2OJLA

Crystal structure of q7waf1_borpa from bordetella parapertussis. northeast structural genomics target bpr68.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
79
structure length
79
Chain Sequence
HPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of Q7WAF1_BORPA from Bordetella parapertussis
rcsb
source organism Bordetella parapertussis
molecule tags Structural genomics, unknown function
total genus 22
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ojlA00
5G1KA 4MF6A 4TKYA 5ECSA 1GWCA 2P0GA 3JCML 4OMVA 3CSJA 1A8LA 3IC4A 1EOHA 5DJMA 3DEXA 2P31A 4PURA 2X64A 3C1RA 4PQHA 3QOUA 5HFGA 3BOAA 5ECKB 1OC9A 3LEFA 2Z9SA 1A8YA 2C0EA 4ZB8A 1DE1A 1MDJA 2ZCTA 4JU5A 1WJKA 1GLPA 2HLSA 2CV4A 4BL7A 1OYJA 3UVTA 1AC1A 3SWLA 2IWTA 2LJKA 1SL1B 4TR1A 3C71A 3QDNA 1T7PB 3UAPA 4XS1A 5ECLB 1TKDB 1HNBA 1PGTA 4NHZA 4G2EA 4FH8A 3IRAA 2V6OA 1EP7A 2DMMA 3C73A 3FR6A 1X9WB 3WT2A 4MF5A 3FR9A 3A2XA 2YJHA 4ML6A 1RK4A 4HQZA 1T1VA 1AUCA 1XXUA 2EIRA 4BA7A 3GH9A 1GTIA 2PPTA 4MJEA 2GLRA 4K0GA 3KD0A 4OFNA 1YKAA 3W6GA 3GKKA 1TP9A 2R6KA 2H73A 4ZBBA 5HR2A 4PUAA 2L59A 1AIUA 1M0UA 2CQ9A 2PBJA 2YN1A 5A5KA 4IN0A 2NDOA 3ZTLA 3O76A 1JZWA 3EU3A 1X5EA 4AJ8A 3TRXA 2HSHA 5KN2A 2K18A 4FYBA 1VF1A 2B5YA 3TKSA 5GZZB 4HUAA 2C1YA 1TK5B 4FYUA 1GRXA 2JZTA 2VL9A 1OVNA 2WFCA 1J0FA 2KUCA 2YOIA 5JCGA 3RBTA 3VI5A 5J3RA 4ECIA 4JR4A 4IQAA 1JZRA 1NSWA 4HQSA 3VWUA 4KA0A 4X1UA 5GSSA 4I97A 2VL3A 2GSTA 2PVOC 4GRFA 3Q74A 1V57A 2FA4A 2GZPA 2C3QA 2H1DA 5A4WA 2VCXA 4KAEA 3RPPA 2B5EA 1M2BA 2PUKC 2DIYA 4J57E 1PSQA 3WGXA 1SL2B 4F2IA 3A2VA 3QMXA 4EKZA 3F6FA 4JRRA 4ISDA 5IPGA 4KCAA 3I69A 1JLWA 1YEPA 11GSA 2C0FA 4F03A 1XWKA 1M2DA 2OE1A 2P5RA 3QR6A 1ZGNA 4MJBA 2X99A 1B8XA 3MDKA 4Q5RA 4CW9A 3LWAA 1K0AA 1S3CA 5IOWA 4TN8A 2V6KA 3F4RA 4WR4A 1HYUA 4X43A 3M0FA 4CDOA 2WGRA 2HSYA 4QL9A 1X5DA 4DSRA 3Q18A 4EDZA 3F9UA 3D22A 3ERFA 1NM3A 3F63A 1THOA 2CT6A 2DJKA 3GYKA 3KIJA 1Y6EA 1K3YA 2GVPA 2IFQA 3DRNA 3ZMKA 2IMEA 1ZZYA 4NWYA 1N2AA 2HZEA 5J41A 4N30A 1GUMA 2L4QA 3ZRDA 1DBYA 1TW9A 3IV4A 1OC3A 4MK3A 1PRXA 4OFTA 3WGDA 3CSHA 1GTBA 4MABA 2FY6A 4JEDA 5CRDA 4BVXA 1MD4A 1H75A 3GSTA 4EVMA 4HU9A 1OAZA 2WJUA 1O85A 5HR3A 3APOA 4N11A 1OE8A 5JCWA 3HXSA 1SJIA 5ID2A 5B8AA 1PD21 1T4ZA 2VCZA 5AIXA 1GNWA 1R26A 4XCSA 5DAKB 1JLVA 2PN8A 2JZRA 3TKSE 3MAKA 1AW9A 2BMXA 4EDYA 3MNGA 4X0XA 4YQMA 3GURA 1O6JA 5DQSA 3UOMA 4F0CA 2H0HA 2MBSA 3KP9A 3M3MA 3TJKA 2JADA 4PQ1A 2N5FA 1S3AA 2R4VA 5G30A 1O8WA 3LSZA 5DBQA 3G7JA 1USBA 4XS4B 4WEYA 4WETA 5H5QA 2JU5A 5D9TA 3KH7A 5CNWA 2FWGA 3IDVA 3GTUA 2OACA 5IPHA 2N5BA 4L5OA 3R2QA 3TRQA 3TRPA 5HQPA 5ECRB 1SU9A 4POLA 5IMVA 1MD3A 2RLIA 3QAVA 2RUEA 5IMZA 1K3LA 3VK9A 5L71A 1XVWA 3WD6A 1FO5A 1EV4A 4O92A 3HCZA 1CQHA 2FCHA 3F4TA 1TJDA 1FB0A 4GCIA 3LG6A 1GH2A 3VFIA 5ECOB 3PINA 4FO5A 4IVFA 2AV4A 2RM5A 3LYKA 2JZSA 2AAWA 2M80A 5DVBA 2DIZA 2I3YA 2H6YA 4FIWA 2DJ3A 3G7IA 2VL2C 2BJXA 5G5FA 2O85A 4WKWA 3I6AA 3TKPA 4WXTA 3AY8A 3N5OA 3CBUA 1U3AA 1THXA 1V98A 2CZ2A 4ID0A 4KW6A 1OC8A 3DKSA 4IKHA 5F06A 4FYCA 4MCUA 3WGEA 3IBHA 3RAZA 2IMIA 5ECPB 4TXOA 4V1Ap 4LA1A 3GX0A 3P8WA 1GUHA 3I9V2 4EO3A 1EOGA 2YANA 5ECMB 3ZVJA 2TRCP 1GSEA 2M72A 2PERA 4KX4A 5ENUA 1X9SB 1QGVA 3HVXA 4MZWA 2OE3A 1M7TA 5KN3A 5EY6A 4K8MA 4DSSA 4TRXA 2HFDA 2HT9A 4AJ7A 1TU8A 2FWEA 1OKDA 4MMMA 4BWQA 18GSA 2DJJA 1BEDA 4WF4A 1A2JA 3M8NA 3UJ1A 3FZAA 5IO0A 1K3OA 2YPMA 1RW1A 5EPFA 2H1AA 1FVJA 3HVVA 3E3EA 1LU4A 1GULA 2V1MA 3FKFA 3LFLA 2YV9A 4OWYA 5JWRB 2C3NA 5CRHA 4BWSA 4QQ7A 1F9MA 1V58A 1BAYA 3DVWA 5ECNB 3KTBA 2H0IA 1GNEA 1YZXA 4DVCA 2XPEA 5J9CA 2LJAA 4Q5QA 2AB6A 2X8GA 2C80A 4IP1A 2L6CA 4ECCA 4E8EA 2E2MA 3EWLA 4MH2A 2H6ZA 2KP1A 3QFAC 3TOUA 3KTLA 5IMCA 1DE2A 2L5OA 2CX3A 4YAPA 1A2LA 2DJ1A 4ZL7A 2YP6A 4LL1B 5B8BA 3CTFA 2O7KA 4PQIA 2LRNA 22GSA 2H0GA 1E6BA 1XFLA 2FA8A 1EEJA 5J4UA 1ERWA 3TUEA 2LV3A 5DCGA 2M46A 1U87A 2TRXA 3IE3A 1NHOA 3UARA 3F6DA 2F9SA 2B7KA 3FZ9A 1ZL9A 5DCHA 5KEJA 1EEMA 4KGIA 1UA5A 2CAQA 2WS2A 3GNJA 1XW5A 2FUG2 1G7EA 4F82A 1WRYA 4D73B 2GS3A 1XWBA 2L6DA 1NHYA 5ECQB 3HVSA 3UMAA 1G7OA 3L9VA 6GSVA 1K0MA 1F37A 1EP8A 1VF2A 4ZIJA 5HR1A 4K7IA 1K0NA 2C3TA 1GSFA 2VLVA 2PU9C 3UIWA 1XWAA 2CVDA 4BVYA 2VLUA 2K8SA 4POKA 1R7HA 2H74A 3F4SA 3IOSA 1K0OA 4GQCA 1GUKA 1TRWA 1ZMAA 1KEBA 1SENA 4NMUA 3GN3A 3A5WA 1YEXA 3TGZA 2VCTA 1ZYEA 1X9MB 3ZFLA 1TI3A 4AF2A 3A2WA 2NPBA 5J5NA 2LQQA 4E8HA 1N8JA 3VPTA 1XCCA 3TDGA 5IIZA 2WDUA 5D96A 1K0DA 1UVZA 2YV7A 2VLTA 3GRXA 2PGTA 5CAXA 4V2LA 2IJYA 2WB9A 1OE7A 5IMFA 4KSMA 1TU7A 3EU4A 3EC3A 2XPDA 4HJMA 4GLTA 2CVKA 1SK1A 3DIEA 3DWVA 5AISA 3PR8A 1BG5A 5DALA 2VD0A 4OO4A 3EE2A 1SYRA 5LNKe 5D9WA 5AGYA 4ZBDA 1GL8A 4OCFA 3LQ7A 6GSUA 2H19A 5F8BA 2V2GA 2HYXA 4OD7A 4PNGA 4IS0A 1KNGA 4ACSA 4ZL8A 2CA8A 1QQ2A 1BJXA 1PN9A 4MPFA 3DMLA 4QL7A 1QK8A 3FHKA 3PH9A 1JFUA 1PX7A 1KBNA 2LUSA 2B6MA 2A2RA 5E59A 4JBBA 5D93A 4IBPA 2K6VA 1Z6NA 2LRTA 2N5AA 5C04A 4KDYA 2H72A 2YZHA 2GTUA 3IAS2 1K0BA 1A2MA 5D9XA 4WR5A 1M9BA 3U6VA 4WBJA 1PKWA 5G1LA 1SKRB 1W89A 5ECHB 2XC2A 3C1SA 6GSXA 3QD9A 1OC9B 3GMFA 3GL5A 1PA3A 2LNTA 3HJPA 3M9KA 1H4OA 4L0WA 2VOCA 3CYNA 4DSQA 4GXZA 1GSDA 3H8QA 4TR3A 4TR1B 1VF4A 1B9XC 4MJCA 2YWIA 1TOFA 4Q5NA 4NXIA 1WPIA 4K0NA 3M9JA 2KP2A 3F3QA 3WYWA 3HA9A 2HRFA 2I1UA 4YQVA 3BD2A 1Y25A 4HZ2A 1DSBA 2G2QA 5GAND 2ON5A 5CYYA 3RHCA 4EUYA 1YKCA 2K9FA 3D6IA 5A4VA 1J08A 2LSTA 1OKTA 3F3RA 3D0ZA 5COHA 1PQNA 5H5SA 3ZLPA 4GF0A 5KN0A 4HOJA 5C00A 1JHBA 5F07A 2C0GA 3TKRA 2DBCA 1TDIA 1XVQA 3APSA 1HNAA 3QAGA 4K7NA 4TW5A 4O32A 2KHPA 1GTAA 2YWOA 4ZILA 4PX1A 1R5AA 2QKEA 3NOFA 4RUVA 2LKUA 6GSWA 2FD3A 1MEKA 3G7YA 4GQFA 4NV5A 1Z7PA 2F8AA 4KUNA 3IK9A 1ZYQB 2F51A 2R3XA 5H5RA 3ZITA 3L9SA 1M99A 1M2AA 2L5LA 1HQOA 3VWVA 3NZNA 1F3AA 2DJ0A 3RDWA 1BYEA 1GLQA 3O6TA 4WBRD 4GTUA 1YQ1A 1VRSD 3TKQA 5HR0A 2PMTA 2B7JA 1S3DA 3W8JA 4EE0A 2VL2A 1B48A 1ERVA 2I4AA 2HZFA 1ERTA 1XWCA 3SBCA 4OFMA 2MMZA 2LNSA 3LXTA 3TOTA 3UBKA 1WP0A 1MDIA 4J2FA 5ECIB 4NV2A 4LMVA 4ECJA 1Z6MA 4XS6A 1MTCA 2A4VA 4I5QA 7GSSA 4XTSA 4DEJA 1EV9A 1XOBA 1WE0A 3O3TA 1U3IA 1CQGA 4RQXA 3KCMA 2GSQA 1V2AA 3HDCA 1G6WA 6GSSA 2YWMA 3FW2A 2GQLA 3HKRA 5D8IA 2I9HA 2ZNMA 1XW9A 1XPVA 5G5EA 4GWRA 3H79A 1U6TA 1NW2A 2MZCA 3Q6OA 1AAZA 4V2MA 1UN2A 5DJLA 1C72A 3KGKA 3V1WA 4V2NA 1GSSA 14GSA 3H4KA 2JL4A 5DDLA 1UC7A 4YH2A 2BTOT 1FHEA 3FK8A 3D4MA 4KE3A 2CAIA 5LD0A 1VF3A 2RIIA 5DQYA 3GL3A 3FZ4A 1R5PA 5IQYA 2AJQB 4MF7A 1E2YA 1WWJA 4TVEA 2IFQB 4AGSA 1F6MC 3IXRA 2HZEB 5J9BA 4ILFA 1V9WA 2YWNA 1XZOA 2HI7A 3LJRA 1A24A 4GSSA 2GDRA 3KZQA 4IQ1A 5JWOB 1O7UA 3M1GA 2MMOA 1I5GA 1VGLA 1IYHA 2GT5A 1Q4JA 1FW1A 5CP1A 2B1KA 3GV1A 3P90A 3CTGA 13GSA 3C8EA 5ID2B 1SK2A 3CRUA 3E0UA 3ZVJD 1QMVA 2HXKA 3HY2A 1XWGA 1F3BA 3GUSA 1F2EA 4KSOA 2NTOA 20GSA 3HJMA 4XRAA 3ZL5A 4EL1A 2J23A 4NAXA 2MYGA 2V32A 5CO3A 5FT3A 1HD2A 1URMA 1JZOA 1ERUA 1ON4A 2J9HA 1TK8B 1PMTA 5CRGA 2LS5A 2XHFA 3GKXA 2OKAA 3ME7A 2E0QA 2R5GA 1QXHA 3EMXA 4OCEA 2HE3A 1T4YA 3FYGA 1W4VA 2RM6A 2IMDA 3GTUB 2OE0A 3GIXA 1ABAA 2O89A 4J56E 4YQUA 1FVKA 2AUVA 3F8UA 4RQRA 4N10A 4P3YB 3MSZA 2GZZA 2GGTA 4L0UA 1FB6A 2F8FA 3CMIA 1Q98A 1LJRA 1V40A 3GH6A 5D73A 2DC5A 2CZ3A 4N0VA 4TXVA 2DLXA 3DYRA 3BCIA 2I81A 2MMAA 1ML6A 2LRCA 3ED3A 2EIOA 5GSTA 3VURA 1K0CA 1XW6A 2VCWA 2H8LA 1PX6A 1XIYA 2OBKA 1O73A 1WMJA 4G10A 3EVIA 3KH9A 1A0RP 1RQMA 5A4UA 4HI7A 3KXOA 4F9ZA 4WF5A 4HS1A 3K8NA 4ZXGA 4ZBAA 4LLRA 3EYTA 4N0ZA 2GSSA 3OR5A 2O8VB 2VD1A 1ZCPA 3EINA 2VM2A 4POMA 5DAKA 1J9BA 4ZB6A 2E2GA 2XBIA 3ZYWA 1GSQA 2JACA 3ZIVA 2H76A 4Z7XA 3Q19A 5CRWA 4IELA 3QAWA 4TXOB 1TI1A 5IO2A 4ML1A 1JZDA 4TOPA 2IL3A 3QCPA 1BX9A 2REMA 2PVQA 3LYPA 1ACVA 4OO5A 2FWHA 4LMWA 4IJIA 8GSSA 3BCKA 3ME8A 3KP8A 2F3MA 2LEGA 4XS4A 2C0DA 2EC4A 3GKMA 4I6XA 1TRUA 5KN1A 3LXZA 2JSZA 4DSSB 3I43A 3ZIJA 1T00A 1SD8A 4F0BA 4PUFC 1YY7A 1GTUA 1HNCA 2NVLA 3WT1A 3J7Yk 2ZUPA 1T8EB 5IMDA 2FWFA 5HFKA 2MMNA 2VAFA 5E4WA 1AQXA 2V41A 2GQKA 1LBKA 2E7PA 2VUPA 2H75A 2TIRA 3FY7A 3TKSC 4K6XA 5GAPD 3ISOA 3QPMA 3HJOA 3IK7A 3P2AA 1GP1A 3VLNA 3VI7A 1A0FA 5EL8A 3DD3A 4MPGA 5B7CA 1ILOA 2AHEA 4ULXA 2IIYA 4L8EA 4YAVA 4MH3A 1PKZA 2H71A 4PNFA 4L5LA 3TJGA 4MZCA 4K2DA 4NHWA 3U5RE 2MBTA 2FGXA 1FAAA 3GKNA 1G6YA 5AIVA 2CVBA 5G31A 4MJAA 3L0HA 5FWGA 3GHAA 2WULA 5LCZA 3UBLA 4KDXA 5IMAA 3DVXA 4MP4A 1B4PA 4I8BA 3D5JA 3GSSA 2H70A 3L9UA 4MZBA 4KDUA 2O87A 3HHVA 1M9AA 2X8CA 4G9HA 1G0TA 2B5XA 3F0IA 1XOAA 3A3TA 3LORA 4JE1A 1PL2A 1SKWB 3GFKA 1EGOA 3QFBC 3G9BA 2OJLA 3TCOA 3US3A 4JR6A 9GSSA 2FLSA 2X8HA 2EIQA 5F05A 5JWQB 4ECBA 1Z7RA 2H1GA 4BPYA 3VWXA 2JSYA 1SJZA 3H1NA 3E9JB 4K9ZA 2H1BA 2VCQA 1AQVA 3HYPA 2YNXA 4IGJA 3CRTA 4KCEA 2DJ2A 2HRNA 1R4WA 3ERWA 4HJ2A 1O81A 1SYXA 1X0RA 1SL0B 2H6XA 3BBYA 5INYA 3PGTA 10GSA 2L57A 6GSYA 2VO4A 2LJRA 4NPBA 4ZB9A 3L78A 1AQWA 3VPQA 3ZMLA 1Z5YE 1SKSB 4JZQA 4V1Ag 2OADA 1FOVA 4K1FA 3FRCA 2YZUA 1X5CA 2QSIA 4O7HA 2IMKA 1XBSA 1PL1A 3CSIA 3FZ5A 3NIVA 2WCIA 4KB3A 2IPAA 4POBA 16GSA 3BJ5A 4AJ6A 4IHUA 4LL4B 3GX8A 3EURA 4HEA2 2VM1A 1IYIA 3LGCA 2A2SA 5EVOA 4K7OA 3EMPA 1YDKA 2FHEA 2L4CA 3TB2A 3IR4A 5DALB 3MWHA 3ZFBA 2FNOA 2IMFA 1GSUA 3KM6A 1A23A 5CREA 3APQA 3IHQA 3UVHA 2YJ7A 1O8XA 2R37A 1U88A 2B3SA 4D73A 2VIMA 3HZ4A 5IM9A 2H01A 2ALBA 3UEMA 2WRTA 1EGRA 3TJBA 3D21A 1T3BA 1SK0A 5HFIA 1WIKA 4KNDA 2IN3A 4I2TA 2ON7A 5ELAA 3DGQA 5B6NA 4IJ3A 4EC0A 3FR3A 19GSA 5D9VA 4RI6A 4MDCA 4H86A 2DSAA 5ELGA 2WZ9A 3GA4A 2LTKA 1YF1A 1BQ7A 3P7XA 17GSA 2H30A 2NBSA 4MLYA 3H93A 1TXXA 3RHBA 1TTZA 4XHMA 1B9YC 2PWJA 4GSNA 2DMLA 2KLXA 2QC7A 2XBQA 1SJ6A 4O5RA 5JCUA 3ZZXA 1GSYA 4CHSA 3ZREA 2KOKA 2AYTA 1TRSA 2B1LA 1WOUA 4XRDA 4GSTA 3D4TA 2HNLA 3C7MA 5B6MA 5F0GA 4EF0A 3VWWA 2QGVA 1EZKA 3UL3A 2LQOA 4HU7A 5G2ZA 1TRVA 2VCVA 4HZ4A 3IAM2 1SD9A 3J7Yb 1AXDA 4RI7A 1TK0B 2R2JA 4PGTA 4PXOA 4IW9A 2D2ZA 4Q5FA 3KJYA 1Z9HA 2GT6A 3HZ8A 1KTEA 1QFNA 4HDEA 5AN1A 1YF0A 2YCDA 3CXGA 1MDKA 1B4QA 3TJJA 5ABRA 5IOXA 12GSA 2GQMA 3FEUA 4EXJA 1I9DA 4ZL9A 1ZOFA 3L4NA 4XIHA 3S9FA 6GSTA 2RUFA 1EWXA 3KMOA 1YJ6A 2C4JA 3KEBA 2OA7A 4G19A 3W8SA 3ERGA 2GSRA 4MA9A 3IPZA 4IP6A 4TR0A 4I2UA 4KH7A 2OBIA 4TR4A 5FHIA 2C8UA 2K8VA 1QUWA 1ST9A 1DUGA 2P5QA 3KMNA 2GZYA 3IA1A 3N9JA 3RPNA 1Z3EA 1FG4A 2H66A 3HD5A 3TJFA 2CX4A 2ES7A 3DXBA 2G0FA
