3S9FA

The structure of tryparedoxin i from leishmania major
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
SGVAKHLGEALKLRKQADTADMDSLSGKTVFFYFSASWCPPCRGFTPQLVEFYEKHHDSKNFEIILASWDEEEDDFNAYYAKMPWLSIPFANRNIVEALTKKYSVESIPTLIGLNADTGDTVTTRARHALTQDPMGEQFPWRDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Tryparedoxin
publication title The crystal structures of the tryparedoxin-tryparedoxin peroxidase couple unveil the structural determinants of Leishmania detoxification pathway.
pubmed doi rcsb
source organism Leishmania major
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3s9fA00
2WGRA 1GH2A 4RI7A 2D2ZA 1PA3A 3D4MA 4LLRA 3TJGA 1VRSD 3DKSA 1SL1B 2DIZA 2CVDA 1GP1A 4KH7A 2H19A 4K7NA 2E2GA 1E2YA 3D0ZA 3DIEA 1EOHA 1XFLA 3A5WA 3ERWA 3HVSA 4F2IA 2RUFA 2KP2A 3DEXA 4POLA 2CT6A 2I3YA 3RHCA 4IJ3A 2VCVA 5HR3A 2WZ9A 3HD5A 1CQHA 2YV9A 1ZCPA 5DVBA 1Z7RA 3F3RA 2FUG2 4ML6A 4LL4B 3E3EA 5GSTA 2JU5A 2AHEA 1J08A 2RUEA 2H8LA 3WYWA 4ZBDA 5H5RA 2V2GA 4HQZA 2H75A 4MH3A 2VM2A 3HJPA 2A2RA 1GUHA 4Q5NA 3OR5A 3ZFLA 2IL3A 5EPFA 5ELGA 1K3YA 1TRWA 3ZMKA 2R6KA 2CAIA 1MDIA 1I5GA 1KEBA 4MP4A 6GSVA 3ZL5A 1ERUA 2C0FA 2L5LA 1EEJA 4RQXA 2VAFA 2AAWA 1PKZA 2VM1A 1YY7A 1Z6MA 1EOGA 4WBRD 4EXJA 1QFNA 4EKZA 3VFIA 4I2TA 2GS3A 5EY6A 2YV7A 3F8UA 1LU4A 4MZBA 3QFAC 5CRWA 2R5GA 3LGCA 4JU5A 1O7UA 4MABA 4L0WA 5G30A 5A5KA 3PINA 2XBIA 1GL8A 2EC4A 3GKNA 4MA9A 2ZCTA 3KCMA 4V1Ag 1BAYA 1MD3A 3TKRA 3G7IA 4X0XA 4Z7XA 5IMCA 5INYA 1AIUA 4IVFA 1B8XA 1Q4JA 1ZGNA 2GLRA 2DJJA 3IRAA 4ZILA 5ABRA 2GSRA 3WGEA 1ERVA 1T4ZA 3APSA 5DAKB 3GSTA 2HE3A 2H66A 2TIRA 4XTSA 2R4VA 1HNCA 1HD2A 3WT1A 1CQGA 1R26A 2IJYA 1DSBA 5GZZB 5F05A 1TU8A 3BCIA 1ABAA 19GSA 1FW1A 1GTUA 1EV9A 3M8NA 3W8JA 2VD0A 1O8XA 3GYKA 5CRGA 1SKSB 2VL2C 2K18A 3DYRA 4K1FA 4ZB6A 4HI7A 1GSSA 2DJKA 3GIXA 1SJZA 1ST9A 3EE2A 2VCQA 3IAM2 1A0RP 4ECIA 4ECBA 1GUMA 4LA1A 1GLQA 3TOUA 3KH9A 3V1WA 1AAZA 4N30A 18GSA 4EO3A 1NM3A 1XOBA 3GL5A 1SK0A 2QC7A 3EMPA 5DJMA 3F6FA 3HYPA 5D9XA 3D22A 2LRTA 1YJ6A 1K0OA 4MCUA 1SL0B 1Z5YE 2XC2A 4L5LA 5J4UA 4MJCA 3TJJA 4BPYA 5L71A 1BEDA 1XCCA 2MMNA 3GKMA 1O81A 3VPTA 1XIYA 2HLSA 1SENA 3TB2A 3MDKA 4F0CA 2L6CA 4KDXA 2FWFA 4I8BA 3NIVA 4KSMA 2JL4A 2YJHA 4ML1A 2F8FA 3ZZXA 2MBSA 1M2BA 2O89A 3GH6A 4IN0A 3TJFA 1WJKA 5IMVA 2X8HA 2LNTA 3IXRA 1KTEA 3ZIVA 2NDOA 2VL2A 4NAXA 1YEPA 2E7PA 1JZDA 1V58A 3TCOA 4XRDA 3GN3A 4IW9A 1XWGA 3SBCA 1XVQA 2O87A 2LJAA 3KMNA 4ZL8A 1X5CA 2HZFA 2H01A 3IHQA 1G6YA 3GURA 5CO3A 3KZQA 5HFGA 1LBKA 5A4WA 2WB9A 4PXOA 5IMDA 3APOA 4TR1B 1FOVA 2DMLA 1M7TA 3GTUB 4ZB9A 3M3MA 2PMTA 1S3CA 3M0FA 3M9JA 4KCEA 4TVEA 2QSIA 1OC9A 3CRUA 6GSUA 1XVWA 4GCIA 3VI7A 1ON4A 1SJIA 5D9TA 4CDOA 1OE8A 4KE3A 3C1SA 3TKSE 1XW9A 2KOKA 5JCGA 5AN1A 5KN2A 3UARA 2C0DA 3EYTA 4XS1A 2IIYA 1EP8A 2JZTA 4IELA 4L5OA 5G2ZA 5DALA 4WF4A 1EGOA 4KB3A 4BWSA 3GV1A 2HYXA 4OMVA 4HUAA 5JWQB 3KP8A 2I81A 4BL7A 1N8JA 1SD9A 4O5RA 1OYJA 1U6TA 1NW2A 3HA9A 3IR4A 1VF4A 2GDRA 3L9UA 2LQQA 3H93A 2FWGA 3QDNA 1Z3EA 2YJ7A 2F9SA 3RBTA 3DVWA 2OACA 4G10A 4POBA 5J41A 5ID2B 2H6ZA 4XS4B 2VCXA 2AYTA 5HFIA 3KTBA 5DBQA 1ERWA 2QKEA 3GRXA 1ZMAA 3O6TA 5ECIB 2C1YA 1WMJA 2B5EA 2CAQA 4KSOA 2ES7A 5AIXA 1K3OA 4GXZA 2YWNA 1TRUA 1A0FA 1SYXA 2F51A 1TP9A 3KIJA 1K0DA 2DJ2A 2X99A 1AUCA 4ISDA 1WP0A 4YAVA 3IK7A 1K0NA 4ID0A 4GLTA 1XWCA 3DXBA 4G19A 4XIHA 2K8VA 2DJ3A 1T00A 2LSTA 3C1RA 1EWXA 1MD4A 3G7YA 4GRFA 1XPVA 5J3RA 3QCPA 1DUGA 1M99A 3HXSA 1GTBA 4XRAA 4HU9A 4MLYA 5ECQB 4PQHA 4MF6A 1V2AA 1O85A 3Q18A 4KW6A 3KJYA 3M1GA 4YAPA 5IOXA 3KH7A 3HY2A 1TU7A 3ZTLA 3E9JB 1SYRA 3TRPA 2O8VB 3U5RE 2FY6A 3GH9A 3H4KA 5ECPB 3QR6A 4XHMA 1AC1A 3A2VA 3UMAA 2IFQB 4NXIA 5DAKA 4KX4A 4NPBA 1GSUA 1X9WB 1YQ1A 2LRCA 1W4VA 4WR4A 4KA0A 4N0VA 3GL3A 3D4TA 2I9HA 4TN8A 2FWEA 1V40A 3ZMLA 2CQ9A 2LKUA 3GMFA 5ECMB 1DE2A 4BA7A 5F0GA 3FR3A 1NSWA 1DBYA 1GSEA 3FZ9A 4GSNA 1FAAA 5IMAA 2LNSA 1THOA 2FNOA 4DSQA 2K6VA 3TRXA 1MTCA 4FYCA 2IMIA 4WXTA 3P7XA 1GSDA 1X5DA 2H6XA 3L0HA 3LFLA 4KNDA 3IV4A 1UN2A 1Z9HA 2EIRA 2IWTA 3F3QA 1PQNA 2KUCA 5AISA 4OCEA 1TXXA 2H1BA 4MH2A 4V1Ap 4N0ZA 3APQA 2IN3A 4AJ6A 2AUVA 3MNGA 2HSYA 2XPDA 2REMA 3UAPA 3AY8A 3L4NA 4LMVA 1V98A 3LORA 1A8YA 2BJXA 5CAXA 3ISOA 4IS0A 2LUSA 3R2QA 5D9WA 3I43A 2OADA 1VF1A 2TRCP 1XXUA 2JACA 5E59A 4D73B 3O76A 2C3QA 3LXZA 1FB0A 1WIKA 4JZQA 1USBA 4K2DA 4E8HA 2VL9A 3CTGA 4NV2A 5C00A 3PR8A 1OVNA 3CBUA 3ZYWA 2CZ3A 5ENUA 2VLTA 1F37A 2X8GA 5D9VA 3CSHA 4ACSA 4AJ7A 4QQ7A 6GSXA 4O7HA 5IMZA 3TDGA 3G7JA 1EEMA 4MMMA 1PN9A 2XBQA 4MJEA 6GSSA 1U3AA 1PRXA 3GX8A 3GHAA 4K9ZA 1JLVA 1OKTA 2L57A 9GSSA 2L5OA 3FW2A 2YWOA 3HJOA 16GSA 3WGXA 2PPTA 4BVYA 1TTZA 2DJ0A 4X1UA 4G9HA 1S3AA 1FB6A 3DGQA 2GZYA 3CXGA 2B5XA 2G2QA 1IYHA 3L9SA 3MAKA 2JSYA 4GQCA 5HQPA 1G6WA 1M0UA 4DSSB 2AV4A 1MEKA 2GQMA 4MJAA 2NTOA 4V2MA 2WFCA 5ECOB 1QMVA 4TXOB 1TRVA 3NZNA 3GNJA 5AIVA 1TI3A 3TOTA 3D21A 3IAS2 1J0FA 1YF1A 4I6XA 3F4TA 4I97A 2V6OA 4XS4A 3N9JA 3FK8A 1SKRB 2B6MA 2CX3A 3HCZA 3RPNA 2WS2A 1XW6A 2MMAA 3GA4A 2TRXA 2ZUPA 3FZ5A 3L78A 2GSSA 1X5EA 3UVHA 4PX1A 1X0RA 3HJMA 2VIMA 5JWOB 3CSJA 4ULXA 2K9FA 5IO0A 4PNGA 3EURA 3ZITA 2JZRA 1W89A 4DEJA 1Y6EA 4CW9A 3Q6OA 2C0GA 3LEFA 4PURA 4DVCA 1Y25A 4YQUA 2DIYA 3CTFA 1R7HA 3CSIA 2GQKA 5CRHA 3TKSC 3LJRA 3UL3A 2H0GA 1K0BA 2F8AA 1AQXA 4HZ2A 4K0GA 5FHIA 3LYPA 1GTAA 3UIWA 3IOSA 2B7KA 1R5PA 2H74A 2LEGA 1WRYA 2ON5A 3UVTA 4JBBA 5ECNB 2N5BA 3I9V2 5IO2A 3EVIA 1A23A 1GSFA 2YZUA 4TRXA 3H1NA 1WE0A 2CVKA 1T7PB 4ZBAA 1A2MA 4AGSA 5HR0A 5IQYA 4YH2A 1KBNA 3ME8A 4GWRA 4POMA 4HJMA 3I69A 5J5NA 1GWCA 3VI5A 2PUKC 2HZEA 3P2AA 2AB6A 1B4QA 2MBTA 2FLSA 1WWJA 1WPIA 3DVXA 4KDUA 2XPEA 1EP7A 5DDLA 1AQWA 1WOUA 1YF0A 3C8EA 3VPQA 4IJIA 2KHPA 4OWYA 4PQIA 3UEMA 1XW5A 1A2JA 2CA8A 4F03A 3TKSA 2H76A 2LRNA 4Q5RA 2LTKA 2ON7A 4K8MA 3FKFA 1FG4A 2WJUA 4GSTA 5G5FA 5H5SA 1YZXA 1QK8A 4G2EA 1GRXA 3KD0A 1G7EA 1GSQA 5GSSA 2C0EA 1TKDB 3ZRDA 4YQMA 3NOFA 4CHSA 1ERTA 1XWBA 2F3MA 4MPGA 3LXTA 3LYKA 1XWKA 1F2EA 3IE3A 4K6XA 5FT3A 5J9CA 1E6BA 1ZL9A 4X43A 4ZXGA 1SJ6A 2IPAA 3RHBA 2H0IA 4PUAA 4EE0A 1U3IA 3I6AA 3FRCA 2PVOC 4ZL9A 4N11A 4I2UA 2ALBA 2L4QA 2MMOA 2NVLA 2HI7A 2HNLA 1B9YC 2GT5A 2NBSA 5ECHB 3ZLPA 5KN0A 2C8UA 5G1KA 2B3SA 1VGLA 5B7CA 3RDWA 5JCUA 4YQVA 3J7Yk 11GSA 4PGTA 3TRQA 1YEXA 5IPHA 4D73A 3S9FA 3UJ1A 1YKAA 4OD7A 4WBJA 4KCAA 5ELAA 22GSA 2M72A 2LV3A 3EINA 4MF5A 2HRFA 3BCKA 1XBSA 4K0NA 4J2FA 4F0BA 3EMXA 4I5QA 1TDIA 2YWMA 3D5JA 2X8CA 5G1LA 4ZB8A 5ECRB 1PX7A 2VLVA 3MSZA 6GSYA 4ZBBA 3DD3A 6GSWA 2EIQA 4HEA2 4IP6A 4IHUA 2FCHA 1SK1A 5EL8A 4NWYA 3QAVA 3LWAA 2I1UA 2P0GA 1GTIA 3IBHA 1GNEA 4J56E 1Q98A 1GSYA 4KUNA 4JE1A 5EVOA 4MPFA 2B1LA 5LD0A 2L4CA 3BD2A 1B9XC 3F4SA 3A2WA 1H4OA 2KP1A 3PGTA 4AJ8A 1C72A 2DBCA 2N5FA 1A2LA 2GQLA 1K0MA 1XZOA 1GLPA 2N5AA 1YDKA 3LSZA 5F8BA 2GZZA 1FO5A 2I4AA 5DQSA 17GSA 5F06A 4DSSA 3GKKA 2LQOA 3EU3A 2HRNA 2J9HA 5D73A 5IOWA 5DCGA 2OE0A 4L8EA 4TKYA 4TR4A 5KN3A 2E0QA 3GFKA 1RQMA 1OC9B 5GAND 1M9BA 3EC3A 1O73A 3TKQA 1F3AA 4PUFC 2H72A 3TKPA 3DRNA 2YN1A 1PKWA 1PX6A 3ZIJA 2P5QA 4HQSA 1QXHA 1AXDA 2H6YA 1ZOFA 2H0HA 2WCIA 6GSTA 5DALB 3QPMA 3Q74A 2CV4A 5IIZA 4MF7A 4QL9A 1VF2A 3F0IA 2OBIA 5J9BA 1BX9A 4JR6A 4TOPA 2MYGA 5DCHA 2VD1A 2X64A 1EGRA 1X9MB 1JZRA 4IBPA 4LL1B 3M9KA 4BVXA 4HU7A 1PGTA 4GTUA 1G7OA 3VK9A 2NPBA 3VWXA 1V57A 5F07A 2RM5A 1BQ7A 3PH9A 2DLXA 3A2XA 2HFDA 4NV5A 3K8NA 2GZPA 3TJBA 2R2JA 3KXOA 3IA1A 4P3YB 2VCWA 1JZOA 3VWUA 4MZWA 3QAWA 2WDUA 1ZZYA 2L59A 4KDYA 3GUSA 4HS1A 1RW1A 5COHA 1BYEA 3FR9A 4F9ZA 3SWLA 4Q5FA 2HXKA 1MDJA 5B8BA 1JFUA 3IDVA 3KEBA 3O3TA 5DJLA 5A4VA 2G0FA 2H73A 4FIWA 4EUYA 4TXVA 3US3A 4TR1A 2YPMA 3GTUA 2YCDA 1FHEA 2VO4A 1SKWB 2OE1A 2JZSA 2ZNMA 3F6DA 4GSSA 1OE7A 1U88A 1ZYEA 2OBKA 3BBYA 5IMFA 4ECJA 3TGZA 5E4WA 10GSA 1EZKA 4GF0A 14GSA 2HSHA 3JCML 3F9UA 4IKHA 1DE1A 2IMKA 4E8EA 4O92A 1THXA 1PMTA 1K3LA 3BJ5A 2DSAA 2H30A 3D6IA 2B1KA 4KAEA 3UBKA 1OC8A 1AW9A 2YANA 3DWVA 4IP1A 2FGXA 2VOCA 1X9SB 1M2AA 1O6JA 3QMXA 1YKCA 4HDEA 3RAZA 2GT6A 2PWJA 1T4YA 1UA5A 1T3BA 4FH8A 1T8EB 4LMWA 2GVPA 4L0UA 1Z6NA 2K8SA 4WF5A 2OA7A 1JHBA 1Z7PA 1XWAA 2M46A 2YP6A 1F6MC 1PL2A 2RM6A 1K0CA 7GSSA 1TI1A 3KGKA 13GSA 3A3TA 1FVJA 2A4VA 4MDCA 5KN1A 2FWHA 2Z9SA 2M80A 3HVXA 4JRRA 2JSZA 