSQA 4G0IA 3HA9A 4NPBA 4PNGA 3DGQA 3IV4A 3SBCA 4OCFA 2HXKA 1ML6A 1MD3A 3TDGA 3EE2A 3QD9A 4WF4A 3GV1A 5HR0A 4MF7A 4GF0A 2ZUPA 2VCWA 4OO4A 3US3A 3UMAA 2GVPA 1AXDA 3G7YA 1UVZA 2B1LA 1K0AA 1BJXA 2FGXA 3GUSA 4IW9A 5F0GA 5JWOB 4NMUA 2WS2A 1Z6MA 2V41A 4IGJA 3H79A 1MDJA 2LJAA 4BL7A 4KF9A 1SK2A 1YKCA 3EU3A 2B6MA 4V1Ap 3HKRA 2MMNA 4G9HA 1V58A 4ZXGA 2HT9A 4OMVA 1XW6A 4GTUA 4AJ7A 1N2AA 2H1DA 3G9BA 1B4QA 2YJHA 4ACSA 2CAIA 4L0UA 2CQ9A 4N0VA 1T7PB 4USSA 1GSEA 5DCGA 1NHYA 3PPUA 1XWBA 2LKUA 3CTFA 5G2ZA 3D4MA 1F9MA 3EMPA 3A5IA 2XPEA 4WR5A 2OBIA 2HRAA 2H74A 1SJ6A 4L5OA 4G19A 4GWRA 2LSTA 3F3QA 3C8EA 1SYRA 2GZPA 4H86A 2HSMA 3MNGA 4TVEA 3HJMA 1HQOA 2C0FA 4K8MA 4MZCA 1EEJA 4RQXA 1WIKA 4I6XA 4ZBBA 9GSSA 3UVTA 1W4VA 3FY7A 1WP0A 4N30A 5DCHA 2VD0A 2R6KA 2GSTA 4KDUA 4GRFA 4NXIA 2FWEA 1RK4A 2H6XA 3GL3A 3TRXA 3FMWA 2VCQA 1GRXA 5ECOB 1ZYNA 3APOA 5G5FA 4PNFA 2FHEA 2I9HA 4IQAA 4MJCA 2X4AA 1XWCA 5JCGA 2VAFA 2H71A 4V2MA 3N9JA 2LQQA 1T4ZA 5J5NA 3LQ7A 3E9JB 4HJ2A 4MCUA 1TDIA 4JE1A 4JU5A 3Q74A 6GSTA 1SL0B 19GSA 1W89A 4J57E 3WT2A 1OE7A 4FYUA 2XHFA 4BPYA 4IP6A 5IMDA 2F8AA 2B5XA 4ECBA 3DKSA 1QXHA 4POLA 3KIJA 1B9YC 2L4CA 1MDKA 3ZTLA 2HYXA 2LRCA 2B3SA 5L71A 4KDXA 1UC7A 5COHA 4BVYB 4MH3A 3AY8A 2NDOA 4XTSA 4EKZA 2E0QA 3EWLA 3KTLA 1F3BA 4XS4A 2F9SA 4JR6A 2I81A 2OKAA 5G30A
chains in the Genus database with same CATH topology
1EP7A 3QAVA 2O85A 3LJRA 4DSRA 4TR1A 3ZL5A 1V2AA 2QGVA 3HHVA 3CTGA 6GSWA 1B8XA 3GTUA 3A2XA 1XZOA 2RIIA 3EPTA 1M9BA 1C72A 2CT6A 5G5EA 1ABAA 4O32A 2BTOT 1YF0A 4YQMA 4O5UA 4HZ2A 4PURA 1XCCA 2P5RA 5DALB 4KH7A 4QQ7A 1AQWA 4DSQA 3NIVA 3M0FA 4Z7XA 4N11A 4NHZA 5G1LA 5IOWA 5J4UA 4TXOB 2L6CA 2BJXA 3FHKA 2JSYA 3WD6A 3HJPA 4HU7A 3L9UA 4EDZA 1U3AA 3GTUB 4LL1B 5KOXA 4K2DA 3S9FA 4PQHA 2D2ZA 4EXJA 2C3NA 3QCPA 4IHUA 4NWYA 1OKDA 1FG4A 1XOAA 4IN0A 3TKQA 2MMZA 4DSSB 1Z9HA 3GH9A 3HZ4A 3VURA 4KUNA 5D96A 4FIWA 1R26A 4WXTA 3KD0A 2CX4A 4HZ4A 3U5RE 1XFLA 1ZYPA 4G0KA 1HNCA 1CQGA 5CNWA 5D9TA 2CVDA 5IMFA 2CV4A 4KX4A 2O89A 3C71A 3ED3A 1K0CA 2QA1A 4MJBA 4MZBA 2N5FA 5F8BA 5B6MA 3L0HA 1B4PA 3VWWA 1K0DA 1V40A 5ECLB 1DUGA 4LL4B 1EWXA 3PGTA 2TRCP 2REMA 4Z2RA 5D8IA 2PGTA 3TCOA 1SD9A 1SENA 1G6WA 3J7Yk 3GKNA 3HVSA 1ZCPA 3O3TA 1GWCA 3C7MA 2PVQA 5B8BA 3EVIA 4MK3A 4TRXA 1M2BA 1GSYA 5IPHA 3CXGA 4KA0A 3MYDA 1YY7A 1SU9A 3RHCA 2VD1A 5ELGA 1BYEA 1K0MA 1MDIA 2CZ3A 2DKIA 2VLTA 1X9WB 5KN1A 4F0CA 2HLSA 3BD2A 2LTKA 3VFIA 3A3TA 4ZL7A 1WPIA 6GSYA 5CP1A 1TK8B 5ECHB 6GSUA 2HRNA 4EF0A 1JLVA 5IM9A 3IXRA 5F07A 2UZ8A 4I5QA 2H01A 4F82A 3QOUA 5IPGA 4BVXB 1KNGA 3VI7A 4F9ZA 4PUFC 2V1MA 2JADA 1GL8A 3C1SA 2M46A 3TKRA 2X8CA 3ME7A 2IN3A 1XWGA 4XRAA 1FW1A 3GNJA 2H1AA 5HR3A 1EV4A 4V2NA 2FLSA 1BG5A 5ID2A 1R5AA 3IC4A 2HNLA 2EC4A 1SKRB 3HCZA 2WFCA 2MMOA 2P31A 3ZFLA 1SL2B 2EIRA 3TJBA 1GSUA 3K8NA 3QDNA 2QKEA 4ZBDA 1GSSA 2K9FA 1T1VA 1GTAA 4RUVA 3RAZA 4K1FA 4ZB8A 1PMTA 4ZIJA 2X64A 2FUG2 2VM1A 5JCWA 1X9MB 4KCEA 1EOHA 4MPGA 1GLQA 1S3CA 2NVLA 3CSJA 1JZWA 1SD8A 1YQ1A 1OVNA 2H19A 5HFKA 1V57A 1F6MC 3FZAA 5D73A 2Z9SA 2ON7A 4HDEA 4KNDA 2H70A 2V6KA 2IFQB 3UIWA 4TXVA 1EV9A 4KGIA 3F0IA 3TKPA 4J2FA 4WBJA 2IMKA 2CAQA 3E0UA 1K3YA 1TRVA 3DWVA 2VM2A 5G1KA 3D21A 3IBHA 1R5PA 3L9SA 2HZEB 3LORA 4EVMA 3BBYA 2PVOC 1IYHA 5IOXA 3QPMA 2O7KA 1YJ6A 1JHBA 1XIYA 3QMXA 5DVBA 2WCIA 1SJZA 1TJDA 1G7OA 3UBKA 1TI1A 2GSSA 4ULXA 2VCVA 2C0EA 1AIUA 1EEMA 1X0RA 1O6JA 2DKHA 1M7TA 4D73A 2LS5A 1O81A 3LGCA 1X9SB 11GSA 2FNOA 1GUHA 2FWHA 2HSYA 4X0XA 3IHQA 2DJ2A 2WB9A 2KLXA 2M80A 2J9HA 2VUPA 4X1UA 1PX6A 2KP2A 4O7HA 4ZL8A 1K0NA 1GSFA 1U87A 3GIXA 3I43A 4EDYA 4V2LA 1VGLA 3E3EA 4Q5QA 4GSSA 1O85A 1FHEA 2E7PA 2VOCA 3LXZA 5IMZA 6GSSA 1YDKA 1HNAA 3D5JA 5CRWA 2DIYA 4PTSA 4XIHA 4AJ6A 2MYGA 2C0DA 1JFUA 1WE0A 3MWHA 1QUWA 2VL2C 3DD3A 3KP8A 1WOUA 2OE3A 4KCAA 3APQA 2WDUA 5GZZB 2GZZA 2C8UA 3HVVA 4BL7B 3KH7A 1ERVA 2A4HA 1JZDA 4MH2A 1PD21 2WZ9A 3EINA 2XBIA 5ENUA 5A4VA 3TGZA 3VWUA 3F3RA 4OWYA 3KMNA 2H6YA 1PL2A 1A0FA 3P2AA 3QFBC 4HEA2 1FVKA 4I2TA 4ZB6A 4WEYA 3GA4A 4XS6A 2PMTA 3A5WA 4ML6A 3ZRDA 1MTCA 4IJIA 2FA8A 2VO4A 2LQOA 2V32A 2IMIA 1OE8A 4K9ZA 3KTBA 4WBRD 2R5GA 3LYPA 1I9DA 1PL1A 4TR4A 3HYPA 1JZOA 3TKSA 1M2DA 4G2EA 3I69A 3FRCA 4O92A 5KN3A 4CY8A 1WRYA 4CDOA 1YF1A 4Q5FA 2YWOA 4LMVA 4KB3A 2KHPA 3KGKA 1ZOFA 2A2SA 1XVQA 3GHAA 4FYBA 4A5PA 1T4YA 2DMLA 4GXZA 5LD0A 1VRSD 2OACA 2TRXA 3ZREA 3KM6A 1H75A 2HSHA 5DJLA 3C73A 3O6TA 4EIPA 5HFGA 5GAPD 3HDCA 2ALBA 1LJRA 3IHGA 5DQSA 3G7JA 5GSTA 3IA1A 1GTIA 5IQYA 2KP1A 1TRUA 4IKHA 2YZUA 2WJUA 2V6OA 3GMFA 5FWGA 2X49A 2RM6A 3LYKA 1TP9A 4PQIA 3L4NA 2CVKA 4TN8A 4ECIA 2L6DA 6GSXA 3TB2A 3APSA 4TR0A 2ZNMA 3ZFBA 2H0GA 1PX7A 2LRNA 4CHSA 1XPVA 3BOAA 4YKFA 3ZITA 3VPTA 5HQPA 2AHEA 4IJ3A 2PN8A 4ECJA 1JLWA 1XBSA 4XS4B 2H8LA 1YEXA 1K0OA 2HFDA 1ERWA 2GSQA 2PBJA 3Q19A 4TR1B 4WKWA 5J9CA 5AN1A 1G0TA 4ML1A 1BAYA 1OAZA 2XC2A 1VF4A 1U6TA 1IYIA 1ZYQB 1T3BA 3F6FA 1WJKA 3WT1A 4PXOA 1OYJA 2ON5A 2LEGA 5EPFA 4I2UA 2C3QA 16GSA 2LNSA 2FA4A 2MMAA 2YZHA 2GQKA 3IK7A 1GTBA 2OE1A 4POKA 2H30A 5ECPB 2R2JA 2IMEA 1WMJA 2IWTA 5B6NA 2H73A 1I5GA 1R4WA 2GQMA 2AB6A 1TXXA 1A2MA 2X8GA 1NHOA 1YZXA 3F4RA 3UOMA 1SKWB 2K8VA 5CREA 1ACVA 2L57A 5AIXA 4KDYA 5EVOA 2IJYA 4IVFA 2LNTA 2YOIA 1Y25A 3TJFA 3CSIA 3GRXA 1TRSA 1T00A 4KE3A 1ERUA 5HFIA 4FQUA 20GSA 7GSSA 1VF1A 4OFTA 1V98A 1XOBA 4EIQA 2IL3A 1X5EA 1LU4A 2H6ZA 2VIMA 3IE3A 2F8FA 4K6XA 2JU5A 4GLTA 3IRAA 2LJRA 3IC8A 3TUEA 3VPQA 3CYNA 4CY6A 3HZ8A 2HE3A 3FZ5A 3TJJA 4TOPA 3DRNA 3GKMA 1GTUA 4L8EA 3GSSA 2MBTA 1AAZA 5ELAA 4RQRA 4K5SA 2AAWA 1QFNA 5J41A 1BQ7A 3M3MA 3CRUA 2RLIA 4OD7A 5D9VA 3M1GA 5B7CA 3EYTA 3RBTA 3IPZA 2H75A 3OR5A 4PGTA 3EU4A 4PQ1A 4PUAA 1SKSB 4PX1A 2DJ1A 3W6GA 3SWLA 5A4UA 17GSA 2EIQA 2K8SA 5DAKA 3HY2A 2H66A 4WF5A 5GSSA 1AUCA 3GYKA 4L0WA 1PN9A 2C1YA 5F05A 2YWNA 4X4JA 5C00A 3ZVJA 3HXSA 4HJMA 5FHIA 4X43A 22GSA 2IPAA 4ZB9A 5DJMA 5H5SA 1A24A 2GT6A 3FK8A 4G0LA 3BCKA 3DVWA 1JZRA 3F4SA 3VK9A 3CBUA 1PN0A 5A5KA 4OFNA 1GH2A 3QAWA 3QR6A 1ON4A 3KMOA 3ERFA 2DJKA 3RDWA 1FO5A 1CQHA 1SK1A 3ERGA 1E2YA 1TRWA 5DAKB 2HRKA 10GSA 4HQZA 3PH9A 8GSSA 4HOJA 1GUMA 5BMUA 1TK0B 1UN2A 4MJAA 3H1NA 5C04A 3DMLA 2HZFA 1XWAA 1O7UA 2A2PA 3UAPA 3DIEA 5F06A 1AQXA 1DSBA 1PKZA 3TRPA 3U6VA 5CRDA 1DE2A 5ID2B 2YN1A 2IMFA 2G0FA 2R0GA 1T8EB 5E4WA 4BWSA 5DQYA 14GSA 1HNBA 1GNWA 4JRRA 4Q5RA 1GLPA 4HS1A 4KW6A 2J23A 2L5LA 3BJ5A 5HR2A 4K0NA 3H4KA 5ECQB 1EGRA 2O87A 4Q5NA 5ECSA 1TOFA 1B9XC 2P5QA 4GSTA 1A23A 3R3EA 4XRDA 2OJLA 4I97A 3KJYA 5FT3A 2L59A 1EZKA 3IAS2 3WGDA 4POBA 2AYTA 1S3AA 4IS0A 5KN0A 2B5YA 3J7Yb 1PKWA 3DVXA 1FB6A 4EUYA 1ERTA 4E8HA 18GSA 2I3YA 2N5AA 3FKFA 3WYWA 3H8QA 2YPMA 2FD3A 2ES7A 2LRTA 5ECMB 3W8SA 1ZZYA 5KOWA 1E6BA 1TKDB 4YAPA 4EE0A 4OO5A 4F0BA 4MPFA 2K6VA 1TTZA 2DLXA 4L5LA 2LJKA 3EC3A 3UVHA 1USBA 3FW2A 3KEBA 4G10A 2NTOA 2RUFA 1J0FA 3IR4A 1DBYA 3ZMLA 3F6DA 2R37A 1M0UA 4ZBAA 1G7EA 1THXA 1SK0A 2YANA 3DEXA 5IO2A 5CRHA 3LXTA 2L5OA 2IMDA 3CSHA 2PU9C 2QSIA 3RPPA 4YAVA 2JZRA 2PERA 5HR1A 2H1GA 2DIZA 2JZSA 1QMVA 3CRTA 2YJ7A 3V1WA 4V1Ag 3HVXA 4D73B 1NM3A 1O8XA 