chains in the Genus database with same CATH superfamily
3IC8A 5G1KA 4MF6A 4TKYA 5ECSA 1GWCA 2P0GA 3JCML 4OMVA 2A2PA 2R0CA 4KF9A 3CSJA 1A8LA 3IC4A 1EOHA 5DJMA 3DEXA 1M3IA 2P31A 4PURA 2X64A 3C1RA 4PQHA 3QOUA 5HFGA 3BOAA 5ECKB 1OC9A 3LEFA 2Z9SA 1A8YA 2C0EA 4ZB8A 1DE1A 1MDJA 2ZCTA 4JU5A 1WJKA 2QA1A 1GLPA 2HLSA 3PPUA 2CV4A 4BL7A 1OYJA 3UVTA 1AC1A 3SWLA 2IWTA 2LJKA 1SL1B 4TR1A 3C71A 3QDNA 1T7PB 3UAPA 4XS1A 5ECLB 1TKDB 1HNBA 1PGTA 4NHZA 4G2EA 4FH8A 3IRAA 2V6OA 1EP7A 2DMMA 3C73A 3FR6A 1X9WB 3WT2A 4MF5A 3FR9A 3A2XA 2YJHA 4ML6A 1RK4A 4HQZA 1T1VA 1AUCA 1XXUA 2EIRA 4BA7A 3GH9A 1GTIA 2PPTA 4MJEA 2GLRA 4K0GA 5BMUA 3KD0A 4OFNA 1YKAA 3W6GA 3GKKA 1TP9A 2R6KA 2H73A 4ZBBA 5HR2A 4PUAA 2L59A 1AIUA 1M0UA 2CQ9A 2PBJA 2YN1A 5A5KA 4IN0A 2NDOA 3ZTLA 3O76A 3HVNA 1JZWA 3EU3A 1X5EA 4AJ8A 3TRXA 2HSHA 5KN2A 2K18A 4FYBA 1VF1A 1XG8A 1FOHA 2B5YA 3TKSA 5GZZB 4HUAA 2C1YA 1TK5B 4FYUA 1GRXA 2JZTA 2VL9A 1OVNA 2WFCA 1J0FA 2KUCA 2YOIA 5JCGA 3RBTA 3VI5A 5J3RA 4ECIA 4JR4A 3EPTA 4IQAA 1JZRA 1NSWA 4HQSA 4K5SA 3VWUA 4KA0A 4X1UA 5GSSA 4I97A 2VL3A 2GSTA 2PVOC 4GRFA 3Q74A 1V57A 2FA4A 2GZPA 2C3QA 2H1DA 5A4WA 2VCXA 4KAEA 3RPPA 2B5EA 1M2BA 2PUKC 2DIYA 4J57E 1PSQA 3WGXA 1SL2B 4F2IA 3A2VA 3QMXA 4EKZA 3F6FA 4JRRA 4ISDA 5IPGA 4KCAA 3I69A 1JLWA 1YEPA 11GSA 2C0FA 4F03A 1XWKA 1M2DA 2OE1A 2P5RA 3QR6A 1ZGNA 4MJBA 2X99A 1B8XA 3MDKA 4Q5RA 4CW9A 3LWAA 1K0AA 1S3CA 5IOWA 4TN8A 2V6KA 3F4RA 4WR4A 1HYUA 4X43A 3M0FA 4CDOA 2WGRA 2HSYA 4QL9A 1X5DA 4DSRA 3Q18A 4EDZA 3F9UA 3D22A 3ERFA 1NM3A 3F63A 1THOA 4O5QA 2CT6A 2DJKA 3GYKA 3KIJA 1Y6EA 1K3YA 2GVPA 2IFQA 3DRNA 3ZMKA 2IMEA 1ZZYA 4NWYA 1N2AA 2HZEA 5J41A 4N30A 1GUMA 2L4QA 3ZRDA 1DBYA 1TW9A 3IV4A 1OC3A 4MK3A 1PRXA 4OFTA 3WGDA 3CSHA 1GTBA 1PN0A 4MABA 2FY6A 4JEDA 5CRDA 4BVXA 1MD4A 1H75A 3GSTA 4EVMA 4HU9A 1OAZA 2WJUA 3MIXA 4YKFA 1O85A 5HR3A 3APOA 4N11A 1OE8A 5JCWA 3HXSA 1SJIA 5ID2A 5B8AA 1PD21 1T4ZA 2VCZA 5AIXA 1GNWA 1R26A 4XCSA 5DAKB 1JLVA 2PN8A 2JZRA 3TKSE 3MAKA 1AW9A 2BMXA 4EDYA 3MNGA 4X0XA 4YQMA 3GURA 1O6JA 5DQSA 3UOMA 4F0CA 3MYDA 2H0HA 2MBSA 3KP9A 3M3MA 3TJKA 2JADA 4PQ1A 2N5FA 1S3AA 3R3EA 2R4VA 5G30A 1O8WA 4K5RA 3LSZA 4G0LA 5DBQA 3G7JA 1USBA 4XS4B 4WEYA 4WETA 5H5QA 4USSA 2JU5A 5D9TA 3KH7A 5CNWA 3A5IA 2X4AA 2FWGA 3IDVA 3GTUA 2OACA 5IPHA 2N5BA 4L5OA 3R2QA 3TRQA 3TRPA 5HQPA 5ECRB 1SU9A 4POLA 5IMVA 1MD3A 2RLIA 3QAVA 2RUEA 5IMZA 1K3LA 3VK9A 5L71A 1XVWA 3WD6A 1FO5A 1EV4A 4O92A 3HCZA 4CY6A 1CQHA 2FCHA 3F4TA 1TJDA 1FB0A 4GCIA 3LG6A 1GH2A 3VFIA 5ECOB 3PINA 4FO5A 4IVFA 2AV4A 2RM5A 3LYKA 2JZSA 2AAWA 2M80A 5DVBA 2DIZA 2I3YA 2H6YA 4FIWA 2DJ3A 3G7IA 2VL2C 2BJXA 5G5FA 2O85A 4WKWA 3I6AA 3TKPA 4WXTA 3AY8A 3N5OA 3CBUA 1U3AA 1THXA 1V98A 2CZ2A 4ID0A 4KW6A 1OC8A 3DKSA 4IKHA 5F06A 4FYCA 4MCUA 3WGEA 3IBHA 3RAZA 2IMIA 5ECPB 4TXOA 4V1Ap 4LA1A 3GX0A 3P8WA 1GUHA 3I9V2 4EO3A 1EOGA 2YANA 5ECMB 3ZVJA 4EIQA 2TRCP 1GSEA 2M72A 2PERA 4FQUA 4KX4A 5ENUA 1X9SB 1QGVA 3HVXA 4MZWA 2OE3A 1M7TA 5KN3A 5EY6A 4K8MA 4DSSA 4TRXA 2HFDA 2HT9A 4AJ7A 1TU8A 2FWEA 1OKDA 4MMMA 4BWQA 18GSA 2DJJA 1BEDA 4WF4A 1A2JA 3M8NA 3UJ1A 3FZAA 5IO0A 1K3OA 2YPMA 1RW1A 5EPFA 2H1AA 1FVJA 3HVVA 3E3EA 1LU4A 1S3RA 1GULA 2V1MA 3FKFA 3LFLA 2YV9A 4OWYA 5JWRB 2C3NA 5CRHA 4BWSA 4QQ7A 1F9MA 1V58A 1BAYA 3DVWA 5ECNB 3KTBA 2H0IA 4A5PA 1GNEA 1YZXA 4DVCA 2XPEA 5J9CA 2LJAA 4Q5QA 2AB6A 2X8GA 2C80A 4IP1A 2L6CA 3CQFA 4ECCA 4E8EA 2E2MA 3EWLA 4MH2A 2H6ZA 2KP1A 3QFAC 3TOUA 3KTLA 5IMCA 1DE2A 2L5OA 2CX3A 4YAPA 1A2LA 2DJ1A 4ZL7A 2YP6A 4LL1B 5B8BA 3CTFA 2O7KA 4PQIA 2LRNA 22GSA 2H0GA 1E6BA 1XFLA 2FA8A 1EEJA 5J4UA 1ERWA 3TUEA 2LV3A 5DCGA 2M46A 1U87A 2TRXA 1ZYPA 3IE3A 1NHOA 3UARA 4BIKA 3F6DA 2F9SA 2B7KA 3FZ9A 1ZL9A 5DCHA 5KEJA 1EEMA 3LW9A 4KGIA 1UA5A 2CAQA 2WS2A 3GNJA 1XW5A 2FUG2 1G7EA 4F82A 1WRYA 4D73B 2GS3A 1XWBA 2L6DA 4X4JA 1NHYA 5ECQB 3HVSA 3UMAA 1G7OA 3L9VA 6GSVA 1K0MA 1F37A 1EP8A 1VF2A 4ZIJA 5HR1A 4K7IA 1K0NA 2C3TA 1GSFA 2VLVA 2PU9C 3UIWA 1XWAA 2CVDA 4BVYA 2VLUA 2K8SA 4POKA 1R7HA 2H74A 3F4SA 3IOSA 1K0OA 4GQCA 1GUKA 1TRWA 1ZMAA 1KEBA 1SENA 4NMUA 3GN3A 3A5WA 1YEXA 2QA2A 3TGZA 2VCTA 1ZYEA 1X9MB 3ZFLA 1TI3A 4AF2A 3A2WA 2NPBA 5J5NA 2LQQA 4E8HA 1N8JA 3VPTA 1XCCA 3TDGA 5IIZA 2WDUA 5D96A 1K0DA 1UVZA 2YV7A 2VLTA 3GRXA 2PGTA 5CAXA 4V2LA 2IJYA 2WB9A 1OE7A 5IMFA 4KSMA 1TU7A 3EU4A 2HRKA 3EC3A 2XPDA 4HJMA 4GLTA 2CVKA 1SK1A 3DIEA 3DWVA 5AISA 3PR8A 1BG5A 5DALA 2VD0A 4OO4A 3EE2A 1SYRA 5LNKe 5D9WA 5AGYA 4ZBDA 1GL8A 4OCFA 3LQ7A 6GSUA 2H19A 5F8BA 2V2GA 2HYXA 4OD7A 4PNGA 4IS0A 1KNGA 4ACSA 4ZL8A 2CA8A 1M3JA 1QQ2A 1BJXA 1PN9A 4MPFA 4CY8A 3DMLA 4QL7A 1QK8A 3FHKA 3PH9A 1JFUA 1PX7A 1KBNA 2LUSA 2B6MA 2A2RA 5E59A 4JBBA 4Z2UA 5D93A 4IBPA 2K6VA 1Z6NA 2LRTA 2N5AA 5C04A 4KDYA 2H72A 2YZHA 2GTUA 4YKGA 3IAS2 1K0BA 1A2MA 5D9XA 4WR5A 1M9BA 3U6VA 2UZ8A 4WBJA 1PKWA 5G1LA 4EIPA 1SKRB 1W89A 5ECHB 2XC2A 3C1SA 6GSXA 3QD9A 1OC9B 3GMFA 3GL5A 1PA3A 2LNTA 3HJPA 3M9KA 1H4OA 4L0WA 2VOCA 4BL7B 3CYNA 4DSQA 4GXZA 1GSDA 3H8QA 4TR3A 4TR1B 1VF4A 1B9XC 4MJCA 2YWIA 1TOFA 4Q5NA 4NXIA 1WPIA 4K0NA 3M9JA 2KP2A 3F3QA 3WYWA 3HA9A 2HRFA 2I1UA 4YQVA 3BD2A 1Y25A 4HZ2A 1DSBA 2G2QA 5GAND 2ON5A 5CYYA 3RHCA 4EUYA 1YKCA 2K9FA 3D6IA 5A4VA 1J08A 2LSTA 1OKTA 3F3RA 3D0ZA 5COHA 1PQNA 5H5SA 3ZLPA 4GF0A 5KN0A 4HOJA 5C00A 1JHBA 5F07A 2C0GA 3TKRA 2DBCA 1TDIA 1XVQA 3APSA 1HNAA 3QAGA 4K7NA 4TW5A 2R0PA 4O32A 2KHPA 1GTAA 2YWOA 4ZILA 4PX1A 1R5AA 2QKEA 3NOFA 4RUVA 2LKUA 6GSWA 2FD3A 1MEKA 3G7YA 4GQFA 4NV5A 1Z7PA 2F8AA 4KUNA 3IK9A 1ZYQB 2F51A 2R3XA 5H5RA 3ZITA 3L9SA 1M99A 1M2AA 2L5LA 1HQOA 3VWVA 3NZNA 1F3AA 2DJ0A 3RDWA 1BYEA 1GLQA 3O6TA 4WBRD 4GTUA 1YQ1A 1VRSD 3TKQA 5HR0A 2PMTA 2B7JA 1S3DA 3W8JA 4EE0A 2VL2A 1B48A 1ERVA 2I4AA 2HZFA 1ERTA 1XWCA 3SBCA 4OFMA 2MMZA 2LNSA 3LXTA 3TOTA 3UBKA 1WP0A 2HRAA 1MDIA 4J2FA 5ECIB 4NV2A 4LMVA 4ECJA 1Z6MA 4XS6A 1MTCA 2A4VA 5BRTA 4I5QA 7GSSA 4XTSA 4DEJA 1EV9A 1XOBA 1WE0A 3O3TA 1U3IA 1CQGA 4RQXA 3KCMA 2GSQA 1V2AA 3HDCA 1G6WA 6GSSA 2YWMA 3FW2A 2GQLA 3HKRA 5D8IA 2I9HA 2ZNMA 1XW9A 1XPVA 5G5EA 4GWRA 4G0KA 3H79A 1U6TA 1NW2A 2DKHA 2MZCA 3Q6OA 4PTSA 1AAZA 4V2MA 1UN2A 5DJLA 1C72A 3KGKA 3V1WA 4V2NA 1GSSA 14GSA 3H4KA 2JL4A 5DDLA 1UC7A 4YH2A 2BTOT 1FHEA 3FK8A 3D4MA 4KE3A 2CAIA 5LD0A 1VF3A 2RIIA 5DQYA 3GL3A 3FZ4A 1R5PA 5IQYA 2AJQB 4Z2TA 4MF7A 1E2YA 1WWJA 4TVEA 2IFQB 4AGSA 1F6MC 3IXRA 2HZEB 5J9BA 4ILFA 1V9WA 2YWNA 5KOWA 1XZOA 2HI7A 3LJRA 1A24A 4GSSA 2GDRA 3KZQA 4BVXB 4MNNA 4IQ1A 5JWOB 1O7UA 3M1GA 2MMOA 1I5GA 1VGLA 1IYHA 2GT5A 1Q4JA 1FW1A 5CP1A 2B1KA 3GV1A 3P90A 3CTGA 13GSA 3C8EA 5ID2B 1SK2A 3CRUA 3E0UA 3ZVJD 1QMVA 2HXKA 3HY2A 1XWGA 1F3BA 3GUSA 1F2EA 4KSOA 2NTOA 20GSA 3HJMA 4XRAA 3ZL5A 4EL1A 2J23A 4NAXA 2MYGA 2V32A 5CO3A 5FT3A 1HD2A 1URMA 1JZOA 1ERUA 1ON4A 3IHGA 2J9HA 1TK8B 1PMTA 5CRGA 2LS5A 1PFOA 2XHFA 4HSCX 3GKXA 2OKAA 3ME7A 2R0GA 2E0QA 2R5GA 1QXHA 3EMXA 4OCEA 2HE3A 1T4YA 3FYGA 1W4VA 2RM6A 2IMDA 3GTUB 2OE0A 3GIXA 1ABAA 2O89A 4J56E 4YQUA 1FVKA 2AUVA 3F8UA 4RQRA 4N10A 4P3YB 5KOXA 3MSZA 2GZZA 2GGTA 4L0UA 1FB6A 2F8FA 3CMIA 1Q98A 1LJRA 1V40A 3GH6A 5D73A 2DC5A 2CZ3A 4N0VA 4TXVA 2DLXA 3DYRA 3BCIA 2I81A 2MMAA 4K2XA 1ML6A 2LRCA 3ED3A 2EIOA 5GSTA 3VURA 1K0CA 1XW6A 2VCWA 2H8LA 1PX6A 1XIYA 2X49A 2OBKA 1O73A 1WMJA 4G10A 3EVIA 3KH9A 1A0RP 1RQMA 5A4UA 4HI7A 3KXOA 4F9ZA 4WF5A 4HS1A 2A4HA 3K8NA 4ZXGA 4ZBAA 4LLRA 3EYTA 4N0ZA 3OR5A 2GSSA 2O8VB 2VD1A 1ZCPA 3EINA 2VM2A 4G0IA 4POMA 5DAKA 1J9BA 4ZB6A 2E2GA 2XBIA 3ZYWA 1GSQA 2JACA 3ZIVA 2H76A 4Z7XA 3Q19A 5CRWA 4IELA 3QAWA 4TXOB 1TI1A 5IO2A 4ML1A 1JZDA 4TOPA 2IL3A 3QCPA 1BX9A 2REMA 2PVQA 3LYPA 1ACVA 4OO5A 2FWHA 4LMWA 4IJIA 8GSSA 3BCKA 3ME8A 3KP8A 2F3MA 2LEGA 4XS4A 2C0DA 2EC4A 3GKMA 4I6XA 1TRUA 5KN1A 3LXZA 2JSZA 4DSSB 3I43A 3ZIJA 1T00A 1SD8A 4F0BA 4PUFC 1YY7A 1GTUA 1HNCA 2NVLA 3WT1A 3J7Yk 2ZUPA 1T8EB 5IMDA 2FWFA 5HFKA 2MMNA 2VAFA 5E4WA 1AQXA 2V41A 2GQKA 1LBKA 2E7PA 2VUPA 2H75A 2TIRA 3FY7A 3TKSC 4K6XA 5GAPD 3ISOA 3QPMA 3HJOA 3IK7A 3P2AA 1GP1A 3VLNA 3VI7A 1A0FA 5EL8A 3DD3A 4MPGA 5B7CA 1ILOA 2AHEA 4ULXA 2IIYA 4L8EA 4YAVA 4MH3A 1PKZA 2H71A 4PNFA 4L5LA 3TJGA 4MZCA 4K2DA 4NHWA 3U5RE 2MBTA 2FGXA 1FAAA 3GKNA 1G6YA 5AIVA 2CVBA 5G31A 4MJAA 3L0HA 5FWGA 3GHAA 2WULA 5LCZA 3UBLA 4KDXA 5IMAA 3DVXA 4MP4A 1B4PA 4I8BA 3D5JA 3GSSA 2H70A 3L9UA 4MZBA 4KDUA 2O87A 3HHVA 1M9AA 2X8CA 4G9HA 1G0TA 2B5XA 3F0IA 1XOAA 3A3TA 3LORA 4JE1A 1PL2A 1SKWB 3GFKA 1EGOA 3QFBC 3G9BA 2OJLA 3TCOA 3US3A 4JR6A 9GSSA 2FLSA 2X8HA 2EIQA 5F05A 5JWQB 4ECBA 1Z7RA 2H1GA 4BPYA 3VWXA 2JSYA 1SJZA 3H1NA 3E9JB 4K9ZA 2H1BA 2VCQA 1AQVA 3HYPA 2YNXA 4IGJA 3CRTA 4KCEA 4ICYA 2DJ2A 2HRNA 1R4WA 3ERWA 4HJ2A 1O81A 1SYXA 4BVYB 1X0RA 1SL0B 2H6XA 3BBYA 5INYA 3PGTA 10GSA 2L57A 6GSYA 2VO4A 2LJRA 4NPBA 