3S9FA

The structure of tryparedoxin i from leishmania major
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
SGVAKHLGEALKLRKQADTADMDSLSGKTVFFYFSASWCPPCRGFTPQLVEFYEKHHDSKNFEIILASWDEEEDDFNAYYAKMPWLSIPFANRNIVEALTKKYSVESIPTLIGLNADTGDTVTTRARHALTQDPMGEQFPWRDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryparedoxin
publication title The crystal structures of the tryparedoxin-tryparedoxin peroxidase couple unveil the structural determinants of Leishmania detoxification pathway.
pubmed doi rcsb
source organism Leishmania major
molecule tags Electron transport
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3s9fA00
3VLNA 4IP6A 3APOA 4DSSB 2LV3A 3P2AA 1SL0B 3FHKA 1K3YA 2F9SA 1M2DA 2OE0A 4I8BA 4IS0A 1GSDA 4O92A 2L5LA 5D9XA 5GSTA 2ON7A 3H4KA 3IAS2 2NBSA 5E59A 5F0GA 3LWAA 5HFGA 2H01A 1DSBA 4GXZA 4PXOA 1JZDA 2ALBA 3A3TA 1TTZA 2MBTA 1F3AA 1PN9A 4Q5FA 2VAFA 3IBHA 5H5SA 4HS1A 1XBSA 1TRUA 5ECSA 3H93A 1B9YC 2FA4A 2YWIA 3A5WA 2L4CA 5JWQB 3U5RE 5AN1A 3GKMA 1PX7A 2L57A 3GKXA 5JWOB 4E8HA 1ZOFA 2RIIA 3C71A 3RHCA 1YF1A 1K0DA 3KP9A 2CVDA 2LS5A 5GSSA 4LL1B 2JU5A 4I2UA 2L6DA 4TR3A 1K0NA 2VCXA 3C73A 3LQ7A 2VLUA 4WF5A 1B9XC 2CZ3A 4K0GA 5ELAA 2CAQA 3L4NA 4MJCA 1GUKA 2IFQA 2I81A 1SU9A 3ISOA 1T4ZA 1A2MA 1OC3A 5G1KA 1ERUA 5G2ZA 3C1RA 5L71A 5A4VA 4TKYA 1QQ2A 4XCSA 4OMVA 1SKWB 3HXSA 3GTUA 1E6BA 1SD8A 5ECOB 3GRXA 1SL1B 3BCKA 3ZITA 2GSSA 2H76A 3KGKA 5IMZA 3F63A 3HCZA 1AIUA 5CYYA 4HQZA 4MZBA 4DSRA 3L78A 4ML1A 4E8EA 1A24A 5HFKA 4XHMA 2HXKA 4MZWA 2LJRA 1T00A 3IHQA 1KNGA 1X9SB 1AW9A 4IJ3A 1FO5A 1QFNA 2LNTA 2HFDA 1WMJA 3IV4A 3PINA 1SJ6A 2GVPA 3APSA 5ECRB 1PKWA 2HZEB 1JZRA 4G2EA 2OADA 4PX1A 2L5OA 19GSA 3TRQA 1O85A 5EVOA 4EUYA 3HY2A 1ERVA 4CDOA 2EIOA 2NDOA 1E2YA 2LKUA 2V41A 1URMA 1MD3A 1EOGA 2B6MA 2VO4A 5G30A 2AUVA 4NAXA 3EINA 2P0GA 2GSQA 5A4UA 2VIMA 1JLVA 4CHSA 2DMLA 10GSA 1LBKA 2DJ2A 5CRDA 1QK8A 2IMIA 2OE3A 2CA8A 3S9FA 1GTBA 1GP1A 1EZKA 2C0GA 3FEUA 4WR4A 4PGTA 4V2NA 4TRXA 1J9BA 1VF4A 5ID2A 1FG4A 2X8HA 1TDIA 3TJGA 1X0RA 2YWOA 2IWTA 1WP0A 1DUGA 3TOTA 5ECNB 4JEDA 4IHUA 3QAGA 3QAVA 4I5QA 1QUWA 3TJFA 3D4TA 5IMDA 2H6XA 2C3TA 1YY7A 3GL3A 1ZYEA 3G7IA 5ECHB 1F6MC 1S3CA 3EE2A 1AC1A 3D4MA 1K3OA 3FR3A 3JCML 3GX0A 2WGRA 1PQNA 3G9BA 2H66A 3CRUA 5ECPB 20GSA 3Q6OA 1Z6MA 2O8VB 2BTOT 1C72A 2XPDA 3FZ9A 2YWNA 2C1YA 4TXOB 2VM2A 1XWBA 3EMXA 3WGDA 1EWXA 1HNCA 5COHA 4NPBA 2DIZA 3HD5A 5J4UA 2YJ7A 2QSIA 1XFLA 1ZYQB 2VCQA 3E0UA 4MDCA 3QMXA 5JCUA 3D6IA 4L5OA 1MD4A 1X9MB 2DLXA 1U3IA 2HT9A 4RI7A 2AAWA 5ABRA 3GIXA 1EGRA 2F51A 2H1BA 1OKDA 3D0ZA 2CAIA 3TKSC 1EV9A 3P7XA 2BMXA 2HLSA 1YZXA 4MZCA 3K8NA 4MJBA 3DXBA 11GSA 1TU8A 1R5AA 2VUPA 6GSWA 1O73A 2IMEA 1TJDA 1U3AA 3IC4A 3DGQA 3A2VA 3RHBA 5DBQA 3P90A 2LRNA 1ON4A 2LTKA 3I6AA 4KDUA 2I1UA 2IFQB 1XWAA 13GSA 4GTUA 2NPBA 4ZB6A 2XBIA 1PA3A 3C7MA 1ACVA 3LXZA 3OR5A 3RAZA 6GSVA 2GQMA 1EEJA 4EDYA 3ZFLA 2H74A 3LFLA 2H1DA 3QR6A 3CXGA 3GTUB 2GTUA 2IMFA 4OFNA 3I9V2 3FR6A 1TK0B 4IN0A 4I97A 1SK2A 2MMAA 2WJUA 1Q4JA 2PWJA 2KP1A 1F3BA 1JFUA 2FWGA 3ZLPA 3FKFA 2X8GA 4KDYA 1XW6A 4KW6A 2DC5A 3RPPA 3L9UA 2JZRA 5AIXA 2H0IA 4JBBA 1JZWA 4XS6A 1XVWA 4YAVA 4IGJA 1TRSA 3HJMA 4K2DA 4Z7XA 5ECLB 3IXRA 1T1VA 2VCZA 1YKCA 3VWWA 3KTLA 1GULA 2P31A 3KTBA 2L59A 1MTCA 4HQSA 3EC3A 3M9KA 5IOXA 3UARA 16GSA 4ACSA 3KJYA 3VWVA 1SYXA 1UN2A 4ISDA 1O8XA 5HR1A 1WE0A 4QL9A 3F3QA 1O6JA 1SKSB 4G9HA 5H5RA 2B1KA 3SBCA 5GAND 1XZOA 5HR2A 5C04A 1PGTA 3GSSA 2DJ1A 2CV4A 3H8QA 3Q19A 5FT3A 1ABAA 1J08A 2YWMA 5ID2B 1XOBA 5D9TA 1YKAA 3GHAA 2EIRA 1T3BA 4QL7A 4XS1A 4DSQA 1Z5YE 2FUG2 2G2QA 4D73B 1QXHA 5D9WA 4JZQA 4EC0A 1B8XA 3WGXA 3LYPA 2O87A 2XHFA 4NV2A 2OJLA 4ZXGA 1R26A 2HNLA 3ZTLA 5DJLA 3GX8A 3GH9A 3ZVJD 9GSSA 5IPGA 4AGSA 2HSHA 1I9DA 1XOAA 2YOIA 2O89A 5DCGA 2ZUPA 3MSZA 2FWEA 3IRAA 5CRGA 3ZVJA 2MMZA 3QDNA 4ZL7A 3TRXA 3UBLA 4ZL9A 4NMUA 4EDZA 1T4YA 4OO4A 2IJYA 5KN2A 4J57E 4F9ZA 3QAWA 2VCWA 1UA5A 1GNWA 2X99A 1A0RP 3MAKA 2K6VA 1X5EA 5LD0A 6GSSA 3MNGA 1V58A 2WDUA 3DWVA 3E9JB 1BYEA 2CZ2A 4KDXA 1R7HA 3UEMA 6GSXA 4CW9A 4HJ2A 3IPZA 3IK7A 3TJKA 2K8SA 3M3MA 2DJ0A 1ZCPA 2IMKA 1SK1A 2E7PA 1GUHA 2HSYA 4FYUA 2H1AA 1USBA 4ID0A 4LL4B 3C1SA 2WULA 5GZZB 1BAYA 3U6VA 4DVCA 2I9HA 1M2BA 2GSRA 4KCAA 2PVOC 3ERWA 1X5DA 4KCEA 2YV9A 4WETA 2FHEA 2LSTA 2G0FA 4GRFA 4O5RA 4XS4A 4BA7A 4KA0A 1G6YA 4Q5RA 3FK8A 3KMOA 5IPHA 2H71A 3LJRA 4HZ2A 4MCUA 2NVLA 1B4QA 1KTEA 2GSTA 2XPEA 3ERGA 4PNGA 1BEDA 2R3XA 3M9JA 3ZFBA 4L8EA 4FH8A 5IMFA 1VF1A 1FW1A 1U88A 3CRTA 3I43A 2J23A 2B5XA 5C00A 1PL1A 1THOA 3V1WA 1M9BA 2KP2A 2JSYA 3BJ5A 5DVBA 2DJ3A 2F8FA 1LU4A 2C8UA 2WB9A 2D2ZA 2VCTA 2OA7A 1XWGA 3GA4A 3EWLA 4TR1A 1OVNA 2CVBA 2FD3A 2FWHA 2OKAA 3VK9A 3H79A 3IOSA 3EYTA 4AJ7A 4FYBA 3F9UA 1ERWA 3GURA 3F4RA 5D73A 2OE1A 1CQGA 4GQCA 4HDEA 2OACA 1JLWA 2AV4A 5CO3A 5J9BA 5A4WA 2GS3A 2PU9C 2B5EA 5IO0A 4PURA 4IKHA 2NTOA 5B8BA 3HYPA 1GSFA 2CT6A 2C0DA 3GFKA 2VM1A 3APQA 3DVXA 1NHYA 4F2IA 4F0BA 2RM6A 1WOUA 2HYXA 1EP8A 3GYKA 2GT5A 3N5OA 2XC2A 3LSZA 5J5NA 3A2WA 4N0VA 2FLSA 4WBRD 2OBIA 5IMCA 3GUSA 4V1Ag 1DBYA 4TOPA 1BJXA 2M72A 1ZZYA 2TRXA 2REMA 5DAKB 3UL3A 3IA1A 1SK0A 5AIVA 1MDIA 4G10A 3TB2A 3TKQA 2JZSA 3ZMKA 4ZB9A 1W4VA 3D22A 4J2FA 3P8WA 2M80A 1OYJA 2PVQA 3KEBA 2RLIA 4HZ4A 6GSUA 1O8WA 2YZHA 4YAPA 4IQAA 3ZIVA 4N0ZA 1AQWA 1XWKA 2DJKA 5DQSA 5IQYA 4RQRA 5CREA 3GH6A 3MDKA 1XW5A 4GSTA 3KP8A 2C80A 2ZNMA 4EF0A 3UOMA 5DDLA 5CRHA 1H4OA 4RI6A 4WR5A 4K7NA 1OC9A 3KZQA 3TKSA 1WRYA 1ML6A 2H8LA 3UAPA 1YEXA 2AB6A 5HR3A 4YH2A 2GLRA 5B7CA 3VPQA 1M9AA 1BG5A 3ZL5A 1Z3EA 3TUEA 1YF0A 1TP9A 3BCIA 5ECKB 4XTSA 2FGXA 3AY8A 3GKNA 2O7KA 4DSSA 4NXIA 3DEXA 1Z9HA 5A5KA 5ECQB 3TJJA 5IOWA 2LRTA 4XRDA 3FZAA 3IAM2 1B4PA 3TOUA 5B6MA 5FHIA 3E3EA 5JCWA 3UIWA 1HQOA 3SWLA 3Q18A 2V1MA 4ZIJA 4OCFA 3EU3A 4LMWA 3QD9A 2ZCTA 4I6XA 4PNFA 4POMA 1MEKA 1Y25A 1OAZA 2V6KA 4ZB8A 4AF2A 4WEYA 3WT1A 4EE0A 4BWSA 3NOFA 4TVEA 2WZ9A 2FCHA 3QOUA 3J7Yb 5HQPA 2N5FA 1GSEA 1X9WB 4GSSA 1OKTA 4ECCA 3QFBC 4ZBAA 3A2XA 3GMFA 1XCCA 4MH2A 2F8AA 3ME8A 3F4SA 4LLRA 4FIWA 2HZFA 2YNXA 2L6CA 3GL5A 2R4VA 1G6WA 1THXA 2H75A 3KCMA 4ILFA 3VWXA 3ED3A 3R2QA 4X1UA 2R6KA 1Z7RA 5KN0A 3HZ4A 3G7YA 2DIYA 2GT6A 3UVHA 1SJZA 3CBUA 1XIYA 2X8CA 2V32A 2H1GA 2C4JA 5KN1A 5AGYA 2F3MA 3ZZXA 1A2JA 4MP4A 2C0EA 5INYA 1V98A 3F4TA 2KHPA 4F82A 3M8NA 4J56E 4F0CA 3M1GA 2VLVA 1B48A 2VL9A 3IK9A 4MJEA 3BD2A 4BPYA 4AJ8A 2WCIA 4PQIA 4K7OA 1J0FA 3D5JA 5DALA 1WJKA 3W8JA 2FA8A 3LYKA 2HZEA 2HI7A 1A23A 1VRSD 3EVIA 2LQOA 2WFCA 4JR6A 1SYRA 2AJQB 1S3DA 1NHOA 4KE3A 1GH2A 4KSMA 4AJ6A 3CSIA 2RM5A 4EKZA 2VL3A 8GSSA 2P5QA 1PL2A 1M0UA 2E2MA 3DKSA 5ECMB 1W89A 3KH7A 7GSSA 3VI7A 4TR0A 4Q5NA 1PSQA 1G7OA 1K3LA 4V2LA 1PKZA 1TK5B 4KNDA 2YV7A 4N10A 2A2SA 5G31A 4KH7A 4POKA 3IR4A 4WKWA 4QQ7A 5DCHA 2K18A 2B7JA 2PMTA 3LG6A 3UVTA 1A0FA 2VLTA 1SKRB 1U6TA 6GSTA 2MZCA 2BJXA 4TXVA 4WXTA 3KXOA 2MBSA 2R2JA 3W8SA 3ZRDA 1GL8A 2VOCA 3KD0A 4X43A 3GNJA 4PQHA 2H6ZA 5DJMA 1F2EA 3Q74A 5IMAA 2I3YA 3KIJA 5GAPD 2RUEA 1GSQA 1RW1A 3CMIA 3HKRA 1DE1A 4IELA 2YPMA 3LEFA 3DYRA 5JCGA 3PGTA 2PGTA 3KMNA 1TRVA 2XBQA 3TGZA 1Z7PA 2H6YA 2H19A 1PX6A 3CSHA 3W6GA 4G19A 4ECIA 3CTFA 1G0TA 2HE3A 5EY6A 1BQ7A 4WF4A 3EMPA 3GN3A 18GSA 5ECIB 1OE7A 1NM3A 2QGVA 3VPTA 3KM6A 4MH3A 1MDJA 12GSA 1PMTA 4TXOA 1A8YA 4NWYA 3FZ4A 3TKPA 3RBTA 2H0HA 5FWGA 2H0GA 2GQLA 1RK4A 3F8UA 4HU7A 3TKRA 1ERTA 2PBJA 3L9SA 4L0UA 2A2RA 1TW9A 2OBKA 1SL2B 1EGOA 1WIKA 2GZPA 2X64A 4BL7A 4MK3A 2AYTA 4HEA2 1PD21 2GDRA 1OE8A 2R5GA 3KH9A 4NHZA 3I69A 2DBCA 2WRTA 2VD1A 4GCIA 3HZ8A 5CRWA 4BVYA 2KLXA 1TXXA 3FR9A 3GSTA 1K0AA 1O81A 3J7Yk 2E0QA 4PQ1A 4PUFC 4K7IA 2V6OA 4ZL8A 1GLQA 1IYIA 4RQXA 2N5BA 3WT2A 1EP7A 1SJIA 3UJ1A 4EXJA 1QGVA 1YJ6A 2KOKA 2E2GA 2YANA 5EL8A 3HDCA 3UMAA 4I2TA 2GQKA 5JWRB 2JACA 4BVXA 4DEJA 3DRNA 1N8JA 3RDWA 1TKDB 1TOFA 1ILOA 5KEJA 4MABA 4HU9A 4EO3A 4KAEA 2HRNA 3CYNA 1A2LA 4FO5A 2LNSA 2LEGA 4YQVA 17GSA 1GSYA 1AUCA 2IMDA 2B7KA 4OWYA 3DVWA 4V1Ap 2CVKA 1GSUA 4ECJA 5G5FA 3HVXA 1R5PA 2EIQA 3PH9A 1SENA 1XW9A 5IO2A 5LNKe 1GWCA 2YN1A 1GLPA 2K8VA 1VGLA 1H75A 5J9CA 2MYGA 2CX3A 4POBA 1NSWA 3TKSE 2IN3A 5DALB 1ZGNA 1EEMA 2H70A 4N30A 4YQUA 3HA9A 1YDKA 4KGIA 4TR4A 5HFIA 5DQYA 5F8BA 2DMMA 3ZMLA 1GNEA 1Z6NA 5H5QA 4EL1A 3PR8A 4MF6A 1N2AA 4IVFA 1GTAA 5B8AA 2JL4A 5KN3A 1TK8B 3N9JA 2FWFA 1V40A 2PN8A 1V57A 3QPMA 3H1NA 3GV1A 1FOVA 1V2AA 4KUNA 1WWJA 1V9WA 2GGTA 3LGCA 4ULXA 1ZL9A 3ZIJA 4V2MA 2M46A 4JE1A 4YQMA 1HNAA 2VCVA 4PUAA 4O7HA 3TJBA 4K1FA 3IE3A 4L5LA 1ZMAA 4MMMA 5ENUA 1KEBA 1FAAA 2AHEA 3QCPA 4GWRA 3FRCA 1VF3A 2CX4A 2LJAA 2H72A 2O85A 3HHVA 1UC7A 5B6NA 5D9VA 3DIEA 5IIZA 3MWHA 1FVKA 4MF7A 3ERFA 2FY6A 1TU7A 4D73A 1UVZA 1DE2A 1K0MA 1XVQA 3F3RA 4NHWA 3L9VA 5ELGA 1A8LA 1Q98A 5D93A 3D21A 3HVSA 3C8EA 4GSNA 1AAZA 3FYGA 4MLYA 3O6TA 2HRFA 1LJRA 1KBNA 4ML6A 5G1LA 2QKEA 4MPGA 5F05A 1IYHA 1GUMA 1M99A 4LMVA 4MA9A 2KUCA 4ECBA 4O32A 2LUSA 3QFAC 1MDKA 1BX9A 1FVJA 2P5RA 1EV4A 1XWCA 4K9ZA 4MJAA 3F6FA 4Q5QA 4XIHA 1O7UA 3FW2A 4K8MA 5J41A 3WYWA 3DD3A 1NW2A 4ZBDA 1QMVA 4MPFA 4JRRA 5J3RA 3LXTA 4KX4A 1FHEA 1T8EB 3NZNA 4HUAA 3WGEA 2PUKC 3TDGA 3FZ5A 3VURA 5F06A 4XS4B 2IL3A 4P3YB 4OCEA 5IM9A 2I4AA 2MMOA 2GZZA 1HD2A 3ZYWA 1I5GA 2IIYA 4XRAA 4OFTA 1PRXA 1HNBA 1T7PB 1JHBA 2ES7A 3O76A 2ON5A 3UBKA 1Y6EA 3ME7A 2CQ9A 2LJKA 1CQHA 3NIVA 4GQFA 1TI3A 2IPAA 2B3SA 4X0XA 3TRPA 1K0OA 1GTIA 4FYCA 2YZUA 2YP6A 5HR0A 1X5CA 3CTGA 1YQ1A 1WPIA 4OD7A 2A4VA 2MMNA 1TRWA 1XXUA 1K0CA 1OC8A 3HVVA 2C3QA 6GSYA 4TR1B 3F6DA 1U87A 2L4QA 1R4WA 2LQQA 2PERA 2V2GA 2DSAA 2R37A 5D8IA 2TIRA 2PPTA 5E4WA 2B5YA 1FB0A 1GRXA 4N11A 1XPVA 4GF0A 5LCZA 2B1LA 1F37A 1K0BA 4HI7A 1M2AA 1AXDA 2C0FA 3BBYA 3GKKA 4RUVA 5F07A 4ZBBA 5CAXA 3ZREA 2VL2A 2J9HA 2VD0A 2C3NA 5AISA 1F9MA 3CSJA 3FY7A 2H30A 4IW9A 1TI1A 4LA1A 1RQMA 2FNOA 4ZILA 2K9FA 4TW5A 5EPFA 4GLTA 2JADA 3L0HA 3LORA 1AQXA 1AQVA 2DJJA 2WS2A 5CP1A 3US3A 5IMVA 3IDVA 1GTUA 3RPNA 2GZYA 3VFIA 4HOJA 4TN8A 1VF2A 2N5AA 4WBJA 3M0FA 2VL2C 1HYUA 22GSA 5G5EA 3WD6A 4JR4A 4HJMA 1SD9A 3EU4A 1S3AA 3EURA 3HJOA 3O3TA 1GSSA 3G7JA 4IJIA 3HJPA 4NV5A 5DAKA 2QC7A 3VI5A 1FB6A 4KSOA 2JZTA 4JU5A 4IP1A 2Z9SA 2JSZA 1YEPA 3DMLA 4POLA 4L0WA 2YJHA 4OO5A 4BWQA 1JZOA 1M7TA 3TCOA 3VWUA 1OC9B 4F03A 3BOAA 4K6XA 4OFMA 2YCDA 1EOHA 2LRCA 4KB3A 4MF5A 1G7EA 3F0IA 1ST9A 2H73A 4K0NA 4IQ1A 2RUFA 4IBPA 2EC4A 4EVMA 5D96A 14GSA 2TRCP 4H86A 5CNWA
