2OJLA

Crystal structure of q7waf1_borpa from bordetella parapertussis. northeast structural genomics target bpr68.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
79
structure length
79
Chain Sequence
HPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title Crystal structure of Q7WAF1_BORPA from Bordetella parapertussis
rcsb
source organism Bordetella parapertussis
total genus 22
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ojlA00
3IK9A 3KMNA 5H5QA 1GSUA 2GDRA 3Q6OA 2XPEA 2P0GA 2GVPA 3J7Yk 4NV5A 3KEBA 4KNDA 3TCOA 3C1SA 5J3RA 5ABRA 4L0WA 2P5QA 3EWLA 5GZZB 4J2FA 3WGXA 3M9JA 3ZREA 2V1MA 5ID2B 2YANA 1PX6A 3O3TA 4AJ8A 1ZZYA 5DDLA 1NHOA 5LCZA 3TKSC 4ZL9A 1SKRB 4PX1A 2R6KA 3FW2A 5F07A 1WOUA 3IAS2 4MA9A 2CAQA 4JRRA 1K0NA 2AAWA 2P31A 2R4VA 1EEJA 3M8NA 5GAPD 2VM1A 2B5EA 4OO4A 2VCTA 3EU3A 2YJ7A 6GSXA 1Z7PA 5ECNB 3CTFA 3TKQA 3VPQA 4Q5RA 1Q98A 1ERWA 3EMXA 4F0CA 5EPFA 4EXJA 1SJ6A 3NOFA 2O85A 3ZFBA 1J0FA 2LUSA 2OE1A 3GL3A 2DJJA 5DCGA 2IMEA 5CO3A 2J23A 1FVKA 1MDJA 4PQ1A 1TTZA 3D4MA 4GCIA 4Q5QA 5AIVA 20GSA 3VLNA 1A8LA 3U6VA 3KP9A 2CX3A 5G5EA 2NVLA 1X9WB 3RHCA 3KMOA 4NXIA 5E4WA 3EYTA 4I8BA 1BEDA 4MJCA 2CZ3A 4IVFA 1MTCA 4GTUA 4XIHA 2AJQB 3IBHA 4TR3A 2VD1A 6GSYA 2YWNA 4ECCA 4F9ZA 1GUMA 3VI7A 2AHEA 5DAKA 2O89A 4ZILA 1X5EA 5CP1A 2H74A 4GWRA 4HS1A 4RI7A 4ZBDA 3GNJA 3BCIA 2JZTA 2YPMA 5AN1A 3L78A 2FA4A 5FWGA 5CRDA 3RPNA 4IP6A 1TRUA 2CVKA 1Z3EA 5L71A 5COHA 2YV9A 3ZZXA 1SD8A 1SYXA 3IA1A 5AIXA 1PL2A 3N5OA 4DSSA 4EE0A 1H4OA 4N10A 3G7YA 1GTBA 3GTUB 3HJMA 1E2YA 4LL4B 1GSQA 1GLPA 1SL0B 2L59A 3DGQA 3VWXA 2YWMA 1M2BA 3G7JA 1V9WA 5G31A 5ELGA 2A2SA 1EOGA 2VAFA 2CV4A 2AYTA 1R26A 5EL8A 5FT3A 2R3XA 4TR0A 2F3MA 1EWXA 2HZFA 3HVXA 1V2AA 3TDGA 3NZNA 2B3SA 2YZUA 2C0EA 5IO0A 1VGLA 1QUWA 1TK8B 1SU9A 5ELAA 4KDYA 5H5RA 1JFUA 3ZL5A 3ZIJA 5ECOB 4I2TA 1ZMAA 1AQWA 4AF2A 3FR3A 4ECIA 4KW6A 1XWAA 1JZDA 5HR1A 4DSRA 5IMZA 1GWCA 1HD2A 4G9HA 4EVMA 1LJRA 2LV3A 1QXHA 2PN8A 2FCHA 3MSZA 1UA5A 1TXXA 2HZEA 1ZCPA 1SL1B 2H0IA 4HI7A 1DUGA 1GNWA 2H1AA 3FYGA 3WGDA 2M46A 1MDIA 1R4WA 2IFQA 3EMPA 4KDXA 2OE3A 4NV2A 4XCSA 4CW9A 1EGRA 1C72A 1M0UA 1YZXA 2DC5A 4LLRA 1EP7A 1PA3A 3LJRA 5JWOB 2F8FA 3QD9A 1Z5YE 2J9HA 5D9TA 2DMMA 3G7IA 2I4AA 3APOA 1SKWB 3PINA 2JACA 2F51A 1N8JA 1ILOA 2DJKA 5JCUA 2H76A 3EC3A 3RDWA 4ECJA 2RUEA 4V2NA 5D8IA 4IN0A 1OKDA 4O7HA 1O8WA 3E3EA 5H5SA 1NSWA 2WZ9A 2GZZA 2JL4A 2IJYA 4N30A 5DQYA 4EF0A 3QFBC 3H79A 2R2JA 2FD3A 5JWQB 4OFNA 3O6TA 2NTOA 1FW1A 1XOAA 3CYNA 4HQZA 3PGTA 2H75A 4F2IA 1TU7A 4I2UA 4NPBA 2B5XA 3F63A 2FHEA 3KH9A 1BG5A 4KCAA 2L5OA 5GSSA 2VCXA 1H75A 2WGRA 4DEJA 2N5FA 2GSSA 1SK0A 3GL5A 3KGKA 4RUVA 4BWQA 1T4YA 3D4TA 1X0RA 2LKUA 3F8UA 1G6WA 2WRTA 2WFCA 2ZCTA 1T1VA 5IMDA 2C80A 2LRNA 5HFIA 2VLUA 2OKAA 2HRFA 1E6BA 1BYEA 3ZIVA 1ZGNA 1AAZA 3J7Yb 3ISOA 4L0UA 4KH7A 1U3AA 3HVSA 2GZYA 5ECKB 1N2AA 3ZLPA 2MMNA 3KXOA 2F9SA 4V2LA 5DAKB 1XW6A 2LTKA 3M3MA 2FNOA 2AV4A 2GSQA 1PKZA 2H19A 4BVYA 2JZSA 5J4UA 2VCVA 2IWTA 2H6YA 1DSBA 4ID0A 1Z7RA 19GSA 3CTGA 1R5AA 2H6ZA 17GSA 4NMUA 2D2ZA 5HR0A 3GH6A 4AJ7A 4MJBA 4K2DA 1TDIA 1JLWA 1HQOA 2X8GA 4HJ2A 2OBIA 1DE1A 2XHFA 4MP4A 1M2DA 3S9FA 4XS6A 3CSHA 3DD3A 4DSSB 3UL3A 3I69A 5B8AA 2V32A 2DIYA 4POLA 3C1RA 5HQPA 3I43A 4FYCA 3GRXA 1GTUA 3IOSA 3QOUA 2H0HA 3C73A 5DJMA 1USBA 10GSA 2JSYA 2GGTA 2BTOT 2VL2C 2KOKA 1JZOA 5J5NA 2C8UA 1XVQA 2X99A 1X9SB 3D0ZA 2VCQA 5CREA 3TKSA 3CXGA 3GA4A 4ULXA 4L8EA 2VIMA 1AUCA 3CRUA 1OE8A 3LWAA 3W8JA 2KP1A 1XZOA 3KCMA 4QQ7A 3MAKA 3EURA 4BA7A 5A4UA 2LJKA 4YAVA 4YH2A 1ACVA 2GT5A 3LEFA 1X5CA 4PGTA 2LS5A 3E0UA 3PH9A 1FB0A 4WXTA 2VOCA 3WT1A 3CSIA 4ZIJA 2DJ2A 1X5DA 1NHYA 2H30A 4POMA 4TRXA 3L9UA 2EIQA 3UJ1A 1K3YA 2OE0A 4ACSA 2ZUPA 2QKEA 1SKSB 3L4NA 3GKKA 4RQXA 2YWIA 3DEXA 3D5JA 1T00A 4WR4A 3WGEA 4X43A 5A4VA 1GL8A 2HZEB 1SENA 4EDZA 1VF3A 3TRPA 4K6XA 4TW5A 3ZYWA 1HYUA 3DVXA 5DALA 1AQVA 1PMTA 3FR9A 2IFQB 2GSTA 3FR6A 3D22A 2HLSA 4WF4A 4GXZA 3MNGA 3KM6A 2PU9C 4ZL7A 9GSSA 4WF5A 2C3TA 2H0GA 3BJ5A 4X0XA 4EL1A 5G30A 5B6NA 3TKRA 1EOHA 3H93A 4JR4A 4WBJA 2YJHA 1K0BA 3HJPA 4JR6A 5DQSA 3KZQA 1ST9A 4LMWA 1YEXA 5J41A 4FYBA 4K9ZA 2EC4A 4TKYA 3LQ7A 4K7IA 5DBQA 4MPGA 3QAGA 1B4PA 1FHEA 3C7MA 5DVBA 2FWEA 1EV4A 1HNCA 1XCCA 1FG4A 5DCHA 2F8AA 4IJ3A 3TB2A 1MD3A 7GSSA 2H72A 1K0OA 5B6MA 2K6VA 1BAYA 1F6MC 1JHBA 2OADA 2QC7A 2LSTA 1G6YA 4MLYA 2CAIA 4OWYA 4DSQA 2OACA 4IJIA 4DVCA 1ML6A 3RAZA 4EO3A 3F4SA 1GUKA 1TW9A 3FZ9A 1BQ7A 4XS4A 4QL9A 3IPZA 2G0FA 2O87A 4N11A 4XHMA 2CT6A 3ZVJA 3LXZA 1XPVA 2VCWA 1VF4A 2B1LA 2I81A 2LQQA 5F8BA 1K0CA 2REMA 3NIVA 1ZYEA 1W4VA 3LG6A 5AISA 1UVZA 1ON4A 4NHZA 3KTBA 4ZL8A 1TKDB 3O76A 2L6DA 1AQXA 2QSIA 3A2XA 2I3YA 4ILFA 4HOJA 1G7OA 1SD9A 5GAND 3GUSA 4AJ6A 1S3DA 5CYYA 1KBNA 1FOVA 2WS2A 3EU4A 5G2ZA 1VF2A 2DIZA 3TJKA 1GLQA 1SYRA 2AUVA 1MDKA 2PBJA 3GYKA 2XBIA 1TRVA 3UVTA 3PR8A 1AXDA 4Z7XA 4FYUA 3C8EA 1OE7A 2DJ1A 4IQ1A 6GSWA 1PD21 1AC1A 2Z9SA 5A4WA 2GQMA 4KSMA 3TUEA 4F82A 2H01A 2CX4A 2K8VA 2KLXA 4KAEA 1JZWA 4EDYA 2GT6A 5B8BA 3DRNA 1TI3A 2V2GA 3GX8A 3V1WA 1M7TA 4GRFA 4KGIA 4V1Ag 5ECHB 2FY6A 5EY6A 2DBCA 2E0QA 1O85A 1IYIA 1V40A 4KB3A 1WPIA 1EEMA 4BVXA 3WT2A 4ZB6A 2YP6A 2BJXA 1B9YC 3QR6A 2PPTA 1DE2A 1QFNA 1QMVA 2FGXA 2NBSA 6GSTA 4BPYA 1ABAA 5ECMB 3HYPA 5C04A 1AIUA 1S3AA 3EVIA 3A2VA 2VLTA 3K8NA 5KN3A 2O8VB 1WJKA 4YQVA 13GSA 2PERA 3ERGA 1BJXA 4GSSA 1RK4A 4O92A 4TXOA 2TRCP 5A5KA 2H1DA 6GSSA 3QAVA 4HJMA 2MBSA 4MDCA 1GNEA 3VI5A 5J9CA 3CRTA 2TIRA 4PUAA 3HXSA 1CQGA 5HR3A 1EV9A 1YDKA 2PWJA 1TJDA 4Q5FA 5DALB 2K9FA 2RM5A 4JEDA 2HNLA 5IO2A 2YZHA 1LU4A 1A2MA 2R5GA 4WEYA 3UAPA 2OJLA 3IXRA 1YQ1A 2WULA 3LXTA 3KJYA 2GZPA 18GSA 3TJBA 4KDUA 3F0IA 2FWGA 3KIJA 3H4KA 1G7EA 3UBKA 4G10A 4I5QA 3IHQA 2B6MA 4HU9A 2GS3A 3HZ4A 1WWJA 4IW9A 4PNGA 1EGOA 3IK7A 3CSJA 2XPDA 1B8XA 1R7HA 2H66A 5IPHA 1SL2B 1KTEA 1PRXA 4XTSA 2ON5A 3ZTLA 2G2QA 2FWHA 22GSA 2YV7A 1NM3A 12GSA 3DWVA 1GSSA 2IIYA 3ZMLA 3IC4A 3ZVJD 3IR4A 2FWFA 2L57A 2E2MA 1Z6NA 4TN8A 3LGCA 3A3TA 1GRXA 4PNFA 2XC2A 3R2QA 1A24A 3D21A 3VFIA 1SJIA 2C0DA 4P3YB 1I9DA 2L4CA 4OO5A 1J08A 3VPTA 5G1LA 2B5YA 4Q5NA 1B9XC 4JU5A 2VL2A 1UC7A 3L0HA 3TKSE 2VD0A 1PSQA 4XS4B 1FO5A 2RM6A 2LNTA 5DJLA 4HZ2A 1ERVA 4N0VA 4OCFA 4TR1B 5HFKA 3QMXA 3BCKA 4MPFA 5ECPB 3FEUA 3GFKA 1Z9HA 5INYA 5JCWA 1PL1A 4D73A 4K7OA 4KX4A 1R5PA 2RUFA 4XRAA 2E7PA 1HNBA 2VL9A 4K0NA 2L5LA 3BD2A 2GTUA 3DVWA 2HSYA 3AY8A 3LYKA 1A8YA 1WIKA 3L9SA 1M99A 2H1GA 2VCZA 4N0ZA 1Y6EA 4F03A 3WYWA 2MYGA 3F9UA 2DMLA 1I5GA 2HT9A 2WJUA 3GKXA 4MCUA 2VL3A 4J56E 3Q18A 3F6FA 3GSTA 5IMCA 4FO5A 1V98A 5D9WA 2YN1A 3RBTA 5EVOA 3ZRDA 1OKTA 3DIEA 5HR2A 1ERTA 4KUNA 1Q4JA 1T3BA 2V6KA 2ALBA 1TK0B 3HY2A 3HJOA 1F37A 1K0DA 2MMZA 3VK9A 1WMJA 4PQHA 2X8HA 1THOA 4HU7A 3HKRA 4GQFA 2HSHA 2VLVA 3QFAC 4K7NA 4I6XA 3G9BA 2JSZA 4OCEA 2VO4A 4MZWA 4PURA 1THXA 4YAPA 3GN3A 1URMA 1J9BA 3HVVA 2CVDA 3CBUA 2A2RA 1XIYA 1PKWA 3P8WA 3GKNA 2HE3A 3LFLA 2O7KA 3TOUA 2MMAA 4G19A 4LA1A 1V58A 1YF1A 1TP9A 3GHAA 5ENUA 3VWVA 1QQ2A 1OC9A 2YOIA 5ECRB 3I9V2 2LRTA 3ERFA 2C0FA 1XWBA 4TXOB 4ZB8A 4MF6A 1YKAA 3UMAA 2A4VA 4K0GA 1OVNA 2NPBA 3DMLA 4YQMA 1PGTA 2KP2A 5F06A 3W8SA 1B4QA 2LQOA 3TKPA 1K0MA 4F0BA 2IL3A 3IRAA 2B1KA 2H73A 2IMFA 1QGVA 2H8LA 3H1NA 1W89A 4FIWA 4TVEA 2XBQA 3D6IA 1GTAA 2CA8A 2PUKC 4CHSA 4OFTA 2IN3A 2K8SA 1RW1A 5ECIB 2VM2A 3Q19A 3FHKA 4ML6A 4EUYA 3UOMA 3QCPA 3WD6A 4ISDA 3SBCA 1TRWA 2PGTA 4MZBA 5J9BA 2GLRA 5D93A 3UVHA 3ZITA 1U6TA 2FLSA 1XVWA 3FRCA 4GQCA 1S3CA 2MMOA 4MABA 4RQRA 5E59A 4H86A 1GH2A 1Z6MA 1JZRA 3IDVA 2C3NA 1XW5A 3A2WA 3RPPA 2PMTA 4NHWA 5ECLB 1YEPA 1B48A 1FVJA 1M9AA 1EZKA 2FA8A 3P90A 3M9KA 4OFMA 1M9BA 1TOFA 1T8EB 4POBA 4I97A 2IMKA 1OYJA 3JCML 2P5RA 3F3RA 3E9JB 2ZNMA 4MH3A 4K1FA 1XWCA 1TRSA 2YNXA 1U3IA 3APSA 4TR1A 3N9JA 4PQIA 5D9VA 2X64A 2QGVA 4E8EA 3TRXA 3P7XA 8GSSA 4HZ4A 3APQA 2B7KA 3ZMKA 2M72A 1FB6A 2E2GA 1PN9A 4MJAA 5IPGA 3W6GA 4IHUA 3HDCA 2RLIA 4KSOA 3F4TA 1O8XA 3IAM2 3DXBA 1OC8A 2B7JA 4X1UA 4O32A 3FKFA 4D73B 14GSA 4TR4A 3GURA 2KUCA 4IGJA 3HHVA 2H71A 4G2EA 3MWHA 1GSFA 1XWKA 3KP8A 2JZRA 3LYPA 4IQAA 5D96A 1F9MA 4KCEA 3CMIA 2V41A 3HZ8A 5KEJA 3KH7A 4MZCA 5AGYA 2DLXA 1OAZA 1GUHA 3EE2A 4NWYA 1U87A 1TI1A 1A0RP 3GSSA 4MK3A 4RI6A 1LBKA 3UIWA 4PUFC 1X9MB 4IS0A 1K3LA 2LEGA 2DJ3A 5F0GA 2IMDA 3LORA 2WDUA 1UN2A 3I6AA 3TRQA 1KEBA 1K3OA 1BX9A 1O73A 2C0GA 2HYXA 5CRWA 1GSEA 5CRHA 3FZ4A 4HEA2 4JE1A 1NW2A 1YKCA 5LD0A 1WRYA 3GIXA 2RIIA 1U88A 2C4JA 2ON7A 3UEMA 2IPAA 6GSVA 4MH2A 3ME8A 4GF0A 4MMMA 3MDKA 4ZBAA 1SK2A 1ERUA 5JCGA 1F3AA 3LSZA 5ECSA 2V6OA 5D9XA 1ZL9A 4L5OA 2GQKA 3M1GA 4ML1A 1EP8A 2ES7A 2CQ9A 5ID2A 4HQSA 5CRGA 1HNAA 2IMIA 3HD5A 1OC9B 3RHBA 2LRCA 1G0TA 1ZOFA 11GSA 1YF0A 4EKZA 1WP0A 2HI7A 1XWGA 4GLTA 4LL1B 5IMVA 4HUAA 1XOBA 2M80A 1F2EA 2CZ2A 3P2AA 3A5WA 3HA9A 2CVBA 4K8MA 1GP1A 3TOTA 3IV4A 3DKSA 5IIZA 4JBBA 3F4RA 4GSNA 3GV1A 1T4ZA 4V2MA 1RQMA 3GKMA 3ZFLA 2DSAA 4HDEA 2WB9A 2L4QA 2LNSA 3UARA 3ED3A 2BMXA 2YCDA 1GULA 4TOPA 5LNKe 5G1KA 2K18A 2VUPA 3M0FA 3ERWA 4NAXA 5IMAA 3BOAA 4EC0A 2JADA 3EINA 5GSTA 3QAWA 2OBKA 4WETA 1T7PB 3FZ5A 1AW9A 1PQNA 2H6XA 1IYHA 4L5LA 2PVOC 5IOXA 4XS1A 4KA0A 3KTLA 1GSYA 2KHPA 2L6CA 2EIRA 5C00A 5D73A 4TXVA 1M2AA 1MEKA 1A0FA 5G5FA 4BL7A 3L9VA 1PX7A 4MF5A 2N5BA 4WR5A 3FK8A 1QK8A 1O6JA 3GH9A 5ECQB 2PVQA 5KN2A 1OC3A 1YY7A 4J57E 3ME7A 2I1UA 6GSUA 1KNGA 2C1YA 1SJZA 1XW9A 4POKA 1CQHA 1WE0A 3F3QA 2YWOA 3Q74A 1ZYQB 1TU8A 4OD7A 4JZQA 3DYRA 3VURA 4CDOA 16GSA 4O5RA 4GSTA 4IELA 3QPMA 3VWWA 2H1BA 1V57A 2MBTA 4E8HA 3QDNA 1MD4A 4IP1A 1Y25A 2JU5A 2R37A 2I9HA 1XFLA 4PXOA 3C71A 1SK1A 1A2LA 4ZXGA 5KN1A 5IMFA 5IOWA 4MJEA 3H8QA 1YJ6A 3UBLA 4KE3A 2C3QA 3IE3A 2FUG2 3GTUA 3US3A 3TJGA 4YQUA 3HCZA 2EIOA 1O7UA 1A23A 3TJJA 2HRNA 3FY7A 4V1Ap 2AB6A 2H70A 4LMVA 3OR5A 3U5RE 3BBYA 5CNWA 1XXUA 2DJ0A 5CAXA 5JWRB 1GTIA 5IM9A 1VF1A 2LJRA 2GSRA 1DBYA 3FZAA 3SWLA 2HFDA 2MZCA 1VRSD 3TJFA 4BWSA 4ECBA 4MF7A 2X8CA 4IKHA 2WCIA 4ZBBA 4WBRD 1GSDA 4QL7A 1O81A 2HXKA 3GX0A 5HFGA 4FH8A 1TK5B 3KD0A 1A2JA 2TRXA 3GMFA 3VWUA 1K0AA 1FAAA 4AGSA 4WKWA 2OA7A 3F6DA 2GQLA 2NDOA 1F3BA 4ZB9A 2LJAA 4XRDA 5FHIA 2N5AA 5B7CA 1JLVA 4IBPA 4OMVA 3TGZA 5IQYA 1XBSA 5KN0A 5F05A