1HQOA 5G31A 5IPGA 5ID2A 1HYUA 2KLXA 2H1GA 1SL2B 1U87A 3F63A 2H71A 3DMLA 1TRSA 12GSA 2LJKA 2R37A 4ECCA 4JEDA 1UVZA 3ZREA 4FO5A 2VCTA 1LJRA 5H5QA 4EDZA 2HT9A 1A8LA 4WETA 1JZWA 3IC4A 2C3NA 2FHEA 2VL3A 4XCSA 4WEYA 5HR1A 3WT2A 5AGYA 4EC0A 2LJRA 4EL1A 4EF0A 4NHWA 3FZ4A 3C7MA 3KMOA 3BOAA 3EWLA 2PU9C 3FR6A 5ECSA 1HNBA 3G9BA 3ED3A 1RK4A 3WGDA 1AQVA 3IK9A 3CMIA 3HVVA 1K0AA 3LQ7A 1TK0B 4QL7A 3IPZA 2DC5A 4OFNA 5B6MA 2VLUA 5JWRB 4PNFA 2AJQB 4RQRA 3ZVJD 2JADA 4J57E 4F82A 1R4WA 2IFQA 4BWQA 1ACVA 2OKAA 1GNWA 2CVBA 4FYUA 1O8WA 2WULA 5LCZA 5KEJA 1NHOA 1TW9A 2YWIA 3GX0A 2C3TA 3E0UA 4K7IA 2O85A 1IYIA 4O32A 3FHKA 2V32A 2PERA 1N2AA 2H70A 3ERFA 4RUVA 1V9WA 4HOJA 1SU9A 4WKWA 4N10A 4OFTA 3VWWA 4FYBA 2YOIA 3FYGA 3WD6A 2P31A 1I9DA 1ML6A 5A4UA 2PN8A 5D8IA 1ILOA 2C80A 4K7OA 4XS6A 3TUEA 4EDYA 2OE3A 2DJ1A 2YNXA 2CZ2A 4TW5A 5GAPD 4GQFA 3VLNA 1SK2A 1J9BA 3CRTA 3QAGA 1F3BA 3KP9A 3P8WA 2IMEA 3ZFBA 5JCWA 2GTUA 5LNKe 4KGIA 3QFBC 4RI6A 3W6GA 3HHVA 1H75A 2C4JA 5B6NA 3VURA 2V1MA 3HZ4A 2OJLA 1B48A 2RLIA 3Q19A 5D93A 1UC7A 3VWVA 1OC3A 3H8QA 4HZ4A 3C71A 4TR3A 1ZYQB 1EV4A 2VCZA 2VUPA 3GKXA 5B8AA 4ILFA 3ZVJA 1OAZA 5DQYA 5CREA 3LG6A 2B7JA 2QGVA 3UOMA 1R5AA 1M2DA 2IMFA 2V41A 1S3DA 2L6DA 4V2NA 3ME7A 1TJDA 1GUKA 2MZCA 5CNWA 4H86A 2YZHA 5CRDA 2V6KA 3QD9A 5HR2A 1PL1A 1VF3A 2PGTA 1FVKA 3F4RA 4POKA 3U6VA 3KM6A 2CX4A 1PSQA 1HNAA 4IGJA 2FA4A 1KNGA 1B4PA 2RIIA 5C04A 4OO4A 4V2LA 4AF2A 1QGVA 20GSA 2PBJA 4HJ2A 4NHZA 1T1VA 1GULA 5ECKB 1OKDA 3HDCA 4DSRA 1SD8A 1TOFA 3MWHA 4ZL7A 4MK3A 2J23A 4EVMA 5HFKA 2O7KA 2B5YA 1TK5B 1G0TA 1TK8B 2H1AA 1F9MA 3H79A 4IQ1A 1PD21 4OCFA 3EU4A 4Q5QA 5IM9A 1XOAA 3RPPA 4IQAA 3GSSA 4ZIJA 3UBLA 3W8SA 3FZAA 3L9VA 3P90A 4NMUA 5CYYA 5G5EA 2GGTA 3KTLA 2XHFA 5CP1A 2BMXA 4WR5A 1URMA 4MJBA 3FEUA 1BJXA 2A2SA 2R3XA 3TJKA 1JLWA 3FY7A 2P5RA 3HZ8A 2E2MA 2GSQA 3J7Yb 4TR0A 3ERGA 4OO5A 2HZEB 2FD3A 2EIOA 2H1DA 2FA8A 5FWGA 4TXOA 3HKRA 2LS5A 2WRTA 4JR4A 4PQ1A 3CYNA 8GSSA 1M9AA 3C73A 1QUWA 2GSTA 1NHYA 2IMDA 1BG5A 4MZCA 1A24A 4OFMA 1MDKA 2BTOT 2PVQA 3N5OA 2MMZA 2DMMA 5D96A 1QQ2A 3QOUA 5ECLB
chains in the Genus database with same CATH superfamily
2WGRA 1GH2A 4RI7A 2D2ZA 1PA3A 3D4MA 4LLRA 3TJGA 1VRSD 3DKSA 1SL1B 2DIZA 2CVDA 2HRKA 1GP1A 4KH7A 2H19A 4K7NA 2E2GA 1E2YA 3D0ZA 3DIEA 1EOHA 1XFLA 3A5WA 3ERWA 3HVSA 2UZ8A 4F2IA 2RUFA 2KP2A 3DEXA 4K5RA 4POLA 2CT6A 2I3YA 3RHCA 4IJ3A 2VCVA 5HR3A 2WZ9A 3HD5A 1CQHA 2YV9A 4EIQA 1ZCPA 5DVBA 1Z7RA 3F3RA 2FUG2 4ML6A 4LL4B 3E3EA 5GSTA 2JU5A 2HRAA 2AHEA 1J08A 2RUEA 2H8LA 3WYWA 1PFOA 4ZBDA 5H5RA 2V2GA 4HQZA 2H75A 4MH3A 2VM2A 3HJPA 2A2RA 1GUHA 4Q5NA 3OR5A 3ZFLA 2IL3A 5EPFA 5ELGA 1K3YA 1TRWA 3ZMKA 2R6KA 4YKGA 4O5QA 2CAIA 1MDIA 1I5GA 1KEBA 4MP4A 6GSVA 3ZL5A 1ERUA 2C0FA 2L5LA 1EEJA 4RQXA 2VAFA 2AAWA 1PKZA 2VM1A 1YY7A 1Z6MA 1EOGA 4WBRD 4EXJA 1QFNA 4EKZA 3VFIA 1ZYPA 4I2TA 2GS3A 5EY6A 2YV7A 5BMUA 3F8UA 1LU4A 4MZBA 3QFAC 5CRWA 2R5GA 3LGCA 4JU5A 1O7UA 4MABA 4L0WA 5G30A 5A5KA 3PINA 2XBIA 1GL8A 2EC4A 3GKNA 4MA9A 2ZCTA 3KCMA 4V1Ag 1BAYA 1MD3A 3TKRA 3G7IA 4G0LA 4X0XA 4Z7XA 5IMCA 5INYA 1AIUA 4IVFA 1B8XA 1Q4JA 1ZGNA 2GLRA 2DJJA 3IRAA 4ZILA 5ABRA 2GSRA 3WGEA 1ERVA 1T4ZA 3APSA 5DAKB 3GSTA 2HE3A 2H66A 2TIRA 4G0KA 4XTSA 2R4VA 1HNCA 1HD2A 3WT1A 1CQGA 1R26A 2IJYA 1DSBA 5GZZB 5F05A 1TU8A 3BCIA 1ABAA 19GSA 1FW1A 1GTUA 1EV9A 3M8NA 3W8JA 2VD0A 1O8XA 3GYKA 5CRGA 1SKSB 2VL2C 2K18A 3DYRA 4K1FA 4ZB6A 4HI7A 1GSSA 2DJKA 3GIXA 1SJZA 1ST9A 3EE2A 2VCQA 3IAM2 1A0RP 4ECIA 4ECBA 4YKFA 1GUMA 4LA1A 1GLQA 3TOUA 3KH9A 3V1WA 1AAZA 4N30A 18GSA 4EO3A 1NM3A 1XOBA 3GL5A 1SK0A 2QC7A 3EMPA 5DJMA 3F6FA 3HYPA 3EPTA 5D9XA 3D22A 2LRTA 1YJ6A 1K0OA 4MCUA 1SL0B 1Z5YE 2XC2A 4L5LA 5J4UA 4MJCA 3TJJA 4BPYA 5L71A 1BEDA 1XCCA 1XG8A 2MMNA 3GKMA 1O81A 3VPTA 1XIYA 2HLSA 1SENA 3TB2A 3MDKA 4F0CA 2L6CA 4KDXA 2FWFA 4I8BA 3NIVA 4KSMA 2JL4A 2YJHA 4ML1A 2F8FA 3ZZXA 2MBSA 1M2BA 2O89A 3GH6A 4IN0A 3TJFA 1WJKA 5IMVA 2X8HA 2LNTA 3IXRA 1KTEA 3ZIVA 2NDOA 2VL2A 4NAXA 1YEPA 2E7PA 1JZDA 1V58A 3TCOA 4XRDA 3GN3A 3LW9A 4IW9A 1XWGA 1M3IA 3SBCA 1XVQA 2O87A 2LJAA 3KMNA 4ZL8A 1X5CA 2HZFA 2H01A 3IHQA 1G6YA 3GURA 5CO3A 3KZQA 5HFGA 1LBKA 5A4WA 2WB9A 4PXOA 5IMDA 3APOA 4TR1B 1FOVA 2DMLA 1M7TA 3GTUB 4ZB9A 3M3MA 2PMTA 1S3CA 3M0FA 3M9JA 4KCEA 4TVEA 2QSIA 1OC9A 3CRUA 6GSUA 1XVWA 4GCIA 3VI7A 1ON4A 1SJIA 5D9TA 4CDOA 1OE8A 4KE3A 3C1SA 3TKSE 1XW9A 2KOKA 5JCGA 5AN1A 5KN2A 3UARA 2C0DA 3EYTA 4XS1A 2IIYA 1EP8A 2JZTA 4IELA 4L5OA 5G2ZA 5DALA 4USSA 4WF4A 1EGOA 1ZYNA 4KB3A 4BWSA 3GV1A 2HYXA 4OMVA 4HUAA 5JWQB 3KP8A 2I81A 4BL7A 1N8JA 1SD9A 4O5RA 1OYJA 1U6TA 1NW2A 3HA9A 3IR4A 1VF4A 2GDRA 3L9UA 2LQQA 3H93A 2FWGA 3QDNA 1Z3EA 2YJ7A 2F9SA 3RBTA 3DVWA 2OACA 4G10A 4POBA 5J41A 5ID2B 2H6ZA 4XS4B 2VCXA 2AYTA 5HFIA 3KTBA 5DBQA 1ERWA 2QKEA 3GRXA 1ZMAA 3O6TA 5ECIB 2C1YA 1WMJA 2B5EA 2CAQA 4KSOA 2ES7A 5AIXA 5KOWA 1K3OA 4GXZA 2YWNA 1TRUA 1A0FA 1SYXA 2F51A 1TP9A 3KIJA 1K0DA 2DJ2A 2X99A 1AUCA 4ISDA 1WP0A 4YAVA 3IK7A 1K0NA 2QA1A 4ID0A 4GLTA 1XWCA 3DXBA 4G19A 4XIHA 2K8VA 2DJ3A 1T00A 2LSTA 3C1RA 1EWXA 1MD4A 3G7YA 4GRFA 1XPVA 5J3RA 3QCPA 1DUGA 1M99A 3HXSA 1GTBA 4XRAA 4HU9A 4MLYA 5ECQB 4PQHA 4MF6A 1V2AA 1O85A 3Q18A 4KW6A 3KJYA 3M1GA 4YAPA 5IOXA 3KH7A 3HY2A 1TU7A 3ZTLA 3E9JB 1SYRA 3TRPA 2O8VB 3U5RE 2FY6A 3GH9A 3H4KA 5ECPB 3QR6A 4XHMA 1AC1A 3HVNA 4EIPA 3A2VA 3UMAA 2IFQB 4NXIA 5DAKA 2R0PA 4KX4A 1GSUA 4NPBA 1X9WB 1YQ1A 2LRCA 1W4VA 4WR4A 4KA0A 4N0VA 3GL3A 3D4TA 2I9HA 4TN8A 2FWEA 1V40A 3ZMLA 2CQ9A 2LKUA 3GMFA 5ECMB 1DE2A 4BA7A 5F0GA 3FR3A 1NSWA 1DBYA 1GSEA 3FZ9A 4GSNA 3FMWA 1FAAA 5IMAA 2LNSA 1THOA 4A5PA 2FNOA 4DSQA 2K6VA 3TRXA 1MTCA 4FYCA 2IMIA 4WXTA 3P7XA 1GSDA 1X5DA 2H6XA 3L0HA 3LFLA 4KNDA 3IV4A 1UN2A 1Z9HA 2EIRA 2IWTA 3F3QA 1PQNA 2KUCA 5AISA 4OCEA 1TXXA 2H1BA 4MH2A 4V1Ap 4N0ZA 3APQA 2IN3A 4X4JA 4AJ6A 2AUVA 3MNGA 2HSYA 2XPDA 2REMA 5BRTA 3UAPA 3AY8A 3L4NA 4LMVA 1V98A 3LORA 1A8YA 2BJXA 5CAXA 3ISOA 4IS0A 2LUSA 3R2QA 5D9WA 3I43A 2OADA 1VF1A 2TRCP 1XXUA 2JACA 5E59A 4D73B 3O76A 2C3QA 3LXZA 1FB0A 1WIKA 2X4AA 4JZQA 1USBA 4K2DA 4E8HA 2VL9A 3CTGA 4NV2A 5C00A 3PR8A 1OVNA 3CBUA 3ZYWA 2CZ3A 5ENUA 2VLTA 1F37A 5KOXA 2X8GA 4Z2UA 5D9VA 3CSHA 4ACSA 4AJ7A 4QQ7A 6GSXA 4O7HA 5IMZA 3TDGA 4Z2TA 3G7JA 1EEMA 4MMMA 4CY8A 1PN9A 1S3RA 2XBQA 4MJEA 6GSSA 1U3AA 1PRXA 3GX8A 3GHAA 4K9ZA 1JLVA 1OKTA 2L57A 9GSSA 2L5OA 3FW2A 2YWOA 3HJOA 16GSA 3PPUA 3WGXA 2PPTA 4BVYA 1TTZA 2DJ0A 4X1UA 4G9HA 3R3EA 1S3AA 1PN0A 1FB6A 3DGQA 2GZYA 3CXGA 2B5XA 2G2QA 1IYHA 3L9SA 3MAKA 2JSYA 4GQCA 5HQPA 1G6WA 1M0UA 4DSSB 2AV4A 1MEKA 2GQMA 4MJAA 2NTOA 4V2MA 2WFCA 2A4HA 5ECOB 1QMVA 4PTSA 4TXOB 1TRVA 3NZNA 3GNJA 5AIVA 1TI3A 3TOTA 3D21A 3IAS2 1J0FA 1YF1A 4I6XA 3F4TA 4I97A 2V6OA 4XS4A 3N9JA 3FK8A 3IHGA 1SKRB 2B6MA 2CX3A 3HCZA 3RPNA 2WS2A 1XW6A 2MMAA 3GA4A 2TRXA 2ZUPA 3FZ5A 3L78A 2GSSA 1X5EA 3UVHA 4PX1A 1X0RA 3HJMA 2VIMA 5JWOB 3CSJA 4BVXB 4ULXA 2K9FA 5IO0A 4PNGA 3EURA 3ZITA 2JZRA 1W89A 4DEJA 1Y6EA 4CW9A 3Q6OA 4PURA 2C0GA 3LEFA 4DVCA 1Y25A 4YQUA 2DIYA 3CTFA 1R7HA 3CSIA 2GQKA 5CRHA 3TKSC 3LJRA 3UL3A 2H0GA 1K0BA 2F8AA 1AQXA 4HZ2A 4K0GA 5FHIA 3LYPA 1GTAA 3UIWA 3IOSA 2B7KA 1R5PA 2H74A 2LEGA 1WRYA 2ON5A 3UVTA 4JBBA 5ECNB 2N5BA 3I9V2 5IO2A 3EVIA 1A23A 1GSFA 2YZUA 4TRXA 3H1NA 1WE0A 2CVKA 1T7PB 1FOHA 4ZBAA 1A2MA 4AGSA 5HR0A 5IQYA 4YH2A 1KBNA 3ME8A 4GWRA 4POMA 4HJMA 3I69A 5J5NA 1GWCA 3VI5A 2PUKC 2HZEA 3P2AA 2AB6A 1B4QA 2MBTA 2FLSA 1WWJA 1WPIA 3DVXA 4KDUA 2XPEA 1EP7A 5DDLA 1AQWA 1WOUA 1YF0A 3C8EA 3VPQA 4IJIA 2KHPA 4OWYA 4PQIA 3UEMA 1XW5A 1A2JA 2CA8A 4F03A 3TKSA 2H76A 2LRNA 4Q5RA 2LTKA 2ON7A 4K8MA 3FKFA 1FG4A 2WJUA 4GSTA 5G5FA 5H5SA 1YZXA 1QK8A 4G2EA 1GRXA 3KD0A 1G7EA 1GSQA 2DKIA 5GSSA 2C0EA 1TKDB 3ZRDA 4YQMA 3NOFA 4CHSA 1ERTA 1XWBA 2F3MA 4MPGA 3LXTA 3LYKA 1XWKA 1F2EA 3IE3A 4K6XA 5FT3A 5J9CA 1E6BA 1ZL9A 4ZXGA 1SJ6A 2IPAA 3RHBA 2H0IA 4PUAA 4EE0A 1U3IA 3I6AA 3FRCA 2PVOC 4ZL9A 4N11A 4I2UA 2ALBA 2L4QA 2MMOA 2NVLA 4HSCX 2HI7A 2HNLA 1B9YC 2GT5A 2NBSA 5ECHB 3ZLPA 5KN0A 2C8UA 5G1KA 2B3SA 1VGLA 5B7CA 3RDWA 5JCUA 4YQVA 3J7Yk 11GSA 4PGTA 3TRQA 1YEXA 5IPHA 4D73A 3S9FA 3UJ1A 1YKAA 4OD7A 4WBJA 4KCAA 5ELAA 22GSA 2M72A 2LV3A 3EINA 4MF5A 2HRFA 3BCKA 1XBSA 4K0NA 4J2FA 4F0BA 3EMXA 4I5QA 1TDIA 