chains in the Genus database with same CATH superfamily
3VLNA 4IP6A 3APOA 4DSSB 2HRAA 2LV3A 3P2AA 1SL0B 3FHKA 1K3YA 2F9SA 1M2DA 2OE0A 4I8BA 4IS0A 1GSDA 4O92A 2L5LA 5D9XA 5GSTA 2ON7A 3H4KA 3IAS2 2NBSA 5E59A 5F0GA 3LWAA 5HFGA 2H01A 1DSBA 4GXZA 4PXOA 1JZDA 2ALBA 3A3TA 1TTZA 2DKHA 2MBTA 1F3AA 1PN9A 4Q5FA 2VAFA 3IBHA 5H5SA 4HS1A 1XBSA 1TRUA 5ECSA 3H93A 1B9YC 2FA4A 2YWIA 3A5WA 2L4CA 5JWQB 3U5RE 5AN1A 3GKMA 4O5UA 1PX7A 2L57A 3GKXA 5JWOB 4E8HA 1ZOFA 2RIIA 3C71A 3RHCA 1YF1A 1K0DA 3KP9A 2CVDA 2LS5A 5GSSA 4LL1B 2JU5A 4I2UA 2L6DA 4TR3A 1K0NA 2VCXA 3C73A 3LQ7A 2VLUA 4WF5A 1B9XC 2CZ3A 4K0GA 5ELAA 2CAQA 3L4NA 4MJCA 1GUKA 2IFQA 2I81A 1SU9A 2R0PA 3ISOA 1T4ZA 1A2MA 1OC3A 5G1KA 1ERUA 5G2ZA 3C1RA 5L71A 5A4VA 4TKYA 1QQ2A 4XCSA 4OMVA 1SKWB 3HXSA 3GTUA 1E6BA 1SD8A 5ECOB 3GRXA 1SL1B 3BCKA 3ZITA 2GSSA 2H76A 3KGKA 5IMZA 3F63A 3HCZA 4EIQA 1AIUA 5CYYA 4HQZA 4MZBA 4DSRA 3L78A 4ML1A 4E8EA 1A24A 5HFKA 4XHMA 2HXKA 4MZWA 2LJRA 1T00A 3IHQA 1KNGA 1X9SB 1AW9A 4CY8A 4IJ3A 1FO5A 1QFNA 2LNTA 2HFDA 1WMJA 3IV4A 3PINA 1SJ6A 2GVPA 3APSA 5ECRB 1PKWA 2HZEB 1JZRA 4G2EA 2OADA 4PX1A 2L5OA 19GSA 3TRQA 1O85A 5EVOA 4EUYA 3HY2A 1ERVA 4CDOA 2EIOA 2NDOA 1E2YA 2LKUA 2V41A 1URMA 1MD3A 1EOGA 2B6MA 2VO4A 5G30A 2AUVA 4NAXA 3EINA 2P0GA 2GSQA 5A4UA 2VIMA 1JLVA 4CHSA 2DMLA 10GSA 1LBKA 4FQUA 2DJ2A 5CRDA 1QK8A 2IMIA 2OE3A 2CA8A 3S9FA 1PN0A 1GTBA 1GP1A 1EZKA 2C0GA 3FEUA 4WR4A 4PGTA 4V2NA 4TRXA 1J9BA 1VF4A 5ID2A 1FG4A 2X8HA 1TDIA 3TJGA 1X0RA 2YWOA 2IWTA 1WP0A 1DUGA 3TOTA 5ECNB 4JEDA 4IHUA 3QAGA 3QAVA 4I5QA 1QUWA 3TJFA 3D4TA 5IMDA 2H6XA 2C3TA 1YY7A 3GL3A 1ZYEA 3G7IA 5ECHB 1F6MC 1S3CA 3EE2A 1AC1A 3D4MA 1K3OA 3FR3A 3JCML 3GX0A 2WGRA 1PQNA 3G9BA 2H66A 3CRUA 20GSA 5ECPB 3Q6OA 1Z6MA 2O8VB 2BTOT 1C72A 2XPDA 3CQFA 3FZ9A 2YWNA 2C1YA 4TXOB 2VM2A 2X49A 1XWBA 3EMXA 3WGDA 1EWXA 1HNCA 3LW9A 5COHA 4NPBA 2DIZA 3HD5A 5J4UA 2YJ7A 2QSIA 1XFLA 1ZYQB 2VCQA 3E0UA 4MDCA 3QMXA 5JCUA 3D6IA 4L5OA 1MD4A 1X9MB 2DLXA 1U3IA 2HT9A 4RI7A 2AAWA 5ABRA 3GIXA 1EGRA 2F51A 4BL7B 2H1BA 1OKDA 3D0ZA 2CAIA 3TKSC 1EV9A 3P7XA 2BMXA 2HLSA 1YZXA 4MZCA 3K8NA 4BVYB 4MJBA 3DXBA 11GSA 1TU8A 1R5AA 2VUPA 6GSWA 1O73A 2IMEA 1TJDA 1U3AA 3IC4A 3DGQA 2QA1A 3A2VA 3RHBA 5DBQA 3P90A 2LRNA 1ON4A 2LTKA 4BVXB 3I6AA 4KDUA 3PPUA 2I1UA 2IFQB 1XWAA 13GSA 4GTUA 2NPBA 4ZB6A 2XBIA 1PA3A 3C7MA 1ACVA 3LXZA 4K2XA 3OR5A 3RAZA 6GSVA 2GQMA 1EEJA 4EDYA 3ZFLA 2H74A 4CY6A 3LFLA 2H1DA 3QR6A 3CXGA 3GTUB 2GTUA 2IMFA 4OFNA 3I9V2 3FR6A 1TK0B 4IN0A 4I97A 1SK2A 2MMAA 2WJUA 1Q4JA 2PWJA 2KP1A 1F3BA 1JFUA 1S3RA 2FWGA 3ZLPA 3FKFA 2X8GA 4KDYA 1XW6A 4KW6A 2DC5A 3RPPA 3L9UA 2JZRA 5AIXA 2H0IA 4JBBA 1JZWA 4XS6A 1XVWA 4YAVA 4IGJA 1TRSA 3HJMA 1M3IA 4K2DA 4Z7XA 5ECLB 3IXRA 1T1VA 2VCZA 4O5QA 1YKCA 3VWWA 1ZYNA 3KTLA 1GULA 2P31A 3KTBA 2L59A 1MTCA 4HQSA 3EC3A 3M9KA 5IOXA 3UARA 16GSA 2A2PA 4ACSA 3KJYA 3VWVA 1SYXA 1UN2A 4ISDA 1O8XA 2HRKA 5HR1A 1WE0A 4QL9A 3F3QA 1O6JA 1SKSB 4G9HA 5H5RA 2B1KA 3SBCA 5GAND 1XZOA 1ZYPA 5HR2A 5C04A 1PGTA 3GSSA 2DJ1A 2CV4A 3H8QA 3Q19A 3R3EA 5FT3A 1ABAA 1J08A 2YWMA 5ID2B 1XOBA 5D9TA 1YKAA 3GHAA 2EIRA 1T3BA 4QL7A 4XS1A 4DSQA 1Z5YE 2FUG2 2G2QA 4D73B 1QXHA 5D9WA 4JZQA 4EC0A 1B8XA 3WGXA 3LYPA 2O87A 2XHFA 4NV2A 2OJLA 4ZXGA 1R26A 2HNLA 3ZTLA 5DJLA 3GX8A 3GH9A 3ZVJD 9GSSA 5IPGA 4AGSA 2HSHA 1I9DA 1XOAA 2YOIA 2O89A 5DCGA 2ZUPA 3MSZA 2FWEA 3IRAA 5CRGA 3ZVJA 2MMZA 3QDNA 4ZL7A 3TRXA 3UBLA 4ZL9A 4NMUA 4EDZA 1T4YA 4OO4A 2IJYA 5KN2A 4J57E 4F9ZA 3QAWA 2VCWA 1UA5A 1GNWA 2X99A 1A0RP 3MAKA 2K6VA 1X5EA 5LD0A 6GSSA 3MNGA 1V58A 2WDUA 3DWVA 3E9JB 1BYEA 2CZ2A 4KDXA 1R7HA 3UEMA 6GSXA 4CW9A 4HJ2A 3IPZA 3IK7A 3TJKA 2K8SA 3M3MA 2DJ0A 1ZCPA 2IMKA 1SK1A 2E7PA 1GUHA 2HSYA 4BIKA 4FYUA 2H1AA 1USBA 4ID0A 4LL4B 3C1SA 2WULA 5GZZB 1BAYA 3U6VA 4DVCA 2I9HA 1M2BA 2GSRA 4KCAA 2PVOC 3ERWA 1X5DA 4KCEA 2YV9A 4WETA 2FHEA 2LSTA 2G0FA 4GRFA 4O5RA 4XS4A 4BA7A 4KA0A 1G6YA 4Q5RA 3FK8A 3KMOA 5IPHA 2H71A 3LJRA 4HZ2A 4MCUA 2NVLA 1B4QA 1KTEA 2GSTA 2XPEA 3ERGA 4PNGA 1BEDA 2R3XA 3M9JA 3ZFBA 4L8EA 4FH8A 5IMFA 1VF1A 1FW1A 1U88A 3CRTA 3I43A 2J23A 2B5XA 5C00A 1PL1A 1THOA 3V1WA 1M9BA 2KP2A 2JSYA 3BJ5A 5DVBA 2DJ3A 2F8FA 1LU4A 2C8UA 2WB9A 2D2ZA 2VCTA 2OA7A 1XWGA 3GA4A 3EWLA 4TR1A 1OVNA 2CVBA 2FD3A 2FWHA 2OKAA 3IC8A 3VK9A 3H79A 3IOSA 3EYTA 4AJ7A 4FYBA 3F9UA 1ERWA 3GURA 3F4RA 5D73A 2OE1A 1CQGA 4GQCA 4HDEA 2OACA 1JLWA 2AV4A 5CO3A 5J9BA 5A4WA 2GS3A 2PU9C 2B5EA 5IO0A 4PURA 4IKHA 2NTOA 5B8BA 3HYPA 1GSFA 2CT6A 2C0DA 3GFKA 2VM1A 3APQA 3DVXA 1NHYA 4F2IA 3HVNA 4F0BA 2RM6A 1WOUA 2HYXA 1EP8A 3GYKA 2GT5A 3N5OA 2XC2A 3LSZA 5J5NA 3A2WA 4N0VA 2FLSA 4MNNA 4WBRD 2OBIA 5IMCA 3GUSA 4V1Ag 1DBYA 4TOPA 1BJXA 2M72A 1ZZYA 2TRXA 2REMA 5DAKB 3UL3A 3IA1A 1SK0A 5AIVA 1MDIA 4G10A 3TB2A 3TKQA 2JZSA 3ZMKA 4ZB9A 1W4VA 3D22A 4J2FA 3P8WA 2M80A 1OYJA 2PVQA 3KEBA 2RLIA 4HZ4A 6GSUA 1O8WA 2YZHA 4YAPA 4IQAA 3ZIVA 4N0ZA 1AQWA 1XWKA 2DJKA 5DQSA 5IQYA 4RQRA 5CREA 3GH6A 3MDKA 1XW5A 4GSTA 3KP8A 2C80A 2ZNMA 4EF0A 3UOMA 4KF9A 5DDLA 5CRHA 1H4OA 4RI6A 4WR5A 4K7NA 1OC9A 3KZQA 3TKSA 1WRYA 1ML6A 2H8LA 3UAPA 1YEXA 2AB6A 5HR3A 4YH2A 2GLRA 5B7CA 3VPQA 1M9AA 1BG5A 3ZL5A 1Z3EA 3TUEA 1YF0A 1TP9A 3BCIA 5ECKB 4XTSA 2FGXA 3AY8A 3GKNA 2O7KA 4DSSA 4NXIA 3DEXA 1Z9HA 5A5KA 5ECQB 3TJJA 5IOWA 2LRTA 4XRDA 3FZAA 3IAM2 1FOHA 1B4PA 3TOUA 5B6MA 5FHIA 3E3EA 5JCWA 3UIWA 5KOWA 1HQOA 3SWLA 4Z2TA 3Q18A 2V1MA 4ZIJA 4OCFA 3EU3A 4LMWA 3QD9A 2ZCTA 4I6XA 4PNFA 4POMA 1MEKA 1Y25A 1OAZA 1M3JA 2V6KA 4ZB8A 4WEYA 4AF2A 3WT1A 4EE0A 4BWSA 3NOFA 4TVEA 2WZ9A 2FCHA 3QOUA 3J7Yb 5HQPA 2N5FA 1GSEA 1X9WB 4GSSA 1OKTA 4ECCA 3QFBC 4ZBAA 3A2XA 3GMFA 1XCCA 4MH2A 2F8AA 3ME8A 3F4SA 4LLRA 3A5IA 4FIWA 2HZFA 2YNXA 2L6CA 3GL5A 2R4VA 1G6WA 1THXA 2H75A 3KCMA 4ILFA 3VWXA 3ED3A 3R2QA 4X1UA 2R6KA 1Z7RA 5KN0A 3HZ4A 3G7YA 2DIYA 2GT6A 3UVHA 1SJZA 3CBUA 1XIYA 2X8CA 2V32A 2H1GA 2C4JA 5KN1A 5AGYA 2F3MA 3ZZXA 1A2JA 4MP4A 2C0EA 5INYA 1V98A 3F4TA 2KHPA 4F82A 3M8NA 4J56E 4F0CA 3M1GA 2VLVA 1B48A 2VL9A 3IK9A 4MJEA 4PTSA 3BD2A 4BPYA 4AJ8A 2WCIA 4PQIA 5BRTA 4G0LA 4K7OA 1J0FA 3D5JA 5DALA 1WJKA 3W8JA 2FA8A 3LYKA 2HZEA 2HI7A 1A23A 1VRSD 3EVIA 2LQOA 2WFCA 4JR6A 1SYRA 2AJQB 1S3DA 1NHOA 4G0KA 4KE3A 1GH2A 4KSMA 4AJ6A 3CSIA 2RM5A 4EKZA 2VL3A 8GSSA 2P5QA 1PL2A 1M0UA 2E2MA 3DKSA 5ECMB 1W89A 3KH7A 7GSSA 3VI7A 4TR0A 2R0GA 4Q5NA 1PSQA 1G7OA 1K3LA 4V2LA 1PKZA 1TK5B 4KNDA 4USSA 2YV7A 4N10A 2A2SA 5G31A 4KH7A 4POKA 3IR4A 4WKWA 4QQ7A 5DCHA 2K18A 2B7JA 2PMTA 3LG6A 3UVTA 1A0FA 2VLTA 1SKRB 1U6TA 6GSTA 2MZCA 2BJXA 4TXVA 4WXTA 3KXOA 2MBSA 2R2JA 3W8SA 3ZRDA 1GL8A 2VOCA 3KD0A 4X43A 3GNJA 4PQHA 2H6ZA 5DJMA 1F2EA 3Q74A 5IMAA 2I3YA 3KIJA 5GAPD 2RUEA 1GSQA 1RW1A 3CMIA 3HKRA 1DE1A 4IELA 2YPMA 3LEFA 3DYRA 5JCGA 3PGTA 2PGTA 3KMNA 1TRVA 2XBQA 3TGZA 1Z7PA 2H6YA 2H19A 1PX6A 3CSHA 3W6GA 4G19A 4ECIA 3CTFA 1G0TA 2HE3A 5EY6A 1BQ7A 4WF4A 3EMPA 3GN3A 18GSA 5ECIB 1OE7A 1NM3A 2QGVA 3VPTA 3KM6A 4MH3A 1MDJA 12GSA 1PMTA 4TXOA 1A8YA 4NWYA 3FZ4A 3TKPA 3RBTA 2H0HA 5FWGA 2H0GA 2GQLA 1XG8A 1RK4A 3F8UA 4HU7A 3TKRA 1ERTA 2PBJA 3L9SA 4L0UA 2A2RA 1TW9A 2OBKA 1SL2B 1EGOA 1WIKA 2GZPA 2X64A 4BL7A 4MK3A 2AYTA 4HEA2 1PD21 2GDRA 1OE8A 2R5GA 3KH9A 4NHZA 3I69A 2DBCA 2WRTA 2VD1A 4GCIA 2UZ8A 3HZ8A 5CRWA 4BVYA 2KLXA 1TXXA 3FR9A 3GSTA 1K0AA 1O81A 3J7Yk 2E0QA 4PQ1A 4PUFC 4K7IA 2V6OA 4ZL8A 1GLQA 1IYIA 4RQXA 2N5BA 3WT2A 1EP7A 1SJIA 3UJ1A 4EXJA 1QGVA 1YJ6A 2KOKA 2E2GA 2YANA 5EL8A 3HDCA 3UMAA 4I2TA 2GQKA 5JWRB 2JACA 4BVXA 4DEJA 3DRNA 1N8JA 3RDWA 1TKDB 1TOFA 1ILOA 5KEJA 4MABA 4HU9A 4EO3A 4KAEA 2HRNA 3CYNA 1A2LA 2DKIA 4FO5A 2LNSA 2LEGA 4YQVA 17GSA 1GSYA 1AUCA 2IMDA 2B7KA 4OWYA 3DVWA 4V1Ap 2CVKA 1GSUA 4ECJA 5G5FA 3HVXA 1R5PA 2EIQA 3PH9A 1SENA 1XW9A 3EPTA 5IO2A 5LNKe 1GWCA 2YN1A 1GLPA 3IHGA 2K8VA 1VGLA 1H75A 5J9CA 2MYGA 2CX3A 4POBA 1NSWA 3TKSE 2IN3A 5DALB 1ZGNA 1EEMA 2H70A 4N30A 4YQUA 3HA9A 1YDKA 4KGIA 4TR4A 5HFIA 5DQYA 5F8BA 2DMMA 3ZMLA 1GNEA 1Z6NA 5H5QA 4EL1A 3PR8A 4MF6A 1N2AA 4IVFA 1GTAA 5B8AA 2JL4A 5KN3A 1TK8B 4EIPA 3N9JA 2FWFA 1V40A 2PN8A 1V57A 3QPMA 3H1NA 3GV1A 1FOVA 1V2AA 4KUNA 1WWJA 1V9WA 2GGTA 2R0CA 4ULXA 3LGCA 1ZL9A 3ZIJA 4V2MA 2M46A 4JE1A 4YQMA 1HNAA 2VCVA 4PUAA 4O7HA 3TJBA 4K1FA 3IE3A 4L5LA 1ZMAA 4MMMA 5ENUA 1KEBA 1FAAA 2AHEA 3QCPA 2A4HA 4GWRA 2HSMA 3FRCA 1VF3A 2CX4A 2LJAA 2H72A 2O85A 3HHVA 1UC7A 5B6NA 5D9VA 3DIEA 5IIZA 3MWHA 1FVKA 4MF7A 3ERFA 2FY6A 1TU7A 2QA2A 4D73A 1UVZA 1DE2A 1K0MA 1XVQA 3F3RA 4NHWA 3L9VA 5ELGA 1A8LA 1Q98A 5D93A 3D21A 3HVSA 3C8EA 4GSNA 1AAZA 3FYGA 4MLYA 3O6TA 2HRFA 1LJRA 1KBNA 4ML6A 5G1LA 2QKEA 4MPGA 4Z2UA 5F05A 1IYHA 1GUMA 1M99A 