2OJLA

Crystal structure of q7waf1_borpa from bordetella parapertussis. northeast structural genomics target bpr68.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
79
structure length
79
Chain Sequence
HPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of Q7WAF1_BORPA from Bordetella parapertussis
rcsb
source organism Bordetella parapertussis
molecule tags Structural genomics, unknown function
total genus 22
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ojlA00
2FWHA 2X8CA 5DVBA 4ZBBA 1F9MA 1ZGNA 1J08A 1R7HA 4I2UA 5FWGA 1K0AA 1B9YC 3TJFA 3KTBA 4ACSA 3KXOA 3F63A 1X5CA 5B6MA 1YKAA 3QD9A 2PGTA 2FCHA 4F2IA 7GSSA 5CNWA 4ZILA 3HKRA 3H4KA 1YF1A 3UMAA 4WR4A 16GSA 2H72A 4L0WA 3WGDA 4I97A 4HJMA 5CYYA 3O76A 1T3BA 3P90A 5H5QA 2GT6A 2HZEB 5G1LA 2X8HA 2CVKA 3ZTLA 3UVTA 3G7YA 1F3AA 2YZUA 5B6NA 1J0FA 2EC4A 2IPAA 3MNGA 5AN1A 5FT3A 2XHFA 1X9WB 5ECQB 3H79A 4XS6A 1AIUA 3TJBA 1JZDA 1NW2A 2NVLA 2F51A 3IHQA 1A0FA 3CRTA 4MJEA 1SK0A 1SK1A 2CAQA 4NAXA 2F8AA 1OC8A 2GS3A 2FA4A 3VK9A 3F8UA 4KDXA 1W4VA 1V58A 4AJ8A 4TR4A 2R5GA 3FR3A 1V40A 1XW9A 2VCXA 1AC1A 3DXBA 2H8LA 1K3LA 2DJ0A 4BVXA 2EIOA 3VWVA 1Z6MA 17GSA 1S3AA 5KN1A 2ZUPA 2E0QA 3GH9A 3A2XA 3L9VA 2KOKA 4IQAA 1PA3A 2V1MA 5EL8A 2VCTA 5F0GA 3KM6A 5JWRB 2RUEA 4V1Ag 2BJXA 1G7OA 2FA8A 2LJRA 5AISA 1VF3A 1BYEA 1B8XA 4GSNA 2OBIA 3HHVA 1GNWA 2QGVA 5D9TA 1SKSB 2YV7A 1GUKA 2C3TA 5IO0A 1MEKA 6GSWA 4HDEA 4YQUA 2GDRA 2OADA 2FWFA 1O81A 1GSYA 3NOFA 4AGSA 1UC7A 2CT6A 3FYGA 2DSAA 1SD9A 4GTUA 3UJ1A 4IHUA 1OE7A 1AQXA 4POLA 2ZCTA 3NIVA 2FGXA 2LS5A 2G2QA 4HZ4A 3WGEA 5DQSA 4HU7A 4OMVA 4ZBAA 3EMPA 4PUAA 2QSIA 4I5QA 4GSSA 2M46A 3TB2A 2JZRA 3G7IA 4ID0A 3O6TA 2TRCP 3HJOA 4KAEA 3KIJA 1BEDA 2C8UA 4GWRA 4IGJA 4MJAA 1TK0B 2K6VA 4L5LA 4J2FA 2MYGA 1F3BA 2DJ2A 2IIYA 3BBYA 2PU9C 4IQ1A 4ISDA 3P2AA 4IP6A 1GTUA 1O85A 4F03A 2AUVA 2ON7A 5GZZB 2B7KA 1SK2A 5D93A 1PL2A 4PNGA 2B5EA 5ECSA 2L4QA 3M1GA 2K9FA 2PVQA 3GH6A 4LA1A 2IMDA 2CA8A 4KE3A 2YPMA 5IMVA 2V6KA 5ECOB 2B1KA 1YEXA 5F07A 2H0IA 1NSWA 3HD5A 5EY6A 2KLXA 4LMVA 3U5RE 4V2LA 5H5SA 2OACA 3UIWA 2GSSA 4PNFA 4D73B 1XXUA 3CTGA 3ZVJA 3DEXA 3HDCA 1V9WA 3IRAA 2I1UA 2E2MA 4PXOA 1VGLA 1X0RA 2VM1A 3IK7A 3M0FA 2RUFA 2IMFA 3LORA 4MZCA 4V1Ap 2HZEA 3AY8A 1PL1A 1E6BA 3MSZA 1TK8B 2LRCA 4OFMA 1R4WA 3GN3A 5IQYA 3TJKA 3VPTA 1ERUA 5ECMB 1X5EA 4O5RA 5DQYA 5CRGA 4N10A 1TW9A 1G6WA 5IO2A 2MMNA 1CQHA 1G0TA 4MF6A 2H66A 3DGQA 1M0UA 1DUGA 5A4WA 3H1NA 2IFQB 1XWBA 2L6DA 3VURA 1YQ1A 1SKWB 4K8MA 3IA1A 2IN3A 4OO4A 1B48A 11GSA 2VIMA 2H01A 2F3MA 3HJMA 1QK8A 2TIRA 4KSMA 6GSTA 3APOA 5ELGA 13GSA 3DYRA 1U6TA 1JLVA 4CW9A 1XCCA 2DJ3A 3DRNA 3LGCA 2K8SA 5A5KA 3IAS2 3RHCA 1X5DA 3KH7A 4WR5A 1GULA 3KH9A 3CSJA 4XTSA 5JCGA 2DBCA 4ZB6A 1EV4A 1YEPA 4Z7XA 3C1RA 1T4YA 1YDKA 5D96A 1FAAA 3R2QA 5AGYA 4PQ1A 4ML6A 3VWXA 3HXSA 4N30A 3P8WA 2JSYA 1OKTA 4XHMA 1WWJA 1OC3A 1X9SB 1EOGA 4TR3A 3QFAC 5ECPB 2H74A 3MWHA 1W89A 4HS1A 2YZHA 1C72A 2YJ7A 1GUHA 2B3SA 4V2NA 3Q19A 5L71A 4MZWA 3IXRA 4F0CA 5LNKe 2H76A 4LMWA 2MMOA 5HFIA 4I6XA 1SL0B 4K9ZA 3GRXA 2GZZA 1YKCA 1VRSD 4MK3A 2VLTA 3CSIA 4YQMA 3BD2A 3GIXA 1U3IA 4QL9A 4HEA2 2H6XA 6GSUA 4DVCA 5IIZA 4MZBA 3C71A 3WD6A 1ZL9A 2RLIA 1Q98A 2LV3A 1EWXA 1GTAA 3D22A 4OO5A 1GSUA 6GSYA 2H1AA 3ZRDA 3ZVJD 1DE2A 5DCGA 4KNDA 4RUVA 4DSQA 3TKQA 2WB9A 4AJ7A 4MF5A 1RW1A 3HJPA 1A2LA 2IMKA 5IM9A 3F9UA 2XBIA 2HSHA 5A4UA 3CRUA 1EV9A 3GURA 1HNAA 2DJJA 3APSA 3L4NA 2LSTA 4JZQA 1K0NA 1EGRA 1WOUA 2O85A 2PVOC 3IE3A 4HU9A 1VF4A 1GSQA 3A2WA 5DJLA 2PMTA 4D73A 1MD3A 3QAVA 1ERVA 1SYRA 2IL3A 1FVJA 1AQWA 3QPMA 2B1LA 1OKDA 1TKDB 2KUCA 3VLNA 3PH9A 3QMXA 2JL4A 4FYBA 1I9DA 4PURA 3E3EA 3L9SA 3CSHA 2DJKA 2P5QA 2V32A 4BL7A 3KD0A 2GT5A 3EC3A 1EEJA 4L0UA 5J5NA 3GX0A 3IC4A 3ZIVA 1N8JA 3D5JA 4YH2A 3D4TA 3LEFA 1A8LA 4WETA 4HQZA 2AJQB 1OC9B 2H1BA 3VWUA 4ECJA 3M9KA 4NV5A 4JRRA 1QUWA 1SJZA 4NHWA 2IFQA 1TP9A 2GVPA 2VL2C 3DMLA 3F6FA 2OE1A 4FO5A 1EOHA 5DAKB 3TKSE 2GGTA 3FHKA 1JFUA 4HJ2A 3UOMA 4MABA 2YNXA 5ECIB 1OE8A 1MDJA 2HSYA 1M9BA 1PD21 4TN8A 1WP0A 2L57A 4ZB8A 1T8EB 4E8HA 2LUSA 3J7Yk 1WE0A 4NWYA 4ZBDA 3ZLPA 3EMXA 3IDVA 2VM2A 3CMIA 4OFTA 4XRAA 4MPGA 2LQOA 9GSSA 2C0EA 4N0ZA 1IYHA 1J9BA 1Z5YE 2H0GA 1PX6A 1V98A 3KGKA 2CQ9A 2MBTA 2RM5A 5JCWA 2JZSA 1BJXA 4G9HA 3EU3A 14GSA 2Z9SA 2YWIA 4TW5A 3KCMA 2FUG2 5A4VA 3CTFA 4DSSB 3HA9A 4ILFA 3QAGA 2VCQA 2AB6A 2C80A 4POMA 3FR6A 2RIIA 1UVZA 5F05A 4JEDA 2H30A 4RQXA 2HFDA 2GZYA 3ZL5A 3HVXA 2B5XA 4Q5RA 12GSA 3C7MA 20GSA 1SJIA 1ILOA 4MJBA 4DEJA 2WS2A 1TU7A 2HRNA 5C04A 4K2DA 3KMOA 4OCFA 5IMFA 2HZFA 5GAPD 2ES7A 5CREA 1WRYA 4K0NA 1GTIA 3RHBA 4EE0A 4N0VA 5G30A 3W8JA 1ON4A 5J9CA 3ZZXA 1TRWA 2FWGA 1CQGA 3WGXA 2NTOA 3BCKA 1TRSA 5HFKA 3TRQA 3BCIA 3WYWA 1TJDA 4ZB9A 3TKSC 4K6XA 4GLTA 2JACA 2GSTA 1URMA 1HQOA 3JCML 1XW6A 2P5RA 4FYUA 5G31A 3M3MA 4KUNA 1QQ2A 2I81A 2BMXA 3G7JA 5CRDA 8GSSA 2O89A 5ECRB 1B4PA 4GCIA 3GTUB 1Z7PA 4KDUA 4WF4A 4OD7A 1AAZA 3PR8A 3E0UA 4G19A 5F06A 6GSVA 4NHZA 1THOA 5CRHA 1SENA 2WZ9A 3N5OA 4ZXGA 1OC9A 1PRXA 1Z7RA 2R2JA 3LWAA 4MLYA 3APQA 1T00A 3GSTA 3TUEA 2M80A 1SL1B 2C3QA 1JZRA 5IOWA 4H86A 5DJMA 2CVDA 5HR2A 5IPGA 4QQ7A 1ZCPA 5DAKA 4YAPA 3MDKA 5AIXA 1A2MA 1X9MB 3FZ9A 5JWOB 3FKFA 1PQNA 4CHSA 2YWOA 1G7EA 3A5WA 1XVQA 1BX9A 1ACVA 3FY7A 3CYNA 2VL9A 1B9XC 3I9V2 4KA0A 1FB6A 3IR4A 4FH8A 2GLRA 3RPNA 4IJ3A 4IJIA 3HCZA 1GTBA 3Q74A 3RAZA 5LCZA 2LJKA 4RI7A 4N11A 3TOUA 3RDWA 4TRXA 1O8WA 3GUSA 3ERGA 2WFCA 3VWWA 4TVEA 4LL4B 4DSSA 5ECKB 4KX4A 1FOVA 2QKEA 1BQ7A 3LXZA 2XPDA 2OA7A 1SL2B 4HUAA 3US3A 2C3NA 2DIYA 3UBLA 1K0OA 1O73A 4PUFC 1GH2A 4AJ6A 4O32A 1SJ6A 2EIQA 1ABAA 2MMAA 2JSZA 1KTEA 3BOAA 5G1KA 4BWSA 4G2EA 2HXKA 1FB0A 3QR6A 4JBBA 1PKWA 2L5LA 3E9JB 4TXVA 1H4OA 1SKRB 4RI6A 5KEJA 5DDLA 5ID2B 4K7OA 4BWQA 6GSXA 3LYPA 1I5GA 3BJ5A 1HD2A 3WT2A 5F8BA 4J57E 2LNSA 2O7KA 3D21A 4FIWA 2L4CA 3F3RA 1GNEA 1UN2A 1V2AA 1SU9A 3TDGA 5KN3A 1M2DA 4XIHA 2OE0A 3F0IA 2NPBA 2A2RA 2TRXA 4Q5NA 5JCUA 4X0XA 5HFGA 4NMUA 2KHPA 5H5RA 3GKXA 5IMZA 2HRFA 4PGTA 4TKYA 4POBA 1N2AA 3KMNA 5C00A 3K8NA 2HLSA 3FEUA 3GTUA 3C73A 1S3CA 2LRTA 2I3YA 1GRXA 3LQ7A 1LJRA 1JZOA 4P3YB 2QC7A 2P0GA 4HI7A 3M8NA 3FK8A 2YV9A 4EUYA 1XFLA 1GUMA 2IJYA 4EDYA 4IN0A 1M2AA 5J4UA 2IWTA 2G0FA 4LL1B 1ZYQB 4IS0A 3GL3A 1TTZA 1F37A 1FHEA 5COHA 2CVBA 4ZL9A 4TOPA 4GSTA 2H1DA 2MBSA 2HE3A 5HQPA 1BAYA 1TDIA 2VCWA 4POKA 1GWCA 1V57A 3HVVA 2VL2A 3RPPA 4PQHA 1SD8A 2V6OA 5KN2A 2KP2A 2GTUA 2E2GA 1TXXA 5AIVA 2LQQA 1MDIA 2FWEA 3W6GA 2HI7A 2PN8A 4MDCA 1FO5A 4F82A 3F6DA 4RQRA 1JZWA 1Z3EA 4Q5QA 5HR1A 5B8AA 3TKPA 3ME7A 3UVHA 5B8BA 2B6MA 3D0ZA 3VI5A 1QGVA 2ON5A 3N9JA 6GSSA 3LYKA 3TCOA 3TJJA 3EYTA 5EPFA 4MCUA 2H6ZA 3QOUA 3DVWA 4OWYA 5D9WA 1K0CA 1MTCA 2VO4A 3DD3A 2FLSA 3FR9A 3NZNA 1Z9HA 1ZOFA 3EINA 3IAM2 1UA5A 2N5BA 2F8FA 3L9UA 4QL7A 3DIEA 3A2VA 1FG4A 1AW9A 1R26A 1BG5A 1H75A 2GQMA 4XS4B 1K0BA 3UARA 4EO3A 4TR1B 4CDOA 2H1GA 2FHEA 1R5PA 2MZCA 2OE3A 3F3QA 3GX8A 4JU5A 3ED3A 4WKWA 3HYPA 1AXDA 1TRUA 3KJYA 4PX1A 1YY7A 1MD4A 5B7CA 3EVIA 5CP1A 5LD0A 4WF5A 2FNOA 5G5FA 2GSQA 5ECLB 5IMAA 3C1SA 2K18A 2L6CA 4IBPA 5ID2A 3TRXA 3QAWA 1TI3A 3LJRA 2OJLA 3P7XA 1KBNA 4MMMA 1KNGA 4XRDA 4X43A 2OBKA 2EIRA 5ECHB 2VLUA 3IV4A 4ECIA 2HNLA 2R4VA 4EXJA 2L5OA 2XBQA 1XWGA 2H71A 3TJGA 1EP8A 1K3YA 1DBYA 2XPEA 3TKSA 4ULXA 3VFIA 2PBJA 2VOCA 1T4ZA 1VF1A 1XZOA 4MH3A 5GSSA 3F4RA 2YP6A 3HZ8A 2B5YA 3GL5A 3TGZA 1T7PB 1XBSA 1JLWA 5CAXA 1GSSA 4KCEA 4JE1A 4PQIA 2YWMA 1TU8A 3EWLA 2VAFA 3QCPA 2GSRA 1O6JA 5HR0A 4EDZA 4IVFA 2C1YA 1IYIA 5JWQB 3H93A 3TOTA 1XPVA 5D9VA 5GAND 2C0FA 4K1FA 4O7HA 2DMLA 4F9ZA 5IOXA 5G5EA 1EEMA 1EP7A 2H0HA 3G9BA 2CAIA 1GL8A 2LTKA 2REMA 2DC5A 2RM6A 1SYXA 4ZL8A 1THXA 2R3XA 4L8EA 1ML6A 1OAZA 4EVMA 1AUCA 2I9HA 1XW5A 1ERWA 2YCDA 2BTOT 3GA4A 2YN1A 1Z6NA 1B4QA 3IPZA 3FRCA 4X1UA 4YAVA 4E8EA 2V2GA 4DSRA 1PN9A 2H73A 4HOJA 2HT9A 4BVYA 4K7NA 1K0MA 4WBJA 5DALB 2VCVA 4MP4A 1A23A 2WCIA 3CBUA 3ZIJA 3GYKA 2C4JA 5DBQA 3TKRA 4TR0A 1YJ6A 4LLRA 3EE2A 1ZZYA 1M9AA 2DLXA 2WJUA 2X99A 4AF2A 1M2BA 2JU5A 2X8GA 3KTLA 1GP1A 1RK4A 2I4AA 3GKNA 1XWAA 4XCSA 4HQSA 4ECBA 1TOFA 4V2MA 4WXTA 5INYA 2XC2A 3ERFA 4NPBA 2E7PA 3O3TA 4XS4A 1M99A 2H19A 3M9JA 4OFNA 3SBCA 4TR1A 2GZPA 2YWNA 3QFBC 3OR5A 3GKKA 3V1WA 1F6MC 3PINA 1WIKA 4IP1A 5ECNB 4KH7A 4TXOB 2YANA 5KN0A 3S9FA 2VUPA 1Y25A 1A0RP 2AAWA 2H70A 3UL3A 1JHBA 5G2ZA 1PMTA 2ALBA 5IMDA 3FZ4A 4KW6A 2WDUA 1YZXA 4OCEA 2OKAA 3H8QA 2WGRA 1XOAA 3CXGA 1Y6EA 1XOBA 3L78A 1HYUA 3ME8A 4NXIA 2VLVA 1QXHA 4Q5FA 2CV4A 5ENUA 3GMFA 3GSSA 3GKMA 4ZL7A 2VL3A 1AQVA 2AHEA 3DVXA 3KP8A 4YQVA 3HVSA 1U3AA 4K0GA 2PUKC 2D2ZA 3I43A 2VCZA 2J9HA 4EF0A 3U6VA 1KEBA 1A8YA 5J3RA 1YF0A 1WJKA 2GQKA 4KGIA 1OYJA 1USBA 1NM3A 1PGTA 2DJ1A 2L59A 4F0BA 2H75A 3KEBA 1EGOA 1GSEA 2PPTA 3F4SA 1WPIA 2JADA 4I2TA 1LBKA 5IPHA 5ABRA 4MF7A 4EKZA 19GSA 3ZMKA 2MMZA 5ELAA 1O8XA 3ZITA 1HNCA 2LKUA 4EC0A 4JR6A 3D6IA 3KP9A 2C0GA 1S3DA 3FZ5A 4L5OA 1GLQA 3D4MA 2NBSA 2CZ2A 3Q6OA 1ZYEA 4FYCA 1LU4A 2GQLA 5J9BA 5FHIA 4JR4A 1K3OA 4IW9A 1A2JA 1XWCA 1O7UA 1U88A 1TK5B 1TRVA 3Q18A 2O87A 3UEMA 5D8IA 1RQMA 5J41A 5IMCA 1DSBA 3LG6A 3A3TA 4BPYA 2VD0A 2YJHA 1ERTA 2F9SA 3PGTA 3KZQA 5GSTA 2LEGA 5E59A 2O8VB 2R6KA 3VI7A 5HR3A 3ERWA 1R5AA 2WULA 2DIZA 1F2EA 4GRFA 3L0HA 1HNBA 1PX7A 1G6YA 2IMEA 1M7TA 3W8SA 4MH2A 3GNJA 1OVNA 3LXTA 4GF0A 1FVKA 1U87A 1QMVA 4NV2A 5DALA 2WRTA 1GLPA 1GSDA 4WEYA 1ZMAA 3C8EA 4MPFA 10GSA 1T1VA 2A2SA 4K7IA 3DWVA 4HZ2A 3RBTA 2C0DA 3SWLA 1GSFA 2H6YA 5D73A 1XWKA 1XIYA 3UAPA 1DE1A 5CRWA 4GXZA 2PWJA 3GV1A 4G10A 3IK9A 4EL1A 2KP1A 3EU4A 5EVOA 1ST9A 3UBKA 2DMMA 1VF2A 1K0DA 5DCHA 4J56E 1PKZA 1QFNA 3GFKA 1XVWA 2A4VA 4BA7A 3ZFBA 2J23A 4XS1A 2N5AA 3VPQA 2AYTA 2YOIA 4MA9A 2ZNMA 3WT1A 3HY2A 4KCAA 3FZAA 1WMJA 5CO3A 3DKSA 2B7JA 4GQFA 4I8BA 2FY6A 1NHYA 4KB3A 3ISOA 3QDNA 2M72A 2HYXA 4TXOA 3J7Yb 2LRNA 2CX4A 2VD1A 4WBRD 1TI1A 1Q4JA 2LNTA 2FD3A 2V41A 18GSA 2K8VA 1FW1A 2CZ3A 1NHOA 3EURA 3IOSA 2JZTA 2X64A 1E2YA 3ZYWA 4GQCA 4KSOA 2R37A 1A24A 2P31A 3I69A 5E4WA 3FW2A 3LFLA 3MAKA 2NDOA 22GSA 4ML1A 3HZ4A 4ECCA 4KDYA 2N5FA 3I6AA 3IBHA 2IMIA 4O92A 2AV4A 3LSZA 4IELA 3ZREA 4MJCA 2CX3A 3TRPA 1PSQA 3ZFLA 1MDKA 2LJAA 2PERA 3F4TA 3GHAA 5D9XA 4IKHA 3ZMLA 4ZIJA 1EZKA