chains in the Genus database with same CATH superfamily
3IK9A 3KMNA 5H5QA 1GSUA 2GDRA 3Q6OA 4EIQA 2XPEA 2P0GA 2GVPA 3J7Yk 4NV5A 4A5PA 3KEBA 4KNDA 3TCOA 3C1SA 5J3RA 5ABRA 4L0WA 2P5QA 3EWLA 5GZZB 4J2FA 3WGXA 3M9JA 3ZREA 2V1MA 5ID2B 2YANA 1PX6A 3O3TA 4AJ8A 1ZZYA 5DDLA 1NHOA 5LCZA 3TKSC 4ZL9A 1SKRB 4PX1A 2R6KA 3FW2A 5F07A 1WOUA 3IAS2 4MA9A 2CAQA 4JRRA 1K0NA 2AAWA 2P31A 2R4VA 1EEJA 3M8NA 5GAPD 2VM1A 2B5EA 4OO4A 2VCTA 3EU3A 2YJ7A 6GSXA 1Z7PA 5ECNB 3CTFA 3TKQA 3VPQA 4Q5RA 1Q98A 1ERWA 3EMXA 3MYDA 4F0CA 5EPFA 4EXJA 1SJ6A 3NOFA 2O85A 3ZFBA 1J0FA 2LUSA 2OE1A 3GL3A 2DJJA 5DCGA 2IMEA 5CO3A 2J23A 1FVKA 2DKIA 1MDJA 4PQ1A 1TTZA 3D4MA 4GCIA 4Q5QA 5AIVA 2HSMA 20GSA 3VLNA 1A8LA 3U6VA 3KP9A 2CX3A 5G5EA 2NVLA 1X9WB 3RHCA 3KMOA 4NXIA 5E4WA 3EYTA 4I8BA 1BEDA 4BL7B 4MJCA 2CZ3A 4IVFA 1MTCA 4GTUA 4XIHA 2AJQB 3IBHA 4TR3A 2VD1A 6GSYA 2YWNA 4K2XA 4ECCA 4F9ZA 1GUMA 3VI7A 2AHEA 5DAKA 2O89A 4ZILA 1X5EA 5CP1A 4G0LA 2H74A 4GWRA 4HS1A 4RI7A 4ZBDA 3GNJA 3BCIA 2JZTA 2YPMA 5AN1A 3L78A 2FA4A 5FWGA 5CRDA 3RPNA 4IP6A 1TRUA 2CVKA 1Z3EA 5L71A 5COHA 2YV9A 3ZZXA 1SD8A 4Z2UA 2R0PA 1SYXA 3IA1A 5AIXA 1PL2A 3N5OA 4DSSA 4EE0A 1H4OA 4N10A 3G7YA 1GTBA 3GTUB 3HJMA 1E2YA 4LL4B 1GSQA 1GLPA 1SL0B 2L59A 3DGQA 3VWXA 2YWMA 1M2BA 3G7JA 1V9WA 2DKHA 5G31A 5ELGA 2A2SA 1EOGA 3IC8A 2VAFA 2CV4A 2AYTA 1R26A 5EL8A 5FT3A 2R3XA 4TR0A 2F3MA 1EWXA 2HZFA 3HVXA 1V2AA 3TDGA 3NZNA 4YKGA 2B3SA 2YZUA 2C0EA 5IO0A 1VGLA 1QUWA 1TK8B 1SU9A 5ELAA 4KDYA 5H5RA 1JFUA 3ZL5A 3ZIJA 5ECOB 4I2TA 1ZMAA 1AQWA 4AF2A 3FR3A 4ECIA 4KW6A 3HVNA 1XWAA 1JZDA 5HR1A 4DSRA 5IMZA 1GWCA 1HD2A 4G9HA 4MNNA 2A4HA 4EVMA 1LJRA 2LV3A 1QXHA 2PN8A 2FCHA 3MSZA 1UA5A 1TXXA 2HZEA 1ZCPA 1SL1B 2H0IA 4HI7A 1DUGA 1GNWA 1PN0A 2H1AA 3FYGA 3WGDA 2M46A 1MDIA 1R4WA 2IFQA 3EMPA 4KDXA 2OE3A 4NV2A 4XCSA 4CW9A 1EGRA 1C72A 1M0UA 1YZXA 2DC5A 4LLRA 1EP7A 1PA3A 3LJRA 5JWOB 2F8FA 3QD9A 1Z5YE 2J9HA 5D9TA 2DMMA 3G7IA 2I4AA 3APOA 1SKWB 3PINA 2JACA 2F51A 1N8JA 1ILOA 2DJKA 5JCUA 2H76A 3EC3A 3RDWA 4ECJA 2RUEA 4V2NA 5D8IA 4IN0A 1OKDA 4O7HA 1O8WA 3E3EA 5H5SA 1NSWA 2WZ9A 2GZZA 2JL4A 2IJYA 4N30A 5DQYA 4EF0A 3QFBC 3H79A 2R2JA 2FD3A 5JWQB 4OFNA 3O6TA 2NTOA 1FW1A 1XOAA 3CYNA 4HQZA 3PGTA 2H75A 4KF9A 4F2IA 1TU7A 4I2UA 4NPBA 2B5XA 3F63A 2FHEA 3KH9A 4ICYA 1BG5A 4KCAA 2L5OA 5GSSA 2VCXA 1H75A 2WGRA 4DEJA 2N5FA 2GSSA 1SK0A 3GL5A 3KGKA 4RUVA 4BWQA 1T4YA 3D4TA 1X0RA 2LKUA 3F8UA 1G6WA 2WRTA 2WFCA 2ZCTA 1T1VA 5IMDA 2C80A 2LRNA 5HFIA 2VLUA 2OKAA 2HRFA 1E6BA 1BYEA 3ZIVA 1ZGNA 1AAZA 3J7Yb 3ISOA 4L0UA 4KH7A 1U3AA 2UZ8A 3HVSA 2QA2A 2GZYA 5ECKB 1N2AA 3ZLPA 2MMNA 3KXOA 2F9SA 4V2LA 5DAKB 1XW6A 2LTKA 3M3MA 2FNOA 2AV4A 2GSQA 1PKZA 2H19A 4BVYA 2JZSA 5J4UA 2VCVA 2IWTA 2H6YA 1DSBA 4ID0A 1Z7RA 19GSA 3CTGA 1R5AA 2H6ZA 17GSA 4NMUA 2D2ZA 5HR0A 3GH6A 4AJ7A 4MJBA 4K2DA 1TDIA 1JLWA 1HQOA 2X8GA 4HJ2A 2OBIA 1DE1A 2XHFA 4MP4A 1M2DA 3S9FA 4XS6A 3CSHA 3DD3A 4DSSB 3UL3A 3I69A 5B8AA 2V32A 2DIYA 4POLA 3C1RA 5HQPA 3I43A 4FYCA 3GRXA 1GTUA 3IOSA 3QOUA 2H0HA 3C73A 5DJMA 1USBA 10GSA 2JSYA 2GGTA 3R3EA 2BTOT 2VL2C 2KOKA 1JZOA 5J5NA 2C8UA 1XVQA 2X99A 1X9SB 3D0ZA 2VCQA 5CREA 3TKSA 1FOHA 3CXGA 3GA4A 4ULXA 4L8EA 2VIMA 1AUCA 3CRUA 1OE8A 3LWAA 3W8JA 2KP1A 1XZOA 3KCMA 4QQ7A 3MAKA 3EURA 4BA7A 5A4UA 2LJKA 4YAVA 4YH2A 1ACVA 2GT5A 3LEFA 1X5CA 4PGTA 2LS5A 3E0UA 3PH9A 1FB0A 4WXTA 2VOCA 3WT1A 3CSIA 4ZIJA 2DJ2A 1X5DA 1NHYA 2H30A 4POMA 4TRXA 3L9UA 2EIQA 3UJ1A 1K3YA 2OE0A 4ACSA 4USSA 1ZYPA 3CQFA 2ZUPA 2QKEA 1SKSB 3L4NA 3GKKA 4RQXA 2YWIA 3DEXA 3D5JA 1T00A 4WR4A 3WGEA 4X43A 5A4VA 1GL8A 2HZEB 1SENA 4EDZA 1VF3A 3TRPA 4K6XA 4TW5A 3ZYWA 1HYUA 3DVXA 3PPUA 5DALA 1AQVA 1PMTA 3FR9A 2IFQB 2GSTA 3FR6A 3D22A 2HLSA 4WF4A 4GXZA 3MNGA 3KM6A 2PU9C 4ZL7A 9GSSA 4WF5A 2C3TA 2H0GA 3BJ5A 4X0XA 4EL1A 5G30A 5B6NA 3TKRA 1EOHA 3H93A 4JR4A 4WBJA 2YJHA 1K0BA 3HJPA 4JR6A 5DQSA 3KZQA 1ST9A 4LMWA 1YEXA 5J41A 4FYBA 4K9ZA 2EC4A 4TKYA 3LQ7A 4K7IA 5DBQA 4MPGA 3QAGA 1B4PA 1FHEA 3C7MA 5DVBA 2FWEA 1EV4A 1HNCA 1XCCA 1FG4A 5DCHA 2F8AA 4IJ3A 3TB2A 1MD3A 7GSSA 2H72A 1K0OA 5B6MA 2K6VA 1BAYA 4FQUA 1F6MC 1JHBA 2OADA 2QC7A 2LSTA 1G6YA 4MLYA 2CAIA 4OWYA 4DSQA 2OACA 4IJIA 4DVCA 1ML6A 3RAZA 4Z2RA 4EO3A 3F4SA 1GUKA 1TW9A 3FZ9A 1BQ7A 4XS4A 4QL9A 3IPZA 2G0FA 2O87A 4N11A 4XHMA 2CT6A 5KOXA 3ZVJA 3LXZA 1XPVA 2VCWA 1VF4A 2B1LA 2I81A 2LQQA 5F8BA 1K0CA 2REMA 3NIVA 1ZYEA 1W4VA 3LG6A 5AISA 1UVZA 1ON4A 4NHZA 3KTBA 4ZL8A 1TKDB 3O76A 2L6DA 1AQXA 2QSIA 3A2XA 2I3YA 4ILFA 4CY8A 1PFOA 2X49A 4HOJA 4BVYB 1G7OA 4EIPA 1SD9A 5GAND 3GUSA 4AJ6A 1S3DA 5CYYA 1KBNA 1FOVA 2HRKA 1M3JA 2WS2A 3EU4A 5G2ZA 1VF2A 2DIZA 3TJKA 1GLQA 1SYRA 2AUVA 1MDKA 2PBJA 3GYKA 2XBIA 1TRVA 3UVTA 3PR8A 1AXDA 4Z7XA 4FYUA 3C8EA 3FMWA 1OE7A 2DJ1A 4IQ1A 6GSWA 1PD21 1AC1A 3MIXA 2Z9SA 5A4WA 2GQMA 4KSMA 3TUEA 4F82A 2H01A 2CX4A 2K8VA 2KLXA 4KAEA 1JZWA 4EDYA 2GT6A 5B8BA 3DRNA 1TI3A 2V2GA 4Z2TA 3GX8A 3V1WA 1M7TA 4GRFA 4KGIA 4V1Ag 5ECHB 2FY6A 5EY6A 2DBCA 2E0QA 1O85A 1IYIA 1V40A 4KB3A 1WPIA 1EEMA 4BVXA 3WT2A 4ZB6A 2YP6A 2BJXA 1B9YC 3QR6A 2PPTA 1DE2A 1QFNA 1QMVA 2FGXA 2NBSA 6GSTA 1ZYNA 4BPYA 1ABAA 5ECMB 3HYPA 5C04A 1AIUA 1S3AA 3EVIA 3A2VA 2VLTA 3K8NA 5KN3A 2O8VB 4O5QA 1WJKA 4YQVA 13GSA 2PERA 3ERGA 1BJXA 4GSSA 1RK4A 4O92A 4TXOA 2TRCP 5A5KA 2H1DA 6GSSA 3QAVA 4HJMA 2MBSA 4MDCA 1GNEA 3VI5A 5J9CA 3CRTA 2TIRA 4PUAA 3HXSA 1CQGA 5HR3A 1EV9A 1YDKA 2PWJA 1TJDA 4Q5FA 5DALB 2K9FA 2RM5A 4JEDA 2HNLA 5IO2A 2YZHA 1LU4A 1A2MA 2R5GA 4WEYA 3UAPA 2OJLA 3IXRA 1YQ1A 2WULA 3LXTA 3KJYA 2GZPA 18GSA 3TJBA 4KDUA 3F0IA 2FWGA 4G0KA 3KIJA 3H4KA 1G7EA 3UBKA 4G10A 4I5QA 3IHQA 2B6MA 4HU9A 2GS3A 3HZ4A 1WWJA 4IW9A 4PNGA 1EGOA 3IK7A 3CSJA 2XPDA 1B8XA 1R7HA 2H66A 5IPHA 1SL2B 1KTEA 1PRXA 4XTSA 2ON5A 3ZTLA 2G2QA 2FWHA 22GSA 2YV7A 5KOWA 1NM3A 12GSA 3DWVA 1GSSA 2IIYA 3ZMLA 3IC4A 3ZVJD 3IR4A 2FWFA 2L57A 2E2MA 1Z6NA 4TN8A 3LGCA 3A3TA 1GRXA 4PNFA 2XC2A 3R2QA 1A24A 3D21A 3VFIA 1SJIA 2C0DA 4P3YB 1I9DA 2L4CA 4OO5A 1J08A 3VPTA 5G1LA 2B5YA 4G0IA 4Q5NA 1B9XC 4JU5A 2VL2A 1UC7A 3L0HA 3TKSE 2VD0A 1PSQA 4XS4B 1FO5A 2RM6A 2LNTA 5DJLA 4HZ2A 1ERVA 4N0VA 4OCFA 4TR1B 5HFKA 3QMXA 3BCKA 4MPFA 5ECPB 3FEUA 3GFKA 1Z9HA 5INYA 5JCWA 1PL1A 4D73A 4K7OA 4KX4A 1R5PA 2RUFA 4XRAA 2E7PA 1HNBA 2VL9A 4K0NA 2L5LA 3BD2A 2GTUA 3DVWA 2HSYA 3AY8A 3LYKA 1A8YA 1WIKA 3L9SA 1M99A 2H1GA 2VCZA 4N0ZA 1Y6EA 4F03A 3WYWA 2MYGA 3F9UA 2DMLA 1I5GA 2HT9A 4MCUA 2WJUA 3GKXA 4K5RA 2VL3A 4J56E 3Q18A 3F6FA 3GSTA 5IMCA 4FO5A 1V98A 5D9WA 2YN1A 3RBTA 5EVOA 3ZRDA 1OKTA 3DIEA 5HR2A 1ERTA 4KUNA 1Q4JA 1T3BA 2V6KA 2ALBA 1TK0B 3HY2A 3HJOA 1F37A 1K0DA 2MMZA 3VK9A 1WMJA 4PQHA 2X8HA 1THOA 4HU7A 3HKRA 4GQFA 2HSHA 2VLVA 3QFAC 4K7NA 4I6XA 3G9BA 4BVXB 2JSZA 4OCEA 2VO4A 4MZWA 4PURA 1THXA 4YAPA 3GN3A 1URMA 1J9BA 3HVVA 2CVDA 3CBUA 2A2RA 1XIYA 1PKWA 3P8WA 3GKNA 2HE3A 3LFLA 2O7KA 3TOUA 2MMAA 4G19A 4LA1A 1V58A 1YF1A 1TP9A 3GHAA 5ENUA 3VWVA 1QQ2A 1OC9A 2YOIA 5ECRB 3I9V2 2LRTA 3ERFA 2C0FA 1XWBA 4TXOB 4ZB8A 4MF6A 1YKAA 3UMAA 2A4VA 4K0GA 1OVNA 2NPBA 3DMLA 4YQMA 1PGTA 2KP2A 5F06A 3W8SA 4HSCX 2LQOA 1B4QA 3TKPA 1K0MA 4PTSA 2IL3A 3IRAA 4F0BA 2B1KA 2H73A 2IMFA 1QGVA 2H8LA 3H1NA 1W89A 4FIWA 4TVEA 2XBQA 3D6IA 1GTAA 2CA8A 2PUKC 4CHSA 3IHGA 4OFTA 2IN3A 2K8SA 1RW1A 5ECIB 4CY6A 2VM2A 3Q19A 3FHKA 2X4AA 4ML6A 4EUYA 3UOMA 4YKFA 3QCPA 3WD6A 4ISDA 3SBCA 2QA1A 1TRWA 2PGTA 4MZBA 5J9BA 2GLRA 5D93A 3UVHA 3ZITA 1S3RA 1U6TA 2FLSA 3EPTA 1XVWA 3FRCA 4GQCA 1S3CA 2R0GA 2MMOA 4MABA 4RQRA 5E59A 4H86A 1GH2A 1Z6MA 1JZRA 3IDVA 2C3NA 1XW5A 3A2WA 3RPPA 2PMTA 4NHWA 5ECLB 1YEPA 2R0CA 1B48A 1FVJA 1M9AA 1EZKA 2FA8A 3P90A 3M9KA 4OFMA 3A5IA 1M9BA 1TOFA 1T8EB 4POBA 4I97A 2IMKA 1OYJA 3JCML 2P5RA 3F3RA 3E9JB 2ZNMA 4MH3A 4K1FA 4O5UA 1XWCA 1TRSA 2YNXA 1U3IA 3APSA 4K5SA 4TR1A 3N9JA 4PQIA 5D9VA 1XG8A 2X64A 2QGVA 4E8EA 3TRXA 3P7XA 8GSSA 4HZ4A 3APQA 2B7KA 3ZMKA 2M72A 1FB6A 2E2GA 1PN9A 4MJAA 5IPGA 3W6GA 4IHUA 3HDCA 2RLIA 4KSOA 3F4TA 1O8XA 3IAM2 3DXBA 1OC8A 2B7JA 4X1UA 4O32A 3FKFA 4D73B 14GSA 4TR4A 3GURA 2KUCA 5BRTA 4IGJA 3HHVA 2H71A 4G2EA 3MWHA 1GSFA 1XWKA 5BMUA 3KP8A 2JZRA 3LYPA 4IQAA 5D96A 1F9MA 4KCEA 3CMIA 2V41A 3HZ8A 5KEJA 3KH7A 4MZCA 4X4JA 5AGYA 2DLXA 1OAZA 1GUHA 3EE2A 4NWYA 1U87A 1TI1A 1A0RP 3GSSA 4MK3A 4RI6A 1LBKA 3UIWA 4PUFC 1X9MB 4IS0A 1K3LA 2LEGA 2DJ3A 5F0GA 2IMDA 3LORA 2WDUA 1UN2A 3I6AA 3TRQA 1KEBA 1K3OA 1BX9A 1O73A 1M3IA 2C0GA 2HYXA 5CRWA 1GSEA 5CRHA 3FZ4A 4HEA2 4JE1A 3LW9A 1NW2A 1YKCA 5LD0A 1WRYA 3GIXA 2RIIA 1U88A 2C4JA 2ON7A 3UEMA 2IPAA 6GSVA 4MH2A 3ME8A 4GF0A 4MMMA 3MDKA 4ZBAA 1SK2A 1ERUA 5JCGA 1F3AA 3LSZA 5ECSA 2V6OA 5D9XA 1ZL9A 4L5OA 2GQKA 3M1GA 4ML1A 1EP8A 2ES7A 2CQ9A 5ID2A 4HQSA 5CRGA 1HNAA 2IMIA 3HD5A 1OC9B 3RHBA 2LRCA 1G0TA 1ZOFA 11GSA 1YF0A 4EKZA 1WP0A 2HI7A 1XWGA 