2YWMA 3D5JA 2X8CA 5G1LA 4ZB8A 5ECRB 1PX7A 4Z2RA 2VLVA 3MSZA 6GSYA 4ZBBA 3DD3A 6GSWA 2EIQA 4HEA2 4IP6A 4IHUA 2FCHA 1SK1A 5EL8A 4NWYA 3QAVA 3LWAA 2I1UA 2P0GA 1GTIA 3IBHA 4O5UA 1GNEA 4J56E 1Q98A 1GSYA 4KUNA 4JE1A 5EVOA 4MPFA 2B1LA 5LD0A 2L4CA 3BD2A 1B9XC 3F4SA 3A2WA 1H4OA 2KP1A 3PGTA 4AJ8A 1C72A 2DBCA 2N5FA 1A2LA 2GQLA 1K0MA 1XZOA 1GLPA 2N5AA 1YDKA 3LSZA 5F8BA 2GZZA 1FO5A 2I4AA 5DQSA 17GSA 5F06A 4DSSA 3GKKA 2LQOA 3EU3A 2HRNA 2J9HA 5D73A 5IOWA 5DCGA 2OE0A 4L8EA 4TKYA 4TR4A 5KN3A 2E0QA 3GFKA 1RQMA 1OC9B 5GAND 1M9BA 3EC3A 1O73A 3MYDA 3TKQA 3A5IA 1F3AA 4PUFC 2H72A 3TKPA 3DRNA 2YN1A 1PKWA 1PX6A 3ZIJA 2P5QA 4HQSA 1QXHA 1AXDA 2H6YA 1ZOFA 2H0HA 2WCIA 6GSTA 5DALB 3QPMA 3Q74A 2CV4A 5IIZA 4MF7A 4QL9A 1VF2A 3F0IA 2OBIA 5J9BA 4BL7B 1BX9A 4JR6A 4TOPA 2MYGA 2VD1A 2X64A 4K2XA 5DCHA 1EGRA 1X9MB 1JZRA 4IBPA 4LL1B 3M9KA 4BVXA 4HU7A 1PGTA 4GTUA 1G7OA 3VK9A 2NPBA 3VWXA 1V57A 5F07A 2RM5A 1BQ7A 3PH9A 2DLXA 3A2XA 2HFDA 4NV5A 3K8NA 2GZPA 3TJBA 2R2JA 3KXOA 3IA1A 4P3YB 2VCWA 1JZOA 2DKHA 3VWUA 4MZWA 3QAWA 2WDUA 1ZZYA 2L59A 4KDYA 3GUSA 4HS1A 1RW1A 5COHA 2R0GA 1BYEA 3FR9A 4F9ZA 3SWLA 4Q5FA 2HXKA 1M3JA 1MDJA 5B8BA 1JFUA 3IDVA 3KEBA 3O3TA 5DJLA 5A4VA 2G0FA 2H73A 4FIWA 4EUYA 2X49A 4TXVA 3US3A 2A2PA 4BIKA 4TR1A 2YPMA 3GTUA 2YCDA 1FHEA 2VO4A 1SKWB 2OE1A 2JZSA 2ZNMA 3F6DA 4GSSA 1OE7A 1U88A 1ZYEA 4FQUA 2OBKA 3BBYA 5IMFA 4ECJA 3TGZA 4G0IA 5E4WA 10GSA 1EZKA 4GF0A 14GSA 2HSHA 3JCML 3F9UA 4IKHA 1DE1A 2IMKA 4E8EA 4O92A 1THXA 1PMTA 1K3LA 3BJ5A 2DSAA 2H30A 3D6IA 2B1KA 4KAEA 3UBKA 1OC8A 1AW9A 2YANA 3DWVA 4IP1A 4KF9A 2FGXA 2VOCA 1X9SB 1M2AA 1O6JA 3QMXA 1YKCA 4HDEA 3RAZA 2GT6A 2PWJA 1T4YA 1UA5A 1T3BA 4FH8A 1T8EB 4LMWA 2GVPA 4L0UA 1Z6NA 2K8SA 4WF5A 2OA7A 1JHBA 1Z7PA 1XWAA 2M46A 2YP6A 1F6MC 1PL2A 2RM6A 1K0CA 7GSSA 1TI1A 3KGKA 13GSA 3A3TA 1FVJA 2A4VA 4MDCA 5KN1A 2FWHA 2Z9SA 2M80A 3HVXA 4JRRA 2JSZA 1HQOA 5G31A 5IPGA 5ID2A 1HYUA 2KLXA 2H1GA 1SL2B 1U87A 3F63A 2H71A 3DMLA 1TRSA 12GSA 2LJKA 2R37A 4ECCA 4JEDA 1UVZA 3IC8A 4FO5A 3ZREA 2VCTA 1LJRA 5H5QA 4EDZA 2HT9A 1A8LA 4WETA 1JZWA 3IC4A 2C3NA 2FHEA 2VL3A 4XCSA 4WEYA 5HR1A 3WT2A 5AGYA 4EC0A 2LJRA 4EL1A 4EF0A 4NHWA 3FZ4A 3C7MA 3KMOA 3BOAA 3EWLA 2PU9C 3FR6A 5ECSA 1HNBA 3G9BA 3ED3A 1RK4A 3WGDA 1AQVA 3IK9A 3CMIA 3HVVA 1K0AA 3LQ7A 1TK0B 4QL7A 3IPZA 2DC5A 4OFNA 2R0CA 5B6MA 2VLUA 5JWRB 4PNFA 2AJQB 4RQRA 3ZVJD 2JADA 4J57E 4F82A 1R4WA 2IFQA 4BWQA 1ACVA 2OKAA 1GNWA 2CVBA 4FYUA 1O8WA 2WULA 5LCZA 5KEJA 1NHOA 1TW9A 2YWIA 3GX0A 2C3TA 3E0UA 4K7IA 2O85A 1IYIA 3MIXA 4O32A 3FHKA 2V32A 2PERA 1N2AA 2H70A 3ERFA 4RUVA 1V9WA 4HOJA 1SU9A 4WKWA 4N10A 4OFTA 3VWWA 4FYBA 2YOIA 3FYGA 3WD6A 2P31A 1I9DA 1ML6A 5A4UA 2PN8A 5D8IA 1ILOA 2C80A 4K7OA 4XS6A 3TUEA 4EDYA 2OE3A 2DJ1A 2YNXA 2CZ2A 4TW5A 5GAPD 4GQFA 3VLNA 1SK2A 1J9BA 3CRTA 3QAGA 1F3BA 2HSMA 3KP9A 4BVYB 3P8WA 2IMEA 3ZFBA 5JCWA 2GTUA 5LNKe 4KGIA 3QFBC 4RI6A 3W6GA 3HHVA 1H75A 2C4JA 5B6NA 3VURA 2V1MA 3HZ4A 2OJLA 1B48A 2RLIA 3Q19A 5D93A 1UC7A 3VWVA 1OC3A 3H8QA 4HZ4A 3C71A 4TR3A 1ZYQB 1EV4A 2VCZA 2VUPA 3GKXA 5B8AA 4ILFA 3ZVJA 1OAZA 5DQYA 5CREA 3LG6A 2B7JA 2QGVA 4MNNA 3UOMA 1R5AA 1M2DA 2IMFA 2V41A 1S3DA 2L6DA 4V2NA 3ME7A 1TJDA 1GUKA 2MZCA 5CNWA 4H86A 2YZHA 5CRDA 2V6KA 3QD9A 5HR2A 1PL1A 1VF3A 2PGTA 1FVKA 3F4RA 4POKA 3U6VA 3KM6A 2CX4A 1PSQA 1HNAA 4IGJA 2FA4A 1KNGA 1B4PA 2RIIA 5C04A 4OO4A 4V2LA 4AF2A 1QGVA 20GSA 2PBJA 4HJ2A 4NHZA 1T1VA 1GULA 4CY6A 1OKDA 5ECKB 5ECLB 3HDCA 4DSRA 1SD8A 1TOFA 3MWHA 4ZL7A 4MK3A 2J23A 4EVMA 5HFKA 2O7KA 2B5YA 1TK5B 1G0TA 1TK8B 2H1AA 1F9MA 3H79A 4IQ1A 1PD21 4OCFA 3CQFA 3EU4A 4Q5QA 5IM9A 1XOAA 3RPPA 4IQAA 3GSSA 4ZIJA 3UBLA 3W8SA 3FZAA 3L9VA 3P90A 4NMUA 5CYYA 5G5EA 2GGTA 3KTLA 2XHFA 5CP1A 2BMXA 4WR5A 1URMA 4MJBA 3FEUA 4ICYA 1BJXA 2A2SA 2R3XA 3TJKA 1JLWA 3FY7A 2P5RA 3HZ8A 2E2MA 2GSQA 3J7Yb 4TR0A 3ERGA 4OO5A 2HZEB 2FD3A 2EIOA 2H1DA 2FA8A 5FWGA 4TXOA 3HKRA 2LS5A 2WRTA 4JR4A 4PQ1A 2QA2A 3CYNA 8GSSA 1M9AA 3C73A 1QUWA 2GSTA 1NHYA 2IMDA 1BG5A 4MZCA 1A24A 4OFMA 4K5SA 1MDKA 2BTOT 2PVQA 3N5OA 2MMZA 2DMMA 5D96A 1QQ2A 3QOUA 4X43A
chains in the Genus database with same CATH topology
2WGRA 1GH2A 4RI7A 2D2ZA 1PA3A 3D4MA 4LLRA 3TJGA 1VRSD 3DKSA 1SL1B 2DIZA 2CVDA 2HRKA 1GP1A 4KH7A 2H19A 4K7NA 2E2GA 1E2YA 3D0ZA 3DIEA 1EOHA 1XFLA 3A5WA 3ERWA 3HVSA 2UZ8A 4F2IA 2RUFA 2KP2A 3DEXA 4K5RA 4POLA 2CT6A 2I3YA 3RHCA 4IJ3A 2VCVA 5HR3A 2WZ9A 3HD5A 1CQHA 2YV9A 4EIQA 1ZCPA 5DVBA 1Z7RA 3F3RA 2FUG2 4ML6A 4LL4B 3E3EA 5GSTA 2JU5A 2HRAA 2AHEA 1J08A 2RUEA 2H8LA 3WYWA 4ZBDA 5H5RA 2V2GA 4HQZA 2H75A 4MH3A 2VM2A 3HJPA 2A2RA 1GUHA 4Q5NA 3OR5A 3ZFLA 2IL3A 5EPFA 5ELGA 1K3YA 1TRWA 3ZMKA 2R6KA 4YKGA 4O5QA 2CAIA 1MDIA 1I5GA 1KEBA 4MP4A 6GSVA 3ZL5A 1ERUA 2C0FA 2L5LA 1EEJA 4RQXA 2VAFA 2AAWA 1PKZA 2VM1A 1YY7A 1Z6MA 1EOGA 4WBRD 4EXJA 1QFNA 4EKZA 3VFIA 1ZYPA 4I2TA 2GS3A 5EY6A 2YV7A 5BMUA 3F8UA 1LU4A 4MZBA 3QFAC 5CRWA 2R5GA 3LGCA 4JU5A 1O7UA 4MABA 4L0WA 5G30A 5A5KA 3PINA 2XBIA 1GL8A 2EC4A 3GKNA 4MA9A 2ZCTA 3KCMA 4V1Ag 1BAYA 1MD3A 3TKRA 3G7IA 4G0LA 4X0XA 4Z7XA 5IMCA 5INYA 1AIUA 4IVFA 1B8XA 1Q4JA 1ZGNA 2GLRA 2DJJA 3IRAA 4ZILA 5ABRA 2GSRA 3WGEA 1ERVA 1T4ZA 3APSA 5DAKB 3GSTA 2HE3A 2H66A 2TIRA 4G0KA 4XTSA 2R4VA 1HNCA 1HD2A 3WT1A 1CQGA 1R26A 2IJYA 1DSBA 5GZZB 5F05A 1TU8A 3BCIA 1ABAA 19GSA 1FW1A 1GTUA 1EV9A 3M8NA 3W8JA 2VD0A 1O8XA 3GYKA 5CRGA 1SKSB 2VL2C 2K18A 3DYRA 4K1FA 4ZB6A 4HI7A 1GSSA 2DJKA 3GIXA 1SJZA 1ST9A 3EE2A 2VCQA 3IAM2 1A0RP 4ECIA 4ECBA 4YKFA 1GUMA 4LA1A 1GLQA 3TOUA 3KH9A 3V1WA 1AAZA 4N30A 18GSA 4EO3A 1NM3A 1XOBA 3GL5A 1SK0A 2QC7A 3EMPA 5DJMA 3F6FA 3HYPA 3EPTA 5D9XA 3D22A 2LRTA 1YJ6A 1K0OA 4MCUA 1SL0B 1Z5YE 2XC2A 4L5LA 5J4UA 4MJCA 3TJJA 4BPYA 5L71A 1BEDA 1XCCA 2MMNA 3GKMA 1O81A 3VPTA 1XIYA 2HLSA 1SENA 3TB2A 3MDKA 4F0CA 2L6CA 4KDXA 2FWFA 4I8BA 3NIVA 4KSMA 2JL4A 2YJHA 4ML1A 2F8FA 3ZZXA 2MBSA 1M2BA 2O89A 3GH6A 4IN0A 3TJFA 1WJKA 5IMVA 2X8HA 2LNTA 3IXRA 1KTEA 3ZIVA 2NDOA 2VL2A 4NAXA 1YEPA 2E7PA 1JZDA 1V58A 3TCOA 4XRDA 3GN3A 3LW9A 4IW9A 1XWGA 3SBCA 1XVQA 2O87A 2LJAA 3KMNA 4ZL8A 1X5CA 2HZFA 2H01A 3IHQA 1G6YA 3GURA 5CO3A 3KZQA 5HFGA 1LBKA 5A4WA 2WB9A 4PXOA 5IMDA 3APOA 4TR1B 1FOVA 2DMLA 1M7TA 3GTUB 4ZB9A 3M3MA 2PMTA 1S3CA 3M0FA 3M9JA 4KCEA 4TVEA 2QSIA 1OC9A 3CRUA 6GSUA 1XVWA 4GCIA 3VI7A 1ON4A 1SJIA 5D9TA 4CDOA 1OE8A 4KE3A 3C1SA 3TKSE 1XW9A 2KOKA 5JCGA 5AN1A 5KN2A 3UARA 2C0DA 3EYTA 4XS1A 2IIYA 1EP8A 2JZTA 4IELA 4L5OA 5G2ZA 5DALA 4USSA 4WF4A 1EGOA 1ZYNA 4KB3A 4BWSA 3GV1A 2HYXA 4OMVA 4HUAA 5JWQB 3KP8A 2I81A 4BL7A 1N8JA 1SD9A 4O5RA 1OYJA 1U6TA 1NW2A 3HA9A 3IR4A 1VF4A 2GDRA 3L9UA 2LQQA 3H93A 2FWGA 3QDNA 1Z3EA 2YJ7A 2F9SA 3RBTA 3DVWA 2OACA 4G10A 4POBA 5J41A 5ID2B 2H6ZA 4XS4B 2VCXA 2AYTA 5HFIA 3KTBA 5DBQA 1ERWA 2QKEA 3GRXA 1ZMAA 3O6TA 5ECIB 2C1YA 1WMJA 2B5EA 2CAQA 4KSOA 2ES7A 5AIXA 5KOWA 1K3OA 4GXZA 2YWNA 1TRUA 1A0FA 1SYXA 2F51A 1TP9A 3KIJA 1K0DA 2DJ2A 2X99A 1AUCA 4ISDA 1WP0A 4YAVA 3IK7A 1K0NA 2QA1A 4ID0A 4GLTA 1XWCA 3DXBA 4G19A 4XIHA 2K8VA 2DJ3A 1T00A 2LSTA 3C1RA 1EWXA 1MD4A 3G7YA 4GRFA 1XPVA 5J3RA 3QCPA 1DUGA 1M99A 3HXSA 1GTBA 4XRAA 4HU9A 4MLYA 5ECQB 4PQHA 4MF6A 1V2AA 1O85A 3Q18A 4KW6A 3KJYA 3M1GA 4YAPA 5IOXA 3KH7A 3HY2A 1TU7A 3ZTLA 3E9JB 1SYRA 3TRPA 2O8VB 3U5RE 2FY6A 3GH9A 3H4KA 5ECPB 3QR6A 4XHMA 1AC1A 4EIPA 3A2VA 3UMAA 2IFQB 4NXIA 5DAKA 2R0PA 4KX4A 1GSUA 4NPBA 1X9WB 1YQ1A 2LRCA 1W4VA 4WR4A 4KA0A 4N0VA 3GL3A 3D4TA 2I9HA 4TN8A 2FWEA 1V40A 3ZMLA 2CQ9A 2LKUA 3GMFA 5ECMB 1DE2A 4BA7A 5F0GA 3FR3A 1NSWA 1DBYA 1GSEA 3FZ9A 4GSNA 3FMWA 1FAAA 5IMAA 2LNSA 1THOA 4A5PA 2FNOA 4DSQA 2K6VA 3TRXA 1MTCA 4FYCA 2IMIA 4WXTA 3P7XA 1GSDA 1X5DA 2H6XA 3L0HA 3LFLA 4KNDA 3IV4A 1UN2A 1Z9HA 2EIRA 2IWTA 3F3QA 1PQNA 2KUCA 5AISA 4OCEA 1TXXA 2H1BA 4MH2A 4V1Ap 4N0ZA 3APQA 2IN3A 4X4JA 4AJ6A 2AUVA 3MNGA 2HSYA 2XPDA 2REMA 5BRTA 3UAPA 3AY8A 3L4NA 4LMVA 1V98A 3LORA 1A8YA 2BJXA 5CAXA 3ISOA 4IS0A 2LUSA 3R2QA 5D9WA 3I43A 2OADA 1VF1A 2TRCP 1XXUA 2JACA 5E59A 4D73B 3O76A 2C3QA 3LXZA 1FB0A 1WIKA 2X4AA 4JZQA 1USBA 4K2DA 4E8HA 2VL9A 3CTGA 4NV2A 5C00A 3PR8A 1OVNA 3CBUA 3ZYWA 2CZ3A 5ENUA 2VLTA 1F37A 5KOXA 2X8GA 4Z2UA 5D9VA 3CSHA 4ACSA 4AJ7A 4QQ7A 6GSXA 4O7HA 5IMZA 3TDGA 4Z2TA 3G7JA 1EEMA 4MMMA 4CY8A 1PN9A 2XBQA 