chains in the Genus database with same CATH superfamily
2FWHA 2X8CA 5DVBA 4ZBBA 1F9MA 1ZGNA 1J08A 1R7HA 4I2UA 5FWGA 1K0AA 1B9YC 3TJFA 4K5RA 3KTBA 4ACSA 3KXOA 3F63A 1X5CA 5B6MA 1YKAA 3QD9A 2PGTA 2FCHA 4F2IA 7GSSA 5CNWA 4ZILA 3HKRA 3H4KA 1YF1A 3UMAA 4WR4A 16GSA 2H72A 4O5QA 4L0WA 3WGDA 4I97A 4HJMA 5CYYA 3O76A 1T3BA 3P90A 5H5QA 2GT6A 2HZEB 5G1LA 2X8HA 2CVKA 3ZTLA 3UVTA 3G7YA 1F3AA 2YZUA 5B6NA 1J0FA 2EC4A 2IPAA 3MNGA 5AN1A 5FT3A 2XHFA 1X9WB 5ECQB 3H79A 4XS6A 1AIUA 3TJBA 1JZDA 1NW2A 2NVLA 2F51A 3IHQA 1A0FA 3CRTA 4ICYA 4MJEA 4CY6A 1SK0A 1SK1A 2CAQA 4O5UA 4NAXA 2F8AA 1OC8A 2GS3A 2FA4A 3VK9A 3F8UA 4KDXA 1W4VA 1V58A 4AJ8A 4TR4A 2R5GA 3FR3A 1V40A 1XW9A 2VCXA 1AC1A 3DXBA 2H8LA 4X4JA 1K3LA 2DJ0A 4BVXA 2EIOA 3VWVA 1Z6MA 17GSA 1S3AA 5KN1A 2ZUPA 2E0QA 3GH9A 3A2XA 3L9VA 2KOKA 4IQAA 1PA3A 2V1MA 5EL8A 2VCTA 5F0GA 3KM6A 5JWRB 2RUEA 4V1Ag 3LW9A 5KOXA 2BJXA 1G7OA 2FA8A 2LJRA 5AISA 1VF3A 1BYEA 1B8XA 4GSNA 2OBIA 3HHVA 1GNWA 2QGVA 5D9TA 1SKSB 2YV7A 1GUKA 2C3TA 5IO0A 1MEKA 6GSWA 4HDEA 4YQUA 2GDRA 2OADA 2FWFA 1O81A 1GSYA 3NOFA 4AGSA 1UC7A 2CT6A 3FYGA 2DSAA 1SD9A 4GTUA 3UJ1A 4IHUA 1OE7A 1AQXA 4POLA 2ZCTA 3NIVA 2FGXA 2LS5A 2G2QA 4HZ4A 3WGEA 5DQSA 4HU7A 4OMVA 4ZBAA 3EMPA 4PUAA 2QSIA 4I5QA 4GSSA 2M46A 3TB2A 2JZRA 3G7IA 4ID0A 3O6TA 2TRCP 3HJOA 4KAEA 3KIJA 1BEDA 2C8UA 4GWRA 4IGJA 4MJAA 1TK0B 2K6VA 4L5LA 4J2FA 2MYGA 1F3BA 2DJ2A 2IIYA 3BBYA 2PU9C 4IQ1A 4ISDA 3P2AA 4IP6A 1GTUA 1O85A 4F03A 2AUVA 2ON7A 5GZZB 2B7KA 1SK2A 5D93A 1PL2A 4PNGA 2B5EA 5ECSA 2L4QA 3M1GA 2K9FA 2PVQA 3GH6A 4LA1A 2IMDA 2QA1A 2CA8A 4KE3A 2YPMA 5IMVA 2V6KA 3MYDA 5ECOB 2B1KA 1YEXA 5F07A 2H0IA 1NSWA 3HD5A 5EY6A 5BMUA 2KLXA 4LMVA 3U5RE 4V2LA 5H5SA 2OACA 3UIWA 2GSSA 4PNFA 4D73B 1XXUA 3CTGA 3ZVJA 3DEXA 3HDCA 1V9WA 3IRAA 2I1UA 2E2MA 4PXOA 1VGLA 1X0RA 2VM1A 3IK7A 3M0FA 2RUFA 2IMFA 3LORA 4MZCA 4V1Ap 2HZEA 3AY8A 4BL7B 1PL1A 1E6BA 3MSZA 1TK8B 2LRCA 4OFMA 1R4WA 3GN3A 5IQYA 3TJKA 3VPTA 1ERUA 5ECMB 1X5EA 4O5RA 5DQYA 5CRGA 4N10A 1TW9A 1G6WA 5IO2A 2MMNA 1CQHA 1G0TA 4MF6A 2H66A 3DGQA 1M0UA 1DUGA 5A4WA 3H1NA 2IFQB 1XWBA 2L6DA 3VURA 1YQ1A 1SKWB 4K8MA 3IA1A 3A5IA 2IN3A 4OO4A 1B48A 11GSA 4YKFA 2VIMA 2H01A 2F3MA 3HJMA 1QK8A 2TIRA 4KSMA 6GSTA 3APOA 5ELGA 13GSA 3DYRA 1U6TA 1JLVA 4CW9A 1XCCA 2DJ3A 3DRNA 3LGCA 2K8SA 5A5KA 3IAS2 3RHCA 1X5DA 3KH7A 4WR5A 1GULA 3KH9A 3CSJA 4XTSA 5JCGA 2DBCA 4ZB6A 1EV4A 1YEPA 4Z7XA 3C1RA 1T4YA 1YDKA 5D96A 1FAAA 3R2QA 5AGYA 4PQ1A 4ML6A 3VWXA 3HXSA 4N30A 3P8WA 2JSYA 1OKTA 4XHMA 1WWJA 1OC3A 1X9SB 1EOGA 4TR3A 3QFAC 5ECPB 2H74A 3MWHA 1W89A 4HS1A 2YZHA 1C72A 2YJ7A 1GUHA 2B3SA 4V2NA 3Q19A 5L71A 4MZWA 3IXRA 4F0CA 5LNKe 2H76A 4LMWA 2MMOA 5HFIA 4I6XA 1SL0B 4K9ZA 3GRXA 2GZZA 1YKCA 1VRSD 4MK3A 2VLTA 3CSIA 4YQMA 3BD2A 3GIXA 1U3IA 4QL9A 4HEA2 2H6XA 6GSUA 4DVCA 5IIZA 4MZBA 3C71A 3WD6A 1ZL9A 2RLIA 1Q98A 2LV3A 1EWXA 1GTAA 3D22A 4OO5A 1GSUA 6GSYA 2H1AA 3ZRDA 3ZVJD 1DE2A 5DCGA 4KNDA 4RUVA 4DSQA 3TKQA 2WB9A 4AJ7A 4MF5A 1RW1A 3HJPA 1A2LA 2IMKA 5IM9A 3F9UA 2XBIA 4EIQA 2HSHA 5A4UA 3CRUA 1EV9A 3GURA 1HNAA 2DJJA 3APSA 3L4NA 2LSTA 4JZQA 1K0NA 1EGRA 1WOUA 2O85A 2PVOC 3IE3A 4HU9A 1VF4A 1GSQA 3A2WA 5DJLA 2PMTA 4D73A 1MD3A 3QAVA 1ERVA 1SYRA 2IL3A 1FVJA 4CY8A 1AQWA 3QPMA 2B1LA 1OKDA 1TKDB 2KUCA 3VLNA 3PH9A 3QMXA 2JL4A 4FYBA 1I9DA 4PURA 3E3EA 3L9SA 3CSHA 2DJKA 2P5QA 4K2XA 2V32A 4BL7A 3KD0A 2GT5A 3EC3A 1EEJA 4L0UA 5J5NA 4FQUA 3GX0A 3IC4A 3ZIVA 1N8JA 3D5JA 4YH2A 3D4TA 3LEFA 1A8LA 4WETA 4HQZA 2AJQB 1OC9B 2H1BA 3VWUA 4ECJA 3M9KA 1PFOA 4NV5A 4JRRA 4K5SA 1QUWA 3IHGA 1SJZA 4NHWA 2IFQA 1TP9A 2GVPA 2VL2C 3DMLA 3F6FA 2OE1A 4FO5A 3FMWA 1EOHA 5DAKB 3TKSE 2GGTA 3FHKA 1JFUA 4HJ2A 3UOMA 4MABA 2YNXA 5ECIB 1OE8A 1MDJA 2HSYA 1M9BA 1PD21 4TN8A 1WP0A 2L57A 4ZB8A 1T8EB 4E8HA 2LUSA 3J7Yk 1WE0A 4NWYA 4ZBDA 3ZLPA 2HRAA 3EMXA 3IDVA 2VM2A 3CMIA 4OFTA 4XRAA 4MPGA 2LQOA 9GSSA 2C0EA 4N0ZA 1IYHA 1J9BA 1Z5YE 2H0GA 1PX6A 1V98A 4A5PA 3KGKA 2CQ9A 2MBTA 2RM5A 5JCWA 2JZSA 4G0IA 1BJXA 4G9HA 3EU3A 14GSA 2Z9SA 5KOWA 2YWIA 4TW5A 3KCMA 2FUG2 5A4VA 3CTFA 4DSSB 3HA9A 4ILFA 3QAGA 2VCQA 2AB6A 2C80A 4POMA 3FR6A 2RIIA 1UVZA 4G0LA 2DKIA 5F05A 4JEDA 2H30A 4RQXA 2HFDA 2GZYA 3ZL5A 3HVXA 2B5XA 4Q5RA 2UZ8A 12GSA 3C7MA 20GSA 1SJIA 2QA2A 1ILOA 4MJBA 4DEJA 2WS2A 1TU7A 2HRNA 5C04A 4K2DA 3KMOA 4OCFA 5IMFA 2HZFA 5GAPD 2ES7A 5CREA 1WRYA 4K0NA 1GTIA 3RHBA 4EE0A 4N0VA 5G30A 3W8JA 1ON4A 1M3IA 5J9CA 3ZZXA 1TRWA 2FWGA 1CQGA 3WGXA 2NTOA 3BCKA 1TRSA 5HFKA 3TRQA 3BCIA 3WYWA 1TJDA 4ZB9A 3TKSC 4K6XA 4GLTA 2JACA 2GSTA 1URMA 1HQOA 3JCML 1XW6A 2P5RA 4FYUA 5G31A 3M3MA 4KUNA 1QQ2A 3CQFA 2I81A 2BMXA 3G7JA 5CRDA 4KF9A 8GSSA 2O89A 5ECRB 1B4PA 4GCIA 3GTUB 1Z7PA 4KDUA 4WF4A 4OD7A 1AAZA 3PR8A 3E0UA 4G19A 5F06A 6GSVA 4NHZA 1THOA 5CRHA 1S3RA 1SENA 2WZ9A 3N5OA 4ZXGA 1OC9A 1PRXA 1Z7RA 2R2JA 3LWAA 4MLYA 3APQA 1T00A 3GSTA 3TUEA 2M80A 1SL1B 2C3QA 1JZRA 5IOWA 4H86A 5DJMA 2CVDA 5HR2A 5IPGA 4QQ7A 1ZCPA 5DAKA 4YAPA 3MDKA 5AIXA 1A2MA 1X9MB 3FZ9A 5JWOB 3FKFA 1PQNA 4CHSA 2YWOA 1G7EA 3A5WA 1XVQA 1BX9A 1ACVA 3FY7A 3CYNA 2VL9A 1B9XC 3I9V2 4KA0A 1FB6A 3IR4A 4FH8A 2GLRA 3RPNA 4IJ3A 4IJIA 3HCZA 4PTSA 1GTBA 3Q74A 3RAZA 5LCZA 3R3EA 2LJKA 4RI7A 4N11A 3TOUA 3RDWA 4YKGA 4TRXA 1O8WA 3GUSA 3ERGA 5BRTA 2WFCA 3VWWA 4TVEA 1PN0A 4LL4B 4DSSA 5ECKB 4KX4A 1FOVA 2QKEA 1BQ7A 3LXZA 2XPDA 2OA7A 1SL2B 4HUAA 3US3A 2C3NA 2DIYA 3UBLA 1K0OA 1O73A 4PUFC 1GH2A 4AJ6A 4O32A 1SJ6A 2EIQA 1ABAA 2MMAA 2JSZA 1KTEA 3BOAA 5G1KA 4BWSA 4G2EA 2HXKA 1FB0A 3QR6A 4JBBA 1PKWA 2L5LA 3E9JB 4TXVA 1H4OA 1SKRB 4RI6A 5KEJA 5DDLA 5ID2B 4K7OA 4BWQA 6GSXA 1FOHA 3LYPA 1I5GA 3BJ5A 1HD2A 3WT2A 5F8BA 4J57E 2LNSA 2O7KA 3D21A 4FIWA 2L4CA 3F3RA 1GNEA 1UN2A 1V2AA 1SU9A 3TDGA 5KN3A 1M2DA 4XIHA 2OE0A 3F0IA 2NPBA 2A2RA 1M3JA 2TRXA 4Q5NA 5JCUA 4X0XA 5HFGA 4NMUA 2KHPA 5H5RA 3GKXA 5IMZA 2HRFA 4PGTA 4TKYA 4POBA 1N2AA 3KMNA 5C00A 3K8NA 2HLSA 3FEUA 3GTUA 3C73A 4HSCX 1S3CA 2LRTA 2I3YA 1GRXA 3LQ7A 1LJRA 4Z2TA 1JZOA 4P3YB 2QC7A 2P0GA 4HI7A 3M8NA 3FK8A 2YV9A 2DKHA 4EUYA 1XFLA 1GUMA 2IJYA 4EDYA 4IN0A 1M2AA 5J4UA 2IWTA 2G0FA 4LL1B 1ZYQB 4IS0A 3GL3A 1TTZA 1F37A 1FHEA 5COHA 2CVBA 4ZL9A 4TOPA 4Z2UA 4GSTA 2H1DA 2MBSA 2HE3A 5HQPA 1BAYA 1TDIA 3IC8A 2VCWA 4POKA 1GWCA 1V57A 3HVVA 2VL2A 3RPPA 4PQHA 1SD8A 2V6OA 5KN2A 2KP2A 2GTUA 2E2GA 1TXXA 5AIVA 2LQQA 1MDIA 2FWEA 3W6GA 2HI7A 2PN8A 4MDCA 1FO5A 4F82A 3F6DA 4RQRA 4BVYB 1JZWA 1Z3EA 4Q5QA 5HR1A 5B8AA 3TKPA 3ME7A 3UVHA 5B8BA 2B6MA 3D0ZA 3VI5A 1QGVA 2ON5A 3N9JA 6GSSA 3LYKA 3TCOA 3TJJA 3EYTA 5EPFA 4MCUA 2H6ZA 3QOUA 3DVWA 4OWYA 5D9WA 1K0CA 1MTCA 2VO4A 3DD3A 2FLSA 3FR9A 3NZNA 1Z9HA 1ZOFA 3EINA 2X49A 3IAM2 1UA5A 2N5BA 2F8FA 3L9UA 4QL7A 3DIEA 3A2VA 1FG4A 1AW9A 1R26A 1BG5A 1H75A 2GQMA 4XS4B 1K0BA 3UARA 4EO3A 4TR1B 4CDOA 2H1GA 2FHEA 1R5PA 2MZCA 2OE3A 3F3QA 3GX8A 4JU5A 3ED3A 4WKWA 3HYPA 1AXDA 1TRUA 3KJYA 4PX1A 1YY7A 1MD4A 5B7CA 3EVIA 5CP1A 5LD0A 4WF5A 2FNOA 5G5FA 2GSQA 5ECLB 5IMAA 3C1SA 2K18A 2L6CA 4IBPA 5ID2A 3TRXA 3QAWA 1TI3A 3LJRA 2OJLA 3P7XA 1KBNA 4MMMA 1KNGA 4XRDA 4X43A 2OBKA 2EIRA 5ECHB 2VLUA 3IV4A 4ECIA 2HNLA 2R4VA 4EXJA 2L5OA 2XBQA 1XWGA 2H71A 3TJGA 4Z2RA 1EP8A 1K3YA 1DBYA 2XPEA 3TKSA 4ULXA 3VFIA 2PBJA 2VOCA 1T4ZA 1VF1A 1XZOA 4MH3A 5GSSA 3F4RA 2YP6A 3HZ8A 2B5YA 3GL5A 3TGZA 1T7PB 1XBSA 1JLWA 5CAXA 4BIKA 1GSSA 4KCEA 4JE1A 4PQIA 2YWMA 1TU8A 3EWLA 2VAFA 3QCPA 2GSRA 1O6JA 5HR0A 4EDZA 4IVFA 2C1YA 1IYIA 5JWQB 3H93A 3TOTA 1XPVA 5D9VA 5GAND 2C0FA 4K1FA 4O7HA 2DMLA 4F9ZA 5IOXA 5G5EA 1EEMA 1EP7A 2H0HA 3G9BA 2CAIA 1GL8A 4USSA 2LTKA 2REMA 2DC5A 2RM6A 1SYXA 4ZL8A 1THXA 2R3XA 4L8EA 1ML6A 1OAZA 4EVMA 1AUCA 1ZYNA 2I9HA 1XW5A 1ERWA 2YCDA 2BTOT 3GA4A 2YN1A 1Z6NA 1B4QA 3IPZA 3FRCA 4X1UA 4YAVA 4E8EA 2V2GA 4DSRA 1PN9A 2H73A 4HOJA 2HT9A 4BVYA 4K7NA 1K0MA 4WBJA 5DALB 2VCVA 3MIXA 4MP4A 1A23A 2WCIA 3CBUA 3ZIJA 3GYKA 2C4JA 2R0GA 5DBQA 3TKRA 4TR0A 3PPUA 1YJ6A 4LLRA 3EE2A 1ZZYA 1M9AA 2DLXA 2WJUA 2X99A 3EPTA 4AF2A 1M2BA 2JU5A 2X8GA 3KTLA 1GP1A 1RK4A 2I4AA 3GKNA 1XWAA 4XCSA 4HQSA 4ECBA 1TOFA 4V2MA 4WXTA 5INYA 2XC2A 3ERFA 4NPBA 2E7PA 3O3TA 4XS4A 1M99A 4MNNA 2H19A 3M9JA 4OFNA 3SBCA 4TR1A 2GZPA 2YWNA 3QFBC 3OR5A 3GKKA 3V1WA 1F6MC 3PINA 1WIKA 4IP1A 5ECNB 4KH7A 4TXOB 2YANA 5KN0A 3S9FA 2VUPA 1Y25A 1A0RP 2AAWA 2H70A 3UL3A 1JHBA 5G2ZA 1PMTA 2ALBA 2A4HA 5IMDA 3FZ4A 4KW6A 3HVNA 2WDUA 1YZXA 4OCEA 2OKAA 3H8QA 2WGRA 2HSMA 1XOAA 3CXGA 1Y6EA 1XOBA 3L78A 1HYUA 3ME8A 4NXIA 2VLVA 1QXHA 4Q5FA 2CV4A 5ENUA 3GMFA 3GSSA 3GKMA 4ZL7A 2VL3A 1AQVA 2AHEA 3DVXA 3KP8A 4YQVA 3HVSA 1U3AA 4K0GA 2PUKC 2D2ZA 3I43A 1XG8A 2J9HA 2VCZA 3U6VA 4EF0A 1KEBA 1A8YA 5J3RA 1YF0A 1WJKA 2GQKA 4KGIA 1OYJA 1USBA 1NM3A 1PGTA 2DJ1A 2L59A 4F0BA 2H75A 3KEBA 1EGOA 1GSEA 2PPTA 3F4SA 1WPIA 