4LMVA 4MA9A 2KUCA 4ECBA 4O32A 2LUSA 3QFAC 1MDKA 1BX9A 1FVJA 2P5RA 1EV4A 1XWCA 4K9ZA 4MJAA 3F6FA 4Q5QA 4XIHA 1O7UA 3FW2A 2X4AA 4K8MA 5J41A 3WYWA 3DD3A 1NW2A 4ZBDA 1QMVA 4MPFA 4JRRA 5J3RA 3LXTA 4KX4A 1FHEA 1T8EB 3MIXA 3NZNA 4HUAA 3WGEA 2PUKC 3TDGA 3FZ5A 3VURA 5F06A 4ICYA 4XS4B 2IL3A 4P3YB 4OCEA 5IM9A 2I4AA 2MMOA 2GZZA 1HD2A 3ZYWA 1I5GA 2IIYA 4XRAA 4OFTA 1PRXA 1HNBA 1T7PB 1JHBA 2ES7A 3O76A 2ON5A 3UBKA 1Y6EA 3ME7A 2CQ9A 2LJKA 1CQHA 3NIVA 4GQFA 1TI3A 2IPAA 2B3SA 4X0XA 3TRPA 1K0OA 1GTIA 4FYCA 2YZUA 2YP6A 5HR0A 1X5CA 3CTGA 1YQ1A 1WPIA 4OD7A 2A4VA 2MMNA 1TRWA 1XXUA 1K0CA 1OC8A 3HVVA 2C3QA 6GSYA 4TR1B 3F6DA 1U87A 2L4QA 4G0IA 1R4WA 2LQQA 1PFOA 2PERA 2V2GA 2DSAA 2R37A 5D8IA 2TIRA 2PPTA 5E4WA 2B5YA 1FB0A 1GRXA 4N11A 1XPVA 4GF0A 5LCZA 2B1LA 1F37A 1K0BA 4HI7A 1M2AA 1AXDA 2C0FA 3BBYA 3GKKA 4RUVA 5F07A 4ZBBA 4YKGA 5CAXA 3ZREA 2VL2A 2J9HA 2VD0A 5KOXA 4YKFA 2C3NA 5AISA 1F9MA 3CSJA 3FY7A 4Z2RA 3MYDA 2H30A 4IW9A 1TI1A 4LA1A 1RQMA 2FNOA 4ZILA 2K9FA 4TW5A 5EPFA 4GLTA 2JADA 3L0HA 3LORA 1AQXA 1AQVA 2DJJA 2WS2A 5CP1A 3US3A 5IMVA 3IDVA 1GTUA 3RPNA 2GZYA 3VFIA 4HOJA 4TN8A 1VF2A 2N5AA 4WBJA 3M0FA 2VL2C 1HYUA 22GSA 5G5EA 3WD6A 4JR4A 4HJMA 1SD9A 3EU4A 1S3AA 3EURA 3HJOA 3O3TA 1GSSA 3G7JA 4IJIA 3HJPA 4NV5A 5DAKA 2QC7A 3VI5A 1FB6A 4KSOA 2JZTA 4X4JA 4JU5A 4IP1A 2Z9SA 2JSZA 1YEPA 3DMLA 4K5SA 4POLA 4L0WA 2YJHA 4OO5A 4BWQA 1JZOA 1M7TA 3TCOA 3VWUA 1OC9B 4F03A 3BOAA 4K6XA 4OFMA 5BMUA 2YCDA 1EOHA 2LRCA 4KB3A 4MF5A 1G7EA 3F0IA 1ST9A 2H73A 4HSCX 4K0NA 4IQ1A 2RUFA 4IBPA 3FMWA 2EC4A 4EVMA 5D96A 14GSA 2TRCP 4H86A 5CNWA 4A5PA 4K5RA
chains in the Genus database with same CATH topology
3VLNA 4IP6A 3APOA 4DSSB 2HRAA 2LV3A 3P2AA 1SL0B 3FHKA 1K3YA 2F9SA 1M2DA 2OE0A 4I8BA 4IS0A 1GSDA 4O92A 2L5LA 5D9XA 5GSTA 2ON7A 3H4KA 3IAS2 2NBSA 5E59A 5F0GA 3LWAA 5HFGA 2H01A 1DSBA 4GXZA 4PXOA 1JZDA 2ALBA 3A3TA 1TTZA 2DKHA 2MBTA 1F3AA 1PN9A 4Q5FA 2VAFA 3IBHA 5H5SA 4HS1A 1XBSA 1TRUA 5ECSA 3H93A 1B9YC 2FA4A 2YWIA 3A5WA 2L4CA 5JWQB 3U5RE 5AN1A 3GKMA 4O5UA 1PX7A 2L57A 3GKXA 5JWOB 4E8HA 1ZOFA 2RIIA 3C71A 3RHCA 1YF1A 1K0DA 3KP9A 2CVDA 2LS5A 5GSSA 4LL1B 2JU5A 4I2UA 2L6DA 4TR3A 1K0NA 2VCXA 3C73A 3LQ7A 2VLUA 4WF5A 1B9XC 2CZ3A 4K0GA 5ELAA 2CAQA 3L4NA 4MJCA 1GUKA 2IFQA 2I81A 1SU9A 2R0PA 3ISOA 1T4ZA 1A2MA 1OC3A 5G1KA 1ERUA 5G2ZA 3C1RA 5L71A 5A4VA 4TKYA 1QQ2A 4XCSA 4OMVA 1SKWB 3HXSA 3GTUA 1E6BA 1SD8A 5ECOB 3GRXA 1SL1B 3BCKA 3ZITA 2GSSA 2H76A 3KGKA 5IMZA 3F63A 3HCZA 4EIQA 1AIUA 5CYYA 4HQZA 4MZBA 4DSRA 3L78A 4ML1A 4E8EA 1A24A 5HFKA 4XHMA 2HXKA 4MZWA 2LJRA 1T00A 3IHQA 1KNGA 1X9SB 1AW9A 4CY8A 4IJ3A 1FO5A 1QFNA 2LNTA 2HFDA 1WMJA 3IV4A 3PINA 1SJ6A 2GVPA 3APSA 5ECRB 1PKWA 2HZEB 1JZRA 4G2EA 2OADA 4PX1A 2L5OA 19GSA 3TRQA 1O85A 5EVOA 4EUYA 3HY2A 1ERVA 4CDOA 2EIOA 2NDOA 1E2YA 2LKUA 2V41A 1URMA 1MD3A 1EOGA 2B6MA 2VO4A 5G30A 2AUVA 4NAXA 3EINA 2P0GA 2GSQA 5A4UA 2VIMA 1JLVA 4CHSA 2DMLA 10GSA 1LBKA 4FQUA 2DJ2A 5CRDA 1QK8A 2IMIA 2OE3A 2CA8A 3S9FA 1PN0A 1GTBA 1GP1A 1EZKA 2C0GA 3FEUA 4WR4A 4PGTA 4V2NA 4TRXA 1J9BA 1VF4A 5ID2A 1FG4A 2X8HA 1TDIA 3TJGA 1X0RA 2YWOA 2IWTA 1WP0A 1DUGA 3TOTA 5ECNB 4JEDA 4IHUA 3QAGA 3QAVA 4I5QA 1QUWA 3TJFA 3D4TA 5IMDA 2H6XA 2C3TA 1YY7A 3GL3A 1ZYEA 3G7IA 5ECHB 1F6MC 1S3CA 3EE2A 1AC1A 3D4MA 1K3OA 3FR3A 3JCML 3GX0A 2WGRA 1PQNA 3G9BA 2H66A 3CRUA 20GSA 5ECPB 3Q6OA 1Z6MA 2O8VB 2BTOT 1C72A 2XPDA 3FZ9A 2YWNA 2C1YA 4TXOB 2VM2A 2X49A 1XWBA 3EMXA 3WGDA 1EWXA 1HNCA 3LW9A 5COHA 4NPBA 2DIZA 3HD5A 5J4UA 2YJ7A 2QSIA 1XFLA 1ZYQB 2VCQA 3E0UA 4MDCA 3QMXA 5JCUA 3D6IA 4L5OA 1MD4A 1X9MB 2DLXA 1U3IA 2HT9A 4RI7A 2AAWA 5ABRA 3GIXA 1EGRA 2F51A 4BL7B 2H1BA 1OKDA 3D0ZA 2CAIA 3TKSC 1EV9A 3P7XA 2BMXA 2HLSA 1YZXA 4MZCA 3K8NA 4BVYB 4MJBA 3DXBA 11GSA 1TU8A 1R5AA 2VUPA 6GSWA 1O73A 2IMEA 1TJDA 1U3AA 3IC4A 3DGQA 2QA1A 3A2VA 3RHBA 5DBQA 3P90A 2LRNA 1ON4A 2LTKA 4BVXB 3I6AA 4KDUA 3PPUA 2I1UA 2IFQB 1XWAA 13GSA 4GTUA 2NPBA 4ZB6A 2XBIA 1PA3A 3C7MA 1ACVA 3LXZA 4K2XA 3OR5A 3RAZA 6GSVA 2GQMA 1EEJA 4EDYA 3ZFLA 2H74A 4CY6A 3LFLA 2H1DA 3QR6A 3CXGA 3GTUB 2GTUA 2IMFA 4OFNA 3I9V2 3FR6A 1TK0B 4IN0A 4I97A 1SK2A 2MMAA 2WJUA 1Q4JA 2PWJA 2KP1A 1F3BA 1JFUA 2FWGA 3ZLPA 3FKFA 2X8GA 4KDYA 1XW6A 4KW6A 2DC5A 3RPPA 3L9UA 2JZRA 5AIXA 2H0IA 4JBBA 1JZWA 4XS6A 1XVWA 4YAVA 4IGJA 1TRSA 3HJMA 4K2DA 4Z7XA 5ECLB 3IXRA 1T1VA 2VCZA 4O5QA 1YKCA 3VWWA 1ZYNA 3KTLA 1GULA 2P31A 3KTBA 2L59A 1MTCA 4HQSA 3EC3A 3M9KA 5IOXA 3UARA 16GSA 2A2PA 4ACSA 3KJYA 3VWVA 1SYXA 1UN2A 4ISDA 1O8XA 2HRKA 5HR1A 1WE0A 4QL9A 3F3QA 1O6JA 1SKSB 4G9HA 5H5RA 2B1KA 3SBCA 5GAND 1XZOA 1ZYPA 5HR2A 5C04A 1PGTA 3GSSA 2DJ1A 2CV4A 3H8QA 3Q19A 3R3EA 5FT3A 1ABAA 1J08A 2YWMA 5ID2B 1XOBA 5D9TA 1YKAA 3GHAA 2EIRA 1T3BA 4QL7A 4XS1A 4DSQA 1Z5YE 2FUG2 2G2QA 4D73B 1QXHA 5D9WA 4JZQA 4EC0A 1B8XA 3WGXA 3LYPA 2O87A 2XHFA 4NV2A 2OJLA 4ZXGA 1R26A 2HNLA 3ZTLA 5DJLA 3GX8A 3GH9A 3ZVJD 9GSSA 5IPGA 4AGSA 2HSHA 1I9DA 1XOAA 2YOIA 2O89A 5DCGA 2ZUPA 3MSZA 2FWEA 3IRAA 5CRGA 3ZVJA 2MMZA 3QDNA 4ZL7A 3TRXA 3UBLA 4ZL9A 4NMUA 4EDZA 1T4YA 4OO4A 2IJYA 5KN2A 4J57E 4F9ZA 3QAWA 2VCWA 1UA5A 1GNWA 2X99A 1A0RP 3MAKA 2K6VA 1X5EA 5LD0A 6GSSA 3MNGA 1V58A 2WDUA 3DWVA 3E9JB 1BYEA 2CZ2A 4KDXA 1R7HA 3UEMA 6GSXA 4CW9A 4HJ2A 3IPZA 3IK7A 3TJKA 2K8SA 3M3MA 2DJ0A 1ZCPA 2IMKA 1SK1A 2E7PA 1GUHA 2HSYA 4FYUA 2H1AA 1USBA 4ID0A 4LL4B 3C1SA 2WULA 5GZZB 1BAYA 3U6VA 4DVCA 2I9HA 1M2BA 2GSRA 4KCAA 2PVOC 3ERWA 1X5DA 4KCEA 2YV9A 4WETA 2FHEA 2LSTA 2G0FA 4GRFA 4O5RA 4XS4A 4BA7A 4KA0A 1G6YA 4Q5RA 3FK8A 3KMOA 5IPHA 2H71A 3LJRA 4HZ2A 4MCUA 2NVLA 1B4QA 1KTEA 2GSTA 2XPEA 3ERGA 4PNGA 1BEDA 2R3XA 3M9JA 3ZFBA 4L8EA 4FH8A 5IMFA 1VF1A 1FW1A 1U88A 3CRTA 3I43A 2J23A 2B5XA 5C00A 1PL1A 1THOA 3V1WA 1M9BA 2KP2A 2JSYA 3BJ5A 5DVBA 2DJ3A 2F8FA 1LU4A 2C8UA 2WB9A 2D2ZA 2VCTA 2OA7A 1XWGA 3GA4A 3EWLA 4TR1A 1OVNA 2CVBA 2FD3A 2FWHA 2OKAA 3IC8A 3VK9A 3H79A 3IOSA 3EYTA 4AJ7A 4FYBA 3F9UA 1ERWA 3GURA 3F4RA 5D73A 2OE1A 1CQGA 4GQCA 4HDEA 2OACA 1JLWA 2AV4A 5CO3A 5J9BA 5A4WA 2GS3A 2PU9C 2B5EA 5IO0A 4PURA 4IKHA 2NTOA 5B8BA 3HYPA 1GSFA 2CT6A 2C0DA 3GFKA 2VM1A 3APQA 3DVXA 1NHYA 4F2IA 4F0BA 2RM6A 1WOUA 2HYXA 1EP8A 3GYKA 2GT5A 3N5OA 2XC2A 3LSZA 5J5NA 3A2WA 4N0VA 2FLSA 4MNNA 4WBRD 2OBIA 5IMCA 3GUSA 4V1Ag 1DBYA 4TOPA 1BJXA 2M72A 1ZZYA 2TRXA 2REMA 5DAKB 3UL3A 3IA1A 1SK0A 5AIVA 1MDIA 4G10A 3TB2A 3TKQA 2JZSA 3ZMKA 4ZB9A 1W4VA 3D22A 4J2FA 3P8WA 2M80A 1OYJA 2PVQA 3KEBA 2RLIA 4HZ4A 6GSUA 1O8WA 2YZHA 4YAPA 4IQAA 3ZIVA 4N0ZA 1AQWA 1XWKA 2DJKA 5DQSA 5IQYA 4RQRA 5CREA 3GH6A 3MDKA 1XW5A 4GSTA 3KP8A 2C80A 2ZNMA 4EF0A 3UOMA 4KF9A 5DDLA 5CRHA 1H4OA 4RI6A 4WR5A 4K7NA 1OC9A 3KZQA 3TKSA 1WRYA 1ML6A 2H8LA 3UAPA 1YEXA 2AB6A 5HR3A 4YH2A 2GLRA 5B7CA 3VPQA 1M9AA 1BG5A 3ZL5A 1Z3EA 3TUEA 1YF0A 1TP9A 3BCIA 5ECKB 4XTSA 2FGXA 3AY8A 3GKNA 2O7KA 4DSSA 4NXIA 3DEXA 1Z9HA 5A5KA 5ECQB 3TJJA 5IOWA 2LRTA 4XRDA 3FZAA 3IAM2 1FOHA 1B4PA 3TOUA 5B6MA 5FHIA 3E3EA 5JCWA 3UIWA 5KOWA 1HQOA 3SWLA 4Z2TA 3Q18A 2V1MA 4ZIJA 4OCFA 3EU3A 4LMWA 3QD9A 2ZCTA 4I6XA 4PNFA 4POMA 1MEKA 1Y25A 1OAZA 2V6KA 4ZB8A 4AF2A 4WEYA 3WT1A 4EE0A 4BWSA 3NOFA 4TVEA 2WZ9A 2FCHA 3QOUA 3J7Yb 5HQPA 2N5FA 1GSEA 1X9WB 4GSSA 1OKTA 4ECCA 3QFBC 4ZBAA 3A2XA 3GMFA 1XCCA 4MH2A 2F8AA 3ME8A 3F4SA 4LLRA 3A5IA 4FIWA 2HZFA 2YNXA 2L6CA 3GL5A 2R4VA 1G6WA 1THXA 2H75A 3KCMA 4ILFA 3VWXA 3ED3A 3R2QA 4X1UA 2R6KA 1Z7RA 5KN0A 3HZ4A 3G7YA 2DIYA 2GT6A 3UVHA 1SJZA 3CBUA 1XIYA 2X8CA 2V32A 2H1GA 2C4JA 5KN1A 5AGYA 2F3MA 3ZZXA 1A2JA 4MP4A 2C0EA 5INYA 1V98A 3F4TA 2KHPA 4F82A 3M8NA 4J56E 4F0CA 3M1GA 2VLVA 1B48A 2VL9A 3IK9A 4MJEA 4PTSA 3BD2A 4BPYA 4AJ8A 2WCIA 4PQIA 5BRTA 4G0LA 4K7OA 1J0FA 3D5JA 5DALA 1WJKA 3W8JA 2FA8A 3LYKA 2HZEA 2HI7A 1A23A 1VRSD 3EVIA 2LQOA 2WFCA 4JR6A 1SYRA 2AJQB 1S3DA 1NHOA 4G0KA 4KE3A 1GH2A 4KSMA 4AJ6A 3CSIA 2RM5A 4EKZA 2VL3A 8GSSA 2P5QA 1PL2A 1M0UA 2E2MA 3DKSA 5ECMB 1W89A 3KH7A 7GSSA 3VI7A 4TR0A 2R0GA 4Q5NA 1PSQA 1G7OA 1K3LA 4V2LA 1PKZA 1TK5B 4KNDA 4USSA 2YV7A 4N10A 2A2SA 5G31A 4KH7A 4POKA 3IR4A 4WKWA 4QQ7A 5DCHA 2K18A 2B7JA 2PMTA 3LG6A 3UVTA 1A0FA 2VLTA 1SKRB 1U6TA 6GSTA 2MZCA 2BJXA 4TXVA 4WXTA 3KXOA 2MBSA 2R2JA 3W8SA 3ZRDA 1GL8A 2VOCA 3KD0A 4X43A 3GNJA 4PQHA 2H6ZA 5DJMA 1F2EA 3Q74A 5IMAA 2I3YA 3KIJA 5GAPD 2RUEA 1GSQA 1RW1A 3CMIA 3HKRA 1DE1A 4IELA 2YPMA 3LEFA 3DYRA 5JCGA 3PGTA 2PGTA 3KMNA 1TRVA 2XBQA 3TGZA 1Z7PA 2H6YA 2H19A 1PX6A 3CSHA 3W6GA 4G19A 4ECIA 3CTFA 1G0TA 2HE3A 5EY6A 1BQ7A 4WF4A 3EMPA 3GN3A 18GSA 5ECIB 1OE7A 1NM3A 2QGVA 3VPTA 3KM6A 4MH3A 1MDJA 12GSA 1PMTA 4TXOA 1A8YA 4NWYA 3FZ4A 3TKPA 3RBTA 2H0HA 5FWGA 2H0GA 2GQLA 1RK4A 3F8UA 4HU7A 3TKRA 1ERTA 2PBJA 3L9SA 4L0UA 2A2RA 1TW9A 2OBKA 1SL2B 1EGOA 1WIKA 2GZPA 2X64A 4BL7A 4MK3A 2AYTA 4HEA2 1PD21 2GDRA 1OE8A 2R5GA 3KH9A 4NHZA 3I69A 2DBCA 2WRTA 2VD1A 4GCIA 2UZ8A 3HZ8A 5CRWA 4BVYA 2KLXA 1TXXA 3FR9A 3GSTA 1K0AA 1O81A 3J7Yk 2E0QA 4PQ1A 4PUFC 4K7IA 2V6OA 4ZL8A 1GLQA 1IYIA 4RQXA 2N5BA 3WT2A 1EP7A 1SJIA 3UJ1A 4EXJA 1QGVA 1YJ6A 2KOKA 2E2GA 2YANA 5EL8A 3HDCA 3UMAA 4I2TA 2GQKA 5JWRB 2JACA 4BVXA 4DEJA 3DRNA 1N8JA 3RDWA 1TKDB 1TOFA 1ILOA 5KEJA 4MABA 4HU9A 4EO3A 4KAEA 2HRNA 3CYNA 1A2LA 2DKIA 4FO5A 2LNSA 2LEGA 4YQVA 17GSA 1GSYA 1AUCA 2IMDA 2B7KA 4OWYA 3DVWA 4V1Ap 2CVKA 1GSUA 4ECJA 5G5FA 3HVXA 1R5PA 2EIQA 3PH9A 1SENA 1XW9A 3EPTA 5IO2A 5LNKe 1GWCA 2YN1A 1GLPA 3IHGA 2K8VA 1VGLA 1H75A 5J9CA 2MYGA 2CX3A 4POBA 1NSWA 3TKSE 2IN3A 5DALB 1ZGNA 1EEMA 2H70A 4N30A 4YQUA 3HA9A 1YDKA 4KGIA 4TR4A 5HFIA 5DQYA 5F8BA 2DMMA 3ZMLA 1GNEA 