4MJEA 6GSSA 1U3AA 1PRXA 3GX8A 3GHAA 4K9ZA 1JLVA 1OKTA 2L57A 9GSSA 2L5OA 3FW2A 2YWOA 3HJOA 16GSA 3PPUA 3WGXA 2PPTA 4BVYA 1TTZA 2DJ0A 4X1UA 4G9HA 3R3EA 1S3AA 1PN0A 1FB6A 3DGQA 2GZYA 3CXGA 2B5XA 2G2QA 1IYHA 3L9SA 3MAKA 2JSYA 4GQCA 5HQPA 1G6WA 1M0UA 4DSSB 2AV4A 1MEKA 2GQMA 4MJAA 2NTOA 4V2MA 2WFCA 2A4HA 5ECOB 1QMVA 4PTSA 4TXOB 1TRVA 3NZNA 3GNJA 5AIVA 1TI3A 3TOTA 3D21A 3IAS2 1J0FA 1YF1A 4I6XA 3F4TA 4I97A 2V6OA 4XS4A 3N9JA 3FK8A 3IHGA 1SKRB 2B6MA 2CX3A 3HCZA 3RPNA 2WS2A 1XW6A 2MMAA 3GA4A 2TRXA 2ZUPA 3FZ5A 3L78A 2GSSA 1X5EA 3UVHA 4PX1A 1X0RA 3HJMA 2VIMA 5JWOB 3CSJA 4BVXB 4ULXA 2K9FA 5IO0A 4PNGA 3EURA 3ZITA 2JZRA 1W89A 4DEJA 1Y6EA 4CW9A 3Q6OA 4PURA 2C0GA 3LEFA 4DVCA 1Y25A 4YQUA 2DIYA 3CTFA 1R7HA 3CSIA 2GQKA 5CRHA 3TKSC 3LJRA 3UL3A 2H0GA 1K0BA 2F8AA 1AQXA 4HZ2A 4K0GA 5FHIA 3LYPA 1GTAA 3UIWA 3IOSA 2B7KA 1R5PA 2H74A 2LEGA 1WRYA 2ON5A 3UVTA 4JBBA 5ECNB 2N5BA 3I9V2 5IO2A 3EVIA 1A23A 1GSFA 2YZUA 4TRXA 3H1NA 1WE0A 2CVKA 1T7PB 1FOHA 4ZBAA 1A2MA 4AGSA 5HR0A 5IQYA 4YH2A 1KBNA 3ME8A 4GWRA 4POMA 4HJMA 3I69A 5J5NA 1GWCA 3VI5A 2PUKC 2HZEA 3P2AA 2AB6A 1B4QA 2MBTA 2FLSA 1WWJA 1WPIA 3DVXA 4KDUA 2XPEA 1EP7A 5DDLA 1AQWA 1WOUA 1YF0A 3C8EA 3VPQA 4IJIA 2KHPA 4OWYA 4PQIA 3UEMA 1XW5A 1A2JA 2CA8A 4F03A 3TKSA 2H76A 2LRNA 4Q5RA 2LTKA 2ON7A 4K8MA 3FKFA 1FG4A 2WJUA 4GSTA 5G5FA 5H5SA 1YZXA 1QK8A 4G2EA 1GRXA 3KD0A 1G7EA 1GSQA 2DKIA 5GSSA 2C0EA 1TKDB 3ZRDA 4YQMA 3NOFA 4CHSA 1ERTA 1XWBA 2F3MA 4MPGA 3LXTA 3LYKA 1XWKA 1F2EA 3IE3A 4K6XA 5FT3A 5J9CA 1E6BA 1ZL9A 4ZXGA 1SJ6A 2IPAA 3RHBA 2H0IA 4PUAA 4EE0A 1U3IA 3I6AA 3FRCA 2PVOC 4ZL9A 4N11A 4I2UA 2ALBA 2L4QA 2MMOA 2NVLA 2HI7A 2HNLA 1B9YC 2GT5A 2NBSA 5ECHB 3ZLPA 5KN0A 2C8UA 5G1KA 2B3SA 1VGLA 5B7CA 3RDWA 5JCUA 4YQVA 3J7Yk 11GSA 4PGTA 3TRQA 1YEXA 5IPHA 4D73A 3S9FA 3UJ1A 1YKAA 4OD7A 4WBJA 4KCAA 5ELAA 22GSA 2M72A 2LV3A 3EINA 4MF5A 2HRFA 3BCKA 1XBSA 4K0NA 4J2FA 4F0BA 3EMXA 4I5QA 1TDIA 2YWMA 3D5JA 2X8CA 5G1LA 4ZB8A 5ECRB 1PX7A 4Z2RA 2VLVA 3MSZA 6GSYA 4ZBBA 3DD3A 6GSWA 2EIQA 4HEA2 4IP6A 4IHUA 2FCHA 1SK1A 5EL8A 4NWYA 3QAVA 3LWAA 2I1UA 2P0GA 1GTIA 3IBHA 4O5UA 1GNEA 4J56E 1Q98A 1GSYA 4KUNA 4JE1A 5EVOA 4MPFA 2B1LA 5LD0A 2L4CA 3BD2A 1B9XC 3F4SA 3A2WA 1H4OA 2KP1A 3PGTA 4AJ8A 1C72A 2DBCA 2N5FA 1A2LA 2GQLA 1K0MA 1XZOA 1GLPA 2N5AA 1YDKA 3LSZA 5F8BA 2GZZA 1FO5A 2I4AA 5DQSA 17GSA 5F06A 4DSSA 3GKKA 2LQOA 3EU3A 2HRNA 2J9HA 5D73A 5IOWA 5DCGA 2OE0A 4L8EA 4TKYA 4TR4A 5KN3A 2E0QA 3GFKA 1RQMA 1OC9B 5GAND 1M9BA 3EC3A 1O73A 3MYDA 3TKQA 3A5IA 1F3AA 4PUFC 2H72A 3TKPA 3DRNA 2YN1A 1PKWA 1PX6A 3ZIJA 2P5QA 4HQSA 1QXHA 1AXDA 2H6YA 1ZOFA 2H0HA 2WCIA 6GSTA 5DALB 3QPMA 3Q74A 2CV4A 5IIZA 4MF7A 4QL9A 1VF2A 3F0IA 2OBIA 5J9BA 4BL7B 1BX9A 4JR6A 4TOPA 2MYGA 2VD1A 2X64A 4K2XA 5DCHA 1EGRA 1X9MB 1JZRA 4IBPA 4LL1B 3M9KA 4BVXA 4HU7A 1PGTA 4GTUA 1G7OA 3VK9A 2NPBA 3VWXA 1V57A 5F07A 2RM5A 1BQ7A 3PH9A 2DLXA 3A2XA 2HFDA 4NV5A 3K8NA 2GZPA 3TJBA 2R2JA 3KXOA 3IA1A 4P3YB 2VCWA 1JZOA 2DKHA 3VWUA 4MZWA 3QAWA 2WDUA 1ZZYA 2L59A 4KDYA 3GUSA 4HS1A 1RW1A 5COHA 2R0GA 1BYEA 3FR9A 4F9ZA 3SWLA 4Q5FA 2HXKA 1MDJA 5B8BA 1JFUA 3IDVA 3KEBA 3O3TA 5DJLA 5A4VA 2G0FA 2H73A 4FIWA 4EUYA 2X49A 4TXVA 3US3A 2A2PA 4TR1A 2YPMA 3GTUA 2YCDA 1FHEA 2VO4A 1SKWB 2OE1A 2JZSA 2ZNMA 3F6DA 4GSSA 1OE7A 1U88A 1ZYEA 4FQUA 2OBKA 3BBYA 5IMFA 4ECJA 3TGZA 4G0IA 5E4WA 10GSA 1EZKA 4GF0A 14GSA 2HSHA 3JCML 3F9UA 4IKHA 1DE1A 2IMKA 4E8EA 4O92A 1THXA 1PMTA 1K3LA 3BJ5A 2DSAA 2H30A 3D6IA 2B1KA 4KAEA 3UBKA 1OC8A 1AW9A 2YANA 3DWVA 4IP1A 4KF9A 2FGXA 2VOCA 1X9SB 1M2AA 1O6JA 3QMXA 1YKCA 4HDEA 3RAZA 2GT6A 2PWJA 1T4YA 1UA5A 1T3BA 4FH8A 1T8EB 4LMWA 2GVPA 4L0UA 1Z6NA 2K8SA 4WF5A 2OA7A 1JHBA 1Z7PA 1XWAA 2M46A 2YP6A 1F6MC 1PL2A 2RM6A 1K0CA 7GSSA 1TI1A 3KGKA 13GSA 3A3TA 1FVJA 2A4VA 4MDCA 5KN1A 2FWHA 2Z9SA 2M80A 3HVXA 4JRRA 2JSZA 1HQOA 5G31A 5IPGA 5ID2A 1HYUA 2KLXA 2H1GA 1SL2B 1U87A 3F63A 2H71A 3DMLA 1TRSA 12GSA 2LJKA 2R37A 4ECCA 4JEDA 1UVZA 3IC8A 4FO5A 3ZREA 2VCTA 1LJRA 5H5QA 4EDZA 2HT9A 1A8LA 4WETA 1JZWA 3IC4A 2C3NA 2FHEA 2VL3A 4XCSA 4WEYA 5HR1A 3WT2A 5AGYA 4EC0A 2LJRA 4EL1A 4EF0A 4NHWA 3FZ4A 3C7MA 3KMOA 3BOAA 3EWLA 2PU9C 3FR6A 5ECSA 1HNBA 3G9BA 3ED3A 1RK4A 3WGDA 1AQVA 3IK9A 3CMIA 3HVVA 1K0AA 3LQ7A 1TK0B 4QL7A 3IPZA 2DC5A 4OFNA 2R0CA 5B6MA 2VLUA 5JWRB 4PNFA 2AJQB 4RQRA 3ZVJD 2JADA 4J57E 4F82A 1R4WA 2IFQA 4BWQA 1ACVA 2OKAA 1GNWA 2CVBA 4FYUA 1O8WA 2WULA 5LCZA 5KEJA 1NHOA 1TW9A 2YWIA 3GX0A 2C3TA 3E0UA 4K7IA 2O85A 1IYIA 3MIXA 4O32A 3FHKA 2V32A 2PERA 1N2AA 2H70A 3ERFA 4RUVA 1V9WA 4HOJA 1SU9A 4WKWA 4N10A 4OFTA 3VWWA 4FYBA 2YOIA 3FYGA 3WD6A 2P31A 1I9DA 1ML6A 5A4UA 2PN8A 5D8IA 1ILOA 2C80A 4K7OA 4XS6A 3TUEA 4EDYA 2OE3A 2DJ1A 2YNXA 2CZ2A 4TW5A 5GAPD 4GQFA 3VLNA 1SK2A 1J9BA 3CRTA 3QAGA 1F3BA 2HSMA 3KP9A 4BVYB 3P8WA 2IMEA 3ZFBA 5JCWA 2GTUA 5LNKe 4KGIA 3QFBC 4RI6A 3W6GA 3HHVA 1H75A 2C4JA 5B6NA 3VURA 2V1MA 3HZ4A 2OJLA 1B48A 2RLIA 3Q19A 5D93A 1UC7A 3VWVA 1OC3A 3H8QA 4HZ4A 3C71A 4TR3A 1ZYQB 1EV4A 2VCZA 2VUPA 3GKXA 5B8AA 4ILFA 3ZVJA 1OAZA 5DQYA 5CREA 3LG6A 2B7JA 2QGVA 4MNNA 3UOMA 1R5AA 1M2DA 2IMFA 2V41A 1S3DA 2L6DA 4V2NA 3ME7A 1TJDA 1GUKA 2MZCA 5CNWA 4H86A 2YZHA 5CRDA 2V6KA 3QD9A 5HR2A 1PL1A 1VF3A 2PGTA 1FVKA 3F4RA 4POKA 3U6VA 3KM6A 2CX4A 1PSQA 1HNAA 4IGJA 2FA4A 1KNGA 1B4PA 2RIIA 5C04A 4OO4A 4V2LA 4AF2A 1QGVA 20GSA 2PBJA 4HJ2A 4NHZA 1T1VA 1GULA 4CY6A 1OKDA 5ECKB 5ECLB 3HDCA 4DSRA 1SD8A 1TOFA 3MWHA 4ZL7A 4MK3A 2J23A 4EVMA 5HFKA 2O7KA 2B5YA 1TK5B 1G0TA 1TK8B 2H1AA 1F9MA 3H79A 4IQ1A 1PD21 4OCFA 3EU4A 4Q5QA 5IM9A 1XOAA 3RPPA 4IQAA 3GSSA 4ZIJA 3UBLA 3W8SA 3FZAA 3L9VA 3P90A 4NMUA 5CYYA 5G5EA 2GGTA 3KTLA 2XHFA 5CP1A 2BMXA 4WR5A 1URMA 4MJBA 3FEUA 4ICYA 1BJXA 2A2SA 2R3XA 3TJKA 1JLWA 3FY7A 2P5RA 3HZ8A 2E2MA 2GSQA 3J7Yb 4TR0A 3ERGA 4OO5A 2HZEB 2FD3A 2EIOA 2H1DA 2FA8A 5FWGA 4TXOA 3HKRA 2LS5A 2WRTA 4JR4A 4PQ1A 2QA2A 3CYNA 8GSSA 1M9AA 3C73A 1QUWA 2GSTA 1NHYA 2IMDA 1BG5A 4MZCA 1A24A 4OFMA 4K5SA 1MDKA 2BTOT 2PVQA 3N5OA 2MMZA 2DMMA 5D96A 1QQ2A 3QOUA 4X43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGR A;  1GH2 A;  4RI7 A;  2D2Z A;  1PA3 A;  3D4M A;  4LLR A;  3TJG A;  1VRS D;  3DKS A;  1SL1 B;  2DIZ A;  2CVD A;  1GP1 A;  4KH7 A;  2H19 A;  4K7N A;  2E2G A;  1E2Y A;  3D0Z A;  3DIE A;  1EOH A;  1XFL A;  3A5W A;  3ERW A;  3HVS A;  4F2I A;  2RUF A;  2KP2 A;  3DEX A;  4POL A;  2CT6 A;  2I3Y A;  3RHC A;  4IJ3 A;  2VCV A;  5HR3 A;  2WZ9 A;  3HD5 A;  1CQH A;  2YV9 A;  1ZCP A;  5DVB A;  1Z7R A;  3F3R A;  2FUG 2;  4ML6 A;  4LL4 B;  3E3E A;  5GST A;  2JU5 A;  2AHE A;  1J08 A;  2RUE A;  2H8L A;  3WYW A;  4ZBD A;  5H5R A;  2V2G A;  4HQZ A;  2H75 A;  4MH3 A;  2VM2 A;  3HJP A;  2A2R A;  1GUH A;  4Q5N A;  3OR5 A;  3ZFL A;  2IL3 A;  5EPF A;  5ELG A;  1K3Y A;  1TRW A;  3ZMK A;  2R6K A;  2CAI A;  1MDI A;  1I5G A;  1KEB A;  4MP4 A;  6GSV A;  3ZL5 A;  1ERU A;  2C0F A;  2L5L A;  1EEJ A;  4RQX A;  2VAF A;  2AAW A;  1PKZ A;  2VM1 A;  1YY7 A;  1Z6M A;  1EOG A;  4WBR D;  4EXJ A;  1QFN A;  4EKZ A;  3VFI A;  4I2T A;  2GS3 A;  5EY6 A;  2YV7 A;  3F8U A;  1LU4 A;  4MZB A;  3QFA C;  5CRW A;  2R5G A;  3LGC A;  4JU5 A;  1O7U A;  4MAB A;  4L0W A;  5G30 A;  5A5K A;  3PIN A;  2XBI A;  1GL8 A;  2EC4 A;  3GKN A;  4MA9 A;  2ZCT A;  3KCM A;  4V1A g;  1BAY A;  1MD3 A;  3TKR A;  3G7I A;  4X0X A;  4Z7X A;  5IMC A;  5INY A;  1AIU A;  4IVF A;  1B8X A;  1Q4J A;  1ZGN A;  2GLR A;  2DJJ A;  3IRA A;  4ZIL A;  5ABR A;  2GSR A;  3WGE A;  1ERV A;  1T4Z A;  3APS A;  5DAK B;  3GST A;  2HE3 A;  2H66 A;  2TIR A;  4XTS A;  2R4V A;  1HNC A;  1HD2 A;  3WT1 A;  1CQG A;  1R26 A;  2IJY A;  1DSB A;  5GZZ B;  5F05 A;  1TU8 A;  3BCI A;  1ABA A;  19GS A;  1FW1 A;  1GTU A;  1EV9 A;  3M8N A;  3W8J A;  2VD0 A;  1O8X A;  3GYK A;  5CRG A;  1SKS B;  2VL2 C;  2K18 A;  3DYR A;  4K1F A;  4ZB6 A;  4HI7 A;  1GSS A;  2DJK A;  3GIX A;  1SJZ A;  1ST9 A;  3EE2 A;  2VCQ A;  3IAM 2;  1A0R P;  4ECI A;  4ECB A;  1GUM A;  4LA1 A;  1GLQ A;  3TOU A;  3KH9 A;  3V1W A;  1AAZ A;  4N30 A;  18GS A;  4EO3 A;  1NM3 A;  1XOB A;  3GL5 A;  1SK0 A;  2QC7 A;  3EMP A;  5DJM A;  3F6F A;  3HYP A;  5D9X A;  3D22 A;  2LRT A;  1YJ6 A;  1K0O A;  4MCU A;  1SL0 B;  1Z5Y E;  2XC2 A;  