2JADA 4I2TA 1LBKA 5IPHA 5ABRA 4MF7A 4EKZA 2R0PA 19GSA 3ZMKA 2MMZA 5ELAA 1O8XA 3ZITA 1HNCA 2LKUA 4EC0A 4JR6A 3D6IA 3KP9A 2C0GA 1S3DA 3FZ5A 4L5OA 1GLQA 3D4MA 2NBSA 2CZ2A 3Q6OA 1ZYEA 4FYCA 1LU4A 2GQLA 5J9BA 5FHIA 4JR4A 1K3OA 4IW9A 1A2JA 1XWCA 2A2PA 1O7UA 1U88A 1TK5B 1TRVA 3Q18A 2O87A 3UEMA 5D8IA 1RQMA 5J41A 5IMCA 1DSBA 3LG6A 3A3TA 4BPYA 2VD0A 2YJHA 1ERTA 2F9SA 3PGTA 3KZQA 5GSTA 2LEGA 5E59A 2X4AA 2O8VB 2R6KA 3VI7A 4EIPA 5HR3A 3ERWA 1R5AA 2WULA 2DIZA 1F2EA 4GRFA 3L0HA 1HNBA 1PX7A 1G6YA 2IMEA 1M7TA 3W8SA 4MH2A 3GNJA 1OVNA 3LXTA 4GF0A 1FVKA 1U87A 1QMVA 4NV2A 5DALA 2WRTA 1GLPA 1GSDA 2HRKA 4WEYA 1ZMAA 3C8EA 4MPFA 10GSA 1T1VA 2A2SA 4K7IA 3DWVA 4HZ2A 3RBTA 2C0DA 3SWLA 1GSFA 2H6YA 5D73A 1XWKA 1XIYA 3UAPA 1DE1A 5CRWA 4GXZA 2PWJA 3GV1A 4G10A 3IK9A 4EL1A 2KP1A 3EU4A 5EVOA 1ST9A 3UBKA 2DMMA 1VF2A 1K0DA 5DCHA 4J56E 1PKZA 1QFNA 4BVXB 3GFKA 1XVWA 2A4VA 4BA7A 3ZFBA 2J23A 4XS1A 2N5AA 3VPQA 2AYTA 2YOIA 4MA9A 2ZNMA 3WT1A 3HY2A 4KCAA 3FZAA 1WMJA 5CO3A 3DKSA 2B7JA 4GQFA 4I8BA 2FY6A 1NHYA 4KB3A 3ISOA 3QDNA 2M72A 2HYXA 4TXOA 3J7Yb 2LRNA 2CX4A 2VD1A 4WBRD 1TI1A 1Q4JA 2LNTA 2FD3A 2V41A 18GSA 2K8VA 1FW1A 2CZ3A 1NHOA 3EURA 3IOSA 2JZTA 2X64A 1E2YA 3ZYWA 4GQCA 4KSOA 2R37A 1A24A 2P31A 3I69A 5E4WA 3FW2A 3LFLA 3MAKA 2NDOA 22GSA 4ML1A 4G0KA 3HZ4A 4ECCA 4KDYA 1ZYPA 2N5FA 3I6AA 3IBHA 2IMIA 4O92A 2AV4A 3LSZA 2R0CA 4IELA 3ZREA 4MJCA 2CX3A 3TRPA 1PSQA 3ZFLA 1MDKA 2LJAA 2PERA 3F4TA 3GHAA 5D9XA 4IKHA 3ZMLA 4ZIJA 1EZKA
chains in the Genus database with same CATH topology
2FWHA 2X8CA 5DVBA 4ZBBA 1F9MA 1ZGNA 1J08A 1R7HA 4I2UA 5FWGA 1K0AA 1B9YC 3TJFA 4K5RA 3KTBA 4ACSA 3KXOA 3F63A 1X5CA 5B6MA 1YKAA 3QD9A 2PGTA 2FCHA 4F2IA 7GSSA 5CNWA 4ZILA 3HKRA 3H4KA 1YF1A 3UMAA 4WR4A 16GSA 2H72A 4O5QA 4L0WA 3WGDA 4I97A 4HJMA 5CYYA 3O76A 1T3BA 3P90A 5H5QA 2GT6A 2HZEB 5G1LA 2X8HA 2CVKA 3ZTLA 3UVTA 3G7YA 1F3AA 2YZUA 5B6NA 1J0FA 2EC4A 2IPAA 3MNGA 5AN1A 5FT3A 2XHFA 1X9WB 5ECQB 3H79A 4XS6A 1AIUA 3TJBA 1JZDA 1NW2A 2NVLA 2F51A 3IHQA 1A0FA 3CRTA 4ICYA 4MJEA 4CY6A 1SK0A 1SK1A 2CAQA 4O5UA 4NAXA 2F8AA 1OC8A 2GS3A 2FA4A 3VK9A 3F8UA 4KDXA 1W4VA 1V58A 4AJ8A 4TR4A 2R5GA 3FR3A 1V40A 1XW9A 2VCXA 1AC1A 3DXBA 2H8LA 4X4JA 1K3LA 2DJ0A 4BVXA 2EIOA 3VWVA 1Z6MA 17GSA 1S3AA 5KN1A 2ZUPA 2E0QA 3GH9A 3A2XA 3L9VA 2KOKA 4IQAA 1PA3A 2V1MA 5EL8A 2VCTA 5F0GA 3KM6A 5JWRB 2RUEA 4V1Ag 3LW9A 5KOXA 2BJXA 1G7OA 2FA8A 2LJRA 5AISA 1VF3A 1BYEA 1B8XA 4GSNA 2OBIA 3HHVA 1GNWA 2QGVA 5D9TA 1SKSB 2YV7A 1GUKA 2C3TA 5IO0A 1MEKA 6GSWA 4HDEA 4YQUA 2GDRA 2OADA 2FWFA 1O81A 1GSYA 3NOFA 4AGSA 1UC7A 2CT6A 3FYGA 2DSAA 1SD9A 4GTUA 3UJ1A 4IHUA 1OE7A 1AQXA 4POLA 2ZCTA 3NIVA 2FGXA 2LS5A 2G2QA 4HZ4A 3WGEA 5DQSA 4HU7A 4OMVA 4ZBAA 3EMPA 4PUAA 2QSIA 4I5QA 4GSSA 2M46A 3TB2A 2JZRA 3G7IA 4ID0A 3O6TA 2TRCP 3HJOA 4KAEA 3KIJA 1BEDA 2C8UA 4GWRA 4IGJA 4MJAA 1TK0B 2K6VA 4L5LA 4J2FA 2MYGA 1F3BA 2DJ2A 2IIYA 3BBYA 2PU9C 4IQ1A 4ISDA 3P2AA 4IP6A 1GTUA 1O85A 4F03A 2AUVA 2ON7A 5GZZB 2B7KA 1SK2A 5D93A 1PL2A 4PNGA 2B5EA 5ECSA 2L4QA 3M1GA 2K9FA 2PVQA 3GH6A 4LA1A 2IMDA 2QA1A 2CA8A 4KE3A 2YPMA 5IMVA 2V6KA 3MYDA 5ECOB 2B1KA 1YEXA 5F07A 2H0IA 1NSWA 3HD5A 5EY6A 5BMUA 2KLXA 4LMVA 3U5RE 4V2LA 5H5SA 2OACA 3UIWA 2GSSA 4PNFA 4D73B 1XXUA 3CTGA 3ZVJA 3DEXA 3HDCA 1V9WA 3IRAA 2I1UA 2E2MA 4PXOA 1VGLA 1X0RA 2VM1A 3IK7A 3M0FA 2RUFA 2IMFA 3LORA 4MZCA 4V1Ap 2HZEA 3AY8A 4BL7B 1PL1A 1E6BA 3MSZA 1TK8B 2LRCA 4OFMA 1R4WA 3GN3A 5IQYA 3TJKA 3VPTA 1ERUA 5ECMB 1X5EA 4O5RA 5DQYA 5CRGA 4N10A 1TW9A 1G6WA 5IO2A 2MMNA 1CQHA 1G0TA 4MF6A 2H66A 3DGQA 1M0UA 1DUGA 5A4WA 3H1NA 2IFQB 1XWBA 2L6DA 3VURA 1YQ1A 1SKWB 4K8MA 3IA1A 3A5IA 2IN3A 4OO4A 1B48A 11GSA 4YKFA 2VIMA 2H01A 2F3MA 3HJMA 1QK8A 2TIRA 4KSMA 6GSTA 3APOA 5ELGA 13GSA 3DYRA 1U6TA 1JLVA 4CW9A 1XCCA 2DJ3A 3DRNA 3LGCA 2K8SA 5A5KA 3IAS2 3RHCA 1X5DA 3KH7A 4WR5A 1GULA 3KH9A 3CSJA 4XTSA 5JCGA 2DBCA 4ZB6A 1EV4A 1YEPA 4Z7XA 3C1RA 1T4YA 1YDKA 5D96A 1FAAA 3R2QA 5AGYA 4PQ1A 4ML6A 3VWXA 3HXSA 4N30A 3P8WA 2JSYA 1OKTA 4XHMA 1WWJA 1OC3A 1X9SB 1EOGA 4TR3A 3QFAC 5ECPB 2H74A 3MWHA 1W89A 4HS1A 2YZHA 1C72A 2YJ7A 1GUHA 2B3SA 4V2NA 3Q19A 5L71A 4MZWA 3IXRA 4F0CA 5LNKe 2H76A 4LMWA 2MMOA 5HFIA 4I6XA 1SL0B 4K9ZA 3GRXA 2GZZA 1YKCA 1VRSD 4MK3A 2VLTA 3CSIA 4YQMA 3BD2A 3GIXA 1U3IA 4QL9A 4HEA2 2H6XA 6GSUA 4DVCA 5IIZA 4MZBA 3C71A 3WD6A 1ZL9A 2RLIA 1Q98A 2LV3A 1EWXA 1GTAA 3D22A 4OO5A 1GSUA 6GSYA 2H1AA 3ZRDA 3ZVJD 1DE2A 5DCGA 4KNDA 4RUVA 4DSQA 3TKQA 2WB9A 4AJ7A 4MF5A 1RW1A 3HJPA 1A2LA 2IMKA 5IM9A 3F9UA 2XBIA 4EIQA 2HSHA 5A4UA 3CRUA 1EV9A 3GURA 1HNAA 2DJJA 3APSA 3L4NA 2LSTA 4JZQA 1K0NA 1EGRA 1WOUA 2O85A 2PVOC 3IE3A 4HU9A 1VF4A 1GSQA 3A2WA 5DJLA 2PMTA 4D73A 1MD3A 3QAVA 1ERVA 1SYRA 2IL3A 1FVJA 4CY8A 1AQWA 3QPMA 2B1LA 1OKDA 1TKDB 2KUCA 3VLNA 3PH9A 3QMXA 2JL4A 4FYBA 1I9DA 4PURA 3E3EA 3L9SA 3CSHA 2DJKA 2P5QA 4K2XA 2V32A 4BL7A 3KD0A 2GT5A 3EC3A 1EEJA 4L0UA 5J5NA 4FQUA 3GX0A 3IC4A 3ZIVA 1N8JA 3D5JA 4YH2A 3D4TA 3LEFA 1A8LA 4WETA 4HQZA 2AJQB 1OC9B 2H1BA 3VWUA 4ECJA 3M9KA 4NV5A 4JRRA 4K5SA 1QUWA 3IHGA 1SJZA 4NHWA 2IFQA 1TP9A 2GVPA 2VL2C 3DMLA 3F6FA 2OE1A 4FO5A 3FMWA 1EOHA 5DAKB 3TKSE 2GGTA 3FHKA 1JFUA 4HJ2A 3UOMA 4MABA 2YNXA 5ECIB 1OE8A 1MDJA 2HSYA 1M9BA 1PD21 4TN8A 1WP0A 2L57A 4ZB8A 1T8EB 4E8HA 2LUSA 3J7Yk 1WE0A 4NWYA 4ZBDA 3ZLPA 2HRAA 3EMXA 3IDVA 2VM2A 3CMIA 4OFTA 4XRAA 4MPGA 2LQOA 9GSSA 2C0EA 4N0ZA 1IYHA 1J9BA 1Z5YE 2H0GA 1PX6A 1V98A 4A5PA 3KGKA 2CQ9A 2MBTA 2RM5A 5JCWA 2JZSA 4G0IA 1BJXA 4G9HA 3EU3A 14GSA 2Z9SA 5KOWA 2YWIA 4TW5A 3KCMA 2FUG2 5A4VA 3CTFA 4DSSB 3HA9A 4ILFA 3QAGA 2VCQA 2AB6A 2C80A 4POMA 3FR6A 2RIIA 1UVZA 4G0LA 2DKIA 5F05A 4JEDA 2H30A 4RQXA 2HFDA 2GZYA 3ZL5A 3HVXA 2B5XA 4Q5RA 2UZ8A 12GSA 3C7MA 20GSA 1SJIA 2QA2A 1ILOA 4MJBA 4DEJA 2WS2A 1TU7A 2HRNA 5C04A 4K2DA 3KMOA 4OCFA 5IMFA 2HZFA 5GAPD 2ES7A 5CREA 1WRYA 4K0NA 1GTIA 3RHBA 4EE0A 4N0VA 5G30A 3W8JA 1ON4A 5J9CA 3ZZXA 1TRWA 2FWGA 1CQGA 3WGXA 2NTOA 3BCKA 1TRSA 5HFKA 3TRQA 3BCIA 3WYWA 1TJDA 4ZB9A 3TKSC 4K6XA 4GLTA 2JACA 2GSTA 1URMA 1HQOA 3JCML 1XW6A 2P5RA 4FYUA 5G31A 3M3MA 4KUNA 1QQ2A 2I81A 2BMXA 3G7JA 5CRDA 4KF9A 8GSSA 2O89A 5ECRB 1B4PA 4GCIA 3GTUB 1Z7PA 4KDUA 4WF4A 4OD7A 1AAZA 3PR8A 3E0UA 4G19A 5F06A 6GSVA 4NHZA 1THOA 5CRHA 1SENA 2WZ9A 3N5OA 4ZXGA 1OC9A 1PRXA 1Z7RA 2R2JA 3LWAA 4MLYA 3APQA 1T00A 3GSTA 3TUEA 2M80A 1SL1B 2C3QA 1JZRA 5IOWA 4H86A 5DJMA 2CVDA 5HR2A 5IPGA 4QQ7A 1ZCPA 5DAKA 4YAPA 3MDKA 5AIXA 1A2MA 1X9MB 3FZ9A 5JWOB 3FKFA 1PQNA 4CHSA 2YWOA 1G7EA 3A5WA 1XVQA 1BX9A 1ACVA 3FY7A 3CYNA 2VL9A 1B9XC 3I9V2 4KA0A 1FB6A 3IR4A 4FH8A 2GLRA 3RPNA 4IJ3A 4IJIA 3HCZA 4PTSA 1GTBA 3Q74A 3RAZA 5LCZA 3R3EA 2LJKA 4RI7A 4N11A 3TOUA 3RDWA 4YKGA 4TRXA 1O8WA 3GUSA 3ERGA 5BRTA 2WFCA 3VWWA 4TVEA 1PN0A 4LL4B 4DSSA 5ECKB 4KX4A 1FOVA 2QKEA 1BQ7A 3LXZA 2XPDA 2OA7A 1SL2B 4HUAA 3US3A 2C3NA 2DIYA 3UBLA 1K0OA 1O73A 4PUFC 1GH2A 4AJ6A 4O32A 1SJ6A 2EIQA 1ABAA 2MMAA 2JSZA 1KTEA 3BOAA 5G1KA 4BWSA 4G2EA 2HXKA 1FB0A 3QR6A 4JBBA 1PKWA 2L5LA 3E9JB 4TXVA 1H4OA 1SKRB 4RI6A 5KEJA 5DDLA 5ID2B 4K7OA 4BWQA 6GSXA 1FOHA 3LYPA 1I5GA 3BJ5A 1HD2A 3WT2A 5F8BA 4J57E 2LNSA 2O7KA 3D21A 4FIWA 2L4CA 3F3RA 1GNEA 1UN2A 1V2AA 1SU9A 3TDGA 5KN3A 1M2DA 4XIHA 2OE0A 3F0IA 2NPBA 2A2RA 2TRXA 4Q5NA 5JCUA 4X0XA 5HFGA 4NMUA 2KHPA 5H5RA 3GKXA 5IMZA 2HRFA 4PGTA 4TKYA 4POBA 1N2AA 3KMNA 5C00A 3K8NA 2HLSA 3FEUA 3GTUA 3C73A 1S3CA 2LRTA 2I3YA 1GRXA 3LQ7A 1LJRA 4Z2TA 1JZOA 4P3YB 2QC7A 2P0GA 4HI7A 3M8NA 3FK8A 2YV9A 2DKHA 4EUYA 1XFLA 1GUMA 2IJYA 4EDYA 4IN0A 1M2AA 5J4UA 2IWTA 2G0FA 4LL1B 1ZYQB 4IS0A 3GL3A 1TTZA 1F37A 1FHEA 5COHA 2CVBA 4ZL9A 4TOPA 4Z2UA 4GSTA 2H1DA 2MBSA 2HE3A 5HQPA 1BAYA 1TDIA 3IC8A 2VCWA 4POKA 1GWCA 1V57A 3HVVA 2VL2A 3RPPA 4PQHA 1SD8A 2V6OA 5KN2A 2KP2A 2GTUA 2E2GA 1TXXA 5AIVA 2LQQA 1MDIA 2FWEA 3W6GA 2HI7A 2PN8A 4MDCA 1FO5A 4F82A 3F6DA 4RQRA 4BVYB 1JZWA 1Z3EA 4Q5QA 5HR1A 5B8AA 3TKPA 3ME7A 3UVHA 5B8BA 2B6MA 3D0ZA 3VI5A 1QGVA 2ON5A 3N9JA 6GSSA 3LYKA 3TCOA 3TJJA 3EYTA 5EPFA 4MCUA 2H6ZA 3QOUA 3DVWA 4OWYA 5D9WA 1K0CA 1MTCA 2VO4A 3DD3A 2FLSA 3FR9A 3NZNA 1Z9HA 1ZOFA 3EINA 2X49A 3IAM2 1UA5A 2N5BA 2F8FA 3L9UA 4QL7A 3DIEA 3A2VA 1FG4A 1AW9A 1R26A 1BG5A 1H75A 2GQMA 4XS4B 1K0BA 3UARA 4EO3A 4TR1B 4CDOA 2H1GA 2FHEA 1R5PA 2MZCA 2OE3A 3F3QA 3GX8A 4JU5A 3ED3A 4WKWA 3HYPA 1AXDA 1TRUA 3KJYA 4PX1A 1YY7A 1MD4A 5B7CA 3EVIA 5CP1A 5LD0A 4WF5A 2FNOA 5G5FA 2GSQA 5ECLB 5IMAA 3C1SA 2K18A 2L6CA 4IBPA 5ID2A 3TRXA 3QAWA 1TI3A 3LJRA 2OJLA 3P7XA 1KBNA 4MMMA 1KNGA 4XRDA 4X43A 2OBKA 2EIRA 5ECHB 2VLUA 3IV4A 4ECIA 2HNLA 2R4VA 4EXJA 2L5OA 2XBQA 1XWGA 2H71A 3TJGA 4Z2RA 1EP8A 1K3YA 1DBYA 2XPEA 3TKSA 4ULXA 3VFIA 2PBJA 2VOCA 1T4ZA 1VF1A 1XZOA 4MH3A 5GSSA 3F4RA 2YP6A 3HZ8A 2B5YA 3GL5A 3TGZA 1T7PB 1XBSA 1JLWA 5CAXA 1GSSA 4KCEA 4JE1A 4PQIA 2YWMA 1TU8A 3EWLA 2VAFA 3QCPA 2GSRA 1O6JA 5HR0A 4EDZA 4IVFA 2C1YA 1IYIA 5JWQB 3H93A 3TOTA 1XPVA 5D9VA 5GAND 2C0FA 4K1FA 4O7HA 2DMLA 4F9ZA 5IOXA 5G5EA 1EEMA 1EP7A 2H0HA 3G9BA 2CAIA 1GL8A 4USSA 2LTKA 2REMA 2DC5A 2RM6A 1SYXA 4ZL8A 1THXA 2R3XA 4L8EA 1ML6A 1OAZA 4EVMA 1AUCA 1ZYNA 2I9HA 1XW5A 1ERWA 2YCDA 2BTOT 3GA4A 2YN1A 1Z6NA 1B4QA 3IPZA 3FRCA 4X1UA 4YAVA 4E8EA 2V2GA 4DSRA 1PN9A 2H73A 4HOJA 2HT9A 4BVYA 4K7NA 1K0MA 4WBJA 5DALB 2VCVA 3MIXA 4MP4A 1A23A 2WCIA 3CBUA 3ZIJA 3GYKA 2C4JA 2R0GA 5DBQA 3TKRA 4TR0A 3PPUA 1YJ6A 4LLRA 3EE2A 1ZZYA 1M9AA 2DLXA 2WJUA 2X99A 3EPTA 4AF2A 1M2BA 2JU5A 2X8GA 3KTLA 1GP1A 1RK4A 2I4AA 3GKNA 1XWAA 4XCSA 4HQSA 4ECBA 1TOFA 4V2MA 