1YKAA

Solution structure of grx4, a monothiol glutaredoxin from e. coli.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords monothiol glutaredoxin ydhD
publication title Molecular mapping of functionalities in the solution structure of reduced Grx4, a monothiol glutaredoxin from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ykaA01
3KH9A 4O5RA 2OKAA 1TJDA 3ERWA 5LNKe 3TKRA 2XBQA 1J0FA 2ZUPA 4JR4A 3EU3A 1AUCA 5J4UA 1FOVA 3J7Yb 4NHWA 2QC7A 3EVIA 1AC1A 2E2GA 20GSA 4GSTA 2HI7A 1V98A 4KB3A 4Q5RA 2GT5A 2R4VA 4MZBA 1TU7A 2L57A 4MK3A 4TR1B 4OFTA 1GUKA 4V2NA 3D6IA 4HZ4A 3GKMA 4KGIA 3LG6A 1R7HA 1GSUA 4Q5NA 4X43A 1GUMA 3RHBA 2CAIA 1TDIA 3DD3A 1OKDA 3TKSE 22GSA 2YWOA 2VM1A 2D2ZA 2VCVA 1GRXA 1TP9A 3FZ5A 3N9JA 2VCWA 4GWRA 5ECKB 2A2RA 4NPBA 3SWLA 2PPTA 1QQ2A 5IIZA 4JR6A 2FA4A 4KDXA 2LQQA 4V1Ag 2R6KA 1YDKA 2MMAA 3FK8A 2JSZA 4LMWA 3TRXA 4OFNA 3TJKA 3HA9A 5J3RA 5IMAA 4GSNA 3RBTA 1JZWA 3GSSA 4IP6A 1HNBA 4WEYA 2LKUA 1XVQA 5B8BA 2GSTA 3ZFLA 1ERTA 4JU5A 3WT2A 2K6VA 3QR6A 1FAAA 2VD1A 5D96A 4TOPA 2KUCA 4BVXA 3LQ7A 3FRCA 5DQSA 1EZKA 1PSQA 2ZNMA 1I5GA 1BAYA 1GTBA 2GGTA 1MTCA 3EYTA 4I2UA 5EPFA 4IQAA 2F51A 3C1RA 1GNEA 3UVTA 12GSA 1TK5B 5EL8A 2R3XA 3M0FA 2X8GA 2VIMA 2IMFA 5DAKA 5ECLB 4H86A 4HJ2A 3UAPA 2JZTA 1XOAA 4YH2A 3BD2A 4DVCA 2HYXA 4L0UA 3E0UA 1WIKA 3A2WA 1EGOA 3ZVJD 3A3TA 2M80A 4GQCA 3TKQA 2V6KA 3US3A 1K3OA 2VLVA 4KNDA 4I97A 3Q19A 2KLXA 1NHOA 3BOAA 1SL0B 4ZB8A 1RW1A 4OD7A 4MH3A 3QCPA 5B6NA 3ERGA 1GWCA 4V2LA 1TK0B 2IN3A 1EOHA 1KNGA 1GLQA 3U6VA 2ON5A 1U88A 1XWKA 2DMLA 5CREA 2L4QA 1BYEA 2AB6A 1PL1A 3P90A 3GSTA 5H5RA 4KW6A 4XTSA 1B9YC 3Q6OA 4EC0A 3A5WA 2G0FA 1ERVA 3F3QA 1PN9A 16GSA 4IJ3A 2H66A 3HJMA 4HUAA 3APSA 5JWOB 1YY7A 3C7MA 1OKTA 2V2GA 4TVEA 5GSSA 1F37A 2PERA 1RQMA 5COHA 4HQZA 5D9WA 1T8EB 3KMNA 1XXUA 1ON4A 4J57E 3GL5A 4D73A 3UJ1A 4FH8A 4WR5A 3TRPA 5GAPD 1ZYEA 1V40A 1T4ZA 2WZ9A 2C0GA 2LRCA 4MZCA 3NOFA 2PN8A 2GTUA 4FYUA 2H6YA 4G19A 5CRHA 4TR4A 1B4QA 2L6CA 2H1GA 4IELA 4V2MA 2VL9A 5AIVA 1OC3A 2IWTA 2PMTA 3QDNA 1AAZA 1M0UA 1M9AA 3GRXA 3F4RA 4ML6A 1K0OA 5B6MA 1JFUA 4IVFA 3FEUA 4IP1A 1SKSB 1DE1A 5G31A 4MJBA 2VCTA 2WGRA 2WFCA 3GN3A 3RAZA 1AQXA 3PGTA 5IMVA 4G2EA 4F9ZA 1K0MA 5JCUA 1K0CA 2H76A 1X5EA 2E0QA 4WR4A 1Z3EA 3J7Yk 3GFKA 2ALBA 3DKSA 3FZ9A 2JZSA 5ECPB 1SJZA 1E2YA 2IMKA 3KCMA 4KAEA 4D73B 5ID2A 1USBA 2B7KA 3ZFBA 1GSEA 3VI5A 4ISDA 2TRXA 3A2VA 1X0RA 3UBLA 4BWQA 3UBKA 1ZOFA 4KE3A 3SBCA 2N5AA 1A2LA 2I81A 2GQLA 1E6BA 4K7IA 1HNAA 1BG5A 4RQXA 3AY8A 3MWHA 3ZZXA 3L9UA 3VK9A 14GSA 4EKZA 2GDRA 2GQKA 3EU4A 2VL3A 5A4WA 2H75A 5F8BA 3VPTA 2CV4A 3HVXA 1K3YA 4EXJA 2C8UA 4NAXA 5GAND 2YPMA 1TK8B 4POKA 2C80A 2I9HA 2WULA 2OADA 3BCKA 4GQFA 5CRWA 2GSRA 9GSSA 3C1SA 4PGTA 1O8WA 2C4JA 4PX1A 1QFNA 4L8EA 2WS2A 2H73A 2LV3A 2RM5A 3C73A 5D93A 5GSTA 5LCZA 2LNTA 1IYIA 3IHQA 2YN1A 4GCIA 4JBBA 4KSOA 2GT6A 4N11A 3GKKA 4V1Ap 3BJ5A 1EP8A 5AIXA 1PD21 3LJRA 4XRDA 3UOMA 3HZ8A 1F6MC 2B6MA 2CVKA 6GSSA 1WMJA 2YOIA 3GX0A 2GSQA 1JZOA 2R2JA 3G7JA 1K0BA 1U87A 2LJAA 3WYWA 5INYA 2DJ1A 1T00A 3D22A 5C00A 1OAZA 4MP4A 2RUEA 1YKCA 3H4KA 2N5BA 4MABA 5F05A 1AIUA 2NBSA 2H19A 1V58A 1J9BA 1V2AA 2F8AA 1PA3A 3TGZA 5IPHA 3ZYWA 4AF2A 5G1LA 4K0NA 3N5OA 4J56E 1F9MA 3GTUA 4MJAA 3NZNA 2IL3A 5DALA 4DSRA 4NWYA 3FW2A 4K7OA 1Z6NA 3HVVA 3TJJA 3WGDA 1GSYA 3ED3A 2LEGA 2K18A 5ELGA 2HZFA 10GSA 3L78A 4MH2A 1H4OA 5H5QA 5DBQA 5G5FA 2O8VB 2YWMA 4BWSA 2HRFA 4BA7A 4ML1A 5GZZB 4JEDA 1GTAA 2AAWA 4E8EA 1YQ1A 1HYUA 3IAS2 3DWVA 2GS3A 2HLSA 2C0FA 4JE1A 3ZIJA 3C71A 5ECIB 4O92A 1B4PA 2B5XA 2YV7A 4BVYA 4XS4A 2FA8A 4POMA 4QQ7A 3F3RA 3TJFA 1Z5YE 3U5RE 1W89A 1WE0A 3MAKA 3KZQA 1FVJA 2WJUA 4NMUA 3M9KA 1G7EA 4Z7XA 1X5CA 2FY6A 3GV1A 4EO3A 1FHEA 3G7YA 2H6XA 1EP7A 5DALB 4ZL8A 4ILFA 4TXVA 1QXHA 2VD0A 4EL1A 1XBSA 5KN0A 3CBUA 3EMPA 1SJIA 8GSSA 4XS1A 2R5GA 4E8HA 4YQUA 3APOA 3IOSA 4MPGA 1SJ6A 4QL7A 4LMVA 2MMNA 1QMVA 4QL9A 1SKWB 1EEJA 1G6WA 5E59A 2YJHA 3IK9A 1SD8A 2O87A 3I9V2 1KBNA 1THOA 1XZOA 3UIWA 4EF0A 3M8NA 1K0AA 3I69A 1GULA 2VCZA 2O85A 1JZDA 5ECMB 5HFIA 3O6TA 4WF4A 3KGKA 5FWGA 3LYPA 1G6YA 3IRAA 3F4TA 5AN1A 3W8JA 1WP0A 3M1GA 1S3CA 2C3TA 3HY2A 3HD5A 1M2BA 2GZPA 1W4VA 3LORA 6GSUA 4HQSA 1FW1A 2C0DA 2P31A 3FZ4A 1Y25A 1MDJA 2VL2C 3D5JA 3UL3A 3O76A 4PXOA 1ZMAA 1XWBA 3FYGA 3GH6A 4K9ZA 5AISA 2L4CA 3GA4A 3C8EA 1TTZA 3L4NA 2EIQA 2OE1A 4CDOA 4F2IA 2F9SA 3ZREA 3O3TA 4KCAA 3KTLA 5CAXA 2KP1A 4RUVA 2AV4A 4TW5A 4HU9A 3ZVJA 5HQPA 2ES7A 3KH7A 4G9HA 1AQWA 1S3DA 5B7CA 3JCML 2P5RA 2H0HA 2KP2A 4HDEA 5CYYA 2FUG2 2CT6A 3ZMKA 1FVKA 2CX3A 2O7KA 2OA7A 3P8WA 5EY6A 3VPQA 1LBKA 3M3MA 3UEMA 4RQRA 3QAWA 2BTOT 2JSYA 5FT3A 2HFDA 3HDCA 1SK0A 2VL2A 3MDKA 2XBIA 2G2QA 1GLPA 1N8JA 1VF3A 3TRQA 7GSSA 1VGLA 2YV9A 5KN2A 5ECOB 2GZYA 4KSMA 1FO5A 4O32A 1X5DA 5DAKB 2PU9C 2RIIA 4I5QA 1XVWA 2NVLA 2FLSA 2VO4A 4NV2A 3CTFA 1A24A 3GMFA 3F8UA 6GSXA 1TI3A 2AUVA 1JHBA 1GH2A 3W6GA 1SYXA 4NHZA 3KD0A 3D0ZA 3IBHA 1YKAA 3VI7A 4BPYA 1GTUA 3KP8A 3QOUA 1T3BA 1A0FA 2HZEA 3P7XA 3CSIA 3GIXA 1QK8A 2XPEA 4EUYA 4AJ8A 1G0TA 1TW9A 2N5FA 3GHAA 1TI1A 2FWHA 2CZ3A 4HEA2 1YEPA 4TXOA 3KJYA 1R5PA 1PRXA 3VWVA 1X9WB 4K1FA 3KMOA 4WKWA 1BJXA 2LTKA 1S3AA 5LD0A 1V9WA 2I4AA 5A5KA 2NTOA 1R5AA 3HXSA 2JZRA 2H1AA 4TR0A 2YCDA 1SU9A 4P3YB 1K3LA 1MDIA 2YZHA 1ABAA 3GURA 1LJRA 2TRCP 1NSWA 5DDLA 1AXDA 5J9BA 3Q74A 3EE2A 5F07A 1SL1B 2X8CA 5IMCA 3F0IA 1TRVA 2YP6A 3TCOA 3RPNA 4IQ1A 1ACVA 5IMZA 2X8HA 1M7TA 5KEJA 2OBIA 3IK7A 1VF4A 3IPZA 2JACA 2M46A 3DIEA 2FGXA 2C3NA 2VCXA 3Q18A 4ZBDA 1PL2A 5ECHB 2YANA 1G7OA 4AJ6A 4MF5A 4WF5A 4TRXA 5CO3A 5G1KA 2HRNA 4OWYA 2K8SA 5IM9A 2FWFA 1GL8A 4MZWA 1VF2A 2H74A 4X0XA 3ZRDA 19GSA 2IMDA 4MMMA 3ZIVA 3GH9A 1A23A 3WT1A 13GSA 2HXKA 2X99A 3TOUA 2CQ9A 3EWLA 1PQNA 3P2AA 1Z7RA 5D9TA 2V6OA 1LU4A 1R4WA 3LEFA 3LXTA 2AJQB 4JRRA 3LSZA 3VWXA 4CHSA 3IDVA 2VAFA 2MMOA 2H01A 2YWNA 1HNCA 2VLTA 2H71A 2R37A 4PQ1A 1QGVA 2V32A 5HR0A 4F0CA 3R2QA 3EINA 5CRDA 3GL3A 4PURA 4FO5A 1WRYA 4FYBA 2WB9A 5ID2B 1XW6A 4KDYA 4XHMA 1A8YA 2B1LA 4OCFA 3ME7A 2DJ0A 3QAGA 2O89A 4FYCA 4IS0A 4F0BA 1O85A 1OYJA 2XHFA 1O73A 4WETA 4ECIA 4ZBBA 1XIYA 2FWGA 3QFBC 1XWCA 3F63A 1OVNA 2YNXA 4CW9A 3PINA 2KHPA 4LL1B 4MLYA 1Z6MA 2FCHA 3RPPA 5ECRB 1PKWA 3IE3A 2B7JA 2HSHA 2H1BA 2V1MA 1PGTA 1B9XC 1ZCPA 2HE3A 3CMIA 1OC8A 1EWXA 4IN0A 2P0GA 5ECNB 1EEMA 4L0WA 2HT9A 2NPBA 1TRSA 4ZILA 5CNWA 3TKSA 2MBTA 3WGXA 5D73A 5D9XA 5J41A 3GYKA 2E2MA 4KDUA 4XIHA 5IOXA 4L5LA 5DCHA 3DYRA 5EVOA 3FY7A 2ON7A 3DGQA 2MZCA 4J2FA 2C3QA 1BQ7A 1DSBA 2LRNA 4XS6A 2P5QA 5ELAA 1PMTA 1GNWA 2TIRA 3GKXA 1BX9A 2EIRA 6GSVA 2IFQA 1H75A 2QKEA 4MJEA 3HYPA 4JZQA 4ACSA 1M99A 3RHCA 4MF6A 2BJXA 4ZL7A 4ZB9A 2B3SA 2B5YA 5G5EA 1Z9HA 1UC7A 2JU5A 3QFAC 1JLVA 2C1YA 5G30A 4PUAA 6GSYA 2DIZA 2A2SA 1EV4A 2DJ2A 3M9JA 3TDGA 2L5OA 1YZXA 5ABRA 1UA5A 4KUNA 3DMLA 3LXZA 3HZ4A 3WGEA 2IPAA 1T7PB 1VF1A 2HNLA 1EGRA 3KTBA 2H0GA 2H1DA 5ECQB 4OO5A 2MMZA 3KEBA 4ID0A 2PVQA 4X1UA 2CA8A 1M2AA 3IAM2 1JZRA 3OR5A 2VUPA 5G2ZA 2J9HA 3E9JB 1PX6A 4WBRD 1ST9A 3FKFA 1TKDB 2LJRA 3BBYA 3GTUB 4YQMA 4G10A 1ZZYA 3CSHA 4GF0A 3TUEA 4WBJA 2IFQB 3PR8A 2H70A 3CXGA 2GQMA 3DRNA 4DSSA 1GTIA 2NDOA 3FR9A 4HOJA 3H79A 2LNSA 2FHEA 4IKHA 2RUFA 2F8FA 2PBJA 4ECJA 1B8XA 5IOWA 2MBSA 5J5NA 1TRWA 17GSA 1GSFA 1AW9A 3H1NA 1V57A 2V41A 5HR1A 2DC5A 2GLRA 1Q98A 2RLIA 4N0VA 2CX4A 2EC4A 4TN8A 1XW9A 2A4VA 2K9FA 2XC2A 2VOCA 3F6DA 2C0EA 2DMMA 1TU8A 5A4UA 1T1VA 1GUHA 4GTUA 5L71A 3QMXA 4XS4B 3I6AA 4GXZA 5CP1A 3QPMA 2FWEA 3D21A 2X64A 1X9MB 2OACA 3TJGA 3E3EA 5JCWA 1XFLA 2OBKA 1C72A 2B1KA 5A4VA 3MSZA 1XOBA 2PWJA 4YAPA 4HI7A 2GSSA 1SYRA 5HR2A 1SK1A 4TR3A 3V1WA 1EV9A 1F3BA 2YWIA 3UVHA 2F3MA 4PQHA 2M72A 1TOFA 5C04A 4XCSA 1ERWA 3VWUA 5F06A 3ERFA 1YEXA 3WD6A 2VLUA 2H6ZA 4I8BA 2IMIA 3APQA 2CVBA 4OO4A 4MDCA 1MEKA 1THXA 2EIOA 4DSSB 1AQVA 5IO0A 1X9SB 1SENA 4TKYA 18GSA 3MNGA 1EOGA 3ZTLA 4MPFA 4ZXGA 3HHVA 1FB0A 3TB2A 2PGTA 2DJJA 2FD3A 1NM3A 4K0GA 4L5OA 6GSTA 1KTEA 5DCGA 1YF1A 4PNGA 4WXTA 4GSSA 3L9SA 4N0ZA 1ERUA 3S9FA 5ENUA 5KN1A 3VURA 2REMA 1A0RP 3EC3A 4K7NA 3TOTA 3CRUA 3NIVA 2Z9SA 5IMDA 2E7PA 5HFKA 3FR6A 1XCCA 4K8MA 5JCGA 3LGCA 4IBPA 1WPIA 3G9BA 1URMA 4F03A 1UN2A 2WCIA 2WDUA 3G7IA 3FHKA 3BCIA 2LRTA 2JL4A 4BL7A 4Q5FA 4EVMA 1O81A 3DEXA 3KXOA 4OMVA 1BEDA 3CTGA 1ML6A 3LWAA 2GVPA 1SL2B 5JWQB 4ULXA 4HU7A 3GX8A 3HVSA 3H8QA 3F6FA 3KIJA 1RK4A 2KOKA 4GLTA 2AYTA 1XWGA 3PH9A 5KN3A 3IC4A 4DSQA 1T4YA 4ECBA 2LS5A 1NHYA 3GKNA 1PX7A 4N30A 1OE8A 4MJCA 2QGVA 4HS1A 4HJMA 3HKRA 1WJKA 1U3IA 2LSTA 4OFMA 3D4MA 3KP9A 1VRSD 2DIYA 2J23A 2MYGA 1N2AA 4LA1A 1MDKA 4AGSA 5JWRB 5DVBA 2CZ2A 5IQYA 4N10A 1M9BA 4POBA 4PUFC 5B8AA 3IA1A 4KCEA 2CAQA 3L0HA 1MD3A 2RM6A 3FZAA 1ZYQB 4AJ7A 1M2DA 2XPDA 1K0NA 4ZIJA 3TKPA 3ISOA 4EDYA 1XPVA 1KEBA 5DQYA 2CVDA 1SKRB 2IMEA 4OCEA 1ILOA 1DUGA 3ZL5A 3HJPA 2GZZA 4Q5QA 1QUWA 2IJYA 3RDWA 4IW9A 11GSA 2H0IA 1SD9A 2WRTA 3IR4A 3HJOA 1GSSA 2BMXA 2K8VA 1CQGA 4LL4B 4GRFA 2HZEB 4IHUA 1Q4JA 4ZB6A 4RI7A 2OJLA 3EMXA 3UMAA 3CRTA 1Z7PA 3IXRA 3L9VA 2LJKA 4IJIA 4TXOB 5DJLA 1K0DA 3ME8A 2DSAA 1DE2A 4POLA 4LLRA 4FIWA 3VFIA 5CRGA 4ZL9A 1MD4A 4I2TA 3FR3A 2H8LA 4O7HA 3DVWA 4NV5A 3F9UA 5HR3A 1WWJA 2VCQA 4K2DA 1GSDA 5IO2A 1B48A 1OC9A 4YAVA 2FNOA 1J08A 3HCZA 5F0GA 2H72A 1GP1A 3QD9A 1O7UA 1HD2A 2VM2A 3D4TA 3GUSA 4IGJA 3H93A 3LYKA 2PVOC 4MCUA 4KX4A 3TKSC 3K8NA 1ZL9A 3IV4A 3VWWA 2PUKC 2ZCTA 1O6JA 5HFGA 2DBCA 3QAVA 2JADA 1FG4A 2HSYA 1CQHA 3KM6A 1SK2A 3ZITA 3EURA 1ZGNA 3F4SA 5D8IA 1HQOA 4RI6A 1OE7A 2DLXA 5H5SA 3LFLA 1YF0A 2L6DA 2LQOA 1Y6EA 4NXIA 2LUSA 5DJMA 4MA9A 4EE0A 3CSJA 1TXXA 3DXBA 5D9VA 1NW2A 3GNJA 1IYHA 4EDZA 1WOUA 4K6XA 2I3YA 1JLWA 5E4WA 1A8LA 1I9DA 4TR1A 1UVZA 3ZMLA 2YZUA 2AHEA 1A2MA 1R26A 3CYNA 2DJKA 1F2EA 4XRAA 1U6TA 3W8SA 1OC9B 4ZBAA 5FHIA 1FB6A 1U3AA 4PNFA 3I43A 4F82A 6GSWA 1O8XA 1YJ6A 2L59A 3A2XA 2L5LA 4PQIA 2OE3A 4HZ2A 4KH7A 2I1UA 4ECCA 1TRUA 2YJ7A 1XWAA 4KA0A 2H30A 2IIYA 5J9CA 1DBYA 1F3AA 1A2JA 3DVXA 5AGYA 4DEJA 3TJBA 3UARA 2B5EA 4MF7A 5IMFA 5IPGA 2QSIA 3VLNA 4I6XA 5ECSA 4YQVA 3ZLPA 2OE0A 2DJ3A 1XW5A 1GSQA 1PKZA