1Z6NA 5H5QA 4EL1A 3PR8A 4MF6A 1N2AA 4IVFA 1GTAA 5B8AA 2JL4A 5KN3A 1TK8B 4EIPA 3N9JA 2FWFA 1V40A 2PN8A 1V57A 3QPMA 3H1NA 3GV1A 1FOVA 1V2AA 4KUNA 1WWJA 1V9WA 2GGTA 2R0CA 4ULXA 3LGCA 1ZL9A 3ZIJA 4V2MA 2M46A 4JE1A 4YQMA 1HNAA 2VCVA 4PUAA 4O7HA 3TJBA 4K1FA 3IE3A 4L5LA 1ZMAA 4MMMA 5ENUA 1KEBA 1FAAA 2AHEA 3QCPA 2A4HA 4GWRA 2HSMA 3FRCA 1VF3A 2CX4A 2LJAA 2H72A 2O85A 3HHVA 1UC7A 5B6NA 5D9VA 3DIEA 5IIZA 3MWHA 1FVKA 4MF7A 3ERFA 2FY6A 1TU7A 2QA2A 4D73A 1UVZA 1DE2A 1K0MA 1XVQA 3F3RA 4NHWA 3L9VA 5ELGA 1A8LA 1Q98A 5D93A 3D21A 3HVSA 3C8EA 4GSNA 1AAZA 3FYGA 4MLYA 3O6TA 2HRFA 1LJRA 1KBNA 4ML6A 5G1LA 2QKEA 4MPGA 4Z2UA 5F05A 1IYHA 1GUMA 1M99A 4LMVA 4MA9A 2KUCA 4ECBA 4O32A 2LUSA 3QFAC 1MDKA 1BX9A 1FVJA 2P5RA 1EV4A 1XWCA 4K9ZA 4MJAA 3F6FA 4Q5QA 4XIHA 1O7UA 3FW2A 2X4AA 4K8MA 5J41A 3WYWA 3DD3A 1NW2A 4ZBDA 1QMVA 4MPFA 4JRRA 5J3RA 3LXTA 4KX4A 1FHEA 1T8EB 3MIXA 3NZNA 4HUAA 3WGEA 2PUKC 3TDGA 3FZ5A 3VURA 5F06A 4ICYA 4XS4B 2IL3A 4P3YB 4OCEA 5IM9A 2I4AA 2MMOA 2GZZA 1HD2A 3ZYWA 1I5GA 2IIYA 4XRAA 4OFTA 1PRXA 1HNBA 1T7PB 1JHBA 2ES7A 3O76A 2ON5A 3UBKA 1Y6EA 3ME7A 2CQ9A 2LJKA 1CQHA 3NIVA 4GQFA 1TI3A 2IPAA 2B3SA 4X0XA 3TRPA 1K0OA 1GTIA 4FYCA 2YZUA 2YP6A 5HR0A 1X5CA 3CTGA 1YQ1A 1WPIA 4OD7A 2A4VA 2MMNA 1TRWA 1XXUA 1K0CA 1OC8A 3HVVA 2C3QA 6GSYA 4TR1B 3F6DA 1U87A 2L4QA 4G0IA 1R4WA 2LQQA 2PERA 2V2GA 2DSAA 2R37A 5D8IA 2TIRA 2PPTA 5E4WA 2B5YA 1FB0A 1GRXA 4N11A 1XPVA 4GF0A 5LCZA 2B1LA 1F37A 1K0BA 4HI7A 1M2AA 1AXDA 2C0FA 3BBYA 3GKKA 4RUVA 5F07A 4ZBBA 4YKGA 5CAXA 3ZREA 2VL2A 2J9HA 2VD0A 5KOXA 4YKFA 2C3NA 5AISA 1F9MA 3CSJA 3FY7A 4Z2RA 3MYDA 2H30A 4IW9A 1TI1A 4LA1A 1RQMA 2FNOA 4ZILA 2K9FA 4TW5A 5EPFA 4GLTA 2JADA 3L0HA 3LORA 1AQXA 1AQVA 2DJJA 2WS2A 5CP1A 3US3A 5IMVA 3IDVA 1GTUA 3RPNA 2GZYA 3VFIA 4HOJA 4TN8A 1VF2A 2N5AA 4WBJA 3M0FA 2VL2C 1HYUA 22GSA 5G5EA 3WD6A 4JR4A 4HJMA 1SD9A 3EU4A 1S3AA 3EURA 3HJOA 3O3TA 1GSSA 3G7JA 4IJIA 3HJPA 4NV5A 5DAKA 2QC7A 3VI5A 1FB6A 4KSOA 2JZTA 4X4JA 4JU5A 4IP1A 2Z9SA 2JSZA 1YEPA 3DMLA 4K5SA 4POLA 4L0WA 2YJHA 4OO5A 4BWQA 1JZOA 1M7TA 3TCOA 3VWUA 1OC9B 4F03A 3BOAA 4K6XA 4OFMA 5BMUA 2YCDA 1EOHA 2LRCA 4KB3A 4MF5A 1G7EA 3F0IA 1ST9A 2H73A 4K0NA 4IQ1A 2RUFA 4IBPA 3FMWA 2EC4A 4EVMA 5D96A 14GSA 2TRCP 4H86A 5CNWA 4A5PA 4K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLN A;  4IP6 A;  3APO A;  4DSS B;  2LV3 A;  3P2A A;  1SL0 B;  3FHK A;  1K3Y A;  2F9S A;  1M2D A;  2OE0 A;  4I8B A;  4IS0 A;  1GSD A;  4O92 A;  2L5L A;  5D9X A;  5GST A;  2ON7 A;  3H4K A;  3IAS 2;  2NBS A;  5E59 A;  5F0G A;  3LWA A;  5HFG A;  2H01 A;  1DSB A;  4GXZ A;  4PXO A;  1JZD A;  2ALB A;  3A3T A;  1TTZ A;  2MBT A;  1F3A A;  1PN9 A;  4Q5F A;  2VAF A;  3IBH A;  5H5S A;  4HS1 A;  1XBS A;  1TRU A;  5ECS A;  3H93 A;  1B9Y C;  2FA4 A;  2YWI A;  3A5W A;  2L4C A;  5JWQ B;  3U5R E;  5AN1 A;  3GKM A;  1PX7 A;  2L57 A;  3GKX A;  5JWO B;  4E8H A;  1ZOF A;  2RII A;  3C71 A;  3RHC A;  1YF1 A;  1K0D A;  3KP9 A;  2CVD A;  2LS5 A;  5GSS A;  4LL1 B;  2JU5 A;  4I2U A;  2L6D A;  4TR3 A;  1K0N A;  2VCX A;  3C73 A;  3LQ7 A;  2VLU A;  4WF5 A;  1B9X C;  2CZ3 A;  4K0G A;  5ELA A;  2CAQ A;  3L4N A;  4MJC A;  1GUK A;  2IFQ A;  2I81 A;  1SU9 A;  3ISO A;  1T4Z A;  1A2M A;  1OC3 A;  5G1K A;  1ERU A;  5G2Z A;  3C1R A;  5L71 A;  5A4V A;  4TKY A;  1QQ2 A;  4XCS A;  4OMV A;  1SKW B;  3HXS A;  3GTU A;  1E6B A;  1SD8 A;  5ECO B;  3GRX A;  1SL1 B;  3BCK A;  3ZIT A;  2GSS A;  2H76 A;  3KGK A;  5IMZ A;  3F63 A;  3HCZ A;  1AIU A;  5CYY A;  4HQZ A;  4MZB A;  4DSR A;  3L78 A;  4ML1 A;  4E8E A;  1A24 A;  5HFK A;  4XHM A;  2HXK A;  4MZW A;  2LJR A;  1T00 A;  3IHQ A;  1KNG A;  1X9S B;  1AW9 A;  4IJ3 A;  1FO5 A;  1QFN A;  2LNT A;  2HFD A;  1WMJ A;  3IV4 A;  3PIN A;  1SJ6 A;  2GVP A;  3APS A;  5ECR B;  1PKW A;  2HZE B;  1JZR A;  4G2E A;  2OAD A;  4PX1 A;  2L5O A;  19GS A;  3TRQ A;  1O85 A;  5EVO A;  4EUY A;  3HY2 A;  1ERV A;  4CDO A;  2EIO A;  2NDO A;  1E2Y A;  2LKU A;  2V41 A;  1URM A;  1MD3 A;  1EOG A;  2B6M A;  2VO4 A;  5G30 A;  2AUV A;  4NAX A;  3EIN A;  2P0G A;  2GSQ A;  5A4U A;  2VIM A;  1JLV A;  4CHS A;  2DML A;  10GS A;  1LBK A;  2DJ2 A;  5CRD A;  1QK8 A;  2IMI A;  2OE3 A;  2CA8 A;  3S9F A;  1GTB A;  1GP1 A;  1EZK A;  2C0G A;  3FEU A;  4WR4 A;  4PGT A;  4V2N A;  4TRX A;  1J9B A;  1VF4 A;  5ID2 A;  1FG4 A;  2X8H A;  1TDI A;  3TJG A;  1X0R A;  2YWO A;  2IWT A;  1WP0 A;  1DUG A;  3TOT A;  5ECN B;  4JED A;  4IHU A;  3QAG A;  3QAV A;  4I5Q A;  1QUW A;  3TJF A;  3D4T A;  5IMD A;  2H6X A;  2C3T A;  1YY7 A;  3GL3 A;  1ZYE A;  3G7I A;  5ECH B;  1F6M C;  1S3C A;  3EE2 A;  1AC1 A;  3D4M A;  1K3O A;  3FR3 A;  3JCM L;  3GX0 A;  2WGR A;  1PQN A;  3G9B A;  2H66 A;  3CRU A;  5ECP B;  20GS A;  3Q6O A;  1Z6M A;  2O8V B;  2BTO T;  1C72 A;  2XPD A;  3FZ9 A;  2YWN A;  2C1Y A;  4TXO B;  2VM2 A;  1XWB A;  3EMX A;  3WGD A;  1EWX A;  1HNC A;  5COH A;  4NPB A;  2DIZ A;  3HD5 A;  5J4U A;  2YJ7 A;  2QSI A;  1XFL A;  1ZYQ B;  2VCQ A;  3E0U A;  4MDC A;  3QMX A;  5JCU A;  3D6I A;  4L5O A;  1MD4 A;  1X9M B;  2DLX A;  1U3I A;  2HT9 A;  4RI7 A;  2AAW A;  5ABR A;  3GIX A;  1EGR A;  2F51 A;  2H1B A;  1OKD A;  3D0Z A;  2CAI A;  3TKS C;  1EV9 A;  3P7X A;  2BMX A;  2HLS A;  1YZX A;  4MZC A;  3K8N A;  4MJB A;  3DXB A;  11GS A;  1TU8 A;  1R5A A;  2VUP A;  6GSW A;  1O73 A;  2IME A;  1TJD A;  1U3A A;  3IC4 A;  3DGQ A;  3A2V A;  3RHB A;  5DBQ A;  3P90 A;  2LRN A;  1ON4 A;  2LTK A;  3I6A A;  4KDU A;  2I1U A;  2IFQ B;  1XWA A;  13GS A;  4GTU A;  2NPB A;  4ZB6 A;  2XBI A;  1PA3 A;  3C7M A;  1ACV A;  3LXZ A;  3OR5 A;  3RAZ A;  6GSV A;  2GQM A;  1EEJ A;  4EDY A;  3ZFL A;  2H74 A;  3LFL A;  2H1D A;  3QR6 A;  3CXG A;  3GTU B;  2GTU A;  2IMF A;  4OFN A;  3I9V 2;  3FR6 A;  1TK0 B;  4IN0 A;  4I97 A;  1SK2 A;  2MMA A;  2WJU A;  1Q4J A;  2PWJ A;  2KP1 A;  1F3B A;  1JFU A;  2FWG A;  3ZLP A;  3FKF A;  2X8G A;  4KDY A;  1XW6 A;  4KW6 A;  2DC5 A;  3RPP A;  3L9U A;  2JZR A;  5AIX A;  2H0I A;  4JBB A;  1JZW A;  4XS6 A;  1XVW A;  4YAV A;  4IGJ A;  1TRS A;  3HJM A;  4K2D A;  4Z7X A;  5ECL B;  3IXR A;  1T1V A;  2VCZ A;  1YKC A;  3VWW A;  3KTL A;  1GUL A;  2P31 A;  3KTB A;  2L59 A;  1MTC A;  4HQS A;  3EC3 A;  3M9K A;  5IOX A;  3UAR A;  16GS A;  4ACS A;  3KJY A;  3VWV A;  1SYX A;  1UN2 A;  4ISD A;  1O8X A;  5HR1 A;  1WE0 A;  4QL9 A;  3F3Q A;  1O6J A;  1SKS B;  4G9H A;  5H5R A;  2B1K A;  3SBC A;  5GAN D;  1XZO A;  5HR2 A;  5C04 A;  1PGT A;  3GSS A;  2DJ1 A;  2CV4 A;  3H8Q A;  3Q19 A;  5FT3 A;  1ABA A;  1J08 A;  2YWM A;  5ID2 B;  1XOB A;  5D9T A;  1YKA A;  3GHA A;  2EIR A;  1T3B A;  4QL7 A;  4XS1 A;  4DSQ A;  1Z5Y E;  2FUG 2;  2G2Q A;  4D73 B;  1QXH A;  5D9W A;  4JZQ A;  4EC0 A;  1B8X A;  3WGX A;  3LYP A;  2O87 A;  2XHF A;  4NV2 A;  2OJL A;  4ZXG A;  1R26 A;  2HNL A;  3ZTL A;  5DJL A;  3GX8 A;  3GH9 A;  3ZVJ D;  9GSS A;  5IPG A;  4AGS A;  2HSH A;  1I9D A;  1XOA A;  2YOI A;  2O89 A;  5DCG A;  2ZUP A;  3MSZ A;  2FWE A;  3IRA A;  5CRG A;  3ZVJ A;  2MMZ A;  3QDN A;  4ZL7 A;  3TRX A;  3UBL A;  4ZL9 A;  4NMU A;  4EDZ A;  1T4Y A;  4OO4 A;  2IJY A;  5KN2 A;  4J57 E;  4F9Z A;  3QAW A;  2VCW A;  1UA5 A;  1GNW A;  2X99 A;  1A0R P;  3MAK A;  2K6V A;  1X5E A;  5LD0 A;  6GSS A;  3MNG A;  1V58 A;  2WDU A;  3DWV A;  3E9J B;  1BYE A;  2CZ2 A;  4KDX A;  1R7H A;  3UEM A;  6GSX A;  4CW9 A;  4HJ2 A;  3IPZ A;  3IK7 A;  3TJK A;  2K8S A;  3M3M A;  2DJ0 A;  1ZCP A;  2IMK A;  1SK1 A;  2E7P A;  1GUH A;  2HSY A;  4FYU A;  2H1A A;  1USB A;  4ID0 A;  4LL4 B;  3C1S A;  2WUL A;  5GZZ B;  1BAY A;  3U6V A;  4DVC A;  2I9H A;  1M2B A;  2GSR A;  4KCA A;  2PVO C;  3ERW A;  1X5D A;  4KCE A;  2YV9 A;  4WET A;  2FHE A;  2LST A;  2G0F A;  4GRF A;  4O5R A;  4XS4 A;  4BA7 A;  4KA0 A;  1G6Y A;  4Q5R A;  3FK8 A;  3KMO A;  5IPH A;  2H71 A;  3LJR A;  4HZ2 A;  4MCU A;  2NVL A;  1B4Q A;  1KTE A;  2GST A;  2XPE A;  3ERG A;  4PNG A;  1BED A;  2R3X A;  3M9J A;  3ZFB A;  4L8E A;  4FH8 A;  5IMF A;  1VF1 A;  1FW1 A;  1U88 A;  3CRT A;  3I43 A;  2J23 A;  2B5X A;  5C00 A;  1PL1 A;  1THO A;  3V1W A;  1M9B A;  2KP2 A;  2JSY A;  3BJ5 A;  5DVB A;  2DJ3 A;  2F8F A;  1LU4 A;  2C8U A;  2WB9 A;  2D2Z A;  2VCT A;  2OA7 A;  1XWG A;  3GA4 A;  3EWL A;  4TR1 A;  1OVN A;  2CVB A;  2FD3 A;  2FWH A;  2OKA A;  3VK9 A;  3H79 A;  3IOS A;  3EYT A;  4AJ7 A;  4FYB A;  3F9U A;  1ERW A;  3GUR A;  3F4R A;  5D73 A;  2OE1 A;  1CQG A;  4GQC A;  4HDE A;  2OAC A;  1JLW A;  2AV4 A;  5CO3 A;  5J9B A;  5A4W A;  2GS3 A;  2PU9 C;  2B5E A;  5IO0 A;  4PUR A;  4IKH A;  2NTO A;  5B8B A;  3HYP A;  1GSF A;  2CT6 A;  2C0D A;  3GFK A;  2VM1 A;  3APQ A;  3DVX A;  1NHY A;  4F2I A;  4F0B A;  2RM6 A;  1WOU A;  2HYX A;  1EP8 A;  3GYK A;  2GT5 A;  3N5O A;  2XC2 A;  3LSZ A;  5J5N A;  3A2W A;  4N0V A;  2FLS A;  4WBR D;  2OBI A;  5IMC A;  3GUS A;  4V1A g;  1DBY A;  4TOP A;  1BJX A;  2M72 A;  1ZZY A;  2TRX A;  2REM A;  5DAK B;  3UL3 A;  3IA1 A;  1SK0 A;  5AIV A;  1MDI A;  4G10 A;  3TB2 A;  3TKQ A;  2JZS A;  3ZMK A;  4ZB9 A;  1W4V A;  3D22 A;  4J2F A;  3P8W A;  2M80 A;  1OYJ A;  2PVQ A;  3KEB A;  2RLI A;  4HZ4 A;  6GSU A;  1O8W A;  2YZH A;  4YAP A;  4IQA A;  3ZIV A;  4N0Z A;  1AQW A;  1XWK A;  2DJK A;  5DQS A;  5IQY A;  4RQR A;  5CRE A;  3GH6 A;  3MDK A;  1XW5 A;  4GST A;  3KP8 A;  2C80 A;  2ZNM A;  4EF0 A;  3UOM A;  5DDL A;  5CRH A;  1H4O A;  4RI6 A;  