4L5L A;  5J4U A;  4MJC A;  3TJJ A;  4BPY A;  5L71 A;  1BED A;  1XCC A;  2MMN A;  3GKM A;  1O81 A;  3VPT A;  1XIY A;  2HLS A;  1SEN A;  3TB2 A;  3MDK A;  4F0C A;  2L6C A;  4KDX A;  2FWF A;  4I8B A;  3NIV A;  4KSM A;  2JL4 A;  2YJH A;  4ML1 A;  2F8F A;  3ZZX A;  2MBS A;  1M2B A;  2O89 A;  3GH6 A;  4IN0 A;  3TJF A;  1WJK A;  5IMV A;  2X8H A;  2LNT A;  3IXR A;  1KTE A;  3ZIV A;  2NDO A;  2VL2 A;  4NAX A;  1YEP A;  2E7P A;  1JZD A;  1V58 A;  3TCO A;  4XRD A;  3GN3 A;  4IW9 A;  1XWG A;  3SBC A;  1XVQ A;  2O87 A;  2LJA A;  3KMN A;  4ZL8 A;  1X5C A;  2HZF A;  2H01 A;  3IHQ A;  1G6Y A;  3GUR A;  5CO3 A;  3KZQ A;  5HFG A;  1LBK A;  5A4W A;  2WB9 A;  4PXO A;  5IMD A;  3APO A;  4TR1 B;  1FOV A;  2DML A;  1M7T A;  3GTU B;  4ZB9 A;  3M3M A;  2PMT A;  1S3C A;  3M0F A;  3M9J A;  4KCE A;  4TVE A;  2QSI A;  1OC9 A;  3CRU A;  6GSU A;  1XVW A;  4GCI A;  3VI7 A;  1ON4 A;  1SJI A;  5D9T A;  4CDO A;  1OE8 A;  4KE3 A;  3C1S A;  3TKS E;  1XW9 A;  2KOK A;  5JCG A;  5AN1 A;  5KN2 A;  3UAR A;  2C0D A;  3EYT A;  4XS1 A;  2IIY A;  1EP8 A;  2JZT A;  4IEL A;  4L5O A;  5G2Z A;  5DAL A;  4WF4 A;  1EGO A;  4KB3 A;  4BWS A;  3GV1 A;  2HYX A;  4OMV A;  4HUA A;  5JWQ B;  3KP8 A;  2I81 A;  4BL7 A;  1N8J A;  1SD9 A;  4O5R A;  1OYJ A;  1U6T A;  1NW2 A;  3HA9 A;  3IR4 A;  1VF4 A;  2GDR A;  3L9U A;  2LQQ A;  3H93 A;  2FWG A;  3QDN A;  1Z3E A;  2YJ7 A;  2F9S A;  3RBT A;  3DVW A;  2OAC A;  4G10 A;  4POB A;  5J41 A;  5ID2 B;  2H6Z A;  4XS4 B;  2VCX A;  2AYT A;  5HFI A;  3KTB A;  5DBQ A;  1ERW A;  2QKE A;  3GRX A;  1ZMA A;  3O6T A;  5ECI B;  2C1Y A;  1WMJ A;  2B5E A;  2CAQ A;  4KSO A;  2ES7 A;  5AIX A;  1K3O A;  4GXZ A;  2YWN A;  1TRU A;  1A0F A;  1SYX A;  2F51 A;  1TP9 A;  3KIJ A;  1K0D A;  2DJ2 A;  2X99 A;  1AUC A;  4ISD A;  1WP0 A;  4YAV A;  3IK7 A;  1K0N A;  4ID0 A;  4GLT A;  1XWC A;  3DXB A;  4G19 A;  4XIH A;  2K8V A;  2DJ3 A;  1T00 A;  2LST A;  3C1R A;  1EWX A;  1MD4 A;  3G7Y A;  4GRF A;  1XPV A;  5J3R A;  3QCP A;  1DUG A;  1M99 A;  3HXS A;  1GTB A;  4XRA A;  4HU9 A;  4MLY A;  5ECQ B;  4PQH A;  4MF6 A;  1V2A A;  1O85 A;  3Q18 A;  4KW6 A;  3KJY A;  3M1G A;  4YAP A;  5IOX A;  3KH7 A;  3HY2 A;  1TU7 A;  3ZTL A;  3E9J B;  1SYR A;  3TRP A;  2O8V B;  3U5R E;  2FY6 A;  3GH9 A;  3H4K A;  5ECP B;  3QR6 A;  4XHM A;  1AC1 A;  3A2V A;  3UMA A;  2IFQ B;  4NXI A;  5DAK A;  4KX4 A;  4NPB A;  1GSU A;  1X9W B;  1YQ1 A;  2LRC A;  1W4V A;  4WR4 A;  4KA0 A;  4N0V A;  3GL3 A;  3D4T A;  2I9H A;  4TN8 A;  2FWE A;  1V40 A;  3ZML A;  2CQ9 A;  2LKU A;  3GMF A;  5ECM B;  1DE2 A;  4BA7 A;  5F0G A;  3FR3 A;  1NSW A;  1DBY A;  1GSE A;  3FZ9 A;  4GSN A;  1FAA A;  5IMA A;  2LNS A;  1THO A;  2FNO A;  4DSQ A;  2K6V A;  3TRX A;  1MTC A;  4FYC A;  2IMI A;  4WXT A;  3P7X A;  1GSD A;  1X5D A;  2H6X A;  3L0H A;  3LFL A;  4KND A;  3IV4 A;  1UN2 A;  1Z9H A;  2EIR A;  2IWT A;  3F3Q A;  1PQN A;  2KUC A;  5AIS A;  4OCE A;  1TXX A;  2H1B A;  4MH2 A;  4V1A p;  4N0Z A;  3APQ A;  2IN3 A;  4AJ6 A;  2AUV A;  3MNG A;  2HSY A;  2XPD A;  2REM A;  3UAP A;  3AY8 A;  3L4N A;  4LMV A;  1V98 A;  3LOR A;  1A8Y A;  2BJX A;  5CAX A;  3ISO A;  4IS0 A;  2LUS A;  3R2Q A;  5D9W A;  3I43 A;  2OAD A;  1VF1 A;  2TRC P;  1XXU A;  2JAC A;  5E59 A;  4D73 B;  3O76 A;  2C3Q A;  3LXZ A;  1FB0 A;  1WIK A;  4JZQ A;  1USB A;  4K2D A;  4E8H A;  2VL9 A;  3CTG A;  4NV2 A;  5C00 A;  3PR8 A;  1OVN A;  3CBU A;  3ZYW A;  2CZ3 A;  5ENU A;  2VLT A;  1F37 A;  2X8G A;  5D9V A;  3CSH A;  4ACS A;  4AJ7 A;  4QQ7 A;  6GSX A;  4O7H A;  5IMZ A;  3TDG A;  3G7J A;  1EEM A;  4MMM A;  1PN9 A;  2XBQ A;  4MJE A;  6GSS A;  1U3A A;  1PRX A;  3GX8 A;  3GHA A;  4K9Z A;  1JLV A;  1OKT A;  2L57 A;  9GSS A;  2L5O A;  3FW2 A;  2YWO A;  3HJO A;  16GS A;  3WGX A;  2PPT A;  4BVY A;  1TTZ A;  2DJ0 A;  4X1U A;  4G9H A;  1S3A A;  1FB6 A;  3DGQ A;  2GZY A;  3CXG A;  2B5X A;  2G2Q A;  1IYH A;  3L9S A;  3MAK A;  2JSY A;  4GQC A;  5HQP A;  1G6W A;  1M0U A;  4DSS B;  2AV4 A;  1MEK A;  2GQM A;  4MJA A;  2NTO A;  4V2M A;  2WFC A;  5ECO B;  1QMV A;  4TXO B;  1TRV A;  3NZN A;  3GNJ A;  5AIV A;  1TI3 A;  3TOT A;  3D21 A;  3IAS 2;  1J0F A;  1YF1 A;  4I6X A;  3F4T A;  4I97 A;  2V6O A;  4XS4 A;  3N9J A;  3FK8 A;  1SKR B;  2B6M A;  2CX3 A;  3HCZ A;  3RPN A;  2WS2 A;  1XW6 A;  2MMA A;  3GA4 A;  2TRX A;  2ZUP A;  3FZ5 A;  3L78 A;  2GSS A;  1X5E A;  3UVH A;  4PX1 A;  1X0R A;  3HJM A;  2VIM A;  5JWO B;  3CSJ A;  4ULX A;  2K9F A;  5IO0 A;  4PNG A;  3EUR A;  3ZIT A;  2JZR A;  1W89 A;  4DEJ A;  1Y6E A;  4CW9 A;  3Q6O A;  2C0G A;  3LEF A;  4PUR A;  4DVC A;  1Y25 A;  4YQU A;  2DIY A;  3CTF A;  1R7H A;  3CSI A;  2GQK A;  5CRH A;  3TKS C;  3LJR A;  3UL3 A;  2H0G A;  1K0B A;  2F8A A;  1AQX A;  4HZ2 A;  4K0G A;  5FHI A;  3LYP A;  1GTA A;  3UIW A;  3IOS A;  2B7K A;  1R5P A;  2H74 A;  2LEG A;  1WRY A;  2ON5 A;  3UVT A;  4JBB A;  5ECN B;  2N5B A;  3I9V 2;  5IO2 A;  3EVI A;  1A23 A;  1GSF A;  2YZU A;  4TRX A;  3H1N A;  1WE0 A;  2CVK A;  1T7P B;  4ZBA A;  1A2M A;  4AGS A;  5HR0 A;  5IQY A;  4YH2 A;  1KBN A;  3ME8 A;  4GWR A;  4POM A;  4HJM A;  3I69 A;  5J5N A;  1GWC A;  3VI5 A;  2PUK C;  2HZE A;  3P2A A;  2AB6 A;  1B4Q A;  2MBT A;  2FLS A;  1WWJ A;  1WPI A;  3DVX A;  4KDU A;  2XPE A;  1EP7 A;  5DDL A;  1AQW A;  1WOU A;  1YF0 A;  3C8E A;  3VPQ A;  4IJI A;  2KHP A;  4OWY A;  4PQI A;  3UEM A;  1XW5 A;  1A2J A;  2CA8 A;  4F03 A;  3TKS A;  2H76 A;  2LRN A;  4Q5R A;  2LTK A;  2ON7 A;  4K8M A;  3FKF A;  1FG4 A;  2WJU A;  4GST A;  5G5F A;  5H5S A;  1YZX A;  1QK8 A;  4G2E A;  1GRX A;  3KD0 A;  1G7E A;  1GSQ A;  5GSS A;  2C0E A;  1TKD B;  3ZRD A;  4YQM A;  3NOF A;  4CHS A;  1ERT A;  1XWB A;  2F3M A;  4MPG A;  3LXT A;  3LYK A;  1XWK A;  1F2E A;  3IE3 A;  4K6X A;  5FT3 A;  5J9C A;  1E6B A;  1ZL9 A;  4X43 A;  4ZXG A;  1SJ6 A;  2IPA A;  3RHB A;  2H0I A;  4PUA A;  4EE0 A;  1U3I A;  3I6A A;  3FRC A;  2PVO C;  4ZL9 A;  4N11 A;  4I2U A;  2ALB A;  2L4Q A;  2MMO A;  2NVL A;  2HI7 A;  2HNL A;  1B9Y C;  2GT5 A;  2NBS A;  5ECH B;  3ZLP A;  5KN0 A;  2C8U A;  5G1K A;  2B3S A;  1VGL A;  5B7C A;  3RDW A;  5JCU A;  4YQV A;  3J7Y k;  11GS A;  4PGT A;  3TRQ A;  1YEX A;  5IPH A;  4D73 A;  3S9F A;  3UJ1 A;  1YKA A;  4OD7 A;  4WBJ A;  4KCA A;  5ELA A;  22GS A;  2M72 A;  2LV3 A;  3EIN A;  4MF5 A;  2HRF A;  3BCK A;  1XBS A;  4K0N A;  4J2F A;  4F0B A;  3EMX A;  4I5Q A;  1TDI A;  2YWM A;  3D5J A;  2X8C A;  5G1L A;  4ZB8 A;  5ECR B;  1PX7 A;  2VLV A;  3MSZ A;  6GSY A;  4ZBB A;  3DD3 A;  6GSW A;  2EIQ A;  4HEA 2;  4IP6 A;  4IHU A;  2FCH A;  1SK1 A;  5EL8 A;  4NWY A;  3QAV A;  3LWA A;  2I1U A;  2P0G A;  1GTI A;  3IBH A;  1GNE A;  4J56 E;  1Q98 A;  1GSY A;  4KUN A;  4JE1 A;  5EVO A;  4MPF A;  2B1L A;  5LD0 A;  2L4C A;  3BD2 A;  1B9X C;  3F4S A;  3A2W A;  1H4O A;  2KP1 A;  3PGT A;  4AJ8 A;  1C72 A;  2DBC A;  2N5F A;  1A2L A;  2GQL A;  1K0M A;  1XZO A;  1GLP A;  2N5A A;  1YDK A;  3LSZ A;  5F8B A;  2GZZ A;  1FO5 A;  2I4A A;  5DQS A;  17GS A;  5F06 A;  4DSS A;  3GKK A;  2LQO A;  3EU3 A;  2HRN A;  2J9H A;  5D73 A;  5IOW A;  5DCG A;  2OE0 A;  4L8E A;  4TKY A;  4TR4 A;  5KN3 A;  2E0Q A;  3GFK A;  1RQM A;  1OC9 B;  5GAN D;  1M9B A;  3EC3 A;  1O73 A;  3TKQ A;  1F3A A;  4PUF C;  2H72 A;  3TKP A;  3DRN A;  2YN1 A;  1PKW A;  1PX6 A;  3ZIJ A;  2P5Q A;  4HQS A;  1QXH A;  1AXD A;  2H6Y A;  1ZOF A;  2H0H A;  2WCI A;  6GST A;  5DAL B;  3QPM A;  3Q74 A;  2CV4 A;  5IIZ A;  4MF7 A;  4QL9 A;  1VF2 A;  3F0I A;  2OBI A;  5J9B A;  1BX9 A;  4JR6 A;  4TOP A;  2MYG A;  5DCH A;  2VD1 A;  2X64 A;  1EGR A;  1X9M B;  1JZR A;  4IBP A;  4LL1 B;  3M9K A;  4BVX A;  4HU7 A;  1PGT A;  4GTU A;  1G7O A;  3VK9 A;  2NPB A;  3VWX A;  1V57 A;  5F07 A;  2RM5 A;  1BQ7 A;  3PH9 A;  2DLX A;  3A2X A;  2HFD A;  4NV5 A;  3K8N A;  2GZP A;  3TJB A;  2R2J A;  3KXO A;  3IA1 A;  4P3Y B;  2VCW A;  1JZO A;  3VWU A;  4MZW A;  3QAW A;  2WDU A;  1ZZY A;  2L59 A;  4KDY A;  3GUS A;  4HS1 A;  1RW1 A;  5COH A;  1BYE A;  3FR9 A;  4F9Z A;  3SWL A;  4Q5F A;  2HXK A;  1MDJ A;  5B8B A;  1JFU A;  3IDV A;  3KEB A;  3O3T A;  