chains in the Genus database with same CATH superfamily
3KH9A 4O5RA 2OKAA 1TJDA 3ERWA 5LNKe 3TKRA 2XBQA 1J0FA 2ZUPA 4JR4A 3EU3A 1AUCA 5J4UA 1FOVA 3J7Yb 4NHWA 2QC7A 3EVIA 1AC1A 2E2GA 20GSA 4GSTA 2HI7A 1V98A 4KB3A 4X4JA 4Q5RA 2GT5A 2R4VA 4MZBA 1TU7A 2L57A 4MK3A 4TR1B 4OFTA 1GUKA 4V2NA 3D6IA 4HZ4A 3GKMA 4KGIA 3LG6A 1R7HA 1GSUA 4Q5NA 4X43A 1GUMA 3RHBA 2CAIA 1PN0A 1TDIA 3DD3A 1OKDA 3TKSE 22GSA 2YWOA 2VM1A 2D2ZA 2VCVA 1GRXA 1TP9A 3FZ5A 3N9JA 2VCWA 4GWRA 5ECKB 3IC8A 2A2RA 4NPBA 3SWLA 3EPTA 2PPTA 1QQ2A 5IIZA 4JR6A 2FA4A 4KDXA 2LQQA 4BIKA 2R0PA 4V1Ag 2R6KA 1YDKA 2MMAA 2X49A 3FK8A 2JSZA 4LMWA 3TRXA 4OFNA 1PFOA 3HA9A 3TJKA 5J3RA 5IMAA 4GSNA 3RBTA 1JZWA 3GSSA 4IP6A 1HNBA 4WEYA 2LKUA 1XVQA 5B8BA 2GSTA 3R3EA 3ZFLA 1ERTA 4JU5A 3WT2A 2K6VA 4PTSA 3QR6A 1FAAA 2VD1A 5D96A 4TOPA 2KUCA 4BVXA 3LQ7A 3FRCA 5DQSA 1EZKA 1PSQA 2ZNMA 1I5GA 1BAYA 1GTBA 2GGTA 1MTCA 3EYTA 4I2UA 5EPFA 4IQAA 2F51A 3C1RA 1GNEA 3UVTA 12GSA 1TK5B 5EL8A 2R3XA 3M0FA 2X8GA 2VIMA 3MIXA 2IMFA 5DAKA 5ECLB 4H86A 4HJ2A 3UAPA 4YKFA 2JZTA 1XOAA 4YH2A 3BD2A 4DVCA 2HYXA 4L0UA 3E0UA 1WIKA 3A2WA 1EGOA 3ZVJD 3A3TA 2M80A 4GQCA 3TKQA 2V6KA 3US3A 1K3OA 2VLVA 4KNDA 4I97A 3Q19A 2KLXA 1NHOA 3BOAA 1SL0B 4ZB8A 1RW1A 4OD7A 4MH3A 3QCPA 5B6NA 3ERGA 1GWCA 4V2LA 1TK0B 2IN3A 1EOHA 1KNGA 1GLQA 3U6VA 2ON5A 1U88A 1XWKA 2DMLA 5CREA 2L4QA 1S3RA 1BYEA 2AB6A 1PL1A 3P90A 3GSTA 5H5RA 4KW6A 4XTSA 1B9YC 3Q6OA 4EC0A 4BVXB 3A5WA 2G0FA 1ERVA 3F3QA 1PN9A 16GSA 4IJ3A 4KF9A 2H66A 3HJMA 4HUAA 1ZYNA 3APSA 5JWOB 1YY7A 3C7MA 1OKTA 2V2GA 4TVEA 5GSSA 1F37A 2PERA 1RQMA 5COHA 4HQZA 5D9WA 1T8EB 3KMNA 1XXUA 1ON4A 4J57E 3GL5A 4D73A 3UJ1A 4FH8A 4WR5A 3TRPA 5GAPD 1ZYEA 1V40A 1T4ZA 2WZ9A 2C0GA 2LRCA 4MZCA 3NOFA 2PN8A 2GTUA 4FYUA 2H6YA 4G19A 5CRHA 4TR4A 1B4QA 2L6CA 2H1GA 4IELA 4V2MA 2VL9A 5AIVA 1OC3A 2IWTA 2PMTA 3QDNA 1AAZA 1M0UA 1M9AA 3GRXA 3F4RA 4ML6A 1K0OA 5B6MA 1JFUA 4IVFA 3FEUA 4IP1A 1SKSB 1DE1A 5G31A 4MJBA 2VCTA 2WGRA 2WFCA 3GN3A 3RAZA 1AQXA 3PGTA 5IMVA 4G2EA 4F9ZA 1K0MA 5JCUA 1K0CA 2H76A 1X5EA 2HRAA 2E0QA 4WR4A 1Z3EA 3J7Yk 3GFKA 2ALBA 3DKSA 3FZ9A 2JZSA 5ECPB 1SJZA 1E2YA 2IMKA 3KCMA 4KAEA 4D73B 5ID2A 1USBA 2R0GA 2B7KA 3ZFBA 1GSEA 3VI5A 4ISDA 2TRXA 3A2VA 1X0RA 3UBLA 4BWQA 3UBKA 1ZOFA 2DKHA 4KE3A 3SBCA 2N5AA 1FOHA 4K2XA 1A2LA 2I81A 2GQLA 1E6BA 4K7IA 1HNAA 1BG5A 4FQUA 4RQXA 3AY8A 3MWHA 3ZZXA 3L9UA 3VK9A 14GSA 4EKZA 2GDRA 2GQKA 3EU4A 2VL3A 4Z2TA 5A4WA 2H75A 5F8BA 4MNNA 3VPTA 2CV4A 3HVXA 1K3YA 4EXJA 2C8UA 4NAXA 5GAND 2YPMA 1TK8B 4POKA 2C80A 2I9HA 2WULA 2OADA 3BCKA 4GQFA 5CRWA 2GSRA 9GSSA 2QA1A 3C1SA 4PGTA 1O8WA 2C4JA 2X4AA 4PX1A 1QFNA 4L8EA 2WS2A 2H73A 2LV3A 2RM5A 3C73A 5D93A 5GSTA 5LCZA 2LNTA 1IYIA 3IHQA 2YN1A 4GCIA 4JBBA 4KSOA 2GT6A 4N11A 3GKKA 4V1Ap 3BJ5A 1EP8A 5AIXA 1PD21 3LJRA 4XRDA 3UOMA 3HZ8A 1F6MC 2B6MA 2CVKA 6GSSA 1WMJA 2YOIA 3GX0A 2GSQA 1JZOA 2R2JA 3G7JA 1K0BA 1U87A 2LJAA 3WYWA 5INYA 2DJ1A 1T00A 3D22A 5C00A 1OAZA 4MP4A 2RUEA 1YKCA 3H4KA 2N5BA 4MABA 5F05A 1AIUA 2NBSA 2H19A 1V58A 1J9BA 1V2AA 2F8AA 1PA3A 3TGZA 5IPHA 3ZYWA 4AF2A 5G1LA 4K0NA 3N5OA 4J56E 1F9MA 3GTUA 4MJAA 3NZNA 2IL3A 5DALA 4USSA 4DSRA 4NWYA 1M3IA 3FW2A 4K7OA 1Z6NA 3HVVA 3TJJA 3WGDA 1GSYA 2A4HA 3ED3A 2LEGA 2K18A 5ELGA 2HZFA 10GSA 3L78A 4MH2A 1H4OA 5H5QA 5DBQA 5G5FA 2O8VB 2YWMA 4BWSA 2HRFA 4BA7A 4ML1A 5GZZB 4JEDA 1GTAA 2AAWA 4E8EA 1YQ1A 1HYUA 4CY8A 3IAS2 3DWVA 2GS3A 2HLSA 3LW9A 2C0FA 4JE1A 3ZIJA 3C71A 5ECIB 4O92A 1B4PA 2B5XA 2YV7A 4BVYA 4XS4A 2FA8A 4POMA 4QQ7A 4CY6A 3F3RA 3TJFA 1Z5YE 3U5RE 1W89A 1WE0A 3MAKA 3KZQA 1FVJA 2WJUA 4NMUA 3M9KA 1G7EA 4Z7XA 1X5CA 2FY6A 3GV1A 4EO3A 1FHEA 3G7YA 2H6XA 1EP7A 5DALB 4ZL8A 4ILFA 4TXVA 1QXHA 2VD0A 4EL1A 1XBSA 5KN0A 3CBUA 3EMPA 1SJIA 8GSSA 4XS1A 2R5GA 4E8HA 4YQUA 5KOWA 3APOA 3IOSA 4MPGA 1SJ6A 4QL7A 4LMVA 2MMNA 1QMVA 4QL9A 1SKWB 1EEJA 1G6WA 5E59A 2YJHA 3IK9A 1SD8A 2O87A 4K5RA 3I9V2 1KBNA 1THOA 1XZOA 3UIWA 4EF0A 3M8NA 1K0AA 3I69A 1GULA 2VCZA 2O85A 1JZDA 4K5SA 5ECMB 5HFIA 3O6TA 4WF4A 3KGKA 5FWGA 3LYPA 4G0LA 1G6YA 3IRAA 3F4TA 5AN1A 3W8JA 1WP0A 3M1GA 1S3CA 2C3TA 3HY2A 3HD5A 1M2BA 2GZPA 1W4VA 3LORA 6GSUA 4HQSA 4O5QA 1FW1A 2C0DA 2P31A 3FZ4A 1Y25A 1MDJA 2VL2C 3D5JA 3UL3A 3O76A 4PXOA 1ZMAA 2A2PA 1XWBA 3FYGA 3GH6A 4K9ZA 5AISA 2L4CA 3GA4A 3C8EA 1TTZA 3FMWA 3L4NA 2EIQA 2OE1A 4CDOA 4F2IA 2F9SA 3ZREA 4KCAA 3O3TA 3KTLA 5CAXA 2KP1A 4RUVA 2AV4A 4TW5A 4HU9A 3ZVJA 5HQPA 2ES7A 3KH7A 4G9HA 1AQWA 4YKGA 1S3DA 5B7CA 3JCML 2P5RA 2H0HA 2KP2A 4HDEA 5CYYA 2FUG2 2CT6A 3ZMKA 1FVKA 2CX3A 2O7KA 2OA7A 3P8WA 5EY6A 3VPQA 1LBKA 3M3MA 3UEMA 4RQRA 3QAWA 2BTOT 2JSYA 5FT3A 2HFDA 3HDCA 1SK0A 2VL2A 3MDKA 2XBIA 2G2QA 1GLPA 1N8JA 1VF3A 3TRQA 7GSSA 1VGLA 2QA2A 2YV9A 5KN2A 5ECOB 2GZYA 4KSMA 1FO5A 3PPUA 4O32A 1X5DA 5DAKB 2PU9C 2RIIA 4I5QA 1XVWA 2NVLA 2FLSA 2VO4A 4NV2A 3CTFA 1A24A 3GMFA 3F8UA 6GSXA 1TI3A 2AUVA 1JHBA 1GH2A 3A5IA 3W6GA 1SYXA 4NHZA 3KD0A 3D0ZA 4G0IA 3IBHA 1YKAA 3VI7A 4BPYA 1GTUA 3KP8A 3QOUA 1T3BA 1A0FA 2HZEA 3P7XA 3CSIA 3GIXA 1QK8A 2XPEA 4EUYA 4AJ8A 4G0KA 1G0TA 1TW9A 2N5FA 3GHAA 2HRKA 1TI1A 2FWHA 2CZ3A 4HEA2 1YEPA 4TXOA 3KJYA 1R5PA 1PRXA 3VWVA 1X9WB 4K1FA 3KMOA 4WKWA 1BJXA 2LTKA 1S3AA 2UZ8A 5LD0A 1V9WA 2I4AA 5A5KA 2NTOA 1R5AA 3HXSA 2JZRA 2H1AA 4TR0A 2YCDA 1SU9A 4P3YB 1K3LA 1MDIA 2YZHA 1ABAA 3GURA 1LJRA 2TRCP 1NSWA 5DDLA 1AXDA 5J9BA 3Q74A 3EE2A 5F07A 1SL1B 2X8CA 5IMCA 3F0IA 1TRVA 2YP6A 3TCOA 3RPNA 4IQ1A 1ACVA 5IMZA 2X8HA 1M7TA 5KEJA 2OBIA 3IK7A 1VF4A 3IPZA 2JACA 2M46A 3DIEA 2FGXA 2C3NA 2VCXA 3Q18A 4ZBDA 1PL2A 5ECHB 2YANA 1G7OA 4AJ6A 4MF5A 4WF5A 4TRXA 5CO3A 5G1KA 2HRNA 4OWYA 1M3JA 2K8SA 5IM9A 2FWFA 1GL8A 4MZWA 1VF2A 2H74A 4X0XA 3ZRDA 19GSA 2IMDA 4MMMA 3ZIVA 3GH9A 1A23A 3WT1A 13GSA 2HXKA 5BMUA 2X99A 3TOUA 2CQ9A 3EWLA 1PQNA 3P2AA 1Z7RA 5D9TA 2V6OA 1LU4A 1R4WA 3LEFA 3LXTA 2AJQB 4JRRA 3LSZA 3VWXA 4CHSA 3IDVA 2VAFA 2MMOA 2H01A 2YWNA 1HNCA 2VLTA 2H71A 2R37A 4PQ1A 1QGVA 2V32A 5HR0A 1XG8A 4F0CA 3MYDA 3R2QA 3EINA 5CRDA 3GL3A 4PURA 4FO5A 1WRYA 4FYBA 2WB9A 5ID2B 1XW6A 4KDYA 4XHMA 1A8YA 2B1LA 4OCFA 3ME7A 2DJ0A 3QAGA 2O89A 4FYCA 4IS0A 4F0BA 1O85A 1OYJA 2XHFA 1O73A 4WETA 4ECIA 4ZBBA 1XIYA 2FWGA 3QFBC 1XWCA 3F63A 1OVNA 2YNXA 4CW9A 3PINA 2KHPA 4ICYA 4LL1B 4MLYA 1Z6MA 2FCHA 3RPPA 5ECRB 1PKWA 3IE3A 2B7JA 2HSHA 2H1BA 2V1MA 1PGTA 1B9XC 1ZCPA 2HE3A 3CMIA 1OC8A 1EWXA 4IN0A 2P0GA 5ECNB 1EEMA 4L0WA 2HT9A 2NPBA 1TRSA 4ZILA 5CNWA 3TKSA 1ZYPA 2MBTA 3WGXA 5D73A 5D9XA 5J41A 3GYKA 2E2MA 4KDUA 4XIHA 5IOXA 4L5LA 5DCHA 3DYRA 5EVOA 3FY7A 2ON7A 3DGQA 2MZCA 4J2FA 2C3QA 1BQ7A 1DSBA 2LRNA 4XS6A 2HSMA 2P5QA 5ELAA 1PMTA 1GNWA 2TIRA 3GKXA 1BX9A 2EIRA 6GSVA 2IFQA 1H75A 2QKEA 4MJEA 3HYPA 4JZQA 4ACSA 1M99A 3RHCA 4MF6A 2BJXA 4ZL7A 4ZB9A 2B3SA 2B5YA 5G5EA 1Z9HA 1UC7A 2JU5A 3QFAC 1JLVA 2C1YA 5G30A 4PUAA 6GSYA 2DIZA 2A2SA 1EV4A 2DJ2A 3M9JA 3TDGA 2L5OA 1YZXA 5ABRA 1UA5A 4KUNA 3DMLA 3LXZA 3HZ4A 3WGEA 2IPAA 1T7PB 1VF1A 2HNLA 1EGRA 3KTBA 2H0GA 2H1DA 5ECQB 4OO5A 2MMZA 3KEBA 4ID0A 2PVQA 4X1UA 2CA8A 3HVNA 1M2AA 3IAM2 1JZRA 3OR5A 2VUPA 5G2ZA 2J9HA 5KOXA 3E9JB 1PX6A 4WBRD 1ST9A 3FKFA 1TKDB 2LJRA 3BBYA 3GTUB 4YQMA 4G10A 1ZZYA 3CSHA 4GF0A 3TUEA 4WBJA 2IFQB 2R0CA 3PR8A 2H70A 3CXGA 2GQMA 3DRNA 4DSSA 1GTIA 2NDOA 3FR9A 4HOJA 3H79A 2LNSA 2FHEA 4IKHA 2RUFA 2F8FA 2PBJA 4ECJA 1B8XA 5IOWA 2MBSA 5J5NA 1TRWA 17GSA 1GSFA 1AW9A 3H1NA 1V57A 2V41A 5HR1A 2DC5A 2GLRA 1Q98A 2RLIA 4N0VA 2CX4A 2EC4A 4TN8A 1XW9A 2A4VA 2K9FA 2XC2A 2VOCA 3F6DA 2C0EA 2DMMA 1TU8A 5A4UA 1T1VA 2DKIA 1GUHA 4GTUA 5L71A 4BVYB 3QMXA 4XS4B 3I6AA 4GXZA 5CP1A 3QPMA 2FWEA 3D21A 2X64A 1X9MB 2OACA 3TJGA 3E3EA 5JCWA 1XFLA 2OBKA 1C72A 2B1KA 5A4VA 3MSZA 1XOBA 2PWJA 4YAPA 4HI7A 2GSSA 4HSCX 1SYRA 5HR2A 1SK1A 4TR3A 3V1WA 1EV9A 1F3BA 2YWIA 3UVHA 2F3MA 4PQHA 2M72A 1TOFA 5C04A 4XCSA 1ERWA 3VWUA 5F06A 3ERFA 1YEXA 3WD6A 2VLUA 2H6ZA 4I8BA 2IMIA 3APQA 2CVBA 4OO4A 4MDCA 1MEKA 1THXA 2EIOA 4DSSB 1AQVA 4EIPA 5IO0A 1X9SB 1SENA 4TKYA 18GSA 3MNGA 1EOGA 3ZTLA 4MPFA 3CQFA 4ZXGA 3HHVA 1FB0A 3TB2A 2PGTA 2DJJA 2FD3A 1NM3A 4K0GA 4L5OA 6GSTA 1KTEA 5DCGA 1YF1A 4PNGA 4WXTA 4GSSA 3L9SA 4N0ZA 1ERUA 3S9FA 5ENUA 5KN1A 3VURA 2REMA 1A0RP 3EC3A 4K7NA 3TOTA 3CRUA 3NIVA 4Z2RA 2Z9SA 5IMDA 2E7PA 5HFKA 3FR6A 1XCCA 4K8MA 5JCGA 3LGCA 4IBPA 1WPIA 3G9BA 1URMA 4F03A 1UN2A 2WCIA 2WDUA 3G7IA 3FHKA 3BCIA 2LRTA 2JL4A 4BL7A 4Q5FA 4EVMA 1O81A 3DEXA 3KXOA 4OMVA 1BEDA 3CTGA 1ML6A 3LWAA 2GVPA 1SL2B 5JWQB 4ULXA 4HU7A 3GX8A 3HVSA 3H8QA 3F6FA 3KIJA 1RK4A 2KOKA 4GLTA 2AYTA 1XWGA 3PH9A 5KN3A 3IC4A 4DSQA 1T4YA 4ECBA 2LS5A 1NHYA 3GKNA 1PX7A 4N30A 1OE8A 4MJCA 2QGVA 4HS1A 4HJMA 3HKRA 1WJKA 1U3IA 2LSTA 4OFMA 3D4MA 4EIQA 3KP9A 1VRSD 2DIYA 2J23A 2MYGA 1N2AA 4LA1A 1MDKA 4AGSA 5JWRB 5DVBA 2CZ2A 5IQYA 4N10A 1M9BA 4POBA 4PUFC 5B8AA 3IA1A 4KCEA 2CAQA 3L0HA 1MD3A 2RM6A 3FZAA 1ZYQB 4AJ7A 1M2DA 2XPDA 1K0NA 4ZIJA 3TKPA 3ISOA 4EDYA 1XPVA 1KEBA 5DQYA 2CVDA 1SKRB 2IMEA 4OCEA 1ILOA 1DUGA 3ZL5A 4BL7B 3HJPA 2GZZA 4Q5QA 1QUWA 2IJYA 3RDWA 4IW9A 11GSA 2H0IA 1SD9A 2WRTA 3IR4A 3HJOA 1GSSA 2BMXA 2K8VA 1CQGA 4LL4B 4GRFA 2HZEB 4IHUA 1Q4JA 3IHGA 4ZB6A 4RI7A 2OJLA 3EMXA 3UMAA 3CRTA 1Z7PA 3IXRA 3L9VA 2LJKA 4IJIA 4TXOB 5DJLA 1K0DA 3ME8A 2DSAA 1DE2A 4A5PA 4POLA 4LLRA 4FIWA 3VFIA 5CRGA 4ZL9A 1MD4A 4I2TA 3FR3A 2H8LA 4O7HA 3DVWA 4NV5A 3F9UA 5HR3A 1WWJA 2VCQA 4K2DA 1GSDA 5IO2A 1B48A 1OC9A 4YAVA 2FNOA 1J08A 3HCZA 5F0GA 2H72A 1GP1A 3QD9A 1O7UA 1HD2A 2VM2A 5BRTA 3D4TA 3GUSA 4IGJA 3H93A 3LYKA 2PVOC 4MCUA 4KX4A 3TKSC 3K8NA 1ZL9A 3IV4A 3VWWA 2PUKC 2ZCTA 1O6JA 5HFGA 2DBCA 3QAVA 2JADA 1FG4A 2HSYA 1CQHA 3KM6A 1SK2A 3ZITA 3EURA 1ZGNA 3F4SA 4O5UA 5D8IA 1HQOA 4RI6A 1OE7A 2DLXA 5H5SA 3LFLA 1YF0A 2L6DA 2LQOA 1Y6EA 4NXIA 2LUSA 5DJMA 4MA9A 4EE0A 3CSJA 1TXXA 3DXBA 5D9VA 1NW2A 3GNJA 1IYHA 4EDZA 1WOUA 4K6XA 2I3YA 1JLWA 5E4WA 1A8LA 1I9DA 4TR1A 1UVZA 3ZMLA 2YZUA 2AHEA 1A2MA 1R26A 3CYNA 2DJKA 1F2EA 4XRAA 1U6TA 3W8SA 1OC9B 4ZBAA 5FHIA 1FB6A 1U3AA 4PNFA 3I43A 4F82A 6GSWA 1O8XA 1YJ6A 2L59A 3A2XA 2L5LA 4PQIA 2OE3A 4HZ2A 4KH7A 2I1UA 4ECCA 1TRUA 2YJ7A 1XWAA 4KA0A 2H30A 2IIYA 5J9CA 1DBYA 1F3AA 1A2JA 3DVXA 5AGYA 4DEJA 3TJBA 3UARA 2B5EA 4MF7A 5IMFA 5IPGA 2QSIA 3VLNA 4I6XA 5ECSA 4YQVA 3ZLPA 4Z2UA 2OE0A 2DJ3A 1XW5A 1GSQA 1PKZA