4WR5 A;  4K7N A;  1OC9 A;  3KZQ A;  3TKS A;  1WRY A;  1ML6 A;  2H8L A;  3UAP A;  1YEX A;  2AB6 A;  5HR3 A;  4YH2 A;  2GLR A;  5B7C A;  3VPQ A;  1M9A A;  1BG5 A;  3ZL5 A;  1Z3E A;  3TUE A;  1YF0 A;  1TP9 A;  3BCI A;  5ECK B;  4XTS A;  2FGX A;  3AY8 A;  3GKN A;  2O7K A;  4DSS A;  4NXI A;  3DEX A;  1Z9H A;  5A5K A;  5ECQ B;  3TJJ A;  5IOW A;  2LRT A;  4XRD A;  3FZA A;  3IAM 2;  1B4P A;  3TOU A;  5B6M A;  5FHI A;  3E3E A;  5JCW A;  3UIW A;  1HQO A;  3SWL A;  3Q18 A;  2V1M A;  4ZIJ A;  4OCF A;  3EU3 A;  4LMW A;  3QD9 A;  2ZCT A;  4I6X A;  4PNF A;  4POM A;  1MEK A;  1Y25 A;  1OAZ A;  2V6K A;  4ZB8 A;  4AF2 A;  4WEY A;  3WT1 A;  4EE0 A;  4BWS A;  3NOF A;  4TVE A;  2WZ9 A;  2FCH A;  3QOU A;  3J7Y b;  5HQP A;  2N5F A;  1GSE A;  1X9W B;  4GSS A;  1OKT A;  4ECC A;  3QFB C;  4ZBA A;  3A2X A;  3GMF A;  1XCC A;  4MH2 A;  2F8A A;  3ME8 A;  3F4S A;  4LLR A;  4FIW A;  2HZF A;  2YNX A;  2L6C A;  3GL5 A;  2R4V A;  1G6W A;  1THX A;  2H75 A;  3KCM A;  4ILF A;  3VWX A;  3ED3 A;  3R2Q A;  4X1U A;  2R6K A;  1Z7R A;  5KN0 A;  3HZ4 A;  3G7Y A;  2DIY A;  2GT6 A;  3UVH A;  1SJZ A;  3CBU A;  1XIY A;  2X8C A;  2V32 A;  2H1G A;  2C4J A;  5KN1 A;  5AGY A;  2F3M A;  3ZZX A;  1A2J A;  4MP4 A;  2C0E A;  5INY A;  1V98 A;  3F4T A;  2KHP A;  4F82 A;  3M8N A;  4J56 E;  4F0C A;  3M1G A;  2VLV A;  1B48 A;  2VL9 A;  3IK9 A;  4MJE A;  3BD2 A;  4BPY A;  4AJ8 A;  2WCI A;  4PQI A;  4K7O A;  1J0F A;  3D5J A;  5DAL A;  1WJK A;  3W8J A;  2FA8 A;  3LYK A;  2HZE A;  2HI7 A;  1A23 A;  1VRS D;  3EVI A;  2LQO A;  2WFC A;  4JR6 A;  1SYR A;  2AJQ B;  1S3D A;  1NHO A;  4KE3 A;  1GH2 A;  4KSM A;  4AJ6 A;  3CSI A;  2RM5 A;  4EKZ A;  2VL3 A;  8GSS A;  2P5Q A;  1PL2 A;  1M0U A;  2E2M A;  3DKS A;  5ECM B;  1W89 A;  3KH7 A;  7GSS A;  3VI7 A;  4TR0 A;  4Q5N A;  1PSQ A;  1G7O A;  1K3L A;  4V2L A;  1PKZ A;  1TK5 B;  4KND A;  2YV7 A;  4N10 A;  2A2S A;  5G31 A;  4KH7 A;  4POK A;  3IR4 A;  4WKW A;  4QQ7 A;  5DCH A;  2K18 A;  2B7J A;  2PMT A;  3LG6 A;  3UVT A;  1A0F A;  2VLT A;  1SKR B;  1U6T A;  6GST A;  2MZC A;  2BJX A;  4TXV A;  4WXT A;  3KXO A;  2MBS A;  2R2J A;  3W8S A;  3ZRD A;  1GL8 A;  2VOC A;  3KD0 A;  4X43 A;  3GNJ A;  4PQH A;  2H6Z A;  5DJM A;  1F2E A;  3Q74 A;  5IMA A;  2I3Y A;  3KIJ A;  5GAP D;  2RUE A;  1GSQ A;  1RW1 A;  3CMI A;  3HKR A;  1DE1 A;  4IEL A;  2YPM A;  3LEF A;  3DYR A;  5JCG A;  3PGT A;  2PGT A;  3KMN A;  1TRV A;  2XBQ A;  3TGZ A;  1Z7P A;  2H6Y A;  2H19 A;  1PX6 A;  3CSH A;  3W6G A;  4G19 A;  4ECI A;  3CTF A;  1G0T A;  2HE3 A;  5EY6 A;  1BQ7 A;  4WF4 A;  3EMP A;  3GN3 A;  18GS A;  5ECI B;  1OE7 A;  1NM3 A;  2QGV A;  3VPT A;  3KM6 A;  4MH3 A;  1MDJ A;  12GS A;  1PMT A;  4TXO A;  1A8Y A;  4NWY A;  3FZ4 A;  3TKP A;  3RBT A;  2H0H A;  5FWG A;  2H0G A;  2GQL A;  1RK4 A;  3F8U A;  4HU7 A;  3TKR A;  1ERT A;  2PBJ A;  3L9S A;  4L0U A;  2A2R A;  1TW9 A;  2OBK A;  1SL2 B;  1EGO A;  1WIK A;  2GZP A;  2X64 A;  4BL7 A;  4MK3 A;  2AYT A;  4HEA 2;  1PD2 1;  2GDR A;  1OE8 A;  2R5G A;  3KH9 A;  4NHZ A;  3I69 A;  2DBC A;  2WRT A;  2VD1 A;  4GCI A;  3HZ8 A;  5CRW A;  4BVY A;  2KLX A;  1TXX A;  3FR9 A;  3GST A;  1K0A A;  1O81 A;  3J7Y k;  2E0Q A;  4PQ1 A;  4PUF C;  4K7I A;  2V6O A;  4ZL8 A;  1GLQ A;  1IYI A;  4RQX A;  2N5B A;  3WT2 A;  1EP7 A;  1SJI A;  3UJ1 A;  4EXJ A;  1QGV A;  1YJ6 A;  2KOK A;  2E2G A;  2YAN A;  5EL8 A;  3HDC A;  3UMA A;  4I2T A;  2GQK A;  5JWR B;  2JAC A;  4BVX A;  4DEJ A;  3DRN A;  1N8J A;  3RDW A;  1TKD B;  1TOF A;  1ILO A;  5KEJ A;  4MAB A;  4HU9 A;  4EO3 A;  4KAE A;  2HRN A;  3CYN A;  1A2L A;  4FO5 A;  2LNS A;  2LEG A;  4YQV A;  17GS A;  1GSY A;  1AUC A;  2IMD A;  2B7K A;  4OWY A;  3DVW A;  4V1A p;  2CVK A;  1GSU A;  4ECJ A;  5G5F A;  3HVX A;  1R5P A;  2EIQ A;  3PH9 A;  1SEN A;  1XW9 A;  5IO2 A;  5LNK e;  1GWC A;  2YN1 A;  1GLP A;  2K8V A;  1VGL A;  1H75 A;  5J9C A;  2MYG A;  2CX3 A;  4POB A;  1NSW A;  3TKS E;  2IN3 A;  5DAL B;  1ZGN A;  1EEM A;  2H70 A;  4N30 A;  4YQU A;  3HA9 A;  1YDK A;  4KGI A;  4TR4 A;  5HFI A;  5DQY A;  5F8B A;  2DMM A;  3ZML A;  1GNE A;  1Z6N A;  5H5Q A;  4EL1 A;  3PR8 A;  4MF6 A;  1N2A A;  4IVF A;  1GTA A;  5B8A A;  2JL4 A;  5KN3 A;  1TK8 B;  3N9J A;  2FWF A;  1V40 A;  2PN8 A;  1V57 A;  3QPM A;  3H1N A;  3GV1 A;  1FOV A;  1V2A A;  4KUN A;  1WWJ A;  1V9W A;  2GGT A;  3LGC A;  4ULX A;  1ZL9 A;  3ZIJ A;  4V2M A;  2M46 A;  4JE1 A;  4YQM A;  1HNA A;  2VCV A;  4PUA A;  4O7H A;  3TJB A;  4K1F A;  3IE3 A;  4L5L A;  1ZMA A;  4MMM A;  5ENU A;  1KEB A;  1FAA A;  2AHE A;  3QCP A;  4GWR A;  3FRC A;  1VF3 A;  2CX4 A;  2LJA A;  2H72 A;  2O85 A;  3HHV A;  1UC7 A;  5B6N A;  5D9V A;  3DIE A;  5IIZ A;  3MWH A;  1FVK A;  4MF7 A;  3ERF A;  2FY6 A;  1TU7 A;  4D73 A;  1UVZ A;  1DE2 A;  1K0M A;  1XVQ A;  3F3R A;  4NHW A;  3L9V A;  5ELG A;  1A8L A;  1Q98 A;  5D93 A;  3D21 A;  3HVS A;  3C8E A;  4GSN A;  1AAZ A;  3FYG A;  4MLY A;  3O6T A;  2HRF A;  1LJR A;  1KBN A;  4ML6 A;  5G1L A;  2QKE A;  4MPG A;  5F05 A;  1IYH A;  1GUM A;  1M99 A;  4LMV A;  4MA9 A;  2KUC A;  4ECB A;  4O32 A;  2LUS A;  3QFA C;  1MDK A;  1BX9 A;  1FVJ A;  2P5R A;  1EV4 A;  1XWC A;  4K9Z A;  4MJA A;  3F6F A;  4Q5Q A;  4XIH A;  1O7U A;  3FW2 A;  4K8M A;  5J41 A;  3WYW A;  3DD3 A;  1NW2 A;  4ZBD A;  1QMV A;  4MPF A;  4JRR A;  5J3R A;  3LXT A;  4KX4 A;  1FHE A;  1T8E B;  3NZN A;  4HUA A;  3WGE A;  2PUK C;  3TDG A;  3FZ5 A;  3VUR A;  5F06 A;  4XS4 B;  2IL3 A;  4P3Y B;  4OCE A;  5IM9 A;  2I4A A;  2MMO A;  2GZZ A;  1HD2 A;  3ZYW A;  1I5G A;  2IIY A;  4XRA A;  4OFT A;  1PRX A;  1HNB A;  1T7P B;  1JHB A;  2ES7 A;  3O76 A;  2ON5 A;  3UBK A;  1Y6E A;  3ME7 A;  2CQ9 A;  2LJK A;  1CQH A;  3NIV A;  4GQF A;  1TI3 A;  2IPA A;  2B3S A;  4X0X A;  3TRP A;  1K0O A;  1GTI A;  4FYC A;  2YZU A;  2YP6 A;  5HR0 A;  1X5C A;  3CTG A;  1YQ1 A;  1WPI A;  4OD7 A;  2A4V A;  2MMN A;  1TRW A;  1XXU A;  1K0C A;  1OC8 A;  3HVV A;  2C3Q A;  6GSY A;  4TR1 B;  3F6D A;  1U87 A;  2L4Q A;  1R4W A;  2LQQ A;  2PER A;  2V2G A;  2DSA A;  2R37 A;  5D8I A;  2TIR A;  2PPT A;  5E4W A;  2B5Y A;  1FB0 A;  1GRX A;  4N11 A;  1XPV A;  4GF0 A;  5LCZ A;  2B1L A;  1F37 A;  1K0B A;  4HI7 A;  1M2A A;  1AXD A;  2C0F A;  3BBY A;  3GKK A;  4RUV A;  5F07 A;  4ZBB A;  5CAX A;  3ZRE A;  2VL2 A;  2J9H A;  2VD0 A;  2C3N A;  5AIS A;  1F9M A;  3CSJ A;  3FY7 A;  2H30 A;  4IW9 A;  1TI1 A;  4LA1 A;  1RQM A;  2FNO A;  4ZIL A;  2K9F A;  4TW5 A;  5EPF A;  4GLT A;  2JAD A;  3L0H A;  3LOR A;  1AQX A;  1AQV A;  2DJJ A;  2WS2 A;  5CP1 A;  3US3 A;  5IMV A;  3IDV A;  1GTU A;  3RPN A;  2GZY A;  3VFI A;  4HOJ A;  4TN8 A;  1VF2 A;  2N5A A;  4WBJ A;  3M0F A;  2VL2 C;  1HYU A;  22GS A;  5G5E A;  3WD6 A;  4JR4 A;  4HJM A;  1SD9 A;  3EU4 A;  1S3A A;  3EUR A;  3HJO A;  3O3T A;  1GSS A;  3G7J A;  4IJI A;  3HJP A;  4NV5 A;  5DAK A;  2QC7 A;  3VI5 A;  1FB6 A;  4KSO A;  2JZT A;  4JU5 A;  4IP1 A;  2Z9S A;  2JSZ A;  1YEP A;  3DML A;  4POL A;  4L0W A;  2YJH A;  4OO5 A;  4BWQ A;  1JZO A;  1M7T A;  3TCO A;  3VWU A;  1OC9 B;  4F03 A;  3BOA A;  4K6X A;  4OFM A;  2YCD A;  1EOH A;  2LRC A;  4KB3 A;  4MF5 A;  1G7E A;  3F0I A;  1ST9 A;  2H73 A;  4K0N A;  4IQ1 A;  2RUF A;  4IBP A;  2EC4 A;  4EVM A;  5D96 A;  14GS A;  2TRC P;  4H86 A;  5CNW A; 
#chains in the Genus database with same CATH topology
 3VLN A;  4IP6 A;  3APO A;  4DSS B;  2HRA A;  2LV3 A;  3P2A A;  1SL0 B;  3FHK A;  1K3Y A;  2F9S A;  1M2D A;  2OE0 A;  4I8B A;  4IS0 A;  1GSD A;  4O92 A;  2L5L A;  5D9X A;  5GST A;  2ON7 A;  3H4K A;  3IAS 2;  2NBS A;  5E59 A;  5F0G A;  3LWA A;  5HFG A;  2H01 A;  1DSB A;  4GXZ A;  4PXO A;  1JZD A;  2ALB A;  3A3T A;  1TTZ A;  2DKH A;  2MBT A;  1F3A A;  1PN9 A;  4Q5F A;  2VAF A;  3IBH A;  5H5S A;  4HS1 A;  1XBS A;  1TRU A;  5ECS A;  3H93 A;  1B9Y C;  2FA4 A;  2YWI A;  3A5W A;  2L4C A;  5JWQ B;  3U5R E;  5AN1 A;  3GKM A;  4O5U A;  1PX7 A;  2L57 A;  3GKX A;  5JWO B;  4E8H A;  1ZOF A;  2RII A;  3C71 A;  3RHC A;  1YF1 A;  1K0D A;  3KP9 A;  2CVD A;  2LS5 A;  5GSS A;  4LL1 B;  2JU5 A;  4I2U A;  2L6D A;  4TR3 A;  1K0N A;  2VCX A;  3C73 A;  3LQ7 A;  2VLU A;  4WF5 A;  1B9X C;  2CZ3 A;  4K0G A;  5ELA A;  2CAQ A;  3L4N A;  4MJC A;  1GUK A;  2IFQ A;  2I81 A;  1SU9 A;  2R0P A;  3ISO A;  1T4Z A;  1A2M A;  1OC3 A;  5G1K A;  1ERU A;  5G2Z A;  3C1R A;  5L71 A;  5A4V A;  4TKY A;  1QQ2 A;  4XCS A;  4OMV A;  1SKW B;  3HXS A;  3GTU A;  1E6B A;  1SD8 A;  5ECO B;  3GRX A;  1SL1 B;  3BCK A;  3ZIT A;  2GSS A;  2H76 A;  3KGK A;  5IMZ A;  3F63 A;  3HCZ A;  4EIQ A;  1AIU A;  5CYY A;  4HQZ A;  4MZB A;  4DSR A;  3L78 A;  4ML1 A;  4E8E A;  1A24 A;  5HFK A;  4XHM A;  2HXK A;  4MZW A;  2LJR A;  1T00 A;  3IHQ A;  1KNG A;  1X9S B;  1AW9 A;  4CY8 A;  4IJ3 A;  1FO5 A;  1QFN A;  2LNT A;  2HFD A;  1WMJ A;  3IV4 A;  3PIN A;  1SJ6 A;  2GVP A;  3APS A;  5ECR B;  1PKW A;  2HZE B;  1JZR A;  4G2E A;  2OAD A;  4PX1 A;  2L5O A;  19GS A;  3TRQ A;  1O85 A;  5EVO A;  4EUY A;  3HY2 A;  1ERV A;  4CDO A;  2EIO A;  2NDO A;  1E2Y A;  2LKU A;  2V41 A;  1URM A;  1MD3 A;  1EOG A;  2B6M A;  2VO4 A;  5G30 A;  2AUV A;  4NAX A;  3EIN A;  2P0G A;  2GSQ A;  5A4U A;  2VIM A;  1JLV A;  4CHS A;  2DML A;  10GS A;  1LBK A;  4FQU A;  2DJ2 A;  5CRD A;  1QK8 A;  2IMI A;  2OE3 A;  2CA8 A;  3S9F A;  1PN0 A;  1GTB A;  1GP1 A;  1EZK