4GLTA 4LL1B 5IMVA 4HUAA 1XOBA 2M80A 1F2EA 2CZ2A 2HRAA 3P2AA 3A5WA 3HA9A 2CVBA 4K8MA 1GP1A 3TOTA 3IV4A 3DKSA 5IIZA 4JBBA 3F4RA 4GSNA 3GV1A 1T4ZA 4V2MA 1RQMA 3GKMA 3ZFLA 2DSAA 4HDEA 2WB9A 2L4QA 2LNSA 3UARA 3ED3A 2BMXA 2YCDA 1GULA 4TOPA 5LNKe 5G1KA 2K18A 2VUPA 3M0FA 3ERWA 4NAXA 5IMAA 3BOAA 4EC0A 2JADA 3EINA 5GSTA 3QAWA 2OBKA 4WETA 1T7PB 3FZ5A 1AW9A 1PQNA 2H6XA 1IYHA 4L5LA 2PVOC 5IOXA 4XS1A 4KA0A 3KTLA 1GSYA 2KHPA 2L6CA 2EIRA 5C00A 5D73A 4TXVA 1M2AA 1MEKA 1A0FA 5G5FA 4BL7A 3L9VA 1PX7A 4MF5A 2N5BA 4WR5A 3FK8A 1QK8A 1O6JA 3GH9A 5ECQB 2PVQA 5KN2A 1OC3A 1YY7A 4J57E 3ME7A 2I1UA 6GSUA 1KNGA 2C1YA 1SJZA 1XW9A 4POKA 1CQHA 1WE0A 3F3QA 2YWOA 3Q74A 1ZYQB 1TU8A 4OD7A 4JZQA 3DYRA 3VURA 4CDOA 16GSA 4O5RA 4GSTA 4IELA 3QPMA 3VWWA 2H1BA 1V57A 2MBTA 4E8HA 3QDNA 1MD4A 4IP1A 1Y25A 2JU5A 2R37A 2I9HA 1XFLA 4PXOA 3C71A 1SK1A 1A2LA 4ZXGA 5KN1A 5IMFA 5IOWA 4MJEA 3H8QA 1YJ6A 3UBLA 4BIKA 4KE3A 2C3QA 3IE3A 2A2PA 2FUG2 3GTUA 3US3A 3TJGA 4YQUA 3HCZA 2EIOA 1O7UA 1A23A 3TJJA 2HRNA 3FY7A 4V1Ap 2AB6A 2H70A 4LMVA 3OR5A 3U5RE 3BBYA 5CNWA 1XXUA 2DJ0A 5CAXA 5JWRB 1GTIA 5IM9A 1VF1A 2LJRA 2GSRA 1DBYA 3FZAA 3SWLA 2HFDA 2MZCA 1VRSD 3TJFA 4BWSA 4ECBA 4MF7A 2X8CA 4IKHA 2WCIA 4ZBBA 4WBRD 1GSDA 4QL7A 1O81A 2HXKA 3GX0A 5HFGA 4FH8A 1TK5B 3KD0A 1A2JA 2TRXA 3GMFA 3VWUA 1K0AA 1FAAA 4AGSA 4WKWA 2OA7A 3F6DA 2GQLA 2NDOA 1F3BA 4ZB9A 2LJAA 4XRDA 5FHIA 2N5AA 5B7CA 1JLVA 4IBPA 4OMVA 3TGZA 5IQYA 1XBSA 5KN0A 5F05A
chains in the Genus database with same CATH topology
3IK9A 3KMNA 5H5QA 1GSUA 2GDRA 3Q6OA 4EIQA 2XPEA 2P0GA 2GVPA 3J7Yk 4NV5A 4A5PA 3KEBA 4KNDA 3TCOA 3C1SA 5J3RA 5ABRA 4L0WA 2P5QA 3EWLA 5GZZB 4J2FA 3WGXA 3M9JA 3ZREA 2V1MA 5ID2B 2YANA 1PX6A 3O3TA 4AJ8A 1ZZYA 5DDLA 1NHOA 5LCZA 3TKSC 4ZL9A 1SKRB 4PX1A 2R6KA 3FW2A 5F07A 1WOUA 3IAS2 4MA9A 2CAQA 4JRRA 1K0NA 2AAWA 2P31A 2R4VA 1EEJA 3M8NA 5GAPD 2VM1A 2B5EA 4OO4A 2VCTA 3EU3A 2YJ7A 6GSXA 1Z7PA 5ECNB 3CTFA 3TKQA 3VPQA 4Q5RA 1Q98A 1ERWA 3EMXA 3MYDA 4F0CA 5EPFA 4EXJA 1SJ6A 3NOFA 2O85A 3ZFBA 1J0FA 2LUSA 2OE1A 3GL3A 2DJJA 5DCGA 2IMEA 5CO3A 2J23A 1FVKA 2DKIA 1MDJA 4PQ1A 1TTZA 3D4MA 4GCIA 4Q5QA 5AIVA 2HSMA 20GSA 3VLNA 1A8LA 3U6VA 3KP9A 2CX3A 5G5EA 2NVLA 1X9WB 3RHCA 3KMOA 4NXIA 5E4WA 3EYTA 4I8BA 1BEDA 4BL7B 4MJCA 2CZ3A 4IVFA 1MTCA 4GTUA 4XIHA 2AJQB 3IBHA 4TR3A 2VD1A 6GSYA 2YWNA 4K2XA 4ECCA 4F9ZA 1GUMA 3VI7A 2AHEA 5DAKA 2O89A 4ZILA 1X5EA 5CP1A 4G0LA 2H74A 4GWRA 4HS1A 4RI7A 4ZBDA 3GNJA 3BCIA 2JZTA 2YPMA 5AN1A 3L78A 2FA4A 5FWGA 5CRDA 3RPNA 4IP6A 1TRUA 2CVKA 1Z3EA 5L71A 5COHA 2YV9A 3ZZXA 1SD8A 4Z2UA 2R0PA 1SYXA 3IA1A 5AIXA 1PL2A 3N5OA 4DSSA 4EE0A 1H4OA 4N10A 3G7YA 1GTBA 3GTUB 3HJMA 1E2YA 4LL4B 1GSQA 1GLPA 1SL0B 2L59A 3DGQA 3VWXA 2YWMA 1M2BA 3G7JA 1V9WA 2DKHA 5G31A 5ELGA 2A2SA 1EOGA 3IC8A 2VAFA 2CV4A 2AYTA 1R26A 5EL8A 5FT3A 2R3XA 4TR0A 2F3MA 1EWXA 2HZFA 3HVXA 1V2AA 3TDGA 3NZNA 4YKGA 2B3SA 2YZUA 2C0EA 5IO0A 1VGLA 1QUWA 1TK8B 1SU9A 5ELAA 4KDYA 5H5RA 1JFUA 3ZL5A 3ZIJA 5ECOB 4I2TA 1ZMAA 1AQWA 4AF2A 3FR3A 4ECIA 4KW6A 1XWAA 1JZDA 5HR1A 4DSRA 5IMZA 1GWCA 1HD2A 4G9HA 4MNNA 2A4HA 4EVMA 1LJRA 2LV3A 1QXHA 2PN8A 2FCHA 3MSZA 1UA5A 1TXXA 2HZEA 1ZCPA 1SL1B 2H0IA 4HI7A 1DUGA 1GNWA 1PN0A 2H1AA 3FYGA 3WGDA 2M46A 1MDIA 1R4WA 2IFQA 3EMPA 4KDXA 2OE3A 4NV2A 4XCSA 4CW9A 1EGRA 1C72A 1M0UA 1YZXA 2DC5A 4LLRA 1EP7A 1PA3A 3LJRA 5JWOB 2F8FA 3QD9A 1Z5YE 2J9HA 5D9TA 2DMMA 3G7IA 2I4AA 3APOA 1SKWB 3PINA 2JACA 2F51A 1N8JA 1ILOA 2DJKA 5JCUA 2H76A 3EC3A 3RDWA 4ECJA 2RUEA 4V2NA 5D8IA 4IN0A 1OKDA 4O7HA 1O8WA 3E3EA 5H5SA 1NSWA 2WZ9A 2GZZA 2JL4A 2IJYA 4N30A 5DQYA 4EF0A 3QFBC 3H79A 2R2JA 2FD3A 5JWQB 4OFNA 3O6TA 2NTOA 1FW1A 1XOAA 3CYNA 4HQZA 3PGTA 2H75A 4KF9A 4F2IA 1TU7A 4I2UA 4NPBA 2B5XA 3F63A 2FHEA 3KH9A 4ICYA 1BG5A 4KCAA 2L5OA 5GSSA 2VCXA 1H75A 2WGRA 4DEJA 2N5FA 2GSSA 1SK0A 3GL5A 3KGKA 4RUVA 4BWQA 1T4YA 3D4TA 1X0RA 2LKUA 3F8UA 1G6WA 2WRTA 2WFCA 2ZCTA 1T1VA 5IMDA 2C80A 2LRNA 5HFIA 2VLUA 2OKAA 2HRFA 1E6BA 1BYEA 3ZIVA 1ZGNA 1AAZA 3J7Yb 3ISOA 4L0UA 4KH7A 1U3AA 2UZ8A 3HVSA 2QA2A 2GZYA 5ECKB 1N2AA 3ZLPA 2MMNA 3KXOA 2F9SA 4V2LA 5DAKB 1XW6A 2LTKA 3M3MA 2FNOA 2AV4A 2GSQA 1PKZA 2H19A 4BVYA 2JZSA 5J4UA 2VCVA 2IWTA 2H6YA 1DSBA 4ID0A 1Z7RA 19GSA 3CTGA 1R5AA 2H6ZA 17GSA 4NMUA 2D2ZA 5HR0A 3GH6A 4AJ7A 4MJBA 4K2DA 1TDIA 1JLWA 1HQOA 2X8GA 4HJ2A 2OBIA 1DE1A 2XHFA 4MP4A 1M2DA 3S9FA 4XS6A 3CSHA 3DD3A 4DSSB 3UL3A 3I69A 5B8AA 2V32A 2DIYA 4POLA 3C1RA 5HQPA 3I43A 4FYCA 3GRXA 1GTUA 3IOSA 3QOUA 2H0HA 3C73A 5DJMA 1USBA 10GSA 2JSYA 2GGTA 3R3EA 2BTOT 2VL2C 2KOKA 1JZOA 5J5NA 2C8UA 1XVQA 2X99A 1X9SB 3D0ZA 2VCQA 5CREA 3TKSA 1FOHA 3CXGA 3GA4A 4ULXA 4L8EA 2VIMA 1AUCA 3CRUA 1OE8A 3LWAA 3W8JA 2KP1A 1XZOA 3KCMA 4QQ7A 3MAKA 3EURA 4BA7A 5A4UA 2LJKA 4YAVA 4YH2A 1ACVA 2GT5A 3LEFA 1X5CA 4PGTA 2LS5A 3E0UA 3PH9A 1FB0A 4WXTA 2VOCA 3WT1A 3CSIA 4ZIJA 2DJ2A 1X5DA 1NHYA 2H30A 4POMA 4TRXA 3L9UA 2EIQA 3UJ1A 1K3YA 2OE0A 4ACSA 4USSA 1ZYPA 2ZUPA 2QKEA 1SKSB 3L4NA 3GKKA 4RQXA 2YWIA 3DEXA 3D5JA 1T00A 4WR4A 3WGEA 4X43A 5A4VA 1GL8A 2HZEB 1SENA 4EDZA 1VF3A 3TRPA 4K6XA 4TW5A 3ZYWA 1HYUA 3DVXA 3PPUA 5DALA 1AQVA 1PMTA 3FR9A 2IFQB 2GSTA 3FR6A 3D22A 2HLSA 4WF4A 4GXZA 3MNGA 3KM6A 2PU9C 4ZL7A 9GSSA 4WF5A 2C3TA 2H0GA 3BJ5A 4X0XA 4EL1A 5G30A 5B6NA 3TKRA 1EOHA 3H93A 4JR4A 4WBJA 2YJHA 1K0BA 3HJPA 4JR6A 5DQSA 3KZQA 1ST9A 4LMWA 1YEXA 5J41A 4FYBA 4K9ZA 2EC4A 4TKYA 3LQ7A 4K7IA 5DBQA 4MPGA 3QAGA 1B4PA 1FHEA 3C7MA 5DVBA 2FWEA 1EV4A 1HNCA 1XCCA 1FG4A 5DCHA 2F8AA 4IJ3A 3TB2A 1MD3A 7GSSA 2H72A 1K0OA 5B6MA 2K6VA 1BAYA 4FQUA 1F6MC 1JHBA 2OADA 2QC7A 2LSTA 1G6YA 4MLYA 2CAIA 4OWYA 4DSQA 2OACA 4IJIA 4DVCA 1ML6A 3RAZA 4Z2RA 4EO3A 3F4SA 1GUKA 1TW9A 3FZ9A 1BQ7A 4XS4A 4QL9A 3IPZA 2G0FA 2O87A 4N11A 4XHMA 2CT6A 5KOXA 3ZVJA 3LXZA 1XPVA 2VCWA 1VF4A 2B1LA 2I81A 2LQQA 5F8BA 1K0CA 2REMA 3NIVA 1ZYEA 1W4VA 3LG6A 5AISA 1UVZA 1ON4A 4NHZA 3KTBA 4ZL8A 1TKDB 3O76A 2L6DA 1AQXA 2QSIA 3A2XA 2I3YA 4ILFA 4CY8A 2X49A 4HOJA 4BVYB 1G7OA 4EIPA 1SD9A 5GAND 3GUSA 4AJ6A 1S3DA 5CYYA 1KBNA 1FOVA 2HRKA 2WS2A 3EU4A 5G2ZA 1VF2A 2DIZA 3TJKA 1GLQA 1SYRA 2AUVA 1MDKA 2PBJA 3GYKA 2XBIA 1TRVA 3UVTA 3PR8A 1AXDA 4Z7XA 4FYUA 3C8EA 3FMWA 1OE7A 2DJ1A 4IQ1A 6GSWA 1PD21 1AC1A 3MIXA 2Z9SA 5A4WA 2GQMA 4KSMA 3TUEA 4F82A 2H01A 2CX4A 2K8VA 2KLXA 4KAEA 1JZWA 4EDYA 2GT6A 5B8BA 3DRNA 1TI3A 2V2GA 4Z2TA 3GX8A 3V1WA 1M7TA 4GRFA 4KGIA 4V1Ag 5ECHB 2FY6A 5EY6A 2DBCA 2E0QA 1O85A 1IYIA 1V40A 4KB3A 1WPIA 1EEMA 4BVXA 3WT2A 4ZB6A 2YP6A 2BJXA 1B9YC 3QR6A 2PPTA 1DE2A 1QFNA 1QMVA 2FGXA 2NBSA 6GSTA 1ZYNA 4BPYA 1ABAA 5ECMB 3HYPA 5C04A 1AIUA 1S3AA 3EVIA 3A2VA 2VLTA 3K8NA 5KN3A 2O8VB 4O5QA 1WJKA 4YQVA 13GSA 2PERA 3ERGA 1BJXA 4GSSA 1RK4A 4O92A 4TXOA 2TRCP 5A5KA 2H1DA 6GSSA 3QAVA 4HJMA 2MBSA 4MDCA 1GNEA 3VI5A 5J9CA 3CRTA 2TIRA 4PUAA 3HXSA 1CQGA 5HR3A 1EV9A 1YDKA 2PWJA 1TJDA 4Q5FA 5DALB 2K9FA 2RM5A 4JEDA 2HNLA 5IO2A 2YZHA 1LU4A 1A2MA 2R5GA 4WEYA 3UAPA 2OJLA 3IXRA 1YQ1A 2WULA 3LXTA 3KJYA 2GZPA 18GSA 3TJBA 4KDUA 3F0IA 2FWGA 4G0KA 3KIJA 3H4KA 1G7EA 3UBKA 4G10A 4I5QA 3IHQA 2B6MA 4HU9A 2GS3A 3HZ4A 1WWJA 4IW9A 4PNGA 1EGOA 3IK7A 3CSJA 2XPDA 1B8XA 1R7HA 2H66A 5IPHA 1SL2B 1KTEA 1PRXA 4XTSA 2ON5A 3ZTLA 2G2QA 2FWHA 22GSA 2YV7A 5KOWA 1NM3A 12GSA 3DWVA 1GSSA 2IIYA 3ZMLA 3IC4A 3ZVJD 3IR4A 2FWFA 2L57A 2E2MA 1Z6NA 4TN8A 3LGCA 3A3TA 1GRXA 4PNFA 2XC2A 3R2QA 1A24A 3D21A 3VFIA 1SJIA 2C0DA 4P3YB 1I9DA 2L4CA 4OO5A 1J08A 3VPTA 5G1LA 2B5YA 4G0IA 4Q5NA 1B9XC 4JU5A 2VL2A 1UC7A 3L0HA 3TKSE 2VD0A 1PSQA 4XS4B 1FO5A 2RM6A 2LNTA 5DJLA 4HZ2A 1ERVA 4N0VA 4OCFA 4TR1B 5HFKA 3QMXA 3BCKA 4MPFA 5ECPB 3FEUA 3GFKA 1Z9HA 5INYA 5JCWA 1PL1A 4D73A 4K7OA 4KX4A 1R5PA 2RUFA 4XRAA 2E7PA 1HNBA 2VL9A 4K0NA 2L5LA 3BD2A 2GTUA 3DVWA 2HSYA 3AY8A 3LYKA 1A8YA 1WIKA 3L9SA 1M99A 2H1GA 2VCZA 4N0ZA 1Y6EA 4F03A 3WYWA 2MYGA 3F9UA 2DMLA 1I5GA 2HT9A 4MCUA 2WJUA 3GKXA 4K5RA 2VL3A 4J56E 3Q18A 3F6FA 3GSTA 5IMCA 4FO5A 1V98A 5D9WA 2YN1A 3RBTA 5EVOA 3ZRDA 1OKTA 3DIEA 5HR2A 1ERTA 4KUNA 1Q4JA 1T3BA 2V6KA 2ALBA 1TK0B 3HY2A 3HJOA 1F37A 1K0DA 2MMZA 3VK9A 1WMJA 4PQHA 2X8HA 1THOA 4HU7A 3HKRA 4GQFA 2HSHA 2VLVA 3QFAC 4K7NA 4I6XA 3G9BA 4BVXB 2JSZA 4OCEA 2VO4A 4MZWA 4PURA 1THXA 4YAPA 3GN3A 1URMA 1J9BA 3HVVA 2CVDA 3CBUA 2A2RA 1XIYA 1PKWA 3P8WA 3GKNA 2HE3A 3LFLA 2O7KA 3TOUA 2MMAA 4G19A 4LA1A 1V58A 1YF1A 1TP9A 3GHAA 5ENUA 3VWVA 1QQ2A 1OC9A 2YOIA 5ECRB 3I9V2 2LRTA 3ERFA 2C0FA 1XWBA 4TXOB 4ZB8A 4MF6A 1YKAA 3UMAA 2A4VA 4K0GA 1OVNA 2NPBA 3DMLA 4YQMA 1PGTA 2KP2A 5F06A 3W8SA 1B4QA 2LQOA 3TKPA 1K0MA 4PTSA 2IL3A 3IRAA 4F0BA 2B1KA 2H73A 2IMFA 1QGVA 2H8LA 3H1NA 1W89A 4FIWA 4TVEA 2XBQA 3D6IA 1GTAA 2CA8A 2PUKC 4CHSA 3IHGA 4OFTA 2IN3A 2K8SA 1RW1A 5ECIB 4CY6A 2VM2A 3Q19A 3FHKA 2X4AA 4ML6A 4EUYA 3UOMA 4YKFA 3QCPA 3WD6A 4ISDA 3SBCA 2QA1A 1TRWA 2PGTA 4MZBA 5J9BA 2GLRA 5D93A 3UVHA 3ZITA 1U6TA 2FLSA 3EPTA 1XVWA 3FRCA 4GQCA 1S3CA 2R0GA 2MMOA 4MABA 4RQRA 5E59A 4H86A 1GH2A 1Z6MA 1JZRA 3IDVA 2C3NA 1XW5A 3A2WA 3RPPA 2PMTA 4NHWA 5ECLB 1YEPA 2R0CA 1B48A 1FVJA 1M9AA 1EZKA 2FA8A 3P90A 3M9KA 4OFMA 3A5IA 1M9BA 1TOFA 1T8EB 4POBA 4I97A 2IMKA 1OYJA 3JCML 2P5RA 3F3RA 3E9JB 2ZNMA 4MH3A 4K1FA 4O5UA 1XWCA 1TRSA 2YNXA 1U3IA 3APSA 4K5SA 4TR1A 3N9JA 4PQIA 5D9VA 2X64A 2QGVA 4E8EA 3TRXA 3P7XA 8GSSA 4HZ4A 3APQA 2B7KA 3ZMKA 2M72A 1FB6A 2E2GA 1PN9A 4MJAA 5IPGA 3W6GA 4IHUA 3HDCA 2RLIA 4KSOA 3F4TA 1O8XA 3IAM2 3DXBA 1OC8A 2B7JA 4X1UA 4O32A 3FKFA 4D73B 14GSA 4TR4A 3GURA 2KUCA 5BRTA 4IGJA 3HHVA 2H71A 4G2EA 3MWHA 