4ZB9A 3L78A 1AQWA 3VPQA 3ZMLA 1Z5YE 1SKSB 4JZQA 4V1Ag 2OADA 1FOVA 4K1FA 3FRCA 2YZUA 1X5CA 2QSIA 4O7HA 2IMKA 1XBSA 1PL1A 3CSIA 3FZ5A 3NIVA 2WCIA 4KB3A 2IPAA 4POBA 16GSA 3BJ5A 4AJ6A 4IHUA 4LL4B 3GX8A 3EURA 4HEA2 2VM1A 1IYIA 3LGCA 2A2SA 5EVOA 4K7OA 3EMPA 1YDKA 2FHEA 3FMWA 2L4CA 3TB2A 3IR4A 5DALB 3MWHA 3ZFBA 2FNOA 2IMFA 1GSUA 3KM6A 1A23A 5CREA 3APQA 3IHQA 3UVHA 2YJ7A 1O8XA 2R37A 1U88A 2B3SA 4D73A 2VIMA 3HZ4A 5IM9A 2H01A 2ALBA 3UEMA 2WRTA 1EGRA 3TJBA 3D21A 1T3BA 1SK0A 5HFIA 1WIKA 4KNDA 2IN3A 4I2TA 2ON7A 5ELAA 3DGQA 5B6NA 4IJ3A 4EC0A 3FR3A 19GSA 5D9VA 4RI6A 4MDCA 4H86A 2DSAA 5ELGA 2WZ9A 3GA4A 2LTKA 1YF1A 1BQ7A 3P7XA 17GSA 2H30A 2NBSA 4MLYA 3H93A 1TXXA 3RHBA 1TTZA 4XHMA 1B9YC 2PWJA 4GSNA 2DMLA 2KLXA 2QC7A 2XBQA 1SJ6A 4O5RA 5JCUA 3ZZXA 1GSYA 4CHSA 3ZREA 2KOKA 2AYTA 1TRSA 2B1LA 1WOUA 4XRDA 4GSTA 3D4TA 2HNLA 3C7MA 5B6MA 5F0GA 4EF0A 3VWWA 4Z2RA 2QGVA 1EZKA 3UL3A 4O5UA 2DKIA 2LQOA 4HU7A 5G2ZA 1TRVA 2VCVA 4HZ4A 3IAM2 1SD9A 3J7Yb 1AXDA 4RI7A 1TK0B 2R2JA 4PGTA 4PXOA 4IW9A 2D2ZA 4Q5FA 3KJYA 1Z9HA 2GT6A 3HZ8A 1KTEA 1QFNA 2HSMA 4HDEA 5AN1A 1YF0A 2YCDA 3CXGA 1MDKA 1B4QA 3TJJA 5ABRA 5IOXA 12GSA 1ZYNA 2GQMA 3FEUA 4EXJA 1I9DA 4ZL9A 1ZOFA 3L4NA 4XIHA 3S9FA 6GSTA 2RUFA 1EWXA 3KMOA 1YJ6A 2C4JA 3KEBA 2OA7A 4G19A 3W8SA 3ERGA 2GSRA 4MA9A 3IPZA 4IP6A 4TR0A 4I2UA 4KH7A 2OBIA 4TR4A 5FHIA 2C8UA 2K8VA 1QUWA 1ST9A 1DUGA 2P5QA 3KMNA 2GZYA 3IA1A 3N9JA 3RPNA 1Z3EA 1FG4A 2H66A 3HD5A 3TJFA 2CX4A 2ES7A 3DXBA 2G0FA
chains in the Genus database with same CATH topology
3IC8A 5G1KA 4MF6A 4TKYA 5ECSA 1GWCA 2P0GA 3JCML 4OMVA 2A2PA 2R0CA 4KF9A 3CSJA 1A8LA 3IC4A 1EOHA 5DJMA 3DEXA 2P31A 4PURA 2X64A 3C1RA 4PQHA 3QOUA 5HFGA 3BOAA 5ECKB 1OC9A 3LEFA 2Z9SA 1A8YA 2C0EA 4ZB8A 1DE1A 1MDJA 2ZCTA 4JU5A 1WJKA 2QA1A 1GLPA 2HLSA 3PPUA 2CV4A 4BL7A 1OYJA 3UVTA 1AC1A 3SWLA 2IWTA 2LJKA 1SL1B 4TR1A 3C71A 3QDNA 1T7PB 3UAPA 4XS1A 5ECLB 1TKDB 1HNBA 1PGTA 4NHZA 4G2EA 4FH8A 3IRAA 2V6OA 1EP7A 2DMMA 3C73A 3FR6A 1X9WB 3WT2A 4MF5A 3FR9A 3A2XA 2YJHA 4ML6A 1RK4A 4HQZA 1T1VA 1AUCA 1XXUA 2EIRA 4BA7A 3GH9A 1GTIA 2PPTA 4MJEA 2GLRA 4K0GA 5BMUA 3KD0A 4OFNA 1YKAA 3W6GA 3GKKA 1TP9A 2R6KA 2H73A 4ZBBA 5HR2A 4PUAA 2L59A 1AIUA 1M0UA 2CQ9A 2PBJA 2YN1A 5A5KA 4IN0A 2NDOA 3ZTLA 3O76A 1JZWA 3EU3A 1X5EA 4AJ8A 3TRXA 2HSHA 5KN2A 2K18A 4FYBA 1VF1A 1FOHA 2B5YA 3TKSA 5GZZB 4HUAA 2C1YA 1TK5B 4FYUA 1GRXA 2JZTA 2VL9A 1OVNA 2WFCA 1J0FA 2KUCA 2YOIA 5JCGA 3RBTA 3VI5A 5J3RA 4ECIA 4JR4A 3EPTA 4IQAA 1JZRA 1NSWA 4HQSA 4K5SA 3VWUA 4KA0A 4X1UA 5GSSA 4I97A 2VL3A 2GSTA 2PVOC 4GRFA 3Q74A 1V57A 2FA4A 2GZPA 2C3QA 2H1DA 5A4WA 2VCXA 4KAEA 3RPPA 2B5EA 1M2BA 2PUKC 2DIYA 4J57E 1PSQA 3WGXA 1SL2B 4F2IA 3A2VA 3QMXA 4EKZA 3F6FA 4JRRA 4ISDA 5IPGA 4KCAA 3I69A 1JLWA 1YEPA 11GSA 2C0FA 4F03A 1XWKA 1M2DA 2OE1A 2P5RA 3QR6A 1ZGNA 4MJBA 2X99A 1B8XA 3MDKA 4Q5RA 4CW9A 3LWAA 1K0AA 1S3CA 5IOWA 4TN8A 2V6KA 3F4RA 4WR4A 1HYUA 4X43A 3M0FA 4CDOA 2WGRA 2HSYA 4QL9A 1X5DA 4DSRA 3Q18A 4EDZA 3F9UA 3D22A 3ERFA 1NM3A 3F63A 1THOA 4O5QA 2CT6A 2DJKA 3GYKA 3KIJA 1Y6EA 1K3YA 2GVPA 2IFQA 3DRNA 3ZMKA 2IMEA 1ZZYA 4NWYA 1N2AA 2HZEA 5J41A 4N30A 1GUMA 2L4QA 3ZRDA 1DBYA 1TW9A 3IV4A 1OC3A 4MK3A 1PRXA 4OFTA 3WGDA 3CSHA 1GTBA 1PN0A 4MABA 2FY6A 4JEDA 5CRDA 4BVXA 1MD4A 1H75A 3GSTA 4EVMA 4HU9A 1OAZA 2WJUA 3MIXA 4YKFA 1O85A 5HR3A 3APOA 4N11A 1OE8A 5JCWA 3HXSA 1SJIA 5ID2A 5B8AA 1PD21 1T4ZA 2VCZA 5AIXA 1GNWA 1R26A 4XCSA 5DAKB 1JLVA 2PN8A 2JZRA 3TKSE 3MAKA 1AW9A 2BMXA 4EDYA 3MNGA 4X0XA 4YQMA 3GURA 1O6JA 5DQSA 3UOMA 4F0CA 3MYDA 2H0HA 2MBSA 3KP9A 3M3MA 3TJKA 2JADA 4PQ1A 2N5FA 1S3AA 3R3EA 2R4VA 5G30A 1O8WA 4K5RA 3LSZA 4G0LA 5DBQA 3G7JA 1USBA 4XS4B 4WEYA 4WETA 5H5QA 4USSA 2JU5A 5D9TA 3KH7A 5CNWA 3A5IA 2X4AA 2FWGA 3IDVA 3GTUA 2OACA 5IPHA 2N5BA 4L5OA 3R2QA 3TRQA 3TRPA 5HQPA 5ECRB 1SU9A 4POLA 5IMVA 1MD3A 2RLIA 3QAVA 2RUEA 5IMZA 1K3LA 3VK9A 5L71A 1XVWA 3WD6A 1FO5A 1EV4A 4O92A 3HCZA 4CY6A 1CQHA 2FCHA 3F4TA 1TJDA 1FB0A 4GCIA 3LG6A 1GH2A 3VFIA 5ECOB 3PINA 4FO5A 4IVFA 2AV4A 2RM5A 3LYKA 2JZSA 2AAWA 2M80A 5DVBA 2DIZA 2I3YA 2H6YA 4FIWA 2DJ3A 3G7IA 2VL2C 2BJXA 5G5FA 2O85A 4WKWA 3I6AA 3TKPA 4WXTA 3AY8A 3N5OA 3CBUA 1U3AA 1THXA 1V98A 2CZ2A 4ID0A 4KW6A 1OC8A 3DKSA 4IKHA 5F06A 4FYCA 4MCUA 3WGEA 3IBHA 3RAZA 2IMIA 5ECPB 4TXOA 4V1Ap 4LA1A 3GX0A 3P8WA 1GUHA 3I9V2 4EO3A 1EOGA 2YANA 5ECMB 3ZVJA 4EIQA 2TRCP 1GSEA 2M72A 2PERA 4FQUA 4KX4A 5ENUA 1X9SB 1QGVA 3HVXA 4MZWA 2OE3A 1M7TA 5KN3A 5EY6A 4K8MA 4DSSA 4TRXA 2HFDA 2HT9A 4AJ7A 1TU8A 2FWEA 1OKDA 4MMMA 4BWQA 18GSA 2DJJA 1BEDA 4WF4A 1A2JA 3M8NA 3UJ1A 3FZAA 5IO0A 1K3OA 2YPMA 1RW1A 5EPFA 2H1AA 1FVJA 3HVVA 3E3EA 1LU4A 1GULA 2V1MA 3FKFA 3LFLA 2YV9A 4OWYA 5JWRB 2C3NA 5CRHA 4BWSA 4QQ7A 1F9MA 1V58A 1BAYA 3DVWA 5ECNB 3KTBA 2H0IA 4A5PA 1GNEA 1YZXA 4DVCA 2XPEA 5J9CA 2LJAA 4Q5QA 2AB6A 2X8GA 2C80A 4IP1A 2L6CA 4ECCA 4E8EA 2E2MA 3EWLA 4MH2A 2H6ZA 2KP1A 3QFAC 3TOUA 3KTLA 5IMCA 1DE2A 2L5OA 2CX3A 4YAPA 1A2LA 2DJ1A 4ZL7A 2YP6A 4LL1B 5B8BA 3CTFA 2O7KA 4PQIA 2LRNA 22GSA 2H0GA 1E6BA 1XFLA 2FA8A 1EEJA 5J4UA 1ERWA 3TUEA 2LV3A 5DCGA 2M46A 1U87A 2TRXA 1ZYPA 3IE3A 1NHOA 3UARA 3F6DA 2F9SA 2B7KA 3FZ9A 1ZL9A 5DCHA 5KEJA 1EEMA 3LW9A 4KGIA 1UA5A 2CAQA 2WS2A 3GNJA 1XW5A 2FUG2 1G7EA 4F82A 1WRYA 4D73B 2GS3A 1XWBA 2L6DA 4X4JA 1NHYA 5ECQB 3HVSA 3UMAA 1G7OA 3L9VA 6GSVA 1K0MA 1F37A 1EP8A 1VF2A 4ZIJA 5HR1A 4K7IA 1K0NA 2C3TA 1GSFA 2VLVA 2PU9C 3UIWA 1XWAA 2CVDA 4BVYA 2VLUA 2K8SA 4POKA 1R7HA 2H74A 3F4SA 3IOSA 1K0OA 4GQCA 1GUKA 1TRWA 1ZMAA 1KEBA 1SENA 4NMUA 3GN3A 3A5WA 1YEXA 2QA2A 3TGZA 2VCTA 1ZYEA 1X9MB 3ZFLA 1TI3A 4AF2A 3A2WA 2NPBA 5J5NA 2LQQA 4E8HA 1N8JA 3VPTA 1XCCA 3TDGA 5IIZA 2WDUA 5D96A 1K0DA 1UVZA 2YV7A 2VLTA 3GRXA 2PGTA 5CAXA 4V2LA 2IJYA 2WB9A 1OE7A 5IMFA 4KSMA 1TU7A 3EU4A 2HRKA 3EC3A 2XPDA 4HJMA 4GLTA 2CVKA 1SK1A 3DIEA 3DWVA 5AISA 3PR8A 1BG5A 5DALA 2VD0A 4OO4A 3EE2A 1SYRA 5LNKe 5D9WA 5AGYA 4ZBDA 1GL8A 4OCFA 3LQ7A 6GSUA 2H19A 5F8BA 2V2GA 2HYXA 4OD7A 4PNGA 4IS0A 1KNGA 4ACSA 4ZL8A 2CA8A 1QQ2A 1BJXA 1PN9A 4MPFA 4CY8A 3DMLA 4QL7A 1QK8A 3FHKA 3PH9A 1JFUA 1PX7A 1KBNA 2LUSA 2B6MA 2A2RA 5E59A 4JBBA 4Z2UA 5D93A 4IBPA 2K6VA 1Z6NA 2LRTA 2N5AA 5C04A 4KDYA 2H72A 2YZHA 2GTUA 4YKGA 3IAS2 1K0BA 1A2MA 5D9XA 4WR5A 1M9BA 3U6VA 2UZ8A 4WBJA 1PKWA 5G1LA 4EIPA 1SKRB 1W89A 5ECHB 2XC2A 3C1SA 6GSXA 3QD9A 1OC9B 3GMFA 3GL5A 1PA3A 2LNTA 3HJPA 3M9KA 1H4OA 4L0WA 2VOCA 4BL7B 3CYNA 4DSQA 4GXZA 1GSDA 3H8QA 4TR3A 4TR1B 1VF4A 1B9XC 4MJCA 2YWIA 1TOFA 4Q5NA 4NXIA 1WPIA 4K0NA 3M9JA 2KP2A 3F3QA 3WYWA 3HA9A 2HRFA 2I1UA 4YQVA 3BD2A 1Y25A 4HZ2A 1DSBA 2G2QA 5GAND 2ON5A 5CYYA 3RHCA 4EUYA 1YKCA 2K9FA 3D6IA 5A4VA 1J08A 2LSTA 1OKTA 3F3RA 3D0ZA 5COHA 1PQNA 5H5SA 3ZLPA 4GF0A 5KN0A 4HOJA 5C00A 1JHBA 5F07A 2C0GA 3TKRA 2DBCA 1TDIA 1XVQA 3APSA 1HNAA 3QAGA 4K7NA 4TW5A 2R0PA 4O32A 2KHPA 1GTAA 2YWOA 4ZILA 4PX1A 1R5AA 2QKEA 3NOFA 4RUVA 2LKUA 6GSWA 2FD3A 1MEKA 3G7YA 4GQFA 4NV5A 1Z7PA 2F8AA 4KUNA 3IK9A 1ZYQB 2F51A 2R3XA 5H5RA 3ZITA 3L9SA 1M99A 1M2AA 2L5LA 1HQOA 3VWVA 3NZNA 1F3AA 2DJ0A 3RDWA 1BYEA 1GLQA 3O6TA 4WBRD 4GTUA 1YQ1A 1VRSD 3TKQA 5HR0A 2PMTA 2B7JA 1S3DA 3W8JA 4EE0A 2VL2A 1B48A 1ERVA 2I4AA 2HZFA 1ERTA 1XWCA 3SBCA 4OFMA 2MMZA 2LNSA 3LXTA 3TOTA 3UBKA 1WP0A 2HRAA 1MDIA 4J2FA 5ECIB 4NV2A 4LMVA 4ECJA 1Z6MA 4XS6A 1MTCA 2A4VA 5BRTA 4I5QA 7GSSA 4XTSA 4DEJA 1EV9A 1XOBA 1WE0A 3O3TA 1U3IA 1CQGA 4RQXA 3KCMA 2GSQA 1V2AA 3HDCA 1G6WA 6GSSA 2YWMA 3FW2A 2GQLA 3HKRA 5D8IA 2I9HA 2ZNMA 1XW9A 1XPVA 5G5EA 4GWRA 4G0KA 3H79A 1U6TA 1NW2A 2DKHA 2MZCA 3Q6OA 4PTSA 1AAZA 4V2MA 1UN2A 5DJLA 1C72A 3KGKA 3V1WA 4V2NA 1GSSA 14GSA 3H4KA 2JL4A 5DDLA 1UC7A 4YH2A 2BTOT 1FHEA 3FK8A 3D4MA 4KE3A 2CAIA 5LD0A 1VF3A 2RIIA 5DQYA 3GL3A 3FZ4A 1R5PA 5IQYA 2AJQB 4Z2TA 4MF7A 1E2YA 1WWJA 4TVEA 2IFQB 4AGSA 1F6MC 3IXRA 2HZEB 5J9BA 4ILFA 1V9WA 2YWNA 5KOWA 1XZOA 2HI7A 3LJRA 1A24A 4GSSA 2GDRA 3KZQA 4BVXB 4MNNA 4IQ1A 5JWOB 1O7UA 3M1GA 2MMOA 1I5GA 1VGLA 1IYHA 2GT5A 1Q4JA 1FW1A 5CP1A 2B1KA 3GV1A 3P90A 3CTGA 13GSA 3C8EA 5ID2B 1SK2A 3CRUA 3E0UA 3ZVJD 1QMVA 2HXKA 3HY2A 1XWGA 1F3BA 3GUSA 1F2EA 4KSOA 2NTOA 20GSA 3HJMA 4XRAA 3ZL5A 4EL1A 2J23A 4NAXA 2MYGA 2V32A 5CO3A 5FT3A 1HD2A 1URMA 1JZOA 1ERUA 1ON4A 3IHGA 2J9HA 1TK8B 1PMTA 5CRGA 2LS5A 2XHFA 3GKXA 2OKAA 3ME7A 2R0GA 2E0QA 2R5GA 1QXHA 3EMXA 4OCEA 2HE3A 1T4YA 3FYGA 1W4VA 2RM6A 2IMDA 3GTUB 2OE0A 3GIXA 1ABAA 2O89A 4J56E 4YQUA 1FVKA 2AUVA 3F8UA 4RQRA 4N10A 4P3YB 5KOXA 3MSZA 2GZZA 2GGTA 4L0UA 1FB6A 2F8FA 3CMIA 1Q98A 1LJRA 1V40A 3GH6A 5D73A 2DC5A 2CZ3A 4N0VA 4TXVA 2DLXA 3DYRA 3BCIA 2I81A 2MMAA 4K2XA 1ML6A 2LRCA 3ED3A 2EIOA 5GSTA 3VURA 1K0CA 1XW6A 2VCWA 2H8LA 1PX6A 1XIYA 2X49A 2OBKA 1O73A 1WMJA 4G10A 3EVIA 3KH9A 1A0RP 1RQMA 5A4UA 4HI7A 3KXOA 4F9ZA 4WF5A 4HS1A 2A4HA 3K8NA 4ZXGA 4ZBAA 4LLRA 3EYTA 4N0ZA 3OR5A 2GSSA 2O8VB 2VD1A 1ZCPA 3EINA 2VM2A 4G0IA 4POMA 5DAKA 1J9BA 4ZB6A 2E2GA 2XBIA 3ZYWA 1GSQA 2JACA 3ZIVA 2H76A 4Z7XA 3Q19A 5CRWA 4IELA 3QAWA 4TXOB 1TI1A 5IO2A 4ML1A 1JZDA 4TOPA 2IL3A 3QCPA 1BX9A 2REMA 2PVQA 3LYPA 1ACVA 4OO5A 2FWHA 4LMWA 4IJIA 8GSSA 3BCKA 3ME8A 3KP8A 2F3MA 2LEGA 4XS4A 2C0DA 2EC4A 3GKMA 4I6XA 1TRUA 5KN1A 3LXZA 2JSZA 4DSSB 3I43A 3ZIJA 1T00A 1SD8A 4F0BA 4PUFC 1YY7A 1GTUA 1HNCA 2NVLA 3WT1A 3J7Yk 2ZUPA 1T8EB 5IMDA 2FWFA 5HFKA 2MMNA 2VAFA 5E4WA 1AQXA 2V41A 2GQKA 1LBKA 2E7PA 2VUPA 2H75A 2TIRA 3FY7A 3TKSC 4K6XA 5GAPD 3ISOA 3QPMA 3HJOA 3IK7A 3P2AA 1GP1A 3VLNA 3VI7A 1A0FA 5EL8A 3DD3A 4MPGA 5B7CA 1ILOA 2AHEA 4ULXA 2IIYA 