A;  2C0G A;  3FEU A;  4WR4 A;  4PGT A;  4V2N A;  4TRX A;  1J9B A;  1VF4 A;  5ID2 A;  1FG4 A;  2X8H A;  1TDI A;  3TJG A;  1X0R A;  2YWO A;  2IWT A;  1WP0 A;  1DUG A;  3TOT A;  5ECN B;  4JED A;  4IHU A;  3QAG A;  3QAV A;  4I5Q A;  1QUW A;  3TJF A;  3D4T A;  5IMD A;  2H6X A;  2C3T A;  1YY7 A;  3GL3 A;  1ZYE A;  3G7I A;  5ECH B;  1F6M C;  1S3C A;  3EE2 A;  1AC1 A;  3D4M A;  1K3O A;  3FR3 A;  3JCM L;  3GX0 A;  2WGR A;  1PQN A;  3G9B A;  2H66 A;  3CRU A;  20GS A;  5ECP B;  3Q6O A;  1Z6M A;  2O8V B;  2BTO T;  1C72 A;  2XPD A;  3CQF A;  3FZ9 A;  2YWN A;  2C1Y A;  4TXO B;  2VM2 A;  2X49 A;  1XWB A;  3EMX A;  3WGD A;  1EWX A;  1HNC A;  3LW9 A;  5COH A;  4NPB A;  2DIZ A;  3HD5 A;  5J4U A;  2YJ7 A;  2QSI A;  1XFL A;  1ZYQ B;  2VCQ A;  3E0U A;  4MDC A;  3QMX A;  5JCU A;  3D6I A;  4L5O A;  1MD4 A;  1X9M B;  2DLX A;  1U3I A;  2HT9 A;  4RI7 A;  2AAW A;  5ABR A;  3GIX A;  1EGR A;  2F51 A;  4BL7 B;  2H1B A;  1OKD A;  3D0Z A;  2CAI A;  3TKS C;  1EV9 A;  3P7X A;  2BMX A;  2HLS A;  1YZX A;  4MZC A;  3K8N A;  4BVY B;  4MJB A;  3DXB A;  11GS A;  1TU8 A;  1R5A A;  2VUP A;  6GSW A;  1O73 A;  2IME A;  1TJD A;  1U3A A;  3IC4 A;  3DGQ A;  2QA1 A;  3A2V A;  3RHB A;  5DBQ A;  3P90 A;  2LRN A;  1ON4 A;  2LTK A;  4BVX B;  3I6A A;  4KDU A;  3PPU A;  2I1U A;  2IFQ B;  1XWA A;  13GS A;  4GTU A;  2NPB A;  4ZB6 A;  2XBI A;  1PA3 A;  3C7M A;  1ACV A;  3LXZ A;  4K2X A;  3OR5 A;  3RAZ A;  6GSV A;  2GQM A;  1EEJ A;  4EDY A;  3ZFL A;  2H74 A;  4CY6 A;  3LFL A;  2H1D A;  3QR6 A;  3CXG A;  3GTU B;  2GTU A;  2IMF A;  4OFN A;  3I9V 2;  3FR6 A;  1TK0 B;  4IN0 A;  4I97 A;  1SK2 A;  2MMA A;  2WJU A;  1Q4J A;  2PWJ A;  2KP1 A;  1F3B A;  1JFU A;  1S3R A;  2FWG A;  3ZLP A;  3FKF A;  2X8G A;  4KDY A;  1XW6 A;  4KW6 A;  2DC5 A;  3RPP A;  3L9U A;  2JZR A;  5AIX A;  2H0I A;  4JBB A;  1JZW A;  4XS6 A;  1XVW A;  4YAV A;  4IGJ A;  1TRS A;  3HJM A;  1M3I A;  4K2D A;  4Z7X A;  5ECL B;  3IXR A;  1T1V A;  2VCZ A;  4O5Q A;  1YKC A;  3VWW A;  1ZYN A;  3KTL A;  1GUL A;  2P31 A;  3KTB A;  2L59 A;  1MTC A;  4HQS A;  3EC3 A;  3M9K A;  5IOX A;  3UAR A;  16GS A;  2A2P A;  4ACS A;  3KJY A;  3VWV A;  1SYX A;  1UN2 A;  4ISD A;  1O8X A;  2HRK A;  5HR1 A;  1WE0 A;  4QL9 A;  3F3Q A;  1O6J A;  1SKS B;  4G9H A;  5H5R A;  2B1K A;  3SBC A;  5GAN D;  1XZO A;  1ZYP A;  5HR2 A;  5C04 A;  1PGT A;  3GSS A;  2DJ1 A;  2CV4 A;  3H8Q A;  3Q19 A;  3R3E A;  5FT3 A;  1ABA A;  1J08 A;  2YWM A;  5ID2 B;  1XOB A;  5D9T A;  1YKA A;  3GHA A;  2EIR A;  1T3B A;  4QL7 A;  4XS1 A;  4DSQ A;  1Z5Y E;  2FUG 2;  2G2Q A;  4D73 B;  1QXH A;  5D9W A;  4JZQ A;  4EC0 A;  1B8X A;  3WGX A;  3LYP A;  2O87 A;  2XHF A;  4NV2 A;  2OJL A;  4ZXG A;  1R26 A;  2HNL A;  3ZTL A;  5DJL A;  3GX8 A;  3GH9 A;  3ZVJ D;  9GSS A;  5IPG A;  4AGS A;  2HSH A;  1I9D A;  1XOA A;  2YOI A;  2O89 A;  5DCG A;  2ZUP A;  3MSZ A;  2FWE A;  3IRA A;  5CRG A;  3ZVJ A;  2MMZ A;  3QDN A;  4ZL7 A;  3TRX A;  3UBL A;  4ZL9 A;  4NMU A;  4EDZ A;  1T4Y A;  4OO4 A;  2IJY A;  5KN2 A;  4J57 E;  4F9Z A;  3QAW A;  2VCW A;  1UA5 A;  1GNW A;  2X99 A;  1A0R P;  3MAK A;  2K6V A;  1X5E A;  5LD0 A;  6GSS A;  3MNG A;  1V58 A;  2WDU A;  3DWV A;  3E9J B;  1BYE A;  2CZ2 A;  4KDX A;  1R7H A;  3UEM A;  6GSX A;  4CW9 A;  4HJ2 A;  3IPZ A;  3IK7 A;  3TJK A;  2K8S A;  3M3M A;  2DJ0 A;  1ZCP A;  2IMK A;  1SK1 A;  2E7P A;  1GUH A;  2HSY A;  4BIK A;  4FYU A;  2H1A A;  1USB A;  4ID0 A;  4LL4 B;  3C1S A;  2WUL A;  5GZZ B;  1BAY A;  3U6V A;  4DVC A;  2I9H A;  1M2B A;  2GSR A;  4KCA A;  2PVO C;  3ERW A;  1X5D A;  4KCE A;  2YV9 A;  4WET A;  2FHE A;  2LST A;  2G0F A;  4GRF A;  4O5R A;  4XS4 A;  4BA7 A;  4KA0 A;  1G6Y A;  4Q5R A;  3FK8 A;  3KMO A;  5IPH A;  2H71 A;  3LJR A;  4HZ2 A;  4MCU A;  2NVL A;  1B4Q A;  1KTE A;  2GST A;  2XPE A;  3ERG A;  4PNG A;  1BED A;  2R3X A;  3M9J A;  3ZFB A;  4L8E A;  4FH8 A;  5IMF A;  1VF1 A;  1FW1 A;  1U88 A;  3CRT A;  3I43 A;  2J23 A;  2B5X A;  5C00 A;  1PL1 A;  1THO A;  3V1W A;  1M9B A;  2KP2 A;  2JSY A;  3BJ5 A;  5DVB A;  2DJ3 A;  2F8F A;  1LU4 A;  2C8U A;  2WB9 A;  2D2Z A;  2VCT A;  2OA7 A;  1XWG A;  3GA4 A;  3EWL A;  4TR1 A;  1OVN A;  2CVB A;  2FD3 A;  2FWH A;  2OKA A;  3IC8 A;  3VK9 A;  3H79 A;  3IOS A;  3EYT A;  4AJ7 A;  4FYB A;  3F9U A;  1ERW A;  3GUR A;  3F4R A;  5D73 A;  2OE1 A;  1CQG A;  4GQC A;  4HDE A;  2OAC A;  1JLW A;  2AV4 A;  5CO3 A;  5J9B A;  5A4W A;  2GS3 A;  2PU9 C;  2B5E A;  5IO0 A;  4PUR A;  4IKH A;  2NTO A;  5B8B A;  3HYP A;  1GSF A;  2CT6 A;  2C0D A;  3GFK A;  2VM1 A;  3APQ A;  3DVX A;  1NHY A;  4F2I A;  3HVN A;  4F0B A;  2RM6 A;  1WOU A;  2HYX A;  1EP8 A;  3GYK A;  2GT5 A;  3N5O A;  2XC2 A;  3LSZ A;  5J5N A;  3A2W A;  4N0V A;  2FLS A;  4MNN A;  4WBR D;  2OBI A;  5IMC A;  3GUS A;  4V1A g;  1DBY A;  4TOP A;  1BJX A;  2M72 A;  1ZZY A;  2TRX A;  2REM A;  5DAK B;  3UL3 A;  3IA1 A;  1SK0 A;  5AIV A;  1MDI A;  4G10 A;  3TB2 A;  3TKQ A;  2JZS A;  3ZMK A;  4ZB9 A;  1W4V A;  3D22 A;  4J2F A;  3P8W A;  2M80 A;  1OYJ A;  2PVQ A;  3KEB A;  2RLI A;  4HZ4 A;  6GSU A;  1O8W A;  2YZH A;  4YAP A;  4IQA A;  3ZIV A;  4N0Z A;  1AQW A;  1XWK A;  2DJK A;  5DQS A;  5IQY A;  4RQR A;  5CRE A;  3GH6 A;  3MDK A;  1XW5 A;  4GST A;  3KP8 A;  2C80 A;  2ZNM A;  4EF0 A;  3UOM A;  4KF9 A;  5DDL A;  5CRH A;  1H4O A;  4RI6 A;  4WR5 A;  4K7N A;  1OC9 A;  3KZQ A;  3TKS A;  1WRY A;  1ML6 A;  2H8L A;  3UAP A;  1YEX A;  2AB6 A;  5HR3 A;  4YH2 A;  2GLR A;  5B7C A;  3VPQ A;  1M9A A;  1BG5 A;  3ZL5 A;  1Z3E A;  3TUE A;  1YF0 A;  1TP9 A;  3BCI A;  5ECK B;  4XTS A;  2FGX A;  3AY8 A;  3GKN A;  2O7K A;  4DSS A;  4NXI A;  3DEX A;  1Z9H A;  5A5K A;  5ECQ B;  3TJJ A;  5IOW A;  2LRT A;  4XRD A;  3FZA A;  3IAM 2;  1FOH A;  1B4P A;  3TOU A;  5B6M A;  5FHI A;  3E3E A;  5JCW A;  3UIW A;  5KOW A;  1HQO A;  3SWL A;  4Z2T A;  3Q18 A;  2V1M A;  4ZIJ A;  4OCF A;  3EU3 A;  4LMW A;  3QD9 A;  2ZCT A;  4I6X A;  4PNF A;  4POM A;  1MEK A;  1Y25 A;  1OAZ A;  1M3J A;  2V6K A;  4ZB8 A;  4WEY A;  4AF2 A;  3WT1 A;  4EE0 A;  4BWS A;  3NOF A;  4TVE A;  2WZ9 A;  2FCH A;  3QOU A;  3J7Y b;  5HQP A;  2N5F A;  1GSE A;  1X9W B;  4GSS A;  1OKT A;  4ECC A;  3QFB C;  4ZBA A;  3A2X A;  3GMF A;  1XCC A;  4MH2 A;  2F8A A;  3ME8 A;  3F4S A;  4LLR A;  3A5I A;  4FIW A;  2HZF A;  2YNX A;  2L6C A;  3GL5 A;  2R4V A;  1G6W A;  1THX A;  2H75 A;  3KCM A;  4ILF A;  3VWX A;  3ED3 A;  3R2Q A;  4X1U A;  2R6K A;  1Z7R A;  5KN0 A;  3HZ4 A;  3G7Y A;  2DIY A;  2GT6 A;  3UVH A;  1SJZ A;  3CBU A;  1XIY A;  2X8C A;  2V32 A;  2H1G A;  2C4J A;  5KN1 A;  5AGY A;  2F3M A;  3ZZX A;  1A2J A;  4MP4 A;  2C0E A;  5INY A;  1V98 A;  3F4T A;  2KHP A;  4F82 A;  3M8N A;  4J56 E;  4F0C A;  3M1G A;  2VLV A;  1B48 A;  2VL9 A;  3IK9 A;  4MJE A;  4PTS A;  3BD2 A;  4BPY A;  4AJ8 A;  2WCI A;  4PQI A;  5BRT A;  4G0L A;  4K7O A;  1J0F A;  3D5J A;  5DAL A;  1WJK A;  3W8J A;  2FA8 A;  3LYK A;  2HZE A;  2HI7 A;  1A23 A;  1VRS D;  3EVI A;  2LQO A;  2WFC A;  4JR6 A;  1SYR A;  2AJQ B;  1S3D A;  1NHO A;  4G0K A;  4KE3 A;  1GH2 A;  4KSM A;  4AJ6 A;  3CSI A;  2RM5 A;  4EKZ A;  2VL3 A;  8GSS A;  2P5Q A;  1PL2 A;  1M0U A;  2E2M A;  3DKS A;  5ECM B;  1W89 A;  3KH7 A;  7GSS A;  3VI7 A;  4TR0 A;  2R0G A;  4Q5N A;  1PSQ A;  1G7O A;  1K3L A;  4V2L A;  1PKZ A;  1TK5 B;  4KND A;  4USS A;  2YV7 A;  4N10 A;  2A2S A;  5G31 A;  4KH7 A;  4POK A;  3IR4 A;  4WKW A;  4QQ7 A;  5DCH A;  2K18 A;  2B7J A;  2PMT A;  3LG6 A;  3UVT A;  1A0F A;  2VLT A;  1SKR B;  1U6T A;  6GST A;  2MZC A;  2BJX A;  4TXV A;  4WXT A;  3KXO A;  2MBS A;  2R2J A;  3W8S A;  3ZRD A;  1GL8 A;  2VOC A;  3KD0 A;  4X43 A;  3GNJ A;  4PQH A;  2H6Z A;  5DJM A;  1F2E A;  3Q74 A;  5IMA A;  2I3Y A;  3KIJ A;  5GAP D;  2RUE A;  1GSQ A;  1RW1 A;  3CMI A;  3HKR A;  1DE1 A;  4IEL A;  2YPM A;  3LEF A;  3DYR A;  5JCG A;  3PGT A;  2PGT A;  3KMN A;  1TRV A;  2XBQ A;  3TGZ A;  1Z7P A;  2H6Y A;  2H19 A;  1PX6 A;  3CSH A;  3W6G A;  4G19 A;  4ECI A;  3CTF A;  1G0T A;  2HE3 A;  5EY6 A;  1BQ7 A;  4WF4 A;  3EMP A;  3GN3 A;  18GS A;  5ECI B;  1OE7 A;  1NM3 A;  2QGV A;  3VPT A;  3KM6 A;  4MH3 A;  1MDJ A;  12GS A;  1PMT A;  4TXO A;  1A8Y A;  4NWY A;  3FZ4 A;  3TKP A;  3RBT A;  2H0H A;  5FWG A;  2H0G A;  2GQL A;  1XG8 A;  1RK4 A;  3F8U A;  4HU7 A;  3TKR A;  1ERT A;  2PBJ A;  3L9S A;  4L0U A;  2A2R A;  1TW9 A;  2OBK A;  1SL2 B;  1EGO A;  1WIK A;  2GZP A;  2X64 A;  4BL7 A;  4MK3 A;  2AYT A;  4HEA 2;  1PD2 1;  2GDR A;  1OE8 A;  2R5G A;  3KH9 A;  4NHZ A;  3I69 A;  2DBC A;  2WRT A;  2VD1 A;  4GCI A;  2UZ8 A;  3HZ8 A;  5CRW A;  4BVY A;  2KLX A;  1TXX A;  3FR9 A;  3GST A;  1K0A A;  1O81 A;  3J7Y k;  2E0Q A;  4PQ1 A;  4PUF C;  4K7I A;  2V6O A;  4ZL8 A;  1GLQ A;  1IYI A;  4RQX A;  2N5B A;  3WT2 A;  1EP7 A;  1SJI A;  3UJ1 A;  4EXJ A;  1QGV A;  1YJ6 A;  2KOK A;  2E2G A;  2YAN A;  5EL8 A;  3HDC A;  3UMA A;  4I2T A;  2GQK A;  5JWR B;  2JAC A;  4BVX A;  4DEJ A;  3DRN A;  1N8J A;  3RDW A;  1TKD B;  1TOF A;  1ILO A;  5KEJ A;  4MAB A;  4HU9 A;  4EO3 A;  4KAE A;  2HRN A;  3CYN A;  1A2L A;  2DKI A;  4FO5 A;  2LNS A;  2LEG A;  4YQV A;  17GS A;  1GSY A;  1AUC A;  2IMD A;  2B7K A;  4OWY A;  3DVW A;  4V1A p;  2CVK A;  1GSU A;  4ECJ A;  5G5F A;  3HVX A;  1R5P A;  2EIQ A;  3PH9 A;  1SEN A;  1XW9 A;  3EPT A;  5IO2 A;  5LNK e;  1GWC A;  2YN1 