5DJL A;  5A4V A;  2G0F A;  2H73 A;  4FIW A;  4EUY A;  4TXV A;  3US3 A;  4TR1 A;  2YPM A;  3GTU A;  2YCD A;  1FHE A;  2VO4 A;  1SKW B;  2OE1 A;  2JZS A;  2ZNM A;  3F6D A;  4GSS A;  1OE7 A;  1U88 A;  1ZYE A;  2OBK A;  3BBY A;  5IMF A;  4ECJ A;  3TGZ A;  5E4W A;  10GS A;  1EZK A;  4GF0 A;  14GS A;  2HSH A;  3JCM L;  3F9U A;  4IKH A;  1DE1 A;  2IMK A;  4E8E A;  4O92 A;  1THX A;  1PMT A;  1K3L A;  3BJ5 A;  2DSA A;  2H30 A;  3D6I A;  2B1K A;  4KAE A;  3UBK A;  1OC8 A;  1AW9 A;  2YAN A;  3DWV A;  4IP1 A;  2FGX A;  2VOC A;  1X9S B;  1M2A A;  1O6J A;  3QMX A;  1YKC A;  4HDE A;  3RAZ A;  2GT6 A;  2PWJ A;  1T4Y A;  1UA5 A;  1T3B A;  4FH8 A;  1T8E B;  4LMW A;  2GVP A;  4L0U A;  1Z6N A;  2K8S A;  4WF5 A;  2OA7 A;  1JHB A;  1Z7P A;  1XWA A;  2M46 A;  2YP6 A;  1F6M C;  1PL2 A;  2RM6 A;  1K0C A;  7GSS A;  1TI1 A;  3KGK A;  13GS A;  3A3T A;  1FVJ A;  2A4V A;  4MDC A;  5KN1 A;  2FWH A;  2Z9S A;  2M80 A;  3HVX A;  4JRR A;  2JSZ A;  1HQO A;  5G31 A;  5IPG A;  5ID2 A;  1HYU A;  2KLX A;  2H1G A;  1SL2 B;  1U87 A;  3F63 A;  2H71 A;  3DML A;  1TRS A;  12GS A;  2LJK A;  2R37 A;  4ECC A;  4JED A;  1UVZ A;  3ZRE A;  4FO5 A;  2VCT A;  1LJR A;  5H5Q A;  4EDZ A;  2HT9 A;  1A8L A;  4WET A;  1JZW A;  3IC4 A;  2C3N A;  2FHE A;  2VL3 A;  4XCS A;  4WEY A;  5HR1 A;  3WT2 A;  5AGY A;  4EC0 A;  2LJR A;  4EL1 A;  4EF0 A;  4NHW A;  3FZ4 A;  3C7M A;  3KMO A;  3BOA A;  3EWL A;  2PU9 C;  3FR6 A;  5ECS A;  1HNB A;  3G9B A;  3ED3 A;  1RK4 A;  3WGD A;  1AQV A;  3IK9 A;  3CMI A;  3HVV A;  1K0A A;  3LQ7 A;  1TK0 B;  4QL7 A;  3IPZ A;  2DC5 A;  4OFN A;  5B6M A;  2VLU A;  5JWR B;  4PNF A;  2AJQ B;  4RQR A;  3ZVJ D;  2JAD A;  4J57 E;  4F82 A;  1R4W A;  2IFQ A;  4BWQ A;  1ACV A;  2OKA A;  1GNW A;  2CVB A;  4FYU A;  1O8W A;  2WUL A;  5LCZ A;  5KEJ A;  1NHO A;  1TW9 A;  2YWI A;  3GX0 A;  2C3T A;  3E0U A;  4K7I A;  2O85 A;  1IYI A;  4O32 A;  3FHK A;  2V32 A;  2PER A;  1N2A A;  2H70 A;  3ERF A;  4RUV A;  1V9W A;  4HOJ A;  1SU9 A;  4WKW A;  4N10 A;  4OFT A;  3VWW A;  4FYB A;  2YOI A;  3FYG A;  3WD6 A;  2P31 A;  1I9D A;  1ML6 A;  5A4U A;  2PN8 A;  5D8I A;  1ILO A;  2C80 A;  4K7O A;  4XS6 A;  3TUE A;  4EDY A;  2OE3 A;  2DJ1 A;  2YNX A;  2CZ2 A;  4TW5 A;  5GAP D;  4GQF A;  3VLN A;  1SK2 A;  1J9B A;  3CRT A;  3QAG A;  1F3B A;  3KP9 A;  3P8W A;  2IME A;  3ZFB A;  5JCW A;  2GTU A;  5LNK e;  4KGI A;  3QFB C;  4RI6 A;  3W6G A;  3HHV A;  1H75 A;  2C4J A;  5B6N A;  3VUR A;  2V1M A;  3HZ4 A;  2OJL A;  1B48 A;  2RLI A;  3Q19 A;  5D93 A;  1UC7 A;  3VWV A;  1OC3 A;  3H8Q A;  4HZ4 A;  3C71 A;  4TR3 A;  1ZYQ B;  1EV4 A;  2VCZ A;  2VUP A;  3GKX A;  5B8A A;  4ILF A;  3ZVJ A;  1OAZ A;  5DQY A;  5CRE A;  3LG6 A;  2B7J A;  2QGV A;  3UOM A;  1R5A A;  1M2D A;  2IMF A;  2V41 A;  1S3D A;  2L6D A;  4V2N A;  3ME7 A;  1TJD A;  1GUK A;  2MZC A;  5CNW A;  4H86 A;  2YZH A;  5CRD A;  2V6K A;  3QD9 A;  5HR2 A;  1PL1 A;  1VF3 A;  2PGT A;  1FVK A;  3F4R A;  4POK A;  3U6V A;  3KM6 A;  2CX4 A;  1PSQ A;  1HNA A;  4IGJ A;  2FA4 A;  1KNG A;  1B4P A;  2RII A;  5C04 A;  4OO4 A;  4V2L A;  4AF2 A;  1QGV A;  20GS A;  2PBJ A;  4HJ2 A;  4NHZ A;  1T1V A;  1GUL A;  5ECK B;  1OKD A;  3HDC A;  4DSR A;  1SD8 A;  1TOF A;  3MWH A;  4ZL7 A;  4MK3 A;  2J23 A;  4EVM A;  5HFK A;  2O7K A;  2B5Y A;  1TK5 B;  1G0T A;  1TK8 B;  2H1A A;  1F9M A;  3H79 A;  4IQ1 A;  1PD2 1;  4OCF A;  3EU4 A;  4Q5Q A;  5IM9 A;  1XOA A;  3RPP A;  4IQA A;  3GSS A;  4ZIJ A;  3UBL A;  3W8S A;  3FZA A;  3L9V A;  3P90 A;  4NMU A;  5CYY A;  5G5E A;  2GGT A;  3KTL A;  2XHF A;  5CP1 A;  2BMX A;  4WR5 A;  1URM A;  4MJB A;  3FEU A;  1BJX A;  2A2S A;  2R3X A;  3TJK A;  1JLW A;  3FY7 A;  2P5R A;  3HZ8 A;  2E2M A;  2GSQ A;  3J7Y b;  4TR0 A;  3ERG A;  4OO5 A;  2HZE B;  2FD3 A;  2EIO A;  2H1D A;  2FA8 A;  5FWG A;  4TXO A;  3HKR A;  2LS5 A;  2WRT A;  4JR4 A;  4PQ1 A;  3CYN A;  8GSS A;  1M9A A;  3C73 A;  1QUW A;  2GST A;  1NHY A;  2IMD A;  1BG5 A;  4MZC A;  1A24 A;  4OFM A;  1MDK A;  2BTO T;  2PVQ A;  3N5O A;  2MMZ A;  2DMM A;  5D96 A;  1QQ2 A;  3QOU A;  5ECL B; 
#chains in the Genus database with same CATH topology
 2WGR A;  1GH2 A;  4RI7 A;  2D2Z A;  1PA3 A;  3D4M A;  4LLR A;  3TJG A;  1VRS D;  3DKS A;  1SL1 B;  2DIZ A;  2CVD A;  2HRK A;  1GP1 A;  4KH7 A;  2H19 A;  4K7N A;  2E2G A;  1E2Y A;  3D0Z A;  3DIE A;  1EOH A;  1XFL A;  3A5W A;  3ERW A;  3HVS A;  2UZ8 A;  4F2I A;  2RUF A;  2KP2 A;  3DEX A;  4K5R A;  4POL A;  2CT6 A;  2I3Y A;  3RHC A;  4IJ3 A;  2VCV A;  5HR3 A;  2WZ9 A;  3HD5 A;  1CQH A;  2YV9 A;  4EIQ A;  1ZCP A;  5DVB A;  1Z7R A;  3F3R A;  2FUG 2;  4ML6 A;  4LL4 B;  3E3E A;  5GST A;  2JU5 A;  2HRA A;  2AHE A;  1J08 A;  2RUE A;  2H8L A;  3WYW A;  1PFO A;  4ZBD A;  5H5R A;  2V2G A;  4HQZ A;  2H75 A;  4MH3 A;  2VM2 A;  3HJP A;  2A2R A;  1GUH A;  4Q5N A;  3OR5 A;  3ZFL A;  2IL3 A;  5EPF A;  5ELG A;  1K3Y A;  1TRW A;  3ZMK A;  2R6K A;  4YKG A;  4O5Q A;  2CAI A;  1MDI A;  1I5G A;  1KEB A;  4MP4 A;  6GSV A;  3ZL5 A;  1ERU A;  2C0F A;  2L5L A;  1EEJ A;  4RQX A;  2VAF A;  2AAW A;  1PKZ A;  2VM1 A;  1YY7 A;  1Z6M A;  1EOG A;  4WBR D;  4EXJ A;  1QFN A;  4EKZ A;  3VFI A;  1ZYP A;  4I2T A;  2GS3 A;  5EY6 A;  2YV7 A;  5BMU A;  3F8U A;  1LU4 A;  4MZB A;  3QFA C;  5CRW A;  2R5G A;  3LGC A;  4JU5 A;  1O7U A;  4MAB A;  4L0W A;  5G30 A;  5A5K A;  3PIN A;  2XBI A;  1GL8 A;  2EC4 A;  3GKN A;  4MA9 A;  2ZCT A;  3KCM A;  4V1A g;  1BAY A;  1MD3 A;  3TKR A;  3G7I A;  4G0L A;  4X0X A;  4Z7X A;  5IMC A;  5INY A;  1AIU A;  4IVF A;  1B8X A;  1Q4J A;  1ZGN A;  2GLR A;  2DJJ A;  3IRA A;  4ZIL A;  5ABR A;  2GSR A;  3WGE A;  1ERV A;  1T4Z A;  3APS A;  5DAK B;  3GST A;  2HE3 A;  2H66 A;  2TIR A;  4G0K A;  4XTS A;  2R4V A;  1HNC A;  1HD2 A;  3WT1 A;  1CQG A;  1R26 A;  2IJY A;  1DSB A;  5GZZ B;  5F05 A;  1TU8 A;  3BCI A;  1ABA A;  19GS A;  1FW1 A;  1GTU A;  1EV9 A;  3M8N A;  3W8J A;  2VD0 A;  1O8X A;  3GYK A;  5CRG A;  1SKS B;  2VL2 C;  2K18 A;  3DYR A;  4K1F A;  4ZB6 A;  4HI7 A;  1GSS A;  2DJK A;  3GIX A;  1SJZ A;  1ST9 A;  3EE2 A;  2VCQ A;  3IAM 2;  1A0R P;  4ECI A;  4ECB A;  4YKF A;  1GUM A;  4LA1 A;  1GLQ A;  3TOU A;  3KH9 A;  3V1W A;  1AAZ A;  4N30 A;  18GS A;  4EO3 A;  1NM3 A;  1XOB A;  3GL5 A;  1SK0 A;  2QC7 A;  3EMP A;  5DJM A;  3F6F A;  3HYP A;  3EPT A;  5D9X A;  3D22 A;  2LRT A;  1YJ6 A;  1K0O A;  4MCU A;  1SL0 B;  1Z5Y E;  2XC2 A;  4L5L A;  5J4U A;  4MJC A;  3TJJ A;  4BPY A;  5L71 A;  1BED A;  1XCC A;  1XG8 A;  2MMN A;  3GKM A;  1O81 A;  3VPT A;  1XIY A;  2HLS A;  1SEN A;  3TB2 A;  3MDK A;  4F0C A;  2L6C A;  4KDX A;  2FWF A;  4I8B A;  3NIV A;  4KSM A;  2JL4 A;  2YJH A;  4ML1 A;  2F8F A;  3ZZX A;  2MBS A;  1M2B A;  2O89 A;  3GH6 A;  4IN0 A;  3TJF A;  1WJK A;  5IMV A;  2X8H A;  2LNT A;  3IXR A;  1KTE A;  3ZIV A;  2NDO A;  2VL2 A;  4NAX A;  1YEP A;  2E7P A;  1JZD A;  1V58 A;  3TCO A;  4XRD A;  3GN3 A;  3LW9 A;  4IW9 A;  1XWG A;  1M3I A;  3SBC A;  1XVQ A;  2O87 A;  2LJA A;  3KMN A;  4ZL8 A;  1X5C A;  2HZF A;  2H01 A;  3IHQ A;  1G6Y A;  3GUR A;  5CO3 A;  3KZQ A;  5HFG A;  1LBK A;  5A4W A;  2WB9 A;  4PXO A;  5IMD A;  3APO A;  4TR1 B;  1FOV A;  2DML A;  1M7T A;  3GTU B;  4ZB9 A;  3M3M A;  2PMT A;  1S3C A;  3M0F A;  3M9J A;  4KCE A;  4TVE A;  2QSI A;  1OC9 A;  3CRU A;  6GSU A;  1XVW A;  4GCI A;  3VI7 A;  1ON4 A;  1SJI A;  5D9T A;  4CDO A;  1OE8 A;  4KE3 A;  3C1S A;  3TKS E;  1XW9 A;  2KOK A;  5JCG A;  5AN1 A;  5KN2 A;  3UAR A;  2C0D A;  3EYT A;  4XS1 A;  2IIY A;  1EP8 A;  2JZT A;  4IEL A;  4L5O A;  5G2Z A;  5DAL A;  4USS A;  4WF4 A;  1EGO A;  1ZYN A;  4KB3 A;  4BWS A;  3GV1 A;  2HYX A;  4OMV A;  4HUA A;  5JWQ B;  3KP8 A;  2I81 A;  4BL7 A;  1N8J A;  1SD9 A;  4O5R A;  1OYJ A;  1U6T A;  1NW2 A;  3HA9 A;  3IR4 A;  1VF4 A;  2GDR A;  3L9U A;  2LQQ A;  3H93 A;  2FWG A;  3QDN A;  1Z3E A;  2YJ7 A;  2F9S A;  3RBT A;  3DVW A;  2OAC A;  4G10 A;  4POB A;  5J41 A;  5ID2 B;  2H6Z A;  4XS4 B;  2VCX A;  2AYT A;  5HFI A;  3KTB A;  5DBQ A;  1ERW A;  2QKE A;  3GRX A;  1ZMA A;  3O6T A;  5ECI B;  2C1Y A;  1WMJ A;  2B5E A;  2CAQ A;  