2PUKC 2NPBA 4BWQA 2A4VA 4NV5A 2RUEA 1B48A 1R7HA 2OE0A 3KXOA 1F2EA 3WGEA 2GSRA 3NOFA 2DBCA 2OADA 4TR3A 2JL4A 2VL9A 3A2VA 2RM5A 5E59A 1A8LA 1UA5A 1X5CA 3MIXA 2CX3A 4JZQA 3LG6A 2R0CA 2OA7A 3UJ1A 1YEPA 2HI7A 1TW9A 4POMA 1M9AA 2DJ3A 5ECKB 5KEJA 1A2LA 2H76A 4KSMA 2L4QA 1NSWA 4YQVA 3W8JA 4OFMA 2YV9A 4AJ8A 1XWKA 2DJ0A 1Z6NA 2GT5A 3F9UA 5CRGA 3VI5A 1TI3A 4NV2A 1XW5A 1Q4JA 3ISOA 3IAM2 3EMXA 3GSTA 5J9BA 5DBQA 3GKXA 3O76A 1KBNA 2VL3A 1EOGA 5AGYA 3D22A 3A2WA 2GGTA 3TKSE 3ERWA 1QQ2A 2GTUA 1SL1B 4IQ1A 1ZL9A 3GX8A 1XW9A 3FR3A 3TOTA 3VWXA 2DJJA 3LSZA 1Z5YE 4BVYA 4GSNA 1U3IA 3GFKA 2YWMA 4DEJA 5H5QA 2YCDA 4NAXA 4MJEA 2PPTA 4Z2UA 3ZLPA 2E2GA 3MAKA 3FZ9A 3UARA 5IO0A 2V2GA 3L9VA 4FO5A 1G6YA 2I4AA 3FR9A 3M8NA 2IIYA 5AISA 1F37A 1O73A 1A0RP 4IP1A 1ILOA 1EP8A 1PA3A 1AC1A 1U88A 2B5EA 2GQLA 1ZGNA 4ID0A 4CW9A 1V9WA 4BA7A 2FY6A 3RHBA 2DMMA 2N5BA 5DALA 3HD5A 3ZZXA 3TRQA 1H4OA 1BX9A 1X5DA 5A4WA 4MF6A 1GP1A 2VCTA 2OBKA 3LEFA 3FZ4A 3PINA 2H1BA 2YWIA 2E2MA 4TXOA 4IELA 4XCSA 3I9V2 5EY6A 1KEBA 1K0BA 4EL1A 4K0GA 2H0HA 3H93A 1Y6EA 3LFLA 2GZYA 1A2JA 4EC0A 3KP9A 2YP6A 3MSZA 4K7NA 1SJIA 6GSVA 4K2XA 2NBSA 3D4TA 1MEKA 3FEUA 4RI6A 4LMWA 2P0GA 3C1RA 1OC9A 4DSSA 5CYYA 3GH6A 1LBKA 2FWGA 2PWJA 1ZMAA 4KSOA 5IMCA 12GSA 3P90A 4P3YB 1PQNA 5JWRB 2R4VA 5EL8A 1TU7A 3WGXA 2H0IA 2VL2A 4MA9A 4MMMA 1PRXA 3BCIA 4KAEA 1OC8A 4TKYA 5D9WA 5ECRB 2VLVA 1ST9A 4JBBA 3ZVJD 5B8AA 4K5RA 1YKAA 4XS1A 1M2AA 4DVCA 13GSA 1KTEA 4K7IA 3Q18A 4WR4A 4ILFA 2X8HA 5ECIB 5G31A 1J9BA 4FH8A 3IDVA 4GCIA 1THOA 3TJGA 1AW9A 1OC9B 3KH9A 3F4TA 1HYUA 3R2QA 3M9JA 4GQFA 4MDCA 5IIZA 2HRFA 4O5QA 3L78A 2CA8A 1TK5B 4WETA 3UL3A 5LNKe 1XXUA 4HQSA 4HI7A 5D9XA 4N0ZA 2JACA 1FB0A 2C3TA 4N10A 2FWFA 4Z2TA 1GUKA 2K18A 1SYXA 2H72A 1FOHA 5ECNB 3LW9A 2R3XA 3ME8A 1K3LA 2QC7A 1FAAA 4BVXA 3F8UA 2KUCA 4JEDA 2FCHA 2B7KA 1K3OA 3F63A 4O5RA 2VCZA 1RQMA 4JR4A 3UBLA 2ZCTA 3CMIA 2AV4A 3RPNA 2X99A 5KN2A 3VWVA 2F51A 4QL9A 4K7OA 1Z3EA 2XPDA 2VLUA 5JWQB 3ZYWA 3FYGA 3GN3A 5DDLA 3VLNA 1PGTA 3ZIVA 1GNEA 4IBPA 4GQCA 1F3AA 2QA2A 4F03A 5LCZA 1ZYEA 1TU8A 2KOKA 3GKKA 4ECCA 1MD4A 4TW5A 2A2RA 2DC5A 3ZIJA 1XVWA 2I1UA 4YKGA 3DYRA 4ZILA 2JSZA 4HU9A 2YV7A 5CO3A 3UEMA 1DE1A 3Q6OA 3HJOA 2CZ2A 1GSDA 3N5OA 4RI7A 1FVJA 1OKTA 4I8BA 1Z7RA 3KCMA 1URMA 5CAXA 2R0PA 5AIVA 4QL7A 2CVBA 2B7JA 3KZQA 4YQUA 5JCUA 4YH2A 3JCML 4AGSA 1AQVA 5J3RA 2WGRA 1Z7PA 2IFQA 2XBQA 2B1KA 3DXBA 3TOUA 3GX0A 2GS3A 2GLRA 3TJKA 2AJQB 4EO3A 2WULA 5INYA 2TIRA 5H5RA 1N8JA 2C80A 1S3DA 3D0ZA 5BRTA 2YNXA 1VF2A 3MDKA 3QAGA 2C0GA 2LUSA 4LLRA 1QGVA 4NHWA 4XHMA 4ZL9A 1OC3A 4AF2A 5IMVA 2MBSA 1QK8A 2VCXA 4J56E 1Q98A 2HZEA 4ICYA 3FR6A 3EURA 2MZCA 1FOVA 5GAND 3D6IA 2LV3A 1NW2A 3IOSA 1WWJA 1M99A 5D93A 3TKSC 1A8YA 3IK9A 2DSAA 4FYCA 3QFAC 3PR8A 3GURA 1O8WA 1VF3A 3M9KA 3LWAA 3ZMKA 1GULA 1RW1A 4E8EA 2BMXA 4MNNA 3GL5A 4MP4A 2AUVA 1EGOA 2EIOA 4MABA 3P8WA 4MZWA 4LA1A 4OCEA 4ISDA 2JZTA 3NZNA 4HUAA 3I6AA 1BEDA 3G7IA 5ABRA 2F3MA 1HD2A 2GDRA 2M72A 1J08A 2WRTA 2O8VB 2C4JA 4MF5A 5IMAA 4MLYA 2G2QA 3P7XA 4F2IA 1PSQA 1GSQA 4G0IA 3HA9A 4NPBA 4PNGA 3DGQA 3IV4A 3SBCA 4OCFA 2HXKA 1ML6A 1MD3A 3TDGA 3EE2A 3QD9A 4WF4A 3GV1A 5HR0A 4MF7A 4GF0A 2ZUPA 2VCWA 4OO4A 3US3A 3UMAA 2GVPA 1AXDA 3G7YA 1UVZA 2B1LA 1K0AA 1BJXA 2FGXA 3GUSA 4IW9A 5F0GA 5JWOB 4NMUA 2WS2A 1Z6MA 2V41A 4IGJA 3H79A 1MDJA 2LJAA 4BL7A 4KF9A 1SK2A 1YKCA 3EU3A 2B6MA 4V1Ap 3HKRA 2MMNA 4G9HA 1V58A 4ZXGA 2HT9A 4OMVA 1XW6A 4GTUA 4AJ7A 1N2AA 2H1DA 3G9BA 1B4QA 2YJHA 4ACSA 2CAIA 4L0UA 2CQ9A 4N0VA 1T7PB 4USSA 1GSEA 5DCGA 1NHYA 3PPUA 1XWBA 2LKUA 3CTFA 5G2ZA 3D4MA 1F9MA 3EMPA 3A5IA 2XPEA 4WR5A 2OBIA 2HRAA 2H74A 1SJ6A 4L5OA 4G19A 4GWRA 2LSTA 3F3QA 3C8EA 1SYRA 2GZPA 4H86A 2HSMA 3MNGA 4TVEA 3HJMA 1HQOA 2C0FA 4K8MA 4MZCA 1EEJA 4RQXA 1WIKA 4I6XA 4ZBBA 9GSSA 3UVTA 1W4VA 3FY7A 1WP0A 4N30A 5DCHA 2VD0A 2R6KA 2GSTA 4KDUA 4GRFA 4NXIA 2FWEA 1RK4A 2H6XA 3GL3A 3TRXA 3FMWA 2VCQA 1GRXA 5ECOB 1ZYNA 3APOA 5G5FA 4PNFA 2FHEA 2I9HA 4IQAA 4MJCA 2X4AA 1XWCA 5JCGA 2VAFA 2H71A 4V2MA 3N9JA 2LQQA 1T4ZA 5J5NA 3LQ7A 3E9JB 4HJ2A 4MCUA 1TDIA 4JE1A 4JU5A 3Q74A 6GSTA 1SL0B 19GSA 1W89A 4J57E 3WT2A 1OE7A 4FYUA 2XHFA 4BPYA 4IP6A 5IMDA 2F8AA 2B5XA 4ECBA 3DKSA 1QXHA 4POLA 3KIJA 1B9YC 2L4CA 1MDKA 3ZTLA 2HYXA 2LRCA 2B3SA 5L71A 4KDXA 1UC7A 5COHA 4BVYB 4MH3A 3AY8A 2NDOA 4XTSA 4EKZA 2E0QA 3EWLA 3KTLA 1F3BA 4XS4A 2F9SA 4JR6A 2I81A 2OKAA 5G30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP7 A;  3QAV A;  2O85 A;  3LJR A;  4DSR A;  4TR1 A;  3ZL5 A;  1V2A A;  2QGV A;  3HHV A;  3CTG A;  6GSW A;  1B8X A;  3GTU A;  3A2X A;  1XZO A;  2RII A;  1M9B A;  1C72 A;  2CT6 A;  5G5E A;  1ABA A;  4O32 A;  2BTO T;  1YF0 A;  4YQM A;  4HZ2 A;  4PUR A;  1XCC A;  2P5R A;  5DAL B;  4KH7 A;  4QQ7 A;  1AQW A;  4DSQ A;  3NIV A;  3M0F A;  4Z7X A;  4N11 A;  4NHZ A;  5G1L A;  5IOW A;  5J4U A;  4TXO B;  2L6C A;  2BJX A;  3FHK A;  2JSY A;  3WD6 A;  3HJP A;  4HU7 A;  3L9U A;  4EDZ A;  1U3A A;  3GTU B;  4LL1 B;  4K2D A;  3S9F A;  4PQH A;  2D2Z A;  4EXJ A;  2C3N A;  3QCP A;  4IHU A;  4NWY A;  1OKD A;  1FG4 A;  1XOA A;  4IN0 A;  3TKQ A;  2MMZ A;  4DSS B;  1Z9H A;  3GH9 A;  3HZ4 A;  3VUR A;  4KUN A;  5D96 A;  4FIW A;  1R26 A;  4WXT A;  3KD0 A;  2CX4 A;  4HZ4 A;  3U5R E;  1XFL A;  1HNC A;  1CQG A;  5CNW A;  5D9T A;  2CVD A;  5IMF A;  2CV4 A;  4KX4 A;  2O89 A;  3C71 A;  3ED3 A;  1K0C A;  4MJB A;  4MZB A;  2N5F A;  5F8B A;  5B6M A;  3L0H A;  1B4P A;  3VWW A;  1K0D A;  1V40 A;  5ECL B;  1DUG A;  4LL4 B;  1EWX A;  3PGT A;  2TRC P;  2REM A;  5D8I A;  2PGT A;  3TCO A;  1SD9 A;  1SEN A;  1G6W A;  3J7Y k;  3GKN A;  3HVS A;  1ZCP A;  3O3T A;  1GWC A;  3C7M A;  2PVQ A;  5B8B A;  3EVI A;  4MK3 A;  4TRX A;  1M2B A;  1GSY A;  5IPH A;  3CXG A;  4KA0 A;  1YY7 A;  1SU9 A;  3RHC A;  2VD1 A;  5ELG A;  1BYE A;  1K0M A;  1MDI A;  2CZ3 A;  2VLT A;  1X9W B;  5KN1 A;  4F0C A;  2HLS A;  3BD2 A;  2LTK A;  3VFI A;  3A3T A;  4ZL7 A;  1WPI A;  6GSY A;  5CP1 A;  1TK8 B;  5ECH B;  6GSU A;  2HRN A;  4EF0 A;  1JLV A;  5IM9 A;  3IXR A;  5F07 A;  4I5Q A;  2H01 A;  4F82 A;  3QOU A;  5IPG A;  1KNG A;  3VI7 A;  4F9Z A;  4PUF C;  2V1M A;  2JAD A;  1GL8 A;  3C1S A;  2M46 A;  3TKR A;  2X8C A;  3ME7 A;  2IN3 A;  1XWG A;  4XRA A;  1FW1 A;  3GNJ A;  2H1A A;  5HR3 A;  1EV4 A;  4V2N A;  2FLS A;  1BG5 A;  5ID2 A;  1R5A A;  3IC4 A;  2HNL A;  2EC4 A;  1SKR B;  3HCZ A;  2WFC A;  2MMO A;  2P31 A;  3ZFL A;  1SL2 B;  2EIR A;  3TJB A;  1GSU A;  3K8N A;  3QDN A;  2QKE A;  4ZBD A;  1GSS A;  2K9F A;  1T1V A;  1GTA A;  4RUV A;  3RAZ A;  4K1F A;  4ZB8 A;  1PMT A;  4ZIJ A;  2X64 A;  2FUG 2;  2VM1 A;  5JCW A;  1X9M B;  4KCE A;  1EOH A;  4MPG A;  1GLQ A;  1S3C A;  2NVL A;  3CSJ A;  1JZW A;  1SD8 A;  1YQ1 A;  1OVN A;  2H19 A;  5HFK A;  1V57 A;  1F6M C;  3FZA A;  5D73 A;  2Z9S A;  2ON7 A;  4HDE A;  4KND A;  2H70 A;  2V6K A;  2IFQ B;  3UIW A;  4TXV A;  1EV9 A;  4KGI A;  3F0I A;  3TKP A;  4J2F A;  4WBJ A;  2IMK A;  2CAQ A;  3E0U A;  1K3Y A;  1TRV A;  3DWV A;  2VM2 A;  5G1K A;  3D21 