4L8EA 4YAVA 4MH3A 1PKZA 2H71A 4PNFA 4L5LA 3TJGA 4MZCA 4K2DA 4NHWA 3U5RE 2MBTA 2FGXA 1FAAA 3GKNA 1G6YA 5AIVA 2CVBA 5G31A 4MJAA 3L0HA 5FWGA 3GHAA 2WULA 5LCZA 3UBLA 4KDXA 5IMAA 3DVXA 4MP4A 1B4PA 4I8BA 3D5JA 3GSSA 2H70A 3L9UA 4MZBA 4KDUA 2O87A 3HHVA 1M9AA 2X8CA 4G9HA 1G0TA 2B5XA 3F0IA 1XOAA 3A3TA 3LORA 4JE1A 1PL2A 1SKWB 3GFKA 1EGOA 3QFBC 3G9BA 2OJLA 3TCOA 3US3A 4JR6A 9GSSA 2FLSA 2X8HA 2EIQA 5F05A 5JWQB 4ECBA 1Z7RA 2H1GA 4BPYA 3VWXA 2JSYA 1SJZA 3H1NA 3E9JB 4K9ZA 2H1BA 2VCQA 1AQVA 3HYPA 2YNXA 4IGJA 3CRTA 4KCEA 4ICYA 2DJ2A 2HRNA 1R4WA 3ERWA 4HJ2A 1O81A 1SYXA 4BVYB 1X0RA 1SL0B 2H6XA 3BBYA 5INYA 3PGTA 10GSA 2L57A 6GSYA 2VO4A 2LJRA 4NPBA 4ZB9A 3L78A 1AQWA 3VPQA 3ZMLA 1Z5YE 1SKSB 4JZQA 4V1Ag 2OADA 1FOVA 4K1FA 3FRCA 2YZUA 1X5CA 2QSIA 4O7HA 2IMKA 1XBSA 1PL1A 3CSIA 3FZ5A 3NIVA 2WCIA 4KB3A 2IPAA 4POBA 16GSA 3BJ5A 4AJ6A 4IHUA 4LL4B 3GX8A 3EURA 4HEA2 2VM1A 1IYIA 3LGCA 2A2SA 5EVOA 4K7OA 3EMPA 1YDKA 2FHEA 3FMWA 2L4CA 3TB2A 3IR4A 5DALB 3MWHA 3ZFBA 2FNOA 2IMFA 1GSUA 3KM6A 1A23A 5CREA 3APQA 3IHQA 3UVHA 2YJ7A 1O8XA 2R37A 1U88A 2B3SA 4D73A 2VIMA 3HZ4A 5IM9A 2H01A 2ALBA 3UEMA 2WRTA 1EGRA 3TJBA 3D21A 1T3BA 1SK0A 5HFIA 1WIKA 4KNDA 2IN3A 4I2TA 2ON7A 5ELAA 3DGQA 5B6NA 4IJ3A 4EC0A 3FR3A 19GSA 5D9VA 4RI6A 4MDCA 4H86A 2DSAA 5ELGA 2WZ9A 3GA4A 2LTKA 1YF1A 1BQ7A 3P7XA 17GSA 2H30A 2NBSA 4MLYA 3H93A 1TXXA 3RHBA 1TTZA 4XHMA 1B9YC 2PWJA 4GSNA 2DMLA 2KLXA 2QC7A 2XBQA 1SJ6A 4O5RA 5JCUA 3ZZXA 1GSYA 4CHSA 3ZREA 2KOKA 2AYTA 1TRSA 2B1LA 1WOUA 4XRDA 4GSTA 3D4TA 2HNLA 3C7MA 5B6MA 5F0GA 4EF0A 3VWWA 4Z2RA 2QGVA 1EZKA 3UL3A 4O5UA 2DKIA 2LQOA 4HU7A 5G2ZA 1TRVA 2VCVA 4HZ4A 3IAM2 1SD9A 3J7Yb 1AXDA 4RI7A 1TK0B 2R2JA 4PGTA 4PXOA 4IW9A 2D2ZA 4Q5FA 3KJYA 1Z9HA 2GT6A 3HZ8A 1KTEA 1QFNA 2HSMA 4HDEA 5AN1A 1YF0A 2YCDA 3CXGA 1MDKA 1B4QA 3TJJA 5ABRA 5IOXA 12GSA 1ZYNA 2GQMA 3FEUA 4EXJA 1I9DA 4ZL9A 1ZOFA 3L4NA 4XIHA 3S9FA 6GSTA 2RUFA 1EWXA 3KMOA 1YJ6A 2C4JA 3KEBA 2OA7A 4G19A 3W8SA 3ERGA 2GSRA 4MA9A 3IPZA 4IP6A 4TR0A 4I2UA 4KH7A 2OBIA 4TR4A 5FHIA 2C8UA 2K8VA 1QUWA 1ST9A 1DUGA 2P5QA 3KMNA 2GZYA 3IA1A 3N9JA 3RPNA 1Z3EA 1FG4A 2H66A 3HD5A 3TJFA 2CX4A 2ES7A 3DXBA 2G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G1K A;  4MF6 A;  4TKY A;  5ECS A;  1GWC A;  2P0G A;  3JCM L;  4OMV A;  3CSJ A;  1A8L A;  3IC4 A;  1EOH A;  5DJM A;  3DEX A;  2P31 A;  4PUR A;  2X64 A;  3C1R A;  4PQH A;  3QOU A;  5HFG A;  3BOA A;  5ECK B;  1OC9 A;  3LEF A;  2Z9S A;  1A8Y A;  2C0E A;  4ZB8 A;  1DE1 A;  1MDJ A;  2ZCT A;  4JU5 A;  1WJK A;  1GLP A;  2HLS A;  2CV4 A;  4BL7 A;  1OYJ A;  3UVT A;  1AC1 A;  3SWL A;  2IWT A;  2LJK A;  1SL1 B;  4TR1 A;  3C71 A;  3QDN A;  1T7P B;  3UAP A;  4XS1 A;  5ECL B;  1TKD B;  1HNB A;  1PGT A;  4NHZ A;  4G2E A;  4FH8 A;  3IRA A;  2V6O A;  1EP7 A;  2DMM A;  3C73 A;  3FR6 A;  1X9W B;  3WT2 A;  4MF5 A;  3FR9 A;  3A2X A;  2YJH A;  4ML6 A;  1RK4 A;  4HQZ A;  1T1V A;  1AUC A;  1XXU A;  2EIR A;  4BA7 A;  3GH9 A;  1GTI A;  2PPT A;  4MJE A;  2GLR A;  4K0G A;  3KD0 A;  4OFN A;  1YKA A;  3W6G A;  3GKK A;  1TP9 A;  2R6K A;  2H73 A;  4ZBB A;  5HR2 A;  4PUA A;  2L59 A;  1AIU A;  1M0U A;  2CQ9 A;  2PBJ A;  2YN1 A;  5A5K A;  4IN0 A;  2NDO A;  3ZTL A;  3O76 A;  1JZW A;  3EU3 A;  1X5E A;  4AJ8 A;  3TRX A;  2HSH A;  5KN2 A;  2K18 A;  4FYB A;  1VF1 A;  2B5Y A;  3TKS A;  5GZZ B;  4HUA A;  2C1Y A;  1TK5 B;  4FYU A;  1GRX A;  2JZT A;  2VL9 A;  1OVN A;  2WFC A;  1J0F A;  2KUC A;  2YOI A;  5JCG A;  3RBT A;  3VI5 A;  5J3R A;  4ECI A;  4JR4 A;  4IQA A;  1JZR A;  1NSW A;  4HQS A;  3VWU A;  4KA0 A;  4X1U A;  5GSS A;  4I97 A;  2VL3 A;  2GST A;  2PVO C;  4GRF A;  3Q74 A;  1V57 A;  2FA4 A;  2GZP A;  2C3Q A;  2H1D A;  5A4W A;  2VCX A;  4KAE A;  3RPP A;  2B5E A;  1M2B A;  2PUK C;  2DIY A;  4J57 E;  1PSQ A;  3WGX A;  1SL2 B;  4F2I A;  3A2V A;  3QMX A;  4EKZ A;  3F6F A;  4JRR A;  4ISD A;  5IPG A;  4KCA A;  3I69 A;  1JLW A;  1YEP A;  11GS A;  2C0F A;  4F03 A;  1XWK A;  1M2D A;  2OE1 A;  2P5R A;  3QR6 A;  1ZGN A;  4MJB A;  2X99 A;  1B8X A;  3MDK A;  4Q5R A;  4CW9 A;  3LWA A;  1K0A A;  1S3C A;  5IOW A;  4TN8 A;  2V6K A;  3F4R A;  4WR4 A;  1HYU A;  4X43 A;  3M0F A;  4CDO A;  2WGR A;  2HSY A;  4QL9 A;  1X5D A;  4DSR A;  3Q18 A;  4EDZ A;  3F9U A;  3D22 A;  3ERF A;  1NM3 A;  3F63 A;  1THO A;  2CT6 A;  2DJK A;  3GYK A;  3KIJ A;  1Y6E A;  1K3Y A;  2GVP A;  2IFQ A;  3DRN A;  3ZMK A;  2IME A;  1ZZY A;  4NWY A;  1N2A A;  2HZE A;  5J41 A;  4N30 A;  1GUM A;  2L4Q A;  3ZRD A;  1DBY A;  1TW9 A;  3IV4 A;  1OC3 A;  4MK3 A;  1PRX A;  4OFT A;  3WGD A;  3CSH A;  1GTB A;  4MAB A;  2FY6 A;  4JED A;  5CRD A;  4BVX A;  1MD4 A;  1H75 A;  3GST A;  4EVM A;  4HU9 A;  1OAZ A;  2WJU A;  1O85 A;  5HR3 A;  3APO A;  4N11 A;  1OE8 A;  5JCW A;  3HXS A;  1SJI A;  5ID2 A;  5B8A A;  1PD2 1;  1T4Z A;  2VCZ A;  5AIX A;  1GNW A;  1R26 A;  4XCS A;  5DAK B;  1JLV A;  2PN8 A;  2JZR A;  3TKS E;  3MAK A;  1AW9 A;  2BMX A;  4EDY A;  3MNG A;  4X0X A;  4YQM A;  3GUR A;  1O6J A;  5DQS A;  3UOM A;  4F0C A;  2H0H A;  2MBS A;  3KP9 A;  3M3M A;  3TJK A;  2JAD A;  4PQ1 A;  2N5F A;  1S3A A;  2R4V A;  5G30 A;  1O8W A;  3LSZ A;  5DBQ A;  3G7J A;  1USB A;  4XS4 B;  4WEY A;  4WET A;  5H5Q A;  2JU5 A;  5D9T A;  3KH7 A;  5CNW A;  2FWG A;  3IDV A;  3GTU A;  2OAC A;  5IPH A;  2N5B A;  4L5O A;  3R2Q A;  3TRQ A;  3TRP A;  5HQP A;  5ECR B;  1SU9 A;  4POL A;  5IMV A;  1MD3 A;  2RLI A;  3QAV A;  2RUE A;  5IMZ A;  1K3L A;  3VK9 A;  5L71 A;  1XVW A;  3WD6 A;  1FO5 A;  1EV4 A;  4O92 A;  3HCZ A;  1CQH A;  2FCH A;  3F4T A;  1TJD A;  1FB0 A;  4GCI A;  3LG6 A;  1GH2 A;  3VFI A;  5ECO B;  3PIN A;  4FO5 A;  4IVF A;  2AV4 A;  2RM5 A;  3LYK A;  2JZS A;  2AAW A;  2M80 A;  5DVB A;  2DIZ A;  2I3Y A;  2H6Y A;  4FIW A;  2DJ3 A;  3G7I A;  2VL2 C;  2BJX A;  5G5F A;  2O85 A;  4WKW A;  3I6A A;  3TKP A;  4WXT A;  3AY8 A;  3N5O A;  3CBU A;  1U3A A;  1THX A;  1V98 A;  2CZ2 A;  4ID0 A;  4KW6 A;  1OC8 A;  3DKS A;  4IKH A;  5F06 A;  4FYC A;  4MCU A;  3WGE A;  3IBH A;  3RAZ A;  2IMI A;  5ECP B;  4TXO A;  4V1A p;  4LA1 A;  3GX0 A;  3P8W A;  1GUH A;  3I9V 2;  4EO3 A;  1EOG A;  2YAN A;  5ECM B;  3ZVJ A;  2TRC P;  1GSE A;  2M72 A;  2PER A;  4KX4 A;  5ENU A;  1X9S B;  1QGV A;  3HVX A;  4MZW A;  2OE3 A;  1M7T A;  5KN3 A;  5EY6 A;  4K8M A;  4DSS A;  4TRX A;  2HFD A;  2HT9 A;  4AJ7 A;  1TU8 A;  2FWE A;  1OKD A;  4MMM A;  4BWQ A;  18GS A;  2DJJ A;  1BED A;  4WF4 A;  1A2J A;  3M8N A;  3UJ1 A;  3FZA A;  5IO0 A;  1K3O A;  2YPM A;  1RW1 A;  5EPF A;  2H1A A;  1FVJ A;  3HVV A;  3E3E A;  1LU4 A;  1GUL A;  2V1M A;  3FKF A;  3LFL A;  2YV9 A;  4OWY A;  5JWR B;  2C3N A;  5CRH A;  4BWS A;  4QQ7 A;  1F9M A;  1V58 A;  1BAY A;  3DVW A;  5ECN B;  3KTB A;  2H0I A;  1GNE A;  1YZX A;  4DVC A;  2XPE A;  5J9C A;  2LJA A;  4Q5Q A;  2AB6 A;  2X8G A;  2C80 A;  4IP1 A;  2L6C A;  4ECC A;  4E8E A;  2E2M A;  3EWL A;  4MH2 A;  2H6Z A;  2KP1 A;  3QFA C;  3TOU A;  3KTL A;  5IMC A;  1DE2 A;  2L5O A;  2CX3 A;  4YAP A;  1A2L A;  2DJ1 A;  4ZL7 A;  2YP6 A;  4LL1 B;  5B8B A;  3CTF A;  2O7K A;  4PQI A;  2LRN A;  22GS A;  2H0G A;  1E6B A;  1XFL A;  2FA8 A;  1EEJ A;  5J4U A;  1ERW A;  3TUE A;  2LV3 A;  5DCG A;  2M46 A;  1U87 A;  2TRX A;  3IE3 A;  1NHO A;  3UAR A;  3F6D A;  2F9S A;  2B7K A;  3FZ9 A;  1ZL9 A;  5DCH A;  5KEJ A;  1EEM A;  4KGI A;  1UA5 A;  2CAQ A;  2WS2 A;  3GNJ A;  1XW5 A;  2FUG 2;  1G7E A;  4F82 A;  1WRY A;  4D73 B;  2GS3 A;  1XWB A;  2L6D A;  1NHY A;  5ECQ B;  3HVS A;  3UMA A;  1G7O A;  3L9V A;  6GSV A;  1K0M A;  1F37 A;  1EP8 A;  1VF2 A;  4ZIJ A;  5HR1 A;  4K7I A;  1K0N A;  2C3T A;  1GSF A;  2VLV A;  2PU9 C;  3UIW A;  1XWA A;  2CVD A;  4BVY A;  2VLU A;  2K8S A;  4POK A;  1R7H A;  2H74 A;  3F4S A;  3IOS A;  1K0O A;  4GQC A;  1GUK A;  1TRW A;  1ZMA A;  1KEB A;  1SEN A;  4NMU A;  3GN3 A;  3A5W A;  1YEX A;  3TGZ A;  2VCT A;  1ZYE A;  1X9M B;  3ZFL A;  1TI3 A;  4AF2 A;  3A2W A;  2NPB A;  5J5N A;  2LQQ A;  4E8H A;  1N8J A;  3VPT A;  1XCC A;  3TDG A;  5IIZ A;  2WDU A;  5D96 A;  1K0D A;  1UVZ A;  2YV7 A;  2VLT A;  3GRX A;  2PGT A;  5CAX A;  4V2L A;  2IJY A;  2WB9 A;  1OE7 A;  5IMF A;  4KSM A;  1TU7 A;  3EU4 A;  3EC3 A;  2XPD A;  4HJM A;  4GLT A;  2CVK A;  1SK1 A;  3DIE A;  3DWV A;  5AIS A;  3PR8 A;  1BG5 A;  5DAL A;  2VD0 A;  4OO4 A;  3EE2 A;  1SYR A;  5LNK e;  5D9W A;  5AGY A;  4ZBD A;  1GL8 A;  4OCF A;  3LQ7 A;  6GSU A;  2H19 A;  5F8B A;  2V2G A;  2HYX A;  4OD7 A;  4PNG A;  4IS0 A;  1KNG A;  4ACS A;  4ZL8 A;  2CA8 A;  1QQ2 A;  1BJX A;  1PN9 A;  4MPF A;  3DML A;  4QL7 A;  1QK8 A;  3FHK A;  3PH9 A;  1JFU A;  1PX7 A;  1KBN A;  2LUS A;  2B6M A;  2A2R A;  5E59 A;  4JBB A;  5D93 A;  4IBP A;  2K6V A;  1Z6N A;  2LRT A;  2N5A A;  5C04 A;  4KDY A;  2H72 A;  2YZH A;  2GTU A;  3IAS 2;  1K0B A;  1A2M A;  5D9X A;  4WR5 A;  1M9B A;  3U6V A;  4WBJ A;  1PKW A;  5G1L A;  1SKR B;  1W89 A;  5ECH B;  2XC2 A;  3C1S A;  6GSX A;  3QD9 A;  1OC9 B;  3GMF A;  3GL5 A;  1PA3 A;  2LNT A;  3HJP A;  3M9K A;  1H4O A;  4L0W A;  2VOC A;  3CYN A;  4DSQ A;  4GXZ A;  1GSD A;  3H8Q A;  4TR3 A;  4TR1 B;  1VF4 A;  1B9X C;  4MJC A;  2YWI A;  1TOF A;  4Q5N A;  4NXI A;  1WPI A;  4K0N A;  3M9J A;  2KP2 A;  3F3Q A;  3WYW A;  3HA9 A;  2HRF A;  2I1U A;  4YQV A;  3BD2 A;  1Y25 A;  4HZ2 A;  1DSB A;  2G2Q A;  5GAN D;  2ON5 A;  5CYY A;  