1GSFA 1XWKA 5BMUA 3KP8A 2JZRA 3LYPA 4IQAA 5D96A 1F9MA 4KCEA 3CMIA 2V41A 3HZ8A 5KEJA 3KH7A 4MZCA 4X4JA 5AGYA 2DLXA 1OAZA 1GUHA 3EE2A 4NWYA 1U87A 1TI1A 1A0RP 3GSSA 4MK3A 4RI6A 1LBKA 3UIWA 4PUFC 1X9MB 4IS0A 1K3LA 2LEGA 2DJ3A 5F0GA 2IMDA 3LORA 2WDUA 1UN2A 3I6AA 3TRQA 1KEBA 1K3OA 1BX9A 1O73A 2C0GA 2HYXA 5CRWA 1GSEA 5CRHA 3FZ4A 4HEA2 4JE1A 3LW9A 1NW2A 1YKCA 5LD0A 1WRYA 3GIXA 2RIIA 1U88A 2C4JA 2ON7A 3UEMA 2IPAA 6GSVA 4MH2A 3ME8A 4GF0A 4MMMA 3MDKA 4ZBAA 1SK2A 1ERUA 5JCGA 1F3AA 3LSZA 5ECSA 2V6OA 5D9XA 1ZL9A 4L5OA 2GQKA 3M1GA 4ML1A 1EP8A 2ES7A 2CQ9A 5ID2A 4HQSA 5CRGA 1HNAA 2IMIA 3HD5A 1OC9B 3RHBA 2LRCA 1G0TA 1ZOFA 11GSA 1YF0A 4EKZA 1WP0A 2HI7A 1XWGA 4GLTA 4LL1B 5IMVA 4HUAA 1XOBA 2M80A 1F2EA 2CZ2A 2HRAA 3P2AA 3A5WA 3HA9A 2CVBA 4K8MA 1GP1A 3TOTA 3IV4A 3DKSA 5IIZA 4JBBA 3F4RA 4GSNA 3GV1A 1T4ZA 4V2MA 1RQMA 3GKMA 3ZFLA 2DSAA 4HDEA 2WB9A 2L4QA 2LNSA 3UARA 3ED3A 2BMXA 2YCDA 1GULA 4TOPA 5LNKe 5G1KA 2K18A 2VUPA 3M0FA 3ERWA 4NAXA 5IMAA 3BOAA 4EC0A 2JADA 3EINA 5GSTA 3QAWA 2OBKA 4WETA 1T7PB 3FZ5A 1AW9A 1PQNA 2H6XA 1IYHA 4L5LA 2PVOC 5IOXA 4XS1A 4KA0A 3KTLA 1GSYA 2KHPA 2L6CA 2EIRA 5C00A 5D73A 4TXVA 1M2AA 1MEKA 1A0FA 5G5FA 4BL7A 3L9VA 1PX7A 4MF5A 2N5BA 4WR5A 3FK8A 1QK8A 1O6JA 3GH9A 5ECQB 2PVQA 5KN2A 1OC3A 1YY7A 4J57E 3ME7A 2I1UA 6GSUA 1KNGA 2C1YA 1SJZA 1XW9A 4POKA 1CQHA 1WE0A 3F3QA 2YWOA 3Q74A 1ZYQB 1TU8A 4OD7A 4JZQA 3DYRA 3VURA 4CDOA 16GSA 4O5RA 4GSTA 4IELA 3QPMA 3VWWA 2H1BA 1V57A 2MBTA 4E8HA 3QDNA 1MD4A 4IP1A 1Y25A 2JU5A 2R37A 2I9HA 1XFLA 4PXOA 3C71A 1SK1A 1A2LA 4ZXGA 5KN1A 5IMFA 5IOWA 4MJEA 3H8QA 1YJ6A 3UBLA 4KE3A 2C3QA 3IE3A 2A2PA 2FUG2 3GTUA 3US3A 3TJGA 4YQUA 3HCZA 2EIOA 1O7UA 1A23A 3TJJA 2HRNA 3FY7A 4V1Ap 2AB6A 2H70A 4LMVA 3OR5A 3U5RE 3BBYA 5CNWA 1XXUA 2DJ0A 5CAXA 5JWRB 1GTIA 5IM9A 1VF1A 2LJRA 2GSRA 1DBYA 3FZAA 3SWLA 2HFDA 2MZCA 1VRSD 3TJFA 4BWSA 4ECBA 4MF7A 2X8CA 4IKHA 2WCIA 4ZBBA 4WBRD 1GSDA 4QL7A 1O81A 2HXKA 3GX0A 5HFGA 4FH8A 1TK5B 3KD0A 1A2JA 2TRXA 3GMFA 3VWUA 1K0AA 1FAAA 4AGSA 4WKWA 2OA7A 3F6DA 2GQLA 2NDOA 1F3BA 4ZB9A 2LJAA 4XRDA 5FHIA 2N5AA 5B7CA 1JLVA 4IBPA 4OMVA 3TGZA 5IQYA 1XBSA 5KN0A 5F05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK9 A;  3KMN A;  5H5Q A;  1GSU A;  2GDR A;  3Q6O A;  2XPE A;  2P0G A;  2GVP A;  3J7Y k;  4NV5 A;  3KEB A;  4KND A;  3TCO A;  3C1S A;  5J3R A;  5ABR A;  4L0W A;  2P5Q A;  3EWL A;  5GZZ B;  4J2F A;  3WGX A;  3M9J A;  3ZRE A;  2V1M A;  5ID2 B;  2YAN A;  1PX6 A;  3O3T A;  4AJ8 A;  1ZZY A;  5DDL A;  1NHO A;  5LCZ A;  3TKS C;  4ZL9 A;  1SKR B;  4PX1 A;  2R6K A;  3FW2 A;  5F07 A;  1WOU A;  3IAS 2;  4MA9 A;  2CAQ A;  4JRR A;  1K0N A;  2AAW A;  2P31 A;  2R4V A;  1EEJ A;  3M8N A;  5GAP D;  2VM1 A;  2B5E A;  4OO4 A;  2VCT A;  3EU3 A;  2YJ7 A;  6GSX A;  1Z7P A;  5ECN B;  3CTF A;  3TKQ A;  3VPQ A;  4Q5R A;  1Q98 A;  1ERW A;  3EMX A;  4F0C A;  5EPF A;  4EXJ A;  1SJ6 A;  3NOF A;  2O85 A;  3ZFB A;  1J0F A;  2LUS A;  2OE1 A;  3GL3 A;  2DJJ A;  5DCG A;  2IME A;  5CO3 A;  2J23 A;  1FVK A;  1MDJ A;  4PQ1 A;  1TTZ A;  3D4M A;  4GCI A;  4Q5Q A;  5AIV A;  20GS A;  3VLN A;  1A8L A;  3U6V A;  3KP9 A;  2CX3 A;  5G5E A;  2NVL A;  1X9W B;  3RHC A;  3KMO A;  4NXI A;  5E4W A;  3EYT A;  4I8B A;  1BED A;  4MJC A;  2CZ3 A;  4IVF A;  1MTC A;  4GTU A;  4XIH A;  2AJQ B;  3IBH A;  4TR3 A;  2VD1 A;  6GSY A;  2YWN A;  4ECC A;  4F9Z A;  1GUM A;  3VI7 A;  2AHE A;  5DAK A;  2O89 A;  4ZIL A;  1X5E A;  5CP1 A;  2H74 A;  4GWR A;  4HS1 A;  4RI7 A;  4ZBD A;  3GNJ A;  3BCI A;  2JZT A;  2YPM A;  5AN1 A;  3L78 A;  2FA4 A;  5FWG A;  5CRD A;  3RPN A;  4IP6 A;  1TRU A;  2CVK A;  1Z3E A;  5L71 A;  5COH A;  2YV9 A;  3ZZX A;  1SD8 A;  1SYX A;  3IA1 A;  5AIX A;  1PL2 A;  3N5O A;  4DSS A;  4EE0 A;  1H4O A;  4N10 A;  3G7Y A;  1GTB A;  3GTU B;  3HJM A;  1E2Y A;  4LL4 B;  1GSQ A;  1GLP A;  1SL0 B;  2L59 A;  3DGQ A;  3VWX A;  2YWM A;  1M2B A;  3G7J A;  1V9W A;  5G31 A;  5ELG A;  2A2S A;  1EOG A;  2VAF A;  2CV4 A;  2AYT A;  1R26 A;  5EL8 A;  5FT3 A;  2R3X A;  4TR0 A;  2F3M A;  1EWX A;  2HZF A;  3HVX A;  1V2A A;  3TDG A;  3NZN A;  2B3S A;  2YZU A;  2C0E A;  5IO0 A;  1VGL A;  1QUW A;  1TK8 B;  1SU9 A;  5ELA A;  4KDY A;  5H5R A;  1JFU A;  3ZL5 A;  3ZIJ A;  5ECO B;  4I2T A;  1ZMA A;  1AQW A;  4AF2 A;  3FR3 A;  4ECI A;  4KW6 A;  1XWA A;  1JZD A;  5HR1 A;  4DSR A;  5IMZ A;  1GWC A;  1HD2 A;  4G9H A;  4EVM A;  1LJR A;  2LV3 A;  1QXH A;  2PN8 A;  2FCH A;  3MSZ A;  1UA5 A;  1TXX A;  2HZE A;  1ZCP A;  1SL1 B;  2H0I A;  4HI7 A;  1DUG A;  1GNW A;  2H1A A;  3FYG A;  3WGD A;  2M46 A;  1MDI A;  1R4W A;  2IFQ A;  3EMP A;  4KDX A;  2OE3 A;  4NV2 A;  4XCS A;  4CW9 A;  1EGR A;  1C72 A;  1M0U A;  1YZX A;  2DC5 A;  4LLR A;  1EP7 A;  1PA3 A;  3LJR A;  5JWO B;  2F8F A;  3QD9 A;  1Z5Y E;  2J9H A;  5D9T A;  2DMM A;  3G7I A;  2I4A A;  3APO A;  1SKW B;  3PIN A;  2JAC A;  2F51 A;  1N8J A;  1ILO A;  2DJK A;  5JCU A;  2H76 A;  3EC3 A;  3RDW A;  4ECJ A;  2RUE A;  4V2N A;  5D8I A;  4IN0 A;  1OKD A;  4O7H A;  1O8W A;  3E3E A;  5H5S A;  1NSW A;  2WZ9 A;  2GZZ A;  2JL4 A;  2IJY A;  4N30 A;  5DQY A;  4EF0 A;  3QFB C;  3H79 A;  2R2J A;  2FD3 A;  5JWQ B;  4OFN A;  3O6T A;  2NTO A;  1FW1 A;  1XOA A;  3CYN A;  4HQZ A;  3PGT A;  2H75 A;  4F2I A;  1TU7 A;  4I2U A;  4NPB A;  2B5X A;  3F63 A;  2FHE A;  3KH9 A;  1BG5 A;  4KCA A;  2L5O A;  5GSS A;  2VCX A;  1H75 A;  2WGR A;  4DEJ A;  2N5F A;  2GSS A;  1SK0 A;  3GL5 A;  3KGK A;  4RUV A;  4BWQ A;  1T4Y A;  3D4T A;  1X0R A;  2LKU A;  3F8U A;  1G6W A;  2WRT A;  2WFC A;  2ZCT A;  1T1V A;  5IMD A;  2C80 A;  2LRN A;  5HFI A;  2VLU A;  2OKA A;  2HRF A;  1E6B A;  1BYE A;  3ZIV A;  1ZGN A;  1AAZ A;  3J7Y b;  3ISO A;  4L0U A;  4KH7 A;  1U3A A;  3HVS A;  2GZY A;  5ECK B;  1N2A A;  3ZLP A;  2MMN A;  3KXO A;  2F9S A;  4V2L A;  5DAK B;  1XW6 A;  2LTK A;  3M3M A;  2FNO A;  2AV4 A;  2GSQ A;  1PKZ A;  2H19 A;  4BVY A;  2JZS A;  5J4U A;  2VCV A;  2IWT A;  2H6Y A;  1DSB A;  4ID0 A;  1Z7R A;  19GS A;  3CTG A;  1R5A A;  2H6Z A;  17GS A;  4NMU A;  2D2Z A;  5HR0 A;  3GH6 A;  4AJ7 A;  4MJB A;  4K2D A;  1TDI A;  1JLW A;  1HQO A;  2X8G A;  4HJ2 A;  2OBI A;  1DE1 A;  2XHF A;  4MP4 A;  1M2D A;  3S9F A;  4XS6 A;  3CSH A;  3DD3 A;  4DSS B;  3UL3 A;  3I69 A;  5B8A A;  2V32 A;  2DIY A;  4POL A;  3C1R A;  5HQP A;  3I43 A;  4FYC A;  3GRX A;  1GTU A;  3IOS A;  3QOU A;  2H0H A;  3C73 A;  5DJM A;  1USB A;  10GS A;  2JSY A;  2GGT A;  2BTO T;  2VL2 C;  2KOK A;  1JZO A;  5J5N A;  2C8U A;  1XVQ A;  2X99 A;  1X9S B;  3D0Z A;  2VCQ A;  5CRE A;  3TKS A;  3CXG A;  3GA4 A;  4ULX A;  4L8E A;  2VIM A;  1AUC A;  3CRU A;  1OE8 A;  3LWA A;  3W8J A;  2KP1 A;  1XZO A;  3KCM A;  4QQ7 A;  3MAK A;  3EUR A;  4BA7 A;  5A4U A;  2LJK A;  4YAV A;  4YH2 A;  1ACV A;  2GT5 A;  3LEF A;  1X5C A;  4PGT A;  2LS5 A;  3E0U A;  3PH9 A;  1FB0 A;  4WXT A;  2VOC A;  3WT1 A;  3CSI A;  4ZIJ A;  2DJ2 A;  1X5D A;  1NHY A;  2H30 A;  4POM A;  4TRX A;  3L9U A;  2EIQ A;  3UJ1 A;  1K3Y A;  2OE0 A;  4ACS A;  2ZUP A;  2QKE A;  1SKS B;  3L4N A;  3GKK A;  4RQX A;  2YWI A;  3DEX A;  3D5J A;  1T00 A;  4WR4 A;  3WGE A;  4X43 A;  5A4V A;  1GL8 A;  2HZE B;  1SEN A;  4EDZ A;  1VF3 A;  3TRP A;  4K6X A;  4TW5 A;  3ZYW A;  1HYU A;  3DVX A;  5DAL A;  1AQV A;  1PMT A;  3FR9 A;  2IFQ B;  2GST A;  3FR6 A;  3D22 A;  2HLS A;  4WF4 A;  4GXZ A;  3MNG A;  3KM6 A;  2PU9 C;  4ZL7 A;  9GSS A;  4WF5 A;  2C3T A;  2H0G A;  3BJ5 A;  4X0X A;  4EL1 A;  5G30 A;  5B6N A;  3TKR A;  1EOH A;  3H93 A;  4JR4 A;  4WBJ A;  2YJH A;  1K0B A;  3HJP A;  4JR6 A;  5DQS A;  3KZQ A;  1ST9 A;  4LMW A;  1YEX A;  5J41 A;  4FYB A;  4K9Z A;  2EC4 A;  4TKY A;  3LQ7 A;  4K7I A;  5DBQ A;  4MPG A;  3QAG A;  1B4P A;  1FHE A;  3C7M A;  5DVB A;  2FWE A;  1EV4 A;  1HNC A;  1XCC A;  1FG4 A;  5DCH A;  2F8A A;  4IJ3 A;  3TB2 A;  1MD3 A;  7GSS A;  2H72 A;  1K0O A;  5B6M A;  2K6V A;  1BAY A;  1F6M C;  1JHB A;  2OAD A;  2QC7 A;  2LST A;  1G6Y A;  4MLY A;  2CAI A;  4OWY A;  4DSQ A;  2OAC A;  4IJI A;  4DVC A;  1ML6 A;  3RAZ A;  4EO3 A;  3F4S A;  1GUK A;  1TW9 A;  3FZ9 A;  1BQ7 A;  4XS4 A;  4QL9 A;  3IPZ A;  2G0F A;  2O87 A;  4N11 A;  4XHM A;  2CT6 A;  3ZVJ A;  3LXZ A;  1XPV A;  2VCW A;  1VF4 A;  2B1L A;  2I81 A;  2LQQ A;  5F8B A;  1K0C A;  2REM A;  3NIV A;  1ZYE A;  1W4V A;  3LG6 A;  5AIS A;  1UVZ A;  1ON4 A;  4NHZ A;  3KTB A;  4ZL8 A;  1TKD B;  3O76 A;  2L6D A;  1AQX A;  2QSI A;  3A2X A;  2I3Y A;  4ILF A;  4HOJ A;  1G7O A;  1SD9 A;  5GAN D;  3GUS A;  4AJ6 A;  1S3D A;  5CYY A;  1KBN A;  1FOV A;  2WS2 A;  3EU4 A;  5G2Z A;  1VF2 A;  2DIZ A;  3TJK A;  1GLQ A;  1SYR A;  2AUV A;  1MDK A;  2PBJ A;  3GYK A;  2XBI A;  1TRV A;  3UVT A;  3PR8 A;  1AXD A;  4Z7X A;  4FYU A;  3C8E A;  1OE7 A;  2DJ1 A;  4IQ1 A;  6GSW A;  1PD2 1;  1AC1 A;  2Z9S A;  5A4W A;  2GQM A;  4KSM A;  3TUE A;  4F82 A;  2H01 A;  2CX4 A;  2K8V A;  2KLX A;  4KAE A;  1JZW A;  4EDY A;  2GT6 A;  5B8B A;  3DRN A;  1TI3 A;  2V2G A;  3GX8 A;  3V1W A;  1M7T A;  4GRF A;  4KGI A;  4V1A g;  5ECH B;  2FY6 A;  5EY6 A;  2DBC A;  2E0Q A;  1O85 A;  1IYI A;  1V40 A;  4KB3 A;  1WPI A;  1EEM A;  4BVX A;  3WT2 A;  4ZB6 A;  2YP6 A;  2BJX A;  1B9Y C;  3QR6 A;  2PPT A;  1DE2 A;  1QFN A;  1QMV A;  2FGX A;  2NBS A;  6GST A;  4BPY A;  1ABA A;  5ECM B;  3HYP A;  5C04 A;  1AIU A;  1S3A A;  3EVI A;  3A2V A;  