A;  3IBH A;  1R5P A;  3L9S A;  2HZE B;  3LOR A;  4EVM A;  3BBY A;  2PVO C;  1IYH A;  5IOX A;  3QPM A;  2O7K A;  1YJ6 A;  1JHB A;  1XIY A;  3QMX A;  5DVB A;  2WCI A;  1SJZ A;  1TJD A;  1G7O A;  3UBK A;  1TI1 A;  2GSS A;  4ULX A;  2VCV A;  2C0E A;  1AIU A;  1EEM A;  1X0R A;  1O6J A;  1M7T A;  4D73 A;  2LS5 A;  1O81 A;  3LGC A;  1X9S B;  11GS A;  2FNO A;  1GUH A;  2FWH A;  2HSY A;  4X0X A;  3IHQ A;  2DJ2 A;  2WB9 A;  2KLX A;  2M80 A;  2J9H A;  2VUP A;  4X1U A;  1PX6 A;  2KP2 A;  4O7H A;  4ZL8 A;  1K0N A;  1GSF A;  1U87 A;  3GIX A;  3I43 A;  4EDY A;  4V2L A;  1VGL A;  3E3E A;  4Q5Q A;  4GSS A;  1O85 A;  1FHE A;  2E7P A;  2VOC A;  3LXZ A;  5IMZ A;  6GSS A;  1YDK A;  1HNA A;  3D5J A;  5CRW A;  2DIY A;  4XIH A;  4AJ6 A;  2MYG A;  2C0D A;  1JFU A;  1WE0 A;  3MWH A;  1QUW A;  2VL2 C;  3DD3 A;  3KP8 A;  1WOU A;  2OE3 A;  4KCA A;  3APQ A;  2WDU A;  5GZZ B;  2GZZ A;  2C8U A;  3HVV A;  3KH7 A;  1ERV A;  1JZD A;  4MH2 A;  1PD2 1;  2WZ9 A;  3EIN A;  2XBI A;  5ENU A;  5A4V A;  3TGZ A;  3VWU A;  3F3R A;  4OWY A;  3KMN A;  2H6Y A;  1PL2 A;  1A0F A;  3P2A A;  3QFB C;  4HEA 2;  1FVK A;  4I2T A;  4ZB6 A;  4WEY A;  3GA4 A;  4XS6 A;  2PMT A;  3A5W A;  4ML6 A;  3ZRD A;  1MTC A;  4IJI A;  2FA8 A;  2VO4 A;  2LQO A;  2V32 A;  2IMI A;  1OE8 A;  4K9Z A;  3KTB A;  4WBR D;  2R5G A;  3LYP A;  1I9D A;  1PL1 A;  4TR4 A;  3HYP A;  1JZO A;  3TKS A;  1M2D A;  4G2E A;  3I69 A;  3FRC A;  4O92 A;  5KN3 A;  1WRY A;  4CDO A;  1YF1 A;  4Q5F A;  2YWO A;  4LMV A;  4KB3 A;  2KHP A;  3KGK A;  1ZOF A;  2A2S A;  1XVQ A;  3GHA A;  4FYB A;  1T4Y A;  2DML A;  4GXZ A;  5LD0 A;  1VRS D;  2OAC A;  2TRX A;  3ZRE A;  3KM6 A;  1H75 A;  2HSH A;  5DJL A;  3C73 A;  3O6T A;  5HFG A;  5GAP D;  3HDC A;  2ALB A;  1LJR A;  5DQS A;  3G7J A;  5GST A;  3IA1 A;  1GTI A;  5IQY A;  2KP1 A;  1TRU A;  4IKH A;  2YZU A;  2WJU A;  2V6O A;  3GMF A;  5FWG A;  3LYK A;  2RM6 A;  1TP9 A;  4PQI A;  3L4N A;  2CVK A;  4TN8 A;  4ECI A;  2L6D A;  6GSX A;  3TB2 A;  3APS A;  4TR0 A;  2ZNM A;  3ZFB A;  2H0G A;  1PX7 A;  2LRN A;  4CHS A;  1XPV A;  3BOA A;  3ZIT A;  3VPT A;  5HQP A;  2AHE A;  4IJ3 A;  2PN8 A;  4ECJ A;  1JLW A;  1XBS A;  4XS4 B;  2H8L A;  1YEX A;  1K0O A;  2HFD A;  1ERW A;  2GSQ A;  2PBJ A;  3Q19 A;  4TR1 B;  4WKW A;  5J9C A;  5AN1 A;  1G0T A;  4ML1 A;  1BAY A;  1OAZ A;  2XC2 A;  1VF4 A;  1U6T A;  1IYI A;  1ZYQ B;  1T3B A;  3F6F A;  1WJK A;  3WT1 A;  4PXO A;  1OYJ A;  5EPF A;  2ON5 A;  2LEG A;  4I2U A;  2C3Q A;  16GS A;  2LNS A;  2FA4 A;  2MMA A;  2YZH A;  2GQK A;  3IK7 A;  1GTB A;  2OE1 A;  4POK A;  2H30 A;  5ECP B;  2R2J A;  2IME A;  1WMJ A;  2IWT A;  5B6N A;  2H73 A;  1I5G A;  1R4W A;  2GQM A;  2AB6 A;  1TXX A;  1A2M A;  2X8G A;  1NHO A;  1YZX A;  3F4R A;  3UOM A;  1SKW B;  2K8V A;  5CRE A;  1ACV A;  2L57 A;  5AIX A;  4KDY A;  5EVO A;  2IJY A;  4IVF A;  2LNT A;  2YOI A;  1Y25 A;  3TJF A;  3CSI A;  3GRX A;  1TRS A;  1T00 A;  4KE3 A;  1ERU A;  5HFI A;  20GS A;  7GSS A;  1VF1 A;  4OFT A;  1V98 A;  1XOB A;  2IL3 A;  1X5E A;  1LU4 A;  2H6Z A;  2VIM A;  3IE3 A;  2F8F A;  4K6X A;  2JU5 A;  4GLT A;  3IRA A;  2LJR A;  3TUE A;  3VPQ A;  3CYN A;  3HZ8 A;  2HE3 A;  3FZ5 A;  3TJJ A;  4TOP A;  3DRN A;  3GKM A;  1GTU A;  4L8E A;  3GSS A;  2MBT A;  1AAZ A;  5ELA A;  4RQR A;  2AAW A;  1QFN A;  5J41 A;  1BQ7 A;  3M3M A;  3CRU A;  2RLI A;  4OD7 A;  5D9V A;  3M1G A;  5B7C A;  3EYT A;  3RBT A;  3IPZ A;  2H75 A;  3OR5 A;  4PGT A;  3EU4 A;  4PQ1 A;  4PUA A;  1SKS B;  4PX1 A;  2DJ1 A;  3W6G A;  3SWL A;  5A4U A;  17GS A;  2EIQ A;  2K8S A;  5DAK A;  3HY2 A;  2H66 A;  4WF5 A;  5GSS A;  1AUC A;  3GYK A;  4L0W A;  1PN9 A;  2C1Y A;  5F05 A;  2YWN A;  5C00 A;  3ZVJ A;  3HXS A;  4HJM A;  5FHI A;  4X43 A;  22GS A;  2IPA A;  4ZB9 A;  5DJM A;  5H5S A;  1A24 A;  2GT6 A;  3FK8 A;  3BCK A;  3DVW A;  1JZR A;  3F4S A;  3VK9 A;  3CBU A;  5A5K A;  4OFN A;  1GH2 A;  3QAW A;  3QR6 A;  1ON4 A;  3KMO A;  3ERF A;  2DJK A;  3RDW A;  1FO5 A;  1CQH A;  1SK1 A;  3ERG A;  1E2Y A;  1TRW A;  5DAK B;  10GS A;  4HQZ A;  3PH9 A;  8GSS A;  4HOJ A;  1GUM A;  1TK0 B;  1UN2 A;  4MJA A;  3H1N A;  5C04 A;  3DML A;  2HZF A;  1XWA A;  1O7U A;  3UAP A;  3DIE A;  5F06 A;  1AQX A;  1DSB A;  1PKZ A;  3TRP A;  3U6V A;  5CRD A;  1DE2 A;  5ID2 B;  2YN1 A;  2IMF A;  2G0F A;  1T8E B;  5E4W A;  4BWS A;  5DQY A;  14GS A;  1HNB A;  1GNW A;  4JRR A;  4Q5R A;  1GLP A;  4HS1 A;  4KW6 A;  2J23 A;  2L5L A;  3BJ5 A;  5HR2 A;  4K0N A;  3H4K A;  5ECQ B;  1EGR A;  2O87 A;  4Q5N A;  5ECS A;  1TOF A;  1B9X C;  2P5Q A;  4GST A;  1A23 A;  4XRD A;  2OJL A;  4I97 A;  3KJY A;  5FT3 A;  2L59 A;  1EZK A;  3IAS 2;  3WGD A;  4POB A;  2AYT A;  1S3A A;  4IS0 A;  5KN0 A;  2B5Y A;  3J7Y b;  1PKW A;  3DVX A;  1FB6 A;  4EUY A;  1ERT A;  4E8H A;  18GS A;  2I3Y A;  2N5A A;  3FKF A;  3WYW A;  3H8Q A;  2YPM A;  2FD3 A;  2ES7 A;  2LRT A;  5ECM B;  3W8S A;  1ZZY A;  1E6B A;  1TKD B;  4YAP A;  4EE0 A;  4OO5 A;  4F0B A;  4MPF A;  2K6V A;  1TTZ A;  2DLX A;  4L5L A;  2LJK A;  3EC3 A;  3UVH A;  1USB A;  3FW2 A;  3KEB A;  4G10 A;  2NTO A;  2RUF A;  1J0F A;  3IR4 A;  1DBY A;  3ZML A;  3F6D A;  2R37 A;  1M0U A;  4ZBA A;  1G7E A;  1THX A;  1SK0 A;  2YAN A;  3DEX A;  5IO2 A;  5CRH A;  3LXT A;  2L5O A;  2IMD A;  3CSH A;  2PU9 C;  2QSI A;  3RPP A;  4YAV A;  2JZR A;  2PER A;  5HR1 A;  2H1G A;  2DIZ A;  2JZS A;  1QMV A;  3CRT A;  2YJ7 A;  3V1W A;  4V1A g;  3HVX A;  4D73 B;  1NM3 A;  1O8X A;  2PUK C;  2NPB A;  4BWQ A;  2A4V A;  4NV5 A;  2RUE A;  1B48 A;  1R7H A;  2OE0 A;  3KXO A;  1F2E A;  3WGE A;  2GSR A;  3NOF A;  2DBC A;  2OAD A;  4TR3 A;  2JL4 A;  2VL9 A;  3A2V A;  2RM5 A;  5E59 A;  1A8L A;  1UA5 A;  1X5C A;  2CX3 A;  4JZQ A;  3LG6 A;  2OA7 A;  3UJ1 A;  1YEP A;  2HI7 A;  1TW9 A;  4POM A;  1M9A A;  2DJ3 A;  5ECK B;  5KEJ A;  1A2L A;  2H76 A;  4KSM A;  2L4Q A;  1NSW A;  4YQV A;  3W8J A;  4OFM A;  2YV9 A;  4AJ8 A;  1XWK A;  2DJ0 A;  1Z6N A;  2GT5 A;  3F9U A;  5CRG A;  3VI5 A;  1TI3 A;  4NV2 A;  1XW5 A;  1Q4J A;  3ISO A;  3IAM 2;  3EMX A;  3GST A;  5J9B A;  5DBQ A;  3GKX A;  3O76 A;  1KBN A;  2VL3 A;  1EOG A;  5AGY A;  3D22 A;  3A2W A;  2GGT A;  3TKS E;  3ERW A;  1QQ2 A;  2GTU A;  1SL1 B;  4IQ1 A;  1ZL9 A;  3GX8 A;  1XW9 A;  3FR3 A;  3TOT A;  3VWX A;  2DJJ A;  3LSZ A;  1Z5Y E;  4BVY A;  4GSN A;  1U3I A;  3GFK A;  2YWM A;  4DEJ A;  5H5Q A;  2YCD A;  4NAX A;  4MJE A;  2PPT A;  3ZLP A;  2E2G A;  3MAK A;  3FZ9 A;  3UAR A;  5IO0 A;  2V2G A;  3L9V A;  4FO5 A;  1G6Y A;  2I4A A;  3FR9 A;  3M8N A;  2IIY A;  5AIS A;  1F37 A;  1O73 A;  1A0R P;  4IP1 A;  1ILO A;  1EP8 A;  1PA3 A;  1AC1 A;  1U88 A;  2B5E A;  2GQL A;  1ZGN A;  4ID0 A;  4CW9 A;  1V9W A;  4BA7 A;  2FY6 A;  3RHB A;  2DMM A;  2N5B A;  5DAL A;  3HD5 A;  3ZZX A;  3TRQ A;  1H4O A;  1BX9 A;  1X5D A;  5A4W A;  4MF6 A;  1GP1 A;  2VCT A;  2OBK A;  3LEF A;  3FZ4 A;  3PIN A;  2H1B A;  2YWI A;  2E2M A;  4TXO A;  4IEL A;  4XCS A;  