3RHC A;  4EUY A;  1YKC A;  2K9F A;  3D6I A;  5A4V A;  1J08 A;  2LST A;  1OKT A;  3F3R A;  3D0Z A;  5COH A;  1PQN A;  5H5S A;  3ZLP A;  4GF0 A;  5KN0 A;  4HOJ A;  5C00 A;  1JHB A;  5F07 A;  2C0G A;  3TKR A;  2DBC A;  1TDI A;  1XVQ A;  3APS A;  1HNA A;  3QAG A;  4K7N A;  4TW5 A;  4O32 A;  2KHP A;  1GTA A;  2YWO A;  4ZIL A;  4PX1 A;  1R5A A;  2QKE A;  3NOF A;  4RUV A;  2LKU A;  6GSW A;  2FD3 A;  1MEK A;  3G7Y A;  4GQF A;  4NV5 A;  1Z7P A;  2F8A A;  4KUN A;  3IK9 A;  1ZYQ B;  2F51 A;  2R3X A;  5H5R A;  3ZIT A;  3L9S A;  1M99 A;  1M2A A;  2L5L A;  1HQO A;  3VWV A;  3NZN A;  1F3A A;  2DJ0 A;  3RDW A;  1BYE A;  1GLQ A;  3O6T A;  4WBR D;  4GTU A;  1YQ1 A;  1VRS D;  3TKQ A;  5HR0 A;  2PMT A;  2B7J A;  1S3D A;  3W8J A;  4EE0 A;  2VL2 A;  1B48 A;  1ERV A;  2I4A A;  2HZF A;  1ERT A;  1XWC A;  3SBC A;  4OFM A;  2MMZ A;  2LNS A;  3LXT A;  3TOT A;  3UBK A;  1WP0 A;  1MDI A;  4J2F A;  5ECI B;  4NV2 A;  4LMV A;  4ECJ A;  1Z6M A;  4XS6 A;  1MTC A;  2A4V A;  4I5Q A;  7GSS A;  4XTS A;  4DEJ A;  1EV9 A;  1XOB A;  1WE0 A;  3O3T A;  1U3I A;  1CQG A;  4RQX A;  3KCM A;  2GSQ A;  1V2A A;  3HDC A;  1G6W A;  6GSS A;  2YWM A;  3FW2 A;  2GQL A;  3HKR A;  5D8I A;  2I9H A;  2ZNM A;  1XW9 A;  1XPV A;  5G5E A;  4GWR A;  3H79 A;  1U6T A;  1NW2 A;  2MZC A;  3Q6O A;  1AAZ A;  4V2M A;  1UN2 A;  5DJL A;  1C72 A;  3KGK A;  3V1W A;  4V2N A;  1GSS A;  14GS A;  3H4K A;  2JL4 A;  5DDL A;  1UC7 A;  4YH2 A;  2BTO T;  1FHE A;  3FK8 A;  3D4M A;  4KE3 A;  2CAI A;  5LD0 A;  1VF3 A;  2RII A;  5DQY A;  3GL3 A;  3FZ4 A;  1R5P A;  5IQY A;  2AJQ B;  4MF7 A;  1E2Y A;  1WWJ A;  4TVE A;  2IFQ B;  4AGS A;  1F6M C;  3IXR A;  2HZE B;  5J9B A;  4ILF A;  1V9W A;  2YWN A;  1XZO A;  2HI7 A;  3LJR A;  1A24 A;  4GSS A;  2GDR A;  3KZQ A;  4IQ1 A;  5JWO B;  1O7U A;  3M1G A;  2MMO A;  1I5G A;  1VGL A;  1IYH A;  2GT5 A;  1Q4J A;  1FW1 A;  5CP1 A;  2B1K A;  3GV1 A;  3P90 A;  3CTG A;  13GS A;  3C8E A;  5ID2 B;  1SK2 A;  3CRU A;  3E0U A;  3ZVJ D;  1QMV A;  2HXK A;  3HY2 A;  1XWG A;  1F3B A;  3GUS A;  1F2E A;  4KSO A;  2NTO A;  20GS A;  3HJM A;  4XRA A;  3ZL5 A;  4EL1 A;  2J23 A;  4NAX A;  2MYG A;  2V32 A;  5CO3 A;  5FT3 A;  1HD2 A;  1URM A;  1JZO A;  1ERU A;  1ON4 A;  2J9H A;  1TK8 B;  1PMT A;  5CRG A;  2LS5 A;  2XHF A;  3GKX A;  2OKA A;  3ME7 A;  2E0Q A;  2R5G A;  1QXH A;  3EMX A;  4OCE A;  2HE3 A;  1T4Y A;  3FYG A;  1W4V A;  2RM6 A;  2IMD A;  3GTU B;  2OE0 A;  3GIX A;  1ABA A;  2O89 A;  4J56 E;  4YQU A;  1FVK A;  2AUV A;  3F8U A;  4RQR A;  4N10 A;  4P3Y B;  3MSZ A;  2GZZ A;  2GGT A;  4L0U A;  1FB6 A;  2F8F A;  3CMI A;  1Q98 A;  1LJR A;  1V40 A;  3GH6 A;  5D73 A;  2DC5 A;  2CZ3 A;  4N0V A;  4TXV A;  2DLX A;  3DYR A;  3BCI A;  2I81 A;  2MMA A;  1ML6 A;  2LRC A;  3ED3 A;  2EIO A;  5GST A;  3VUR A;  1K0C A;  1XW6 A;  2VCW A;  2H8L A;  1PX6 A;  1XIY A;  2OBK A;  1O73 A;  1WMJ A;  4G10 A;  3EVI A;  3KH9 A;  1A0R P;  1RQM A;  5A4U A;  4HI7 A;  3KXO A;  4F9Z A;  4WF5 A;  4HS1 A;  3K8N A;  4ZXG A;  4ZBA A;  4LLR A;  3EYT A;  4N0Z A;  2GSS A;  3OR5 A;  2O8V B;  2VD1 A;  1ZCP A;  3EIN A;  2VM2 A;  4POM A;  5DAK A;  1J9B A;  4ZB6 A;  2E2G A;  2XBI A;  3ZYW A;  1GSQ A;  2JAC A;  3ZIV A;  2H76 A;  4Z7X A;  3Q19 A;  5CRW A;  4IEL A;  3QAW A;  4TXO B;  1TI1 A;  5IO2 A;  4ML1 A;  1JZD A;  4TOP A;  2IL3 A;  3QCP A;  1BX9 A;  2REM A;  2PVQ A;  3LYP A;  1ACV A;  4OO5 A;  2FWH A;  4LMW A;  4IJI A;  8GSS A;  3BCK A;  3ME8 A;  3KP8 A;  2F3M A;  2LEG A;  4XS4 A;  2C0D A;  2EC4 A;  3GKM A;  4I6X A;  1TRU A;  5KN1 A;  3LXZ A;  2JSZ A;  4DSS B;  3I43 A;  3ZIJ A;  1T00 A;  1SD8 A;  4F0B A;  4PUF C;  1YY7 A;  1GTU A;  1HNC A;  2NVL A;  3WT1 A;  3J7Y k;  2ZUP A;  1T8E B;  5IMD A;  2FWF A;  5HFK A;  2MMN A;  2VAF A;  5E4W A;  1AQX A;  2V41 A;  2GQK A;  1LBK A;  2E7P A;  2VUP A;  2H75 A;  2TIR A;  3FY7 A;  3TKS C;  4K6X A;  5GAP D;  3ISO A;  3QPM A;  3HJO A;  3IK7 A;  3P2A A;  1GP1 A;  3VLN A;  3VI7 A;  1A0F A;  5EL8 A;  3DD3 A;  4MPG A;  5B7C A;  1ILO A;  2AHE A;  4ULX A;  2IIY A;  4L8E A;  4YAV A;  4MH3 A;  1PKZ A;  2H71 A;  4PNF A;  4L5L A;  3TJG A;  4MZC A;  4K2D A;  4NHW A;  3U5R E;  2MBT A;  2FGX A;  1FAA A;  3GKN A;  1G6Y A;  5AIV A;  2CVB A;  5G31 A;  4MJA A;  3L0H A;  5FWG A;  3GHA A;  2WUL A;  5LCZ A;  3UBL A;  4KDX A;  5IMA A;  3DVX A;  4MP4 A;  1B4P A;  4I8B A;  3D5J A;  3GSS A;  2H70 A;  3L9U A;  4MZB A;  4KDU A;  2O87 A;  3HHV A;  1M9A A;  2X8C A;  4G9H A;  1G0T A;  2B5X A;  3F0I A;  1XOA A;  3A3T A;  3LOR A;  4JE1 A;  1PL2 A;  1SKW B;  3GFK A;  1EGO A;  3QFB C;  3G9B A;  2OJL A;  3TCO A;  3US3 A;  4JR6 A;  9GSS A;  2FLS A;  2X8H A;  2EIQ A;  5F05 A;  5JWQ B;  4ECB A;  1Z7R A;  2H1G A;  4BPY A;  3VWX A;  2JSY A;  1SJZ A;  3H1N A;  3E9J B;  4K9Z A;  2H1B A;  2VCQ A;  1AQV A;  3HYP A;  2YNX A;  4IGJ A;  3CRT A;  4KCE A;  2DJ2 A;  2HRN A;  1R4W A;  3ERW A;  4HJ2 A;  1O81 A;  1SYX A;  1X0R A;  1SL0 B;  2H6X A;  3BBY A;  5INY A;  3PGT A;  10GS A;  2L57 A;  6GSY A;  2VO4 A;  2LJR A;  4NPB A;  4ZB9 A;  3L78 A;  1AQW A;  3VPQ A;  3ZML A;  1Z5Y E;  1SKS B;  4JZQ A;  4V1A g;  2OAD A;  1FOV A;  4K1F A;  3FRC A;  2YZU A;  1X5C A;  2QSI A;  4O7H A;  2IMK A;  1XBS A;  1PL1 A;  3CSI A;  3FZ5 A;  3NIV A;  2WCI A;  4KB3 A;  2IPA A;  4POB A;  16GS A;  3BJ5 A;  4AJ6 A;  4IHU A;  4LL4 B;  3GX8 A;  3EUR A;  4HEA 2;  2VM1 A;  1IYI A;  3LGC A;  2A2S A;  5EVO A;  4K7O A;  3EMP A;  1YDK A;  2FHE A;  2L4C A;  3TB2 A;  3IR4 A;  5DAL B;  3MWH A;  3ZFB A;  2FNO A;  2IMF A;  1GSU A;  3KM6 A;  1A23 A;  5CRE A;  3APQ A;  3IHQ A;  3UVH A;  2YJ7 A;  1O8X A;  2R37 A;  1U88 A;  2B3S A;  4D73 A;  2VIM A;  3HZ4 A;  5IM9 A;  2H01 A;  2ALB A;  3UEM A;  2WRT A;  1EGR A;  3TJB A;  3D21 A;  1T3B A;  1SK0 A;  5HFI A;  1WIK A;  4KND A;  2IN3 A;  4I2T A;  2ON7 A;  5ELA A;  3DGQ A;  5B6N A;  4IJ3 A;  4EC0 A;  3FR3 A;  19GS A;  5D9V A;  4RI6 A;  4MDC A;  4H86 A;  2DSA A;  5ELG A;  2WZ9 A;  3GA4 A;  2LTK A;  1YF1 A;  1BQ7 A;  3P7X A;  17GS A;  2H30 A;  2NBS A;  4MLY A;  3H93 A;  1TXX A;  3RHB A;  1TTZ A;  4XHM A;  1B9Y C;  2PWJ A;  4GSN A;  2DML A;  2KLX A;  2QC7 A;  2XBQ A;  1SJ6 A;  4O5R A;  5JCU A;  3ZZX A;  1GSY A;  4CHS A;  3ZRE A;  2KOK A;  2AYT A;  1TRS A;  2B1L A;  1WOU A;  4XRD A;  4GST A;  3D4T A;  2HNL A;  3C7M A;  5B6M A;  5F0G A;  4EF0 A;  3VWW A;  2QGV A;  1EZK A;  3UL3 A;  2LQO A;  4HU7 A;  5G2Z A;  1TRV A;  2VCV A;  4HZ4 A;  3IAM 2;  1SD9 A;  3J7Y b;  1AXD A;  4RI7 A;  1TK0 B;  2R2J A;  4PGT A;  4PXO A;  4IW9 A;  2D2Z A;  4Q5F A;  3KJY A;  1Z9H A;  2GT6 A;  3HZ8 A;  1KTE A;  1QFN A;  4HDE A;  5AN1 A;  1YF0 A;  2YCD A;  3CXG A;  1MDK A;  1B4Q A;  3TJJ A;  5ABR A;  5IOX A;  12GS A;  2GQM A;  3FEU A;  4EXJ A;  1I9D A;  4ZL9 A;  1ZOF A;  3L4N A;  4XIH A;  3S9F A;  6GST A;  2RUF A;  1EWX A;  3KMO A;  1YJ6 A;  2C4J A;  3KEB A;  2OA7 A;  4G19 A;  3W8S A;  3ERG A;  2GSR A;  4MA9 A;  3IPZ A;  4IP6 A;  4TR0 A;  4I2U A;  4KH7 A;  2OBI A;  4TR4 A;  5FHI A;  2C8U A;  2K8V A;  1QUW A;  1ST9 A;  1DUG A;  2P5Q A;  3KMN A;  2GZY A;  3IA1 A;  3N9J A;  3RPN A;  1Z3E A;  1FG4 A;  2H66 A;  3HD5 A;  3TJF A;  2CX4 A;  2ES7 A;  3DXB A;  2G0F A; 
#chains in the Genus database with same CATH topology
 3IC8 A;  5G1K A;  4MF6 A;  4TKY A;  5ECS A;  1GWC A;  2P0G A;  3JCM L;  4OMV A;  2A2P A;  2R0C A;  4KF9 A;  3CSJ A;  1A8L A;  3IC4 A;  1EOH A;  5DJM A;  3DEX A;  1M3I A;  2P31 A;  4PUR A;  2X64 A;  3C1R A;  4PQH A;  3QOU A;  5HFG A;  3BOA A;  5ECK B;  1OC9 A;  3LEF A;  2Z9S A;  1A8Y A;  2C0E A;  4ZB8 A;  1DE1 A;  1MDJ A;  2ZCT A;  4JU5 A;  1WJK A;  2QA1 A;  1GLP A;  2HLS A;  3PPU A;  2CV4 A;  4BL7 A;  1OYJ A;  3UVT A;  1AC1 A;  3SWL A;  2IWT A;  2LJK A;  1SL1 B;  4TR1 A;  3C71 A;  3QDN A;  1T7P B;  3UAP A;  4XS1 A;  5ECL B;  1TKD B;  1HNB A;  1PGT A;  4NHZ A;  4G2E A;  4FH8 A;  3IRA A;  2V6O A;  1EP7 A;  2DMM A;  3C73 A;  3FR6 A;  1X9W B;  3WT2 A;  4MF5 A;  3FR9 A;  3A2X A;  2YJH A;  4ML6 A;  1RK4 A;  4HQZ A;  1T1V A;  1AUC A;  1XXU A;  2EIR A;  4BA7 A;  3GH9 A;  1GTI A;  2PPT A;  4MJE A;  2GLR A;  4K0G A;  5BMU A;  3KD0 A;  4OFN A;  1YKA A;  3W6G A;  3GKK A;  1TP9 A;  2R6K A;  2H73 A;  4ZBB A;  5HR2 A;  4PUA A;  2L59 A;  1AIU A;  1M0U A;  2CQ9 A;  2PBJ A;  2YN1 A;  5A5K A;  4IN0 A;  2NDO A;  3ZTL A;  3O76 A;  3HVN A;  1JZW A;  3EU3 A;  1X5E A;  4AJ8 A;  3TRX A;  2HSH A;  5KN2 A;  2K18 A;  4FYB A;  1VF1 A;  1XG8 A;  1FOH A;  2B5Y A;  3TKS A;  5GZZ B;  4HUA A;  2C1Y A;  1TK5 B;  4FYU A;  1GRX A;  2JZT A;  2VL9 A;  1OVN A;  2WFC A;  1J0F A;  2KUC A;  2YOI A;  5JCG A;  3RBT A;  3VI5 A;  5J3R A;  4ECI A;  4JR4 A;  3EPT A;  4IQA A;  1JZR A;  1NSW A;  4HQS A;  4K5S A;  3VWU A;  4KA0 A;  4X1U A;  5GSS A;  4I97 A;  2VL3 A;  2GST A;  2PVO C;  4GRF A;  3Q74 A;  1V57 A;  2FA4 A;  2GZP A;  2C3Q A;  2H1D A;  5A4W A;  2VCX A;  4KAE A;  3RPP A;  2B5E A;  1M2B A;  2PUK C;  2DIY A;  4J57 E;  1PSQ A;  3WGX A;  1SL2 B;  4F2I A;  3A2V A;  3QMX A;  4EKZ A;  3F6F A;  4JRR A;  4ISD A;  5IPG A;  4KCA A;  3I69 A;  1JLW A;  1YEP A;  11GS A;  2C0F A;  4F03 A;  1XWK A;  1M2D A;  2OE1 A;  2P5R A;  3QR6 A;  1ZGN A;  4MJB A;  2X99 A;  1B8X A;  3MDK A;  4Q5R A;  4CW9 A;  3LWA A;  1K0A A;  1S3C A;  5IOW A;  4TN8 A;  2V6K A;  3F4R A;  4WR4 A;  