2VLT A;  3K8N A;  5KN3 A;  2O8V B;  1WJK A;  4YQV A;  13GS A;  2PER A;  3ERG A;  1BJX A;  4GSS A;  1RK4 A;  4O92 A;  4TXO A;  2TRC P;  5A5K A;  2H1D A;  6GSS A;  3QAV A;  4HJM A;  2MBS A;  4MDC A;  1GNE A;  3VI5 A;  5J9C A;  3CRT A;  2TIR A;  4PUA A;  3HXS A;  1CQG A;  5HR3 A;  1EV9 A;  1YDK A;  2PWJ A;  1TJD A;  4Q5F A;  5DAL B;  2K9F A;  2RM5 A;  4JED A;  2HNL A;  5IO2 A;  2YZH A;  1LU4 A;  1A2M A;  2R5G A;  4WEY A;  3UAP A;  2OJL A;  3IXR A;  1YQ1 A;  2WUL A;  3LXT A;  3KJY A;  2GZP A;  18GS A;  3TJB A;  4KDU A;  3F0I A;  2FWG A;  3KIJ A;  3H4K A;  1G7E A;  3UBK A;  4G10 A;  4I5Q A;  3IHQ A;  2B6M A;  4HU9 A;  2GS3 A;  3HZ4 A;  1WWJ A;  4IW9 A;  4PNG A;  1EGO A;  3IK7 A;  3CSJ A;  2XPD A;  1B8X A;  1R7H A;  2H66 A;  5IPH A;  1SL2 B;  1KTE A;  1PRX A;  4XTS A;  2ON5 A;  3ZTL A;  2G2Q A;  2FWH A;  22GS A;  2YV7 A;  1NM3 A;  12GS A;  3DWV A;  1GSS A;  2IIY A;  3ZML A;  3IC4 A;  3ZVJ D;  3IR4 A;  2FWF A;  2L57 A;  2E2M A;  1Z6N A;  4TN8 A;  3LGC A;  3A3T A;  1GRX A;  4PNF A;  2XC2 A;  3R2Q A;  1A24 A;  3D21 A;  3VFI A;  1SJI A;  2C0D A;  4P3Y B;  1I9D A;  2L4C A;  4OO5 A;  1J08 A;  3VPT A;  5G1L A;  2B5Y A;  4Q5N A;  1B9X C;  4JU5 A;  2VL2 A;  1UC7 A;  3L0H A;  3TKS E;  2VD0 A;  1PSQ A;  4XS4 B;  1FO5 A;  2RM6 A;  2LNT A;  5DJL A;  4HZ2 A;  1ERV A;  4N0V A;  4OCF A;  4TR1 B;  5HFK A;  3QMX A;  3BCK A;  4MPF A;  5ECP B;  3FEU A;  3GFK A;  1Z9H A;  5INY A;  5JCW A;  1PL1 A;  4D73 A;  4K7O A;  4KX4 A;  1R5P A;  2RUF A;  4XRA A;  2E7P A;  1HNB A;  2VL9 A;  4K0N A;  2L5L A;  3BD2 A;  2GTU A;  3DVW A;  2HSY A;  3AY8 A;  3LYK A;  1A8Y A;  1WIK A;  3L9S A;  1M99 A;  2H1G A;  2VCZ A;  4N0Z A;  1Y6E A;  4F03 A;  3WYW A;  2MYG A;  3F9U A;  2DML A;  1I5G A;  2HT9 A;  2WJU A;  3GKX A;  4MCU A;  2VL3 A;  4J56 E;  3Q18 A;  3F6F A;  3GST A;  5IMC A;  4FO5 A;  1V98 A;  5D9W A;  2YN1 A;  3RBT A;  5EVO A;  3ZRD A;  1OKT A;  3DIE A;  5HR2 A;  1ERT A;  4KUN A;  1Q4J A;  1T3B A;  2V6K A;  2ALB A;  1TK0 B;  3HY2 A;  3HJO A;  1F37 A;  1K0D A;  2MMZ A;  3VK9 A;  1WMJ A;  4PQH A;  2X8H A;  1THO A;  4HU7 A;  3HKR A;  4GQF A;  2HSH A;  2VLV A;  3QFA C;  4K7N A;  4I6X A;  3G9B A;  2JSZ A;  4OCE A;  2VO4 A;  4MZW A;  4PUR A;  1THX A;  4YAP A;  3GN3 A;  1URM A;  1J9B A;  3HVV A;  2CVD A;  3CBU A;  2A2R A;  1XIY A;  1PKW A;  3P8W A;  3GKN A;  2HE3 A;  3LFL A;  2O7K A;  3TOU A;  2MMA A;  4G19 A;  4LA1 A;  1V58 A;  1YF1 A;  1TP9 A;  3GHA A;  5ENU A;  3VWV A;  1QQ2 A;  1OC9 A;  2YOI A;  5ECR B;  3I9V 2;  2LRT A;  3ERF A;  2C0F A;  1XWB A;  4TXO B;  4ZB8 A;  4MF6 A;  1YKA A;  3UMA A;  2A4V A;  4K0G A;  1OVN A;  2NPB A;  3DML A;  4YQM A;  1PGT A;  2KP2 A;  5F06 A;  3W8S A;  1B4Q A;  2LQO A;  3TKP A;  1K0M A;  4F0B A;  2IL3 A;  3IRA A;  2B1K A;  2H73 A;  2IMF A;  1QGV A;  2H8L A;  3H1N A;  1W89 A;  4FIW A;  4TVE A;  2XBQ A;  3D6I A;  1GTA A;  2CA8 A;  2PUK C;  4CHS A;  4OFT A;  2IN3 A;  2K8S A;  1RW1 A;  5ECI B;  2VM2 A;  3Q19 A;  3FHK A;  4ML6 A;  4EUY A;  3UOM A;  3QCP A;  3WD6 A;  4ISD A;  3SBC A;  1TRW A;  2PGT A;  4MZB A;  5J9B A;  2GLR A;  5D93 A;  3UVH A;  3ZIT A;  1U6T A;  2FLS A;  1XVW A;  3FRC A;  4GQC A;  1S3C A;  2MMO A;  4MAB A;  4RQR A;  5E59 A;  4H86 A;  1GH2 A;  1Z6M A;  1JZR A;  3IDV A;  2C3N A;  1XW5 A;  3A2W A;  3RPP A;  2PMT A;  4NHW A;  5ECL B;  1YEP A;  1B48 A;  1FVJ A;  1M9A A;  1EZK A;  2FA8 A;  3P90 A;  3M9K A;  4OFM A;  1M9B A;  1TOF A;  1T8E B;  4POB A;  4I97 A;  2IMK A;  1OYJ A;  3JCM L;  2P5R A;  3F3R A;  3E9J B;  2ZNM A;  4MH3 A;  4K1F A;  1XWC A;  1TRS A;  2YNX A;  1U3I A;  3APS A;  4TR1 A;  3N9J A;  4PQI A;  5D9V A;  2X64 A;  2QGV A;  4E8E A;  3TRX A;  3P7X A;  8GSS A;  4HZ4 A;  3APQ A;  2B7K A;  3ZMK A;  2M72 A;  1FB6 A;  2E2G A;  1PN9 A;  4MJA A;  5IPG A;  3W6G A;  4IHU A;  3HDC A;  2RLI A;  4KSO A;  3F4T A;  1O8X A;  3IAM 2;  3DXB A;  1OC8 A;  2B7J A;  4X1U A;  4O32 A;  3FKF A;  4D73 B;  14GS A;  4TR4 A;  3GUR A;  2KUC A;  4IGJ A;  3HHV A;  2H71 A;  4G2E A;  3MWH A;  1GSF A;  1XWK A;  3KP8 A;  2JZR A;  3LYP A;  4IQA A;  5D96 A;  1F9M A;  4KCE A;  3CMI A;  2V41 A;  3HZ8 A;  5KEJ A;  3KH7 A;  4MZC A;  5AGY A;  2DLX A;  1OAZ A;  1GUH A;  3EE2 A;  4NWY A;  1U87 A;  1TI1 A;  1A0R P;  3GSS A;  4MK3 A;  4RI6 A;  1LBK A;  3UIW A;  4PUF C;  1X9M B;  4IS0 A;  1K3L A;  2LEG A;  2DJ3 A;  5F0G A;  2IMD A;  3LOR A;  2WDU A;  1UN2 A;  3I6A A;  3TRQ A;  1KEB A;  1K3O A;  1BX9 A;  1O73 A;  2C0G A;  2HYX A;  5CRW A;  1GSE A;  5CRH A;  3FZ4 A;  4HEA 2;  4JE1 A;  1NW2 A;  1YKC A;  5LD0 A;  1WRY A;  3GIX A;  2RII A;  1U88 A;  2C4J A;  2ON7 A;  3UEM A;  2IPA A;  6GSV A;  4MH2 A;  3ME8 A;  4GF0 A;  4MMM A;  3MDK A;  4ZBA A;  1SK2 A;  1ERU A;  5JCG A;  1F3A A;  3LSZ A;  5ECS A;  2V6O A;  5D9X A;  1ZL9 A;  4L5O A;  2GQK A;  3M1G A;  4ML1 A;  1EP8 A;  2ES7 A;  2CQ9 A;  5ID2 A;  4HQS A;  5CRG A;  1HNA A;  2IMI A;  3HD5 A;  1OC9 B;  3RHB A;  2LRC A;  1G0T A;  1ZOF A;  11GS A;  1YF0 A;  4EKZ A;  1WP0 A;  2HI7 A;  1XWG A;  4GLT A;  4LL1 B;  5IMV A;  4HUA A;  1XOB A;  2M80 A;  1F2E A;  2CZ2 A;  3P2A A;  3A5W A;  3HA9 A;  2CVB A;  4K8M A;  1GP1 A;  3TOT A;  3IV4 A;  3DKS A;  5IIZ A;  4JBB A;  3F4R A;  4GSN A;  3GV1 A;  1T4Z A;  4V2M A;  1RQM A;  3GKM A;  3ZFL A;  2DSA A;  4HDE A;  2WB9 A;  2L4Q A;  2LNS A;  3UAR A;  3ED3 A;  2BMX A;  2YCD A;  1GUL A;  4TOP A;  5LNK e;  5G1K A;  2K18 A;  2VUP A;  3M0F A;  3ERW A;  4NAX A;  5IMA A;  3BOA A;  4EC0 A;  2JAD A;  3EIN A;  5GST A;  3QAW A;  2OBK A;  4WET A;  1T7P B;  3FZ5 A;  1AW9 A;  1PQN A;  2H6X A;  1IYH A;  4L5L A;  2PVO C;  5IOX A;  4XS1 A;  4KA0 A;  3KTL A;  1GSY A;  2KHP A;  2L6C A;  2EIR A;  5C00 A;  5D73 A;  4TXV A;  1M2A A;  1MEK A;  1A0F A;  5G5F A;  4BL7 A;  3L9V A;  1PX7 A;  4MF5 A;  2N5B A;  4WR5 A;  3FK8 A;  1QK8 A;  1O6J A;  3GH9 A;  5ECQ B;  2PVQ A;  5KN2 A;  1OC3 A;  1YY7 A;  4J57 E;  3ME7 A;  2I1U A;  6GSU A;  1KNG A;  2C1Y A;  1SJZ A;  1XW9 A;  4POK A;  1CQH A;  1WE0 A;  3F3Q A;  2YWO A;  3Q74 A;  1ZYQ B;  1TU8 A;  4OD7 A;  4JZQ A;  3DYR A;  3VUR A;  4CDO A;  16GS A;  4O5R A;  4GST A;  4IEL A;  3QPM A;  3VWW A;  2H1B A;  1V57 A;  2MBT A;  4E8H A;  3QDN A;  1MD4 A;  4IP1 A;  1Y25 A;  2JU5 A;  2R37 A;  2I9H A;  1XFL A;  4PXO A;  3C71 A;  1SK1 A;  1A2L A;  4ZXG A;  5KN1 A;  5IMF A;  5IOW A;  4MJE A;  3H8Q A;  1YJ6 A;  3UBL A;  4KE3 A;  2C3Q A;  3IE3 A;  2FUG 2;  3GTU A;  3US3 A;  3TJG A;  4YQU A;  3HCZ A;  2EIO A;  1O7U A;  1A23 A;  3TJJ A;  2HRN A;  3FY7 A;  4V1A p;  2AB6 A;  2H70 A;  4LMV A;  3OR5 A;  3U5R E;  3BBY A;  5CNW A;  1XXU A;  2DJ0 A;  5CAX A;  5JWR B;  1GTI A;  5IM9 A;  1VF1 A;  2LJR A;  2GSR A;  1DBY A;  3FZA A;  3SWL A;  2HFD A;  2MZC A;  1VRS D;  3TJF A;  4BWS A;  4ECB A;  4MF7 A;  2X8C A;  4IKH A;  2WCI A;  4ZBB A;  4WBR D;  1GSD A;  4QL7 A;  1O81 A;  2HXK A;  3GX0 A;  5HFG A;  4FH8 A;  1TK5 B;  3KD0 A;  1A2J A;  2TRX A;  3GMF A;  3VWU A;  1K0A A;  1FAA A;  4AGS A;  4WKW A;  2OA7 A;  3F6D A;  2GQL A;  2NDO A;  1F3B A;  4ZB9 A;  2LJA A;  4XRD A;  5FHI A;  2N5A A;  5B7C A;  1JLV A;  4IBP A;  4OMV A;  3TGZ A;  5IQY A;  1XBS A;  5KN0 A;  5F05 A; 
#chains in the Genus database with same CATH topology
 3IK9 A;  3KMN A;  5H5Q A;  1GSU A;  2GDR A;  3Q6O A;  4EIQ A;  2XPE A;  2P0G A;  2GVP A;  3J7Y k;  4NV5 A;  4A5P A;  3KEB A;  4KND A;  3TCO A;  3C1S A;  5J3R A;  5ABR A;  4L0W A;  2P5Q A;  3EWL A;  5GZZ B;  4J2F A;  3WGX A;  3M9J A;  3ZRE A;  2V1M A;  5ID2 B;  2YAN A;  1PX6 A;  3O3T A;  4AJ8 A;  1ZZY A;  5DDL A;  1NHO A;  5LCZ A;  3TKS C;  4ZL9 A;  1SKR B;  4PX1 A;  2R6K A;  3FW2 A;  5F07 A;  1WOU A;  3IAS 2;  4MA9 A;  2CAQ A;  4JRR A;  1K0N A;  2AAW A;  2P31 A;  2R4V A;  1EEJ A;  3M8N A;  5GAP D;  2VM1 A;  2B5E A;  4OO4 A;  2VCT A;  3EU3 A;  2YJ7 A;  6GSX A;  1Z7P A;  5ECN B;  3CTF A;  3TKQ A;  3VPQ A;  4Q5R A;  1Q98 A;  1ERW A;  3EMX A;  3MYD A;  4F0C A;  5EPF A;  4EXJ A;  1SJ6 A;  3NOF A;  2O85 A;  3ZFB A;  1J0F A;  2LUS A;  2OE1 A;  3GL3 A;  2DJJ A;  5DCG A;  2IME A;  5CO3 A;  2J23 A;  1FVK A;  2DKI A;  1MDJ A;  4PQ1 A;  1TTZ A;  3D4M A;  4GCI A;  4Q5Q A;  5AIV A;  2HSM A;  20GS A;  3VLN A;  1A8L A;  3U6V A;  3KP9 A;  2CX3 A;  5G5E A;  2NVL A;  1X9W B;  3RHC A;  3KMO A;  4NXI A;  5E4W A;  3EYT A;  4I8B A;  1BED A;  4BL7 B;  4MJC A;  2CZ3 A;  4IVF A;  1MTC A;  4GTU A;  4XIH A;  2AJQ B;  3IBH A;  4TR3 A;  2VD1 A;  6GSY A;  2YWN A;  4K2X A;  4ECC A;  4F9Z A;  1GUM A;  3VI7 A;  2AHE A;  5DAK A;  2O89 A;  4ZIL A;  1X5E A;  5CP1 A;  4G0L A;  2H74 A;  4GWR A;  4HS1 A;  4RI7 A;  4ZBD A;  3GNJ A;  3BCI A;  2JZT A;  2YPM A;  5AN1 A;  3L78 A;  2FA4 A;  5FWG A;  5CRD A;  3RPN A;  4IP6 A;  1TRU A;  2CVK A;  1Z3E A;  5L71 A;  5COH A;  2YV9 A;  3ZZX A;  1SD8 A;  4Z2U A;  2R0P A;  1SYX A;  3IA1 A;  5AIX A;  1PL2 A;  3N5O A;  4DSS A;  4EE0 A;  1H4O A;  4N10 A;  3G7Y A;  1GTB A;  3GTU B;  3HJM A;  1E2Y A;  4LL4 B;  1GSQ A;  1GLP A;  1SL0 B;  2L59 A;  3DGQ A;  3VWX A;  2YWM A;  1M2B A;  3G7J A;  1V9W A;  2DKH A;  5G31 A;  5ELG A;  2A2S A;  1EOG A;  3IC8 A;  2VAF A;  2CV4 A;  2AYT A;  1R26 A;  5EL8 A;  5FT3 A;  2R3X A;  4TR0 A;  2F3M A;  1EWX A;  2HZF A;  3HVX A;  1V2A A;  3TDG A;  3NZN A;  4YKG A;  2B3S A;  2YZU A;  2C0E A;  5IO0 A;  