3I9V 2;  5EY6 A;  1KEB A;  1K0B A;  4EL1 A;  4K0G A;  2H0H A;  3H93 A;  1Y6E A;  3LFL A;  2GZY A;  1A2J A;  4EC0 A;  3KP9 A;  2YP6 A;  3MSZ A;  4K7N A;  1SJI A;  6GSV A;  2NBS A;  3D4T A;  1MEK A;  3FEU A;  4RI6 A;  4LMW A;  2P0G A;  3C1R A;  1OC9 A;  4DSS A;  5CYY A;  3GH6 A;  1LBK A;  2FWG A;  2PWJ A;  1ZMA A;  4KSO A;  5IMC A;  12GS A;  3P90 A;  4P3Y B;  1PQN A;  5JWR B;  2R4V A;  5EL8 A;  1TU7 A;  3WGX A;  2H0I A;  2VL2 A;  4MA9 A;  4MMM A;  1PRX A;  3BCI A;  4KAE A;  1OC8 A;  4TKY A;  5D9W A;  5ECR B;  2VLV A;  1ST9 A;  4JBB A;  3ZVJ D;  5B8A A;  1YKA A;  4XS1 A;  1M2A A;  4DVC A;  13GS A;  1KTE A;  4K7I A;  3Q18 A;  4WR4 A;  4ILF A;  2X8H A;  5ECI B;  5G31 A;  1J9B A;  4FH8 A;  3IDV A;  4GCI A;  1THO A;  3TJG A;  1AW9 A;  1OC9 B;  3KH9 A;  3F4T A;  1HYU A;  3R2Q A;  3M9J A;  4GQF A;  4MDC A;  5IIZ A;  2HRF A;  3L78 A;  2CA8 A;  1TK5 B;  4WET A;  3UL3 A;  5LNK e;  1XXU A;  4HQS A;  4HI7 A;  5D9X A;  4N0Z A;  2JAC A;  1FB0 A;  2C3T A;  4N10 A;  2FWF A;  1GUK A;  2K18 A;  1SYX A;  2H72 A;  5ECN B;  2R3X A;  3ME8 A;  1K3L A;  2QC7 A;  1FAA A;  4BVX A;  3F8U A;  2KUC A;  4JED A;  2FCH A;  2B7K A;  1K3O A;  3F63 A;  4O5R A;  2VCZ A;  1RQM A;  4JR4 A;  3UBL A;  2ZCT A;  3CMI A;  2AV4 A;  3RPN A;  2X99 A;  5KN2 A;  3VWV A;  2F51 A;  4QL9 A;  4K7O A;  1Z3E A;  2XPD A;  2VLU A;  5JWQ B;  3ZYW A;  3FYG A;  3GN3 A;  5DDL A;  3VLN A;  1PGT A;  3ZIV A;  1GNE A;  4IBP A;  4GQC A;  1F3A A;  4F03 A;  5LCZ A;  1ZYE A;  1TU8 A;  2KOK A;  3GKK A;  4ECC A;  1MD4 A;  4TW5 A;  2A2R A;  2DC5 A;  3ZIJ A;  1XVW A;  2I1U A;  3DYR A;  4ZIL A;  2JSZ A;  4HU9 A;  2YV7 A;  5CO3 A;  3UEM A;  1DE1 A;  3Q6O A;  3HJO A;  2CZ2 A;  1GSD A;  3N5O A;  4RI7 A;  1FVJ A;  1OKT A;  4I8B A;  1Z7R A;  3KCM A;  1URM A;  5CAX A;  5AIV A;  4QL7 A;  2CVB A;  2B7J A;  3KZQ A;  4YQU A;  5JCU A;  4YH2 A;  3JCM L;  4AGS A;  1AQV A;  5J3R A;  2WGR A;  1Z7P A;  2IFQ A;  2XBQ A;  2B1K A;  3DXB A;  3TOU A;  3GX0 A;  2GS3 A;  2GLR A;  3TJK A;  2AJQ B;  4EO3 A;  2WUL A;  5INY A;  2TIR A;  5H5R A;  1N8J A;  2C80 A;  1S3D A;  3D0Z A;  2YNX A;  1VF2 A;  3MDK A;  3QAG A;  2C0G A;  2LUS A;  4LLR A;  1QGV A;  4NHW A;  4XHM A;  4ZL9 A;  1OC3 A;  4AF2 A;  5IMV A;  2MBS A;  1QK8 A;  2VCX A;  4J56 E;  1Q98 A;  2HZE A;  3FR6 A;  3EUR A;  2MZC A;  1FOV A;  5GAN D;  3D6I A;  2LV3 A;  1NW2 A;  3IOS A;  1WWJ A;  1M99 A;  5D93 A;  3TKS C;  1A8Y A;  3IK9 A;  2DSA A;  4FYC A;  3QFA C;  3PR8 A;  3GUR A;  1O8W A;  1VF3 A;  3M9K A;  3LWA A;  3ZMK A;  1GUL A;  1RW1 A;  4E8E A;  2BMX A;  3GL5 A;  4MP4 A;  2AUV A;  1EGO A;  2EIO A;  4MAB A;  3P8W A;  4MZW A;  4LA1 A;  4OCE A;  4ISD A;  2JZT A;  3NZN A;  4HUA A;  3I6A A;  1BED A;  3G7I A;  5ABR A;  2F3M A;  1HD2 A;  2GDR A;  2M72 A;  1J08 A;  2WRT A;  2O8V B;  2C4J A;  4MF5 A;  5IMA A;  4MLY A;  2G2Q A;  3P7X A;  4F2I A;  1PSQ A;  1GSQ A;  3HA9 A;  4NPB A;  4PNG A;  3DGQ A;  3IV4 A;  3SBC A;  4OCF A;  2HXK A;  1ML6 A;  1MD3 A;  3TDG A;  3EE2 A;  3QD9 A;  4WF4 A;  3GV1 A;  5HR0 A;  4MF7 A;  4GF0 A;  2ZUP A;  2VCW A;  4OO4 A;  3US3 A;  3UMA A;  2GVP A;  1AXD A;  3G7Y A;  1UVZ A;  2B1L A;  1K0A A;  1BJX A;  2FGX A;  3GUS A;  4IW9 A;  5F0G A;  5JWO B;  4NMU A;  2WS2 A;  1Z6M A;  2V41 A;  4IGJ A;  3H79 A;  1MDJ A;  2LJA A;  4BL7 A;  1SK2 A;  1YKC A;  3EU3 A;  2B6M A;  4V1A p;  3HKR A;  2MMN A;  4G9H A;  1V58 A;  4ZXG A;  2HT9 A;  4OMV A;  1XW6 A;  4GTU A;  4AJ7 A;  1N2A A;  2H1D A;  3G9B A;  1B4Q A;  2YJH A;  4ACS A;  2CAI A;  4L0U A;  2CQ9 A;  4N0V A;  1T7P B;  1GSE A;  5DCG A;  1NHY A;  1XWB A;  2LKU A;  3CTF A;  5G2Z A;  3D4M A;  1F9M A;  3EMP A;  2XPE A;  4WR5 A;  2OBI A;  2H74 A;  1SJ6 A;  4L5O A;  4G19 A;  4GWR A;  2LST A;  3F3Q A;  3C8E A;  1SYR A;  2GZP A;  4H86 A;  3MNG A;  4TVE A;  3HJM A;  1HQO A;  2C0F A;  4K8M A;  4MZC A;  1EEJ A;  4RQX A;  1WIK A;  4I6X A;  4ZBB A;  9GSS A;  3UVT A;  1W4V A;  3FY7 A;  1WP0 A;  4N30 A;  5DCH A;  2VD0 A;  2R6K A;  2GST A;  4KDU A;  4GRF A;  4NXI A;  2FWE A;  1RK4 A;  2H6X A;  3GL3 A;  3TRX A;  2VCQ A;  1GRX A;  5ECO B;  3APO A;  5G5F A;  4PNF A;  2FHE A;  2I9H A;  4IQA A;  4MJC A;  1XWC A;  5JCG A;  2VAF A;  2H71 A;  4V2M A;  3N9J A;  2LQQ A;  1T4Z A;  5J5N A;  3LQ7 A;  3E9J B;  4HJ2 A;  4MCU A;  1TDI A;  4JE1 A;  4JU5 A;  3Q74 A;  6GST A;  1SL0 B;  19GS A;  1W89 A;  4J57 E;  3WT2 A;  1OE7 A;  4FYU A;  2XHF A;  4BPY A;  4IP6 A;  5IMD A;  2F8A A;  2B5X A;  4ECB A;  3DKS A;  1QXH A;  4POL A;  3KIJ A;  1B9Y C;  2L4C A;  1MDK A;  3ZTL A;  2HYX A;  2LRC A;  2B3S A;  5L71 A;  4KDX A;  1UC7 A;  5COH A;  4MH3 A;  3AY8 A;  2NDO A;  4XTS A;  4EKZ A;  2E0Q A;  3EWL A;  3KTL A;  1F3B A;  4XS4 A;  2F9S A;  4JR6 A;  2I81 A;  2OKA A;  5G30 A; 
#chains in the Genus database with same CATH topology
 1EP7 A;  3QAV A;  2O85 A;  3LJR A;  4DSR A;  4TR1 A;  3ZL5 A;  1V2A A;  2QGV A;  3HHV A;  3CTG A;  6GSW A;  1B8X A;  3GTU A;  3A2X A;  1XZO A;  2RII A;  3EPT A;  1M9B A;  1C72 A;  2CT6 A;  5G5E A;  1ABA A;  4O32 A;  2BTO T;  1YF0 A;  4YQM A;  4O5U A;  4HZ2 A;  4PUR A;  1XCC A;  2P5R A;  5DAL B;  4KH7 A;  4QQ7 A;  1AQW A;  4DSQ A;  3NIV A;  3M0F A;  4Z7X A;  4N11 A;  4NHZ A;  5G1L A;  5IOW A;  5J4U A;  4TXO B;  2L6C A;  2BJX A;  3FHK A;  2JSY A;  3WD6 A;  3HJP A;  4HU7 A;  3L9U A;  4EDZ A;  1U3A A;  3GTU B;  4LL1 B;  5KOX A;  4K2D A;  3S9F A;  4PQH A;  2D2Z A;  4EXJ A;  2C3N A;  3QCP A;  4IHU A;  4NWY A;  1OKD A;  1FG4 A;  1XOA A;  4IN0 A;  3TKQ A;  2MMZ A;  4DSS B;  1Z9H A;  3GH9 A;  3HZ4 A;  3VUR A;  4KUN A;  5D96 A;  4FIW A;  1R26 A;  4WXT A;  3KD0 A;  2CX4 A;  4HZ4 A;  3U5R E;  1XFL A;  1ZYP A;  4G0K A;  1HNC A;  1CQG A;  5CNW A;  5D9T A;  2CVD A;  5IMF A;  2CV4 A;  4KX4 A;  2O89 A;  3C71 A;  3ED3 A;  1K0C A;  2QA1 A;  4MJB A;  4MZB A;  2N5F A;  5F8B A;  5B6M A;  3L0H A;  1B4P A;  3VWW A;  1K0D A;  1V40 A;  5ECL B;  1DUG A;  4LL4 B;  1EWX A;  3PGT A;  2TRC P;  2REM A;  4Z2R A;  5D8I A;  2PGT A;  3TCO A;  1SD9 A;  1SEN A;  1G6W A;  3J7Y k;  3GKN A;  3HVS A;  1ZCP A;  3O3T A;  1GWC A;  3C7M A;  2PVQ A;  5B8B A;  3EVI A;  4MK3 A;  4TRX A;  1M2B A;  1GSY A;  5IPH A;  3CXG A;  4KA0 A;  3MYD A;  1YY7 A;  1SU9 A;  3RHC A;  2VD1 A;  5ELG A;  1BYE A;  1K0M A;  1MDI A;  2CZ3 A;  2DKI A;  2VLT A;  1X9W B;  5KN1 A;  4F0C A;  2HLS A;  3BD2 A;  2LTK A;  3VFI A;  3A3T A;  4ZL7 A;  1WPI A;  6GSY A;  5CP1 A;  1TK8 B;  5ECH B;  6GSU A;  2HRN A;  4EF0 A;  1JLV A;  5IM9 A;  3IXR A;  5F07 A;  2UZ8 A;  4I5Q A;  2H01 A;  4F82 A;  3QOU A;  5IPG A;  4BVX B;  1KNG A;  3VI7 A;  4F9Z A;  4PUF C;  2V1M A;  2JAD A;  1GL8 A;  3C1S A;  2M46 A;  3TKR A;  2X8C A;  3ME7 A;  2IN3 A;  1XWG A;  4XRA A;  1FW1 A;  3GNJ A;  2H1A A;  5HR3 A;  1EV4 A;  4V2N A;  2FLS A;  1BG5 A;  5ID2 A;  1R5A A;  3IC4 A;  2HNL A;  2EC4 A;  1SKR B;  3HCZ A;  2WFC A;  2MMO A;  2P31 A;  3ZFL A;  1SL2 B;  2EIR A;  3TJB A;  1GSU A;  3K8N A;  3QDN