4KSO A;  2ES7 A;  5AIX A;  5KOW A;  1K3O A;  4GXZ A;  2YWN A;  1TRU A;  1A0F A;  1SYX A;  2F51 A;  1TP9 A;  3KIJ A;  1K0D A;  2DJ2 A;  2X99 A;  1AUC A;  4ISD A;  1WP0 A;  4YAV A;  3IK7 A;  1K0N A;  2QA1 A;  4ID0 A;  4GLT A;  1XWC A;  3DXB A;  4G19 A;  4XIH A;  2K8V A;  2DJ3 A;  1T00 A;  2LST A;  3C1R A;  1EWX A;  1MD4 A;  3G7Y A;  4GRF A;  1XPV A;  5J3R A;  3QCP A;  1DUG A;  1M99 A;  3HXS A;  1GTB A;  4XRA A;  4HU9 A;  4MLY A;  5ECQ B;  4PQH A;  4MF6 A;  1V2A A;  1O85 A;  3Q18 A;  4KW6 A;  3KJY A;  3M1G A;  4YAP A;  5IOX A;  3KH7 A;  3HY2 A;  1TU7 A;  3ZTL A;  3E9J B;  1SYR A;  3TRP A;  2O8V B;  3U5R E;  2FY6 A;  3GH9 A;  3H4K A;  5ECP B;  3QR6 A;  4XHM A;  1AC1 A;  3HVN A;  4EIP A;  3A2V A;  3UMA A;  2IFQ B;  4NXI A;  5DAK A;  2R0P A;  4KX4 A;  1GSU A;  4NPB A;  1X9W B;  1YQ1 A;  2LRC A;  1W4V A;  4WR4 A;  4KA0 A;  4N0V A;  3GL3 A;  3D4T A;  2I9H A;  4TN8 A;  2FWE A;  1V40 A;  3ZML A;  2CQ9 A;  2LKU A;  3GMF A;  5ECM B;  1DE2 A;  4BA7 A;  5F0G A;  3FR3 A;  1NSW A;  1DBY A;  1GSE A;  3FZ9 A;  4GSN A;  3FMW A;  1FAA A;  5IMA A;  2LNS A;  1THO A;  4A5P A;  2FNO A;  4DSQ A;  2K6V A;  3TRX A;  1MTC A;  4FYC A;  2IMI A;  4WXT A;  3P7X A;  1GSD A;  1X5D A;  2H6X A;  3L0H A;  3LFL A;  4KND A;  3IV4 A;  1UN2 A;  1Z9H A;  2EIR A;  2IWT A;  3F3Q A;  1PQN A;  2KUC A;  5AIS A;  4OCE A;  1TXX A;  2H1B A;  4MH2 A;  4V1A p;  4N0Z A;  3APQ A;  2IN3 A;  4X4J A;  4AJ6 A;  2AUV A;  3MNG A;  2HSY A;  2XPD A;  2REM A;  5BRT A;  3UAP A;  3AY8 A;  3L4N A;  4LMV A;  1V98 A;  3LOR A;  1A8Y A;  2BJX A;  5CAX A;  3ISO A;  4IS0 A;  2LUS A;  3R2Q A;  5D9W A;  3I43 A;  2OAD A;  1VF1 A;  2TRC P;  1XXU A;  2JAC A;  5E59 A;  4D73 B;  3O76 A;  2C3Q A;  3LXZ A;  1FB0 A;  1WIK A;  2X4A A;  4JZQ A;  1USB A;  4K2D A;  4E8H A;  2VL9 A;  3CTG A;  4NV2 A;  5C00 A;  3PR8 A;  1OVN A;  3CBU A;  3ZYW A;  2CZ3 A;  5ENU A;  2VLT A;  1F37 A;  5KOX A;  2X8G A;  4Z2U A;  5D9V A;  3CSH A;  4ACS A;  4AJ7 A;  4QQ7 A;  6GSX A;  4O7H A;  5IMZ A;  3TDG A;  4Z2T A;  3G7J A;  1EEM A;  4MMM A;  4CY8 A;  1PN9 A;  1S3R A;  2XBQ A;  4MJE A;  6GSS A;  1U3A A;  1PRX A;  3GX8 A;  3GHA A;  4K9Z A;  1JLV A;  1OKT A;  2L57 A;  9GSS A;  2L5O A;  3FW2 A;  2YWO A;  3HJO A;  16GS A;  3PPU A;  3WGX A;  2PPT A;  4BVY A;  1TTZ A;  2DJ0 A;  4X1U A;  4G9H A;  3R3E A;  1S3A A;  1PN0 A;  1FB6 A;  3DGQ A;  2GZY A;  3CXG A;  2B5X A;  2G2Q A;  1IYH A;  3L9S A;  3MAK A;  2JSY A;  4GQC A;  5HQP A;  1G6W A;  1M0U A;  4DSS B;  2AV4 A;  1MEK A;  2GQM A;  4MJA A;  2NTO A;  4V2M A;  2WFC A;  2A4H A;  5ECO B;  1QMV A;  4PTS A;  4TXO B;  1TRV A;  3NZN A;  3GNJ A;  5AIV A;  1TI3 A;  3TOT A;  3D21 A;  3IAS 2;  1J0F A;  1YF1 A;  4I6X A;  3F4T A;  4I97 A;  2V6O A;  4XS4 A;  3N9J A;  3FK8 A;  3IHG A;  1SKR B;  2B6M A;  2CX3 A;  3HCZ A;  3RPN A;  2WS2 A;  1XW6 A;  2MMA A;  3GA4 A;  2TRX A;  2ZUP A;  3FZ5 A;  3L78 A;  2GSS A;  1X5E A;  3UVH A;  4PX1 A;  1X0R A;  3HJM A;  2VIM A;  5JWO B;  3CSJ A;  4BVX B;  4ULX A;  2K9F A;  5IO0 A;  4PNG A;  3EUR A;  3ZIT A;  2JZR A;  1W89 A;  4DEJ A;  1Y6E A;  4CW9 A;  3Q6O A;  4PUR A;  2C0G A;  3LEF A;  4DVC A;  1Y25 A;  4YQU A;  2DIY A;  3CTF A;  1R7H A;  3CSI A;  2GQK A;  5CRH A;  3TKS C;  3LJR A;  3UL3 A;  2H0G A;  1K0B A;  2F8A A;  1AQX A;  4HZ2 A;  4K0G A;  5FHI A;  3LYP A;  1GTA A;  3UIW A;  3IOS A;  2B7K A;  1R5P A;  2H74 A;  2LEG A;  1WRY A;  2ON5 A;  3UVT A;  4JBB A;  5ECN B;  2N5B A;  3I9V 2;  5IO2 A;  3EVI A;  1A23 A;  1GSF A;  2YZU A;  4TRX A;  3H1N A;  1WE0 A;  2CVK A;  1T7P B;  1FOH A;  4ZBA A;  1A2M A;  4AGS A;  5HR0 A;  5IQY A;  4YH2 A;  1KBN A;  3ME8 A;  4GWR A;  4POM A;  4HJM A;  3I69 A;  5J5N A;  1GWC A;  3VI5 A;  2PUK C;  2HZE A;  3P2A A;  2AB6 A;  1B4Q A;  2MBT A;  2FLS A;  1WWJ A;  1WPI A;  3DVX A;  4KDU A;  2XPE A;  1EP7 A;  5DDL A;  1AQW A;  1WOU A;  1YF0 A;  3C8E A;  3VPQ A;  4IJI A;  2KHP A;  4OWY A;  4PQI A;  3UEM A;  1XW5 A;  1A2J A;  2CA8 A;  4F03 A;  3TKS A;  2H76 A;  2LRN A;  4Q5R A;  2LTK A;  2ON7 A;  4K8M A;  3FKF A;  1FG4 A;  2WJU A;  4GST A;  5G5F A;  5H5S A;  1YZX A;  1QK8 A;  4G2E A;  1GRX A;  3KD0 A;  1G7E A;  1GSQ A;  2DKI A;  5GSS A;  2C0E A;  1TKD B;  3ZRD A;  4YQM A;  3NOF A;  4CHS A;  1ERT A;  1XWB A;  2F3M A;  4MPG A;  3LXT A;  3LYK A;  1XWK A;  1F2E A;  3IE3 A;  4K6X A;  5FT3 A;  5J9C A;  1E6B A;  1ZL9 A;  4ZXG A;  1SJ6 A;  2IPA A;  3RHB A;  2H0I A;  4PUA A;  4EE0 A;  1U3I A;  3I6A A;  3FRC A;  2PVO C;  4ZL9 A;  4N11 A;  4I2U A;  2ALB A;  2L4Q A;  2MMO A;  2NVL A;  4HSC X;  2HI7 A;  2HNL A;  1B9Y C;  2GT5 A;  2NBS A;  5ECH B;  3ZLP A;  5KN0 A;  2C8U A;  5G1K A;  2B3S A;  1VGL A;  5B7C A;  3RDW A;  5JCU A;  4YQV A;  3J7Y k;  11GS A;  4PGT A;  3TRQ A;  1YEX A;  5IPH A;  4D73 A;  3S9F A;  3UJ1 A;  1YKA A;  4OD7 A;  4WBJ A;  4KCA A;  5ELA A;  22GS A;  2M72 A;  2LV3 A;  3EIN A;  4MF5 A;  2HRF A;  3BCK A;  1XBS A;  4K0N A;  4J2F A;  4F0B A;  3EMX A;  4I5Q A;  1TDI A;  2YWM A;  3D5J A;  2X8C A;  5G1L A;  4ZB8 A;  5ECR B;  1PX7 A;  4Z2R A;  2VLV A;  3MSZ A;  6GSY A;  4ZBB A;  3DD3 A;  6GSW A;  2EIQ A;  4HEA 2;  4IP6 A;  4IHU A;  2FCH A;  1SK1 A;  5EL8 A;  4NWY A;  3QAV A;  3LWA A;  2I1U A;  2P0G A;  1GTI A;  3IBH A;  4O5U A;  1GNE A;  4J56 E;  1Q98 A;  1GSY A;  4KUN A;  4JE1 A;  5EVO A;  4MPF A;  2B1L A;  5LD0 A;  2L4C A;  3BD2 A;  1B9X C;  3F4S A;  3A2W A;  1H4O A;  2KP1 A;  3PGT A;  4AJ8 A;  1C72 A;  2DBC A;  2N5F A;  1A2L A;  2GQL A;  1K0M A;  1XZO A;  1GLP A;  2N5A A;  1YDK A;  3LSZ A;  5F8B A;  2GZZ A;  1FO5 A;  2I4A A;  5DQS A;  17GS A;  5F06 A;  4DSS A;  3GKK A;  2LQO A;  3EU3 A;  2HRN A;  2J9H A;  5D73 A;  5IOW A;  5DCG A;  2OE0 A;  4L8E A;  4TKY A;  4TR4 A;  5KN3 A;  2E0Q A;  3GFK A;  1RQM A;  1OC9 B;  5GAN D;  1M9B A;  3EC3 A;  1O73 A;  3MYD A;  3TKQ A;  3A5I A;  1F3A A;  4PUF C;  2H72 A;  3TKP A;  3DRN A;  2YN1 A;  1PKW A;  1PX6 A;  3ZIJ A;  2P5Q A;  4HQS A;  1QXH A;  1AXD A;  2H6Y A;  1ZOF A;  2H0H A;  2WCI A;  6GST A;  5DAL B;  3QPM A;  3Q74 A;  2CV4 A;  5IIZ A;  4MF7 A;  4QL9 A;  1VF2 A;  3F0I A;  2OBI A;  5J9B A;  4BL7 B;  1BX9 A;  4JR6 A;  4TOP A;  2MYG A;  2VD1 A;  2X64 A;  4K2X A;  5DCH A;  1EGR A;  1X9M B;  1JZR A;  4IBP A;  4LL1 B;  3M9K A;  4BVX A;  4HU7 A;  1PGT A;  4GTU A;  1G7O A;  3VK9 A;  2NPB A;  3VWX A;  1V57 A;  5F07 A;  2RM5 A;  1BQ7 A;  3PH9 A;  2DLX A;  3A2X A;  2HFD A;  4NV5 A;  3K8N A;  2GZP A;  3TJB A;  2R2J A;  3KXO A;  3IA1 A;  4P3Y B;  2VCW A;  1JZO A;  2DKH A;  3VWU A;  4MZW A;  3QAW A;  2WDU A;  1ZZY A;  2L59 A;  4KDY A;  3GUS A;  4HS1 A;  1RW1 A;  5COH A;  2R0G A;  1BYE A;  3FR9 A;  4F9Z A;  3SWL A;  4Q5F A;  2HXK A;  1M3J A;  1MDJ A;  5B8B A;  1JFU A;  3IDV A;  3KEB A;  3O3T A;  5DJL A;  5A4V A;  2G0F A;  2H73 A;  4FIW A;  4EUY A;  2X49 A;  4TXV A;  3US3 A;  2A2P A;  4BIK A;  4TR1 A;  2YPM A;  3GTU A;  2YCD A;  1FHE A;  2VO4 A;  1SKW B;  2OE1 A;  2JZS A;  2ZNM A;  3F6D A;  4GSS A;  1OE7 A;  1U88 A;  1ZYE A;  4FQU A;  2OBK A;  3BBY A;  5IMF A;  4ECJ A;  3TGZ A;  4G0I A;  5E4W A;  10GS A;  1EZK A;  4GF0 A;  14GS A;  2HSH A;  3JCM L;  3F9U A;  4IKH A;  1DE1 A;  2IMK A;  4E8E A;  4O92 A;  1THX A;  1PMT A;  1K3L A;  3BJ5 A;  2DSA A;  2H30 A;  3D6I A;  2B1K A;  4KAE A;  3UBK A;  1OC8 A;  1AW9 A;  2YAN A;  3DWV A;  4IP1 A;  4KF9 A;  2FGX A;  2VOC A;  1X9S B;  1M2A A;  1O6J A;  3QMX A;  1YKC A;  4HDE A;  3RAZ A;  2GT6 A;  2PWJ A;  1T4Y A;  1UA5 A;  1T3B A;  4FH8 A;  1T8E B;  4LMW A;  2GVP A;  4L0U A;  1Z6N A;  2K8S A;  4WF5 A;  2OA7 A;  1JHB A;  1Z7P A;  1XWA A;  2M46 A;  2YP6 A;  1F6M C;  1PL2 A;  2RM6 A;  1K0C A;  7GSS A;  1TI1 A;  3KGK A;  13GS A;  3A3T A;  1FVJ A;  2A4V A;  4MDC A;  5KN1 A;  2FWH A;  2Z9S A;  2M80 A;  3HVX A;  4JRR A;  2JSZ A;  1HQO A;  5G31 A;  5IPG A;  5ID2 A;  1HYU A;  2KLX A;  2H1G A;  1SL2 B;  1U87 A;  3F63 A;  2H71 A;  3DML A;  1TRS A;  12GS A;  2LJK A;  2R37 A;  4ECC A;  4JED A;  1UVZ A;  3IC8 A;  4FO5 A;  3ZRE A;  2VCT A;  1LJR A;  5H5Q A;  4EDZ A;  2HT9 A;  1A8L A;  4WET A;  1JZW A;  3IC4 A;  