1HYU A;  4X43 A;  3M0F A;  4CDO A;  2WGR A;  2HSY A;  4QL9 A;  1X5D A;  4DSR A;  3Q18 A;  4EDZ A;  3F9U A;  3D22 A;  3ERF A;  1NM3 A;  3F63 A;  1THO A;  4O5Q A;  2CT6 A;  2DJK A;  3GYK A;  3KIJ A;  1Y6E A;  1K3Y A;  2GVP A;  2IFQ A;  3DRN A;  3ZMK A;  2IME A;  1ZZY A;  4NWY A;  1N2A A;  2HZE A;  5J41 A;  4N30 A;  1GUM A;  2L4Q A;  3ZRD A;  1DBY A;  1TW9 A;  3IV4 A;  1OC3 A;  4MK3 A;  1PRX A;  4OFT A;  3WGD A;  3CSH A;  1GTB A;  1PN0 A;  4MAB A;  2FY6 A;  4JED A;  5CRD A;  4BVX A;  1MD4 A;  1H75 A;  3GST A;  4EVM A;  4HU9 A;  1OAZ A;  2WJU A;  3MIX A;  4YKF A;  1O85 A;  5HR3 A;  3APO A;  4N11 A;  1OE8 A;  5JCW A;  3HXS A;  1SJI A;  5ID2 A;  5B8A A;  1PD2 1;  1T4Z A;  2VCZ A;  5AIX A;  1GNW A;  1R26 A;  4XCS A;  5DAK B;  1JLV A;  2PN8 A;  2JZR A;  3TKS E;  3MAK A;  1AW9 A;  2BMX A;  4EDY A;  3MNG A;  4X0X A;  4YQM A;  3GUR A;  1O6J A;  5DQS A;  3UOM A;  4F0C A;  3MYD A;  2H0H A;  2MBS A;  3KP9 A;  3M3M A;  3TJK A;  2JAD A;  4PQ1 A;  2N5F A;  1S3A A;  3R3E A;  2R4V A;  5G30 A;  1O8W A;  4K5R A;  3LSZ A;  4G0L A;  5DBQ A;  3G7J A;  1USB A;  4XS4 B;  4WEY A;  4WET A;  5H5Q A;  4USS A;  2JU5 A;  5D9T A;  3KH7 A;  5CNW A;  3A5I A;  2X4A A;  2FWG A;  3IDV A;  3GTU A;  2OAC A;  5IPH A;  2N5B A;  4L5O A;  3R2Q A;  3TRQ A;  3TRP A;  5HQP A;  5ECR B;  1SU9 A;  4POL A;  5IMV A;  1MD3 A;  2RLI A;  3QAV A;  2RUE A;  5IMZ A;  1K3L A;  3VK9 A;  5L71 A;  1XVW A;  3WD6 A;  1FO5 A;  1EV4 A;  4O92 A;  3HCZ A;  4CY6 A;  1CQH A;  2FCH A;  3F4T A;  1TJD A;  1FB0 A;  4GCI A;  3LG6 A;  1GH2 A;  3VFI A;  5ECO B;  3PIN A;  4FO5 A;  4IVF A;  2AV4 A;  2RM5 A;  3LYK A;  2JZS A;  2AAW A;  2M80 A;  5DVB A;  2DIZ A;  2I3Y A;  2H6Y A;  4FIW A;  2DJ3 A;  3G7I A;  2VL2 C;  2BJX A;  5G5F A;  2O85 A;  4WKW A;  3I6A A;  3TKP A;  4WXT A;  3AY8 A;  3N5O A;  3CBU A;  1U3A A;  1THX A;  1V98 A;  2CZ2 A;  4ID0 A;  4KW6 A;  1OC8 A;  3DKS A;  4IKH A;  5F06 A;  4FYC A;  4MCU A;  3WGE A;  3IBH A;  3RAZ A;  2IMI A;  5ECP B;  4TXO A;  4V1A p;  4LA1 A;  3GX0 A;  3P8W A;  1GUH A;  3I9V 2;  4EO3 A;  1EOG A;  2YAN A;  5ECM B;  3ZVJ A;  4EIQ A;  2TRC P;  1GSE A;  2M72 A;  2PER A;  4FQU A;  4KX4 A;  5ENU A;  1X9S B;  1QGV A;  3HVX A;  4MZW A;  2OE3 A;  1M7T A;  5KN3 A;  5EY6 A;  4K8M A;  4DSS A;  4TRX A;  2HFD A;  2HT9 A;  4AJ7 A;  1TU8 A;  2FWE A;  1OKD A;  4MMM A;  4BWQ A;  18GS A;  2DJJ A;  1BED A;  4WF4 A;  1A2J A;  3M8N A;  3UJ1 A;  3FZA A;  5IO0 A;  1K3O A;  2YPM A;  1RW1 A;  5EPF A;  2H1A A;  1FVJ A;  3HVV A;  3E3E A;  1LU4 A;  1S3R A;  1GUL A;  2V1M A;  3FKF A;  3LFL A;  2YV9 A;  4OWY A;  5JWR B;  2C3N A;  5CRH A;  4BWS A;  4QQ7 A;  1F9M A;  1V58 A;  1BAY A;  3DVW A;  5ECN B;  3KTB A;  2H0I A;  4A5P A;  1GNE A;  1YZX A;  4DVC A;  2XPE A;  5J9C A;  2LJA A;  4Q5Q A;  2AB6 A;  2X8G A;  2C80 A;  4IP1 A;  2L6C A;  3CQF A;  4ECC A;  4E8E A;  2E2M A;  3EWL A;  4MH2 A;  2H6Z A;  2KP1 A;  3QFA C;  3TOU A;  3KTL A;  5IMC A;  1DE2 A;  2L5O A;  2CX3 A;  4YAP A;  1A2L A;  2DJ1 A;  4ZL7 A;  2YP6 A;  4LL1 B;  5B8B A;  3CTF A;  2O7K A;  4PQI A;  2LRN A;  22GS A;  2H0G A;  1E6B A;  1XFL A;  2FA8 A;  1EEJ A;  5J4U A;  1ERW A;  3TUE A;  2LV3 A;  5DCG A;  2M46 A;  1U87 A;  2TRX A;  1ZYP A;  3IE3 A;  1NHO A;  3UAR A;  4BIK A;  3F6D A;  2F9S A;  2B7K A;  3FZ9 A;  1ZL9 A;  5DCH A;  5KEJ A;  1EEM A;  3LW9 A;  4KGI A;  1UA5 A;  2CAQ A;  2WS2 A;  3GNJ A;  1XW5 A;  2FUG 2;  1G7E A;  4F82 A;  1WRY A;  4D73 B;  2GS3 A;  1XWB A;  2L6D A;  4X4J A;  1NHY A;  5ECQ B;  3HVS A;  3UMA A;  1G7O A;  3L9V A;  6GSV A;  1K0M A;  1F37 A;  1EP8 A;  1VF2 A;  4ZIJ A;  5HR1 A;  4K7I A;  1K0N A;  2C3T A;  1GSF A;  2VLV A;  2PU9 C;  3UIW A;  1XWA A;  2CVD A;  4BVY A;  2VLU A;  2K8S A;  4POK A;  1R7H A;  2H74 A;  3F4S A;  3IOS A;  1K0O A;  4GQC A;  1GUK A;  1TRW A;  1ZMA A;  1KEB A;  1SEN A;  4NMU A;  3GN3 A;  3A5W A;  1YEX A;  2QA2 A;  3TGZ A;  2VCT A;  1ZYE A;  1X9M B;  3ZFL A;  1TI3 A;  4AF2 A;  3A2W A;  2NPB A;  5J5N A;  2LQQ A;  4E8H A;  1N8J A;  3VPT A;  1XCC A;  3TDG A;  5IIZ A;  2WDU A;  5D96 A;  1K0D A;  1UVZ A;  2YV7 A;  2VLT A;  3GRX A;  2PGT A;  5CAX A;  4V2L A;  2IJY A;  2WB9 A;  1OE7 A;  5IMF A;  4KSM A;  1TU7 A;  3EU4 A;  2HRK A;  3EC3 A;  2XPD A;  4HJM A;  4GLT A;  2CVK A;  1SK1 A;  3DIE A;  3DWV A;  5AIS A;  3PR8 A;  1BG5 A;  5DAL A;  2VD0 A;  4OO4 A;  3EE2 A;  1SYR A;  5LNK e;  5D9W A;  5AGY A;  4ZBD A;  1GL8 A;  4OCF A;  3LQ7 A;  6GSU A;  2H19 A;  5F8B A;  2V2G A;  2HYX A;  4OD7 A;  4PNG A;  4IS0 A;  1KNG A;  4ACS A;  4ZL8 A;  2CA8 A;  1M3J A;  1QQ2 A;  1BJX A;  1PN9 A;  4MPF A;  4CY8 A;  3DML A;  4QL7 A;  1QK8 A;  3FHK A;  3PH9 A;  1JFU A;  1PX7 A;  1KBN A;  2LUS A;  2B6M A;  2A2R A;  5E59 A;  4JBB A;  4Z2U A;  5D93 A;  4IBP A;  2K6V A;  1Z6N A;  2LRT A;  2N5A A;  5C04 A;  4KDY A;  2H72 A;  2YZH A;  2GTU A;  4YKG A;  3IAS 2;  1K0B A;  1A2M A;  5D9X A;  4WR5 A;  1M9B A;  3U6V A;  2UZ8 A;  4WBJ A;  1PKW A;  5G1L A;  4EIP A;  1SKR B;  1W89 A;  5ECH B;  2XC2 A;  3C1S A;  6GSX A;  3QD9 A;  1OC9 B;  3GMF A;  3GL5 A;  1PA3 A;  2LNT A;  3HJP A;  3M9K A;  1H4O A;  4L0W A;  2VOC A;  4BL7 B;  3CYN A;  4DSQ A;  4GXZ A;  1GSD A;  3H8Q A;  4TR3 A;  4TR1 B;  1VF4 A;  1B9X C;  4MJC A;  2YWI A;  1TOF A;  4Q5N A;  4NXI A;  1WPI A;  4K0N A;  3M9J A;  2KP2 A;  3F3Q A;  3WYW A;  3HA9 A;  2HRF A;  2I1U A;  4YQV A;  3BD2 A;  1Y25 A;  4HZ2 A;  1DSB A;  2G2Q A;  5GAN D;  2ON5 A;  5CYY A;  3RHC A;  4EUY A;  1YKC A;  2K9F A;  3D6I A;  5A4V A;  1J08 A;  2LST A;  1OKT A;  3F3R A;  3D0Z A;  5COH A;  1PQN A;  5H5S A;  3ZLP A;  4GF0 A;  5KN0 A;  4HOJ A;  5C00 A;  1JHB A;  5F07 A;  2C0G A;  3TKR A;  2DBC A;  1TDI A;  1XVQ A;  3APS A;  1HNA A;  3QAG A;  4K7N A;  4TW5 A;  2R0P A;  4O32 A;  2KHP A;  1GTA A;  2YWO A;  4ZIL A;  4PX1 A;  1R5A A;  2QKE A;  3NOF A;  4RUV A;  2LKU A;  6GSW A;  2FD3 A;  1MEK A;  3G7Y A;  4GQF A;  4NV5 A;  1Z7P A;  2F8A A;  4KUN A;  3IK9 A;  1ZYQ B;  2F51 A;  2R3X A;  5H5R A;  3ZIT A;  3L9S A;  1M99 A;  1M2A A;  2L5L A;  1HQO A;  3VWV A;  3NZN A;  1F3A A;  2DJ0 A;  3RDW A;  1BYE A;  1GLQ A;  3O6T A;  4WBR D;  4GTU A;  1YQ1 A;  1VRS D;  3TKQ A;  5HR0 A;  2PMT A;  2B7J A;  1S3D A;  3W8J A;  4EE0 A;  2VL2 A;  1B48 A;  1ERV A;  2I4A A;  2HZF A;  1ERT A;  1XWC A;  3SBC A;  4OFM A;  2MMZ A;  2LNS A;  3LXT A;  3TOT A;  3UBK A;  1WP0 A;  2HRA A;  1MDI A;  4J2F A;  5ECI B;  4NV2 A;  4LMV A;  4ECJ A;  1Z6M A;  4XS6 A;  1MTC A;  2A4V A;  5BRT A;  4I5Q A;  7GSS A;  4XTS A;  4DEJ A;  1EV9 A;  1XOB A;  1WE0 A;  3O3T A;  1U3I A;  1CQG A;  4RQX A;  3KCM A;  2GSQ A;  1V2A A;  3HDC A;  1G6W A;  6GSS A;  2YWM A;  3FW2 A;  2GQL A;  3HKR A;  5D8I A;  2I9H A;  2ZNM A;  1XW9 A;  1XPV A;  5G5E A;  4GWR A;  4G0K A;  3H79 A;  1U6T A;  1NW2 A;  2DKH A;  2MZC A;  3Q6O A;  4PTS A;  1AAZ A;  4V2M A;  1UN2 A;  5DJL A;  1C72 A;  3KGK A;  3V1W A;  4V2N A;  1GSS A;  14GS A;  3H4K A;  2JL4 A;  5DDL A;  1UC7 A;  4YH2 A;  2BTO T;  1FHE A;  3FK8 A;  3D4M A;  4KE3 A;  2CAI A;  5LD0 A;  1VF3 A;  2RII A;  5DQY A;  3GL3 A;  3FZ4 A;  1R5P A;  5IQY A;  2AJQ B;  4Z2T A;  4MF7 A;  1E2Y A;  1WWJ A;  4TVE A;  2IFQ B;  4AGS A;  1F6M C;  3IXR A;  2HZE B;  5J9B A;  4ILF A;  1V9W A;  2YWN A;  5KOW A;  1XZO A;  2HI7 A;  3LJR A;  1A24 A;  4GSS A;  2GDR A;  3KZQ A;  4BVX B;  4MNN A;  4IQ1 A;  5JWO B;  1O7U A;  3M1G A;  2MMO A;  1I5G A;  1VGL A;  1IYH A;  2GT5 A;  1Q4J A;  1FW1 A;  5CP1 A;  2B1K A;  3GV1 A;  3P90 A;  3CTG A;  13GS A;  3C8E A;  5ID2 B;  1SK2 A;  3CRU A;  3E0U A;  3ZVJ D;  1QMV A;  2HXK A;  3HY2 A;  1XWG A;  1F3B A;  3GUS A;  1F2E A;  4KSO A;  2NTO A;  20GS A;  3HJM A;  4XRA A;  3ZL5 A;  4EL1 A;  2J23 A;  4NAX A;  2MYG A;  2V32 A;  5CO3 A;  5FT3 A;  1HD2 A;  1URM A;  1JZO A;  1ERU A;  1ON4 A;  3IHG A;  2J9H A;  1TK8 B;  1PMT A;  5CRG A;  2LS5 A;  1PFO A;  2XHF A;  4HSC X;  3GKX A;  2OKA A;  3ME7 A;  2R0G A;  2E0Q A;  2R5G A;  1QXH A;  3EMX A;  4OCE A;  2HE3 A;  1T4Y A;  3FYG A;  1W4V A;  2RM6 A;  2IMD A;  3GTU B;  2OE0 A;  3GIX A;  1ABA A;  2O89 A;  4J56 E;  4YQU A;  1FVK A;  2AUV A;  3F8U A;  4RQR A;  4N10 A;  4P3Y B;  5KOX A;  3MSZ A;  2GZZ A;  2GGT A;  4L0U A;  1FB6 A;  2F8F A;  3CMI A;  1Q98 A;  1LJR A;  1V40 A;  3GH6 A;  5D73 A;  2DC5 A;  2CZ3 A;  4N0V A;  4TXV A;  2DLX A;  3DYR A;  3BCI A;  2I81 A;  2MMA A;  4K2X A;  1ML6 A;  2LRC A;  3ED3 A;  2EIO A;  5GST A;  3VUR A;  1K0C A;  1XW6 A;  2VCW A;  2H8L A;  1PX6 A;  1XIY A;  2X49 A;  2OBK A;  1O73 A;  1WMJ A;  4G10 A;  3EVI A;  3KH9 A;  1A0R P;  1RQM A;  5A4U A;  4HI7 A;  3KXO A;  4F9Z A;  4WF5 A;  4HS1 A;  2A4H A;  3K8N A;  4ZXG A;  4ZBA A;  4LLR A;  3EYT A;  4N0Z A;  3OR5 A;  2GSS A;  2O8V B;  2VD1 A;  1ZCP A;  3EIN A;  2VM2 A;  4G0I A;  4POM A;  5DAK A;  1J9B A;  4ZB6 A;  2E2G A;  2XBI A;  3ZYW A;  1GSQ A;  2JAC A;  3ZIV A;  2H76 A;  4Z7X A;  3Q19 A;  5CRW A;  4IEL A;  3QAW A;  4TXO B;  1TI1 A;  5IO2 A;  4ML1 A;  1JZD A;  4TOP A;  2IL3 A;  3QCP A;  1BX9 A;  2REM A;  2PVQ A;  3LYP A;  1ACV A;  4OO5 A;  2FWH A;  4LMW A;  4IJI A;  8GSS A;  3BCK A;  3ME8 A;  3KP8 A;  2F3M A;  2LEG A;  4XS4 A;  2C0D A;  2EC4 A;  3GKM A;  4I6X A;  1TRU A;  5KN1 A;  3LXZ A;  2JSZ A;  4DSS B;  3I43 A;  3ZIJ A;  1T00 A;  1SD8 A;  4F0B A;  4PUF C;  1YY7 A;  