4WXTA 5INYA 2XC2A 3ERFA 4NPBA 2E7PA 3O3TA 4XS4A 1M99A 4MNNA 2H19A 3M9JA 4OFNA 3SBCA 4TR1A 2GZPA 2YWNA 3QFBC 3OR5A 3GKKA 3V1WA 1F6MC 3PINA 1WIKA 4IP1A 5ECNB 4KH7A 4TXOB 2YANA 5KN0A 3S9FA 2VUPA 1Y25A 1A0RP 2AAWA 2H70A 3UL3A 1JHBA 5G2ZA 1PMTA 2ALBA 2A4HA 5IMDA 3FZ4A 4KW6A 2WDUA 1YZXA 4OCEA 2OKAA 3H8QA 2WGRA 2HSMA 1XOAA 3CXGA 1Y6EA 1XOBA 3L78A 1HYUA 3ME8A 4NXIA 2VLVA 1QXHA 4Q5FA 2CV4A 5ENUA 3GMFA 3GSSA 3GKMA 4ZL7A 2VL3A 1AQVA 2AHEA 3DVXA 3KP8A 4YQVA 3HVSA 1U3AA 4K0GA 2PUKC 2D2ZA 3I43A 2VCZA 2J9HA 4EF0A 3U6VA 1KEBA 1A8YA 5J3RA 1YF0A 1WJKA 2GQKA 4KGIA 1OYJA 1USBA 1NM3A 1PGTA 2DJ1A 2L59A 4F0BA 2H75A 3KEBA 1EGOA 1GSEA 2PPTA 3F4SA 1WPIA 2JADA 4I2TA 1LBKA 5IPHA 5ABRA 4MF7A 4EKZA 2R0PA 19GSA 3ZMKA 2MMZA 5ELAA 1O8XA 3ZITA 1HNCA 2LKUA 4EC0A 4JR6A 3D6IA 3KP9A 2C0GA 1S3DA 3FZ5A 4L5OA 1GLQA 3D4MA 2NBSA 2CZ2A 3Q6OA 1ZYEA 4FYCA 1LU4A 2GQLA 5J9BA 5FHIA 4JR4A 1K3OA 4IW9A 1A2JA 1XWCA 2A2PA 1O7UA 1U88A 1TK5B 1TRVA 3Q18A 2O87A 3UEMA 5D8IA 1RQMA 5J41A 5IMCA 1DSBA 3LG6A 3A3TA 4BPYA 2VD0A 2YJHA 1ERTA 2F9SA 3PGTA 3KZQA 5GSTA 2LEGA 5E59A 2X4AA 2O8VB 2R6KA 3VI7A 4EIPA 5HR3A 3ERWA 1R5AA 2WULA 2DIZA 1F2EA 4GRFA 3L0HA 1HNBA 1PX7A 1G6YA 2IMEA 1M7TA 3W8SA 4MH2A 3GNJA 1OVNA 3LXTA 4GF0A 1FVKA 1U87A 1QMVA 4NV2A 5DALA 2WRTA 1GLPA 1GSDA 2HRKA 4WEYA 1ZMAA 3C8EA 4MPFA 10GSA 1T1VA 2A2SA 4K7IA 3DWVA 4HZ2A 3RBTA 2C0DA 3SWLA 1GSFA 2H6YA 5D73A 1XWKA 1XIYA 3UAPA 1DE1A 5CRWA 4GXZA 2PWJA 3GV1A 4G10A 3IK9A 4EL1A 2KP1A 3EU4A 5EVOA 1ST9A 3UBKA 2DMMA 1VF2A 1K0DA 5DCHA 4J56E 1PKZA 1QFNA 4BVXB 3GFKA 1XVWA 2A4VA 4BA7A 3ZFBA 2J23A 4XS1A 2N5AA 3VPQA 2AYTA 2YOIA 4MA9A 2ZNMA 3WT1A 3HY2A 4KCAA 3FZAA 1WMJA 5CO3A 3DKSA 2B7JA 4GQFA 4I8BA 2FY6A 1NHYA 4KB3A 3ISOA 3QDNA 2M72A 2HYXA 4TXOA 3J7Yb 2LRNA 2CX4A 2VD1A 4WBRD 1TI1A 1Q4JA 2LNTA 2FD3A 2V41A 18GSA 2K8VA 1FW1A 2CZ3A 1NHOA 3EURA 3IOSA 2JZTA 2X64A 1E2YA 3ZYWA 4GQCA 4KSOA 2R37A 1A24A 2P31A 3I69A 5E4WA 3FW2A 3LFLA 3MAKA 2NDOA 22GSA 4ML1A 4G0KA 3HZ4A 4ECCA 4KDYA 1ZYPA 2N5FA 3I6AA 3IBHA 2IMIA 4O92A 2AV4A 3LSZA 2R0CA 4IELA 3ZREA 4MJCA 2CX3A 3TRPA 1PSQA 3ZFLA 1MDKA 2LJAA 2PERA 3F4TA 3GHAA 5D9XA 4IKHA 3ZMLA 4ZIJA 1EZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWH A;  2X8C A;  5DVB A;  4ZBB A;  1F9M A;  1ZGN A;  1J08 A;  1R7H A;  4I2U A;  5FWG A;  1K0A A;  1B9Y C;  3TJF A;  3KTB A;  4ACS A;  3KXO A;  3F63 A;  1X5C A;  5B6M A;  1YKA A;  3QD9 A;  2PGT A;  2FCH A;  4F2I A;  7GSS A;  5CNW A;  4ZIL A;  3HKR A;  3H4K A;  1YF1 A;  3UMA A;  4WR4 A;  16GS A;  2H72 A;  4L0W A;  3WGD A;  4I97 A;  4HJM A;  5CYY A;  3O76 A;  1T3B A;  3P90 A;  5H5Q A;  2GT6 A;  2HZE B;  5G1L A;  2X8H A;  2CVK A;  3ZTL A;  3UVT A;  3G7Y A;  1F3A A;  2YZU A;  5B6N A;  1J0F A;  2EC4 A;  2IPA A;  3MNG A;  5AN1 A;  5FT3 A;  2XHF A;  1X9W B;  5ECQ B;  3H79 A;  4XS6 A;  1AIU A;  3TJB A;  1JZD A;  1NW2 A;  2NVL A;  2F51 A;  3IHQ A;  1A0F A;  3CRT A;  4MJE A;  1SK0 A;  1SK1 A;  2CAQ A;  4NAX A;  2F8A A;  1OC8 A;  2GS3 A;  2FA4 A;  3VK9 A;  3F8U A;  4KDX A;  1W4V A;  1V58 A;  4AJ8 A;  4TR4 A;  2R5G A;  3FR3 A;  1V40 A;  1XW9 A;  2VCX A;  1AC1 A;  3DXB A;  2H8L A;  1K3L A;  2DJ0 A;  4BVX A;  2EIO A;  3VWV A;  1Z6M A;  17GS A;  1S3A A;  5KN1 A;  2ZUP A;  2E0Q A;  3GH9 A;  3A2X A;  3L9V A;  2KOK A;  4IQA A;  1PA3 A;  2V1M A;  5EL8 A;  2VCT A;  5F0G A;  3KM6 A;  5JWR B;  2RUE A;  4V1A g;  2BJX A;  1G7O A;  2FA8 A;  2LJR A;  5AIS A;  1VF3 A;  1BYE A;  1B8X A;  4GSN A;  2OBI A;  3HHV A;  1GNW A;  2QGV A;  5D9T A;  1SKS B;  2YV7 A;  1GUK A;  2C3T A;  5IO0 A;  1MEK A;  6GSW A;  4HDE A;  4YQU A;  2GDR A;  2OAD A;  2FWF A;  1O81 A;  1GSY A;  3NOF A;  4AGS A;  1UC7 A;  2CT6 A;  3FYG A;  2DSA A;  1SD9 A;  4GTU A;  3UJ1 A;  4IHU A;  1OE7 A;  1AQX A;  4POL A;  2ZCT A;  3NIV A;  2FGX A;  2LS5 A;  2G2Q A;  4HZ4 A;  3WGE A;  5DQS A;  4HU7 A;  4OMV A;  4ZBA A;  3EMP A;  4PUA A;  2QSI A;  4I5Q A;  4GSS A;  2M46 A;  3TB2 A;  2JZR A;  3G7I A;  4ID0 A;  3O6T A;  2TRC P;  3HJO A;  4KAE A;  3KIJ A;  1BED A;  2C8U A;  4GWR A;  4IGJ A;  4MJA A;  1TK0 B;  2K6V A;  4L5L A;  4J2F A;  2MYG A;  1F3B A;  2DJ2 A;  2IIY A;  3BBY A;  2PU9 C;  4IQ1 A;  4ISD A;  3P2A A;  4IP6 A;  1GTU A;  1O85 A;  4F03 A;  2AUV A;  2ON7 A;  5GZZ B;  2B7K A;  1SK2 A;  5D93 A;  1PL2 A;  4PNG A;  2B5E A;  5ECS A;  2L4Q A;  3M1G A;  2K9F A;  2PVQ A;  3GH6 A;  4LA1 A;  2IMD A;  2CA8 A;  4KE3 A;  2YPM A;  5IMV A;  2V6K A;  5ECO B;  2B1K A;  1YEX A;  5F07 A;  2H0I A;  1NSW A;  3HD5 A;  5EY6 A;  2KLX A;  4LMV A;  3U5R E;  4V2L A;  5H5S A;  2OAC A;  3UIW A;  2GSS A;  4PNF A;  4D73 B;  1XXU A;  3CTG A;  3ZVJ A;  3DEX A;  3HDC A;  1V9W A;  3IRA A;  2I1U A;  2E2M A;  4PXO A;  1VGL A;  1X0R A;  2VM1 A;  3IK7 A;  3M0F A;  2RUF A;  2IMF A;  3LOR A;  4MZC A;  4V1A p;  2HZE A;  3AY8 A;  1PL1 A;  1E6B A;  3MSZ A;  1TK8 B;  2LRC A;  4OFM A;  1R4W A;  3GN3 A;  5IQY A;  3TJK A;  3VPT A;  1ERU A;  5ECM B;  1X5E A;  4O5R A;  5DQY A;  5CRG A;  4N10 A;  1TW9 A;  1G6W A;  5IO2 A;  2MMN A;  1CQH A;  1G0T A;  4MF6 A;  2H66 A;  3DGQ A;  1M0U A;  1DUG A;  5A4W A;  3H1N A;  2IFQ B;  1XWB A;  2L6D A;  3VUR A;  1YQ1 A;  1SKW B;  4K8M A;  3IA1 A;  2IN3 A;  4OO4 A;  1B48 A;  11GS A;  2VIM A;  2H01 A;  2F3M A;  3HJM A;  1QK8 A;  2TIR A;  4KSM A;  6GST A;  3APO A;  5ELG A;  13GS A;  3DYR A;  1U6T A;  1JLV A;  4CW9 A;  1XCC A;  2DJ3 A;  3DRN A;  3LGC A;  2K8S A;  5A5K A;  3IAS 2;  3RHC A;  1X5D A;  3KH7 A;  4WR5 A;  1GUL A;  3KH9 A;  3CSJ A;  4XTS A;  5JCG A;  2DBC A;  4ZB6 A;  1EV4 A;  1YEP A;  4Z7X A;  3C1R A;  1T4Y A;  1YDK A;  5D96 A;  1FAA A;  3R2Q A;  5AGY A;  4PQ1 A;  4ML6 A;  3VWX A;  3HXS A;  4N30 A;  3P8W A;  2JSY A;  1OKT A;  4XHM A;  1WWJ A;  1OC3 A;  1X9S B;  1EOG A;  4TR3 A;  3QFA C;  5ECP B;  2H74 A;  3MWH A;  1W89 A;  4HS1 A;  2YZH A;  1C72 A;  2YJ7 A;  1GUH A;  2B3S A;  4V2N A;  3Q19 A;  5L71 A;  4MZW A;  3IXR A;  4F0C A;  5LNK e;  2H76 A;  4LMW A;  2MMO A;  5HFI A;  4I6X A;  1SL0 B;  4K9Z A;  3GRX A;  2GZZ A;  1YKC A;  1VRS D;  4MK3 A;  2VLT A;  3CSI A;  4YQM A;  3BD2 A;  3GIX A;  1U3I A;  4QL9 A;  4HEA 2;  2H6X A;  6GSU A;  4DVC A;  5IIZ A;  4MZB A;  3C71 A;  3WD6 A;  1ZL9 A;  2RLI A;  1Q98 A;  2LV3 A;  1EWX A;  1GTA A;  3D22 A;  4OO5 A;  1GSU A;  6GSY A;  2H1A A;  3ZRD A;  3ZVJ D;  1DE2 A;  5DCG A;  4KND A;  4RUV A;  4DSQ A;  3TKQ A;  2WB9 A;  4AJ7 A;  4MF5 A;  1RW1 A;  3HJP A;  1A2L A;  2IMK A;  5IM9 A;  3F9U A;  2XBI A;  2HSH A;  5A4U A;  3CRU A;  1EV9 A;  3GUR A;  1HNA A;  2DJJ A;  3APS A;  3L4N A;  2LST A;  4JZQ A;  1K0N A;  1EGR A;  1WOU A;  2O85 A;  2PVO C;  3IE3 A;  4HU9 A;  1VF4 A;  1GSQ A;  3A2W A;  5DJL A;  2PMT A;  4D73 A;  1MD3 A;  3QAV A;  1ERV A;  1SYR A;  2IL3 A;  1FVJ A;  1AQW A;  3QPM A;  2B1L A;  1OKD A;  1TKD B;  2KUC A;  3VLN A;  3PH9 A;  3QMX A;  2JL4 A;  4FYB A;  1I9D A;  4PUR A;  3E3E A;  3L9S A;  3CSH A;  2DJK A;  2P5Q A;  2V32 A;  4BL7 A;  3KD0 A;  2GT5 A;  3EC3 A;  1EEJ A;  4L0U A;  5J5N A;  3GX0 A;  3IC4 A;  3ZIV A;  1N8J A;  3D5J A;  4YH2 A;  3D4T A;  3LEF A;  1A8L A;  4WET A;  4HQZ A;  2AJQ B;  1OC9 B;  2H1B A;  3VWU A;  4ECJ A;  3M9K A;  4NV5 A;  4JRR A;  1QUW A;  1SJZ A;  4NHW A;  2IFQ A;  1TP9 A;  2GVP A;  2VL2 C;  3DML A;  3F6F A;  2OE1 A;  4FO5 A;  1EOH A;  5DAK B;  3TKS E;  2GGT A;  3FHK A;  1JFU A;  4HJ2 A;  3UOM A;  4MAB A;  2YNX A;  5ECI B;  1OE8 A;  1MDJ A;  2HSY A;  1M9B A;  1PD2 1;  4TN8 A;  1WP0 A;  2L57 A;  4ZB8 A;  1T8E B;  4E8H A;  2LUS A;  3J7Y k;  1WE0 A;  4NWY A;  4ZBD A;  3ZLP A;  3EMX A;  3IDV A;  2VM2 A;  3CMI A;  4OFT A;  4XRA A;  4MPG A;  2LQO A;  9GSS A;  2C0E A;  4N0Z A;  1IYH A;  1J9B A;  1Z5Y E;  2H0G A;  1PX6 A;  1V98 A;  3KGK A;  2CQ9 A;  2MBT A;  2RM5 A;  5JCW A;  2JZS A;  1BJX A;  4G9H A;  3EU3 A;  14GS A;  2Z9S A;  2YWI A;  4TW5 A;  3KCM A;  2FUG 2;  5A4V A;  3CTF A;  4DSS B;  3HA9 A;  4ILF A;  3QAG A;  2VCQ A;  2AB6 A;  2C80 A;  4POM A;  3FR6 A;  2RII A;  1UVZ A;  5F05 A;  4JED A;  2H30 A;  4RQX A;  2HFD A;  2GZY A;  3ZL5 A;  3HVX A;  2B5X A;  4Q5R A;  12GS A;  3C7M A;  20GS A;  1SJI A;  1ILO A;  4MJB A;  4DEJ A;  2WS2 A;  1TU7 A;  2HRN A;  5C04 A;  4K2D A;  3KMO A;  4OCF A;  5IMF A;  2HZF A;  5GAP D;  2ES7 A;  5CRE A;  1WRY A;  4K0N A;  1GTI A;  3RHB A;  4EE0 A;  4N0V A;  5G30 A;  3W8J A;  1ON4 A;  5J9C A;  3ZZX A;  1TRW A;  2FWG A;  1CQG A;  3WGX A;  2NTO A;  3BCK A;  1TRS A;  5HFK A;  3TRQ A;  3BCI A;  3WYW A;  1TJD A;  4ZB9 A;  3TKS C;  4K6X A;  4GLT A;  2JAC A;  2GST A;  1URM A;  1HQO A;  3JCM L;  1XW6 A;  2P5R A;  4FYU A;  5G31 A;  3M3M A;  4KUN A;  1QQ2 A;  2I81 A;  2BMX A;  3G7J A;  5CRD A;  8GSS A;  2O89 A;  5ECR B;  1B4P A;  4GCI A;  3GTU B;  1Z7P A;  4KDU A;  4WF4 A;  4OD7 A;  1AAZ A;  3PR8 A;  3E0U A;  4G19 A;  5F06 A;  6GSV A;  4NHZ A;  1THO A;  5CRH A;  1SEN A;  2WZ9 A;  3N5O A;  4ZXG A;  1OC9 A;  1PRX A;  1Z7R A;  2R2J A;  3LWA A;  4MLY A;  3APQ A;  1T00 A;  3GST A;  3TUE A;  2M80 A;  1SL1 B;  2C3Q A;  1JZR A;  5IOW A;  4H86 A;  5DJM A;  2CVD A;  5HR2 A;  5IPG A;  4QQ7 A;  1ZCP A;  5DAK A;  4YAP A;  3MDK A;  5AIX A;  1A2M A;  1X9M B;  3FZ9 A;  5JWO B;  3FKF A;  1PQN A;  4CHS A;  2YWO A;  1G7E A;  3A5W A;  1XVQ A;  1BX9 A;  1ACV A;  3FY7 A;  3CYN A;  2VL9 A;  1B9X C;  3I9V 2;  4KA0 A;  1FB6 A;  3IR4 A;  