chains in the Genus database with same CATH topology
3KH9A 4O5RA 2OKAA 1TJDA 3ERWA 5LNKe 3TKRA 2XBQA 1J0FA 2ZUPA 4JR4A 3EU3A 1AUCA 5J4UA 1FOVA 3J7Yb 4NHWA 2QC7A 3EVIA 1AC1A 2E2GA 20GSA 4GSTA 2HI7A 1V98A 4KB3A 4X4JA 4Q5RA 2GT5A 2R4VA 4MZBA 1TU7A 2L57A 4MK3A 4TR1B 4OFTA 1GUKA 4V2NA 3D6IA 4HZ4A 3GKMA 4KGIA 3LG6A 1R7HA 1GSUA 4Q5NA 4X43A 1GUMA 3RHBA 2CAIA 1PN0A 1TDIA 3DD3A 1OKDA 3TKSE 22GSA 2YWOA 2VM1A 2D2ZA 2VCVA 1GRXA 1TP9A 3FZ5A 3N9JA 2VCWA 4GWRA 5ECKB 3IC8A 2A2RA 4NPBA 3SWLA 3EPTA 2PPTA 1QQ2A 5IIZA 4JR6A 2FA4A 4KDXA 2LQQA 2R0PA 4V1Ag 2R6KA 1YDKA 2MMAA 2X49A 3FK8A 2JSZA 4LMWA 3TRXA 4OFNA 3TJKA 3HA9A 5J3RA 5IMAA 4GSNA 3RBTA 1JZWA 3GSSA 4IP6A 1HNBA 4WEYA 2LKUA 1XVQA 5B8BA 2GSTA 3R3EA 3ZFLA 1ERTA 4JU5A 3WT2A 2K6VA 4PTSA 3QR6A 1FAAA 2VD1A 5D96A 4TOPA 2KUCA 4BVXA 3LQ7A 3FRCA 5DQSA 1EZKA 1PSQA 2ZNMA 1I5GA 1BAYA 1GTBA 2GGTA 1MTCA 3EYTA 4I2UA 5EPFA 4IQAA 2F51A 3C1RA 1GNEA 3UVTA 12GSA 1TK5B 5EL8A 2R3XA 3M0FA 2X8GA 2VIMA 3MIXA 2IMFA 5DAKA 5ECLB 4H86A 4HJ2A 3UAPA 4YKFA 2JZTA 1XOAA 4YH2A 3BD2A 4DVCA 2HYXA 4L0UA 3E0UA 1WIKA 3A2WA 1EGOA 3ZVJD 3A3TA 2M80A 4GQCA 3TKQA 2V6KA 3US3A 1K3OA 2VLVA 4KNDA 4I97A 3Q19A 2KLXA 1NHOA 3BOAA 1SL0B 4ZB8A 1RW1A 4OD7A 4MH3A 3QCPA 5B6NA 3ERGA 1GWCA 4V2LA 1TK0B 2IN3A 1EOHA 1KNGA 1GLQA 3U6VA 2ON5A 1U88A 1XWKA 2DMLA 5CREA 2L4QA 1BYEA 2AB6A 1PL1A 3P90A 3GSTA 5H5RA 4KW6A 4XTSA 1B9YC 3Q6OA 4EC0A 4BVXB 3A5WA 2G0FA 1ERVA 3F3QA 1PN9A 16GSA 4IJ3A 4KF9A 2H66A 3HJMA 4HUAA 1ZYNA 3APSA 5JWOB 1YY7A 3C7MA 1OKTA 2V2GA 4TVEA 5GSSA 1F37A 2PERA 1RQMA 5COHA 4HQZA 5D9WA 1T8EB 3KMNA 1XXUA 1ON4A 4J57E 3GL5A 4D73A 3UJ1A 4FH8A 4WR5A 3TRPA 5GAPD 1ZYEA 1V40A 1T4ZA 2WZ9A 2C0GA 2LRCA 4MZCA 3NOFA 2PN8A 2GTUA 4FYUA 2H6YA 4G19A 5CRHA 4TR4A 1B4QA 2L6CA 2H1GA 4IELA 4V2MA 2VL9A 5AIVA 1OC3A 2IWTA 2PMTA 3QDNA 1AAZA 1M0UA 1M9AA 3GRXA 3F4RA 4ML6A 1K0OA 5B6MA 1JFUA 4IVFA 3FEUA 4IP1A 1SKSB 1DE1A 5G31A 4MJBA 2VCTA 2WGRA 2WFCA 3GN3A 3RAZA 1AQXA 3PGTA 5IMVA 4G2EA 4F9ZA 1K0MA 5JCUA 1K0CA 2H76A 1X5EA 2HRAA 2E0QA 4WR4A 1Z3EA 3J7Yk 3GFKA 2ALBA 3DKSA 3FZ9A 2JZSA 5ECPB 1SJZA 1E2YA 2IMKA 3KCMA 4KAEA 4D73B 5ID2A 1USBA 2R0GA 2B7KA 3ZFBA 1GSEA 3VI5A 4ISDA 2TRXA 3A2VA 1X0RA 3UBLA 4BWQA 3UBKA 1ZOFA 2DKHA 4KE3A 3SBCA 2N5AA 1FOHA 4K2XA 1A2LA 2I81A 2GQLA 1E6BA 4K7IA 1HNAA 1BG5A 4FQUA 4RQXA 3AY8A 3MWHA 3ZZXA 3L9UA 3VK9A 14GSA 4EKZA 2GDRA 2GQKA 3EU4A 2VL3A 4Z2TA 5A4WA 2H75A 5F8BA 4MNNA 3VPTA 2CV4A 3HVXA 1K3YA 4EXJA 2C8UA 4NAXA 5GAND 2YPMA 1TK8B 4POKA 2C80A 2I9HA 2WULA 2OADA 3BCKA 4GQFA 5CRWA 2GSRA 9GSSA 2QA1A 3C1SA 4PGTA 1O8WA 2C4JA 2X4AA 4PX1A 1QFNA 4L8EA 2WS2A 2H73A 2LV3A 2RM5A 3C73A 5D93A 5GSTA 5LCZA 2LNTA 1IYIA 3IHQA 2YN1A 4GCIA 4JBBA 4KSOA 2GT6A 4N11A 3GKKA 4V1Ap 3BJ5A 1EP8A 5AIXA 1PD21 3LJRA 4XRDA 3UOMA 3HZ8A 1F6MC 2B6MA 2CVKA 6GSSA 1WMJA 2YOIA 3GX0A 2GSQA 1JZOA 2R2JA 3G7JA 1K0BA 1U87A 2LJAA 3WYWA 5INYA 2DJ1A 1T00A 3D22A 5C00A 1OAZA 4MP4A 2RUEA 1YKCA 3H4KA 2N5BA 4MABA 5F05A 1AIUA 2NBSA 2H19A 1V58A 1J9BA 1V2AA 2F8AA 1PA3A 3TGZA 5IPHA 3ZYWA 4AF2A 5G1LA 4K0NA 3N5OA 4J56E 1F9MA 3GTUA 4MJAA 3NZNA 2IL3A 5DALA 4USSA 4DSRA 4NWYA 3FW2A 4K7OA 1Z6NA 3HVVA 3TJJA 3WGDA 1GSYA 2A4HA 3ED3A 2LEGA 2K18A 5ELGA 2HZFA 10GSA 3L78A 4MH2A 1H4OA 5H5QA 5DBQA 5G5FA 2O8VB 2YWMA 4BWSA 2HRFA 4BA7A 4ML1A 5GZZB 4JEDA 1GTAA 2AAWA 4E8EA 1YQ1A 1HYUA 4CY8A 3IAS2 3DWVA 2GS3A 2HLSA 3LW9A 2C0FA 4JE1A 3ZIJA 3C71A 5ECIB 4O92A 1B4PA 2B5XA 2YV7A 4BVYA 4XS4A 2FA8A 4POMA 4QQ7A 4CY6A 3F3RA 3TJFA 1Z5YE 3U5RE 1W89A 1WE0A 3MAKA 3KZQA 1FVJA 2WJUA 4NMUA 3M9KA 1G7EA 4Z7XA 1X5CA 2FY6A 3GV1A 4EO3A 1FHEA 3G7YA 2H6XA 1EP7A 5DALB 4ZL8A 4ILFA 4TXVA 1QXHA 2VD0A 4EL1A 1XBSA 5KN0A 3CBUA 3EMPA 1SJIA 8GSSA 4XS1A 2R5GA 4E8HA 4YQUA 5KOWA 3APOA 3IOSA 4MPGA 1SJ6A 4QL7A 4LMVA 2MMNA 1QMVA 4QL9A 1SKWB 1EEJA 1G6WA 5E59A 2YJHA 3IK9A 1SD8A 2O87A 4K5RA 3I9V2 1KBNA 1THOA 1XZOA 3UIWA 4EF0A 3M8NA 1K0AA 3I69A 1GULA 2VCZA 2O85A 1JZDA 4K5SA 5ECMB 5HFIA 3O6TA 4WF4A 3KGKA 5FWGA 3LYPA 4G0LA 1G6YA 3IRAA 3F4TA 5AN1A 3W8JA 1WP0A 3M1GA 1S3CA 2C3TA 3HY2A 3HD5A 1M2BA 2GZPA 1W4VA 3LORA 6GSUA 4HQSA 4O5QA 1FW1A 2C0DA 2P31A 3FZ4A 1Y25A 1MDJA 2VL2C 3D5JA 3UL3A 3O76A 4PXOA 1ZMAA 2A2PA 1XWBA 3FYGA 3GH6A 4K9ZA 5AISA 2L4CA 3GA4A 3C8EA 1TTZA 3FMWA 3L4NA 2EIQA 2OE1A 4CDOA 4F2IA 2F9SA 3ZREA 3O3TA 4KCAA 3KTLA 5CAXA 2KP1A 4RUVA 2AV4A 4TW5A 4HU9A 3ZVJA 5HQPA 2ES7A 3KH7A 4G9HA 1AQWA 4YKGA 1S3DA 5B7CA 3JCML 2P5RA 2H0HA 2KP2A 4HDEA 5CYYA 2FUG2 2CT6A 3ZMKA 1FVKA 2CX3A 2O7KA 2OA7A 3P8WA 5EY6A 3VPQA 1LBKA 3M3MA 3UEMA 4RQRA 3QAWA 2BTOT 2JSYA 5FT3A 2HFDA 3HDCA 1SK0A 2VL2A 3MDKA 2XBIA 2G2QA 1GLPA 1N8JA 1VF3A 3TRQA 7GSSA 1VGLA 2QA2A 2YV9A 5KN2A 5ECOB 2GZYA 4KSMA 1FO5A 3PPUA 4O32A 1X5DA 5DAKB 2PU9C 2RIIA 4I5QA 1XVWA 2NVLA 2FLSA 2VO4A 4NV2A 3CTFA 1A24A 3GMFA 3F8UA 6GSXA 1TI3A 2AUVA 1JHBA 1GH2A 3A5IA 3W6GA 1SYXA 4NHZA 3KD0A 3D0ZA 4G0IA 3IBHA 1YKAA 3VI7A 4BPYA 1GTUA 3KP8A 3QOUA 1T3BA 1A0FA 2HZEA 3P7XA 3CSIA 3GIXA 1QK8A 2XPEA 4EUYA 4AJ8A 4G0KA 1G0TA 1TW9A 2N5FA 3GHAA 2HRKA 1TI1A 2FWHA 2CZ3A 4HEA2 1YEPA 4TXOA 3KJYA 1R5PA 1PRXA 3VWVA 1X9WB 4K1FA 3KMOA 4WKWA 1BJXA 2LTKA 1S3AA 2UZ8A 5LD0A 1V9WA 2I4AA 5A5KA 2NTOA 1R5AA 3HXSA 2JZRA 2H1AA 4TR0A 2YCDA 1SU9A 4P3YB 1K3LA 1MDIA 2YZHA 1ABAA 3GURA 1LJRA 2TRCP 1NSWA 5DDLA 1AXDA 5J9BA 3Q74A 3EE2A 5F07A 1SL1B 2X8CA 5IMCA 3F0IA 1TRVA 2YP6A 3TCOA 3RPNA 4IQ1A 1ACVA 5IMZA 2X8HA 1M7TA 5KEJA 2OBIA 3IK7A 1VF4A 3IPZA 2JACA 2M46A 3DIEA 2FGXA 2C3NA 2VCXA 3Q18A 4ZBDA 1PL2A 5ECHB 2YANA 1G7OA 4AJ6A 4MF5A 4WF5A 4TRXA 5CO3A 5G1KA 2HRNA 4OWYA 2K8SA 5IM9A 2FWFA 1GL8A 4MZWA 1VF2A 2H74A 4X0XA 3ZRDA 19GSA 2IMDA 4MMMA 3ZIVA 3GH9A 1A23A 3WT1A 13GSA 2HXKA 5BMUA 2X99A 3TOUA 2CQ9A 3EWLA 1PQNA 3P2AA 1Z7RA 5D9TA 2V6OA 1LU4A 1R4WA 3LEFA 3LXTA 2AJQB 4JRRA 3LSZA 3VWXA 4CHSA 3IDVA 2VAFA 2MMOA 2H01A 2YWNA 1HNCA 2VLTA 2H71A 2R37A 4PQ1A 1QGVA 2V32A 5HR0A 4F0CA 3MYDA 3R2QA 3EINA 5CRDA 3GL3A 4PURA 4FO5A 1WRYA 4FYBA 2WB9A 5ID2B 1XW6A 4KDYA 4XHMA 1A8YA 2B1LA 4OCFA 3ME7A 2DJ0A 3QAGA 2O89A 4FYCA 4IS0A 4F0BA 1O85A 1OYJA 2XHFA 1O73A 4WETA 4ECIA 4ZBBA 1XIYA 2FWGA 3QFBC 1XWCA 3F63A 1OVNA 2YNXA 4CW9A 3PINA 2KHPA 4ICYA 4LL1B 4MLYA 1Z6MA 2FCHA 3RPPA 5ECRB 1PKWA 3IE3A 2B7JA 2HSHA 2H1BA 2V1MA 1PGTA 1B9XC 1ZCPA 2HE3A 3CMIA 1OC8A 1EWXA 4IN0A 2P0GA 5ECNB 1EEMA 4L0WA 2HT9A 2NPBA 1TRSA 4ZILA 5CNWA 3TKSA 1ZYPA 2MBTA 3WGXA 5D73A 5D9XA 5J41A 3GYKA 2E2MA 4KDUA 4XIHA 5IOXA 4L5LA 5DCHA 3DYRA 5EVOA 3FY7A 2ON7A 3DGQA 2MZCA 4J2FA 2C3QA 1BQ7A 1DSBA 2LRNA 4XS6A 2HSMA 2P5QA 5ELAA 1PMTA 1GNWA 2TIRA 3GKXA 1BX9A 2EIRA 6GSVA 2IFQA 1H75A 2QKEA 4MJEA 3HYPA 4JZQA 4ACSA 1M99A 3RHCA 4MF6A 2BJXA 4ZL7A 4ZB9A 2B3SA 2B5YA 5G5EA 1Z9HA 1UC7A 2JU5A 3QFAC 1JLVA 2C1YA 5G30A 4PUAA 6GSYA 2DIZA 2A2SA 1EV4A 2DJ2A 3M9JA 3TDGA 2L5OA 1YZXA 5ABRA 1UA5A 4KUNA 3DMLA 3LXZA 3HZ4A 3WGEA 2IPAA 1T7PB 1VF1A 2HNLA 1EGRA 3KTBA 2H0GA 2H1DA 5ECQB 4OO5A 2MMZA 3KEBA 4ID0A 2PVQA 4X1UA 2CA8A 1M2AA 3IAM2 1JZRA 3OR5A 2VUPA 5G2ZA 2J9HA 5KOXA 3E9JB 1PX6A 4WBRD 1ST9A 3FKFA 1TKDB 2LJRA 3BBYA 3GTUB 4YQMA 4G10A 1ZZYA 3CSHA 4GF0A 3TUEA 4WBJA 2IFQB 2R0CA 3PR8A 2H70A 3CXGA 2GQMA 3DRNA 4DSSA 1GTIA 2NDOA 3FR9A 4HOJA 3H79A 2LNSA 2FHEA 4IKHA 2RUFA 2F8FA 2PBJA 4ECJA 1B8XA 5IOWA 2MBSA 5J5NA 1TRWA 17GSA 1GSFA 1AW9A 3H1NA 1V57A 2V41A 5HR1A 2DC5A 2GLRA 1Q98A 2RLIA 4N0VA 2CX4A 2EC4A 4TN8A 1XW9A 2A4VA 2K9FA 2XC2A 2VOCA 3F6DA 2C0EA 2DMMA 1TU8A 5A4UA 1T1VA 2DKIA 1GUHA 4GTUA 5L71A 4BVYB 3QMXA 4XS4B 3I6AA 4GXZA 5CP1A 3QPMA 2FWEA 3D21A 2X64A 1X9MB 2OACA 3TJGA 3E3EA 5JCWA 1XFLA 2OBKA 1C72A 2B1KA 5A4VA 3MSZA 1XOBA 2PWJA 4YAPA 4HI7A 2GSSA 1SYRA 5HR2A 1SK1A 4TR3A 3V1WA 1EV9A 1F3BA 2YWIA 3UVHA 2F3MA 4PQHA 2M72A 1TOFA 5C04A 4XCSA 1ERWA 3VWUA 5F06A 3ERFA 1YEXA 3WD6A 2VLUA 2H6ZA 4I8BA 2IMIA 3APQA 2CVBA 4OO4A 4MDCA 1MEKA 1THXA 2EIOA 4DSSB 1AQVA 4EIPA 5IO0A 1X9SB 1SENA 4TKYA 18GSA 3MNGA 1EOGA 3ZTLA 4MPFA 4ZXGA 3HHVA 1FB0A 3TB2A 2PGTA 2DJJA 2FD3A 1NM3A 4K0GA 4L5OA 6GSTA 1KTEA 5DCGA 1YF1A 4PNGA 4WXTA 4GSSA 3L9SA 4N0ZA 1ERUA 3S9FA 5ENUA 5KN1A 