1GTU A;  1HNC A;  2NVL A;  3WT1 A;  3J7Y k;  2ZUP A;  1T8E B;  5IMD A;  2FWF A;  5HFK A;  2MMN A;  2VAF A;  5E4W A;  1AQX A;  2V41 A;  2GQK A;  1LBK A;  2E7P A;  2VUP A;  2H75 A;  2TIR A;  3FY7 A;  3TKS C;  4K6X A;  5GAP D;  3ISO A;  3QPM A;  3HJO A;  3IK7 A;  3P2A A;  1GP1 A;  3VLN A;  3VI7 A;  1A0F A;  5EL8 A;  3DD3 A;  4MPG A;  5B7C A;  1ILO A;  2AHE A;  4ULX A;  2IIY A;  4L8E A;  4YAV A;  4MH3 A;  1PKZ A;  2H71 A;  4PNF A;  4L5L A;  3TJG A;  4MZC A;  4K2D A;  4NHW A;  3U5R E;  2MBT A;  2FGX A;  1FAA A;  3GKN A;  1G6Y A;  5AIV A;  2CVB A;  5G31 A;  4MJA A;  3L0H A;  5FWG A;  3GHA A;  2WUL A;  5LCZ A;  3UBL A;  4KDX A;  5IMA A;  3DVX A;  4MP4 A;  1B4P A;  4I8B A;  3D5J A;  3GSS A;  2H70 A;  3L9U A;  4MZB A;  4KDU A;  2O87 A;  3HHV A;  1M9A A;  2X8C A;  4G9H A;  1G0T A;  2B5X A;  3F0I A;  1XOA A;  3A3T A;  3LOR A;  4JE1 A;  1PL2 A;  1SKW B;  3GFK A;  1EGO A;  3QFB C;  3G9B A;  2OJL A;  3TCO A;  3US3 A;  4JR6 A;  9GSS A;  2FLS A;  2X8H A;  2EIQ A;  5F05 A;  5JWQ B;  4ECB A;  1Z7R A;  2H1G A;  4BPY A;  3VWX A;  2JSY A;  1SJZ A;  3H1N A;  3E9J B;  4K9Z A;  2H1B A;  2VCQ A;  1AQV A;  3HYP A;  2YNX A;  4IGJ A;  3CRT A;  4KCE A;  4ICY A;  2DJ2 A;  2HRN A;  1R4W A;  3ERW A;  4HJ2 A;  1O81 A;  1SYX A;  4BVY B;  1X0R A;  1SL0 B;  2H6X A;  3BBY A;  5INY A;  3PGT A;  10GS A;  2L57 A;  6GSY A;  2VO4 A;  2LJR A;  4NPB A;  4ZB9 A;  3L78 A;  1AQW A;  3VPQ A;  3ZML A;  1Z5Y E;  1SKS B;  4JZQ A;  4V1A g;  2OAD A;  1FOV A;  4K1F A;  3FRC A;  2YZU A;  1X5C A;  2QSI A;  4O7H A;  2IMK A;  1XBS A;  1PL1 A;  3CSI A;  3FZ5 A;  3NIV A;  2WCI A;  4KB3 A;  2IPA A;  4POB A;  16GS A;  3BJ5 A;  4AJ6 A;  4IHU A;  4LL4 B;  3GX8 A;  3EUR A;  4HEA 2;  2VM1 A;  1IYI A;  3LGC A;  2A2S A;  5EVO A;  4K7O A;  3EMP A;  1YDK A;  2FHE A;  3FMW A;  2L4C A;  3TB2 A;  3IR4 A;  5DAL B;  3MWH A;  3ZFB A;  2FNO A;  2IMF A;  1GSU A;  3KM6 A;  1A23 A;  5CRE A;  3APQ A;  3IHQ A;  3UVH A;  2YJ7 A;  1O8X A;  2R37 A;  1U88 A;  2B3S A;  4D73 A;  2VIM A;  3HZ4 A;  5IM9 A;  2H01 A;  2ALB A;  3UEM A;  2WRT A;  1EGR A;  3TJB A;  3D21 A;  1T3B A;  1SK0 A;  5HFI A;  1WIK A;  4KND A;  2IN3 A;  4I2T A;  2ON7 A;  5ELA A;  3DGQ A;  5B6N A;  4IJ3 A;  4EC0 A;  3FR3 A;  19GS A;  5D9V A;  4RI6 A;  4MDC A;  4H86 A;  2DSA A;  5ELG A;  2WZ9 A;  3GA4 A;  2LTK A;  1YF1 A;  1BQ7 A;  3P7X A;  17GS A;  2H30 A;  2NBS A;  4MLY A;  3H93 A;  1TXX A;  3RHB A;  1TTZ A;  4XHM A;  1B9Y C;  2PWJ A;  4GSN A;  2DML A;  2KLX A;  2QC7 A;  2XBQ A;  1SJ6 A;  4O5R A;  5JCU A;  3ZZX A;  1GSY A;  4CHS A;  3ZRE A;  2KOK A;  2AYT A;  1TRS A;  2B1L A;  1WOU A;  4XRD A;  4GST A;  3D4T A;  2HNL A;  3C7M A;  5B6M A;  5F0G A;  4EF0 A;  3VWW A;  4Z2R A;  2QGV A;  1EZK A;  3UL3 A;  4O5U A;  2DKI A;  2LQO A;  4HU7 A;  5G2Z A;  1TRV A;  2VCV A;  4HZ4 A;  3IAM 2;  1SD9 A;  3J7Y b;  1AXD A;  4RI7 A;  1TK0 B;  2R2J A;  4PGT A;  4PXO A;  4IW9 A;  2D2Z A;  4Q5F A;  3KJY A;  1Z9H A;  2GT6 A;  3HZ8 A;  1KTE A;  1QFN A;  2HSM A;  4HDE A;  5AN1 A;  1YF0 A;  2YCD A;  3CXG A;  1MDK A;  1B4Q A;  3TJJ A;  5ABR A;  5IOX A;  12GS A;  1ZYN A;  2GQM A;  3FEU A;  4EXJ A;  1I9D A;  4ZL9 A;  1ZOF A;  3L4N A;  4XIH A;  3S9F A;  6GST A;  2RUF A;  1EWX A;  3KMO A;  1YJ6 A;  2C4J A;  3KEB A;  2OA7 A;  4G19 A;  3W8S A;  3ERG A;  2GSR A;  4MA9 A;  3IPZ A;  4IP6 A;  4TR0 A;  4I2U A;  4KH7 A;  2OBI A;  4TR4 A;  5FHI A;  2C8U A;  2K8V A;  1QUW A;  1ST9 A;  1DUG A;  2P5Q A;  3KMN A;  2GZY A;  3IA1 A;  3N9J A;  3RPN A;  1Z3E A;  1FG4 A;  2H66 A;  3HD5 A;  3TJF A;  2CX4 A;  2ES7 A;  3DXB A;  2G0F A; 
#chains in the Genus database with same CATH homology
 3IC8 A;  5G1K A;  4MF6 A;  4TKY A;  5ECS A;  1GWC A;  2P0G A;  3JCM L;  4OMV A;  2A2P A;  2R0C A;  4KF9 A;  3CSJ A;  1A8L A;  3IC4 A;  1EOH A;  5DJM A;  3DEX A;  2P31 A;  4PUR A;  2X64 A;  3C1R A;  4PQH A;  3QOU A;  5HFG A;  3BOA A;  5ECK B;  1OC9 A;  3LEF A;  2Z9S A;  1A8Y A;  2C0E A;  4ZB8 A;  1DE1 A;  1MDJ A;  2ZCT A;  4JU5 A;  1WJK A;  2QA1 A;  1GLP A;  2HLS A;  3PPU A;  2CV4 A;  4BL7 A;  1OYJ A;  3UVT A;  1AC1 A;  3SWL A;  2IWT A;  2LJK A;  1SL1 B;  4TR1 A;  3C71 A;  3QDN A;  1T7P B;  3UAP A;  4XS1 A;  5ECL B;  1TKD B;  1HNB A;  1PGT A;  4NHZ A;  4G2E A;  4FH8 A;  3IRA A;  2V6O A;  1EP7 A;  2DMM A;  3C73 A;  3FR6 A;  1X9W B;  3WT2 A;  4MF5 A;  3FR9 A;  3A2X A;  2YJH A;  4ML6 A;  1RK4 A;  4HQZ A;  1T1V A;  1AUC A;  1XXU A;  2EIR A;  4BA7 A;  3GH9 A;  1GTI A;  2PPT A;  4MJE A;  2GLR A;  4K0G A;  5BMU A;  3KD0 A;  4OFN A;  1YKA A;  3W6G A;  3GKK A;  1TP9 A;  2R6K A;  2H73 A;  4ZBB A;  5HR2 A;  4PUA A;  2L59 A;  1AIU A;  1M0U A;  2CQ9 A;  2PBJ A;  2YN1 A;  5A5K A;  4IN0 A;  2NDO A;  3ZTL A;  3O76 A;  1JZW A;  3EU3 A;  1X5E A;  4AJ8 A;  3TRX A;  2HSH A;  5KN2 A;  2K18 A;  4FYB A;  1VF1 A;  1FOH A;  2B5Y A;  3TKS A;  5GZZ B;  4HUA A;  2C1Y A;  1TK5 B;  4FYU A;  1GRX A;  2JZT A;  2VL9 A;  1OVN A;  2WFC A;  1J0F A;  2KUC A;  2YOI A;  5JCG A;  3RBT A;  3VI5 A;  5J3R A;  4ECI A;  4JR4 A;  3EPT A;  4IQA A;  1JZR A;  1NSW A;  4HQS A;  4K5S A;  3VWU A;  4KA0 A;  4X1U A;  5GSS A;  4I97 A;  2VL3 A;  2GST A;  2PVO C;  4GRF A;  3Q74 A;  1V57 A;  2FA4 A;  2GZP A;  2C3Q A;  2H1D A;  5A4W A;  2VCX A;  4KAE A;  3RPP A;  2B5E A;  1M2B A;  2PUK C;  2DIY A;  4J57 E;  1PSQ A;  3WGX A;  1SL2 B;  4F2I A;  3A2V A;  3QMX A;  4EKZ A;  3F6F A;  4JRR A;  4ISD A;  5IPG A;  4KCA A;  3I69 A;  1JLW A;  1YEP A;  11GS A;  2C0F A;  4F03 A;  1XWK A;  1M2D A;  2OE1 A;  2P5R A;  3QR6 A;  1ZGN A;  4MJB A;  2X99 A;  1B8X A;  3MDK A;  4Q5R A;  4CW9 A;  3LWA A;  1K0A A;  1S3C A;  5IOW A;  4TN8 A;  2V6K A;  3F4R A;  4WR4 A;  1HYU A;  4X43 A;  3M0F A;  4CDO A;  2WGR A;  2HSY A;  4QL9 A;  1X5D A;  4DSR A;  3Q18 A;  4EDZ A;  3F9U A;  3D22 A;  3ERF A;  1NM3 A;  3F63 A;  1THO A;  4O5Q A;  2CT6 A;  2DJK A;  3GYK A;  3KIJ A;  1Y6E A;  1K3Y A;  2GVP A;  2IFQ A;  3DRN A;  3ZMK A;  2IME A;  1ZZY A;  4NWY A;  1N2A A;  2HZE A;  5J41 A;  4N30 A;  1GUM A;  2L4Q A;  3ZRD A;  1DBY A;  1TW9 A;  3IV4 A;  1OC3 A;  4MK3 A;  1PRX A;  4OFT A;  3WGD A;  3CSH A;  1GTB A;  1PN0 A;  4MAB A;  2FY6 A;  4JED A;  5CRD A;  4BVX A;  1MD4 A;  1H75 A;  3GST A;  4EVM A;  4HU9 A;  1OAZ A;  2WJU A;  3MIX A;  4YKF A;  1O85 A;  5HR3 A;  3APO A;  4N11 A;  1OE8 A;  5JCW A;  3HXS A;  1SJI A;  5ID2 A;  5B8A A;  1PD2 1;  1T4Z A;  2VCZ A;  5AIX A;  1GNW A;  1R26 A;  4XCS A;  5DAK B;  1JLV A;  2PN8 A;  2JZR A;  3TKS E;  3MAK A;  1AW9 A;  2BMX A;  4EDY A;  3MNG A;  4X0X A;  4YQM A;  3GUR A;  1O6J A;  5DQS A;  3UOM A;  4F0C A;  3MYD A;  2H0H A;  2MBS A;  3KP9 A;  3M3M A;  3TJK A;  2JAD A;  4PQ1 A;  2N5F A;  1S3A A;  3R3E A;  2R4V A;  5G30 A;  1O8W A;  4K5R A;  3LSZ A;  4G0L A;  5DBQ A;  3G7J A;  1USB A;  4XS4 B;  4WEY A;  4WET A;  5H5Q A;  4USS A;  2JU5 A;  5D9T A;  3KH7 A;  5CNW A;  3A5I A;  2X4A A;  2FWG A;  3IDV A;  3GTU A;  2OAC A;  5IPH A;  2N5B A;  4L5O A;  3R2Q A;  3TRQ A;  3TRP A;  5HQP A;  5ECR B;  1SU9 A;  4POL A;  5IMV A;  1MD3 A;  2RLI A;  3QAV A;  2RUE A;  5IMZ A;  1K3L A;  3VK9 A;  5L71 A;  1XVW A;  3WD6 A;  1FO5 A;  1EV4 A;  4O92 A;  3HCZ A;  4CY6 A;  1CQH A;  2FCH A;  3F4T A;  1TJD A;  1FB0 A;  4GCI A;  3LG6 A;  1GH2 A;  3VFI A;  5ECO B;  3PIN A;  4FO5 A;  4IVF A;  2AV4 A;  2RM5 A;  3LYK A;  2JZS A;  2AAW A;  2M80 A;  5DVB A;  2DIZ A;  2I3Y A;  2H6Y A;  4FIW A;  2DJ3 A;  3G7I A;  2VL2 C;  2BJX A;  5G5F A;  2O85 A;  4WKW A;  3I6A A;  3TKP A;  4WXT A;  3AY8 A;  3N5O A;  3CBU A;  1U3A A;  1THX A;  1V98 A;  2CZ2 A;  4ID0 A;  4KW6 A;  1OC8 A;  3DKS A;  4IKH A;  5F06 A;  4FYC A;  4MCU A;  3WGE A;  3IBH A;  3RAZ A;  2IMI A;  5ECP B;  4TXO A;  4V1A p;  4LA1 A;  3GX0 A;  3P8W A;  1GUH A;  3I9V 2;  4EO3 A;  1EOG A;  2YAN A;  5ECM B;  3ZVJ A;  4EIQ A;  2TRC P;  1GSE A;  2M72 A;  2PER A;  4FQU A;  4KX4 A;  5ENU A;  1X9S B;  1QGV A;  3HVX A;  4MZW A;  2OE3 A;  1M7T A;  5KN3 A;  5EY6 A;  4K8M A;  4DSS A;  4TRX A;  2HFD A;  2HT9 A;  4AJ7 A;  1TU8 A;  2FWE A;  1OKD A;  4MMM A;  4BWQ A;  18GS A;  2DJJ A;  1BED A;  4WF4 A;  1A2J A;  3M8N A;  3UJ1 A;  3FZA A;  5IO0 A;  1K3O A;  2YPM A;  1RW1 A;  5EPF A;  2H1A A;  1FVJ A;  3HVV A;  3E3E A;  1LU4 A;  1GUL A;  2V1M A;  3FKF A;  3LFL A;  2YV9 A;  4OWY A;  5JWR B;  2C3N A;  5CRH A;  4BWS A;  4QQ7 A;  1F9M A;  1V58 A;  1BAY A;  3DVW A;  5ECN B;  3KTB A;  2H0I A;  4A5P A;  1GNE A;  1YZX A;  4DVC A;  2XPE A;  5J9C A;  2LJA A;  4Q5Q A;  2AB6 A;  2X8G A;  2C80 A;  4IP1 A;  2L6C A;  4ECC A;  4E8E A;  2E2M A;  3EWL A;  4MH2 A;  2H6Z A;  2KP1 A;  3QFA C;  3TOU A;  3KTL A;  5IMC A;  1DE2 A;  2L5O A;  2CX3 A;  4YAP A;  1A2L A;  2DJ1 A;  4ZL7 A;  2YP6 A;  4LL1 B;  5B8B A;  3CTF A;  2O7K A;  4PQI A;  2LRN A;  22GS A;  2H0G A;  1E6B A;  1XFL A;  2FA8 A;  1EEJ A;  5J4U A;  1ERW A;  3TUE A;  2LV3 A;  5DCG A;  2M46 A;  1U87 A;  2TRX A;  1ZYP A;  3IE3 A;  1NHO A;  3UAR A;  3F6D A;  2F9S A;  2B7K A;  3FZ9 A;  1ZL9 A;  5DCH A;  5KEJ A;  1EEM A;  3LW9 A;  4KGI A;  1UA5 A;  2CAQ A;  2WS2 A;  3GNJ A;  1XW5 A;  2FUG 2;  1G7E A;  4F82 A;  1WRY A;  4D73 B;  2GS3 A;  1XWB A;  2L6D A;  4X4J A;  1NHY A;  5ECQ B;  3HVS A;  3UMA A;  1G7O A;  3L9V A;  6GSV A;  1K0M A;  1F37 A;  1EP8 A;  1VF2 A;  4ZIJ A;  5HR1 A;  4K7I