4FH8 A;  2GLR A;  3RPN A;  4IJ3 A;  4IJI A;  3HCZ A;  1GTB A;  3Q74 A;  3RAZ A;  5LCZ A;  2LJK A;  4RI7 A;  4N11 A;  3TOU A;  3RDW A;  4TRX A;  1O8W A;  3GUS A;  3ERG A;  2WFC A;  3VWW A;  4TVE A;  4LL4 B;  4DSS A;  5ECK B;  4KX4 A;  1FOV A;  2QKE A;  1BQ7 A;  3LXZ A;  2XPD A;  2OA7 A;  1SL2 B;  4HUA A;  3US3 A;  2C3N A;  2DIY A;  3UBL A;  1K0O A;  1O73 A;  4PUF C;  1GH2 A;  4AJ6 A;  4O32 A;  1SJ6 A;  2EIQ A;  1ABA A;  2MMA A;  2JSZ A;  1KTE A;  3BOA A;  5G1K A;  4BWS A;  4G2E A;  2HXK A;  1FB0 A;  3QR6 A;  4JBB A;  1PKW A;  2L5L A;  3E9J B;  4TXV A;  1H4O A;  1SKR B;  4RI6 A;  5KEJ A;  5DDL A;  5ID2 B;  4K7O A;  4BWQ A;  6GSX A;  3LYP A;  1I5G A;  3BJ5 A;  1HD2 A;  3WT2 A;  5F8B A;  4J57 E;  2LNS A;  2O7K A;  3D21 A;  4FIW A;  2L4C A;  3F3R A;  1GNE A;  1UN2 A;  1V2A A;  1SU9 A;  3TDG A;  5KN3 A;  1M2D A;  4XIH A;  2OE0 A;  3F0I A;  2NPB A;  2A2R A;  2TRX A;  4Q5N A;  5JCU A;  4X0X A;  5HFG A;  4NMU A;  2KHP A;  5H5R A;  3GKX A;  5IMZ A;  2HRF A;  4PGT A;  4TKY A;  4POB A;  1N2A A;  3KMN A;  5C00 A;  3K8N A;  2HLS A;  3FEU A;  3GTU A;  3C73 A;  1S3C A;  2LRT A;  2I3Y A;  1GRX A;  3LQ7 A;  1LJR A;  1JZO A;  4P3Y B;  2QC7 A;  2P0G A;  4HI7 A;  3M8N A;  3FK8 A;  2YV9 A;  4EUY A;  1XFL A;  1GUM A;  2IJY A;  4EDY A;  4IN0 A;  1M2A A;  5J4U A;  2IWT A;  2G0F A;  4LL1 B;  1ZYQ B;  4IS0 A;  3GL3 A;  1TTZ A;  1F37 A;  1FHE A;  5COH A;  2CVB A;  4ZL9 A;  4TOP A;  4GST A;  2H1D A;  2MBS A;  2HE3 A;  5HQP A;  1BAY A;  1TDI A;  2VCW A;  4POK A;  1GWC A;  1V57 A;  3HVV A;  2VL2 A;  3RPP A;  4PQH A;  1SD8 A;  2V6O A;  5KN2 A;  2KP2 A;  2GTU A;  2E2G A;  1TXX A;  5AIV A;  2LQQ A;  1MDI A;  2FWE A;  3W6G A;  2HI7 A;  2PN8 A;  4MDC A;  1FO5 A;  4F82 A;  3F6D A;  4RQR A;  1JZW A;  1Z3E A;  4Q5Q A;  5HR1 A;  5B8A A;  3TKP A;  3ME7 A;  3UVH A;  5B8B A;  2B6M A;  3D0Z A;  3VI5 A;  1QGV A;  2ON5 A;  3N9J A;  6GSS A;  3LYK A;  3TCO A;  3TJJ A;  3EYT A;  5EPF A;  4MCU A;  2H6Z A;  3QOU A;  3DVW A;  4OWY A;  5D9W A;  1K0C A;  1MTC A;  2VO4 A;  3DD3 A;  2FLS A;  3FR9 A;  3NZN A;  1Z9H A;  1ZOF A;  3EIN A;  3IAM 2;  1UA5 A;  2N5B A;  2F8F A;  3L9U A;  4QL7 A;  3DIE A;  3A2V A;  1FG4 A;  1AW9 A;  1R26 A;  1BG5 A;  1H75 A;  2GQM A;  4XS4 B;  1K0B A;  3UAR A;  4EO3 A;  4TR1 B;  4CDO A;  2H1G A;  2FHE A;  1R5P A;  2MZC A;  2OE3 A;  3F3Q A;  3GX8 A;  4JU5 A;  3ED3 A;  4WKW A;  3HYP A;  1AXD A;  1TRU A;  3KJY A;  4PX1 A;  1YY7 A;  1MD4 A;  5B7C A;  3EVI A;  5CP1 A;  5LD0 A;  4WF5 A;  2FNO A;  5G5F A;  2GSQ A;  5ECL B;  5IMA A;  3C1S A;  2K18 A;  2L6C A;  4IBP A;  5ID2 A;  3TRX A;  3QAW A;  1TI3 A;  3LJR A;  2OJL A;  3P7X A;  1KBN A;  4MMM A;  1KNG A;  4XRD A;  4X43 A;  2OBK A;  2EIR A;  5ECH B;  2VLU A;  3IV4 A;  4ECI A;  2HNL A;  2R4V A;  4EXJ A;  2L5O A;  2XBQ A;  1XWG A;  2H71 A;  3TJG A;  1EP8 A;  1K3Y A;  1DBY A;  2XPE A;  3TKS A;  4ULX A;  3VFI A;  2PBJ A;  2VOC A;  1T4Z A;  1VF1 A;  1XZO A;  4MH3 A;  5GSS A;  3F4R A;  2YP6 A;  3HZ8 A;  2B5Y A;  3GL5 A;  3TGZ A;  1T7P B;  1XBS A;  1JLW A;  5CAX A;  1GSS A;  4KCE A;  4JE1 A;  4PQI A;  2YWM A;  1TU8 A;  3EWL A;  2VAF A;  3QCP A;  2GSR A;  1O6J A;  5HR0 A;  4EDZ A;  4IVF A;  2C1Y A;  1IYI A;  5JWQ B;  3H93 A;  3TOT A;  1XPV A;  5D9V A;  5GAN D;  2C0F A;  4K1F A;  4O7H A;  2DML A;  4F9Z A;  5IOX A;  5G5E A;  1EEM A;  1EP7 A;  2H0H A;  3G9B A;  2CAI A;  1GL8 A;  2LTK A;  2REM A;  2DC5 A;  2RM6 A;  1SYX A;  4ZL8 A;  1THX A;  2R3X A;  4L8E A;  1ML6 A;  1OAZ A;  4EVM A;  1AUC A;  2I9H A;  1XW5 A;  1ERW A;  2YCD A;  2BTO T;  3GA4 A;  2YN1 A;  1Z6N A;  1B4Q A;  3IPZ A;  3FRC A;  4X1U A;  4YAV A;  4E8E A;  2V2G A;  4DSR A;  1PN9 A;  2H73 A;  4HOJ A;  2HT9 A;  4BVY A;  4K7N A;  1K0M A;  4WBJ A;  5DAL B;  2VCV A;  4MP4 A;  1A23 A;  2WCI A;  3CBU A;  3ZIJ A;  3GYK A;  2C4J A;  5DBQ A;  3TKR A;  4TR0 A;  1YJ6 A;  4LLR A;  3EE2 A;  1ZZY A;  1M9A A;  2DLX A;  2WJU A;  2X99 A;  4AF2 A;  1M2B A;  2JU5 A;  2X8G A;  3KTL A;  1GP1 A;  1RK4 A;  2I4A A;  3GKN A;  1XWA A;  4XCS A;  4HQS A;  4ECB A;  1TOF A;  4V2M A;  4WXT A;  5INY A;  2XC2 A;  3ERF A;  4NPB A;  2E7P A;  3O3T A;  4XS4 A;  1M99 A;  2H19 A;  3M9J A;  4OFN A;  3SBC A;  4TR1 A;  2GZP A;  2YWN A;  3QFB C;  3OR5 A;  3GKK A;  3V1W A;  1F6M C;  3PIN A;  1WIK A;  4IP1 A;  5ECN B;  4KH7 A;  4TXO B;  2YAN A;  5KN0 A;  3S9F A;  2VUP A;  1Y25 A;  1A0R P;  2AAW A;  2H70 A;  3UL3 A;  1JHB A;  5G2Z A;  1PMT A;  2ALB A;  5IMD A;  3FZ4 A;  4KW6 A;  2WDU A;  1YZX A;  4OCE A;  2OKA A;  3H8Q A;  2WGR A;  1XOA A;  3CXG A;  1Y6E A;  1XOB A;  3L78 A;  1HYU A;  3ME8 A;  4NXI A;  2VLV A;  1QXH A;  4Q5F A;  2CV4 A;  5ENU A;  3GMF A;  3GSS A;  3GKM A;  4ZL7 A;  2VL3 A;  1AQV A;  2AHE A;  3DVX A;  3KP8 A;  4YQV A;  3HVS A;  1U3A A;  4K0G A;  2PUK C;  2D2Z A;  3I43 A;  2VCZ A;  2J9H A;  4EF0 A;  3U6V A;  1KEB A;  1A8Y A;  5J3R A;  1YF0 A;  1WJK A;  2GQK A;  4KGI A;  1OYJ A;  1USB A;  1NM3 A;  1PGT A;  2DJ1 A;  2L59 A;  4F0B A;  2H75 A;  3KEB A;  1EGO A;  1GSE A;  2PPT A;  3F4S A;  1WPI A;  2JAD A;  4I2T A;  1LBK A;  5IPH A;  5ABR A;  4MF7 A;  4EKZ A;  19GS A;  3ZMK A;  2MMZ A;  5ELA A;  1O8X A;  3ZIT A;  1HNC A;  2LKU A;  4EC0 A;  4JR6 A;  3D6I A;  3KP9 A;  2C0G A;  1S3D A;  3FZ5 A;  4L5O A;  1GLQ A;  3D4M A;  2NBS A;  2CZ2 A;  3Q6O A;  1ZYE A;  4FYC A;  1LU4 A;  2GQL A;  5J9B A;  5FHI A;  4JR4 A;  1K3O A;  4IW9 A;  1A2J A;  1XWC A;  1O7U A;  1U88 A;  1TK5 B;  1TRV A;  3Q18 A;  2O87 A;  3UEM A;  5D8I A;  1RQM A;  5J41 A;  5IMC A;  1DSB A;  3LG6 A;  3A3T A;  4BPY A;  2VD0 A;  2YJH A;  1ERT A;  2F9S A;  3PGT A;  3KZQ A;  5GST A;  2LEG A;  5E59 A;  2O8V B;  2R6K A;  3VI7 A;  5HR3 A;  3ERW A;  1R5A A;  2WUL A;  2DIZ A;  1F2E A;  4GRF A;  3L0H A;  1HNB A;  1PX7 A;  1G6Y A;  2IME A;  1M7T A;  3W8S A;  4MH2 A;  3GNJ A;  1OVN A;  3LXT A;  4GF0 A;  1FVK A;  1U87 A;  1QMV A;  4NV2 A;  5DAL A;  2WRT A;  1GLP A;  1GSD A;  4WEY A;  1ZMA A;  3C8E A;  4MPF A;  10GS A;  1T1V A;  2A2S A;  4K7I A;  3DWV A;  4HZ2 A;  3RBT A;  2C0D A;  3SWL A;  1GSF A;  2H6Y A;  5D73 A;  1XWK A;  1XIY A;  3UAP A;  1DE1 A;  5CRW A;  4GXZ A;  2PWJ A;  3GV1 A;  4G10 A;  3IK9 A;  4EL1 A;  2KP1 A;  3EU4 A;  5EVO A;  1ST9 A;  3UBK A;  2DMM A;  1VF2 A;  1K0D A;  5DCH A;  4J56 E;  1PKZ A;  1QFN A;  3GFK A;  1XVW A;  2A4V A;  4BA7 A;  3ZFB A;  2J23 A;  4XS1 A;  2N5A A;  3VPQ A;  2AYT A;  2YOI A;  4MA9 A;  2ZNM A;  3WT1 A;  3HY2 A;  4KCA A;  3FZA A;  1WMJ A;  5CO3 A;  3DKS A;  2B7J A;  4GQF A;  4I8B A;  2FY6 A;  1NHY A;  4KB3 A;  3ISO A;  3QDN A;  2M72 A;  2HYX A;  4TXO A;  3J7Y b;  2LRN A;  2CX4 A;  2VD1 A;  4WBR D;  1TI1 A;  1Q4J A;  2LNT A;  2FD3 A;  2V41 A;  18GS A;  2K8V A;  1FW1 A;  2CZ3 A;  1NHO A;  3EUR A;  3IOS A;  2JZT A;  2X64 A;  1E2Y A;  3ZYW A;  4GQC A;  4KSO A;  2R37 A;  1A24 A;  2P31 A;  3I69 A;  5E4W A;  3FW2 A;  3LFL A;  3MAK A;  2NDO A;  22GS A;  4ML1 A;  3HZ4 A;  4ECC A;  4KDY A;  2N5F A;  3I6A A;  3IBH A;  2IMI A;  4O92 A;  2AV4 A;  3LSZ A;  4IEL A;  3ZRE A;  4MJC A;  2CX3 A;  3TRP A;  1PSQ A;  3ZFL A;  1MDK A;  2LJA A;  2PER A;  3F4T A;  3GHA A;  5D9X A;  4IKH A;  3ZML A;  4ZIJ A;  1EZK A; 
#chains in the Genus database with same CATH topology
 2FWH A;  2X8C A;  5DVB A;  4ZBB A;  1F9M A;  1ZGN A;  1J08 A;  1R7H A;  4I2U A;  5FWG A;  1K0A A;  1B9Y C;  3TJF A;  4K5R A;  3KTB A;  4ACS A;  3KXO A;  3F63 A;  1X5C A;  5B6M A;  1YKA A;  3QD9 A;  2PGT A;  2FCH A;  4F2I A;  7GSS A;  5CNW A;  4ZIL A;  3HKR A;  3H4K A;  1YF1 A;  3UMA A;  4WR4 A;  16GS A;  2H72 A;  4O5Q A;  4L0W A;  3WGD A;  4I97 A;  4HJM A;  5CYY A;  3O76 A;  1T3B A;  3P90 A;  5H5Q A;  2GT6 A;  2HZE B;  5G1L A;  2X8H A;  2CVK A;  3ZTL A;  3UVT A;  3G7Y A;  1F3A A;  2YZU A;  5B6N A;  1J0F A;  2EC4 A;  2IPA A;  3MNG A;  5AN1 A;  5FT3 A;  2XHF A;  1X9W B;  5ECQ B;  3H79 A;  4XS6 A;  1AIU A;  3TJB A;  1JZD A;  1NW2 A;  2NVL A;  2F51 A;  3IHQ A;  1A0F A;  3CRT A;  4ICY A;  4MJE A;  4CY6 A;  1SK0 A;  1SK1 A;  2CAQ A;  4O5U A;  4NAX A;  2F8A A;  1OC8 A;  2GS3 A;  2FA4 A;  3VK9 A;  3F8U A;  4KDX A;  1W4V A;  1V58 A;  4AJ8 A;  4TR4 A;  2R5G A;  3FR3 A;  1V40 A;  1XW9 A;  2VCX A;  1AC1 A;  3DXB A;  2H8L A;  4X4J A;  1K3L A;  2DJ0 A;  4BVX A;  2EIO A;  3VWV A;  1Z6M A;  17GS A;  1S3A A;  5KN1 A;  2ZUP A;  2E0Q A;  3GH9 A;  3A2X A;  3L9V A;  2KOK A;  4IQA A;  1PA3 A;  2V1M A;  5EL8 A;  2VCT A;  5F0G A;  3KM6 A;  5JWR B;  2RUE A;  4V1A g;  3LW9 A;  5KOX A;  2BJX A;  1G7O A;  2FA8 A;  2LJR A;  5AIS A;  1VF3 A;  1BYE A;  1B8X A;  4GSN A;  2OBI A;  3HHV A;  1GNW A;  2QGV A;  5D9T A;  1SKS B;  2YV7 A;  1GUK A;  2C3T A;  5IO0 A;  1MEK A;  6GSW A;  4HDE A;  4YQU A;  2GDR A;  2OAD A;  2FWF A;  1O81 A;  1GSY A;  3NOF A;  4AGS A;  1UC7 A;  2CT6 A;  3FYG A;  2DSA A;  1SD9 A;  4GTU A;  3UJ1 A;  4IHU A;  1OE7 A;  1AQX A;  4POL A;  2ZCT A;  3NIV A;  2FGX A;  2LS5 A;  2G2Q A;  4HZ4 A;  3WGE A;  5DQS A;  4HU7 A;  4OMV A;  4ZBA A;  3EMP A;  4PUA A;  2QSI A;  4I5Q A;  4GSS A;  2M46 A;  3TB2 A;  2JZR A;  3G7I A;  4ID0 A;  3O6T A;  2TRC P;  3HJO A;  4KAE A;  3KIJ A;  1BED A;  2C8U A;  4GWR A;  4IGJ A;  4MJA A;  1TK0 B;  2K6V A;  4L5L A;  4J2F A;  2MYG A;  1F3B A;  2DJ2 A;  2IIY A;  3BBY A;  2PU9 C;  4IQ1 A;  4ISD A;  3P2A A;  