3VURA 2REMA 1A0RP 3EC3A 4K7NA 3TOTA 3CRUA 3NIVA 4Z2RA 2Z9SA 5IMDA 2E7PA 5HFKA 3FR6A 1XCCA 4K8MA 5JCGA 3LGCA 4IBPA 1WPIA 3G9BA 1URMA 4F03A 1UN2A 2WCIA 2WDUA 3G7IA 3FHKA 3BCIA 2LRTA 2JL4A 4BL7A 4Q5FA 4EVMA 1O81A 3DEXA 3KXOA 4OMVA 1BEDA 3CTGA 1ML6A 3LWAA 2GVPA 1SL2B 5JWQB 4ULXA 4HU7A 3GX8A 3HVSA 3H8QA 3F6FA 3KIJA 1RK4A 2KOKA 4GLTA 2AYTA 1XWGA 3PH9A 5KN3A 3IC4A 4DSQA 1T4YA 4ECBA 2LS5A 1NHYA 3GKNA 1PX7A 4N30A 1OE8A 4MJCA 2QGVA 4HS1A 4HJMA 3HKRA 1WJKA 1U3IA 2LSTA 4OFMA 3D4MA 4EIQA 3KP9A 1VRSD 2DIYA 2J23A 2MYGA 1N2AA 4LA1A 1MDKA 4AGSA 5JWRB 5DVBA 2CZ2A 5IQYA 4N10A 1M9BA 4POBA 4PUFC 5B8AA 3IA1A 4KCEA 2CAQA 3L0HA 1MD3A 2RM6A 3FZAA 1ZYQB 4AJ7A 1M2DA 2XPDA 1K0NA 4ZIJA 3TKPA 3ISOA 4EDYA 1XPVA 1KEBA 5DQYA 2CVDA 1SKRB 2IMEA 4OCEA 1ILOA 1DUGA 3ZL5A 4BL7B 3HJPA 2GZZA 4Q5QA 1QUWA 2IJYA 3RDWA 4IW9A 11GSA 2H0IA 1SD9A 2WRTA 3IR4A 3HJOA 1GSSA 2BMXA 2K8VA 1CQGA 4LL4B 4GRFA 2HZEB 4IHUA 1Q4JA 3IHGA 4ZB6A 4RI7A 2OJLA 3EMXA 3UMAA 3CRTA 1Z7PA 3IXRA 3L9VA 2LJKA 4IJIA 4TXOB 5DJLA 1K0DA 3ME8A 2DSAA 1DE2A 4A5PA 4POLA 4LLRA 4FIWA 3VFIA 5CRGA 4ZL9A 1MD4A 4I2TA 3FR3A 2H8LA 4O7HA 3DVWA 4NV5A 3F9UA 5HR3A 1WWJA 2VCQA 4K2DA 1GSDA 5IO2A 1B48A 1OC9A 4YAVA 2FNOA 1J08A 3HCZA 5F0GA 2H72A 1GP1A 3QD9A 1O7UA 1HD2A 2VM2A 5BRTA 3D4TA 3GUSA 4IGJA 3H93A 3LYKA 2PVOC 4MCUA 4KX4A 3TKSC 3K8NA 1ZL9A 3IV4A 3VWWA 2PUKC 2ZCTA 1O6JA 5HFGA 2DBCA 3QAVA 2JADA 1FG4A 2HSYA 1CQHA 3KM6A 1SK2A 3ZITA 3EURA 1ZGNA 3F4SA 4O5UA 5D8IA 1HQOA 4RI6A 1OE7A 2DLXA 5H5SA 3LFLA 1YF0A 2L6DA 2LQOA 1Y6EA 4NXIA 2LUSA 5DJMA 4MA9A 4EE0A 3CSJA 1TXXA 3DXBA 5D9VA 1NW2A 3GNJA 1IYHA 4EDZA 1WOUA 4K6XA 2I3YA 1JLWA 5E4WA 1A8LA 1I9DA 4TR1A 1UVZA 3ZMLA 2YZUA 2AHEA 1A2MA 1R26A 3CYNA 2DJKA 1F2EA 4XRAA 1U6TA 3W8SA 1OC9B 4ZBAA 5FHIA 1FB6A 1U3AA 4PNFA 3I43A 4F82A 6GSWA 1O8XA 1YJ6A 2L59A 3A2XA 2L5LA 4PQIA 2OE3A 4HZ2A 4KH7A 2I1UA 4ECCA 1TRUA 2YJ7A 1XWAA 4KA0A 2H30A 2IIYA 5J9CA 1DBYA 1F3AA 1A2JA 3DVXA 5AGYA 4DEJA 3TJBA 3UARA 2B5EA 4MF7A 5IMFA 5IPGA 2QSIA 3VLNA 4I6XA 5ECSA 4YQVA 3ZLPA 4Z2UA 2OE0A 2DJ3A 1XW5A 1GSQA 1PKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH9 A;  4O5R A;  2OKA A;  1TJD A;  3ERW A;  5LNK e;  3TKR A;  2XBQ A;  1J0F A;  2ZUP A;  4JR4 A;  3EU3 A;  1AUC A;  5J4U A;  1FOV A;  3J7Y b;  4NHW A;  2QC7 A;  3EVI A;  1AC1 A;  2E2G A;  20GS A;  4GST A;  2HI7 A;  1V98 A;  4KB3 A;  4Q5R A;  2GT5 A;  2R4V A;  4MZB A;  1TU7 A;  2L57 A;  4MK3 A;  4TR1 B;  4OFT A;  1GUK A;  4V2N A;  3D6I A;  4HZ4 A;  3GKM A;  4KGI A;  3LG6 A;  1R7H A;  1GSU A;  4Q5N A;  4X43 A;  1GUM A;  3RHB A;  2CAI A;  1TDI A;  3DD3 A;  1OKD A;  3TKS E;  22GS A;  2YWO A;  2VM1 A;  2D2Z A;  2VCV A;  1GRX A;  1TP9 A;  3FZ5 A;  3N9J A;  2VCW A;  4GWR A;  5ECK B;  2A2R A;  4NPB A;  3SWL A;  2PPT A;  1QQ2 A;  5IIZ A;  4JR6 A;  2FA4 A;  4KDX A;  2LQQ A;  4V1A g;  2R6K A;  1YDK A;  2MMA A;  3FK8 A;  2JSZ A;  4LMW A;  3TRX A;  4OFN A;  3TJK A;  3HA9 A;  5J3R A;  5IMA A;  4GSN A;  3RBT A;  1JZW A;  3GSS A;  4IP6 A;  1HNB A;  4WEY A;  2LKU A;  1XVQ A;  5B8B A;  2GST A;  3ZFL A;  1ERT A;  4JU5 A;  3WT2 A;  2K6V A;  3QR6 A;  1FAA A;  2VD1 A;  5D96 A;  4TOP A;  2KUC A;  4BVX A;  3LQ7 A;  3FRC A;  5DQS A;  1EZK A;  1PSQ A;  2ZNM A;  1I5G A;  1BAY A;  1GTB A;  2GGT A;  1MTC A;  3EYT A;  4I2U A;  5EPF A;  4IQA A;  2F51 A;  3C1R A;  1GNE A;  3UVT A;  12GS A;  1TK5 B;  5EL8 A;  2R3X A;  3M0F A;  2X8G A;  2VIM A;  2IMF A;  5DAK A;  5ECL B;  4H86 A;  4HJ2 A;  3UAP A;  2JZT A;  1XOA A;  4YH2 A;  3BD2 A;  4DVC A;  2HYX A;  4L0U A;  3E0U A;  1WIK A;  3A2W A;  1EGO A;  3ZVJ D;  3A3T A;  2M80 A;  4GQC A;  3TKQ A;  2V6K A;  3US3 A;  1K3O A;  2VLV A;  4KND A;  4I97 A;  3Q19 A;  2KLX A;  1NHO A;  3BOA A;  1SL0 B;  4ZB8 A;  1RW1 A;  4OD7 A;  4MH3 A;  3QCP A;  5B6N A;  3ERG A;  1GWC A;  4V2L A;  1TK0 B;  2IN3 A;  1EOH A;  1KNG A;  1GLQ A;  3U6V A;  2ON5 A;  1U88 A;  1XWK A;  2DML A;  5CRE A;  2L4Q A;  1BYE A;  2AB6 A;  1PL1 A;  3P90 A;  3GST A;  5H5R A;  4KW6 A;  4XTS A;  1B9Y C;  3Q6O A;  4EC0 A;  3A5W A;  2G0F A;  1ERV A;  3F3Q A;  1PN9 A;  16GS A;  4IJ3 A;  2H66 A;  3HJM A;  4HUA A;  3APS A;  5JWO B;  1YY7 A;  3C7M A;  1OKT A;  2V2G A;  4TVE A;  5GSS A;  1F37 A;  2PER A;  1RQM A;  5COH A;  4HQZ A;  5D9W A;  1T8E B;  3KMN A;  1XXU A;  1ON4 A;  4J57 E;  3GL5 A;  4D73 A;  3UJ1 A;  4FH8 A;  4WR5 A;  3TRP A;  5GAP D;  1ZYE A;  1V40 A;  1T4Z A;  2WZ9 A;  2C0G A;  2LRC A;  4MZC A;  3NOF A;  2PN8 A;  2GTU A;  4FYU A;  2H6Y A;  4G19 A;  5CRH A;  4TR4 A;  1B4Q A;  2L6C A;  2H1G A;  4IEL A;  4V2M A;  2VL9 A;  5AIV A;  1OC3 A;  2IWT A;  2PMT A;  3QDN A;  1AAZ A;  1M0U A;  1M9A A;  3GRX A;  3F4R A;  4ML6 A;  1K0O A;  5B6M A;  1JFU A;  4IVF A;  3FEU A;  4IP1 A;  1SKS B;  1DE1 A;  5G31 A;  4MJB A;  2VCT A;  2WGR A;  2WFC A;  3GN3 A;  3RAZ A;  1AQX A;  3PGT A;  5IMV A;  4G2E A;  4F9Z A;  1K0M A;  5JCU A;  1K0C A;  2H76 A;  1X5E A;  2E0Q A;  4WR4 A;  1Z3E A;  3J7Y k;  3GFK A;  2ALB A;  3DKS A;  3FZ9 A;  2JZS A;  5ECP B;  1SJZ A;  1E2Y A;  2IMK A;  3KCM A;  4KAE A;  4D73 B;  5ID2 A;  1USB A;  2B7K A;  3ZFB A;  1GSE A;  3VI5 A;  4ISD A;  2TRX A;  3A2V A;  1X0R A;  3UBL A;  4BWQ A;  3UBK A;  1ZOF A;  4KE3 A;  3SBC A;  2N5A A;  1A2L A;  2I81 A;  2GQL A;  1E6B A;  4K7I A;  1HNA A;  1BG5 A;  4RQX A;  3AY8 A;  3MWH A;  3ZZX A;  3L9U A;  3VK9 A;  14GS A;  4EKZ A;  2GDR A;  2GQK A;  3EU4 A;  2VL3 A;  5A4W A;  2H75 A;  5F8B A;  3VPT A;  2CV4 A;  3HVX A;  1K3Y A;  4EXJ A;  2C8U A;  4NAX A;  5GAN D;  2YPM A;  1TK8 B;  4POK A;  2C80 A;  2I9H A;  2WUL A;  2OAD A;  3BCK A;  4GQF A;  5CRW A;  2GSR A;  9GSS A;  3C1S A;  4PGT A;  1O8W A;  2C4J A;  4PX1 A;  1QFN A;  4L8E A;  2WS2 A;  2H73 A;  2LV3 A;  2RM5 A;  3C73 A;  5D93 A;  5GST A;  5LCZ A;  2LNT A;  1IYI A;  3IHQ A;  2YN1 A;  4GCI A;  4JBB A;  4KSO A;  2GT6 A;  4N11 A;  3GKK A;  4V1A p;  3BJ5 A;  1EP8 A;  5AIX A;  1PD2 1;  3LJR A;  4XRD A;  3UOM A;  3HZ8 A;  1F6M C;  2B6M A;  2CVK A;  6GSS A;  1WMJ A;  2YOI A;  3GX0 A;  2GSQ A;  1JZO A;  2R2J A;  3G7J A;  1K0B A;  1U87 A;  2LJA A;  3WYW A;  5INY A;  2DJ1 A;  1T00 A;  3D22 A;  5C00 A;  1OAZ A;  4MP4 A;  2RUE A;  1YKC A;  3H4K A;  2N5B A;  4MAB A;  5F05 A;  1AIU A;  2NBS A;  2H19 A;  1V58 A;  1J9B A;  1V2A A;  2F8A A;  1PA3 A;  3TGZ A;  5IPH A;  3ZYW A;  4AF2 A;  5G1L A;  4K0N A;  3N5O A;  4J56 E;  1F9M A;  3GTU A;  4MJA A;  3NZN A;  2IL3 A;  5DAL A;  4DSR A;  4NWY A;  3FW2 A;  4K7O A;  1Z6N A;  3HVV A;  3TJJ A;  3WGD A;  1GSY A;  3ED3 A;  2LEG A;  2K18 A;  5ELG A;  2HZF A;  10GS A;  3L78 A;  4MH2 A;  1H4O A;  5H5Q A;  5DBQ A;  5G5F A;  2O8V B;  2YWM A;  4BWS A;  2HRF A;  4BA7 A;  4ML1 A;  5GZZ B;  4JED A;  1GTA A;  2AAW A;  4E8E A;  1YQ1 A;  1HYU A;  3IAS 2;  3DWV A;  2GS3 A;  2HLS A;  2C0F A;  4JE1 A;  3ZIJ A;  3C71 A;  5ECI B;  4O92 A;  1B4P A;  2B5X A;  2YV7 A;  4BVY A;  4XS4 A;  2FA8 A;  4POM A;  4QQ7 A;  3F3R A;  3TJF A;  1Z5Y E;  3U5R E;  1W89 A;  1WE0 A;  3MAK A;  3KZQ A;  1FVJ A;  2WJU A;  4NMU A;  3M9K A;  1G7E A;  4Z7X A;  1X5C A;  2FY6 A;  3GV1 A;  4EO3 A;  1FHE A;  3G7Y A;  2H6X A;  1EP7 A;  5DAL B;  4ZL8 A;  4ILF A;  4TXV A;  1QXH A;  2VD0 A;  4EL1 A;  1XBS A;  5KN0 A;  3CBU A;  3EMP A;  1SJI A;  8GSS A;  4XS1 A;  2R5G A;  4E8H A;  4YQU A;  3APO A;  3IOS A;  4MPG A;  1SJ6 A;  4QL7 A;  4LMV A;  2MMN A;  1QMV A;  4QL9 A;  1SKW B;  1EEJ A;  1G6W A;  5E59 A;  2YJH A;  3IK9 A;  1SD8 A;  2O87 A;  3I9V 2;  1KBN A;  1THO A;  1XZO A;  3UIW A;  4EF0 A;  3M8N A;  1K0A A;  3I69 A;  1GUL A;  2VCZ A;  2O85 A;  1JZD A;  5ECM B;  5HFI A;  3O6T A;  4WF4 A;  3KGK A;  5FWG A;  3LYP A;  1G6Y A;  3IRA A;  3F4T A;  5AN1 A;  3W8J A;  1WP0 A;  3M1G A;  1S3C A;  2C3T A;  3HY2 A;  3HD5 A;  1M2B A;  2GZP A;  1W4V A;  3LOR A;  6GSU A;  4HQS A;  1FW1 A;  2C0D A;  2P31 A;  3FZ4 A;  1Y25 A;  1MDJ A;  2VL2 C;  3D5J A;  3UL3 A;  3O76 A;  4PXO A;  1ZMA A;  1XWB A;  3FYG A;  3GH6 A;  4K9Z A;  5AIS A;  2L4C A;  3GA4 A;  3C8E A;  1TTZ A;  3L4N A;  2EIQ A;  2OE1 A;  4CDO A;  4F2I A;  2F9S A;  3ZRE A;  3O3T A;  4KCA A;  3KTL A;  5CAX A;  2KP1 A;  4RUV A;  2AV4 A;  4TW5 A;  4HU9 A;  3ZVJ A;  5HQP A;  2ES7 A;  3KH7 A;  4G9H A;  1AQW A;  1S3D A;  5B7C A;  3JCM L;  2P5R A;  2H0H A;  2KP2 A;  4HDE A;  5CYY A;  2FUG 2;  2CT6 A;  3ZMK A;  1FVK A;  2CX3 A;  2O7K A;  2OA7 A;  3P8W A;  5EY6 A;  3VPQ A;  1LBK A;  3M3M A;  3UEM A;  4RQR A;  3QAW A;  2BTO T;  2JSY A;  5FT3 A;  2HFD A;  3HDC A;  1SK0 A;  2VL2 A;  3MDK A;  2XBI A;  2G2Q A;  1GLP A;  1N8J A;  1VF3 A;  3TRQ A;  7GSS A;  1VGL A;  2YV9 A;  5KN2 A;  5ECO B;  2GZY A;  4KSM A;  1FO5 A;  4O32 A;  1X5D A;  5DAK B;  2PU9 C;  2RII A;  4I5Q A;  1XVW A;  2NVL A;  2FLS A;  2VO4 A;  4NV2 A;  3CTF A;  1A24 A;  3GMF A;  3F8U A;  6GSX A;  1TI3 A;  2AUV A;  1JHB A;  1GH2 A;  3W6G A;  1SYX A;  4NHZ A;  3KD0 A;  3D0Z A;  3IBH A;  1YKA A;  3VI7 A;  4BPY A;  1GTU A;  3KP8 A;  3QOU A;  1T3B A;  1A0F A;  2HZE A;  3P7X A;  3CSI A;  3GIX A;  1QK8 A;  2XPE A;  4EUY A;  4AJ8 A;  1G0T A;  1TW9 A;  2N5F A;  3GHA A;  1TI1 A;  2FWH A;  2CZ3 A;  4HEA 2;  1YEP A;  4TXO A;  3KJY A;  1R5P A;  1PRX A;  3VWV A;  1X9W B;  4K1F A;  3KMO A;  4WKW A;  1BJX A;  2LTK A;  1S3A A;  5LD0 A;  1V9W A;  2I4A A;  5A5K A;  2NTO A;  1R5A A;  3HXS