A;  1GLP A;  3IHG A;  2K8V A;  1VGL A;  1H75 A;  5J9C A;  2MYG A;  2CX3 A;  4POB A;  1NSW A;  3TKS E;  2IN3 A;  5DAL B;  1ZGN A;  1EEM A;  2H70 A;  4N30 A;  4YQU A;  3HA9 A;  1YDK A;  4KGI A;  4TR4 A;  5HFI A;  5DQY A;  5F8B A;  2DMM A;  3ZML A;  1GNE A;  1Z6N A;  5H5Q A;  4EL1 A;  3PR8 A;  4MF6 A;  1N2A A;  4IVF A;  1GTA A;  5B8A A;  2JL4 A;  5KN3 A;  1TK8 B;  4EIP A;  3N9J A;  2FWF A;  1V40 A;  2PN8 A;  1V57 A;  3QPM A;  3H1N A;  3GV1 A;  1FOV A;  1V2A A;  4KUN A;  1WWJ A;  1V9W A;  2GGT A;  2R0C A;  4ULX A;  3LGC A;  1ZL9 A;  3ZIJ A;  4V2M A;  2M46 A;  4JE1 A;  4YQM A;  1HNA A;  2VCV A;  4PUA A;  4O7H A;  3TJB A;  4K1F A;  3IE3 A;  4L5L A;  1ZMA A;  4MMM A;  5ENU A;  1KEB A;  1FAA A;  2AHE A;  3QCP A;  2A4H A;  4GWR A;  2HSM A;  3FRC A;  1VF3 A;  2CX4 A;  2LJA A;  2H72 A;  2O85 A;  3HHV A;  1UC7 A;  5B6N A;  5D9V A;  3DIE A;  5IIZ A;  3MWH A;  1FVK A;  4MF7 A;  3ERF A;  2FY6 A;  1TU7 A;  2QA2 A;  4D73 A;  1UVZ A;  1DE2 A;  1K0M A;  1XVQ A;  3F3R A;  4NHW A;  3L9V A;  5ELG A;  1A8L A;  1Q98 A;  5D93 A;  3D21 A;  3HVS A;  3C8E A;  4GSN A;  1AAZ A;  3FYG A;  4MLY A;  3O6T A;  2HRF A;  1LJR A;  1KBN A;  4ML6 A;  5G1L A;  2QKE A;  4MPG A;  4Z2U A;  5F05 A;  1IYH A;  1GUM A;  1M99 A;  4LMV A;  4MA9 A;  2KUC A;  4ECB A;  4O32 A;  2LUS A;  3QFA C;  1MDK A;  1BX9 A;  1FVJ A;  2P5R A;  1EV4 A;  1XWC A;  4K9Z A;  4MJA A;  3F6F A;  4Q5Q A;  4XIH A;  1O7U A;  3FW2 A;  2X4A A;  4K8M A;  5J41 A;  3WYW A;  3DD3 A;  1NW2 A;  4ZBD A;  1QMV A;  4MPF A;  4JRR A;  5J3R A;  3LXT A;  4KX4 A;  1FHE A;  1T8E B;  3MIX A;  3NZN A;  4HUA A;  3WGE A;  2PUK C;  3TDG A;  3FZ5 A;  3VUR A;  5F06 A;  4ICY A;  4XS4 B;  2IL3 A;  4P3Y B;  4OCE A;  5IM9 A;  2I4A A;  2MMO A;  2GZZ A;  1HD2 A;  3ZYW A;  1I5G A;  2IIY A;  4XRA A;  4OFT A;  1PRX A;  1HNB A;  1T7P B;  1JHB A;  2ES7 A;  3O76 A;  2ON5 A;  3UBK A;  1Y6E A;  3ME7 A;  2CQ9 A;  2LJK A;  1CQH A;  3NIV A;  4GQF A;  1TI3 A;  2IPA A;  2B3S A;  4X0X A;  3TRP A;  1K0O A;  1GTI A;  4FYC A;  2YZU A;  2YP6 A;  5HR0 A;  1X5C A;  3CTG A;  1YQ1 A;  1WPI A;  4OD7 A;  2A4V A;  2MMN A;  1TRW A;  1XXU A;  1K0C A;  1OC8 A;  3HVV A;  2C3Q A;  6GSY A;  4TR1 B;  3F6D A;  1U87 A;  2L4Q A;  4G0I A;  1R4W A;  2LQQ A;  1PFO A;  2PER A;  2V2G A;  2DSA A;  2R37 A;  5D8I A;  2TIR A;  2PPT A;  5E4W A;  2B5Y A;  1FB0 A;  1GRX A;  4N11 A;  1XPV A;  4GF0 A;  5LCZ A;  2B1L A;  1F37 A;  1K0B A;  4HI7 A;  1M2A A;  1AXD A;  2C0F A;  3BBY A;  3GKK A;  4RUV A;  5F07 A;  4ZBB A;  4YKG A;  5CAX A;  3ZRE A;  2VL2 A;  2J9H A;  2VD0 A;  5KOX A;  4YKF A;  2C3N A;  5AIS A;  1F9M A;  3CSJ A;  3FY7 A;  4Z2R A;  3MYD A;  2H30 A;  4IW9 A;  1TI1 A;  4LA1 A;  1RQM A;  2FNO A;  4ZIL A;  2K9F A;  4TW5 A;  5EPF A;  4GLT A;  2JAD A;  3L0H A;  3LOR A;  1AQX A;  1AQV A;  2DJJ A;  2WS2 A;  5CP1 A;  3US3 A;  5IMV A;  3IDV A;  1GTU A;  3RPN A;  2GZY A;  3VFI A;  4HOJ A;  4TN8 A;  1VF2 A;  2N5A A;  4WBJ A;  3M0F A;  2VL2 C;  1HYU A;  22GS A;  5G5E A;  3WD6 A;  4JR4 A;  4HJM A;  1SD9 A;  3EU4 A;  1S3A A;  3EUR A;  3HJO A;  3O3T A;  1GSS A;  3G7J A;  4IJI A;  3HJP A;  4NV5 A;  5DAK A;  2QC7 A;  3VI5 A;  1FB6 A;  4KSO A;  2JZT A;  4X4J A;  4JU5 A;  4IP1 A;  2Z9S A;  2JSZ A;  1YEP A;  3DML A;  4K5S A;  4POL A;  4L0W A;  2YJH A;  4OO5 A;  4BWQ A;  1JZO A;  1M7T A;  3TCO A;  3VWU A;  1OC9 B;  4F03 A;  3BOA A;  4K6X A;  4OFM A;  5BMU A;  2YCD A;  1EOH A;  2LRC A;  4KB3 A;  4MF5 A;  1G7E A;  3F0I A;  1ST9 A;  2H73 A;  4HSC X;  4K0N A;  4IQ1 A;  2RUF A;  4IBP A;  3FMW A;  2EC4 A;  4EVM A;  5D96 A;  14GS A;  2TRC P;  4H86 A;  5CNW A;  4A5P A;  4K5R A; 
#chains in the Genus database with same CATH homology
 3VLN A;  4IP6 A;  3APO A;  4DSS B;  2HRA A;  2LV3 A;  3P2A A;  1SL0 B;  3FHK A;  1K3Y A;  2F9S A;  1M2D A;  2OE0 A;  4I8B A;  4IS0 A;  1GSD A;  4O92 A;  2L5L A;  5D9X A;  5GST A;  2ON7 A;  3H4K A;  3IAS 2;  2NBS A;  5E59 A;  5F0G A;  3LWA A;  5HFG A;  2H01 A;  1DSB A;  4GXZ A;  4PXO A;  1JZD A;  2ALB A;  3A3T A;  1TTZ A;  2DKH A;  2MBT A;  1F3A A;  1PN9 A;  4Q5F A;  2VAF A;  3IBH A;  5H5S A;  4HS1 A;  1XBS A;  1TRU A;  5ECS A;  3H93 A;  1B9Y C;  2FA4 A;  2YWI A;  3A5W A;  2L4C A;  5JWQ B;  3U5R E;  5AN1 A;  3GKM A;  4O5U A;  1PX7 A;  2L57 A;  3GKX A;  5JWO B;  4E8H A;  1ZOF A;  2RII A;  3C71 A;  3RHC A;  1YF1 A;  1K0D A;  3KP9 A;  2CVD A;  2LS5 A;  5GSS A;  4LL1 B;  2JU5 A;  4I2U A;  2L6D A;  4TR3 A;  1K0N A;  2VCX A;  3C73 A;  3LQ7 A;  2VLU A;  4WF5 A;  1B9X C;  2CZ3 A;  4K0G A;  5ELA A;  2CAQ A;  3L4N A;  4MJC A;  1GUK A;  2IFQ A;  2I81 A;  1SU9 A;  2R0P A;  3ISO A;  1T4Z A;  1A2M A;  1OC3 A;  5G1K A;  1ERU A;  5G2Z A;  3C1R A;  5L71 A;  5A4V A;  4TKY A;  1QQ2 A;  4XCS A;  4OMV A;  1SKW B;  3HXS A;  3GTU A;  1E6B A;  1SD8 A;  5ECO B;  3GRX A;  1SL1 B;  3BCK A;  3ZIT A;  2GSS A;  2H76 A;  3KGK A;  5IMZ A;  3F63 A;  3HCZ A;  4EIQ A;  1AIU A;  5CYY A;  4HQZ A;  4MZB A;  4DSR A;  3L78 A;  4ML1 A;  4E8E A;  1A24 A;  5HFK A;  4XHM A;  2HXK A;  4MZW A;  2LJR A;  1T00 A;  3IHQ A;  1KNG A;  1X9S B;  1AW9 A;  4CY8 A;  4IJ3 A;  1FO5 A;  1QFN A;  2LNT A;  2HFD A;  1WMJ A;  3IV4 A;  3PIN A;  1SJ6 A;  2GVP A;  3APS A;  5ECR B;  1PKW A;  2HZE B;  1JZR A;  4G2E A;  2OAD A;  4PX1 A;  2L5O A;  19GS A;  3TRQ A;  1O85 A;  5EVO A;  4EUY A;  3HY2 A;  1ERV A;  4CDO A;  2EIO A;  2NDO A;  1E2Y A;  2LKU A;  2V41 A;  1URM A;  1MD3 A;  1EOG A;  2B6M A;  2VO4 A;  5G30 A;  2AUV A;  4NAX A;  3EIN A;  2P0G A;  2GSQ A;  5A4U A;  2VIM A;  1JLV A;  4CHS A;  2DML A;  10GS A;  1LBK A;  4FQU A;  2DJ2 A;  5CRD A;  1QK8 A;  2IMI A;  2OE3 A;  2CA8 A;  3S9F A;  1PN0 A;  1GTB A;  1GP1 A;  1EZK A;  2C0G A;  3FEU A;  4WR4 A;  4PGT A;  4V2N A;  4TRX A;  1J9B A;  1VF4 A;  5ID2 A;  1FG4 A;  2X8H A;  1TDI A;  3TJG A;  1X0R A;  2YWO A;  2IWT A;  1WP0 A;  1DUG A;  3TOT A;  5ECN B;  4JED A;  4IHU A;  3QAG A;  3QAV A;  4I5Q A;  1QUW A;  3TJF A;  3D4T A;  5IMD A;  2H6X A;  2C3T A;  1YY7 A;  3GL3 A;  1ZYE A;  3G7I A;  5ECH B;  1F6M C;  1S3C A;  3EE2 A;  1AC1 A;  3D4M A;  1K3O A;  3FR3 A;  3JCM L;  3GX0 A;  2WGR A;  1PQN A;  3G9B A;  2H66 A;  3CRU A;  20GS A;  5ECP B;  3Q6O A;  1Z6M A;  2O8V B;  2BTO T;  1C72 A;  2XPD A;  3FZ9 A;  2YWN A;  2C1Y A;  4TXO B;  2VM2 A;  2X49 A;  1XWB A;  3EMX A;  3WGD A;  1EWX A;  1HNC A;  3LW9 A;  5COH A;  4NPB A;  2DIZ A;  3HD5 A;  5J4U A;  2YJ7 A;  2QSI A;  1XFL A;  1ZYQ B;  2VCQ A;  3E0U A;  4MDC A;  3QMX A;  5JCU A;  3D6I A;  4L5O A;  1MD4 A;  1X9M B;  2DLX A;  1U3I A;  2HT9 A;  4RI7 A;  2AAW A;  5ABR A;  3GIX A;  1EGR A;  2F51 A;  4BL7 B;  2H1B A;  1OKD A;  3D0Z A;  2CAI A;  3TKS C;  1EV9 A;  3P7X A;  2BMX A;  2HLS A;  1YZX A;  4MZC A;  3K8N A;  4BVY B;  4MJB A;  3DXB A;  11GS A;  1TU8 A;  1R5A A;  2VUP A;  6GSW A;  1O73 A;  2IME A;  1TJD A;  1U3A A;  3IC4 A;  3DGQ A;  2QA1 A;  3A2V A;  3RHB A;  5DBQ A;  3P90 A;  2LRN A;  1ON4 A;  2LTK A;  4BVX B;  3I6A A;  4KDU A;  3PPU A;  2I1U A;  2IFQ B;  1XWA A;  13GS A;  4GTU A;  2NPB A;  4ZB6 A;  2XBI A;  1PA3 A;  3C7M A;  1ACV A;  3LXZ A;  4K2X A;  3OR5 A;  3RAZ A;  6GSV A;  2GQM A;  1EEJ A;  4EDY A;  3ZFL A;  2H74 A;  4CY6 A;  3LFL A;  2H1D A;  3QR6 A;  3CXG A;  3GTU B;  2GTU A;  2IMF A;  4OFN A;  3I9V 2;  3FR6 A;  1TK0 B;  4IN0 A;  4I97 A;  1SK2 A;  2MMA A;  2WJU A;  1Q4J A;  2PWJ A;  2KP1 A;  1F3B A;  1JFU A;  2FWG A;  3ZLP A;  3FKF A;  2X8G A;  4KDY A;  1XW6 A;  4KW6 A;  2DC5 A;  3RPP A;  3L9U A;  2JZR A;  5AIX A;  2H0I A;  4JBB A;  1JZW A;  4XS6 A;  1XVW A;  4YAV A;  4IGJ A;  1TRS A;  3HJM A;  4K2D A;  4Z7X A;  5ECL B;  3IXR A;  1T1V A;  2VCZ A;  4O5Q A;  1YKC A;  3VWW A;  1ZYN A;  3KTL A;  1GUL A;  2P31 A;  3KTB A;  2L59 A;  1MTC A;  4HQS A;  3EC3 A;  3M9K A;  5IOX A;  3UAR A;  16GS A;  2A2P A;  4ACS A;  3KJY A;  3VWV A;  1SYX A;  1UN2 A;  4ISD A;  1O8X A;  2HRK A;  5HR1 A;  1WE0 A;  4QL9 A;  3F3Q A;  1O6J A;  1SKS B;  4G9H A;  5H5R A;  2B1K A;  3SBC A;  5GAN D;  1XZO A;  1ZYP A;  5HR2 A;  5C04 A;  1PGT A;  3GSS A;  2DJ1 A;  2CV4 A;  3H8Q A;  3Q19 A;  3R3E A;  5FT3 A;  1ABA A;  1J08 A;  2YWM A;  5ID2 B;  1XOB A;  5D9T A;  1YKA A;  3GHA A;  2EIR A;  1T3B A;  4QL7 A;  4XS1 A;  4DSQ A;  1Z5Y E;  2FUG 2;  2G2Q A;  4D73 B;  1QXH A;  5D9W A;  4JZQ A;  4EC0 A;  1B8X A;  3WGX A;  3LYP A;  2O87 A;  2XHF A;  4NV2 A;  2OJL A;  4ZXG A;  1R26 A;  2HNL A;  3ZTL A;  5DJL A;  3GX8 A;  3GH9 A;  3ZVJ D;  9GSS A;  5IPG A;  4AGS A;  2HSH A;  1I9D A;  1XOA A;  2YOI A;  2O89 A;  5DCG A;  2ZUP A;  3MSZ A;  2FWE A;  3IRA A;  5CRG A;  3ZVJ A;  2MMZ A;  3QDN A;  4ZL7 A;  3TRX A;  3UBL A;  4ZL9 A;  4NMU A;  4EDZ A;  1T4Y A;  4OO4 A;  2IJY A;  5KN2 A;  4J57 E;  4F9Z A;  3QAW A;  2VCW A;  1UA5 A;  1GNW A;  2X99 A;  1A0R P;  3MAK A;  2K6V A;  1X5E A;  5LD0 A;  6GSS A;  3MNG A;  1V58 A;  2WDU A;  3DWV A;  3E9J B;  1BYE A;  2CZ2 A;  4KDX A;  1R7H A;  3UEM A;  6GSX A;  4CW9 A;  4HJ2 A;  3IPZ A;  3IK7 A;  3TJK A;  2K8S A;  3M3M A;  2DJ0 A;  1ZCP A;  2IMK A;  1SK1 A;  2E7P A;  1GUH A;  2HSY A;  4FYU A;  2H1A A;  1USB A;  4ID0 A;  4LL4 B;  3C1S A;  2WUL A;  5GZZ B;  1BAY A;  3U6V A;  4DVC A;  2I9H A;  1M2B A;  2GSR A;  4KCA A;  2PVO C;  3ERW A;  1X5D A;  4KCE A;  2YV9 A;  4WET A;  2FHE A;  2LST A;  2G0F A;  4GRF A;  4O5R A;  4XS4 