4IP6 A;  1GTU A;  1O85 A;  4F03 A;  2AUV A;  2ON7 A;  5GZZ B;  2B7K A;  1SK2 A;  5D93 A;  1PL2 A;  4PNG A;  2B5E A;  5ECS A;  2L4Q A;  3M1G A;  2K9F A;  2PVQ A;  3GH6 A;  4LA1 A;  2IMD A;  2QA1 A;  2CA8 A;  4KE3 A;  2YPM A;  5IMV A;  2V6K A;  3MYD A;  5ECO B;  2B1K A;  1YEX A;  5F07 A;  2H0I A;  1NSW A;  3HD5 A;  5EY6 A;  5BMU A;  2KLX A;  4LMV A;  3U5R E;  4V2L A;  5H5S A;  2OAC A;  3UIW A;  2GSS A;  4PNF A;  4D73 B;  1XXU A;  3CTG A;  3ZVJ A;  3DEX A;  3HDC A;  1V9W A;  3IRA A;  2I1U A;  2E2M A;  4PXO A;  1VGL A;  1X0R A;  2VM1 A;  3IK7 A;  3M0F A;  2RUF A;  2IMF A;  3LOR A;  4MZC A;  4V1A p;  2HZE A;  3AY8 A;  4BL7 B;  1PL1 A;  1E6B A;  3MSZ A;  1TK8 B;  2LRC A;  4OFM A;  1R4W A;  3GN3 A;  5IQY A;  3TJK A;  3VPT A;  1ERU A;  5ECM B;  1X5E A;  4O5R A;  5DQY A;  5CRG A;  4N10 A;  1TW9 A;  1G6W A;  5IO2 A;  2MMN A;  1CQH A;  1G0T A;  4MF6 A;  2H66 A;  3DGQ A;  1M0U A;  1DUG A;  5A4W A;  3H1N A;  2IFQ B;  1XWB A;  2L6D A;  3VUR A;  1YQ1 A;  1SKW B;  4K8M A;  3IA1 A;  3A5I A;  2IN3 A;  4OO4 A;  1B48 A;  11GS A;  4YKF A;  2VIM A;  2H01 A;  2F3M A;  3HJM A;  1QK8 A;  2TIR A;  4KSM A;  6GST A;  3APO A;  5ELG A;  13GS A;  3DYR A;  1U6T A;  1JLV A;  4CW9 A;  1XCC A;  2DJ3 A;  3DRN A;  3LGC A;  2K8S A;  5A5K A;  3IAS 2;  3RHC A;  1X5D A;  3KH7 A;  4WR5 A;  1GUL A;  3KH9 A;  3CSJ A;  4XTS A;  5JCG A;  2DBC A;  4ZB6 A;  1EV4 A;  1YEP A;  4Z7X A;  3C1R A;  1T4Y A;  1YDK A;  5D96 A;  1FAA A;  3R2Q A;  5AGY A;  4PQ1 A;  4ML6 A;  3VWX A;  3HXS A;  4N30 A;  3P8W A;  2JSY A;  1OKT A;  4XHM A;  1WWJ A;  1OC3 A;  1X9S B;  1EOG A;  4TR3 A;  3QFA C;  5ECP B;  2H74 A;  3MWH A;  1W89 A;  4HS1 A;  2YZH A;  1C72 A;  2YJ7 A;  1GUH A;  2B3S A;  4V2N A;  3Q19 A;  5L71 A;  4MZW A;  3IXR A;  4F0C A;  5LNK e;  2H76 A;  4LMW A;  2MMO A;  5HFI A;  4I6X A;  1SL0 B;  4K9Z A;  3GRX A;  2GZZ A;  1YKC A;  1VRS D;  4MK3 A;  2VLT A;  3CSI A;  4YQM A;  3BD2 A;  3GIX A;  1U3I A;  4QL9 A;  4HEA 2;  2H6X A;  6GSU A;  4DVC A;  5IIZ A;  4MZB A;  3C71 A;  3WD6 A;  1ZL9 A;  2RLI A;  1Q98 A;  2LV3 A;  1EWX A;  1GTA A;  3D22 A;  4OO5 A;  1GSU A;  6GSY A;  2H1A A;  3ZRD A;  3ZVJ D;  1DE2 A;  5DCG A;  4KND A;  4RUV A;  4DSQ A;  3TKQ A;  2WB9 A;  4AJ7 A;  4MF5 A;  1RW1 A;  3HJP A;  1A2L A;  2IMK A;  5IM9 A;  3F9U A;  2XBI A;  4EIQ A;  2HSH A;  5A4U A;  3CRU A;  1EV9 A;  3GUR A;  1HNA A;  2DJJ A;  3APS A;  3L4N A;  2LST A;  4JZQ A;  1K0N A;  1EGR A;  1WOU A;  2O85 A;  2PVO C;  3IE3 A;  4HU9 A;  1VF4 A;  1GSQ A;  3A2W A;  5DJL A;  2PMT A;  4D73 A;  1MD3 A;  3QAV A;  1ERV A;  1SYR A;  2IL3 A;  1FVJ A;  4CY8 A;  1AQW A;  3QPM A;  2B1L A;  1OKD A;  1TKD B;  2KUC A;  3VLN A;  3PH9 A;  3QMX A;  2JL4 A;  4FYB A;  1I9D A;  4PUR A;  3E3E A;  3L9S A;  3CSH A;  2DJK A;  2P5Q A;  4K2X A;  2V32 A;  4BL7 A;  3KD0 A;  2GT5 A;  3EC3 A;  1EEJ A;  4L0U A;  5J5N A;  4FQU A;  3GX0 A;  3IC4 A;  3ZIV A;  1N8J A;  3D5J A;  4YH2 A;  3D4T A;  3LEF A;  1A8L A;  4WET A;  4HQZ A;  2AJQ B;  1OC9 B;  2H1B A;  3VWU A;  4ECJ A;  3M9K A;  1PFO A;  4NV5 A;  4JRR A;  4K5S A;  1QUW A;  3IHG A;  1SJZ A;  4NHW A;  2IFQ A;  1TP9 A;  2GVP A;  2VL2 C;  3DML A;  3F6F A;  2OE1 A;  4FO5 A;  3FMW A;  1EOH A;  5DAK B;  3TKS E;  2GGT A;  3FHK A;  1JFU A;  4HJ2 A;  3UOM A;  4MAB A;  2YNX A;  5ECI B;  1OE8 A;  1MDJ A;  2HSY A;  1M9B A;  1PD2 1;  4TN8 A;  1WP0 A;  2L57 A;  4ZB8 A;  1T8E B;  4E8H A;  2LUS A;  3J7Y k;  1WE0 A;  4NWY A;  4ZBD A;  3ZLP A;  2HRA A;  3EMX A;  3IDV A;  2VM2 A;  3CMI A;  4OFT A;  4XRA A;  4MPG A;  2LQO A;  9GSS A;  2C0E A;  4N0Z A;  1IYH A;  1J9B A;  1Z5Y E;  2H0G A;  1PX6 A;  1V98 A;  4A5P A;  3KGK A;  2CQ9 A;  2MBT A;  2RM5 A;  5JCW A;  2JZS A;  4G0I A;  1BJX A;  4G9H A;  3EU3 A;  14GS A;  2Z9S A;  5KOW A;  2YWI A;  4TW5 A;  3KCM A;  2FUG 2;  5A4V A;  3CTF A;  4DSS B;  3HA9 A;  4ILF A;  3QAG A;  2VCQ A;  2AB6 A;  2C80 A;  4POM A;  3FR6 A;  2RII A;  1UVZ A;  4G0L A;  2DKI A;  5F05 A;  4JED A;  2H30 A;  4RQX A;  2HFD A;  2GZY A;  3ZL5 A;  3HVX A;  2B5X A;  4Q5R A;  2UZ8 A;  12GS A;  3C7M A;  20GS A;  1SJI A;  2QA2 A;  1ILO A;  4MJB A;  4DEJ A;  2WS2 A;  1TU7 A;  2HRN A;  5C04 A;  4K2D A;  3KMO A;  4OCF A;  5IMF A;  2HZF A;  5GAP D;  2ES7 A;  5CRE A;  1WRY A;  4K0N A;  1GTI A;  3RHB A;  4EE0 A;  4N0V A;  5G30 A;  3W8J A;  1ON4 A;  1M3I A;  5J9C A;  3ZZX A;  1TRW A;  2FWG A;  1CQG A;  3WGX A;  2NTO A;  3BCK A;  1TRS A;  5HFK A;  3TRQ A;  3BCI A;  3WYW A;  1TJD A;  4ZB9 A;  3TKS C;  4K6X A;  4GLT A;  2JAC A;  2GST A;  1URM A;  1HQO A;  3JCM L;  1XW6 A;  2P5R A;  4FYU A;  5G31 A;  3M3M A;  4KUN A;  1QQ2 A;  3CQF A;  2I81 A;  2BMX A;  3G7J A;  5CRD A;  4KF9 A;  8GSS A;  2O89 A;  5ECR B;  1B4P A;  4GCI A;  3GTU B;  1Z7P A;  4KDU A;  4WF4 A;  4OD7 A;  1AAZ A;  3PR8 A;  3E0U A;  4G19 A;  5F06 A;  6GSV A;  4NHZ A;  1THO A;  5CRH A;  1S3R A;  1SEN A;  2WZ9 A;  3N5O A;  4ZXG A;  1OC9 A;  1PRX A;  1Z7R A;  2R2J A;  3LWA A;  4MLY A;  3APQ A;  1T00 A;  3GST A;  3TUE A;  2M80 A;  1SL1 B;  2C3Q A;  1JZR A;  5IOW A;  4H86 A;  5DJM A;  2CVD A;  5HR2 A;  5IPG A;  4QQ7 A;  1ZCP A;  5DAK A;  4YAP A;  3MDK A;  5AIX A;  1A2M A;  1X9M B;  3FZ9 A;  5JWO B;  3FKF A;  1PQN A;  4CHS A;  2YWO A;  1G7E A;  3A5W A;  1XVQ A;  1BX9 A;  1ACV A;  3FY7 A;  3CYN A;  2VL9 A;  1B9X C;  3I9V 2;  4KA0 A;  1FB6 A;  3IR4 A;  4FH8 A;  2GLR A;  3RPN A;  4IJ3 A;  4IJI A;  3HCZ A;  4PTS A;  1GTB A;  3Q74 A;  3RAZ A;  5LCZ A;  3R3E A;  2LJK A;  4RI7 A;  4N11 A;  3TOU A;  3RDW A;  4YKG A;  4TRX A;  1O8W A;  3GUS A;  3ERG A;  5BRT A;  2WFC A;  3VWW A;  4TVE A;  1PN0 A;  4LL4 B;  4DSS A;  5ECK B;  4KX4 A;  1FOV A;  2QKE A;  1BQ7 A;  3LXZ A;  2XPD A;  2OA7 A;  1SL2 B;  4HUA A;  3US3 A;  2C3N A;  2DIY A;  3UBL A;  1K0O A;  1O73 A;  4PUF C;  1GH2 A;  4AJ6 A;  4O32 A;  1SJ6 A;  2EIQ A;  1ABA A;  2MMA A;  2JSZ A;  1KTE A;  3BOA A;  5G1K A;  4BWS A;  4G2E A;  2HXK A;  1FB0 A;  3QR6 A;  4JBB A;  1PKW A;  2L5L A;  3E9J B;  4TXV A;  1H4O A;  1SKR B;  4RI6 A;  5KEJ A;  5DDL A;  5ID2 B;  4K7O A;  4BWQ A;  6GSX A;  1FOH A;  3LYP A;  1I5G A;  3BJ5 A;  1HD2 A;  3WT2 A;  5F8B A;  4J57 E;  2LNS A;  2O7K A;  3D21 A;  4FIW A;  2L4C A;  3F3R A;  1GNE A;  1UN2 A;  1V2A A;  1SU9 A;  3TDG A;  5KN3 A;  1M2D A;  4XIH A;  2OE0 A;  3F0I A;  2NPB A;  2A2R A;  1M3J A;  2TRX A;  4Q5N A;  5JCU A;  4X0X A;  5HFG A;  4NMU A;  2KHP A;  5H5R A;  3GKX A;  5IMZ A;  2HRF A;  4PGT A;  4TKY A;  4POB A;  1N2A A;  3KMN A;  5C00 A;  3K8N A;  2HLS A;  3FEU A;  3GTU A;  3C73 A;  4HSC X;  1S3C A;  2LRT A;  2I3Y A;  1GRX A;  3LQ7 A;  1LJR A;  4Z2T A;  1JZO A;  4P3Y B;  2QC7 A;  2P0G A;  4HI7 A;  3M8N A;  3FK8 A;  2YV9 A;  2DKH A;  4EUY A;  1XFL A;  1GUM A;  2IJY A;  4EDY A;  4IN0 A;  1M2A A;  5J4U A;  2IWT A;  2G0F A;  4LL1 B;  1ZYQ B;  4IS0 A;  3GL3 A;  1TTZ A;  1F37 A;  1FHE A;  5COH A;  2CVB A;  4ZL9 A;  4TOP A;  4Z2U A;  4GST A;  2H1D A;  2MBS A;  2HE3 A;  5HQP A;  1BAY A;  1TDI A;  3IC8 A;  2VCW A;  4POK A;  1GWC A;  1V57 A;  3HVV A;  2VL2 A;  3RPP A;  4PQH A;  1SD8 A;  2V6O A;  5KN2 A;  2KP2 A;  2GTU A;  2E2G A;  1TXX A;  5AIV A;  2LQQ A;  1MDI A;  2FWE A;  3W6G A;  2HI7 A;  2PN8 A;  4MDC A;  1FO5 A;  4F82 A;  3F6D A;  4RQR A;  4BVY B;  1JZW A;  1Z3E A;  4Q5Q A;  5HR1 A;  5B8A A;  3TKP A;  3ME7 A;  3UVH A;  5B8B A;  2B6M A;  3D0Z A;  3VI5 A;  1QGV A;  2ON5 A;  3N9J A;  6GSS A;  3LYK A;  3TCO A;  3TJJ A;  3EYT A;  5EPF A;  4MCU A;  2H6Z A;  3QOU A;  3DVW A;  4OWY A;  5D9W A;  1K0C A;  1MTC A;  2VO4 A;  3DD3 A;  2FLS A;  3FR9 A;  3NZN A;  1Z9H A;  1ZOF A;  3EIN A;  2X49 A;  3IAM 2;  1UA5 A;  2N5B A;  2F8F A;  3L9U A;  4QL7 A;  3DIE A;  3A2V A;  1FG4 A;  1AW9 A;  1R26 A;  1BG5 A;  1H75 A;  2GQM A;  4XS4 B;  1K0B A;  3UAR A;  4EO3 A;  4TR1 B;  4CDO A;  2H1G A;  2FHE A;  1R5P A;  2MZC A;  2OE3 A;  3F3Q A;  3GX8 A;  4JU5 A;  3ED3 A;  4WKW A;  3HYP A;  1AXD A;  1TRU A;  3KJY A;  4PX1 A;  1YY7 A;  1MD4 A;  5B7C A;  3EVI A;  5CP1 A;  5LD0 A;  4WF5 A;  2FNO A;  5G5F A;  2GSQ A;  5ECL B;  5IMA A;  3C1S A;  2K18 A;  2L6C A;  4IBP A;  5ID2 A;  3TRX A;  3QAW A;  1TI3 A;  3LJR A;  2OJL A;  3P7X A;  1KBN A;  4MMM A;  1KNG A;  4XRD A;  4X43 A;  2OBK A;  2EIR A;  5ECH B;  2VLU A;  3IV4 A;  4ECI A;  2HNL A;  2R4V A;  4EXJ A;  2L5O A;  2XBQ A;  1XWG A;  2H71 A;  3TJG A;  4Z2R A;  1EP8 A;  1K3Y A;  1DBY A;  2XPE A;  3TKS A;  4ULX A;  3VFI A;  2PBJ A;  2VOC A;  1T4Z A;  1VF1 A;  1XZO A;  4MH3 A;  5GSS A;  3F4R A;  2YP6 A;  3HZ8 A;  2B5Y A;  3GL5 A;  3TGZ A;  1T7P B;  1XBS A;  1JLW A;  5CAX A;  4BIK A;  1GSS A;  4KCE A;  4JE1 A;  4PQI A;  2YWM A;  1TU8 A;  3EWL A;  2VAF A;  3QCP A;  2GSR A;  1O6J A;  5HR0 A;  4EDZ A;  4IVF A;  2C1Y A;  1IYI A;  5JWQ B;  3H93 A;  3TOT A;  1XPV A;  5D9V A;  5GAN D;  2C0F A;  4K1F A;  4O7H A;  2DML A;  4F9Z A;  5IOX A;  5G5E A;  1EEM A;  1EP7 A;  2H0H A;  3G9B A;  2CAI A;  1GL8 A;  4USS A;  2LTK A;  2REM A;  2DC5 A;  2RM6 A;  1SYX A;  4ZL8 A;  1THX A;  2R3X A;  4L8E A;  1ML6 A;  1OAZ A;  4EVM A;  1AUC A;  1ZYN A;  2I9H A;  1XW5 A;  1ERW A;  2YCD A;  2BTO T;  3GA4 A;  2YN1 A;  1Z6N A;  1B4Q A;  3IPZ A;  3FRC A;  4X1U A;  4YAV A;  4E8E A;  2V2G A;  4DSR A;  1PN9 A;  2H73 A;  4HOJ A;  2HT9 A;  4BVY A;  4K7N A;  1K0M A;  