A;  2JZR A;  2H1A A;  4TR0 A;  2YCD A;  1SU9 A;  4P3Y B;  1K3L A;  1MDI A;  2YZH A;  1ABA A;  3GUR A;  1LJR A;  2TRC P;  1NSW A;  5DDL A;  1AXD A;  5J9B A;  3Q74 A;  3EE2 A;  5F07 A;  1SL1 B;  2X8C A;  5IMC A;  3F0I A;  1TRV A;  2YP6 A;  3TCO A;  3RPN A;  4IQ1 A;  1ACV A;  5IMZ A;  2X8H A;  1M7T A;  5KEJ A;  2OBI A;  3IK7 A;  1VF4 A;  3IPZ A;  2JAC A;  2M46 A;  3DIE A;  2FGX A;  2C3N A;  2VCX A;  3Q18 A;  4ZBD A;  1PL2 A;  5ECH B;  2YAN A;  1G7O A;  4AJ6 A;  4MF5 A;  4WF5 A;  4TRX A;  5CO3 A;  5G1K A;  2HRN A;  4OWY A;  2K8S A;  5IM9 A;  2FWF A;  1GL8 A;  4MZW A;  1VF2 A;  2H74 A;  4X0X A;  3ZRD A;  19GS A;  2IMD A;  4MMM A;  3ZIV A;  3GH9 A;  1A23 A;  3WT1 A;  13GS A;  2HXK A;  2X99 A;  3TOU A;  2CQ9 A;  3EWL A;  1PQN A;  3P2A A;  1Z7R A;  5D9T A;  2V6O A;  1LU4 A;  1R4W A;  3LEF A;  3LXT A;  2AJQ B;  4JRR A;  3LSZ A;  3VWX A;  4CHS A;  3IDV A;  2VAF A;  2MMO A;  2H01 A;  2YWN A;  1HNC A;  2VLT A;  2H71 A;  2R37 A;  4PQ1 A;  1QGV A;  2V32 A;  5HR0 A;  4F0C A;  3R2Q A;  3EIN A;  5CRD A;  3GL3 A;  4PUR A;  4FO5 A;  1WRY A;  4FYB A;  2WB9 A;  5ID2 B;  1XW6 A;  4KDY A;  4XHM A;  1A8Y A;  2B1L A;  4OCF A;  3ME7 A;  2DJ0 A;  3QAG A;  2O89 A;  4FYC A;  4IS0 A;  4F0B A;  1O85 A;  1OYJ A;  2XHF A;  1O73 A;  4WET A;  4ECI A;  4ZBB A;  1XIY A;  2FWG A;  3QFB C;  1XWC A;  3F63 A;  1OVN A;  2YNX A;  4CW9 A;  3PIN A;  2KHP A;  4LL1 B;  4MLY A;  1Z6M A;  2FCH A;  3RPP A;  5ECR B;  1PKW A;  3IE3 A;  2B7J A;  2HSH A;  2H1B A;  2V1M A;  1PGT A;  1B9X C;  1ZCP A;  2HE3 A;  3CMI A;  1OC8 A;  1EWX A;  4IN0 A;  2P0G A;  5ECN B;  1EEM A;  4L0W A;  2HT9 A;  2NPB A;  1TRS A;  4ZIL A;  5CNW A;  3TKS A;  2MBT A;  3WGX A;  5D73 A;  5D9X A;  5J41 A;  3GYK A;  2E2M A;  4KDU A;  4XIH A;  5IOX A;  4L5L A;  5DCH A;  3DYR A;  5EVO A;  3FY7 A;  2ON7 A;  3DGQ A;  2MZC A;  4J2F A;  2C3Q A;  1BQ7 A;  1DSB A;  2LRN A;  4XS6 A;  2P5Q A;  5ELA A;  1PMT A;  1GNW A;  2TIR A;  3GKX A;  1BX9 A;  2EIR A;  6GSV A;  2IFQ A;  1H75 A;  2QKE A;  4MJE A;  3HYP A;  4JZQ A;  4ACS A;  1M99 A;  3RHC A;  4MF6 A;  2BJX A;  4ZL7 A;  4ZB9 A;  2B3S A;  2B5Y A;  5G5E A;  1Z9H A;  1UC7 A;  2JU5 A;  3QFA C;  1JLV A;  2C1Y A;  5G30 A;  4PUA A;  6GSY A;  2DIZ A;  2A2S A;  1EV4 A;  2DJ2 A;  3M9J A;  3TDG A;  2L5O A;  1YZX A;  5ABR A;  1UA5 A;  4KUN A;  3DML A;  3LXZ A;  3HZ4 A;  3WGE A;  2IPA A;  1T7P B;  1VF1 A;  2HNL A;  1EGR A;  3KTB A;  2H0G A;  2H1D A;  5ECQ B;  4OO5 A;  2MMZ A;  3KEB A;  4ID0 A;  2PVQ A;  4X1U A;  2CA8 A;  1M2A A;  3IAM 2;  1JZR A;  3OR5 A;  2VUP A;  5G2Z A;  2J9H A;  3E9J B;  1PX6 A;  4WBR D;  1ST9 A;  3FKF A;  1TKD B;  2LJR A;  3BBY A;  3GTU B;  4YQM A;  4G10 A;  1ZZY A;  3CSH A;  4GF0 A;  3TUE A;  4WBJ A;  2IFQ B;  3PR8 A;  2H70 A;  3CXG A;  2GQM A;  3DRN A;  4DSS A;  1GTI A;  2NDO A;  3FR9 A;  4HOJ A;  3H79 A;  2LNS A;  2FHE A;  4IKH A;  2RUF A;  2F8F A;  2PBJ A;  4ECJ A;  1B8X A;  5IOW A;  2MBS A;  5J5N A;  1TRW A;  17GS A;  1GSF A;  1AW9 A;  3H1N A;  1V57 A;  2V41 A;  5HR1 A;  2DC5 A;  2GLR A;  1Q98 A;  2RLI A;  4N0V A;  2CX4 A;  2EC4 A;  4TN8 A;  1XW9 A;  2A4V A;  2K9F A;  2XC2 A;  2VOC A;  3F6D A;  2C0E A;  2DMM A;  1TU8 A;  5A4U A;  1T1V A;  1GUH A;  4GTU A;  5L71 A;  3QMX A;  4XS4 B;  3I6A A;  4GXZ A;  5CP1 A;  3QPM A;  2FWE A;  3D21 A;  2X64 A;  1X9M B;  2OAC A;  3TJG A;  3E3E A;  5JCW A;  1XFL A;  2OBK A;  1C72 A;  2B1K A;  5A4V A;  3MSZ A;  1XOB A;  2PWJ A;  4YAP A;  4HI7 A;  2GSS A;  1SYR A;  5HR2 A;  1SK1 A;  4TR3 A;  3V1W A;  1EV9 A;  1F3B A;  2YWI A;  3UVH A;  2F3M A;  4PQH A;  2M72 A;  1TOF A;  5C04 A;  4XCS A;  1ERW A;  3VWU A;  5F06 A;  3ERF A;  1YEX A;  3WD6 A;  2VLU A;  2H6Z A;  4I8B A;  2IMI A;  3APQ A;  2CVB A;  4OO4 A;  4MDC A;  1MEK A;  1THX A;  2EIO A;  4DSS B;  1AQV A;  5IO0 A;  1X9S B;  1SEN A;  4TKY A;  18GS A;  3MNG A;  1EOG A;  3ZTL A;  4MPF A;  4ZXG A;  3HHV A;  1FB0 A;  3TB2 A;  2PGT A;  2DJJ A;  2FD3 A;  1NM3 A;  4K0G A;  4L5O A;  6GST A;  1KTE A;  5DCG A;  1YF1 A;  4PNG A;  4WXT A;  4GSS A;  3L9S A;  4N0Z A;  1ERU A;  3S9F A;  5ENU A;  5KN1 A;  3VUR A;  2REM A;  1A0R P;  3EC3 A;  4K7N A;  3TOT A;  3CRU A;  3NIV A;  2Z9S A;  5IMD A;  2E7P A;  5HFK A;  3FR6 A;  1XCC A;  4K8M A;  5JCG A;  3LGC A;  4IBP A;  1WPI A;  3G9B A;  1URM A;  4F03 A;  1UN2 A;  2WCI A;  2WDU A;  3G7I A;  3FHK A;  3BCI A;  2LRT A;  2JL4 A;  4BL7 A;  4Q5F A;  4EVM A;  1O81 A;  3DEX A;  3KXO A;  4OMV A;  1BED A;  3CTG A;  1ML6 A;  3LWA A;  2GVP A;  1SL2 B;  5JWQ B;  4ULX A;  4HU7 A;  3GX8 A;  3HVS A;  3H8Q A;  3F6F A;  3KIJ A;  1RK4 A;  2KOK A;  4GLT A;  2AYT A;  1XWG A;  3PH9 A;  5KN3 A;  3IC4 A;  4DSQ A;  1T4Y A;  4ECB A;  2LS5 A;  1NHY A;  3GKN A;  1PX7 A;  4N30 A;  1OE8 A;  4MJC A;  2QGV A;  4HS1 A;  4HJM A;  3HKR A;  1WJK A;  1U3I A;  2LST A;  4OFM A;  3D4M A;  3KP9 A;  1VRS D;  2DIY A;  2J23 A;  2MYG A;  1N2A A;  4LA1 A;  1MDK A;  4AGS A;  5JWR B;  5DVB A;  2CZ2 A;  5IQY A;  4N10 A;  1M9B A;  4POB A;  4PUF C;  5B8A A;  3IA1 A;  4KCE A;  2CAQ A;  3L0H A;  1MD3 A;  2RM6 A;  3FZA A;  1ZYQ B;  4AJ7 A;  1M2D A;  2XPD A;  1K0N A;  4ZIJ A;  3TKP A;  3ISO A;  4EDY A;  1XPV A;  1KEB A;  5DQY A;  2CVD A;  1SKR B;  2IME A;  4OCE A;  1ILO A;  1DUG A;  3ZL5 A;  3HJP A;  2GZZ A;  4Q5Q A;  1QUW A;  2IJY A;  3RDW A;  4IW9 A;  11GS A;  2H0I A;  1SD9 A;  2WRT A;  3IR4 A;  3HJO A;  1GSS A;  2BMX A;  2K8V A;  1CQG A;  4LL4 B;  4GRF A;  2HZE B;  4IHU A;  1Q4J A;  4ZB6 A;  4RI7 A;  2OJL A;  3EMX A;  3UMA A;  3CRT A;  1Z7P A;  3IXR A;  3L9V A;  2LJK A;  4IJI A;  4TXO B;  5DJL A;  1K0D A;  3ME8 A;  2DSA A;  1DE2 A;  4POL A;  4LLR A;  4FIW A;  3VFI A;  5CRG A;  4ZL9 A;  1MD4 A;  4I2T A;  3FR3 A;  2H8L A;  4O7H A;  3DVW A;  4NV5 A;  3F9U A;  5HR3 A;  1WWJ A;  2VCQ A;  4K2D A;  1GSD A;  5IO2 A;  1B48 A;  1OC9 A;  4YAV A;  2FNO A;  1J08 A;  3HCZ A;  5F0G A;  2H72 A;  1GP1 A;  3QD9 A;  1O7U A;  1HD2 A;  2VM2 A;  3D4T A;  3GUS A;  4IGJ A;  3H93 A;  3LYK A;  2PVO C;  4MCU A;  4KX4 A;  3TKS C;  3K8N A;  1ZL9 A;  3IV4 A;  3VWW A;  2PUK C;  2ZCT A;  1O6J A;  5HFG A;  2DBC A;  3QAV A;  2JAD A;  1FG4 A;  2HSY A;  1CQH A;  3KM6 A;  1SK2 A;  3ZIT A;  3EUR A;  1ZGN A;  3F4S A;  5D8I A;  1HQO A;  4RI6 A;  1OE7 A;  2DLX A;  5H5S A;  3LFL A;  1YF0 A;  2L6D A;  2LQO A;  1Y6E A;  4NXI A;  2LUS A;  5DJM A;  4MA9 A;  4EE0 A;  3CSJ A;  1TXX A;  3DXB A;  5D9V A;  1NW2 A;  3GNJ A;  1IYH A;  4EDZ A;  1WOU A;  4K6X A;  2I3Y A;  1JLW A;  5E4W A;  1A8L A;  1I9D A;  4TR1 A;  1UVZ A;  3ZML A;  2YZU A;  2AHE A;  1A2M A;  1R26 A;  3CYN A;  2DJK A;  1F2E A;  4XRA A;  1U6T A;  3W8S A;  1OC9 B;  4ZBA A;  5FHI A;  1FB6 A;  1U3A A;  4PNF A;  3I43 A;  4F82 A;  6GSW A;  1O8X A;  1YJ6 A;  2L59 A;  3A2X A;  2L5L A;  4PQI A;  2OE3 A;  4HZ2 A;  4KH7 A;  2I1U A;  4ECC A;  1TRU A;  2YJ7 A;  1XWA A;  4KA0 A;  2H30 A;  2IIY A;  5J9C A;  1DBY A;  1F3A A;  1A2J A;  3DVX A;  5AGY A;  4DEJ A;  3TJB A;  3UAR A;  2B5E A;  4MF7 A;  5IMF A;  5IPG A;  2QSI A;  3VLN A;  4I6X A;  5ECS A;  4YQV A;  3ZLP A;  2OE0 A;  2DJ3 A;  1XW5 A;  1GSQ A;  1PKZ A; 
#chains in the Genus database with same CATH topology
 3KH9 A;  4O5R A;  2OKA A;  1TJD A;  3ERW A;  5LNK e;  3TKR A;  2XBQ A;  1J0F A;  2ZUP A;  4JR4 A;  3EU3 A;  1AUC A;  5J4U A;  1FOV A;  3J7Y b;  4NHW A;  2QC7 A;  3EVI A;  1AC1 A;  2E2G A;  20GS A;  4GST A;  2HI7 A;  1V98 A;  4KB3 A;  4X4J A;  4Q5R A;  2GT5 A;  2R4V A;  4MZB A;  1TU7 A;  2L57 A;  4MK3 A;  4TR1 B;  4OFT A;  1GUK A;  4V2N A;  3D6I A;  4HZ4 A;  3GKM A;  4KGI A;  3LG6 A;  1R7H A;  1GSU A;  4Q5N A;  4X43 A;  1GUM A;  3RHB A;  2CAI A;  1PN0 A;  1TDI A;  3DD3 A;  1OKD A;  3TKS E;  22GS A;  2YWO A;  2VM1 A;  2D2Z A;  2VCV A;  1GRX A;  1TP9 A;  3FZ5 A;  3N9J A;  2VCW A;  4GWR A;  5ECK B;  3IC8 A;  2A2R A;  4NPB A;  3SWL A;  3EPT A;  2PPT A;  1QQ2 A;  5IIZ A;  4JR6 A;  2FA4 A;  4KDX A;  2LQQ A;  4BIK A;  2R0P A;  4V1A g;  2R6K A;  1YDK A;  2MMA A;  2X49 A;  3FK8 A;  2JSZ A;  4LMW A;  3TRX A;  4OFN A;  1PFO A;  3HA9 A;  3TJK A;  5J3R A;  5IMA A;  4GSN A;  3RBT A;  1JZW A;  3GSS A;  4IP6 A;  1HNB A;  4WEY A;  2LKU A;  1XVQ A;  5B8B A;  2GST A;  3R3E A;  3ZFL A;  1ERT A;  4JU5 A;  3WT2 A;  2K6V A;  4PTS A;  3QR6 A;  1FAA A;  2VD1 A;  5D96 A;  4TOP A;  2KUC A;  4BVX A;  3LQ7 A;  3FRC A;  5DQS A;  1EZK A;  1PSQ A;  2ZNM A;  1I5G A;  1BAY A;  1GTB A;  2GGT A;  1MTC A;  3EYT A;  4I2U A;  5EPF A;  4IQA A;  2F51 A;  3C1R A;  1GNE A;  3UVT A;  12GS A;  1TK5 B;  5EL8 A;  2R3X A;  3M0F A;  2X8G A;  2VIM A;  3MIX A;  2IMF A;  5DAK A;  5ECL B;  4H86 A;  4HJ2 A;  3UAP A;  4YKF A;  2JZT A;  1XOA A;  4YH2 A;  3BD2 A;  4DVC A;  2HYX A;  4L0U A;  3E0U A;  1WIK A;  3A2W A;  1EGO A;  3ZVJ D;  3A3T A;  2M80 A;  4GQC A;  3TKQ A;  2V6K A;  3US3 A;  1K3O A;  2VLV A;  4KND A;  4I97 A;  3Q19 A;  2KLX A;  1NHO A;  3BOA A;  1SL0 B;  4ZB8 A;  1RW1 A;  4OD7 A;  4MH3 A;  3QCP A;  5B6N A;  3ERG A;  1GWC A;  4V2L A;  1TK0 B;  2IN3 A;  1EOH A;  1KNG A;  1GLQ A;  3U6V A;  2ON5 A;  1U88 A;  1XWK A;  2DML A;  5CRE A;  2L4Q A;  1S3R A;  1BYE A;  2AB6 A;  1PL1 A;  3P90 A;  3GST A;  5H5R A;  4KW6 A;  4XTS A;  1B9Y C;  3Q6O A;  4EC0 A;  4BVX B;  3A5W A;  2G0F A;  1ERV A;  3F3Q A;  1PN9 A;  16GS