A;  2QKE A;  4ZBD A;  1GSS A;  2K9F A;  1T1V A;  1GTA A;  4RUV A;  3RAZ A;  4K1F A;  4ZB8 A;  1PMT A;  4ZIJ A;  2X64 A;  2FUG 2;  2VM1 A;  5JCW A;  1X9M B;  4KCE A;  1EOH A;  4MPG A;  1GLQ A;  1S3C A;  2NVL A;  3CSJ A;  1JZW A;  1SD8 A;  1YQ1 A;  1OVN A;  3HVN A;  2H19 A;  5HFK A;  1V57 A;  1F6M C;  3FZA A;  5D73 A;  2Z9S A;  2ON7 A;  4HDE A;  4KND A;  2H70 A;  2V6K A;  2IFQ B;  3UIW A;  4TXV A;  1EV9 A;  4KGI A;  3F0I A;  3TKP A;  4J2F A;  4WBJ A;  2IMK A;  2CAQ A;  3E0U A;  3CQF A;  1K3Y A;  1TRV A;  3DWV A;  2VM2 A;  5G1K A;  3D21 A;  3IBH A;  1R5P A;  3L9S A;  2HZE B;  3LOR A;  4EVM A;  3BBY A;  2PVO C;  1IYH A;  4BIK A;  5IOX A;  3QPM A;  2O7K A;  1YJ6 A;  1JHB A;  1XIY A;  3QMX A;  5DVB A;  2WCI A;  1SJZ A;  1TJD A;  1G7O A;  3UBK A;  1TI1 A;  2GSS A;  4ULX A;  2VCV A;  2C0E A;  1AIU A;  1EEM A;  1X0R A;  1O6J A;  2DKH A;  1M7T A;  4D73 A;  2LS5 A;  1O81 A;  3LGC A;  1X9S B;  11GS A;  2FNO A;  1GUH A;  2FWH A;  2HSY A;  4X0X A;  3IHQ A;  2DJ2 A;  2WB9 A;  2KLX A;  2M80 A;  2J9H A;  2VUP A;  4X1U A;  1PX6 A;  2KP2 A;  4O7H A;  4ZL8 A;  1K0N A;  1GSF A;  1PFO A;  1U87 A;  3GIX A;  3I43 A;  4EDY A;  4V2L A;  1VGL A;  3E3E A;  4Q5Q A;  4GSS A;  1O85 A;  1FHE A;  2E7P A;  2VOC A;  3LXZ A;  5IMZ A;  6GSS A;  1YDK A;  1HNA A;  3D5J A;  5CRW A;  2DIY A;  4PTS A;  4XIH A;  4AJ6 A;  2MYG A;  2C0D A;  1JFU A;  1WE0 A;  3MWH A;  1QUW A;  2VL2 C;  3DD3 A;  3KP8 A;  1WOU A;  2OE3 A;  4KCA A;  3APQ A;  2WDU A;  5GZZ B;  2GZZ A;  2C8U A;  3HVV A;  4BL7 B;  3KH7 A;  1ERV A;  2A4H A;  1JZD A;  4MH2 A;  1PD2 1;  2WZ9 A;  3EIN A;  2XBI A;  5ENU A;  5A4V A;  3TGZ A;  3VWU A;  3F3R A;  4OWY A;  3KMN A;  2H6Y A;  1PL2 A;  1A0F A;  1S3R A;  3P2A A;  3QFB C;  1FVK A;  4HEA 2;  4I2T A;  4ZB6 A;  4WEY A;  3GA4 A;  4XS6 A;  2PMT A;  3A5W A;  4ML6 A;  3ZRD A;  1MTC A;  4IJI A;  2FA8 A;  2VO4 A;  2LQO A;  2V32 A;  2IMI A;  1OE8 A;  4K9Z A;  3KTB A;  4WBR D;  2R5G A;  3LYP A;  1I9D A;  1PL1 A;  4TR4 A;  3HYP A;  1JZO A;  3TKS A;  1M2D A;  4G2E A;  3I69 A;  3FRC A;  4O92 A;  5KN3 A;  4CY8 A;  1WRY A;  4CDO A;  1YF1 A;  4Q5F A;  2YWO A;  4LMV A;  4KB3 A;  2KHP A;  3KGK A;  1ZOF A;  2A2S A;  1XVQ A;  3GHA A;  4FYB A;  4A5P A;  1T4Y A;  2DML A;  4GXZ A;  5LD0 A;  1VRS D;  2OAC A;  2TRX A;  3ZRE A;  3KM6 A;  1H75 A;  2HSH A;  5DJL A;  3C73 A;  3O6T A;  4EIP A;  5HFG A;  5GAP D;  3HDC A;  2ALB A;  1LJR A;  3IHG A;  5DQS A;  3G7J A;  5GST A;  3IA1 A;  1GTI A;  5IQY A;  2KP1 A;  1TRU A;  4IKH A;  2YZU A;  2WJU A;  2V6O A;  3GMF A;  5FWG A;  2X49 A;  2RM6 A;  3LYK A;  1TP9 A;  4PQI A;  3L4N A;  2CVK A;  4TN8 A;  4ECI A;  2L6D A;  6GSX A;  3TB2 A;  3APS A;  4TR0 A;  2ZNM A;  3ZFB A;  2H0G A;  1PX7 A;  2LRN A;  4CHS A;  1XPV A;  3BOA A;  4YKF A;  3ZIT A;  3VPT A;  5HQP A;  2AHE A;  4IJ3 A;  2PN8 A;  4ECJ A;  1JLW A;  1XBS A;  4XS4 B;  2H8L A;  1YEX A;  1K0O A;  2HFD A;  1ERW A;  2GSQ A;  2PBJ A;  3Q19 A;  4TR1 B;  4WKW A;  5J9C A;  5AN1 A;  1G0T A;  4ML1 A;  1BAY A;  1OAZ A;  2XC2 A;  1VF4 A;  1U6T A;  1IYI A;  1ZYQ B;  1T3B A;  3F6F A;  1WJK A;  3WT1 A;  4PXO A;  1OYJ A;  2ON5 A;  2LEG A;  5EPF A;  4I2U A;  2C3Q A;  16GS A;  2LNS A;  2FA4 A;  2MMA A;  2YZH A;  2GQK A;  3IK7 A;  1GTB A;  2OE1 A;  4POK A;  2H30 A;  5ECP B;  2R2J A;  2IME A;  1WMJ A;  2IWT A;  5B6N A;  2H73 A;  1I5G A;  1R4W A;  2GQM A;  2AB6 A;  1TXX A;  1A2M A;  2X8G A;  1NHO A;  1YZX A;  3F4R A;  3UOM A;  1SKW B;  2K8V A;  5CRE A;  1ACV A;  2L57 A;  5AIX A;  4KDY A;  5EVO A;  2IJY A;  4IVF A;  2LNT A;  2YOI A;  1Y25 A;  3TJF A;  3CSI A;  3GRX A;  1TRS A;  1T00 A;  4KE3 A;  1ERU A;  5HFI A;  4FQU A;  20GS A;  7GSS A;  1VF1 A;  4OFT A;  1V98 A;  1XOB A;  4EIQ A;  2IL3 A;  1X5E A;  1LU4 A;  2H6Z A;  2VIM A;  3IE3 A;  2F8F A;  4K6X A;  2JU5 A;  4GLT A;  3IRA A;  2LJR A;  3IC8 A;  3TUE A;  3VPQ A;  3CYN A;  4CY6 A;  3HZ8 A;  2HE3 A;  3FZ5 A;  3TJJ A;  4TOP A;  3DRN A;  3GKM A;  1GTU A;  4L8E A;  3GSS A;  2MBT A;  1AAZ A;  5ELA A;  4RQR A;  4K5S A;  2AAW A;  1QFN A;  5J41 A;  1BQ7 A;  3M3M A;  3CRU A;  2RLI A;  4OD7 A;  5D9V A;  3M1G A;  5B7C A;  3EYT A;  3RBT A;  3IPZ A;  2H75 A;  3OR5 A;  4PGT A;  3EU4 A;  4PQ1 A;  4PUA A;  1SKS B;  4PX1 A;  2DJ1 A;  3W6G A;  3SWL A;  5A4U A;  17GS A;  2EIQ A;  2K8S A;  5DAK A;  3HY2 A;  2H66 A;  4WF5 A;  5GSS A;  1AUC A;  3GYK A;  4L0W A;  1PN9 A;  2C1Y A;  5F05 A;  2YWN A;  4X4J A;  5C00 A;  3ZVJ A;  3HXS A;  4HJM A;  5FHI A;  4X43 A;  22GS A;  2IPA A;  4ZB9 A;  5DJM A;  5H5S A;  1A24 A;  2GT6 A;  3FK8 A;  4G0L A;  3BCK A;  3DVW A;  1JZR A;  3F4S A;  3VK9 A;  3CBU A;  1PN0 A;  5A5K A;  4OFN A;  1GH2 A;  3QAW A;  3QR6 A;  1ON4 A;  3KMO A;  3ERF A;  2DJK A;  3RDW A;  1FO5 A;  1CQH A;  1SK1 A;  3ERG A;  1E2Y A;  1TRW A;  5DAK B;  2HRK A;  10GS A;  4HQZ A;  3PH9 A;  8GSS A;  4HOJ A;  1GUM A;  5BMU A;  1TK0 B;  1UN2 A;  4MJA A;  3H1N A;  5C04 A;  3DML A;  2HZF A;  1XWA A;  1O7U A;  2A2P A;  3UAP A;  3DIE A;  5F06 A;  1AQX A;  1DSB A;  1PKZ A;  3TRP A;  3U6V A;  5CRD A;  1DE2 A;  5ID2 B;  2YN1 A;  2IMF A;  2G0F A;  2R0G A;  1T8E B;  5E4W A;  4BWS A;  5DQY A;  14GS A;  1HNB A;  1GNW A;  4JRR A;  4Q5R A;  1GLP A;  4HS1 A;  4KW6 A;  2J23 A;  2L5L A;  3BJ5 A;  5HR2 A;  4K0N A;  3H4K A;  5ECQ B;  1EGR A;  2O87 A;  4Q5N A;  5ECS A;  1TOF A;  1B9X C;  2P5Q A;  4GST A;  1A23 A;  3R3E A;  4XRD A;  2OJL A;  4I97 A;  3KJY A;  5FT3 A;  2L59 A;  1EZK A;  3IAS 2;  3WGD A;  4POB A;  2AYT A;  1S3A A;  4IS0 A;  5KN0 A;  2B5Y A;  3J7Y b;  1PKW A;  3DVX A;  1FB6 A;  4EUY A;  1ERT A;  4E8H A;  18GS A;  2I3Y A;  2N5A A;  3FKF A;  3WYW A;  3H8Q A;  2YPM A;  2FD3 A;  2ES7 A;  2LRT A;  5ECM B;  3W8S A;  1ZZY A;  5KOW A;  1E6B A;  1TKD B;  4YAP A;  4EE0 A;  4OO5 A;  4F0B A;  4MPF A;  2K6V A;  1TTZ A;  2DLX A;  4L5L A;  1M3I A;  2LJK A;  3EC3 A;  3UVH A;  1USB A;  3FW2 A;  3KEB A;  4G10 A;  2NTO A;  2RUF A;  1J0F A;  3IR4 A;  1DBY A;  3ZML A;  3F6D A;  2R37 A;  1M0U A;  4ZBA A;  1G7E A;  1THX A;  1SK0 A;  2YAN A;  3DEX A;  5IO2 A;  5CRH A;  3LXT A;  2L5O A;  2IMD A;  3CSH A;  2PU9 C;  2QSI A;  3RPP A;  4YAV A;  2JZR A;  2PER A;  5HR1 A;  2H1G A;  2DIZ A;  2JZS A;  1QMV A;  3CRT A;  2YJ7 A;  3V1W A;  4V1A g;  3HVX A;  4D73 B;  1NM3 A;  1O8X A;  2PUK C;  2NPB A;  4BWQ A;  2A4V A;  4NV5 A;  2RUE A;  1B48 A;  1R7H A;  2OE0 A;  3KXO A;  1F2E A;  3WGE A;  2GSR A;  3NOF A;  2DBC A;  2OAD A;  4TR3 A;  2JL4 A;  2VL9 A;  3A2V A;  2RM5 A;  5E59 A;  1A8L A;  1UA5 A;  1X5C A;  3MIX A;  2CX3 A;  4JZQ A;  3LG6 A;  2R0C A;  2OA7 A;  3UJ1 A;  1YEP A;  2HI7 A;  1TW9 A;  4POM A;  1M9A A;  2DJ3 A;  5ECK B;  5KEJ A;  1A2L A;  2H76 A;  4KSM A;  2L4Q A;  1NSW A;  4YQV A;  3W8J A;  4OFM A;  2YV9 A;  4AJ8 A;  1XWK A;  2DJ0 A;  1Z6N A;  2GT5 A;  3F9U A;  5CRG A;  3VI5 A;  1TI3 A;  1XG8 A;  4NV2 A;  1XW5 A;  1Q4J A;  3ISO A;  3IAM 2;  3EMX A;  3GST A;  5J9B A;  5DBQ A;  