4WBJ A;  5DAL B;  2VCV A;  3MIX A;  4MP4 A;  1A23 A;  2WCI A;  3CBU A;  3ZIJ A;  3GYK A;  2C4J A;  2R0G A;  5DBQ A;  3TKR A;  4TR0 A;  3PPU A;  1YJ6 A;  4LLR A;  3EE2 A;  1ZZY A;  1M9A A;  2DLX A;  2WJU A;  2X99 A;  3EPT A;  4AF2 A;  1M2B A;  2JU5 A;  2X8G A;  3KTL A;  1GP1 A;  1RK4 A;  2I4A A;  3GKN A;  1XWA A;  4XCS A;  4HQS A;  4ECB A;  1TOF A;  4V2M A;  4WXT A;  5INY A;  2XC2 A;  3ERF A;  4NPB A;  2E7P A;  3O3T A;  4XS4 A;  1M99 A;  4MNN A;  2H19 A;  3M9J A;  4OFN A;  3SBC A;  4TR1 A;  2GZP A;  2YWN A;  3QFB C;  3OR5 A;  3GKK A;  3V1W A;  1F6M C;  3PIN A;  1WIK A;  4IP1 A;  5ECN B;  4KH7 A;  4TXO B;  2YAN A;  5KN0 A;  3S9F A;  2VUP A;  1Y25 A;  1A0R P;  2AAW A;  2H70 A;  3UL3 A;  1JHB A;  5G2Z A;  1PMT A;  2ALB A;  2A4H A;  5IMD A;  3FZ4 A;  4KW6 A;  3HVN A;  2WDU A;  1YZX A;  4OCE A;  2OKA A;  3H8Q A;  2WGR A;  2HSM A;  1XOA A;  3CXG A;  1Y6E A;  1XOB A;  3L78 A;  1HYU A;  3ME8 A;  4NXI A;  2VLV A;  1QXH A;  4Q5F A;  2CV4 A;  5ENU A;  3GMF A;  3GSS A;  3GKM A;  4ZL7 A;  2VL3 A;  1AQV A;  2AHE A;  3DVX A;  3KP8 A;  4YQV A;  3HVS A;  1U3A A;  4K0G A;  2PUK C;  2D2Z A;  3I43 A;  1XG8 A;  2J9H A;  2VCZ A;  3U6V A;  4EF0 A;  1KEB A;  1A8Y A;  5J3R A;  1YF0 A;  1WJK A;  2GQK A;  4KGI A;  1OYJ A;  1USB A;  1NM3 A;  1PGT A;  2DJ1 A;  2L59 A;  4F0B A;  2H75 A;  3KEB A;  1EGO A;  1GSE A;  2PPT A;  3F4S A;  1WPI A;  2JAD A;  4I2T A;  1LBK A;  5IPH A;  5ABR A;  4MF7 A;  4EKZ A;  2R0P A;  19GS A;  3ZMK A;  2MMZ A;  5ELA A;  1O8X A;  3ZIT A;  1HNC A;  2LKU A;  4EC0 A;  4JR6 A;  3D6I A;  3KP9 A;  2C0G A;  1S3D A;  3FZ5 A;  4L5O A;  1GLQ A;  3D4M A;  2NBS A;  2CZ2 A;  3Q6O A;  1ZYE A;  4FYC A;  1LU4 A;  2GQL A;  5J9B A;  5FHI A;  4JR4 A;  1K3O A;  4IW9 A;  1A2J A;  1XWC A;  2A2P A;  1O7U A;  1U88 A;  1TK5 B;  1TRV A;  3Q18 A;  2O87 A;  3UEM A;  5D8I A;  1RQM A;  5J41 A;  5IMC A;  1DSB A;  3LG6 A;  3A3T A;  4BPY A;  2VD0 A;  2YJH A;  1ERT A;  2F9S A;  3PGT A;  3KZQ A;  5GST A;  2LEG A;  5E59 A;  2X4A A;  2O8V B;  2R6K A;  3VI7 A;  4EIP A;  5HR3 A;  3ERW A;  1R5A A;  2WUL A;  2DIZ A;  1F2E A;  4GRF A;  3L0H A;  1HNB A;  1PX7 A;  1G6Y A;  2IME A;  1M7T A;  3W8S A;  4MH2 A;  3GNJ A;  1OVN A;  3LXT A;  4GF0 A;  1FVK A;  1U87 A;  1QMV A;  4NV2 A;  5DAL A;  2WRT A;  1GLP A;  1GSD A;  2HRK A;  4WEY A;  1ZMA A;  3C8E A;  4MPF A;  10GS A;  1T1V A;  2A2S A;  4K7I A;  3DWV A;  4HZ2 A;  3RBT A;  2C0D A;  3SWL A;  1GSF A;  2H6Y A;  5D73 A;  1XWK A;  1XIY A;  3UAP A;  1DE1 A;  5CRW A;  4GXZ A;  2PWJ A;  3GV1 A;  4G10 A;  3IK9 A;  4EL1 A;  2KP1 A;  3EU4 A;  5EVO A;  1ST9 A;  3UBK A;  2DMM A;  1VF2 A;  1K0D A;  5DCH A;  4J56 E;  1PKZ A;  1QFN A;  4BVX B;  3GFK A;  1XVW A;  2A4V A;  4BA7 A;  3ZFB A;  2J23 A;  4XS1 A;  2N5A A;  3VPQ A;  2AYT A;  2YOI A;  4MA9 A;  2ZNM A;  3WT1 A;  3HY2 A;  4KCA A;  3FZA A;  1WMJ A;  5CO3 A;  3DKS A;  2B7J A;  4GQF A;  4I8B A;  2FY6 A;  1NHY A;  4KB3 A;  3ISO A;  3QDN A;  2M72 A;  2HYX A;  4TXO A;  3J7Y b;  2LRN A;  2CX4 A;  2VD1 A;  4WBR D;  1TI1 A;  1Q4J A;  2LNT A;  2FD3 A;  2V41 A;  18GS A;  2K8V A;  1FW1 A;  2CZ3 A;  1NHO A;  3EUR A;  3IOS A;  2JZT A;  2X64 A;  1E2Y A;  3ZYW A;  4GQC A;  4KSO A;  2R37 A;  1A24 A;  2P31 A;  3I69 A;  5E4W A;  3FW2 A;  3LFL A;  3MAK A;  2NDO A;  22GS A;  4ML1 A;  4G0K A;  3HZ4 A;  4ECC A;  4KDY A;  1ZYP A;  2N5F A;  3I6A A;  3IBH A;  2IMI A;  4O92 A;  2AV4 A;  3LSZ A;  2R0C A;  4IEL A;  3ZRE A;  4MJC A;  2CX3 A;  3TRP A;  1PSQ A;  3ZFL A;  1MDK A;  2LJA A;  2PER A;  3F4T A;  3GHA A;  5D9X A;  4IKH A;  3ZML A;  4ZIJ A;  1EZK A; 
#chains in the Genus database with same CATH homology
 2FWH A;  2X8C A;  5DVB A;  4ZBB A;  1F9M A;  1ZGN A;  1J08 A;  1R7H A;  4I2U A;  5FWG A;  1K0A A;  1B9Y C;  3TJF A;  4K5R A;  3KTB A;  4ACS A;  3KXO A;  3F63 A;  1X5C A;  5B6M A;  1YKA A;  3QD9 A;  2PGT A;  2FCH A;  4F2I A;  7GSS A;  5CNW A;  4ZIL A;  3HKR A;  3H4K A;  1YF1 A;  3UMA A;  4WR4 A;  16GS A;  2H72 A;  4O5Q A;  4L0W A;  3WGD A;  4I97 A;  4HJM A;  5CYY A;  3O76 A;  1T3B A;  3P90 A;  5H5Q A;  2GT6 A;  2HZE B;  5G1L A;  2X8H A;  2CVK A;  3ZTL A;  3UVT A;  3G7Y A;  1F3A A;  2YZU A;  5B6N A;  1J0F A;  2EC4 A;  2IPA A;  3MNG A;  5AN1 A;  5FT3 A;  2XHF A;  1X9W B;  5ECQ B;  3H79 A;  4XS6 A;  1AIU A;  3TJB A;  1JZD A;  1NW2 A;  2NVL A;  2F51 A;  3IHQ A;  1A0F A;  3CRT A;  4ICY A;  4MJE A;  4CY6 A;  1SK0 A;  1SK1 A;  2CAQ A;  4O5U A;  4NAX A;  2F8A A;  1OC8 A;  2GS3 A;  2FA4 A;  3VK9 A;  3F8U A;  4KDX A;  1W4V A;  1V58 A;  4AJ8 A;  4TR4 A;  2R5G A;  3FR3 A;  1V40 A;  1XW9 A;  2VCX A;  1AC1 A;  3DXB A;  2H8L A;  4X4J A;  1K3L A;  2DJ0 A;  4BVX A;  2EIO A;  3VWV A;  1Z6M A;  17GS A;  1S3A A;  5KN1 A;  2ZUP A;  2E0Q A;  3GH9 A;  3A2X A;  3L9V A;  2KOK A;  4IQA A;  1PA3 A;  2V1M A;  5EL8 A;  2VCT A;  5F0G A;  3KM6 A;  5JWR B;  2RUE A;  4V1A g;  3LW9 A;  5KOX A;  2BJX A;  1G7O A;  2FA8 A;  2LJR A;  5AIS A;  1VF3 A;  1BYE A;  1B8X A;  4GSN A;  2OBI A;  3HHV A;  1GNW A;  2QGV A;  5D9T A;  1SKS B;  2YV7 A;  1GUK A;  2C3T A;  5IO0 A;  1MEK A;  6GSW A;  4HDE A;  4YQU A;  2GDR A;  2OAD A;  2FWF A;  1O81 A;  1GSY A;  3NOF A;  4AGS A;  1UC7 A;  2CT6 A;  3FYG A;  2DSA A;  1SD9 A;  4GTU A;  3UJ1 A;  4IHU A;  1OE7 A;  1AQX A;  4POL A;  2ZCT A;  3NIV A;  2FGX A;  2LS5 A;  2G2Q A;  4HZ4 A;  3WGE A;  5DQS A;  4HU7 A;  4OMV A;  4ZBA A;  3EMP A;  4PUA A;  2QSI A;  4I5Q A;  4GSS A;  2M46 A;  3TB2 A;  2JZR A;  3G7I A;  4ID0 A;  3O6T A;  2TRC P;  3HJO A;  4KAE A;  3KIJ A;  1BED A;  2C8U A;  4GWR A;  4IGJ A;  4MJA A;  1TK0 B;  2K6V A;  4L5L A;  4J2F A;  2MYG A;  1F3B A;  2DJ2 A;  2IIY A;  3BBY A;  2PU9 C;  4IQ1 A;  4ISD A;  3P2A A;  4IP6 A;  1GTU A;  1O85 A;  4F03 A;  2AUV A;  2ON7 A;  5GZZ B;  2B7K A;  1SK2 A;  5D93 A;  1PL2 A;  4PNG A;  2B5E A;  5ECS A;  2L4Q A;  3M1G A;  2K9F A;  2PVQ A;  3GH6 A;  4LA1 A;  2IMD A;  2QA1 A;  2CA8 A;  4KE3 A;  2YPM A;  5IMV A;  2V6K A;  3MYD A;  5ECO B;  2B1K A;  1YEX A;  5F07 A;  2H0I A;  1NSW A;  3HD5 A;  5EY6 A;  5BMU A;  2KLX A;  4LMV A;  3U5R E;  4V2L A;  5H5S A;  2OAC A;  3UIW A;  2GSS A;  4PNF A;  4D73 B;  1XXU A;  3CTG A;  3ZVJ A;  3DEX A;  3HDC A;  1V9W A;  3IRA A;  2I1U A;  2E2M A;  4PXO A;  1VGL A;  1X0R A;  2VM1 A;  3IK7 A;  3M0F A;  2RUF A;  2IMF A;  3LOR A;  4MZC A;  4V1A p;  2HZE A;  3AY8 A;  4BL7 B;  1PL1 A;  1E6B A;  3MSZ A;  1TK8 B;  2LRC A;  4OFM A;  1R4W A;  3GN3 A;  5IQY A;  3TJK A;  3VPT A;  1ERU A;  5ECM B;  1X5E A;  4O5R A;  5DQY A;  5CRG A;  4N10 A;  1TW9 A;  1G6W A;  5IO2 A;  2MMN A;  1CQH A;  1G0T A;  4MF6 A;  2H66 A;  3DGQ A;  1M0U A;  1DUG A;  5A4W A;  3H1N A;  2IFQ B;  1XWB A;  2L6D A;  3VUR A;  1YQ1 A;  1SKW B;  4K8M A;  3IA1 A;  3A5I A;  2IN3 A;  4OO4 A;  1B48 A;  11GS A;  4YKF A;  2VIM A;  2H01 A;  2F3M A;  3HJM A;  1QK8 A;  2TIR A;  4KSM A;  6GST A;  3APO A;  5ELG A;  13GS A;  3DYR A;  1U6T A;  1JLV A;  4CW9 A;  1XCC A;  2DJ3 A;  3DRN A;  3LGC A;  2K8S A;  5A5K A;  3IAS 2;  3RHC A;  1X5D A;  3KH7 A;  4WR5 A;  1GUL A;  3KH9 A;  3CSJ A;  4XTS A;  5JCG A;  2DBC A;  4ZB6 A;  1EV4 A;  1YEP A;  4Z7X A;  3C1R A;  1T4Y A;  1YDK A;  5D96 A;  1FAA A;  3R2Q A;  5AGY A;  4PQ1 A;  4ML6 A;  3VWX A;  3HXS A;  4N30 A;  3P8W A;  2JSY A;  1OKT A;  4XHM A;  1WWJ A;  1OC3 A;  1X9S B;  1EOG A;  4TR3 A;  3QFA C;  5ECP B;  2H74 A;  3MWH A;  1W89 A;  4HS1 A;  2YZH A;  1C72 A;  2YJ7 A;  1GUH A;  2B3S A;  4V2N A;  3Q19 A;  5L71 A;  4MZW A;  3IXR A;  4F0C A;  5LNK e;  2H76 A;  4LMW A;  2MMO A;  5HFI A;  4I6X A;  1SL0 B;  4K9Z A;  3GRX A;  2GZZ A;  1YKC A;  1VRS D;  4MK3 A;  2VLT A;  3CSI A;  4YQM A;  3BD2 A;  3GIX A;  1U3I A;  4QL9 A;  4HEA 2;  2H6X A;  6GSU A;  4DVC A;  5IIZ A;  4MZB A;  3C71 A;  3WD6 A;  1ZL9 A;  2RLI A;  1Q98 A;  2LV3 A;  1EWX A;  1GTA A;  3D22 A;  4OO5 A;  1GSU A;  6GSY A;  2H1A A;  3ZRD A;  3ZVJ D;  1DE2 A;  5DCG A;  4KND A;  4RUV A;  4DSQ A;  3TKQ A;  2WB9 A;  4AJ7 A;  4MF5 A;  1RW1 A;  3HJP A;  1A2L A;  2IMK A;  5IM9 A;  3F9U A;  2XBI A;  4EIQ A;  2HSH A;  5A4U A;  3CRU A;  1EV9 A;  3GUR A;  1HNA A;  2DJJ A;  3APS A;  3L4N A;  2LST A;  4JZQ A;  1K0N A;  1EGR A;  1WOU A;  2O85 A;  2PVO C;  3IE3 A;  4HU9 A;  1VF4 A;  1GSQ A;  3A2W A;  5DJL A;  2PMT A;  4D73 A;  1MD3 A;  3QAV A;  1ERV A;  1SYR A;  2IL3 A;  1FVJ A;  4CY8 A;  1AQW A;  3QPM A;  2B1L A;  1OKD A;  1TKD B;  2KUC A;  3VLN A;  3PH9 A;  3QMX A;  2JL4 A;  4FYB A;  1I9D A;  4PUR A;  3E3E A;  3L9S A;  3CSH A;  2DJK A;  2P5Q A;  4K2X A;  2V32 A;  4BL7 A;  3KD0 A;  2GT5 A;  3EC3 A;  1EEJ A;  4L0U A;  5J5N A;  4FQU A;  3GX0 A;  3IC4 A;  3ZIV A;  1N8J A;  3D5J A;  4YH2 A;  3D4T A;  3LEF A;  1A8L A;  4WET A;  4HQZ A;  2AJQ B;  1OC9 B;  2H1B A;  3VWU A;  4ECJ A;  3M9K A;  4NV5 A;  4JRR A;  4K5S A;  1QUW A;  3IHG A;  1SJZ A;  4NHW A;  2IFQ A;  1TP9 A;  2GVP A;  2VL2 C;  3DML A;  3F6F A;  2OE1 A;  4FO5 A;  3FMW A;  1EOH A;  5DAK B;  3TKS E;  2GGT A;  3FHK A;  1JFU A;  4HJ2 A;  3UOM A;  4MAB A;  2YNX A;  5ECI B;  1OE8 A;  1MDJ A;  2HSY A;  1M9B A;  1PD2 1;  4TN8 A;  1WP0 A;  2L57 A;  4ZB8 A;  1T8E B;  4E8H A;  2LUS A;  3J7Y k;  1WE0 A;  4NWY A;  4ZBD A;  3ZLP A;  2HRA A;  3EMX A;  3IDV A;  2VM2 A;  3CMI A;  4OFT A;  4XRA A;  4MPG A;  2LQO A;  9GSS A;  2C0E