A;  4BA7 A;  4KA0 A;  1G6Y A;  4Q5R A;  3FK8 A;  3KMO A;  5IPH A;  2H71 A;  3LJR A;  4HZ2 A;  4MCU A;  2NVL A;  1B4Q A;  1KTE A;  2GST A;  2XPE A;  3ERG A;  4PNG A;  1BED A;  2R3X A;  3M9J A;  3ZFB A;  4L8E A;  4FH8 A;  5IMF A;  1VF1 A;  1FW1 A;  1U88 A;  3CRT A;  3I43 A;  2J23 A;  2B5X A;  5C00 A;  1PL1 A;  1THO A;  3V1W A;  1M9B A;  2KP2 A;  2JSY A;  3BJ5 A;  5DVB A;  2DJ3 A;  2F8F A;  1LU4 A;  2C8U A;  2WB9 A;  2D2Z A;  2VCT A;  2OA7 A;  1XWG A;  3GA4 A;  3EWL A;  4TR1 A;  1OVN A;  2CVB A;  2FD3 A;  2FWH A;  2OKA A;  3IC8 A;  3VK9 A;  3H79 A;  3IOS A;  3EYT A;  4AJ7 A;  4FYB A;  3F9U A;  1ERW A;  3GUR A;  3F4R A;  5D73 A;  2OE1 A;  1CQG A;  4GQC A;  4HDE A;  2OAC A;  1JLW A;  2AV4 A;  5CO3 A;  5J9B A;  5A4W A;  2GS3 A;  2PU9 C;  2B5E A;  5IO0 A;  4PUR A;  4IKH A;  2NTO A;  5B8B A;  3HYP A;  1GSF A;  2CT6 A;  2C0D A;  3GFK A;  2VM1 A;  3APQ A;  3DVX A;  1NHY A;  4F2I A;  4F0B A;  2RM6 A;  1WOU A;  2HYX A;  1EP8 A;  3GYK A;  2GT5 A;  3N5O A;  2XC2 A;  3LSZ A;  5J5N A;  3A2W A;  4N0V A;  2FLS A;  4MNN A;  4WBR D;  2OBI A;  5IMC A;  3GUS A;  4V1A g;  1DBY A;  4TOP A;  1BJX A;  2M72 A;  1ZZY A;  2TRX A;  2REM A;  5DAK B;  3UL3 A;  3IA1 A;  1SK0 A;  5AIV A;  1MDI A;  4G10 A;  3TB2 A;  3TKQ A;  2JZS A;  3ZMK A;  4ZB9 A;  1W4V A;  3D22 A;  4J2F A;  3P8W A;  2M80 A;  1OYJ A;  2PVQ A;  3KEB A;  2RLI A;  4HZ4 A;  6GSU A;  1O8W A;  2YZH A;  4YAP A;  4IQA A;  3ZIV A;  4N0Z A;  1AQW A;  1XWK A;  2DJK A;  5DQS A;  5IQY A;  4RQR A;  5CRE A;  3GH6 A;  3MDK A;  1XW5 A;  4GST A;  3KP8 A;  2C80 A;  2ZNM A;  4EF0 A;  3UOM A;  4KF9 A;  5DDL A;  5CRH A;  1H4O A;  4RI6 A;  4WR5 A;  4K7N A;  1OC9 A;  3KZQ A;  3TKS A;  1WRY A;  1ML6 A;  2H8L A;  3UAP A;  1YEX A;  2AB6 A;  5HR3 A;  4YH2 A;  2GLR A;  5B7C A;  3VPQ A;  1M9A A;  1BG5 A;  3ZL5 A;  1Z3E A;  3TUE A;  1YF0 A;  1TP9 A;  3BCI A;  5ECK B;  4XTS A;  2FGX A;  3AY8 A;  3GKN A;  2O7K A;  4DSS A;  4NXI A;  3DEX A;  1Z9H A;  5A5K A;  5ECQ B;  3TJJ A;  5IOW A;  2LRT A;  4XRD A;  3FZA A;  3IAM 2;  1FOH A;  1B4P A;  3TOU A;  5B6M A;  5FHI A;  3E3E A;  5JCW A;  3UIW A;  5KOW A;  1HQO A;  3SWL A;  4Z2T A;  3Q18 A;  2V1M A;  4ZIJ A;  4OCF A;  3EU3 A;  4LMW A;  3QD9 A;  2ZCT A;  4I6X A;  4PNF A;  4POM A;  1MEK A;  1Y25 A;  1OAZ A;  2V6K A;  4ZB8 A;  4AF2 A;  4WEY A;  3WT1 A;  4EE0 A;  4BWS A;  3NOF A;  4TVE A;  2WZ9 A;  2FCH A;  3QOU A;  3J7Y b;  5HQP A;  2N5F A;  1GSE A;  1X9W B;  4GSS A;  1OKT A;  4ECC A;  3QFB C;  4ZBA A;  3A2X A;  3GMF A;  1XCC A;  4MH2 A;  2F8A A;  3ME8 A;  3F4S A;  4LLR A;  3A5I A;  4FIW A;  2HZF A;  2YNX A;  2L6C A;  3GL5 A;  2R4V A;  1G6W A;  1THX A;  2H75 A;  3KCM A;  4ILF A;  3VWX A;  3ED3 A;  3R2Q A;  4X1U A;  2R6K A;  1Z7R A;  5KN0 A;  3HZ4 A;  3G7Y A;  2DIY A;  2GT6 A;  3UVH A;  1SJZ A;  3CBU A;  1XIY A;  2X8C A;  2V32 A;  2H1G A;  2C4J A;  5KN1 A;  5AGY A;  2F3M A;  3ZZX A;  1A2J A;  4MP4 A;  2C0E A;  5INY A;  1V98 A;  3F4T A;  2KHP A;  4F82 A;  3M8N A;  4J56 E;  4F0C A;  3M1G A;  2VLV A;  1B48 A;  2VL9 A;  3IK9 A;  4MJE A;  4PTS A;  3BD2 A;  4BPY A;  4AJ8 A;  2WCI A;  4PQI A;  5BRT A;  4G0L A;  4K7O A;  1J0F A;  3D5J A;  5DAL A;  1WJK A;  3W8J A;  2FA8 A;  3LYK A;  2HZE A;  2HI7 A;  1A23 A;  1VRS D;  3EVI A;  2LQO A;  2WFC A;  4JR6 A;  1SYR A;  2AJQ B;  1S3D A;  1NHO A;  4G0K A;  4KE3 A;  1GH2 A;  4KSM A;  4AJ6 A;  3CSI A;  2RM5 A;  4EKZ A;  2VL3 A;  8GSS A;  2P5Q A;  1PL2 A;  1M0U A;  2E2M A;  3DKS A;  5ECM B;  1W89 A;  3KH7 A;  7GSS A;  3VI7 A;  4TR0 A;  2R0G A;  4Q5N A;  1PSQ A;  1G7O A;  1K3L A;  4V2L A;  1PKZ A;  1TK5 B;  4KND A;  4USS A;  2YV7 A;  4N10 A;  2A2S A;  5G31 A;  4KH7 A;  4POK A;  3IR4 A;  4WKW A;  4QQ7 A;  5DCH A;  2K18 A;  2B7J A;  2PMT A;  3LG6 A;  3UVT A;  1A0F A;  2VLT A;  1SKR B;  1U6T A;  6GST A;  2MZC A;  2BJX A;  4TXV A;  4WXT A;  3KXO A;  2MBS A;  2R2J A;  3W8S A;  3ZRD A;  1GL8 A;  2VOC A;  3KD0 A;  4X43 A;  3GNJ A;  4PQH A;  2H6Z A;  5DJM A;  1F2E A;  3Q74 A;  5IMA A;  2I3Y A;  3KIJ A;  5GAP D;  2RUE A;  1GSQ A;  1RW1 A;  3CMI A;  3HKR A;  1DE1 A;  4IEL A;  2YPM A;  3LEF A;  3DYR A;  5JCG A;  3PGT A;  2PGT A;  3KMN A;  1TRV A;  2XBQ A;  3TGZ A;  1Z7P A;  2H6Y A;  2H19 A;  1PX6 A;  3CSH A;  3W6G A;  4G19 A;  4ECI A;  3CTF A;  1G0T A;  2HE3 A;  5EY6 A;  1BQ7 A;  4WF4 A;  3EMP A;  3GN3 A;  18GS A;  5ECI B;  1OE7 A;  1NM3 A;  2QGV A;  3VPT A;  3KM6 A;  4MH3 A;  1MDJ A;  12GS A;  1PMT A;  4TXO A;  1A8Y A;  4NWY A;  3FZ4 A;  3TKP A;  3RBT A;  2H0H A;  5FWG A;  2H0G A;  2GQL A;  1RK4 A;  3F8U A;  4HU7 A;  3TKR A;  1ERT A;  2PBJ A;  3L9S A;  4L0U A;  2A2R A;  1TW9 A;  2OBK A;  1SL2 B;  1EGO A;  1WIK A;  2GZP A;  2X64 A;  4BL7 A;  4MK3 A;  2AYT A;  4HEA 2;  1PD2 1;  2GDR A;  1OE8 A;  2R5G A;  3KH9 A;  4NHZ A;  3I69 A;  2DBC A;  2WRT A;  2VD1 A;  4GCI A;  2UZ8 A;  3HZ8 A;  5CRW A;  4BVY A;  2KLX A;  1TXX A;  3FR9 A;  3GST A;  1K0A A;  1O81 A;  3J7Y k;  2E0Q A;  4PQ1 A;  4PUF C;  4K7I A;  2V6O A;  4ZL8 A;  1GLQ A;  1IYI A;  4RQX A;  2N5B A;  3WT2 A;  1EP7 A;  1SJI A;  3UJ1 A;  4EXJ A;  1QGV A;  1YJ6 A;  2KOK A;  2E2G A;  2YAN A;  5EL8 A;  3HDC A;  3UMA A;  4I2T A;  2GQK A;  5JWR B;  2JAC A;  4BVX A;  4DEJ A;  3DRN A;  1N8J A;  3RDW A;  1TKD B;  1TOF A;  1ILO A;  5KEJ A;  4MAB A;  4HU9 A;  4EO3 A;  4KAE A;  2HRN A;  3CYN A;  1A2L A;  2DKI A;  4FO5 A;  2LNS A;  2LEG A;  4YQV A;  17GS A;  1GSY A;  1AUC A;  2IMD A;  2B7K A;  4OWY A;  3DVW A;  4V1A p;  2CVK A;  1GSU A;  4ECJ A;  5G5F A;  3HVX A;  1R5P A;  2EIQ A;  3PH9 A;  1SEN A;  1XW9 A;  3EPT A;  5IO2 A;  5LNK e;  1GWC A;  2YN1 A;  1GLP A;  3IHG A;  2K8V A;  1VGL A;  1H75 A;  5J9C A;  2MYG A;  2CX3 A;  4POB A;  1NSW A;  3TKS E;  2IN3 A;  5DAL B;  1ZGN A;  1EEM A;  2H70 A;  4N30 A;  4YQU A;  3HA9 A;  1YDK A;  4KGI A;  4TR4 A;  5HFI A;  5DQY A;  5F8B A;  2DMM A;  3ZML A;  1GNE A;  1Z6N A;  5H5Q A;  4EL1 A;  3PR8 A;  4MF6 A;  1N2A A;  4IVF A;  1GTA A;  5B8A A;  2JL4 A;  5KN3 A;  1TK8 B;  4EIP A;  3N9J A;  2FWF A;  1V40 A;  2PN8 A;  1V57 A;  3QPM A;  3H1N A;  3GV1 A;  1FOV A;  1V2A A;  4KUN A;  1WWJ A;  1V9W A;  2GGT A;  2R0C A;  4ULX A;  3LGC A;  1ZL9 A;  3ZIJ A;  4V2M A;  2M46 A;  4JE1 A;  4YQM A;  1HNA A;  2VCV A;  4PUA A;  4O7H A;  3TJB A;  4K1F A;  3IE3 A;  4L5L A;  1ZMA A;  4MMM A;  5ENU A;  1KEB A;  1FAA A;  2AHE A;  3QCP A;  2A4H A;  4GWR A;  2HSM A;  3FRC A;  1VF3 A;  2CX4 A;  2LJA A;  2H72 A;  2O85 A;  3HHV A;  1UC7 A;  5B6N A;  5D9V A;  3DIE A;  5IIZ A;  3MWH A;  1FVK A;  4MF7 A;  3ERF A;  2FY6 A;  1TU7 A;  2QA2 A;  4D73 A;  1UVZ A;  1DE2 A;  1K0M A;  1XVQ A;  3F3R A;  4NHW A;  3L9V A;  5ELG A;  1A8L A;  1Q98 A;  5D93 A;  3D21 A;  3HVS A;  3C8E A;  4GSN A;  1AAZ A;  3FYG A;  4MLY A;  3O6T A;  2HRF A;  1LJR A;  1KBN A;  4ML6 A;  5G1L A;  2QKE A;  4MPG A;  4Z2U A;  5F05 A;  1IYH A;  1GUM A;  1M99 A;  4LMV A;  4MA9 A;  2KUC A;  4ECB A;  4O32 A;  2LUS A;  3QFA C;  1MDK A;  1BX9 A;  1FVJ A;  2P5R A;  1EV4 A;  1XWC A;  4K9Z A;  4MJA A;  3F6F A;  4Q5Q A;  4XIH A;  1O7U A;  3FW2 A;  2X4A A;  4K8M A;  5J41 A;  3WYW A;  3DD3 A;  1NW2 A;  4ZBD A;  1QMV A;  4MPF A;  4JRR A;  5J3R A;  3LXT A;  4KX4 A;  1FHE A;  1T8E B;  3MIX A;  3NZN A;  4HUA A;  3WGE A;  2PUK C;  3TDG A;  3FZ5 A;  3VUR A;  5F06 A;  4ICY A;  4XS4 B;  2IL3 A;  4P3Y B;  4OCE A;  5IM9 A;  2I4A A;  2MMO A;  2GZZ A;  1HD2 A;  3ZYW A;  1I5G A;  2IIY A;  4XRA A;  4OFT A;  1PRX A;  1HNB A;  1T7P B;  1JHB A;  2ES7 A;  3O76 A;  2ON5 A;  3UBK A;  1Y6E A;  3ME7 A;  2CQ9 A;  2LJK A;  1CQH A;  3NIV A;  4GQF A;  1TI3 A;  2IPA A;  2B3S A;  4X0X A;  3TRP A;  1K0O A;  1GTI A;  4FYC A;  2YZU A;  2YP6 A;  5HR0 A;  1X5C A;  3CTG A;  1YQ1 A;  1WPI A;  4OD7 A;  2A4V A;  2MMN A;  1TRW A;  1XXU A;  1K0C A;  1OC8 A;  3HVV A;  2C3Q A;  6GSY A;  4TR1 B;  3F6D A;  1U87 A;  2L4Q A;  4G0I A;  1R4W A;  2LQQ A;  2PER A;  2V2G A;  2DSA A;  2R37 A;  5D8I A;  2TIR A;  2PPT A;  5E4W A;  2B5Y A;  1FB0 A;  1GRX A;  4N11 A;  1XPV A;  4GF0 A;  5LCZ A;  2B1L A;  1F37 A;  1K0B A;  4HI7 A;  1M2A A;  1AXD A;  2C0F A;  3BBY A;  3GKK A;  4RUV A;  5F07 A;  4ZBB A;  4YKG A;  5CAX A;  3ZRE A;  2VL2 A;  2J9H A;  2VD0 A;  5KOX A;  4YKF A;  2C3N A;  5AIS A;  1F9M A;  3CSJ A;  3FY7 A;  4Z2R A;  3MYD A;  2H30 A;  4IW9 A;  1TI1 A;  4LA1 A;  1RQM A;  2FNO A;  4ZIL A;  2K9F A;  4TW5 A;  5EPF A;  4GLT A;  2JAD A;  3L0H A;  3LOR A;  1AQX A;  1AQV A;  2DJJ A;  2WS2 A;  5CP1 A;  3US3 A;  5IMV A;  3IDV A;  1GTU A;  3RPN A;  2GZY A;  3VFI A;  4HOJ A;  4TN8 A;  1VF2 A;  2N5A A;  4WBJ A;  3M0F A;  2VL2 C;  1HYU A;  22GS A;  5G5E A;  3WD6 A;  4JR4 A;  4HJM A;  1SD9 A;  3EU4 A;  1S3A A;  3EUR A;  3HJO A;  3O3T A;  1GSS A;  3G7J A;  4IJI A;  3HJP A;  4NV5 A;  5DAK A;  2QC7 A;  3VI5 A;  1FB6 A;  4KSO A;  2JZT A;  4X4J A;  4JU5 A;  4IP1 A;  2Z9S A;  2JSZ A;  1YEP A;  3DML A;  4K5S A;  4POL A;  4L0W A;  2YJH A;  4OO5 A;  4BWQ A;  1JZO A;  1M7T A;  3TCO A;  3VWU A;  1OC9 B;  4F03 A;  3BOA A;  4K6X A;  4OFM A;  5BMU A;  2YCD A;  1EOH A;  2LRC A;  4KB3 A;  4MF5 A;  1G7E A;  3F0I A;  1ST9 A;  2H73 A;  4K0N A;  4IQ1 A;  2RUF A;  4IBP A;  3FMW A;  2EC4 A;  4EVM A;  5D96 A;  14GS A;  2TRC P;  4H86 A;  5CNW A;  4A5P A;  4K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...