1VGL A;  1QUW A;  1TK8 B;  1SU9 A;  5ELA A;  4KDY A;  5H5R A;  1JFU A;  3ZL5 A;  3ZIJ A;  5ECO B;  4I2T A;  1ZMA A;  1AQW A;  4AF2 A;  3FR3 A;  4ECI A;  4KW6 A;  3HVN A;  1XWA A;  1JZD A;  5HR1 A;  4DSR A;  5IMZ A;  1GWC A;  1HD2 A;  4G9H A;  4MNN A;  2A4H A;  4EVM A;  1LJR A;  2LV3 A;  1QXH A;  2PN8 A;  2FCH A;  3MSZ A;  1UA5 A;  1TXX A;  2HZE A;  1ZCP A;  1SL1 B;  2H0I A;  4HI7 A;  1DUG A;  1GNW A;  1PN0 A;  2H1A A;  3FYG A;  3WGD A;  2M46 A;  1MDI A;  1R4W A;  2IFQ A;  3EMP A;  4KDX A;  2OE3 A;  4NV2 A;  4XCS A;  4CW9 A;  1EGR A;  1C72 A;  1M0U A;  1YZX A;  2DC5 A;  4LLR A;  1EP7 A;  1PA3 A;  3LJR A;  5JWO B;  2F8F A;  3QD9 A;  1Z5Y E;  2J9H A;  5D9T A;  2DMM A;  3G7I A;  2I4A A;  3APO A;  1SKW B;  3PIN A;  2JAC A;  2F51 A;  1N8J A;  1ILO A;  2DJK A;  5JCU A;  2H76 A;  3EC3 A;  3RDW A;  4ECJ A;  2RUE A;  4V2N A;  5D8I A;  4IN0 A;  1OKD A;  4O7H A;  1O8W A;  3E3E A;  5H5S A;  1NSW A;  2WZ9 A;  2GZZ A;  2JL4 A;  2IJY A;  4N30 A;  5DQY A;  4EF0 A;  3QFB C;  3H79 A;  2R2J A;  2FD3 A;  5JWQ B;  4OFN A;  3O6T A;  2NTO A;  1FW1 A;  1XOA A;  3CYN A;  4HQZ A;  3PGT A;  2H75 A;  4KF9 A;  4F2I A;  1TU7 A;  4I2U A;  4NPB A;  2B5X A;  3F63 A;  2FHE A;  3KH9 A;  4ICY A;  1BG5 A;  4KCA A;  2L5O A;  5GSS A;  2VCX A;  1H75 A;  2WGR A;  4DEJ A;  2N5F A;  2GSS A;  1SK0 A;  3GL5 A;  3KGK A;  4RUV A;  4BWQ A;  1T4Y A;  3D4T A;  1X0R A;  2LKU A;  3F8U A;  1G6W A;  2WRT A;  2WFC A;  2ZCT A;  1T1V A;  5IMD A;  2C80 A;  2LRN A;  5HFI A;  2VLU A;  2OKA A;  2HRF A;  1E6B A;  1BYE A;  3ZIV A;  1ZGN A;  1AAZ A;  3J7Y b;  3ISO A;  4L0U A;  4KH7 A;  1U3A A;  2UZ8 A;  3HVS A;  2QA2 A;  2GZY A;  5ECK B;  1N2A A;  3ZLP A;  2MMN A;  3KXO A;  2F9S A;  4V2L A;  5DAK B;  1XW6 A;  2LTK A;  3M3M A;  2FNO A;  2AV4 A;  2GSQ A;  1PKZ A;  2H19 A;  4BVY A;  2JZS A;  5J4U A;  2VCV A;  2IWT A;  2H6Y A;  1DSB A;  4ID0 A;  1Z7R A;  19GS A;  3CTG A;  1R5A A;  2H6Z A;  17GS A;  4NMU A;  2D2Z A;  5HR0 A;  3GH6 A;  4AJ7 A;  4MJB A;  4K2D A;  1TDI A;  1JLW A;  1HQO A;  2X8G A;  4HJ2 A;  2OBI A;  1DE1 A;  2XHF A;  4MP4 A;  1M2D A;  3S9F A;  4XS6 A;  3CSH A;  3DD3 A;  4DSS B;  3UL3 A;  3I69 A;  5B8A A;  2V32 A;  2DIY A;  4POL A;  3C1R A;  5HQP A;  3I43 A;  4FYC A;  3GRX A;  1GTU A;  3IOS A;  3QOU A;  2H0H A;  3C73 A;  5DJM A;  1USB A;  10GS A;  2JSY A;  2GGT A;  3R3E A;  2BTO T;  2VL2 C;  2KOK A;  1JZO A;  5J5N A;  2C8U A;  1XVQ A;  2X99 A;  1X9S B;  3D0Z A;  2VCQ A;  5CRE A;  3TKS A;  1FOH A;  3CXG A;  3GA4 A;  4ULX A;  4L8E A;  2VIM A;  1AUC A;  3CRU A;  1OE8 A;  3LWA A;  3W8J A;  2KP1 A;  1XZO A;  3KCM A;  4QQ7 A;  3MAK A;  3EUR A;  4BA7 A;  5A4U A;  2LJK A;  4YAV A;  4YH2 A;  1ACV A;  2GT5 A;  3LEF A;  1X5C A;  4PGT A;  2LS5 A;  3E0U A;  3PH9 A;  1FB0 A;  4WXT A;  2VOC A;  3WT1 A;  3CSI A;  4ZIJ A;  2DJ2 A;  1X5D A;  1NHY A;  2H30 A;  4POM A;  4TRX A;  3L9U A;  2EIQ A;  3UJ1 A;  1K3Y A;  2OE0 A;  4ACS A;  4USS A;  1ZYP A;  3CQF A;  2ZUP A;  2QKE A;  1SKS B;  3L4N A;  3GKK A;  4RQX A;  2YWI A;  3DEX A;  3D5J A;  1T00 A;  4WR4 A;  3WGE A;  4X43 A;  5A4V A;  1GL8 A;  2HZE B;  1SEN A;  4EDZ A;  1VF3 A;  3TRP A;  4K6X A;  4TW5 A;  3ZYW A;  1HYU A;  3DVX A;  3PPU A;  5DAL A;  1AQV A;  1PMT A;  3FR9 A;  2IFQ B;  2GST A;  3FR6 A;  3D22 A;  2HLS A;  4WF4 A;  4GXZ A;  3MNG A;  3KM6 A;  2PU9 C;  4ZL7 A;  9GSS A;  4WF5 A;  2C3T A;  2H0G A;  3BJ5 A;  4X0X A;  4EL1 A;  5G30 A;  5B6N A;  3TKR A;  1EOH A;  3H93 A;  4JR4 A;  4WBJ A;  2YJH A;  1K0B A;  3HJP A;  4JR6 A;  5DQS A;  3KZQ A;  1ST9 A;  4LMW A;  1YEX A;  5J41 A;  4FYB A;  4K9Z A;  2EC4 A;  4TKY A;  3LQ7 A;  4K7I A;  5DBQ A;  4MPG A;  3QAG A;  1B4P A;  1FHE A;  3C7M A;  5DVB A;  2FWE A;  1EV4 A;  1HNC A;  1XCC A;  1FG4 A;  5DCH A;  2F8A A;  4IJ3 A;  3TB2 A;  1MD3 A;  7GSS A;  2H72 A;  1K0O A;  5B6M A;  2K6V A;  1BAY A;  4FQU A;  1F6M C;  1JHB A;  2OAD A;  2QC7 A;  2LST A;  1G6Y A;  4MLY A;  2CAI A;  4OWY A;  4DSQ A;  2OAC A;  4IJI A;  4DVC A;  1ML6 A;  3RAZ A;  4Z2R A;  4EO3 A;  3F4S A;  1GUK A;  1TW9 A;  3FZ9 A;  1BQ7 A;  4XS4 A;  4QL9 A;  3IPZ A;  2G0F A;  2O87 A;  4N11 A;  4XHM A;  2CT6 A;  5KOX A;  3ZVJ A;  3LXZ A;  1XPV A;  2VCW A;  1VF4 A;  2B1L A;  2I81 A;  2LQQ A;  5F8B A;  1K0C A;  2REM A;  3NIV A;  1ZYE A;  1W4V A;  3LG6 A;  5AIS A;  1UVZ A;  1ON4 A;  4NHZ A;  3KTB A;  4ZL8 A;  1TKD B;  3O76 A;  2L6D A;  1AQX A;  2QSI A;  3A2X A;  2I3Y A;  4ILF A;  4CY8 A;  1PFO A;  2X49 A;  4HOJ A;  4BVY B;  1G7O A;  4EIP A;  1SD9 A;  5GAN D;  3GUS A;  4AJ6 A;  1S3D A;  5CYY A;  1KBN A;  1FOV A;  2HRK A;  1M3J A;  2WS2 A;  3EU4 A;  5G2Z A;  1VF2 A;  2DIZ A;  3TJK A;  1GLQ A;  1SYR A;  2AUV A;  1MDK A;  2PBJ A;  3GYK A;  2XBI A;  1TRV A;  3UVT A;  3PR8 A;  1AXD A;  4Z7X A;  4FYU A;  3C8E A;  3FMW A;  1OE7 A;  2DJ1 A;  4IQ1 A;  6GSW A;  1PD2 1;  1AC1 A;  3MIX A;  2Z9S A;  5A4W A;  2GQM A;  4KSM A;  3TUE A;  4F82 A;  2H01 A;  2CX4 A;  2K8V A;  2KLX A;  4KAE A;  1JZW A;  4EDY A;  2GT6 A;  5B8B A;  3DRN A;  1TI3 A;  2V2G A;  4Z2T A;  3GX8 A;  3V1W A;  1M7T A;  4GRF A;  4KGI A;  4V1A g;  5ECH B;  2FY6 A;  5EY6 A;  2DBC A;  2E0Q A;  1O85 A;  1IYI A;  1V40 A;  4KB3 A;  1WPI A;  1EEM A;  4BVX A;  3WT2 A;  4ZB6 A;  2YP6 A;  2BJX A;  1B9Y C;  3QR6 A;  2PPT A;  1DE2 A;  1QFN A;  1QMV A;  2FGX A;  2NBS A;  6GST A;  1ZYN A;  4BPY A;  1ABA A;  5ECM B;  3HYP A;  5C04 A;  1AIU A;  1S3A A;  3EVI A;  3A2V A;  2VLT A;  3K8N A;  5KN3 A;  2O8V B;  4O5Q A;  1WJK A;  4YQV A;  13GS A;  2PER A;  3ERG A;  1BJX A;  4GSS A;  1RK4 A;  4O92 A;  4TXO A;  2TRC P;  5A5K A;  2H1D A;  6GSS A;  3QAV A;  4HJM A;  2MBS A;  4MDC A;  1GNE A;  3VI5 A;  5J9C A;  3CRT A;  2TIR A;  4PUA A;  3HXS A;  1CQG A;  5HR3 A;  1EV9 A;  1YDK A;  2PWJ A;  1TJD A;  4Q5F A;  5DAL B;  2K9F A;  2RM5 A;  4JED A;  2HNL A;  5IO2 A;  2YZH A;  1LU4 A;  1A2M A;  2R5G A;  4WEY A;  3UAP A;  2OJL A;  3IXR A;  1YQ1 A;  2WUL A;  3LXT A;  3KJY A;  2GZP A;  18GS A;  3TJB A;  4KDU A;  3F0I A;  2FWG A;  4G0K A;  3KIJ A;  3H4K A;  1G7E A;  3UBK A;  4G10 A;  4I5Q A;  3IHQ A;  2B6M A;  4HU9 A;  2GS3 A;  3HZ4 A;  1WWJ A;  4IW9 A;  4PNG A;  1EGO A;  3IK7 A;  3CSJ A;  2XPD A;  1B8X A;  1R7H A;  2H66 A;  5IPH A;  1SL2 B;  1KTE A;  1PRX A;  4XTS A;  2ON5 A;  3ZTL A;  2G2Q A;  2FWH A;  22GS A;  2YV7 A;  5KOW A;  1NM3 A;  12GS A;  3DWV A;  1GSS A;  2IIY A;  3ZML A;  3IC4 A;  3ZVJ D;  3IR4 A;  2FWF A;  2L57 A;  2E2M A;  1Z6N A;  4TN8 A;  3LGC A;  3A3T A;  1GRX A;  4PNF A;  2XC2 A;  3R2Q A;  1A24 A;  3D21 A;  3VFI A;  1SJI A;  2C0D A;  4P3Y B;  1I9D A;  2L4C A;  4OO5 A;  1J08 A;  3VPT A;  5G1L A;  2B5Y A;  4G0I A;  4Q5N A;  1B9X C;  4JU5 A;  2VL2 A;  1UC7 A;  3L0H A;  3TKS E;  2VD0 A;  1PSQ A;  4XS4 B;  1FO5 A;  2RM6 A;  2LNT A;  5DJL A;  4HZ2 A;  1ERV A;  4N0V A;  4OCF A;  4TR1 B;  5HFK A;  3QMX A;  3BCK A;  4MPF A;  5ECP B;  3FEU A;  3GFK A;  1Z9H A;  5INY A;  5JCW A;  1PL1 A;  4D73 A;  4K7O A;  4KX4 A;  1R5P A;  2RUF A;  4XRA A;  2E7P A;  1HNB A;  2VL9 A;  4K0N A;  2L5L A;  3BD2 A;  2GTU A;  3DVW A;  2HSY A;  3AY8 A;  3LYK A;  1A8Y A;  1WIK A;  3L9S A;  1M99 A;  2H1G A;  2VCZ A;  4N0Z A;  1Y6E A;  4F03 A;  3WYW A;  2MYG A;  3F9U A;  2DML A;  1I5G A;  2HT9 A;  4MCU A;  2WJU A;  3GKX A;  4K5R A;  2VL3 A;  4J56 E;  3Q18 A;  3F6F A;  3GST A;  5IMC A;  4FO5 A;  1V98 A;  5D9W A;  2YN1 A;  3RBT A;  5EVO A;  3ZRD A;  1OKT A;  3DIE A;  5HR2 A;  1ERT A;  4KUN A;  1Q4J A;  1T3B A;  2V6K A;  2ALB A;  1TK0 B;  3HY2 A;  3HJO A;  1F37 A;  1K0D A;  2MMZ A;  3VK9 A;  1WMJ A;  4PQH A;  2X8H A;  1THO A;  4HU7 A;  3HKR A;  4GQF A;  2HSH A;  2VLV A;  3QFA C;  4K7N A;  4I6X A;  3G9B A;  4BVX B;  2JSZ A;  4OCE A;  2VO4 A;  4MZW A;  4PUR A;  1THX A;  4YAP A;  3GN3 A;  1URM A;  1J9B A;  3HVV A;  2CVD A;  3CBU A;  2A2R A;  1XIY A;  1PKW A;  3P8W A;  3GKN A;  2HE3 A;  3LFL A;  2O7K A;  3TOU A;  2MMA A;  4G19 A;  4LA1 A;  1V58 A;  1YF1 A;  1TP9 A;  3GHA A;  5ENU A;  3VWV A;  1QQ2 A;  1OC9 A;  2YOI A;  5ECR B;  3I9V 2;  2LRT A;  3ERF A;  2C0F A;  1XWB A;  4TXO B;  4ZB8 A;  4MF6 A;  1YKA A;  3UMA A;  2A4V A;  4K0G A;  1OVN A;  2NPB A;  3DML A;  4YQM A;  1PGT A;  2KP2 A;  5F06 A;  3W8S A;  4HSC X;  2LQO A;  1B4Q A;  3TKP A;  1K0M A;  4PTS A;  2IL3 A;  3IRA A;  4F0B A;  2B1K A;  2H73 A;  2IMF A;  1QGV A;  2H8L A;  3H1N A;  1W89 A;  4FIW A;  4TVE A;  2XBQ A;  3D6I A;  1GTA A;  2CA8 A;  2PUK C;  4CHS A;  3IHG A;  4OFT A;  2IN3 A;  2K8S A;  1RW1 A;  5ECI B;  4CY6 A;  2VM2 A;  3Q19 A;  3FHK A;  2X4A A;  4ML6 A;  4EUY A;  3UOM A;  4YKF A;  3QCP A;  3WD6 A;  4ISD A;  3SBC A;  2QA1 A;  1TRW A;  2PGT A;  4MZB A;  5J9B A;  2GLR A;  5D93 A;  3UVH A;  3ZIT A;  1S3R A;  1U6T A;  2FLS A;  3EPT A;  1XVW A;  3FRC A;  4GQC A;  1S3C A;  2R0G A;  2MMO A;  4MAB A;  4RQR A;  5E59 A;  4H86 A;  1GH2 A;  1Z6M A;  1JZR A;  3IDV A;  2C3N A;  1XW5 A;  3A2W A;  3RPP A;  2PMT A;  4NHW A;  5ECL B;  1YEP A;  2R0C A;  1B48 A;  1FVJ A;  1M9A A;  1EZK A;  2FA8 A;  3P90 A;  3M9K A;  4OFM A;  3A5I A;  1M9B A;  1TOF A;  1T8E B;  4POB A;  4I97 A;  2IMK A;  1OYJ A;  3JCM L;  2P5R A;  3F3R A;  3E9J B;  2ZNM A;  4MH3 A;  4K1F A;  4O5U A;  1XWC A;  1TRS A;  2YNX A;  1U3I A;  3APS A;  4K5S A;  4TR1 A;  3N9J A;  4PQI A;  5D9V