A;  4IJ3 A;  4KF9 A;  2H66 A;  3HJM A;  4HUA A;  1ZYN A;  3APS A;  5JWO B;  1YY7 A;  3C7M A;  1OKT A;  2V2G A;  4TVE A;  5GSS A;  1F37 A;  2PER A;  1RQM A;  5COH A;  4HQZ A;  5D9W A;  1T8E B;  3KMN A;  1XXU A;  1ON4 A;  4J57 E;  3GL5 A;  4D73 A;  3UJ1 A;  4FH8 A;  4WR5 A;  3TRP A;  5GAP D;  1ZYE A;  1V40 A;  1T4Z A;  2WZ9 A;  2C0G A;  2LRC A;  4MZC A;  3NOF A;  2PN8 A;  2GTU A;  4FYU A;  2H6Y A;  4G19 A;  5CRH A;  4TR4 A;  1B4Q A;  2L6C A;  2H1G A;  4IEL A;  4V2M A;  2VL9 A;  5AIV A;  1OC3 A;  2IWT A;  2PMT A;  3QDN A;  1AAZ A;  1M0U A;  1M9A A;  3GRX A;  3F4R A;  4ML6 A;  1K0O A;  5B6M A;  1JFU A;  4IVF A;  3FEU A;  4IP1 A;  1SKS B;  1DE1 A;  5G31 A;  4MJB A;  2VCT A;  2WGR A;  2WFC A;  3GN3 A;  3RAZ A;  1AQX A;  3PGT A;  5IMV A;  4G2E A;  4F9Z A;  1K0M A;  5JCU A;  1K0C A;  2H76 A;  1X5E A;  2HRA A;  2E0Q A;  4WR4 A;  1Z3E A;  3J7Y k;  3GFK A;  2ALB A;  3DKS A;  3FZ9 A;  2JZS A;  5ECP B;  1SJZ A;  1E2Y A;  2IMK A;  3KCM A;  4KAE A;  4D73 B;  5ID2 A;  1USB A;  2R0G A;  2B7K A;  3ZFB A;  1GSE A;  3VI5 A;  4ISD A;  2TRX A;  3A2V A;  1X0R A;  3UBL A;  4BWQ A;  3UBK A;  1ZOF A;  2DKH A;  4KE3 A;  3SBC A;  2N5A A;  1FOH A;  4K2X A;  1A2L A;  2I81 A;  2GQL A;  1E6B A;  4K7I A;  1HNA A;  1BG5 A;  4FQU A;  4RQX A;  3AY8 A;  3MWH A;  3ZZX A;  3L9U A;  3VK9 A;  14GS A;  4EKZ A;  2GDR A;  2GQK A;  3EU4 A;  2VL3 A;  4Z2T A;  5A4W A;  2H75 A;  5F8B A;  4MNN A;  3VPT A;  2CV4 A;  3HVX A;  1K3Y A;  4EXJ A;  2C8U A;  4NAX A;  5GAN D;  2YPM A;  1TK8 B;  4POK A;  2C80 A;  2I9H A;  2WUL A;  2OAD A;  3BCK A;  4GQF A;  5CRW A;  2GSR A;  9GSS A;  2QA1 A;  3C1S A;  4PGT A;  1O8W A;  2C4J A;  2X4A A;  4PX1 A;  1QFN A;  4L8E A;  2WS2 A;  2H73 A;  2LV3 A;  2RM5 A;  3C73 A;  5D93 A;  5GST A;  5LCZ A;  2LNT A;  1IYI A;  3IHQ A;  2YN1 A;  4GCI A;  4JBB A;  4KSO A;  2GT6 A;  4N11 A;  3GKK A;  4V1A p;  3BJ5 A;  1EP8 A;  5AIX A;  1PD2 1;  3LJR A;  4XRD A;  3UOM A;  3HZ8 A;  1F6M C;  2B6M A;  2CVK A;  6GSS A;  1WMJ A;  2YOI A;  3GX0 A;  2GSQ A;  1JZO A;  2R2J A;  3G7J A;  1K0B A;  1U87 A;  2LJA A;  3WYW A;  5INY A;  2DJ1 A;  1T00 A;  3D22 A;  5C00 A;  1OAZ A;  4MP4 A;  2RUE A;  1YKC A;  3H4K A;  2N5B A;  4MAB A;  5F05 A;  1AIU A;  2NBS A;  2H19 A;  1V58 A;  1J9B A;  1V2A A;  2F8A A;  1PA3 A;  3TGZ A;  5IPH A;  3ZYW A;  4AF2 A;  5G1L A;  4K0N A;  3N5O A;  4J56 E;  1F9M A;  3GTU A;  4MJA A;  3NZN A;  2IL3 A;  5DAL A;  4USS A;  4DSR A;  4NWY A;  1M3I A;  3FW2 A;  4K7O A;  1Z6N A;  3HVV A;  3TJJ A;  3WGD A;  1GSY A;  2A4H A;  3ED3 A;  2LEG A;  2K18 A;  5ELG A;  2HZF A;  10GS A;  3L78 A;  4MH2 A;  1H4O A;  5H5Q A;  5DBQ A;  5G5F A;  2O8V B;  2YWM A;  4BWS A;  2HRF A;  4BA7 A;  4ML1 A;  5GZZ B;  4JED A;  1GTA A;  2AAW A;  4E8E A;  1YQ1 A;  1HYU A;  4CY8 A;  3IAS 2;  3DWV A;  2GS3 A;  2HLS A;  3LW9 A;  2C0F A;  4JE1 A;  3ZIJ A;  3C71 A;  5ECI B;  4O92 A;  1B4P A;  2B5X A;  2YV7 A;  4BVY A;  4XS4 A;  2FA8 A;  4POM A;  4QQ7 A;  4CY6 A;  3F3R A;  3TJF A;  1Z5Y E;  3U5R E;  1W89 A;  1WE0 A;  3MAK A;  3KZQ A;  1FVJ A;  2WJU A;  4NMU A;  3M9K A;  1G7E A;  4Z7X A;  1X5C A;  2FY6 A;  3GV1 A;  4EO3 A;  1FHE A;  3G7Y A;  2H6X A;  1EP7 A;  5DAL B;  4ZL8 A;  4ILF A;  4TXV A;  1QXH A;  2VD0 A;  4EL1 A;  1XBS A;  5KN0 A;  3CBU A;  3EMP A;  1SJI A;  8GSS A;  4XS1 A;  2R5G A;  4E8H A;  4YQU A;  5KOW A;  3APO A;  3IOS A;  4MPG A;  1SJ6 A;  4QL7 A;  4LMV A;  2MMN A;  1QMV A;  4QL9 A;  1SKW B;  1EEJ A;  1G6W A;  5E59 A;  2YJH A;  3IK9 A;  1SD8 A;  2O87 A;  4K5R A;  3I9V 2;  1KBN A;  1THO A;  1XZO A;  3UIW A;  4EF0 A;  3M8N A;  1K0A A;  3I69 A;  1GUL A;  2VCZ A;  2O85 A;  1JZD A;  4K5S A;  5ECM B;  5HFI A;  3O6T A;  4WF4 A;  3KGK A;  5FWG A;  3LYP A;  4G0L A;  1G6Y A;  3IRA A;  3F4T A;  5AN1 A;  3W8J A;  1WP0 A;  3M1G A;  1S3C A;  2C3T A;  3HY2 A;  3HD5 A;  1M2B A;  2GZP A;  1W4V A;  3LOR A;  6GSU A;  4HQS A;  4O5Q A;  1FW1 A;  2C0D A;  2P31 A;  3FZ4 A;  1Y25 A;  1MDJ A;  2VL2 C;  3D5J A;  3UL3 A;  3O76 A;  4PXO A;  1ZMA A;  2A2P A;  1XWB A;  3FYG A;  3GH6 A;  4K9Z A;  5AIS A;  2L4C A;  3GA4 A;  3C8E A;  1TTZ A;  3FMW A;  3L4N A;  2EIQ A;  2OE1 A;  4CDO A;  4F2I A;  2F9S A;  3ZRE A;  4KCA A;  3O3T A;  3KTL A;  5CAX A;  2KP1 A;  4RUV A;  2AV4 A;  4TW5 A;  4HU9 A;  3ZVJ A;  5HQP A;  2ES7 A;  3KH7 A;  4G9H A;  1AQW A;  4YKG A;  1S3D A;  5B7C A;  3JCM L;  2P5R A;  2H0H A;  2KP2 A;  4HDE A;  5CYY A;  2FUG 2;  2CT6 A;  3ZMK A;  1FVK A;  2CX3 A;  2O7K A;  2OA7 A;  3P8W A;  5EY6 A;  3VPQ A;  1LBK A;  3M3M A;  3UEM A;  4RQR A;  3QAW A;  2BTO T;  2JSY A;  5FT3 A;  2HFD A;  3HDC A;  1SK0 A;  2VL2 A;  3MDK A;  2XBI A;  2G2Q A;  1GLP A;  1N8J A;  1VF3 A;  3TRQ A;  7GSS A;  1VGL A;  2QA2 A;  2YV9 A;  5KN2 A;  5ECO B;  2GZY A;  4KSM A;  1FO5 A;  3PPU A;  4O32 A;  1X5D A;  5DAK B;  2PU9 C;  2RII A;  4I5Q A;  1XVW A;  2NVL A;  2FLS A;  2VO4 A;  4NV2 A;  3CTF A;  1A24 A;  3GMF A;  3F8U A;  6GSX A;  1TI3 A;  2AUV A;  1JHB A;  1GH2 A;  3A5I A;  3W6G A;  1SYX A;  4NHZ A;  3KD0 A;  3D0Z A;  4G0I A;  3IBH A;  1YKA A;  3VI7 A;  4BPY A;  1GTU A;  3KP8 A;  3QOU A;  1T3B A;  1A0F A;  2HZE A;  3P7X A;  3CSI A;  3GIX A;  1QK8 A;  2XPE A;  4EUY A;  4AJ8 A;  4G0K A;  1G0T A;  1TW9 A;  2N5F A;  3GHA A;  2HRK A;  1TI1 A;  2FWH A;  2CZ3 A;  4HEA 2;  1YEP A;  4TXO A;  3KJY A;  1R5P A;  1PRX A;  3VWV A;  1X9W B;  4K1F A;  3KMO A;  4WKW A;  1BJX A;  2LTK A;  1S3A A;  2UZ8 A;  5LD0 A;  1V9W A;  2I4A A;  5A5K A;  2NTO A;  1R5A A;  3HXS A;  2JZR A;  2H1A A;  4TR0 A;  2YCD A;  1SU9 A;  4P3Y B;  1K3L A;  1MDI A;  2YZH A;  1ABA A;  3GUR A;  1LJR A;  2TRC P;  1NSW A;  5DDL A;  1AXD A;  5J9B A;  3Q74 A;  3EE2 A;  5F07 A;  1SL1 B;  2X8C A;  5IMC A;  3F0I A;  1TRV A;  2YP6 A;  3TCO A;  3RPN A;  4IQ1 A;  1ACV A;  5IMZ A;  2X8H A;  1M7T A;  5KEJ A;  2OBI A;  3IK7 A;  1VF4 A;  3IPZ A;  2JAC A;  2M46 A;  3DIE A;  2FGX A;  2C3N A;  2VCX A;  3Q18 A;  4ZBD A;  1PL2 A;  5ECH B;  2YAN A;  1G7O A;  4AJ6 A;  4MF5 A;  4WF5 A;  4TRX A;  5CO3 A;  5G1K A;  2HRN A;  4OWY A;  1M3J A;  2K8S A;  5IM9 A;  2FWF A;  1GL8 A;  4MZW A;  1VF2 A;  2H74 A;  4X0X A;  3ZRD A;  19GS A;  2IMD A;  4MMM A;  3ZIV A;  3GH9 A;  1A23 A;  3WT1 A;  13GS A;  2HXK A;  5BMU A;  2X99 A;  3TOU A;  2CQ9 A;  3EWL A;  1PQN A;  3P2A A;  1Z7R A;  5D9T A;  2V6O A;  1LU4 A;  1R4W A;  3LEF A;  3LXT A;  2AJQ B;  4JRR A;  3LSZ A;  3VWX A;  4CHS A;  3IDV A;  2VAF A;  2MMO A;  2H01 A;  2YWN A;  1HNC A;  2VLT A;  2H71 A;  2R37 A;  4PQ1 A;  1QGV A;  2V32 A;  5HR0 A;  1XG8 A;  4F0C A;  3MYD A;  3R2Q A;  3EIN A;  5CRD A;  3GL3 A;  4PUR A;  4FO5 A;  1WRY A;  4FYB A;  2WB9 A;  5ID2 B;  1XW6 A;  4KDY A;  4XHM A;  1A8Y A;  2B1L A;  4OCF A;  3ME7 A;  2DJ0 A;  3QAG A;  2O89 A;  4FYC A;  4IS0 A;  4F0B A;  1O85 A;  1OYJ A;  2XHF A;  1O73 A;  4WET A;  4ECI A;  4ZBB A;  1XIY A;  2FWG A;  3QFB C;  1XWC A;  3F63 A;  1OVN A;  2YNX A;  4CW9 A;  3PIN A;  2KHP A;  4ICY A;  4LL1 B;  4MLY A;  1Z6M A;  2FCH A;  3RPP A;  5ECR B;  1PKW A;  3IE3 A;  2B7J A;  2HSH A;  2H1B A;  2V1M A;  1PGT A;  1B9X C;  1ZCP A;  2HE3 A;  3CMI A;  1OC8 A;  1EWX A;  4IN0 A;  2P0G A;  5ECN B;  1EEM A;  4L0W A;  2HT9 A;  2NPB A;  1TRS A;  4ZIL A;  5CNW A;  3TKS A;  1ZYP A;  2MBT A;  3WGX A;  5D73 A;  5D9X A;  5J41 A;  3GYK A;  2E2M A;  4KDU A;  4XIH A;  5IOX A;  4L5L A;  5DCH A;  3DYR A;  5EVO A;  3FY7 A;  2ON7 A;  3DGQ A;  2MZC A;  4J2F A;  2C3Q A;  1BQ7 A;  1DSB A;  2LRN A;  4XS6 A;  2HSM A;  2P5Q A;  5ELA A;  1PMT A;  1GNW A;  2TIR A;  3GKX A;  1BX9 A;  2EIR A;  6GSV A;  2IFQ A;  1H75 A;  2QKE A;  4MJE A;  3HYP A;  4JZQ A;  4ACS A;  1M99 A;  3RHC A;  4MF6 A;  2BJX A;  4ZL7 A;  4ZB9 A;  2B3S A;  2B5Y A;  5G5E A;  1Z9H A;  1UC7 A;  2JU5 A;  3QFA C;  1JLV A;  2C1Y A;  5G30 A;  4PUA A;  6GSY A;  2DIZ A;  2A2S A;  1EV4 A;  2DJ2 A;  3M9J A;  3TDG A;  2L5O A;  1YZX A;  5ABR A;  1UA5 A;  4KUN A;  3DML A;  3LXZ A;  3HZ4 A;  3WGE A;  2IPA A;  1T7P B;  1VF1 A;  2HNL A;  1EGR A;  3KTB A;  2H0G A;  2H1D A;  5ECQ B;  4OO5 A;  2MMZ A;  3KEB A;  4ID0 A;  2PVQ A;  4X1U A;  2CA8 A;  3HVN A;  1M2A A;  3IAM 2;  1JZR A;  3OR5 A;  2VUP A;  5G2Z A;  2J9H A;  5KOX A;  3E9J B;  1PX6 A;  4WBR D;  1ST9 A;  3FKF A;  1TKD B;  2LJR A;  3BBY A;  3GTU B;  4YQM A;  4G10 A;  1ZZY A;  3CSH A;  4GF0 A;  3TUE A;  4WBJ A;  2IFQ B;  2R0C A;  3PR8 A;  2H70 A;  3CXG A;  2GQM A;  3DRN A;  4DSS A;  1GTI A;  2NDO A;  3FR9 A;  4HOJ A;  3H79 A;  2LNS A;  2FHE A;  4IKH A;  2RUF A;  2F8F A;  2PBJ A;  4ECJ A;  1B8X A;  5IOW A;  2MBS A;  5J5N A;  1TRW A;  17GS A;  1GSF A;  1AW9 A;  3H1N A;  1V57 A;  2V41 A;  5HR1 A;  2DC5 A;  2GLR A;  1Q98 A;  2RLI A;  4N0V A;  2CX4 A;  2EC4 A;  4TN8 A;  1XW9 A;  2A4V A;  2K9F A;  2XC2 A;  2VOC A;  3F6D A;  2C0E A;  2DMM A;  1TU8 A;  5A4U A;  1T1V A;  2DKI A;  1GUH A;  4GTU A;  5L71 A;  4BVY B;  3QMX A;  4XS4 B;  3I6A A;  4GXZ A;  5CP1 A;  3QPM A;  2FWE A;  3D21 A;  2X64 A;  1X9M B;  2OAC A;  3TJG A;  3E3E A;  5JCW A;  1XFL A;  2OBK A;  1C72 A;  2B1K A;  5A4V A;  3MSZ A;  1XOB A;  2PWJ A;  4YAP A;  4HI7 A;  2GSS A;  4HSC X;  1SYR A;  5HR2 A;  1SK1 A;  4TR3 A;  3V1W A;  1EV9 A;  1F3B A;  2YWI A;  3UVH A;  2F3M A;  4PQH A;  2M72 A;  1TOF A;  5C04 A;  4XCS A;  1ERW