A;  4N0Z A;  1IYH A;  1J9B A;  1Z5Y E;  2H0G A;  1PX6 A;  1V98 A;  4A5P A;  3KGK A;  2CQ9 A;  2MBT A;  2RM5 A;  5JCW A;  2JZS A;  4G0I A;  1BJX A;  4G9H A;  3EU3 A;  14GS A;  2Z9S A;  5KOW A;  2YWI A;  4TW5 A;  3KCM A;  2FUG 2;  5A4V A;  3CTF A;  4DSS B;  3HA9 A;  4ILF A;  3QAG A;  2VCQ A;  2AB6 A;  2C80 A;  4POM A;  3FR6 A;  2RII A;  1UVZ A;  4G0L A;  2DKI A;  5F05 A;  4JED A;  2H30 A;  4RQX A;  2HFD A;  2GZY A;  3ZL5 A;  3HVX A;  2B5X A;  4Q5R A;  2UZ8 A;  12GS A;  3C7M A;  20GS A;  1SJI A;  2QA2 A;  1ILO A;  4MJB A;  4DEJ A;  2WS2 A;  1TU7 A;  2HRN A;  5C04 A;  4K2D A;  3KMO A;  4OCF A;  5IMF A;  2HZF A;  5GAP D;  2ES7 A;  5CRE A;  1WRY A;  4K0N A;  1GTI A;  3RHB A;  4EE0 A;  4N0V A;  5G30 A;  3W8J A;  1ON4 A;  5J9C A;  3ZZX A;  1TRW A;  2FWG A;  1CQG A;  3WGX A;  2NTO A;  3BCK A;  1TRS A;  5HFK A;  3TRQ A;  3BCI A;  3WYW A;  1TJD A;  4ZB9 A;  3TKS C;  4K6X A;  4GLT A;  2JAC A;  2GST A;  1URM A;  1HQO A;  3JCM L;  1XW6 A;  2P5R A;  4FYU A;  5G31 A;  3M3M A;  4KUN A;  1QQ2 A;  2I81 A;  2BMX A;  3G7J A;  5CRD A;  4KF9 A;  8GSS A;  2O89 A;  5ECR B;  1B4P A;  4GCI A;  3GTU B;  1Z7P A;  4KDU A;  4WF4 A;  4OD7 A;  1AAZ A;  3PR8 A;  3E0U A;  4G19 A;  5F06 A;  6GSV A;  4NHZ A;  1THO A;  5CRH A;  1SEN A;  2WZ9 A;  3N5O A;  4ZXG A;  1OC9 A;  1PRX A;  1Z7R A;  2R2J A;  3LWA A;  4MLY A;  3APQ A;  1T00 A;  3GST A;  3TUE A;  2M80 A;  1SL1 B;  2C3Q A;  1JZR A;  5IOW A;  4H86 A;  5DJM A;  2CVD A;  5HR2 A;  5IPG A;  4QQ7 A;  1ZCP A;  5DAK A;  4YAP A;  3MDK A;  5AIX A;  1A2M A;  1X9M B;  3FZ9 A;  5JWO B;  3FKF A;  1PQN A;  4CHS A;  2YWO A;  1G7E A;  3A5W A;  1XVQ A;  1BX9 A;  1ACV A;  3FY7 A;  3CYN A;  2VL9 A;  1B9X C;  3I9V 2;  4KA0 A;  1FB6 A;  3IR4 A;  4FH8 A;  2GLR A;  3RPN A;  4IJ3 A;  4IJI A;  3HCZ A;  4PTS A;  1GTB A;  3Q74 A;  3RAZ A;  5LCZ A;  3R3E A;  2LJK A;  4RI7 A;  4N11 A;  3TOU A;  3RDW A;  4YKG A;  4TRX A;  1O8W A;  3GUS A;  3ERG A;  5BRT A;  2WFC A;  3VWW A;  4TVE A;  1PN0 A;  4LL4 B;  4DSS A;  5ECK B;  4KX4 A;  1FOV A;  2QKE A;  1BQ7 A;  3LXZ A;  2XPD A;  2OA7 A;  1SL2 B;  4HUA A;  3US3 A;  2C3N A;  2DIY A;  3UBL A;  1K0O A;  1O73 A;  4PUF C;  1GH2 A;  4AJ6 A;  4O32 A;  1SJ6 A;  2EIQ A;  1ABA A;  2MMA A;  2JSZ A;  1KTE A;  3BOA A;  5G1K A;  4BWS A;  4G2E A;  2HXK A;  1FB0 A;  3QR6 A;  4JBB A;  1PKW A;  2L5L A;  3E9J B;  4TXV A;  1H4O A;  1SKR B;  4RI6 A;  5KEJ A;  5DDL A;  5ID2 B;  4K7O A;  4BWQ A;  6GSX A;  1FOH A;  3LYP A;  1I5G A;  3BJ5 A;  1HD2 A;  3WT2 A;  5F8B A;  4J57 E;  2LNS A;  2O7K A;  3D21 A;  4FIW A;  2L4C A;  3F3R A;  1GNE A;  1UN2 A;  1V2A A;  1SU9 A;  3TDG A;  5KN3 A;  1M2D A;  4XIH A;  2OE0 A;  3F0I A;  2NPB A;  2A2R A;  2TRX A;  4Q5N A;  5JCU A;  4X0X A;  5HFG A;  4NMU A;  2KHP A;  5H5R A;  3GKX A;  5IMZ A;  2HRF A;  4PGT A;  4TKY A;  4POB A;  1N2A A;  3KMN A;  5C00 A;  3K8N A;  2HLS A;  3FEU A;  3GTU A;  3C73 A;  1S3C A;  2LRT A;  2I3Y A;  1GRX A;  3LQ7 A;  1LJR A;  4Z2T A;  1JZO A;  4P3Y B;  2QC7 A;  2P0G A;  4HI7 A;  3M8N A;  3FK8 A;  2YV9 A;  2DKH A;  4EUY A;  1XFL A;  1GUM A;  2IJY A;  4EDY A;  4IN0 A;  1M2A A;  5J4U A;  2IWT A;  2G0F A;  4LL1 B;  1ZYQ B;  4IS0 A;  3GL3 A;  1TTZ A;  1F37 A;  1FHE A;  5COH A;  2CVB A;  4ZL9 A;  4TOP A;  4Z2U A;  4GST A;  2H1D A;  2MBS A;  2HE3 A;  5HQP A;  1BAY A;  1TDI A;  3IC8 A;  2VCW A;  4POK A;  1GWC A;  1V57 A;  3HVV A;  2VL2 A;  3RPP A;  4PQH A;  1SD8 A;  2V6O A;  5KN2 A;  2KP2 A;  2GTU A;  2E2G A;  1TXX A;  5AIV A;  2LQQ A;  1MDI A;  2FWE A;  3W6G A;  2HI7 A;  2PN8 A;  4MDC A;  1FO5 A;  4F82 A;  3F6D A;  4RQR A;  4BVY B;  1JZW A;  1Z3E A;  4Q5Q A;  5HR1 A;  5B8A A;  3TKP A;  3ME7 A;  3UVH A;  5B8B A;  2B6M A;  3D0Z A;  3VI5 A;  1QGV A;  2ON5 A;  3N9J A;  6GSS A;  3LYK A;  3TCO A;  3TJJ A;  3EYT A;  5EPF A;  4MCU A;  2H6Z A;  3QOU A;  3DVW A;  4OWY A;  5D9W A;  1K0C A;  1MTC A;  2VO4 A;  3DD3 A;  2FLS A;  3FR9 A;  3NZN A;  1Z9H A;  1ZOF A;  3EIN A;  2X49 A;  3IAM 2;  1UA5 A;  2N5B A;  2F8F A;  3L9U A;  4QL7 A;  3DIE A;  3A2V A;  1FG4 A;  1AW9 A;  1R26 A;  1BG5 A;  1H75 A;  2GQM A;  4XS4 B;  1K0B A;  3UAR A;  4EO3 A;  4TR1 B;  4CDO A;  2H1G A;  2FHE A;  1R5P A;  2MZC A;  2OE3 A;  3F3Q A;  3GX8 A;  4JU5 A;  3ED3 A;  4WKW A;  3HYP A;  1AXD A;  1TRU A;  3KJY A;  4PX1 A;  1YY7 A;  1MD4 A;  5B7C A;  3EVI A;  5CP1 A;  5LD0 A;  4WF5 A;  2FNO A;  5G5F A;  2GSQ A;  5ECL B;  5IMA A;  3C1S A;  2K18 A;  2L6C A;  4IBP A;  5ID2 A;  3TRX A;  3QAW A;  1TI3 A;  3LJR A;  2OJL A;  3P7X A;  1KBN A;  4MMM A;  1KNG A;  4XRD A;  4X43 A;  2OBK A;  2EIR A;  5ECH B;  2VLU A;  3IV4 A;  4ECI A;  2HNL A;  2R4V A;  4EXJ A;  2L5O A;  2XBQ A;  1XWG A;  2H71 A;  3TJG A;  4Z2R A;  1EP8 A;  1K3Y A;  1DBY A;  2XPE A;  3TKS A;  4ULX A;  3VFI A;  2PBJ A;  2VOC A;  1T4Z A;  1VF1 A;  1XZO A;  4MH3 A;  5GSS A;  3F4R A;  2YP6 A;  3HZ8 A;  2B5Y A;  3GL5 A;  3TGZ A;  1T7P B;  1XBS A;  1JLW A;  5CAX A;  1GSS A;  4KCE A;  4JE1 A;  4PQI A;  2YWM A;  1TU8 A;  3EWL A;  2VAF A;  3QCP A;  2GSR A;  1O6J A;  5HR0 A;  4EDZ A;  4IVF A;  2C1Y A;  1IYI A;  5JWQ B;  3H93 A;  3TOT A;  1XPV A;  5D9V A;  5GAN D;  2C0F A;  4K1F A;  4O7H A;  2DML A;  4F9Z A;  5IOX A;  5G5E A;  1EEM A;  1EP7 A;  2H0H A;  3G9B A;  2CAI A;  1GL8 A;  4USS A;  2LTK A;  2REM A;  2DC5 A;  2RM6 A;  1SYX A;  4ZL8 A;  1THX A;  2R3X A;  4L8E A;  1ML6 A;  1OAZ A;  4EVM A;  1AUC A;  1ZYN A;  2I9H A;  1XW5 A;  1ERW A;  2YCD A;  2BTO T;  3GA4 A;  2YN1 A;  1Z6N A;  1B4Q A;  3IPZ A;  3FRC A;  4X1U A;  4YAV A;  4E8E A;  2V2G A;  4DSR A;  1PN9 A;  2H73 A;  4HOJ A;  2HT9 A;  4BVY A;  4K7N A;  1K0M A;  4WBJ A;  5DAL B;  2VCV A;  3MIX A;  4MP4 A;  1A23 A;  2WCI A;  3CBU A;  3ZIJ A;  3GYK A;  2C4J A;  2R0G A;  5DBQ A;  3TKR A;  4TR0 A;  3PPU A;  1YJ6 A;  4LLR A;  3EE2 A;  1ZZY A;  1M9A A;  2DLX A;  2WJU A;  2X99 A;  3EPT A;  4AF2 A;  1M2B A;  2JU5 A;  2X8G A;  3KTL A;  1GP1 A;  1RK4 A;  2I4A A;  3GKN A;  1XWA A;  4XCS A;  4HQS A;  4ECB A;  1TOF A;  4V2M A;  4WXT A;  5INY A;  2XC2 A;  3ERF A;  4NPB A;  2E7P A;  3O3T A;  4XS4 A;  1M99 A;  4MNN A;  2H19 A;  3M9J A;  4OFN A;  3SBC A;  4TR1 A;  2GZP A;  2YWN A;  3QFB C;  3OR5 A;  3GKK A;  3V1W A;  1F6M C;  3PIN A;  1WIK A;  4IP1 A;  5ECN B;  4KH7 A;  4TXO B;  2YAN A;  5KN0 A;  3S9F A;  2VUP A;  1Y25 A;  1A0R P;  2AAW A;  2H70 A;  3UL3 A;  1JHB A;  5G2Z A;  1PMT A;  2ALB A;  2A4H A;  5IMD A;  3FZ4 A;  4KW6 A;  2WDU A;  1YZX A;  4OCE A;  2OKA A;  3H8Q A;  2WGR A;  2HSM A;  1XOA A;  3CXG A;  1Y6E A;  1XOB A;  3L78 A;  1HYU A;  3ME8 A;  4NXI A;  2VLV A;  1QXH A;  4Q5F A;  2CV4 A;  5ENU A;  3GMF A;  3GSS A;  3GKM A;  4ZL7 A;  2VL3 A;  1AQV A;  2AHE A;  3DVX A;  3KP8 A;  4YQV A;  3HVS A;  1U3A A;  4K0G A;  2PUK C;  2D2Z A;  3I43 A;  2VCZ A;  2J9H A;  4EF0 A;  3U6V A;  1KEB A;  1A8Y A;  5J3R A;  1YF0 A;  1WJK A;  2GQK A;  4KGI A;  1OYJ A;  1USB A;  1NM3 A;  1PGT A;  2DJ1 A;  2L59 A;  4F0B A;  2H75 A;  3KEB A;  1EGO A;  1GSE A;  2PPT A;  3F4S A;  1WPI A;  2JAD A;  4I2T A;  1LBK A;  5IPH A;  5ABR A;  4MF7 A;  4EKZ A;  2R0P A;  19GS A;  3ZMK A;  2MMZ A;  5ELA A;  1O8X A;  3ZIT A;  1HNC A;  2LKU A;  4EC0 A;  4JR6 A;  3D6I A;  3KP9 A;  2C0G A;  1S3D A;  3FZ5 A;  4L5O A;  1GLQ A;  3D4M A;  2NBS A;  2CZ2 A;  3Q6O A;  1ZYE A;  4FYC A;  1LU4 A;  2GQL A;  5J9B A;  5FHI A;  4JR4 A;  1K3O A;  4IW9 A;  1A2J A;  1XWC A;  2A2P A;  1O7U A;  1U88 A;  1TK5 B;  1TRV A;  3Q18 A;  2O87 A;  3UEM A;  5D8I A;  1RQM A;  5J41 A;  5IMC A;  1DSB A;  3LG6 A;  3A3T A;  4BPY A;  2VD0 A;  2YJH A;  1ERT A;  2F9S A;  3PGT A;  3KZQ A;  5GST A;  2LEG A;  5E59 A;  2X4A A;  2O8V B;  2R6K A;  3VI7 A;  4EIP A;  5HR3 A;  3ERW A;  1R5A A;  2WUL A;  2DIZ A;  1F2E A;  4GRF A;  3L0H A;  1HNB A;  1PX7 A;  1G6Y A;  2IME A;  1M7T A;  3W8S A;  4MH2 A;  3GNJ A;  1OVN A;  3LXT A;  4GF0 A;  1FVK A;  1U87 A;  1QMV A;  4NV2 A;  5DAL A;  2WRT A;  1GLP A;  1GSD A;  2HRK A;  4WEY A;  1ZMA A;  3C8E A;  4MPF A;  10GS A;  1T1V A;  2A2S A;  4K7I A;  3DWV A;  4HZ2 A;  3RBT A;  2C0D A;  3SWL A;  1GSF A;  2H6Y A;  5D73 A;  1XWK A;  1XIY A;  3UAP A;  1DE1 A;  5CRW A;  4GXZ A;  2PWJ A;  3GV1 A;  4G10 A;  3IK9 A;  4EL1 A;  2KP1 A;  3EU4 A;  5EVO A;  1ST9 A;  3UBK A;  2DMM A;  1VF2 A;  1K0D A;  5DCH A;  4J56 E;  1PKZ A;  1QFN A;  4BVX B;  3GFK A;  1XVW A;  2A4V A;  4BA7 A;  3ZFB A;  2J23 A;  4XS1 A;  2N5A A;  3VPQ A;  2AYT A;  2YOI A;  4MA9 A;  2ZNM A;  3WT1 A;  3HY2 A;  4KCA A;  3FZA A;  1WMJ A;  5CO3 A;  3DKS A;  2B7J A;  4GQF A;  4I8B A;  2FY6 A;  1NHY A;  4KB3 A;  3ISO A;  3QDN A;  2M72 A;  2HYX A;  4TXO A;  3J7Y b;  2LRN A;  2CX4 A;  2VD1 A;  4WBR D;  1TI1 A;  1Q4J A;  2LNT A;  2FD3 A;  2V41 A;  18GS A;  2K8V A;  1FW1 A;  2CZ3 A;  1NHO A;  3EUR A;  3IOS A;  2JZT A;  2X64 A;  1E2Y A;  3ZYW A;  4GQC A;  4KSO A;  2R37 A;  1A24 A;  2P31 A;  3I69 A;  5E4W A;  3FW2 A;  3LFL A;  3MAK A;  2NDO A;  22GS A;  4ML1 A;  4G0K A;  3HZ4 A;  4ECC A;  4KDY A;  1ZYP A;  2N5F A;  3I6A A;  3IBH A;  2IMI A;  4O92 A;  2AV4 A;  3LSZ A;  2R0C A;  4IEL A;  3ZRE A;  4MJC A;  2CX3 A;  3TRP A;  1PSQ A;  3ZFL A;  1MDK A;  2LJA A;  2PER A;  3F4T A;  3GHA A;  5D9X A;  4IKH A;  3ZML A;  4ZIJ A;  1EZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...