3GKX A;  3O76 A;  1KBN A;  2VL3 A;  1EOG A;  5AGY A;  3D22 A;  3A2W A;  2GGT A;  3TKS E;  3ERW A;  1QQ2 A;  2GTU A;  1SL1 B;  4IQ1 A;  1ZL9 A;  3GX8 A;  1XW9 A;  3FR3 A;  3TOT A;  3VWX A;  2DJJ A;  3LSZ A;  1Z5Y E;  4BVY A;  4GSN A;  1U3I A;  3GFK A;  2YWM A;  4DEJ A;  5H5Q A;  2YCD A;  4NAX A;  4MJE A;  2PPT A;  4Z2U A;  3ZLP A;  2E2G A;  4HSC X;  3MAK A;  3FZ9 A;  3UAR A;  5IO0 A;  2V2G A;  3L9V A;  4FO5 A;  1G6Y A;  2I4A A;  3FR9 A;  3M8N A;  2IIY A;  5AIS A;  1F37 A;  1O73 A;  1A0R P;  4IP1 A;  1ILO A;  1EP8 A;  1PA3 A;  1AC1 A;  1U88 A;  2B5E A;  2GQL A;  1ZGN A;  4ID0 A;  4CW9 A;  1V9W A;  4BA7 A;  2FY6 A;  3RHB A;  2DMM A;  2N5B A;  5DAL A;  3HD5 A;  3ZZX A;  3TRQ A;  1H4O A;  1BX9 A;  1X5D A;  5A4W A;  4MF6 A;  1GP1 A;  2VCT A;  2OBK A;  3LEF A;  3FZ4 A;  3PIN A;  2H1B A;  2YWI A;  2E2M A;  4TXO A;  4IEL A;  4XCS A;  3I9V 2;  5EY6 A;  1KEB A;  1K0B A;  4EL1 A;  4K0G A;  2H0H A;  3H93 A;  1Y6E A;  3LFL A;  2GZY A;  1A2J A;  4EC0 A;  3KP9 A;  2YP6 A;  3MSZ A;  4K7N A;  1SJI A;  6GSV A;  4K2X A;  2NBS A;  3D4T A;  1MEK A;  3FEU A;  4RI6 A;  4LMW A;  2P0G A;  3C1R A;  1OC9 A;  4DSS A;  5CYY A;  3GH6 A;  1LBK A;  2FWG A;  2PWJ A;  1ZMA A;  4KSO A;  5IMC A;  12GS A;  3P90 A;  4P3Y B;  1PQN A;  5JWR B;  2R4V A;  5EL8 A;  1TU7 A;  3WGX A;  2H0I A;  2VL2 A;  4MA9 A;  4MMM A;  1PRX A;  3BCI A;  4KAE A;  1OC8 A;  4TKY A;  5D9W A;  5ECR B;  2VLV A;  1ST9 A;  4JBB A;  3ZVJ D;  5B8A A;  4K5R A;  1YKA A;  4XS1 A;  1M2A A;  4DVC A;  13GS A;  1KTE A;  4K7I A;  3Q18 A;  4WR4 A;  4ILF A;  2X8H A;  5ECI B;  5G31 A;  1J9B A;  4FH8 A;  3IDV A;  4GCI A;  1THO A;  3TJG A;  1AW9 A;  1OC9 B;  3KH9 A;  3F4T A;  1HYU A;  3R2Q A;  3M9J A;  4GQF A;  1M3J A;  4MDC A;  5IIZ A;  2HRF A;  4O5Q A;  3L78 A;  2CA8 A;  1TK5 B;  4WET A;  3UL3 A;  5LNK e;  1XXU A;  4HQS A;  4HI7 A;  5D9X A;  4N0Z A;  2JAC A;  1FB0 A;  2C3T A;  4N10 A;  2FWF A;  4Z2T A;  1GUK A;  2K18 A;  1SYX A;  2H72 A;  1FOH A;  5ECN B;  3LW9 A;  2R3X A;  3ME8 A;  1K3L A;  2QC7 A;  1FAA A;  4BVX A;  3F8U A;  2KUC A;  4JED A;  2FCH A;  2B7K A;  1K3O A;  3F63 A;  4O5R A;  2VCZ A;  1RQM A;  4JR4 A;  3UBL A;  2ZCT A;  3CMI A;  2AV4 A;  3RPN A;  2X99 A;  5KN2 A;  3VWV A;  2F51 A;  4QL9 A;  4K7O A;  1Z3E A;  2XPD A;  2VLU A;  5JWQ B;  3ZYW A;  3FYG A;  3GN3 A;  5DDL A;  3VLN A;  1PGT A;  3ZIV A;  1GNE A;  4IBP A;  4GQC A;  1F3A A;  2QA2 A;  4F03 A;  5LCZ A;  1ZYE A;  1TU8 A;  2KOK A;  3GKK A;  4ECC A;  1MD4 A;  4TW5 A;  2A2R A;  2DC5 A;  3ZIJ A;  1XVW A;  2I1U A;  4YKG A;  3DYR A;  4ZIL A;  2JSZ A;  4HU9 A;  2YV7 A;  5CO3 A;  3UEM A;  1DE1 A;  3Q6O A;  3HJO A;  2CZ2 A;  1GSD A;  3N5O A;  4RI7 A;  1FVJ A;  1OKT A;  4I8B A;  1Z7R A;  3KCM A;  1URM A;  5CAX A;  2R0P A;  5AIV A;  4QL7 A;  2CVB A;  2B7J A;  3KZQ A;  4YQU A;  5JCU A;  4YH2 A;  3JCM L;  4AGS A;  1AQV A;  5J3R A;  2WGR A;  1Z7P A;  2IFQ A;  2XBQ A;  2B1K A;  3DXB A;  3TOU A;  3GX0 A;  2GS3 A;  2GLR A;  3TJK A;  2AJQ B;  4EO3 A;  2WUL A;  5INY A;  2TIR A;  5H5R A;  1N8J A;  2C80 A;  1S3D A;  3D0Z A;  5BRT A;  2YNX A;  1VF2 A;  3MDK A;  3QAG A;  2C0G A;  2LUS A;  4LLR A;  1QGV A;  4NHW A;  4XHM A;  4ZL9 A;  1OC3 A;  4AF2 A;  5IMV A;  2MBS A;  1QK8 A;  2VCX A;  4J56 E;  1Q98 A;  2HZE A;  4ICY A;  3FR6 A;  3EUR A;  2MZC A;  1FOV A;  5GAN D;  3D6I A;  2LV3 A;  1NW2 A;  3IOS A;  1WWJ A;  1M99 A;  5D93 A;  3TKS C;  1A8Y A;  3IK9 A;  2DSA A;  4FYC A;  3QFA C;  3PR8 A;  3GUR A;  1O8W A;  1VF3 A;  3M9K A;  3LWA A;  3ZMK A;  1GUL A;  1RW1 A;  4E8E A;  2BMX A;  4MNN A;  3GL5 A;  4MP4 A;  2AUV A;  1EGO A;  2EIO A;  4MAB A;  3P8W A;  4MZW A;  4LA1 A;  4OCE A;  4ISD A;  2JZT A;  3NZN A;  4HUA A;  3I6A A;  1BED A;  3G7I A;  5ABR A;  2F3M A;  1HD2 A;  2GDR A;  2M72 A;  1J08 A;  2WRT A;  2O8V B;  2C4J A;  4MF5 A;  5IMA A;  4MLY A;  2G2Q A;  3P7X A;  4F2I A;  1PSQ A;  1GSQ A;  4G0I A;  3HA9 A;  4NPB A;  4PNG A;  3DGQ A;  3IV4 A;  3SBC A;  4OCF A;  2HXK A;  1ML6 A;  1MD3 A;  3TDG A;  3EE2 A;  3QD9 A;  4WF4 A;  3GV1 A;  5HR0 A;  4MF7 A;  4GF0 A;  2ZUP A;  2VCW A;  4OO4 A;  3US3 A;  3UMA A;  2GVP A;  1AXD A;  3G7Y A;  1UVZ A;  2B1L A;  1K0A A;  1BJX A;  2FGX A;  3GUS A;  4IW9 A;  5F0G A;  5JWO B;  4NMU A;  2WS2 A;  1Z6M A;  2V41 A;  4IGJ A;  3H79 A;  1MDJ A;  2LJA A;  4BL7 A;  4KF9 A;  1SK2 A;  1YKC A;  3EU3 A;  2B6M A;  4V1A p;  3HKR A;  2MMN A;  4G9H A;  1V58 A;  4ZXG A;  2HT9 A;  4OMV A;  1XW6 A;  4GTU A;  4AJ7 A;  1N2A A;  2H1D A;  3G9B A;  1B4Q A;  2YJH A;  4ACS A;  2CAI A;  4L0U A;  2CQ9 A;  4N0V A;  1T7P B;  4USS A;  1GSE A;  5DCG A;  1NHY A;  3PPU A;  1XWB A;  2LKU A;  3CTF A;  5G2Z A;  3D4M A;  1F9M A;  3EMP A;  3A5I A;  2XPE A;  4WR5 A;  2OBI A;  2HRA A;  2H74 A;  1SJ6 A;  4L5O A;  4G19 A;  4GWR A;  2LST A;  3F3Q A;  3C8E A;  1SYR A;  2GZP A;  4H86 A;  2HSM A;  3MNG A;  4TVE A;  3HJM A;  1HQO A;  2C0F A;  4K8M A;  4MZC A;  1EEJ A;  4RQX A;  1WIK A;  4I6X A;  4ZBB A;  9GSS A;  3UVT A;  1W4V A;  3FY7 A;  1WP0 A;  4N30 A;  5DCH A;  2VD0 A;  2R6K A;  2GST A;  4KDU A;  4GRF A;  4NXI A;  2FWE A;  1RK4 A;  2H6X A;  3GL3 A;  3TRX A;  3FMW A;  2VCQ A;  1GRX A;  5ECO B;  1ZYN A;  3APO A;  5G5F A;  4PNF A;  2FHE A;  2I9H A;  4IQA A;  4MJC A;  2X4A A;  1XWC A;  5JCG A;  2VAF A;  2H71 A;  4V2M A;  3N9J A;  2LQQ A;  1T4Z A;  5J5N A;  3LQ7 A;  3E9J B;  4HJ2 A;  4MCU A;  1TDI A;  4JE1 A;  4JU5 A;  3Q74 A;  6GST A;  1SL0 B;  19GS A;  1W89 A;  4J57 E;  3WT2 A;  1OE7 A;  4FYU A;  2XHF A;  4BPY A;  4IP6 A;  5IMD A;  2F8A A;  2B5X A;  4ECB A;  3DKS A;  1QXH A;  4POL A;  3KIJ A;  1B9Y C;  2L4C A;  1MDK A;  3ZTL A;  2HYX A;  2LRC A;  2B3S A;  5L71 A;  4KDX A;  1UC7 A;  5COH A;  4BVY B;  4MH3 A;  3AY8 A;  2NDO A;  4XTS A;  4EKZ A;  2E0Q A;  3EWL A;  3KTL A;  1F3B A;  4XS4 A;  2F9S A;  4JR6 A;  2I81 A;  2OKA A;  5G30 A; 
#chains in the Genus database with same CATH homology