A;  3VWU A;  5F06 A;  3ERF A;  1YEX A;  3WD6 A;  2VLU A;  2H6Z A;  4I8B A;  2IMI A;  3APQ A;  2CVB A;  4OO4 A;  4MDC A;  1MEK A;  1THX A;  2EIO A;  4DSS B;  1AQV A;  4EIP A;  5IO0 A;  1X9S B;  1SEN A;  4TKY A;  18GS A;  3MNG A;  1EOG A;  3ZTL A;  4MPF A;  3CQF A;  4ZXG A;  3HHV A;  1FB0 A;  3TB2 A;  2PGT A;  2DJJ A;  2FD3 A;  1NM3 A;  4K0G A;  4L5O A;  6GST A;  1KTE A;  5DCG A;  1YF1 A;  4PNG A;  4WXT A;  4GSS A;  3L9S A;  4N0Z A;  1ERU A;  3S9F A;  5ENU A;  5KN1 A;  3VUR A;  2REM A;  1A0R P;  3EC3 A;  4K7N A;  3TOT A;  3CRU A;  3NIV A;  4Z2R A;  2Z9S A;  5IMD A;  2E7P A;  5HFK A;  3FR6 A;  1XCC A;  4K8M A;  5JCG A;  3LGC A;  4IBP A;  1WPI A;  3G9B A;  1URM A;  4F03 A;  1UN2 A;  2WCI A;  2WDU A;  3G7I A;  3FHK A;  3BCI A;  2LRT A;  2JL4 A;  4BL7 A;  4Q5F A;  4EVM A;  1O81 A;  3DEX A;  3KXO A;  4OMV A;  1BED A;  3CTG A;  1ML6 A;  3LWA A;  2GVP A;  1SL2 B;  5JWQ B;  4ULX A;  4HU7 A;  3GX8 A;  3HVS A;  3H8Q A;  3F6F A;  3KIJ A;  1RK4 A;  2KOK A;  4GLT A;  2AYT A;  1XWG A;  3PH9 A;  5KN3 A;  3IC4 A;  4DSQ A;  1T4Y A;  4ECB A;  2LS5 A;  1NHY A;  3GKN A;  1PX7 A;  4N30 A;  1OE8 A;  4MJC A;  2QGV A;  4HS1 A;  4HJM A;  3HKR A;  1WJK A;  1U3I A;  2LST A;  4OFM A;  3D4M A;  4EIQ A;  3KP9 A;  1VRS D;  2DIY A;  2J23 A;  2MYG A;  1N2A A;  4LA1 A;  1MDK A;  4AGS A;  5JWR B;  5DVB A;  2CZ2 A;  5IQY A;  4N10 A;  1M9B A;  4POB A;  4PUF C;  5B8A A;  3IA1 A;  4KCE A;  2CAQ A;  3L0H A;  1MD3 A;  2RM6 A;  3FZA A;  1ZYQ B;  4AJ7 A;  1M2D A;  2XPD A;  1K0N A;  4ZIJ A;  3TKP A;  3ISO A;  4EDY A;  1XPV A;  1KEB A;  5DQY A;  2CVD A;  1SKR B;  2IME A;  4OCE A;  1ILO A;  1DUG A;  3ZL5 A;  4BL7 B;  3HJP A;  2GZZ A;  4Q5Q A;  1QUW A;  2IJY A;  3RDW A;  4IW9 A;  11GS A;  2H0I A;  1SD9 A;  2WRT A;  3IR4 A;  3HJO A;  1GSS A;  2BMX A;  2K8V A;  1CQG A;  4LL4 B;  4GRF A;  2HZE B;  4IHU A;  1Q4J A;  3IHG A;  4ZB6 A;  4RI7 A;  2OJL A;  3EMX A;  3UMA A;  3CRT A;  1Z7P A;  3IXR A;  3L9V A;  2LJK A;  4IJI A;  4TXO B;  5DJL A;  1K0D A;  3ME8 A;  2DSA A;  1DE2 A;  4A5P A;  4POL A;  4LLR A;  4FIW A;  3VFI A;  5CRG A;  4ZL9 A;  1MD4 A;  4I2T A;  3FR3 A;  2H8L A;  4O7H A;  3DVW A;  4NV5 A;  3F9U A;  5HR3 A;  1WWJ A;  2VCQ A;  4K2D A;  1GSD A;  5IO2 A;  1B48 A;  1OC9 A;  4YAV A;  2FNO A;  1J08 A;  3HCZ A;  5F0G A;  2H72 A;  1GP1 A;  3QD9 A;  1O7U A;  1HD2 A;  2VM2 A;  5BRT A;  3D4T A;  3GUS A;  4IGJ A;  3H93 A;  3LYK A;  2PVO C;  4MCU A;  4KX4 A;  3TKS C;  3K8N A;  1ZL9 A;  3IV4 A;  3VWW A;  2PUK C;  2ZCT A;  1O6J A;  5HFG A;  2DBC A;  3QAV A;  2JAD A;  1FG4 A;  2HSY A;  1CQH A;  3KM6 A;  1SK2 A;  3ZIT A;  3EUR A;  1ZGN A;  3F4S A;  4O5U A;  5D8I A;  1HQO A;  4RI6 A;  1OE7 A;  2DLX A;  5H5S A;  3LFL A;  1YF0 A;  2L6D A;  2LQO A;  1Y6E A;  4NXI A;  2LUS A;  5DJM A;  4MA9 A;  4EE0 A;  3CSJ A;  1TXX A;  3DXB A;  5D9V A;  1NW2 A;  3GNJ A;  1IYH A;  4EDZ A;  1WOU A;  4K6X A;  2I3Y A;  1JLW A;  5E4W A;  1A8L A;  1I9D A;  4TR1 A;  1UVZ A;  3ZML A;  2YZU A;  2AHE A;  1A2M A;  1R26 A;  3CYN A;  2DJK A;  1F2E A;  4XRA A;  1U6T A;  3W8S A;  1OC9 B;  4ZBA A;  5FHI A;  1FB6 A;  1U3A A;  4PNF A;  3I43 A;  4F82 A;  6GSW A;  1O8X A;  1YJ6 A;  2L59 A;  3A2X A;  2L5L A;  4PQI A;  2OE3 A;  4HZ2 A;  4KH7 A;  2I1U A;  4ECC A;  1TRU A;  2YJ7 A;  1XWA A;  4KA0 A;  2H30 A;  2IIY A;  5J9C A;  1DBY A;  1F3A A;  1A2J A;  3DVX A;  5AGY A;  4DEJ A;  3TJB A;  3UAR A;  2B5E A;  4MF7 A;  5IMF A;  5IPG A;  2QSI A;  3VLN A;  4I6X A;  5ECS A;  4YQV A;  3ZLP A;  4Z2U A;  2OE0 A;  2DJ3 A;  1XW5 A;  1GSQ A;  1PKZ A; 
#chains in the Genus database with same CATH homology
 3KH9 A;  4O5R A;  2OKA A;  1TJD A;  3ERW A;  5LNK e;  3TKR A;  2XBQ A;  1J0F A;  2ZUP A;  4JR4 A;  3EU3 A;  1AUC A;  5J4U A;  1FOV A;  3J7Y b;  4NHW A;  2QC7 A;  3EVI A;  1AC1 A;  2E2G A;  20GS A;  4GST A;  2HI7 A;  1V98 A;  4KB3 A;  4X4J A;  4Q5R A;  2GT5 A;  2R4V A;  4MZB A;  1TU7 A;  2L57 A;  4MK3 A;  4TR1 B;  4OFT A;  1GUK A;  4V2N A;  3D6I A;  4HZ4 A;  3GKM A;  4KGI A;  3LG6 A;  1R7H A;  1GSU A;  4Q5N A;  4X43 A;  1GUM A;  3RHB A;  2CAI A;  1PN0 A;  1TDI A;  3DD3 A;  1OKD A;  3TKS E;  22GS A;  2YWO A;  2VM1 A;  2D2Z A;  2VCV A;  1GRX A;  1TP9 A;  3FZ5 A;  3N9J A;  2VCW A;  4GWR A;  5ECK B;  3IC8 A;  2A2R A;  4NPB A;  3SWL A;  3EPT A;  2PPT A;  1QQ2 A;  5IIZ A;  4JR6 A;  2FA4 A;  4KDX A;  2LQQ A;  2R0P A;  4V1A g;  2R6K A;  1YDK A;  2MMA A;  2X49 A;  3FK8 A;  2JSZ A;  4LMW A;  3TRX A;  4OFN A;  3TJK A;  3HA9 A;  5J3R A;  5IMA A;  4GSN A;  3RBT A;  1JZW A;  3GSS A;  4IP6 A;  1HNB A;  4WEY A;  2LKU A;  1XVQ A;  5B8B A;  2GST A;  3R3E A;  3ZFL A;  1ERT A;  4JU5 A;  3WT2 A;  2K6V A;  4PTS A;  3QR6 A;  1FAA A;  2VD1 A;  5D96 A;  4TOP A;  2KUC A;  4BVX A;  3LQ7 A;  3FRC A;  5DQS A;  1EZK A;  1PSQ A;  2ZNM A;  1I5G A;  1BAY A;  1GTB A;  2GGT A;  1MTC A;  3EYT A;  4I2U A;  5EPF A;  4IQA A;  2F51 A;  3C1R A;  1GNE A;  3UVT A;  12GS A;  1TK5 B;  5EL8 A;  2R3X A;  3M0F A;  2X8G A;  2VIM A;  3MIX A;  2IMF A;  5DAK A;  5ECL B;  4H86 A;  4HJ2 A;  3UAP A;  4YKF A;  2JZT A;  1XOA A;  4YH2 A;  3BD2 A;  4DVC A;  2HYX A;  4L0U A;  3E0U A;  1WIK A;  3A2W A;  1EGO A;  3ZVJ D;  3A3T A;  2M80 A;  4GQC A;  3TKQ A;  2V6K A;  3US3 A;  1K3O A;  2VLV A;  4KND A;  4I97 A;  3Q19 A;  2KLX A;  1NHO A;  3BOA A;  1SL0 B;  4ZB8 A;  1RW1 A;  4OD7 A;  4MH3 A;  3QCP A;  5B6N A;  3ERG A;  1GWC A;  4V2L A;  1TK0 B;  2IN3 A;  1EOH A;  1KNG A;  1GLQ A;  3U6V A;  2ON5 A;  1U88 A;  1XWK A;  2DML A;  5CRE A;  2L4Q A;  1BYE A;  2AB6 A;  1PL1 A;  3P90 A;  3GST A;  5H5R A;  4KW6 A;  4XTS A;  1B9Y C;  3Q6O A;  4EC0 A;  4BVX B;  3A5W A;  2G0F A;  1ERV A;  3F3Q A;  1PN9 A;  16GS A;  4IJ3 A;  4KF9 A;  2H66 A;  3HJM A;  4HUA A;  1ZYN A;  3APS A;  5JWO B;  1YY7 A;  3C7M A;  1OKT A;  2V2G A;  4TVE A;  5GSS A;  1F37 A;  2PER A;  1RQM A;  5COH A;  4HQZ A;  5D9W A;  1T8E B;  3KMN A;  1XXU A;  1ON4 A;  4J57 E;  3GL5 A;  4D73 A;  3UJ1 A;  4FH8 A;  4WR5 A;  3TRP A;  5GAP D;  1ZYE A;  1V40 A;  1T4Z A;  2WZ9 A;  2C0G A;  2LRC A;  4MZC A;  3NOF A;  2PN8 A;  2GTU A;  4FYU A;  2H6Y A;  4G19 A;  5CRH A;  4TR4 A;  1B4Q A;  2L6C A;  2H1G A;  4IEL A;  4V2M A;  2VL9 A;  5AIV A;  1OC3 A;  2IWT A;  2PMT A;  3QDN A;  1AAZ A;  1M0U A;  1M9A A;  3GRX A;  3F4R A;  4ML6 A;  1K0O A;  5B6M A;  1JFU A;  4IVF A;  3FEU A;  4IP1 A;  1SKS B;  1DE1 A;  5G31 A;  4MJB A;  2VCT A;  2WGR A;  2WFC A;  3GN3 A;  3RAZ A;  1AQX A;  3PGT A;  5IMV A;  4G2E A;  4F9Z A;  1K0M A;  5JCU A;  1K0C A;  2H76 A;  1X5E A;  2HRA A;  2E0Q A;  4WR4 A;  1Z3E A;  3J7Y k;  3GFK A;  2ALB A;  3DKS A;  3FZ9 A;  2JZS A;  5ECP B;  1SJZ A;  1E2Y A;  2IMK A;  3KCM A;  4KAE A;  4D73 B;  5ID2 A;  1USB A;  2R0G A;  2B7K A;  3ZFB A;  1GSE A;  3VI5 A;  4ISD A;  2TRX A;  3A2V A;  1X0R A;  3UBL A;  4BWQ A;  3UBK A;  1ZOF A;  2DKH A;  4KE3 A;  3SBC A;  2N5A A;  1FOH A;  4K2X A;  1A2L A;  2I81 A;  2GQL A;  1E6B A;  4K7I A;  1HNA A;  1BG5 A;  4FQU A;  4RQX A;  3AY8 A;  3MWH A;  3ZZX A;  3L9U A;  3VK9 A;  14GS A;  4EKZ A;  2GDR A;  2GQK A;  3EU4 A;  2VL3 A;  4Z2T A;  5A4W A;  2H75 A;  5F8B A;  4MNN A;  3VPT A;  2CV4 A;  3HVX A;  1K3Y A;  4EXJ A;  2C8U A;  4NAX A;  5GAN D;  2YPM A;  1TK8 B;  4POK A;  2C80 A;  2I9H A;  2WUL A;  2OAD A;  3BCK A;  4GQF A;  5CRW A;  2GSR A;  9GSS A;  2QA1 A;  3C1S A;  4PGT A;  1O8W A;  2C4J A;  2X4A A;  4PX1 A;  1QFN A;  4L8E A;  2WS2 A;  2H73 A;  2LV3 A;  2RM5 A;  3C73 A;  5D93 A;  5GST A;  5LCZ A;  2LNT A;  1IYI A;  3IHQ A;  2YN1 A;  4GCI A;  4JBB A;  4KSO A;  2GT6 A;  4N11 A;  3GKK A;  4V1A p;  3BJ5 A;  1EP8 A;  5AIX A;  1PD2 1;  3LJR A;  4XRD A;  3UOM A;  3HZ8 A;  1F6M C;  2B6M A;  2CVK A;  6GSS A;  1WMJ A;  2YOI A;  3GX0 A;  2GSQ A;  1JZO A;  2R2J A;  3G7J A;  1K0B A;  1U87 A;  2LJA A;  3WYW A;  5INY A;  2DJ1 A;  1T00 A;  3D22 A;  5C00 A;  1OAZ A;  4MP4 A;  2RUE A;  1YKC A;  3H4K A;  2N5B A;  4MAB A;  5F05 A;  1AIU A;  2NBS A;  2H19 A;  1V58 A;  1J9B A;  1V2A A;  2F8A A;  1PA3 A;  3TGZ A;  5IPH A;  3ZYW A;  4AF2 A;  5G1L A;  4K0N A;  3N5O A;  4J56 E;  1F9M A;  3GTU A;  4MJA A;  3NZN A;  2IL3 A;  5DAL A;  4USS A;  4DSR A;  4NWY A;  3FW2 A;  4K7O A;  1Z6N A;  3HVV A;  3TJJ A;  3WGD A;  1GSY A;  2A4H A;  3ED3 A;  2LEG A;  2K18 A;  5ELG A;  2HZF A;  10GS A;  3L78 A;  4MH2 A;  1H4O A;  5H5Q A;  5DBQ A;  5G5F A;  2O8V B;  2YWM A;  4BWS A;  2HRF A;  4BA7 A;  4ML1 A;  5GZZ B;  4JED A;  1GTA A;  2AAW A;  4E8E A;  1YQ1 A;  1HYU A;  4CY8 A;  3IAS 2;  3DWV A;  2GS3 A;  2HLS A;  3LW9 A;  2C0F A;  4JE1 A;  3ZIJ A;  3C71 A;  5ECI B;  4O92 A;  1B4P A;  2B5X A;  2YV7 A;  4BVY A;  4XS4 A;  2FA8 A;  4POM A;  4QQ7 A;  4CY6 A;  3F3R A;  3TJF A;  1Z5Y E;  3U5R E;  1W89 A;  1WE0 A;  3MAK A;  3KZQ A;  1FVJ A;  2WJU A;  4NMU A;  3M9K A;  1G7E A;  4Z7X A;  1X5C A;  2FY6 A;  3GV1 A;  4EO3 A;  1FHE A;  3G7Y A;  2H6X A;  1EP7 A;  5DAL B;  4ZL8 A;  4ILF A;  4TXV A;  1QXH A;  2VD0 A;  4EL1 A;  1XBS A;  5KN0 A;  3CBU A;  3EMP A;  1SJI A;  8GSS A;  4XS1 A;  2R5G A;  4E8H A;  4YQU A;  5KOW A;  3APO A;  3IOS A;  4MPG A;  1SJ6 A;  4QL7 A;  4LMV A;  2MMN A;  1QMV A;  4QL9 A;  1SKW B;  1EEJ A;  1G6W A;  5E59 A;  2YJH A;  3IK9 A;  1SD8 A;  2O87 A;  4K5R A;  3I9V 2;  1KBN A;  1THO A;  1XZO