A;  1K0N A;  2C3T A;  1GSF A;  2VLV A;  2PU9 C;  3UIW A;  1XWA A;  2CVD A;  4BVY A;  2VLU A;  2K8S A;  4POK A;  1R7H A;  2H74 A;  3F4S A;  3IOS A;  1K0O A;  4GQC A;  1GUK A;  1TRW A;  1ZMA A;  1KEB A;  1SEN A;  4NMU A;  3GN3 A;  3A5W A;  1YEX A;  2QA2 A;  3TGZ A;  2VCT A;  1ZYE A;  1X9M B;  3ZFL A;  1TI3 A;  4AF2 A;  3A2W A;  2NPB A;  5J5N A;  2LQQ A;  4E8H A;  1N8J A;  3VPT A;  1XCC A;  3TDG A;  5IIZ A;  2WDU A;  5D96 A;  1K0D A;  1UVZ A;  2YV7 A;  2VLT A;  3GRX A;  2PGT A;  5CAX A;  4V2L A;  2IJY A;  2WB9 A;  1OE7 A;  5IMF A;  4KSM A;  1TU7 A;  3EU4 A;  2HRK A;  3EC3 A;  2XPD A;  4HJM A;  4GLT A;  2CVK A;  1SK1 A;  3DIE A;  3DWV A;  5AIS A;  3PR8 A;  1BG5 A;  5DAL A;  2VD0 A;  4OO4 A;  3EE2 A;  1SYR A;  5LNK e;  5D9W A;  5AGY A;  4ZBD A;  1GL8 A;  4OCF A;  3LQ7 A;  6GSU A;  2H19 A;  5F8B A;  2V2G A;  2HYX A;  4OD7 A;  4PNG A;  4IS0 A;  1KNG A;  4ACS A;  4ZL8 A;  2CA8 A;  1QQ2 A;  1BJX A;  1PN9 A;  4MPF A;  4CY8 A;  3DML A;  4QL7 A;  1QK8 A;  3FHK A;  3PH9 A;  1JFU A;  1PX7 A;  1KBN A;  2LUS A;  2B6M A;  2A2R A;  5E59 A;  4JBB A;  4Z2U A;  5D93 A;  4IBP A;  2K6V A;  1Z6N A;  2LRT A;  2N5A A;  5C04 A;  4KDY A;  2H72 A;  2YZH A;  2GTU A;  4YKG A;  3IAS 2;  1K0B A;  1A2M A;  5D9X A;  4WR5 A;  1M9B A;  3U6V A;  2UZ8 A;  4WBJ A;  1PKW A;  5G1L A;  4EIP A;  1SKR B;  1W89 A;  5ECH B;  2XC2 A;  3C1S A;  6GSX A;  3QD9 A;  1OC9 B;  3GMF A;  3GL5 A;  1PA3 A;  2LNT A;  3HJP A;  3M9K A;  1H4O A;  4L0W A;  2VOC A;  4BL7 B;  3CYN A;  4DSQ A;  4GXZ A;  1GSD A;  3H8Q A;  4TR3 A;  4TR1 B;  1VF4 A;  1B9X C;  4MJC A;  2YWI A;  1TOF A;  4Q5N A;  4NXI A;  1WPI A;  4K0N A;  3M9J A;  2KP2 A;  3F3Q A;  3WYW A;  3HA9 A;  2HRF A;  2I1U A;  4YQV A;  3BD2 A;  1Y25 A;  4HZ2 A;  1DSB A;  2G2Q A;  5GAN D;  2ON5 A;  5CYY A;  3RHC A;  4EUY A;  1YKC A;  2K9F A;  3D6I A;  5A4V A;  1J08 A;  2LST A;  1OKT A;  3F3R A;  3D0Z A;  5COH A;  1PQN A;  5H5S A;  3ZLP A;  4GF0 A;  5KN0 A;  4HOJ A;  5C00 A;  1JHB A;  5F07 A;  2C0G A;  3TKR A;  2DBC A;  1TDI A;  1XVQ A;  3APS A;  1HNA A;  3QAG A;  4K7N A;  4TW5 A;  2R0P A;  4O32 A;  2KHP A;  1GTA A;  2YWO A;  4ZIL A;  4PX1 A;  1R5A A;  2QKE A;  3NOF A;  4RUV A;  2LKU A;  6GSW A;  2FD3 A;  1MEK A;  3G7Y A;  4GQF A;  4NV5 A;  1Z7P A;  2F8A A;  4KUN A;  3IK9 A;  1ZYQ B;  2F51 A;  2R3X A;  5H5R A;  3ZIT A;  3L9S A;  1M99 A;  1M2A A;  2L5L A;  1HQO A;  3VWV A;  3NZN A;  1F3A A;  2DJ0 A;  3RDW A;  1BYE A;  1GLQ A;  3O6T A;  4WBR D;  4GTU A;  1YQ1 A;  1VRS D;  3TKQ A;  5HR0 A;  2PMT A;  2B7J A;  1S3D A;  3W8J A;  4EE0 A;  2VL2 A;  1B48 A;  1ERV A;  2I4A A;  2HZF A;  1ERT A;  1XWC A;  3SBC A;  4OFM A;  2MMZ A;  2LNS A;  3LXT A;  3TOT A;  3UBK A;  1WP0 A;  2HRA A;  1MDI A;  4J2F A;  5ECI B;  4NV2 A;  4LMV A;  4ECJ A;  1Z6M A;  4XS6 A;  1MTC A;  2A4V A;  5BRT A;  4I5Q A;  7GSS A;  4XTS A;  4DEJ A;  1EV9 A;  1XOB A;  1WE0 A;  3O3T A;  1U3I A;  1CQG A;  4RQX A;  3KCM A;  2GSQ A;  1V2A A;  3HDC A;  1G6W A;  6GSS A;  2YWM A;  3FW2 A;  2GQL A;  3HKR A;  5D8I A;  2I9H A;  2ZNM A;  1XW9 A;  1XPV A;  5G5E A;  4GWR A;  4G0K A;  3H79 A;  1U6T A;  1NW2 A;  2DKH A;  2MZC A;  3Q6O A;  4PTS A;  1AAZ A;  4V2M A;  1UN2 A;  5DJL A;  1C72 A;  3KGK A;  3V1W A;  4V2N A;  1GSS A;  14GS A;  3H4K A;  2JL4 A;  5DDL A;  1UC7 A;  4YH2 A;  2BTO T;  1FHE A;  3FK8 A;  3D4M A;  4KE3 A;  2CAI A;  5LD0 A;  1VF3 A;  2RII A;  5DQY A;  3GL3 A;  3FZ4 A;  1R5P A;  5IQY A;  2AJQ B;  4Z2T A;  4MF7 A;  1E2Y A;  1WWJ A;  4TVE A;  2IFQ B;  4AGS A;  1F6M C;  3IXR A;  2HZE B;  5J9B A;  4ILF A;  1V9W A;  2YWN A;  5KOW A;  1XZO A;  2HI7 A;  3LJR A;  1A24 A;  4GSS A;  2GDR A;  3KZQ A;  4BVX B;  4MNN A;  4IQ1 A;  5JWO B;  1O7U A;  3M1G A;  2MMO A;  1I5G A;  1VGL A;  1IYH A;  2GT5 A;  1Q4J A;  1FW1 A;  5CP1 A;  2B1K A;  3GV1 A;  3P90 A;  3CTG A;  13GS A;  3C8E A;  5ID2 B;  1SK2 A;  3CRU A;  3E0U A;  3ZVJ D;  1QMV A;  2HXK A;  3HY2 A;  1XWG A;  1F3B A;  3GUS A;  1F2E A;  4KSO A;  2NTO A;  20GS A;  3HJM A;  4XRA A;  3ZL5 A;  4EL1 A;  2J23 A;  4NAX A;  2MYG A;  2V32 A;  5CO3 A;  5FT3 A;  1HD2 A;  1URM A;  1JZO A;  1ERU A;  1ON4 A;  3IHG A;  2J9H A;  1TK8 B;  1PMT A;  5CRG A;  2LS5 A;  2XHF A;  3GKX A;  2OKA A;  3ME7 A;  2R0G A;  2E0Q A;  2R5G A;  1QXH A;  3EMX A;  4OCE A;  2HE3 A;  1T4Y A;  3FYG A;  1W4V A;  2RM6 A;  2IMD A;  3GTU B;  2OE0 A;  3GIX A;  1ABA A;  2O89 A;  4J56 E;  4YQU A;  1FVK A;  2AUV A;  3F8U A;  4RQR A;  4N10 A;  4P3Y B;  5KOX A;  3MSZ A;  2GZZ A;  2GGT A;  4L0U A;  1FB6 A;  2F8F A;  3CMI A;  1Q98 A;  1LJR A;  1V40 A;  3GH6 A;  5D73 A;  2DC5 A;  2CZ3 A;  4N0V A;  4TXV A;  2DLX A;  3DYR A;  3BCI A;  2I81 A;  2MMA A;  4K2X A;  1ML6 A;  2LRC A;  3ED3 A;  2EIO A;  5GST A;  3VUR A;  1K0C A;  1XW6 A;  2VCW A;  2H8L A;  1PX6 A;  1XIY A;  2X49 A;  2OBK A;  1O73 A;  1WMJ A;  4G10 A;  3EVI A;  3KH9 A;  1A0R P;  1RQM A;  5A4U A;  4HI7 A;  3KXO A;  4F9Z A;  4WF5 A;  4HS1 A;  2A4H A;  3K8N A;  4ZXG A;  4ZBA A;  4LLR A;  3EYT A;  4N0Z A;  3OR5 A;  2GSS A;  2O8V B;  2VD1 A;  1ZCP A;  3EIN A;  2VM2 A;  4G0I A;  4POM A;  5DAK A;  1J9B A;  4ZB6 A;  2E2G A;  2XBI A;  3ZYW A;  1GSQ A;  2JAC A;  3ZIV A;  2H76 A;  4Z7X A;  3Q19 A;  5CRW A;  4IEL A;  3QAW A;  4TXO B;  1TI1 A;  5IO2 A;  4ML1 A;  1JZD A;  4TOP A;  2IL3 A;  3QCP A;  1BX9 A;  2REM A;  2PVQ A;  3LYP A;  1ACV A;  4OO5 A;  2FWH A;  4LMW A;  4IJI A;  8GSS A;  3BCK A;  3ME8 A;  3KP8 A;  2F3M A;  2LEG A;  4XS4 A;  2C0D A;  2EC4 A;  3GKM A;  4I6X A;  1TRU A;  5KN1 A;  3LXZ A;  2JSZ A;  4DSS B;  3I43 A;  3ZIJ A;  1T00 A;  1SD8 A;  4F0B A;  4PUF C;  1YY7 A;  1GTU A;  1HNC A;  2NVL A;  3WT1 A;  3J7Y k;  2ZUP A;  1T8E B;  5IMD A;  2FWF A;  5HFK A;  2MMN A;  2VAF A;  5E4W A;  1AQX A;  2V41 A;  2GQK A;  1LBK A;  2E7P A;  2VUP A;  2H75 A;  2TIR A;  3FY7 A;  3TKS C;  4K6X A;  5GAP D;  3ISO A;  3QPM A;  3HJO A;  3IK7 A;  3P2A A;  1GP1 A;  3VLN A;  3VI7 A;  1A0F A;  5EL8 A;  3DD3 A;  4MPG A;  5B7C A;  1ILO A;  2AHE A;  4ULX A;  2IIY A;  4L8E A;  4YAV A;  4MH3 A;  1PKZ A;  2H71 A;  4PNF A;  4L5L A;  3TJG A;  4MZC A;  4K2D A;  4NHW A;  3U5R E;  2MBT A;  2FGX A;  1FAA A;  3GKN A;  1G6Y A;  5AIV A;  2CVB A;  5G31 A;  4MJA A;  3L0H A;  5FWG A;  3GHA A;  2WUL A;  5LCZ A;  3UBL A;  4KDX A;  5IMA A;  3DVX A;  4MP4 A;  1B4P A;  4I8B A;  3D5J A;  3GSS A;  2H70 A;  3L9U A;  4MZB A;  4KDU A;  2O87 A;  3HHV A;  1M9A A;  2X8C A;  4G9H A;  1G0T A;  2B5X A;  3F0I A;  1XOA A;  3A3T A;  3LOR A;  4JE1 A;  1PL2 A;  1SKW B;  3GFK A;  1EGO A;  3QFB C;  3G9B A;  2OJL A;  3TCO A;  3US3 A;  4JR6 A;  9GSS A;  2FLS A;  2X8H A;  2EIQ A;  5F05 A;  5JWQ B;  4ECB A;  1Z7R A;  2H1G A;  4BPY A;  3VWX A;  2JSY A;  1SJZ A;  3H1N A;  3E9J B;  4K9Z A;  2H1B A;  2VCQ A;  1AQV A;  3HYP A;  2YNX A;  4IGJ A;  3CRT A;  4KCE A;  4ICY A;  2DJ2 A;  2HRN A;  1R4W A;  3ERW A;  4HJ2 A;  1O81 A;  1SYX A;  4BVY B;  1X0R A;  1SL0 B;  2H6X A;  3BBY A;  5INY A;  3PGT A;  10GS A;  2L57 A;  6GSY A;  2VO4 A;  2LJR A;  4NPB A;  4ZB9 A;  3L78 A;  1AQW A;  3VPQ A;  3ZML A;  1Z5Y E;  1SKS B;  4JZQ A;  4V1A g;  2OAD A;  1FOV A;  4K1F A;  3FRC A;  2YZU A;  1X5C A;  2QSI A;  4O7H A;  2IMK A;  1XBS A;  1PL1 A;  3CSI A;  3FZ5 A;  3NIV A;  2WCI A;  4KB3 A;  2IPA A;  4POB A;  16GS A;  3BJ5 A;  4AJ6 A;  4IHU A;  4LL4 B;  3GX8 A;  3EUR A;  4HEA 2;  2VM1 A;  1IYI A;  3LGC A;  2A2S A;  5EVO A;  4K7O A;  3EMP A;  1YDK A;  2FHE A;  3FMW A;  2L4C A;  3TB2 A;  3IR4 A;  5DAL B;  3MWH A;  3ZFB A;  2FNO A;  2IMF A;  1GSU A;  3KM6 A;  1A23 A;  5CRE A;  3APQ A;  3IHQ A;  3UVH A;  2YJ7 A;  1O8X A;  2R37 A;  1U88 A;  2B3S A;  4D73 A;  2VIM A;  3HZ4 A;  5IM9 A;  2H01 A;  2ALB A;  3UEM A;  2WRT A;  1EGR A;  3TJB A;  3D21 A;  1T3B A;  1SK0 A;  5HFI A;  1WIK A;  4KND A;  2IN3 A;  4I2T A;  2ON7 A;  5ELA A;  3DGQ A;  5B6N A;  4IJ3 A;  4EC0 A;  3FR3 A;  19GS A;  5D9V A;  4RI6 A;  4MDC A;  4H86 A;  2DSA A;  5ELG A;  2WZ9 A;  3GA4 A;  2LTK A;  1YF1 A;  1BQ7 A;  3P7X A;  17GS A;  2H30 A;  2NBS A;  4MLY A;  3H93 A;  1TXX A;  3RHB A;  1TTZ A;  4XHM A;  1B9Y C;  2PWJ A;  4GSN A;  2DML A;  2KLX A;  2QC7 A;  2XBQ A;  1SJ6 A;  4O5R A;  5JCU A;  3ZZX A;  1GSY A;  4CHS A;  3ZRE A;  2KOK A;  2AYT A;  1TRS A;  2B1L A;  1WOU A;  4XRD A;  4GST A;  3D4T A;  2HNL A;  3C7M A;  5B6M A;  5F0G A;  4EF0 A;  3VWW A;  4Z2R A;  2QGV A;  1EZK A;  3UL3 A;  4O5U A;  2DKI A;  2LQO A;  4HU7 A;  5G2Z A;  1TRV A;  2VCV A;  4HZ4 A;  3IAM 2;  1SD9 A;  3J7Y b;  1AXD A;  4RI7 A;  1TK0 B;  2R2J A;  4PGT A;  4PXO A;  4IW9 A;  2D2Z A;  4Q5F A;  3KJY A;  1Z9H A;  2GT6 A;  3HZ8 A;  1KTE A;  1QFN A;  2HSM A;  4HDE A;  5AN1 A;  1YF0 A;  2YCD A;  3CXG A;  1MDK A;  1B4Q A;  3TJJ A;  5ABR A;  5IOX A;  12GS A;  1ZYN A;  2GQM A;  3FEU A;  4EXJ A;  1I9D A;  4ZL9 A;  1ZOF A;  3L4N A;  4XIH A;  3S9F A;  6GST A;  2RUF A;  1EWX A;  3KMO A;  1YJ6 A;  2C4J A;  3KEB A;  2OA7 A;  4G19 A;  3W8S A;  3ERG A;  2GSR A;  4MA9 A;  3IPZ A;  4IP6 A;  4TR0 A;  4I2U A;  4KH7 A;  2OBI A;  4TR4 A;  5FHI A;  2C8U A;  2K8V A;  1QUW A;  1ST9 A;  1DUG A;  2P5Q A;  3KMN A;  2GZY A;  3IA1 A;  3N9J A;  3RPN A;  1Z3E A;  1FG4 A;  2H66 A;  3HD5 A;  3TJF A;  2CX4 A;  2ES7 A;  3DXB A;  2G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...