 1EP7 A;  3QAV A;  2O85 A;  3LJR A;  4DSR A;  4TR1 A;  3ZL5 A;  1V2A A;  2QGV A;  3HHV A;  3CTG A;  6GSW A;  1B8X A;  3GTU A;  3A2X A;  1XZO A;  2RII A;  3EPT A;  1M9B A;  1C72 A;  2CT6 A;  5G5E A;  1ABA A;  4O32 A;  2BTO T;  1YF0 A;  4YQM A;  4O5U A;  4HZ2 A;  4PUR A;  1XCC A;  2P5R A;  5DAL B;  4KH7 A;  4QQ7 A;  1AQW A;  4DSQ A;  3NIV A;  3M0F A;  4Z7X A;  4N11 A;  4NHZ A;  5G1L A;  5IOW A;  5J4U A;  4TXO B;  2L6C A;  2BJX A;  3FHK A;  2JSY A;  3WD6 A;  3HJP A;  4HU7 A;  3L9U A;  4EDZ A;  1U3A A;  3GTU B;  4LL1 B;  5KOX A;  4K2D A;  3S9F A;  4PQH A;  2D2Z A;  4EXJ A;  2C3N A;  3QCP A;  4IHU A;  4NWY A;  1OKD A;  1FG4 A;  1XOA A;  4IN0 A;  3TKQ A;  2MMZ A;  4DSS B;  1Z9H A;  3GH9 A;  3HZ4 A;  3VUR A;  4KUN A;  5D96 A;  4FIW A;  1R26 A;  4WXT A;  3KD0 A;  2CX4 A;  4HZ4 A;  3U5R E;  1XFL A;  1ZYP A;  4G0K A;  1HNC A;  1CQG A;  5CNW A;  5D9T A;  2CVD A;  5IMF A;  2CV4 A;  4KX4 A;  2O89 A;  3C71 A;  3ED3 A;  1K0C A;  2QA1 A;  4MJB A;  4MZB A;  2N5F A;  5F8B A;  5B6M A;  3L0H A;  1B4P A;  3VWW A;  1K0D A;  1V40 A;  5ECL B;  1DUG A;  4LL4 B;  1EWX A;  3PGT A;  2TRC P;  2REM A;  4Z2R A;  5D8I A;  2PGT A;  3TCO A;  1SD9 A;  1SEN A;  1G6W A;  3J7Y k;  3GKN A;  3HVS A;  1ZCP A;  3O3T A;  1GWC A;  3C7M A;  2PVQ A;  5B8B A;  3EVI A;  4MK3 A;  4TRX A;  1M2B A;  1GSY A;  5IPH A;  3CXG A;  4KA0 A;  3MYD A;  1YY7 A;  1SU9 A;  3RHC A;  2VD1 A;  5ELG A;  1BYE A;  1K0M A;  1MDI A;  2CZ3 A;  2DKI A;  2VLT A;  1X9W B;  5KN1 A;  4F0C A;  2HLS A;  3BD2 A;  2LTK A;  3VFI A;  3A3T A;  4ZL7 A;  1WPI A;  6GSY A;  5CP1 A;  1TK8 B;  5ECH B;  6GSU A;  2HRN A;  4EF0 A;  1JLV A;  5IM9 A;  3IXR A;  5F07 A;  2UZ8 A;  4I5Q A;  2H01 A;  4F82 A;  3QOU A;  5IPG A;  4BVX B;  1KNG A;  3VI7 A;  4F9Z A;  4PUF C;  2V1M A;  2JAD A;  1GL8 A;  3C1S A;  2M46 A;  3TKR A;  2X8C A;  3ME7 A;  2IN3 A;  1XWG A;  4XRA A;  1FW1 A;  3GNJ A;  2H1A A;  5HR3 A;  1EV4 A;  4V2N A;  2FLS A;  1BG5 A;  5ID2 A;  1R5A A;  3IC4 A;  2HNL A;  2EC4 A;  1SKR B;  3HCZ A;  2WFC A;  2MMO A;  2P31 A;  3ZFL A;  1SL2 B;  2EIR A;  3TJB A;  1GSU A;  3K8N A;  3QDN A;  2QKE A;  4ZBD A;  1GSS A;  2K9F A;  1T1V A;  1GTA A;  4RUV A;  3RAZ A;  4K1F A;  4ZB8 A;  1PMT A;  4ZIJ A;  2X64 A;  2FUG 2;  2VM1 A;  5JCW A;  1X9M B;  4KCE A;  1EOH A;  4MPG A;  1GLQ A;  1S3C A;  2NVL A;  3CSJ A;  1JZW A;  1SD8 A;  1YQ1 A;  1OVN A;  2H19 A;  5HFK A;  1V57 A;  1F6M C;  3FZA A;  5D73 A;  2Z9S A;  2ON7 A;  4HDE A;  4KND A;  2H70 A;  2V6K A;  2IFQ B;  3UIW A;  4TXV A;  1EV9 A;  4KGI A;  3F0I A;  3TKP A;  4J2F A;  4WBJ A;  2IMK A;  2CAQ A;  3E0U A;  1K3Y A;  1TRV A;  3DWV A;  2VM2 A;  5G1K A;  3D21 A;  3IBH A;  1R5P A;  3L9S A;  2HZE B;  3LOR A;  4EVM A;  3BBY A;  2PVO C;  1IYH A;  5IOX A;  3QPM A;  2O7K A;  1YJ6 A;  1JHB A;  1XIY A;  3QMX A;  5DVB A;  2WCI A;  1SJZ A;  1TJD A;  1G7O A;  3UBK A;  1TI1 A;  2GSS A;  4ULX A;  2VCV A;  2C0E A;  1AIU A;  1EEM A;  1X0R A;  1O6J A;  2DKH A;  1M7T A;  4D73 A;  2LS5 A;  1O81 A;  3LGC A;  1X9S B;  11GS A;  2FNO A;  1GUH A;  2FWH A;  2HSY A;  4X0X A;  3IHQ A;  2DJ2 A;  2WB9 A;  2KLX A;  2M80 A;  2J9H A;  2VUP A;  4X1U A;  1PX6 A;  2KP2 A;  4O7H A;  4ZL8 A;  1K0N A;  1GSF A;  1U87 A;  3GIX A;  3I43 A;  4EDY A;  4V2L A;  1VGL A;  3E3E A;  4Q5Q A;  4GSS A;  1O85 A;  1FHE A;  2E7P A;  2VOC A;  3LXZ A;  5IMZ A;  6GSS A;  1YDK A;  1HNA A;  3D5J A;  5CRW A;  2DIY A;  4PTS A;  4XIH A;  4AJ6 A;  2MYG A;  2C0D A;  1JFU A;  1WE0 A;  3MWH A;  1QUW A;  2VL2 C;  3DD3 A;  3KP8 A;  1WOU A;  2OE3 A;  4KCA A;  3APQ A;  2WDU A;  5GZZ B;  2GZZ A;  2C8U A;  3HVV A;  4BL7 B;  3KH7 A;  1ERV A;  2A4H A;  1JZD A;  4MH2 A;  1PD2 1;  2WZ9 A;  3EIN A;  2XBI A;  5ENU A;  5A4V A;  3TGZ A;  3VWU A;  3F3R A;  4OWY A;  3KMN A;  2H6Y A;  1PL2 A;  1A0F A;  3P2A A;  3QFB C;  4HEA 2;  1FVK A;  4I2T A;  4ZB6 A;  4WEY A;  3GA4 A;  4XS6 A;  2PMT A;  3A5W A;  4ML6 A;  3ZRD A;  1MTC A;  4IJI A;  2FA8 A;  2VO4 A;  2LQO A;  2V32 A;  2IMI A;  1OE8 A;  4K9Z A;  3KTB A;  4WBR D;  2R5G A;  3LYP A;  1I9D A;  1PL1 A;  4TR4 A;  3HYP A;  1JZO A;  3TKS A;  1M2D A;  4G2E A;  3I69 A;  3FRC A;  4O92 A;  5KN3 A;  4CY8 A;  1WRY A;  4CDO A;  1YF1 A;  4Q5F A;  2YWO A;  4LMV A;  4KB3 A;  2KHP A;  3KGK A;  1ZOF A;  2A2S A;  1XVQ A;  3GHA A;  4FYB A;  4A5P A;  1T4Y A;  2DML A;  4GXZ A;  5LD0 A;  1VRS D;  2OAC A;  2TRX A;  3ZRE A;  3KM6 A;  1H75 A;  2HSH A;  5DJL A;  3C73 A;  3O6T A;  4EIP A;  5HFG A;  5GAP D;  3HDC A;  2ALB A;  1LJR A;  3IHG A;  5DQS A;  3G7J A;  5GST A;  3IA1 A;  1GTI A;  5IQY A;  2KP1 A;  1TRU A;  4IKH A;  2YZU A;  2WJU A;  2V6O A;  3GMF A;  5FWG A;  2X49 A;  2RM6 A;  3LYK A;  1TP9 A;  4PQI A;  3L4N A;  2CVK A;  4TN8 A;  4ECI A;  2L6D A;  6GSX A;  3TB2 A;  3APS A;  4TR0 A;  2ZNM A;  3ZFB A;  2H0G A;  1PX7 A;  2LRN A;  4CHS A;  1XPV A;  3BOA A;  4YKF A;  3ZIT A;  3VPT A;  5HQP A;  2AHE A;  4IJ3 A;  2PN8 A;  4ECJ A;  1JLW A;  1XBS A;  4XS4 B;  2H8L A;  1YEX A;  1K0O A;  2HFD A;  1ERW A;  2GSQ A;  2PBJ A;  3Q19 A;  4TR1 B;  4WKW A;  5J9C A;  5AN1 A;  1G0T A;  4ML1 A;  1BAY A;  1OAZ A;  2XC2 A;  1VF4 A;  1U6T A;  1IYI A;  1ZYQ B;  1T3B A;  3F6F A;  1WJK A;  3WT1 A;  4PXO A;  1OYJ A;  2ON5 A;  2LEG A;  5EPF A;  4I2U A;  2C3Q A;  16GS A;  2LNS A;  2FA4 A;  2MMA A;  2YZH A;  2GQK A;  3IK7 A;  1GTB A;  2OE1 A;  4POK A;  2H30 A;  5ECP B;  2R2J A;  2IME A;  1WMJ A;  2IWT A;  5B6N A;  2H73 A;  1I5G A;  1R4W A;  2GQM A;  2AB6 A;  1TXX A;  1A2M A;  2X8G A;  1NHO A;  1YZX A;  3F4R A;  3UOM A;  1SKW B;  2K8V A;  5CRE A;  1ACV A;  2L57 A;  5AIX A;  4KDY A;  5EVO A;  2IJY A;  4IVF A;  2LNT A;  2YOI A;  1Y25 A;  3TJF A;  3CSI A;  3GRX A;  1TRS A;  1T00 A;  4KE3 A;  1ERU A;  5HFI A;  4FQU A;  20GS A;  7GSS A;  1VF1 A;  4OFT A;  1V98 A;  1XOB A;  4EIQ A;  2IL3 A;  1X5E A;  1LU4 A;  2H6Z A;  2VIM A;  3IE3 A;  2F8F A;  4K6X A;  2JU5 A;  4GLT A;  3IRA A;  2LJR A;  3IC8 A;  3TUE A;  3VPQ A;  3CYN A;  4CY6 A;  3HZ8 A;  2HE3 A;  3FZ5 A;  3TJJ A;  4TOP A;  3DRN A;  3GKM A;  1GTU A;  4L8E A;  3GSS A;  2MBT A;  1AAZ A;  5ELA A;  4RQR A;  4K5S A;  2AAW A;  1QFN A;  5J41 A;  1BQ7 A;  3M3M A;  3CRU A;  2RLI A;  4OD7 A;  5D9V A;  3M1G A;  5B7C A;  3EYT A;  3RBT A;  3IPZ A;  2H75 A;  3OR5 A;  4PGT A;  3EU4 A;  4PQ1 A;  4PUA A;  1SKS B;  4PX1 A;  2DJ1 A;  3W6G A;  3SWL A;  5A4U A;  17GS A;  2EIQ A;  2K8S A;  5DAK A;  3HY2 A;  2H66 A;  4WF5 A;  5GSS A;  1AUC A;  3GYK A;  4L0W A;  1PN9 A;  2C1Y A;  5F05 A;  2YWN A;  4X4J A;  5C00 A;  3ZVJ A;  3HXS A;  4HJM A;  5FHI A;  4X43 A;  22GS A;  2IPA A;  4ZB9 A;  5DJM A;  5H5S A;  1A24 A;  2GT6 A;  3FK8 A;  4G0L A;  3BCK A;  3DVW A;  1JZR A;  3F4S A;  3VK9 A;  3CBU A;  1PN0 A;  5A5K A;  4OFN A;  1GH2 A;  3QAW A;  3QR6 A;  1ON4 A;  3KMO A;  3ERF A;  2DJK A;  3RDW A;  1FO5 A;  1CQH A;  1SK1 A;  3ERG A;  1E2Y A;  1TRW A;  5DAK B;  2HRK A;  10GS A;  4HQZ A;  3PH9 A;  8GSS A;  4HOJ A;  1GUM A;  5BMU A;  1TK0 B;  1UN2 A;  4MJA A;  3H1N A;  5C04 A;  3DML A;  2HZF A;  1XWA A;  1O7U A;  2A2P A;  3UAP A;  3DIE A;  5F06 A;  1AQX A;  1DSB A;  1PKZ A;  3TRP A;  3U6V A;  5CRD A;  1DE2 A;  5ID2 B;  2YN1 A;  2IMF A;  2G0F A;  2R0G A;  1T8E B;  5E4W A;  4BWS A;  5DQY A;  14GS A;  1HNB A;  1GNW A;  4JRR A;  4Q5R A;  1GLP A;  4HS1 A;  4KW6 A;  2J23 A;  2L5L A;  3BJ5 A;  5HR2 A;  4K0N A;  3H4K A;  5ECQ B;  1EGR A;  2O87 A;  4Q5N A;  5ECS A;  1TOF A;  1B9X C;  2P5Q A;  4GST A;  1A23 A;  3R3E A;  4XRD A;  2OJL A;  4I97 A;  3KJY A;  5FT3 A;  2L59 A;  1EZK A;  3IAS 2;  3WGD A;  4POB A;  2AYT A;  1S3A A;  4IS0 A;  5KN0 A;  2B5Y A;  3J7Y b;  1PKW A;  3DVX A;  1FB6 A;  4EUY A;  1ERT A;  4E8H A;  18GS A;  2I3Y A;  2N5A A;  3FKF A;  3WYW A;  3H8Q A;  2YPM A;  2FD3 A;  2ES7 A;  2LRT A;  5ECM B;  3W8S A;  1ZZY A;  5KOW A;  1E6B A;  1TKD B;  4YAP A;  4EE0 A;  4OO5 A;  4F0B A;  4MPF A;  2K6V A;  1TTZ A;  2DLX A;  4L5L A;  2LJK A;  3EC3 A;  3UVH A;  1USB A;  