A;  3UIW A;  4EF0 A;  3M8N A;  1K0A A;  3I69 A;  1GUL A;  2VCZ A;  2O85 A;  1JZD A;  4K5S A;  5ECM B;  5HFI A;  3O6T A;  4WF4 A;  3KGK A;  5FWG A;  3LYP A;  4G0L A;  1G6Y A;  3IRA A;  3F4T A;  5AN1 A;  3W8J A;  1WP0 A;  3M1G A;  1S3C A;  2C3T A;  3HY2 A;  3HD5 A;  1M2B A;  2GZP A;  1W4V A;  3LOR A;  6GSU A;  4HQS A;  4O5Q A;  1FW1 A;  2C0D A;  2P31 A;  3FZ4 A;  1Y25 A;  1MDJ A;  2VL2 C;  3D5J A;  3UL3 A;  3O76 A;  4PXO A;  1ZMA A;  2A2P A;  1XWB A;  3FYG A;  3GH6 A;  4K9Z A;  5AIS A;  2L4C A;  3GA4 A;  3C8E A;  1TTZ A;  3FMW A;  3L4N A;  2EIQ A;  2OE1 A;  4CDO A;  4F2I A;  2F9S A;  3ZRE A;  3O3T A;  4KCA A;  3KTL A;  5CAX A;  2KP1 A;  4RUV A;  2AV4 A;  4TW5 A;  4HU9 A;  3ZVJ A;  5HQP A;  2ES7 A;  3KH7 A;  4G9H A;  1AQW A;  4YKG A;  1S3D A;  5B7C A;  3JCM L;  2P5R A;  2H0H A;  2KP2 A;  4HDE A;  5CYY A;  2FUG 2;  2CT6 A;  3ZMK A;  1FVK A;  2CX3 A;  2O7K A;  2OA7 A;  3P8W A;  5EY6 A;  3VPQ A;  1LBK A;  3M3M A;  3UEM A;  4RQR A;  3QAW A;  2BTO T;  2JSY A;  5FT3 A;  2HFD A;  3HDC A;  1SK0 A;  2VL2 A;  3MDK A;  2XBI A;  2G2Q A;  1GLP A;  1N8J A;  1VF3 A;  3TRQ A;  7GSS A;  1VGL A;  2QA2 A;  2YV9 A;  5KN2 A;  5ECO B;  2GZY A;  4KSM A;  1FO5 A;  3PPU A;  4O32 A;  1X5D A;  5DAK B;  2PU9 C;  2RII A;  4I5Q A;  1XVW A;  2NVL A;  2FLS A;  2VO4 A;  4NV2 A;  3CTF A;  1A24 A;  3GMF A;  3F8U A;  6GSX A;  1TI3 A;  2AUV A;  1JHB A;  1GH2 A;  3A5I A;  3W6G A;  1SYX A;  4NHZ A;  3KD0 A;  3D0Z A;  4G0I A;  3IBH A;  1YKA A;  3VI7 A;  4BPY A;  1GTU A;  3KP8 A;  3QOU A;  1T3B A;  1A0F A;  2HZE A;  3P7X A;  3CSI A;  3GIX A;  1QK8 A;  2XPE A;  4EUY A;  4AJ8 A;  4G0K A;  1G0T A;  1TW9 A;  2N5F A;  3GHA A;  2HRK A;  1TI1 A;  2FWH A;  2CZ3 A;  4HEA 2;  1YEP A;  4TXO A;  3KJY A;  1R5P A;  1PRX A;  3VWV A;  1X9W B;  4K1F A;  3KMO A;  4WKW A;  1BJX A;  2LTK A;  1S3A A;  2UZ8 A;  5LD0 A;  1V9W A;  2I4A A;  5A5K A;  2NTO A;  1R5A A;  3HXS A;  2JZR A;  2H1A A;  4TR0 A;  2YCD A;  1SU9 A;  4P3Y B;  1K3L A;  1MDI A;  2YZH A;  1ABA A;  3GUR A;  1LJR A;  2TRC P;  1NSW A;  5DDL A;  1AXD A;  5J9B A;  3Q74 A;  3EE2 A;  5F07 A;  1SL1 B;  2X8C A;  5IMC A;  3F0I A;  1TRV A;  2YP6 A;  3TCO A;  3RPN A;  4IQ1 A;  1ACV A;  5IMZ A;  2X8H A;  1M7T A;  5KEJ A;  2OBI A;  3IK7 A;  1VF4 A;  3IPZ A;  2JAC A;  2M46 A;  3DIE A;  2FGX A;  2C3N A;  2VCX A;  3Q18 A;  4ZBD A;  1PL2 A;  5ECH B;  2YAN A;  1G7O A;  4AJ6 A;  4MF5 A;  4WF5 A;  4TRX A;  5CO3 A;  5G1K A;  2HRN A;  4OWY A;  2K8S A;  5IM9 A;  2FWF A;  1GL8 A;  4MZW A;  1VF2 A;  2H74 A;  4X0X A;  3ZRD A;  19GS A;  2IMD A;  4MMM A;  3ZIV A;  3GH9 A;  1A23 A;  3WT1 A;  13GS A;  2HXK A;  5BMU A;  2X99 A;  3TOU A;  2CQ9 A;  3EWL A;  1PQN A;  3P2A A;  1Z7R A;  5D9T A;  2V6O A;  1LU4 A;  1R4W A;  3LEF A;  3LXT A;  2AJQ B;  4JRR A;  3LSZ A;  3VWX A;  4CHS A;  3IDV A;  2VAF A;  2MMO A;  2H01 A;  2YWN A;  1HNC A;  2VLT A;  2H71 A;  2R37 A;  4PQ1 A;  1QGV A;  2V32 A;  5HR0 A;  4F0C A;  3MYD A;  3R2Q A;  3EIN A;  5CRD A;  3GL3 A;  4PUR A;  4FO5 A;  1WRY A;  4FYB A;  2WB9 A;  5ID2 B;  1XW6 A;  4KDY A;  4XHM A;  1A8Y A;  2B1L A;  4OCF A;  3ME7 A;  2DJ0 A;  3QAG A;  2O89 A;  4FYC A;  4IS0 A;  4F0B A;  1O85 A;  1OYJ A;  2XHF A;  1O73 A;  4WET A;  4ECI A;  4ZBB A;  1XIY A;  2FWG A;  3QFB C;  1XWC A;  3F63 A;  1OVN A;  2YNX A;  4CW9 A;  3PIN A;  2KHP A;  4ICY A;  4LL1 B;  4MLY A;  1Z6M A;  2FCH A;  3RPP A;  5ECR B;  1PKW A;  3IE3 A;  2B7J A;  2HSH A;  2H1B A;  2V1M A;  1PGT A;  1B9X C;  1ZCP A;  2HE3 A;  3CMI A;  1OC8 A;  1EWX A;  4IN0 A;  2P0G A;  5ECN B;  1EEM A;  4L0W A;  2HT9 A;  2NPB A;  1TRS A;  4ZIL A;  5CNW A;  3TKS A;  1ZYP A;  2MBT A;  3WGX A;  5D73 A;  5D9X A;  5J41 A;  3GYK A;  2E2M A;  4KDU A;  4XIH A;  5IOX A;  4L5L A;  5DCH A;  3DYR A;  5EVO A;  3FY7 A;  2ON7 A;  3DGQ A;  2MZC A;  4J2F A;  2C3Q A;  1BQ7 A;  1DSB A;  2LRN A;  4XS6 A;  2HSM A;  2P5Q A;  5ELA A;  1PMT A;  1GNW A;  2TIR A;  3GKX A;  1BX9 A;  2EIR A;  6GSV A;  2IFQ A;  1H75 A;  2QKE A;  4MJE A;  3HYP A;  4JZQ A;  4ACS A;  1M99 A;  3RHC A;  4MF6 A;  2BJX A;  4ZL7 A;  4ZB9 A;  2B3S A;  2B5Y A;  5G5E A;  1Z9H A;  1UC7 A;  2JU5 A;  3QFA C;  1JLV A;  2C1Y A;  5G30 A;  4PUA A;  6GSY A;  2DIZ A;  2A2S A;  1EV4 A;  2DJ2 A;  3M9J A;  3TDG A;  2L5O A;  1YZX A;  5ABR A;  1UA5 A;  4KUN A;  3DML A;  3LXZ A;  3HZ4 A;  3WGE A;  2IPA A;  1T7P B;  1VF1 A;  2HNL A;  1EGR A;  3KTB A;  2H0G A;  2H1D A;  5ECQ B;  4OO5 A;  2MMZ A;  3KEB A;  4ID0 A;  2PVQ A;  4X1U A;  2CA8 A;  1M2A A;  3IAM 2;  1JZR A;  3OR5 A;  2VUP A;  5G2Z A;  2J9H A;  5KOX A;  3E9J B;  1PX6 A;  4WBR D;  1ST9 A;  3FKF A;  1TKD B;  2LJR A;  3BBY A;  3GTU B;  4YQM A;  4G10 A;  1ZZY A;  3CSH A;  4GF0 A;  3TUE A;  4WBJ A;  2IFQ B;  2R0C A;  3PR8 A;  2H70 A;  3CXG A;  2GQM A;  3DRN A;  4DSS A;  1GTI A;  2NDO A;  3FR9 A;  4HOJ A;  3H79 A;  2LNS A;  2FHE A;  4IKH A;  2RUF A;  2F8F A;  2PBJ A;  4ECJ A;  1B8X A;  5IOW A;  2MBS A;  5J5N A;  1TRW A;  17GS A;  1GSF A;  1AW9 A;  3H1N A;  1V57 A;  2V41 A;  5HR1 A;  2DC5 A;  2GLR A;  1Q98 A;  2RLI A;  4N0V A;  2CX4 A;  2EC4 A;  4TN8 A;  1XW9 A;  2A4V A;  2K9F A;  2XC2 A;  2VOC A;  3F6D A;  2C0E A;  2DMM A;  1TU8 A;  5A4U A;  1T1V A;  2DKI A;  1GUH A;  4GTU A;  5L71 A;  4BVY B;  3QMX A;  4XS4 B;  3I6A A;  4GXZ A;  5CP1 A;  3QPM A;  2FWE A;  3D21 A;  2X64 A;  1X9M B;  2OAC A;  3TJG A;  3E3E A;  5JCW A;  1XFL A;  2OBK A;  1C72 A;  2B1K A;  5A4V A;  3MSZ A;  1XOB A;  2PWJ A;  4YAP A;  4HI7 A;  2GSS A;  1SYR A;  5HR2 A;  1SK1 A;  4TR3 A;  3V1W A;  1EV9 A;  1F3B A;  2YWI A;  3UVH A;  2F3M A;  4PQH A;  2M72 A;  1TOF A;  5C04 A;  4XCS A;  1ERW A;  3VWU A;  5F06 A;  3ERF A;  1YEX A;  3WD6 A;  2VLU A;  2H6Z A;  4I8B A;  2IMI A;  3APQ A;  2CVB A;  4OO4 A;  4MDC A;  1MEK A;  1THX A;  2EIO A;  4DSS B;  1AQV A;  4EIP A;  5IO0 A;  1X9S B;  1SEN A;  4TKY A;  18GS A;  3MNG A;  1EOG A;  3ZTL A;  4MPF A;  4ZXG A;  3HHV A;  1FB0 A;  3TB2 A;  2PGT A;  2DJJ A;  2FD3 A;  1NM3 A;  4K0G A;  4L5O A;  6GST A;  1KTE A;  5DCG A;  1YF1 A;  4PNG A;  4WXT A;  4GSS A;  3L9S A;  4N0Z A;  1ERU A;  3S9F A;  5ENU A;  5KN1 A;  3VUR A;  2REM A;  1A0R P;  3EC3 A;  4K7N A;  3TOT A;  3CRU A;  3NIV A;  4Z2R A;  2Z9S A;  5IMD A;  2E7P A;  5HFK A;  3FR6 A;  1XCC A;  4K8M A;  5JCG A;  3LGC A;  4IBP A;  1WPI A;  3G9B A;  1URM A;  4F03 A;  1UN2 A;  2WCI A;  2WDU A;  3G7I A;  3FHK A;  3BCI A;  2LRT A;  2JL4 A;  4BL7 A;  4Q5F A;  4EVM A;  1O81 A;  3DEX A;  3KXO A;  4OMV A;  1BED A;  3CTG A;  1ML6 A;  3LWA A;  2GVP A;  1SL2 B;  5JWQ B;  4ULX A;  4HU7 A;  3GX8 A;  3HVS A;  3H8Q A;  3F6F A;  3KIJ A;  1RK4 A;  2KOK A;  4GLT A;  2AYT A;  1XWG A;  3PH9 A;  5KN3 A;  3IC4 A;  4DSQ A;  1T4Y A;  4ECB A;  2LS5 A;  1NHY A;  3GKN A;  1PX7 A;  4N30 A;  1OE8 A;  4MJC A;  2QGV A;  4HS1 A;  4HJM A;  3HKR A;  1WJK A;  1U3I A;  2LST A;  4OFM A;  3D4M A;  4EIQ A;  3KP9 A;  1VRS D;  2DIY A;  2J23 A;  2MYG A;  1N2A A;  4LA1 A;  1MDK A;  4AGS A;  5JWR B;  5DVB A;  2CZ2 A;  5IQY A;  4N10 A;  1M9B A;  4POB A;  4PUF C;  5B8A A;  3IA1 A;  4KCE A;  2CAQ A;  3L0H A;  1MD3 A;  2RM6 A;  3FZA A;  1ZYQ B;  4AJ7 A;  1M2D A;  2XPD A;  1K0N A;  4ZIJ A;  3TKP A;  3ISO A;  4EDY A;  1XPV A;  1KEB A;  5DQY A;  2CVD A;  1SKR B;  2IME A;  4OCE A;  1ILO A;  1DUG A;  3ZL5 A;  4BL7 B;  3HJP A;  2GZZ A;  4Q5Q A;  1QUW A;  2IJY A;  3RDW A;  4IW9 A;  11GS A;  2H0I A;  1SD9 A;  2WRT A;  3IR4 A;  3HJO A;  1GSS A;  2BMX A;  2K8V A;  1CQG A;  4LL4 B;  4GRF A;  2HZE B;  4IHU A;  1Q4J A;  3IHG A;  4ZB6 A;  4RI7 A;  2OJL A;  3EMX A;  3UMA A;  3CRT A;  1Z7P A;  3IXR A;  3L9V A;  2LJK A;  4IJI A;  4TXO B;  5DJL A;  1K0D A;  3ME8 A;  2DSA A;  1DE2 A;  4A5P A;  4POL A;  4LLR A;  4FIW A;  3VFI A;  5CRG A;  4ZL9 A;  1MD4 A;  4I2T A;  3FR3 A;  2H8L A;  4O7H A;  3DVW A;  4NV5 A;  3F9U A;  5HR3 A;  1WWJ A;  2VCQ A;  4K2D A;  1GSD A;  5IO2 A;  1B48 A;  1OC9 A;  4YAV A;  2FNO A;  1J08 A;  3HCZ A;  5F0G A;  2H72 A;  1GP1 A;  3QD9 A;  1O7U A;  1HD2 A;  2VM2 A;  5BRT A;  3D4T A;  3GUS A;  4IGJ A;  3H93 A;  3LYK A;  2PVO C;  4MCU A;  4KX4 A;  3TKS C;  3K8N A;  1ZL9 A;  3IV4 A;  3VWW A;  2PUK C;  2ZCT A;  1O6J A;  5HFG A;  2DBC A;  3QAV A;  2JAD A;  1FG4 A;  2HSY A;  1CQH A;  3KM6 A;  1SK2 A;  3ZIT A;  3EUR A;  1ZGN A;  3F4S A;  4O5U A;  5D8I A;  1HQO A;  4RI6 A;  1OE7 A;  2DLX A;  5H5S A;  3LFL A;  1YF0 A;  2L6D A;  2LQO A;  1Y6E A;  4NXI A;  2LUS A;  5DJM A;  4MA9 A;  4EE0 A;  3CSJ A;  1TXX A;  3DXB A;  5D9V A;  1NW2 A;  3GNJ A;  1IYH A;  4EDZ A;  1WOU A;  4K6X A;  2I3Y A;  1JLW A;  5E4W A;  1A8L A;  1I9D A;  4TR1 A;  1UVZ A;  3ZML A;  2YZU A;  2AHE A;  1A2M A;  1R26 A;  3CYN A;  2DJK A;  1F2E A;  4XRA A;  1U6T A;  3W8S A;  1OC9 B;  4ZBA A;  5FHI A;  1FB6 A;  1U3A A;  4PNF A;  3I43 A;  4F82 A;  6GSW A;  1O8X A;  1YJ6 A;  2L59 A;  3A2X A;  2L5L A;  4PQI A;  2OE3 A;  4HZ2 A;  4KH7 A;  2I1U A;  4ECC A;  1TRU A;  2YJ7 A;  1XWA A;  4KA0 A;  2H30 A;  2IIY A;  5J9C A;  1DBY A;  1F3A A;  1A2J A;  3DVX A;  5AGY A;  4DEJ A;  3TJB A;  3UAR A;  2B5E A;  4MF7 A;  5IMF A;  5IPG A;  2QSI A;  3VLN A;  4I6X A;  5ECS A;  4YQV A;  3ZLP A;  4Z2U A;  2OE0 A;  2DJ3 A;  1XW5 A;  1GSQ A;  1PKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...