A;  1XG8 A;  2X64 A;  2QGV A;  4E8E A;  3TRX A;  3P7X A;  8GSS A;  4HZ4 A;  3APQ A;  2B7K A;  3ZMK A;  2M72 A;  1FB6 A;  2E2G A;  1PN9 A;  4MJA A;  5IPG A;  3W6G A;  4IHU A;  3HDC A;  2RLI A;  4KSO A;  3F4T A;  1O8X A;  3IAM 2;  3DXB A;  1OC8 A;  2B7J A;  4X1U A;  4O32 A;  3FKF A;  4D73 B;  14GS A;  4TR4 A;  3GUR A;  2KUC A;  5BRT A;  4IGJ A;  3HHV A;  2H71 A;  4G2E A;  3MWH A;  1GSF A;  1XWK A;  5BMU A;  3KP8 A;  2JZR A;  3LYP A;  4IQA A;  5D96 A;  1F9M A;  4KCE A;  3CMI A;  2V41 A;  3HZ8 A;  5KEJ A;  3KH7 A;  4MZC A;  4X4J A;  5AGY A;  2DLX A;  1OAZ A;  1GUH A;  3EE2 A;  4NWY A;  1U87 A;  1TI1 A;  1A0R P;  3GSS A;  4MK3 A;  4RI6 A;  1LBK A;  3UIW A;  4PUF C;  1X9M B;  4IS0 A;  1K3L A;  2LEG A;  2DJ3 A;  5F0G A;  2IMD A;  3LOR A;  2WDU A;  1UN2 A;  3I6A A;  3TRQ A;  1KEB A;  1K3O A;  1BX9 A;  1O73 A;  1M3I A;  2C0G A;  2HYX A;  5CRW A;  1GSE A;  5CRH A;  3FZ4 A;  4HEA 2;  4JE1 A;  3LW9 A;  1NW2 A;  1YKC A;  5LD0 A;  1WRY A;  3GIX A;  2RII A;  1U88 A;  2C4J A;  2ON7 A;  3UEM A;  2IPA A;  6GSV A;  4MH2 A;  3ME8 A;  4GF0 A;  4MMM A;  3MDK A;  4ZBA A;  1SK2 A;  1ERU A;  5JCG A;  1F3A A;  3LSZ A;  5ECS A;  2V6O A;  5D9X A;  1ZL9 A;  4L5O A;  2GQK A;  3M1G A;  4ML1 A;  1EP8 A;  2ES7 A;  2CQ9 A;  5ID2 A;  4HQS A;  5CRG A;  1HNA A;  2IMI A;  3HD5 A;  1OC9 B;  3RHB A;  2LRC A;  1G0T A;  1ZOF A;  11GS A;  1YF0 A;  4EKZ A;  1WP0 A;  2HI7 A;  1XWG A;  4GLT A;  4LL1 B;  5IMV A;  4HUA A;  1XOB A;  2M80 A;  1F2E A;  2CZ2 A;  2HRA A;  3P2A A;  3A5W A;  3HA9 A;  2CVB A;  4K8M A;  1GP1 A;  3TOT A;  3IV4 A;  3DKS A;  5IIZ A;  4JBB A;  3F4R A;  4GSN A;  3GV1 A;  1T4Z A;  4V2M A;  1RQM A;  3GKM A;  3ZFL A;  2DSA A;  4HDE A;  2WB9 A;  2L4Q A;  2LNS A;  3UAR A;  3ED3 A;  2BMX A;  2YCD A;  1GUL A;  4TOP A;  5LNK e;  5G1K A;  2K18 A;  2VUP A;  3M0F A;  3ERW A;  4NAX A;  5IMA A;  3BOA A;  4EC0 A;  2JAD A;  3EIN A;  5GST A;  3QAW A;  2OBK A;  4WET A;  1T7P B;  3FZ5 A;  1AW9 A;  1PQN A;  2H6X A;  1IYH A;  4L5L A;  2PVO C;  5IOX A;  4XS1 A;  4KA0 A;  3KTL A;  1GSY A;  2KHP A;  2L6C A;  2EIR A;  5C00 A;  5D73 A;  4TXV A;  1M2A A;  1MEK A;  1A0F A;  5G5F A;  4BL7 A;  3L9V A;  1PX7 A;  4MF5 A;  2N5B A;  4WR5 A;  3FK8 A;  1QK8 A;  1O6J A;  3GH9 A;  5ECQ B;  2PVQ A;  5KN2 A;  1OC3 A;  1YY7 A;  4J57 E;  3ME7 A;  2I1U A;  6GSU A;  1KNG A;  2C1Y A;  1SJZ A;  1XW9 A;  4POK A;  1CQH A;  1WE0 A;  3F3Q A;  2YWO A;  3Q74 A;  1ZYQ B;  1TU8 A;  4OD7 A;  4JZQ A;  3DYR A;  3VUR A;  4CDO A;  16GS A;  4O5R A;  4GST A;  4IEL A;  3QPM A;  3VWW A;  2H1B A;  1V57 A;  2MBT A;  4E8H A;  3QDN A;  1MD4 A;  4IP1 A;  1Y25 A;  2JU5 A;  2R37 A;  2I9H A;  1XFL A;  4PXO A;  3C71 A;  1SK1 A;  1A2L A;  4ZXG A;  5KN1 A;  5IMF A;  5IOW A;  4MJE A;  3H8Q A;  1YJ6 A;  3UBL A;  4BIK A;  4KE3 A;  2C3Q A;  3IE3 A;  2A2P A;  2FUG 2;  3GTU A;  3US3 A;  3TJG A;  4YQU A;  3HCZ A;  2EIO A;  1O7U A;  1A23 A;  3TJJ A;  2HRN A;  3FY7 A;  4V1A p;  2AB6 A;  2H70 A;  4LMV A;  3OR5 A;  3U5R E;  3BBY A;  5CNW A;  1XXU A;  2DJ0 A;  5CAX A;  5JWR B;  1GTI A;  5IM9 A;  1VF1 A;  2LJR A;  2GSR A;  1DBY A;  3FZA A;  3SWL A;  2HFD A;  2MZC A;  1VRS D;  3TJF A;  4BWS A;  4ECB A;  4MF7 A;  2X8C A;  4IKH A;  2WCI A;  4ZBB A;  4WBR D;  1GSD A;  4QL7 A;  1O81 A;  2HXK A;  3GX0 A;  5HFG A;  4FH8 A;  1TK5 B;  3KD0 A;  1A2J A;  2TRX A;  3GMF A;  3VWU A;  1K0A A;  1FAA A;  4AGS A;  4WKW A;  2OA7 A;  3F6D A;  2GQL A;  2NDO A;  1F3B A;  4ZB9 A;  2LJA A;  4XRD A;  5FHI A;  2N5A A;  5B7C A;  1JLV A;  4IBP A;  4OMV A;  3TGZ A;  5IQY A;  1XBS A;  5KN0 A;  5F05 A; 
#chains in the Genus database with same CATH homology
 3IK9 A;  3KMN A;  5H5Q A;  1GSU A;  2GDR A;  3Q6O A;  4EIQ A;  2XPE A;  2P0G A;  2GVP A;  3J7Y k;  4NV5 A;  4A5P A;  3KEB A;  4KND A;  3TCO A;  3C1S A;  5J3R A;  5ABR A;  4L0W A;  2P5Q A;  3EWL A;  5GZZ B;  4J2F A;  3WGX A;  3M9J A;  3ZRE A;  2V1M A;  5ID2 B;  2YAN A;  1PX6 A;  3O3T A;  4AJ8 A;  1ZZY A;  5DDL A;  1NHO A;  5LCZ A;  3TKS C;  4ZL9 A;  1SKR B;  4PX1 A;  2R6K A;  3FW2 A;  5F07 A;  1WOU A;  3IAS 2;  4MA9 A;  2CAQ A;  4JRR A;  1K0N A;  2AAW A;  2P31 A;  2R4V A;  1EEJ A;  3M8N A;  5GAP D;  2VM1 A;  2B5E A;  4OO4 A;  2VCT A;  3EU3 A;  2YJ7 A;  6GSX A;  1Z7P A;  5ECN B;  3CTF A;  3TKQ A;  3VPQ A;  4Q5R A;  1Q98 A;  1ERW A;  3EMX A;  3MYD A;  4F0C A;  5EPF A;  4EXJ A;  1SJ6 A;  3NOF A;  2O85 A;  3ZFB A;  1J0F A;  2LUS A;  2OE1 A;  3GL3 A;  2DJJ A;  5DCG A;  2IME A;  5CO3 A;  2J23 A;  1FVK A;  2DKI A;  1MDJ A;  4PQ1 A;  1TTZ A;  3D4M A;  4GCI A;  4Q5Q A;  5AIV A;  2HSM A;  20GS A;  3VLN A;  1A8L A;  3U6V A;  3KP9 A;  2CX3 A;  5G5E A;  2NVL A;  1X9W B;  3RHC A;  3KMO A;  4NXI A;  5E4W A;  3EYT A;  4I8B A;  1BED A;  4BL7 B;  4MJC A;  2CZ3 A;  4IVF A;  1MTC A;  4GTU A;  4XIH A;  2AJQ B;  3IBH A;  4TR3 A;  2VD1 A;  6GSY A;  2YWN A;  4K2X A;  4ECC A;  4F9Z A;  1GUM A;  3VI7 A;  2AHE A;  5DAK A;  2O89 A;  4ZIL A;  1X5E A;  5CP1 A;  4G0L A;  2H74 A;  4GWR A;  4HS1 A;  4RI7 A;  4ZBD A;  3GNJ A;  3BCI A;  2JZT A;  2YPM A;  5AN1 A;  3L78 A;  2FA4 A;  5FWG A;  5CRD A;  3RPN A;  4IP6 A;  1TRU A;  2CVK A;  1Z3E A;  5L71 A;  5COH A;  2YV9 A;  3ZZX A;  1SD8 A;  4Z2U A;  2R0P A;  1SYX A;  3IA1 A;  5AIX A;  1PL2 A;  3N5O A;  4DSS A;  4EE0 A;  1H4O A;  4N10 A;  3G7Y A;  1GTB A;  3GTU B;  3HJM A;  1E2Y A;  4LL4 B;  1GSQ A;  1GLP A;  1SL0 B;  2L59 A;  3DGQ A;  3VWX A;  2YWM A;  1M2B A;  3G7J A;  1V9W A;  2DKH A;  5G31 A;  5ELG A;  2A2S A;  1EOG A;  3IC8 A;  2VAF A;  2CV4 A;  2AYT A;  1R26 A;  5EL8 A;  5FT3 A;  2R3X A;  4TR0 A;  2F3M A;  1EWX A;  2HZF A;  3HVX A;  1V2A A;  3TDG A;  3NZN A;  4YKG A;  2B3S A;  2YZU A;  2C0E A;  5IO0 A;  1VGL A;  1QUW A;  1TK8 B;  1SU9 A;  5ELA A;  4KDY A;  5H5R A;  1JFU A;  3ZL5 A;  3ZIJ A;  5ECO B;  4I2T A;  1ZMA A;  1AQW A;  4AF2 A;  3FR3 A;  4ECI A;  4KW6 A;  1XWA A;  1JZD A;  5HR1 A;  4DSR A;  5IMZ A;  1GWC A;  1HD2 A;  4G9H A;  4MNN A;  2A4H A;  4EVM A;  1LJR A;  2LV3 A;  1QXH A;  2PN8 A;  2FCH A;  3MSZ A;  1UA5 A;  1TXX A;  2HZE A;  1ZCP A;  1SL1 B;  2H0I A;  4HI7 A;  1DUG A;  1GNW A;  1PN0 A;  2H1A A;  3FYG A;  3WGD A;  2M46 A;  1MDI A;  1R4W A;  2IFQ A;  3EMP A;  4KDX A;  2OE3 A;  4NV2 A;  4XCS A;  4CW9 A;  1EGR A;  1C72 A;  1M0U A;  1YZX A;  2DC5 A;  4LLR A;  1EP7 A;  1PA3 A;  3LJR A;  5JWO B;  2F8F A;  3QD9 A;  1Z5Y E;  2J9H A;  5D9T A;  2DMM A;  3G7I A;  2I4A A;  3APO A;  1SKW B;  3PIN A;  2JAC A;  2F51 A;  1N8J A;  1ILO A;  2DJK A;  5JCU A;  2H76 A;  3EC3 A;  3RDW A;  4ECJ A;  2RUE A;  4V2N A;  5D8I A;  4IN0 A;  1OKD A;  4O7H A;  1O8W A;  3E3E A;  5H5S A;  1NSW A;  2WZ9 A;  2GZZ A;  2JL4 A;  2IJY A;  4N30 A;  5DQY A;  4EF0 A;  3QFB C;  3H79 A;  2R2J A;  2FD3 A;  5JWQ B;  4OFN A;  3O6T A;  2NTO A;  1FW1 A;  1XOA A;  3CYN A;  4HQZ A;  3PGT A;  2H75 A;  4KF9 A;  4F2I A;  1TU7 A;  4I2U A;  4NPB A;  2B5X A;  3F63 A;  2FHE A;  3KH9 A;  4ICY A;  1BG5 A;  4KCA A;  2L5O A;  5GSS A;  2VCX A;  1H75 A;  2WGR A;  4DEJ A;  2N5F A;  2GSS A;  1SK0 A;  3GL5 A;  3KGK A;  4RUV A;  4BWQ A;  1T4Y A;  3D4T A;  1X0R A;  2LKU A;  3F8U A;  1G6W A;  2WRT A;  2WFC A;  2ZCT A;  1T1V A;  5IMD A;  2C80 A;  2LRN A;  5HFI A;  2VLU A;  2OKA A;  2HRF A;  1E6B A;  1BYE A;  3ZIV A;  1ZGN A;  1AAZ A;  3J7Y b;  3ISO A;  4L0U A;  4KH7 A;  1U3A A;  2UZ8 A;  3HVS A;  2QA2 A;  2GZY A;  5ECK B;  1N2A A;  3ZLP A;  2MMN A;  3KXO A;  2F9S A;  4V2L A;  5DAK B;  1XW6 A;  2LTK A;  3M3M A;  2FNO A;  2AV4 A;  2GSQ A;  1PKZ A;  2H19 A;  4BVY A;  2JZS A;  5J4U A;  2VCV A;  2IWT A;  2H6Y A;  1DSB A;  4ID0 A;  1Z7R A;  19GS A;  3CTG A;  1R5A A;  2H6Z A;  17GS A;  4NMU A;  2D2Z A;  5HR0 A;  3GH6 A;  4AJ7 A;  4MJB A;  4K2D A;  1TDI A;  1JLW A;  1HQO A;  2X8G A;  4HJ2 A;  2OBI A;  1DE1 A;  2XHF A;  4MP4 A;  1M2D A;  3S9F A;  4XS6 A;  3CSH A;  3DD3 A;  4DSS B;  3UL3 A;  3I69 A;  5B8A A;  2V32 A;  2DIY A;  4POL A;  3C1R A;  5HQP A;  3I43 A;  4FYC A;  3GRX A;  1GTU A;  3IOS A;  3QOU A;  2H0H A;  3C73 A;  5DJM A;  1USB A;  10GS A;  2JSY A;  2GGT A;  3R3E A;  2BTO T;  2VL2 C;  2KOK A;  1JZO A;  5J5N A;  2C8U A;  1XVQ A;  2X99 A;  1X9S B;  3D0Z A;  2VCQ A;  5CRE A;  3TKS A;  1FOH A;  3CXG A;  3GA4 A;  4ULX A;  4L8E A;  2VIM A;  1AUC A;  3CRU A;  1OE8 A;  3LWA A;  3W8J A;  2KP1 A;  1XZO A;  3KCM A;  4QQ7 A;  3MAK A;  3EUR A;  4BA7 A;  5A4U A;  2LJK A;  4YAV A;  4YH2 A;  1ACV A;  2GT5 A;  3LEF A;  1X5C A;  4PGT A;  2LS5 A;  3E0U A;  3PH9 A;  1FB0 A;  4WXT A;  2VOC A;  3WT1 A;  3CSI A;  4ZIJ A;  2DJ2 A;  1X5D A;  1NHY A;  2H30 A;  4POM A;  4TRX A;  3L9U A;  2EIQ A;  3UJ1 A;  1K3Y A;  2OE0 A;  4ACS A;  4USS A;  1ZYP A;  2ZUP A;  2QKE A;  1SKS B;  3L4N A;  3GKK A;  4RQX A;  2YWI A;  3DEX A;  3D5J A;  1T00 A;  4WR4 A;  3WGE A;  4X43 A;  5A4V A;  1GL8 A;  2HZE B;  1SEN A;  4EDZ A;  1VF3 A;  3TRP A;  4K6X A;  4TW5 A;  3ZYW A;  1HYU A;  3DVX A;  3PPU A;  5DAL A;  1AQV A;  1PMT A;  3FR9 A;  2IFQ B;  2GST A;  3FR6 A;  3D22 A;  2HLS A;  4WF4 A;  4GXZ A;  3MNG A;  3KM6 A;  2PU9 C;  4ZL7 A;  9GSS A;  4WF5 A;  2C3T A;  2H0G A;  3BJ5 A;  4X0X A;  4EL1 A;  5G30 A;  5B6N A;  3TKR A;  1EOH A;  3H93 A;  4JR4 A;  4WBJ A;  2YJH A;  1K0B A;  3HJP A;  4JR6 A;  5DQS A;  3KZQ A;  1ST9 A;  4LMW A;  1YEX A;  