3FW2 A;  3KEB A;  4G10 A;  2NTO A;  2RUF A;  1J0F A;  3IR4 A;  1DBY A;  3ZML A;  3F6D A;  2R37 A;  1M0U A;  4ZBA A;  1G7E A;  1THX A;  1SK0 A;  2YAN A;  3DEX A;  5IO2 A;  5CRH A;  3LXT A;  2L5O A;  2IMD A;  3CSH A;  2PU9 C;  2QSI A;  3RPP A;  4YAV A;  2JZR A;  2PER A;  5HR1 A;  2H1G A;  2DIZ A;  2JZS A;  1QMV A;  3CRT A;  2YJ7 A;  3V1W A;  4V1A g;  3HVX A;  4D73 B;  1NM3 A;  1O8X A;  2PUK C;  2NPB A;  4BWQ A;  2A4V A;  4NV5 A;  2RUE A;  1B48 A;  1R7H A;  2OE0 A;  3KXO A;  1F2E A;  3WGE A;  2GSR A;  3NOF A;  2DBC A;  2OAD A;  4TR3 A;  2JL4 A;  2VL9 A;  3A2V A;  2RM5 A;  5E59 A;  1A8L A;  1UA5 A;  1X5C A;  3MIX A;  2CX3 A;  4JZQ A;  3LG6 A;  2R0C A;  2OA7 A;  3UJ1 A;  1YEP A;  2HI7 A;  1TW9 A;  4POM A;  1M9A A;  2DJ3 A;  5ECK B;  5KEJ A;  1A2L A;  2H76 A;  4KSM A;  2L4Q A;  1NSW A;  4YQV A;  3W8J A;  4OFM A;  2YV9 A;  4AJ8 A;  1XWK A;  2DJ0 A;  1Z6N A;  2GT5 A;  3F9U A;  5CRG A;  3VI5 A;  1TI3 A;  4NV2 A;  1XW5 A;  1Q4J A;  3ISO A;  3IAM 2;  3EMX A;  3GST A;  5J9B A;  5DBQ A;  3GKX A;  3O76 A;  1KBN A;  2VL3 A;  1EOG A;  5AGY A;  3D22 A;  3A2W A;  2GGT A;  3TKS E;  3ERW A;  1QQ2 A;  2GTU A;  1SL1 B;  4IQ1 A;  1ZL9 A;  3GX8 A;  1XW9 A;  3FR3 A;  3TOT A;  3VWX A;  2DJJ A;  3LSZ A;  1Z5Y E;  4BVY A;  4GSN A;  1U3I A;  3GFK A;  2YWM A;  4DEJ A;  5H5Q A;  2YCD A;  4NAX A;  4MJE A;  2PPT A;  4Z2U A;  3ZLP A;  2E2G A;  3MAK A;  3FZ9 A;  3UAR A;  5IO0 A;  2V2G A;  3L9V A;  4FO5 A;  1G6Y A;  2I4A A;  3FR9 A;  3M8N A;  2IIY A;  5AIS A;  1F37 A;  1O73 A;  1A0R P;  4IP1 A;  1ILO A;  1EP8 A;  1PA3 A;  1AC1 A;  1U88 A;  2B5E A;  2GQL A;  1ZGN A;  4ID0 A;  4CW9 A;  1V9W A;  4BA7 A;  2FY6 A;  3RHB A;  2DMM A;  2N5B A;  5DAL A;  3HD5 A;  3ZZX A;  3TRQ A;  1H4O A;  1BX9 A;  1X5D A;  5A4W A;  4MF6 A;  1GP1 A;  2VCT A;  2OBK A;  3LEF A;  3FZ4 A;  3PIN A;  2H1B A;  2YWI A;  2E2M A;  4TXO A;  4IEL A;  4XCS A;  3I9V 2;  5EY6 A;  1KEB A;  1K0B A;  4EL1 A;  4K0G A;  2H0H A;  3H93 A;  1Y6E A;  3LFL A;  2GZY A;  1A2J A;  4EC0 A;  3KP9 A;  2YP6 A;  3MSZ A;  4K7N A;  1SJI A;  6GSV A;  4K2X A;  2NBS A;  3D4T A;  1MEK A;  3FEU A;  4RI6 A;  4LMW A;  2P0G A;  3C1R A;  1OC9 A;  4DSS A;  5CYY A;  3GH6 A;  1LBK A;  2FWG A;  2PWJ A;  1ZMA A;  4KSO A;  5IMC A;  12GS A;  3P90 A;  4P3Y B;  1PQN A;  5JWR B;  2R4V A;  5EL8 A;  1TU7 A;  3WGX A;  2H0I A;  2VL2 A;  4MA9 A;  4MMM A;  1PRX A;  3BCI A;  4KAE A;  1OC8 A;  4TKY A;  5D9W A;  5ECR B;  2VLV A;  1ST9 A;  4JBB A;  3ZVJ D;  5B8A A;  4K5R A;  1YKA A;  4XS1 A;  1M2A A;  4DVC A;  13GS A;  1KTE A;  4K7I A;  3Q18 A;  4WR4 A;  4ILF A;  2X8H A;  5ECI B;  5G31 A;  1J9B A;  4FH8 A;  3IDV A;  4GCI A;  1THO A;  3TJG A;  1AW9 A;  1OC9 B;  3KH9 A;  3F4T A;  1HYU A;  3R2Q A;  3M9J A;  4GQF A;  4MDC A;  5IIZ A;  2HRF A;  4O5Q A;  3L78 A;  2CA8 A;  1TK5 B;  4WET A;  3UL3 A;  5LNK e;  1XXU A;  4HQS A;  4HI7 A;  5D9X A;  4N0Z A;  2JAC A;  1FB0 A;  2C3T A;  4N10 A;  2FWF A;  4Z2T A;  1GUK A;  2K18 A;  1SYX A;  2H72 A;  1FOH A;  5ECN B;  3LW9 A;  2R3X A;  3ME8 A;  1K3L A;  2QC7 A;  1FAA A;  4BVX A;  3F8U A;  2KUC A;  4JED A;  2FCH A;  2B7K A;  1K3O A;  3F63 A;  4O5R A;  2VCZ A;  1RQM A;  4JR4 A;  3UBL A;  2ZCT A;  3CMI A;  2AV4 A;  3RPN A;  2X99 A;  5KN2 A;  3VWV A;  2F51 A;  4QL9 A;  4K7O A;  1Z3E A;  2XPD A;  2VLU A;  5JWQ B;  3ZYW A;  3FYG A;  3GN3 A;  5DDL A;  3VLN A;  1PGT A;  3ZIV A;  1GNE A;  4IBP A;  4GQC A;  1F3A A;  2QA2 A;  4F03 A;  5LCZ A;  1ZYE A;  1TU8 A;  2KOK A;  3GKK A;  4ECC A;  1MD4 A;  4TW5 A;  2A2R A;  2DC5 A;  3ZIJ A;  1XVW A;  2I1U A;  4YKG A;  3DYR A;  4ZIL A;  2JSZ A;  4HU9 A;  2YV7 A;  5CO3 A;  3UEM A;  1DE1 A;  3Q6O A;  3HJO A;  2CZ2 A;  1GSD A;  3N5O A;  4RI7 A;  1FVJ A;  1OKT A;  4I8B A;  1Z7R A;  3KCM A;  1URM A;  5CAX A;  2R0P A;  5AIV A;  4QL7 A;  2CVB A;  2B7J A;  3KZQ A;  4YQU A;  5JCU A;  4YH2 A;  3JCM L;  4AGS A;  1AQV A;  5J3R A;  2WGR A;  1Z7P A;  2IFQ A;  2XBQ A;  2B1K A;  3DXB A;  3TOU A;  3GX0 A;  2GS3 A;  2GLR A;  3TJK A;  2AJQ B;  4EO3 A;  2WUL A;  5INY A;  2TIR A;  5H5R A;  1N8J A;  2C80 A;  1S3D A;  3D0Z A;  5BRT A;  2YNX A;  1VF2 A;  3MDK A;  3QAG A;  2C0G A;  2LUS A;  4LLR A;  1QGV A;  4NHW A;  4XHM A;  4ZL9 A;  1OC3 A;  4AF2 A;  5IMV A;  2MBS A;  1QK8 A;  2VCX A;  4J56 E;  1Q98 A;  2HZE A;  4ICY A;  3FR6 A;  3EUR A;  2MZC A;  1FOV A;  5GAN D;  3D6I A;  2LV3 A;  1NW2 A;  3IOS A;  1WWJ A;  1M99 A;  5D93 A;  3TKS C;  1A8Y A;  3IK9 A;  2DSA A;  4FYC A;  3QFA C;  3PR8 A;  3GUR A;  1O8W A;  1VF3 A;  3M9K A;  3LWA A;  3ZMK A;  1GUL A;  1RW1 A;  4E8E A;  2BMX A;  4MNN A;  3GL5 A;  4MP4 A;  2AUV A;  1EGO A;  2EIO A;  4MAB A;  3P8W A;  4MZW A;  4LA1 A;  4OCE A;  4ISD A;  2JZT A;  3NZN A;  4HUA A;  3I6A A;  1BED A;  3G7I A;  5ABR A;  2F3M A;  1HD2 A;  2GDR A;  2M72 A;  1J08 A;  2WRT A;  2O8V B;  2C4J A;  4MF5 A;  5IMA A;  4MLY A;  2G2Q A;  3P7X A;  4F2I A;  1PSQ A;  1GSQ A;  4G0I A;  3HA9 A;  4NPB A;  4PNG A;  3DGQ A;  3IV4 A;  3SBC A;  4OCF A;  2HXK A;  1ML6 A;  1MD3 A;  3TDG A;  3EE2 A;  3QD9 A;  4WF4 A;  3GV1 A;  5HR0 A;  4MF7 A;  4GF0 A;  2ZUP A;  2VCW A;  4OO4 A;  3US3 A;  3UMA A;  2GVP A;  1AXD A;  3G7Y A;  1UVZ A;  2B1L A;  1K0A A;  1BJX A;  2FGX A;  3GUS A;  4IW9 A;  5F0G A;  5JWO B;  4NMU A;  2WS2 A;  1Z6M A;  2V41 A;  4IGJ A;  3H79 A;  1MDJ A;  2LJA A;  4BL7 A;  4KF9 A;  1SK2 A;  1YKC A;  3EU3 A;  2B6M A;  4V1A p;  3HKR A;  2MMN A;  4G9H A;  1V58 A;  4ZXG A;  2HT9 A;  4OMV A;  1XW6 A;  4GTU A;  4AJ7 A;  1N2A A;  2H1D A;  3G9B A;  1B4Q A;  2YJH A;  4ACS A;  2CAI A;  4L0U A;  2CQ9 A;  4N0V A;  1T7P B;  4USS A;  1GSE A;  5DCG A;  1NHY A;  3PPU A;  1XWB A;  2LKU A;  3CTF A;  5G2Z A;  3D4M A;  1F9M A;  3EMP A;  3A5I A;  2XPE A;  4WR5 A;  2OBI A;  2HRA A;  2H74 A;  1SJ6 A;  4L5O A;  4G19 A;  4GWR A;  2LST A;  3F3Q A;  3C8E A;  1SYR A;  2GZP A;  4H86 A;  2HSM A;  3MNG A;  4TVE A;  3HJM A;  1HQO A;  2C0F A;  4K8M A;  4MZC A;  1EEJ A;  4RQX A;  1WIK A;  4I6X A;  4ZBB A;  9GSS A;  3UVT A;  1W4V A;  3FY7 A;  1WP0 A;  4N30 A;  5DCH A;  2VD0 A;  2R6K A;  2GST A;  4KDU A;  4GRF A;  4NXI A;  2FWE A;  1RK4 A;  2H6X A;  3GL3 A;  3TRX A;  3FMW A;  2VCQ A;  1GRX A;  5ECO B;  1ZYN A;  3APO A;  5G5F A;  4PNF A;  2FHE A;  2I9H A;  4IQA A;  4MJC A;  2X4A A;  1XWC A;  5JCG A;  2VAF A;  2H71 A;  4V2M A;  3N9J A;  2LQQ A;  1T4Z A;  5J5N A;  3LQ7 A;  3E9J B;  4HJ2 A;  4MCU A;  1TDI A;  4JE1 A;  4JU5 A;  3Q74 A;  6GST A;  1SL0 B;  19GS A;  1W89 A;  4J57 E;  3WT2 A;  1OE7 A;  4FYU A;  2XHF A;  4BPY A;  4IP6 A;  5IMD A;  2F8A A;  2B5X A;  4ECB A;  3DKS A;  1QXH A;  4POL A;  3KIJ A;  1B9Y C;  2L4C A;  1MDK A;  3ZTL A;  2HYX A;  2LRC A;  2B3S A;  5L71 A;  4KDX A;  1UC7 A;  5COH A;  4BVY B;  4MH3 A;  3AY8 A;  2NDO A;  4XTS A;  4EKZ A;  2E0Q A;  3EWL A;  3KTL A;  1F3B A;  4XS4 A;  2F9S A;  4JR6 A;  2I81 A;  2OKA A;  5G30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...