5J41 A;  4FYB A;  4K9Z A;  2EC4 A;  4TKY A;  3LQ7 A;  4K7I A;  5DBQ A;  4MPG A;  3QAG A;  1B4P A;  1FHE A;  3C7M A;  5DVB A;  2FWE A;  1EV4 A;  1HNC A;  1XCC A;  1FG4 A;  5DCH A;  2F8A A;  4IJ3 A;  3TB2 A;  1MD3 A;  7GSS A;  2H72 A;  1K0O A;  5B6M A;  2K6V A;  1BAY A;  4FQU A;  1F6M C;  1JHB A;  2OAD A;  2QC7 A;  2LST A;  1G6Y A;  4MLY A;  2CAI A;  4OWY A;  4DSQ A;  2OAC A;  4IJI A;  4DVC A;  1ML6 A;  3RAZ A;  4Z2R A;  4EO3 A;  3F4S A;  1GUK A;  1TW9 A;  3FZ9 A;  1BQ7 A;  4XS4 A;  4QL9 A;  3IPZ A;  2G0F A;  2O87 A;  4N11 A;  4XHM A;  2CT6 A;  5KOX A;  3ZVJ A;  3LXZ A;  1XPV A;  2VCW A;  1VF4 A;  2B1L A;  2I81 A;  2LQQ A;  5F8B A;  1K0C A;  2REM A;  3NIV A;  1ZYE A;  1W4V A;  3LG6 A;  5AIS A;  1UVZ A;  1ON4 A;  4NHZ A;  3KTB A;  4ZL8 A;  1TKD B;  3O76 A;  2L6D A;  1AQX A;  2QSI A;  3A2X A;  2I3Y A;  4ILF A;  4CY8 A;  2X49 A;  4HOJ A;  4BVY B;  1G7O A;  4EIP A;  1SD9 A;  5GAN D;  3GUS A;  4AJ6 A;  1S3D A;  5CYY A;  1KBN A;  1FOV A;  2HRK A;  2WS2 A;  3EU4 A;  5G2Z A;  1VF2 A;  2DIZ A;  3TJK A;  1GLQ A;  1SYR A;  2AUV A;  1MDK A;  2PBJ A;  3GYK A;  2XBI A;  1TRV A;  3UVT A;  3PR8 A;  1AXD A;  4Z7X A;  4FYU A;  3C8E A;  3FMW A;  1OE7 A;  2DJ1 A;  4IQ1 A;  6GSW A;  1PD2 1;  1AC1 A;  3MIX A;  2Z9S A;  5A4W A;  2GQM A;  4KSM A;  3TUE A;  4F82 A;  2H01 A;  2CX4 A;  2K8V A;  2KLX A;  4KAE A;  1JZW A;  4EDY A;  2GT6 A;  5B8B A;  3DRN A;  1TI3 A;  2V2G A;  4Z2T A;  3GX8 A;  3V1W A;  1M7T A;  4GRF A;  4KGI A;  4V1A g;  5ECH B;  2FY6 A;  5EY6 A;  2DBC A;  2E0Q A;  1O85 A;  1IYI A;  1V40 A;  4KB3 A;  1WPI A;  1EEM A;  4BVX A;  3WT2 A;  4ZB6 A;  2YP6 A;  2BJX A;  1B9Y C;  3QR6 A;  2PPT A;  1DE2 A;  1QFN A;  1QMV A;  2FGX A;  2NBS A;  6GST A;  1ZYN A;  4BPY A;  1ABA A;  5ECM B;  3HYP A;  5C04 A;  1AIU A;  1S3A A;  3EVI A;  3A2V A;  2VLT A;  3K8N A;  5KN3 A;  2O8V B;  4O5Q A;  1WJK A;  4YQV A;  13GS A;  2PER A;  3ERG A;  1BJX A;  4GSS A;  1RK4 A;  4O92 A;  4TXO A;  2TRC P;  5A5K A;  2H1D A;  6GSS A;  3QAV A;  4HJM A;  2MBS A;  4MDC A;  1GNE A;  3VI5 A;  5J9C A;  3CRT A;  2TIR A;  4PUA A;  3HXS A;  1CQG A;  5HR3 A;  1EV9 A;  1YDK A;  2PWJ A;  1TJD A;  4Q5F A;  5DAL B;  2K9F A;  2RM5 A;  4JED A;  2HNL A;  5IO2 A;  2YZH A;  1LU4 A;  1A2M A;  2R5G A;  4WEY A;  3UAP A;  2OJL A;  3IXR A;  1YQ1 A;  2WUL A;  3LXT A;  3KJY A;  2GZP A;  18GS A;  3TJB A;  4KDU A;  3F0I A;  2FWG A;  4G0K A;  3KIJ A;  3H4K A;  1G7E A;  3UBK A;  4G10 A;  4I5Q A;  3IHQ A;  2B6M A;  4HU9 A;  2GS3 A;  3HZ4 A;  1WWJ A;  4IW9 A;  4PNG A;  1EGO A;  3IK7 A;  3CSJ A;  2XPD A;  1B8X A;  1R7H A;  2H66 A;  5IPH A;  1SL2 B;  1KTE A;  1PRX A;  4XTS A;  2ON5 A;  3ZTL A;  2G2Q A;  2FWH A;  22GS A;  2YV7 A;  5KOW A;  1NM3 A;  12GS A;  3DWV A;  1GSS A;  2IIY A;  3ZML A;  3IC4 A;  3ZVJ D;  3IR4 A;  2FWF A;  2L57 A;  2E2M A;  1Z6N A;  4TN8 A;  3LGC A;  3A3T A;  1GRX A;  4PNF A;  2XC2 A;  3R2Q A;  1A24 A;  3D21 A;  3VFI A;  1SJI A;  2C0D A;  4P3Y B;  1I9D A;  2L4C A;  4OO5 A;  1J08 A;  3VPT A;  5G1L A;  2B5Y A;  4G0I A;  4Q5N A;  1B9X C;  4JU5 A;  2VL2 A;  1UC7 A;  3L0H A;  3TKS E;  2VD0 A;  1PSQ A;  4XS4 B;  1FO5 A;  2RM6 A;  2LNT A;  5DJL A;  4HZ2 A;  1ERV A;  4N0V A;  4OCF A;  4TR1 B;  5HFK A;  3QMX A;  3BCK A;  4MPF A;  5ECP B;  3FEU A;  3GFK A;  1Z9H A;  5INY A;  5JCW A;  1PL1 A;  4D73 A;  4K7O A;  4KX4 A;  1R5P A;  2RUF A;  4XRA A;  2E7P A;  1HNB A;  2VL9 A;  4K0N A;  2L5L A;  3BD2 A;  2GTU A;  3DVW A;  2HSY A;  3AY8 A;  3LYK A;  1A8Y A;  1WIK A;  3L9S A;  1M99 A;  2H1G A;  2VCZ A;  4N0Z A;  1Y6E A;  4F03 A;  3WYW A;  2MYG A;  3F9U A;  2DML A;  1I5G A;  2HT9 A;  4MCU A;  2WJU A;  3GKX A;  4K5R A;  2VL3 A;  4J56 E;  3Q18 A;  3F6F A;  3GST A;  5IMC A;  4FO5 A;  1V98 A;  5D9W A;  2YN1 A;  3RBT A;  5EVO A;  3ZRD A;  1OKT A;  3DIE A;  5HR2 A;  1ERT A;  4KUN A;  1Q4J A;  1T3B A;  2V6K A;  2ALB A;  1TK0 B;  3HY2 A;  3HJO A;  1F37 A;  1K0D A;  2MMZ A;  3VK9 A;  1WMJ A;  4PQH A;  2X8H A;  1THO A;  4HU7 A;  3HKR A;  4GQF A;  2HSH A;  2VLV A;  3QFA C;  4K7N A;  4I6X A;  3G9B A;  4BVX B;  2JSZ A;  4OCE A;  2VO4 A;  4MZW A;  4PUR A;  1THX A;  4YAP A;  3GN3 A;  1URM A;  1J9B A;  3HVV A;  2CVD A;  3CBU A;  2A2R A;  1XIY A;  1PKW A;  3P8W A;  3GKN A;  2HE3 A;  3LFL A;  2O7K A;  3TOU A;  2MMA A;  4G19 A;  4LA1 A;  1V58 A;  1YF1 A;  1TP9 A;  3GHA A;  5ENU A;  3VWV A;  1QQ2 A;  1OC9 A;  2YOI A;  5ECR B;  3I9V 2;  2LRT A;  3ERF A;  2C0F A;  1XWB A;  4TXO B;  4ZB8 A;  4MF6 A;  1YKA A;  3UMA A;  2A4V A;  4K0G A;  1OVN A;  2NPB A;  3DML A;  4YQM A;  1PGT A;  2KP2 A;  5F06 A;  3W8S A;  1B4Q A;  2LQO A;  3TKP A;  1K0M A;  4PTS A;  2IL3 A;  3IRA A;  4F0B A;  2B1K A;  2H73 A;  2IMF A;  1QGV A;  2H8L A;  3H1N A;  1W89 A;  4FIW A;  4TVE A;  2XBQ A;  3D6I A;  1GTA A;  2CA8 A;  2PUK C;  4CHS A;  3IHG A;  4OFT A;  2IN3 A;  2K8S A;  1RW1 A;  5ECI B;  4CY6 A;  2VM2 A;  3Q19 A;  3FHK A;  2X4A A;  4ML6 A;  4EUY A;  3UOM A;  4YKF A;  3QCP A;  3WD6 A;  4ISD A;  3SBC A;  2QA1 A;  1TRW A;  2PGT A;  4MZB A;  5J9B A;  2GLR A;  5D93 A;  3UVH A;  3ZIT A;  1U6T A;  2FLS A;  3EPT A;  1XVW A;  3FRC A;  4GQC A;  1S3C A;  2R0G A;  2MMO A;  4MAB A;  4RQR A;  5E59 A;  4H86 A;  1GH2 A;  1Z6M A;  1JZR A;  3IDV A;  2C3N A;  1XW5 A;  3A2W A;  3RPP A;  2PMT A;  4NHW A;  5ECL B;  1YEP A;  2R0C A;  1B48 A;  1FVJ A;  1M9A A;  1EZK A;  2FA8 A;  3P90 A;  3M9K A;  4OFM A;  3A5I A;  1M9B A;  1TOF A;  1T8E B;  4POB A;  4I97 A;  2IMK A;  1OYJ A;  3JCM L;  2P5R A;  3F3R A;  3E9J B;  2ZNM A;  4MH3 A;  4K1F A;  4O5U A;  1XWC A;  1TRS A;  2YNX A;  1U3I A;  3APS A;  4K5S A;  4TR1 A;  3N9J A;  4PQI A;  5D9V A;  2X64 A;  2QGV A;  4E8E A;  3TRX A;  3P7X A;  8GSS A;  4HZ4 A;  3APQ A;  2B7K A;  3ZMK A;  2M72 A;  1FB6 A;  2E2G A;  1PN9 A;  4MJA A;  5IPG A;  3W6G A;  4IHU A;  3HDC A;  2RLI A;  4KSO A;  3F4T A;  1O8X A;  3IAM 2;  3DXB A;  1OC8 A;  2B7J A;  4X1U A;  4O32 A;  3FKF A;  4D73 B;  14GS A;  4TR4 A;  3GUR A;  2KUC A;  5BRT A;  4IGJ A;  3HHV A;  2H71 A;  4G2E A;  3MWH A;  1GSF A;  1XWK A;  5BMU A;  3KP8 A;  2JZR A;  3LYP A;  4IQA A;  5D96 A;  1F9M A;  4KCE A;  3CMI A;  2V41 A;  3HZ8 A;  5KEJ A;  3KH7 A;  4MZC A;  4X4J A;  5AGY A;  2DLX A;  1OAZ A;  1GUH A;  3EE2 A;  4NWY A;  1U87 A;  1TI1 A;  1A0R P;  3GSS A;  4MK3 A;  4RI6 A;  1LBK A;  3UIW A;  4PUF C;  1X9M B;  4IS0 A;  1K3L A;  2LEG A;  2DJ3 A;  5F0G A;  2IMD A;  3LOR A;  2WDU A;  1UN2 A;  3I6A A;  3TRQ A;  1KEB A;  1K3O A;  1BX9 A;  1O73 A;  2C0G A;  2HYX A;  5CRW A;  1GSE A;  5CRH A;  3FZ4 A;  4HEA 2;  4JE1 A;  3LW9 A;  1NW2 A;  1YKC A;  5LD0 A;  1WRY A;  3GIX A;  2RII A;  1U88 A;  2C4J A;  2ON7 A;  3UEM A;  2IPA A;  6GSV A;  4MH2 A;  3ME8 A;  4GF0 A;  4MMM A;  3MDK A;  4ZBA A;  1SK2 A;  1ERU A;  5JCG A;  1F3A A;  3LSZ A;  5ECS A;  2V6O A;  5D9X A;  1ZL9 A;  4L5O A;  2GQK A;  3M1G A;  4ML1 A;  1EP8 A;  2ES7 A;  2CQ9 A;  5ID2 A;  4HQS A;  5CRG A;  1HNA A;  2IMI A;  3HD5 A;  1OC9 B;  3RHB A;  2LRC A;  1G0T A;  1ZOF A;  11GS A;  1YF0 A;  4EKZ A;  1WP0 A;  2HI7 A;  1XWG A;  4GLT A;  4LL1 B;  5IMV A;  4HUA A;  1XOB A;  2M80 A;  1F2E A;  2CZ2 A;  2HRA A;  3P2A A;  3A5W A;  3HA9 A;  2CVB A;  4K8M A;  1GP1 A;  3TOT A;  3IV4 A;  3DKS A;  5IIZ A;  4JBB A;  3F4R A;  4GSN A;  3GV1 A;  1T4Z A;  4V2M A;  1RQM A;  3GKM A;  3ZFL A;  2DSA A;  4HDE A;  2WB9 A;  2L4Q A;  2LNS A;  3UAR A;  3ED3 A;  2BMX A;  2YCD A;  1GUL A;  4TOP A;  5LNK e;  5G1K A;  2K18 A;  2VUP A;  3M0F A;  3ERW A;  4NAX A;  5IMA A;  3BOA A;  4EC0 A;  2JAD A;  3EIN A;  5GST A;  3QAW A;  2OBK A;  4WET A;  1T7P B;  3FZ5 A;  1AW9 A;  1PQN A;  2H6X A;  1IYH A;  4L5L A;  2PVO C;  5IOX A;  4XS1 A;  4KA0 A;  3KTL A;  1GSY A;  2KHP A;  2L6C A;  2EIR A;  5C00 A;  5D73 A;  4TXV A;  1M2A A;  1MEK A;  1A0F A;  5G5F A;  4BL7 A;  3L9V A;  1PX7 A;  4MF5 A;  2N5B A;  4WR5 A;  3FK8 A;  1QK8 A;  1O6J A;  3GH9 A;  5ECQ B;  2PVQ A;  5KN2 A;  1OC3 A;  1YY7 A;  4J57 E;  3ME7 A;  2I1U A;  6GSU A;  1KNG A;  2C1Y A;  1SJZ A;  1XW9 A;  4POK A;  1CQH A;  1WE0 A;  3F3Q A;  2YWO A;  3Q74 A;  1ZYQ B;  1TU8 A;  4OD7 A;  4JZQ A;  3DYR A;  3VUR A;  4CDO A;  16GS A;  4O5R A;  4GST A;  4IEL A;  3QPM A;  3VWW A;  2H1B A;  1V57 A;  2MBT A;  4E8H A;  3QDN A;  1MD4 A;  4IP1 A;  1Y25 A;  2JU5 A;  2R37 A;  2I9H A;  1XFL A;  4PXO A;  3C71 A;  1SK1 A;  1A2L A;  4ZXG A;  5KN1 A;  5IMF A;  5IOW A;  4MJE A;  3H8Q A;  1YJ6 A;  3UBL A;  4KE3 A;  2C3Q A;  3IE3 A;  2A2P A;  2FUG 2;  3GTU A;  3US3 A;  3TJG A;  4YQU A;  3HCZ A;  2EIO A;  1O7U A;  1A23 A;  3TJJ A;  2HRN A;  3FY7 A;  4V1A p;  2AB6 A;  2H70 A;  4LMV A;  3OR5 A;  3U5R E;  3BBY A;  5CNW A;  1XXU A;  2DJ0 A;  5CAX A;  5JWR B;  1GTI A;  5IM9 A;  1VF1 A;  2LJR A;  2GSR A;  1DBY A;  3FZA A;  3SWL A;  2HFD A;  2MZC A;  1VRS D;  3TJF A;  4BWS A;  4ECB A;  4MF7 A;  2X8C A;  4IKH A;  2WCI A;  4ZBB A;  4WBR D;  1GSD A;  4QL7 A;  1O81 A;  2HXK A;  3GX0 A;  5HFG A;  4FH8 A;  1TK5 B;  3KD0 A;  1A2J A;  2TRX A;  3GMF A;  3VWU A;  1K0A A;  1FAA A;  4AGS A;  4WKW A;  2OA7 A;  3F6D A;  2GQL A;  2NDO A;  1F3B A;  4ZB9 A;  2LJA A;  4XRD A;  5FHI A;  2N5A A;  5B7C A;  1JLV A;  4IBP A;  4OMV A;  3TGZ A;  5IQY A;  1XBS A;  5KN0 A;  5F05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...