2C3N A;  2FHE A;  2VL3 A;  4XCS A;  4WEY A;  5HR1 A;  3WT2 A;  5AGY A;  4EC0 A;  2LJR A;  4EL1 A;  4EF0 A;  4NHW A;  3FZ4 A;  3C7M A;  3KMO A;  3BOA A;  3EWL A;  2PU9 C;  3FR6 A;  5ECS A;  1HNB A;  3G9B A;  3ED3 A;  1RK4 A;  3WGD A;  1AQV A;  3IK9 A;  3CMI A;  3HVV A;  1K0A A;  3LQ7 A;  1TK0 B;  4QL7 A;  3IPZ A;  2DC5 A;  4OFN A;  2R0C A;  5B6M A;  2VLU A;  5JWR B;  4PNF A;  2AJQ B;  4RQR A;  3ZVJ D;  2JAD A;  4J57 E;  4F82 A;  1R4W A;  2IFQ A;  4BWQ A;  1ACV A;  2OKA A;  1GNW A;  2CVB A;  4FYU A;  1O8W A;  2WUL A;  5LCZ A;  5KEJ A;  1NHO A;  1TW9 A;  2YWI A;  3GX0 A;  2C3T A;  3E0U A;  4K7I A;  2O85 A;  1IYI A;  3MIX A;  4O32 A;  3FHK A;  2V32 A;  2PER A;  1N2A A;  2H70 A;  3ERF A;  4RUV A;  1V9W A;  4HOJ A;  1SU9 A;  4WKW A;  4N10 A;  4OFT A;  3VWW A;  4FYB A;  2YOI A;  3FYG A;  3WD6 A;  2P31 A;  1I9D A;  1ML6 A;  5A4U A;  2PN8 A;  5D8I A;  1ILO A;  2C80 A;  4K7O A;  4XS6 A;  3TUE A;  4EDY A;  2OE3 A;  2DJ1 A;  2YNX A;  2CZ2 A;  4TW5 A;  5GAP D;  4GQF A;  3VLN A;  1SK2 A;  1J9B A;  3CRT A;  3QAG A;  1F3B A;  2HSM A;  3KP9 A;  4BVY B;  3P8W A;  2IME A;  3ZFB A;  5JCW A;  2GTU A;  5LNK e;  4KGI A;  3QFB C;  4RI6 A;  3W6G A;  3HHV A;  1H75 A;  2C4J A;  5B6N A;  3VUR A;  2V1M A;  3HZ4 A;  2OJL A;  1B48 A;  2RLI A;  3Q19 A;  5D93 A;  1UC7 A;  3VWV A;  1OC3 A;  3H8Q A;  4HZ4 A;  3C71 A;  4TR3 A;  1ZYQ B;  1EV4 A;  2VCZ A;  2VUP A;  3GKX A;  5B8A A;  4ILF A;  3ZVJ A;  1OAZ A;  5DQY A;  5CRE A;  3LG6 A;  2B7J A;  2QGV A;  4MNN A;  3UOM A;  1R5A A;  1M2D A;  2IMF A;  2V41 A;  1S3D A;  2L6D A;  4V2N A;  3ME7 A;  1TJD A;  1GUK A;  2MZC A;  5CNW A;  4H86 A;  2YZH A;  5CRD A;  2V6K A;  3QD9 A;  5HR2 A;  1PL1 A;  1VF3 A;  2PGT A;  1FVK A;  3F4R A;  4POK A;  3U6V A;  3KM6 A;  2CX4 A;  1PSQ A;  1HNA A;  4IGJ A;  2FA4 A;  1KNG A;  1B4P A;  2RII A;  5C04 A;  4OO4 A;  4V2L A;  4AF2 A;  1QGV A;  20GS A;  2PBJ A;  4HJ2 A;  4NHZ A;  1T1V A;  1GUL A;  4CY6 A;  1OKD A;  5ECK B;  5ECL B;  3HDC A;  4DSR A;  1SD8 A;  1TOF A;  3MWH A;  4ZL7 A;  4MK3 A;  2J23 A;  4EVM A;  5HFK A;  2O7K A;  2B5Y A;  1TK5 B;  1G0T A;  1TK8 B;  2H1A A;  1F9M A;  3H79 A;  4IQ1 A;  1PD2 1;  4OCF A;  3CQF A;  3EU4 A;  4Q5Q A;  5IM9 A;  1XOA A;  3RPP A;  4IQA A;  3GSS A;  4ZIJ A;  3UBL A;  3W8S A;  3FZA A;  3L9V A;  3P90 A;  4NMU A;  5CYY A;  5G5E A;  2GGT A;  3KTL A;  2XHF A;  5CP1 A;  2BMX A;  4WR5 A;  1URM A;  4MJB A;  3FEU A;  4ICY A;  1BJX A;  2A2S A;  2R3X A;  3TJK A;  1JLW A;  3FY7 A;  2P5R A;  3HZ8 A;  2E2M A;  2GSQ A;  3J7Y b;  4TR0 A;  3ERG A;  4OO5 A;  2HZE B;  2FD3 A;  2EIO A;  2H1D A;  2FA8 A;  5FWG A;  4TXO A;  3HKR A;  2LS5 A;  2WRT A;  4JR4 A;  4PQ1 A;  2QA2 A;  3CYN A;  8GSS A;  1M9A A;  3C73 A;  1QUW A;  2GST A;  1NHY A;  2IMD A;  1BG5 A;  4MZC A;  1A24 A;  4OFM A;  4K5S A;  1MDK A;  2BTO T;  2PVQ A;  3N5O A;  2MMZ A;  2DMM A;  5D96 A;  1QQ2 A;  3QOU A;  4X43 A; 
#chains in the Genus database with same CATH homology
 2WGR A;  1GH2 A;  4RI7 A;  2D2Z A;  1PA3 A;  3D4M A;  4LLR A;  3TJG A;  1VRS D;  3DKS A;  1SL1 B;  2DIZ A;  2CVD A;  2HRK A;  1GP1 A;  4KH7 A;  2H19 A;  4K7N A;  2E2G A;  1E2Y A;  3D0Z A;  3DIE A;  1EOH A;  1XFL A;  3A5W A;  3ERW A;  3HVS A;  2UZ8 A;  4F2I A;  2RUF A;  2KP2 A;  3DEX A;  4K5R A;  4POL A;  2CT6 A;  2I3Y A;  3RHC A;  4IJ3 A;  2VCV A;  5HR3 A;  2WZ9 A;  3HD5 A;  1CQH A;  2YV9 A;  4EIQ A;  1ZCP A;  5DVB A;  1Z7R A;  3F3R A;  2FUG 2;  4ML6 A;  4LL4 B;  3E3E A;  5GST A;  2JU5 A;  2HRA A;  2AHE A;  1J08 A;  2RUE A;  2H8L A;  3WYW A;  4ZBD A;  5H5R A;  2V2G A;  4HQZ A;  2H75 A;  4MH3 A;  2VM2 A;  3HJP A;  2A2R A;  1GUH A;  4Q5N A;  3OR5 A;  3ZFL A;  2IL3 A;  5EPF A;  5ELG A;  1K3Y A;  1TRW A;  3ZMK A;  2R6K A;  4YKG A;  4O5Q A;  2CAI A;  1MDI A;  1I5G A;  1KEB A;  4MP4 A;  6GSV A;  3ZL5 A;  1ERU A;  2C0F A;  2L5L A;  1EEJ A;  4RQX A;  2VAF A;  2AAW A;  1PKZ A;  2VM1 A;  1YY7 A;  1Z6M A;  1EOG A;  4WBR D;  4EXJ A;  1QFN A;  4EKZ A;  3VFI A;  1ZYP A;  4I2T A;  2GS3 A;  5EY6 A;  2YV7 A;  5BMU A;  3F8U A;  1LU4 A;  4MZB A;  3QFA C;  5CRW A;  2R5G A;  3LGC A;  4JU5 A;  1O7U A;  4MAB A;  4L0W A;  5G30 A;  5A5K A;  3PIN A;  2XBI A;  1GL8 A;  2EC4 A;  3GKN A;  4MA9 A;  2ZCT A;  3KCM A;  4V1A g;  1BAY A;  1MD3 A;  3TKR A;  3G7I A;  4G0L A;  4X0X A;  4Z7X A;  5IMC A;  5INY A;  1AIU A;  4IVF A;  1B8X A;  1Q4J A;  1ZGN A;  2GLR A;  2DJJ A;  3IRA A;  4ZIL A;  5ABR A;  2GSR A;  3WGE A;  1ERV A;  1T4Z A;  3APS A;  5DAK B;  3GST A;  2HE3 A;  2H66 A;  2TIR A;  4G0K A;  4XTS A;  2R4V A;  1HNC A;  1HD2 A;  3WT1 A;  1CQG A;  1R26 A;  2IJY A;  1DSB A;  5GZZ B;  5F05 A;  1TU8 A;  3BCI A;  1ABA A;  19GS A;  1FW1 A;  1GTU A;  1EV9 A;  3M8N A;  3W8J A;  2VD0 A;  1O8X A;  3GYK A;  5CRG A;  1SKS B;  2VL2 C;  2K18 A;  3DYR A;  4K1F A;  4ZB6 A;  4HI7 A;  1GSS A;  2DJK A;  3GIX A;  1SJZ A;  1ST9 A;  3EE2 A;  2VCQ A;  3IAM 2;  1A0R P;  4ECI A;  4ECB A;  4YKF A;  1GUM A;  4LA1 A;  1GLQ A;  3TOU A;  3KH9 A;  3V1W A;  1AAZ A;  4N30 A;  18GS A;  4EO3 A;  1NM3 A;  1XOB A;  3GL5 A;  1SK0 A;  2QC7 A;  3EMP A;  5DJM A;  3F6F A;  3HYP A;  3EPT A;  5D9X A;  3D22 A;  2LRT A;  1YJ6 A;  1K0O A;  4MCU A;  1SL0 B;  1Z5Y E;  2XC2 A;  4L5L A;  5J4U A;  4MJC A;  3TJJ A;  4BPY A;  5L71 A;  1BED A;  1XCC A;  2MMN A;  3GKM A;  1O81 A;  3VPT A;  1XIY A;  2HLS A;  1SEN A;  3TB2 A;  3MDK A;  4F0C A;  2L6C A;  4KDX A;  2FWF A;  4I8B A;  3NIV A;  4KSM A;  2JL4 A;  2YJH A;  4ML1 A;  2F8F A;  3ZZX A;  2MBS A;  1M2B A;  2O89 A;  3GH6 A;  4IN0 A;  3TJF A;  1WJK A;  5IMV A;  2X8H A;  2LNT A;  3IXR A;  1KTE A;  3ZIV A;  2NDO A;  2VL2 A;  4NAX A;  1YEP A;  2E7P A;  1JZD A;  1V58 A;  3TCO A;  4XRD A;  3GN3 A;  3LW9 A;  4IW9 A;  1XWG A;  3SBC A;  1XVQ A;  2O87 A;  2LJA A;  3KMN A;  4ZL8 A;  1X5C A;  2HZF A;  2H01 A;  3IHQ A;  1G6Y A;  3GUR A;  5CO3 A;  3KZQ A;  5HFG A;  1LBK A;  5A4W A;  2WB9 A;  4PXO A;  5IMD A;  3APO A;  4TR1 B;  1FOV A;  2DML A;  1M7T A;  3GTU B;  4ZB9 A;  3M3M A;  2PMT A;  1S3C A;  3M0F A;  3M9J A;  4KCE A;  4TVE A;  2QSI A;  1OC9 A;  3CRU A;  6GSU A;  1XVW A;  4GCI A;  3VI7 A;  1ON4 A;  1SJI A;  5D9T A;  4CDO A;  1OE8 A;  4KE3 A;  3C1S A;  3TKS E;  1XW9 A;  2KOK A;  5JCG A;  5AN1 A;  5KN2 A;  3UAR A;  2C0D A;  3EYT A;  4XS1 A;  2IIY A;  1EP8 A;  2JZT A;  4IEL A;  4L5O A;  5G2Z A;  5DAL A;  4USS A;  4WF4 A;  1EGO A;  1ZYN A;  4KB3 A;  4BWS A;  3GV1 A;  2HYX A;  4OMV A;  4HUA A;  5JWQ B;  3KP8 A;  2I81 A;  4BL7 A;  1N8J A;  1SD9 A;  4O5R A;  1OYJ A;  1U6T A;  1NW2 A;  3HA9 A;  3IR4 A;  1VF4 A;  2GDR A;  3L9U A;  2LQQ A;  3H93 A;  2FWG A;  3QDN A;  1Z3E A;  2YJ7 A;  2F9S A;  3RBT A;  3DVW A;  2OAC A;  4G10 A;  4POB A;  5J41 A;  5ID2 B;  2H6Z A;  4XS4 B;  2VCX A;  2AYT A;  5HFI A;  3KTB A;  5DBQ A;  1ERW A;  2QKE A;  3GRX A;  1ZMA A;  3O6T A;  5ECI B;  2C1Y A;  1WMJ A;  2B5E A;  2CAQ A;  4KSO A;  2ES7 A;  5AIX A;  5KOW A;  1K3O A;  4GXZ A;  2YWN A;  1TRU A;  1A0F A;  1SYX A;  2F51 A;  1TP9 A;  3KIJ A;  1K0D A;  2DJ2 A;  2X99 A;  1AUC A;  4ISD A;  1WP0 A;  4YAV A;  3IK7 A;  1K0N A;  2QA1 A;  4ID0 A;  4GLT A;  1XWC A;  3DXB A;  4G19 A;  4XIH A;  2K8V A;  2DJ3 A;  1T00 A;  2LST A;  3C1R A;  1EWX A;  1MD4 A;  3G7Y A;  4GRF A;  1XPV A;  5J3R A;  3QCP A;  1DUG A;  1M99 A;  3HXS A;  1GTB A;  4XRA A;  4HU9 A;  4MLY A;  5ECQ B;  4PQH A;  4MF6 A;  1V2A A;  1O85 A;  3Q18 A;  4KW6 A;  3KJY A;  3M1G A;  4YAP A;  5IOX A;  3KH7 A;  3HY2 A;  1TU7 A;  3ZTL A;  3E9J B;  1SYR A;  3TRP A;  2O8V B;  3U5R E;  2FY6 A;  3GH9 A;  3H4K A;  5ECP B;  3QR6 A;  4XHM A;  1AC1 A;  4EIP A;  3A2V A;  3UMA A;  2IFQ B;  4NXI A;  5DAK A;  2R0P A;  4KX4 A;  1GSU A;  4NPB A;  1X9W B;  1YQ1 A;  2LRC A;  1W4V A;  4WR4 A;  4KA0 A;  4N0V A;  3GL3 A;  3D4T A;  2I9H A;  4TN8 A;  2FWE A;  1V40 A;  3ZML A;  2CQ9 A;  2LKU A;  3GMF A;  5ECM B;  1DE2 A;  4BA7 A;  5F0G A;  3FR3 A;  1NSW A;  1DBY A;  1GSE A;  3FZ9 A;  4GSN A;  3FMW A;  1FAA A;  5IMA A;  2LNS A;  1THO A;  4A5P A;  2FNO A;  4DSQ A;  2K6V A;  3TRX A;  1MTC A;  4FYC A;  2IMI A;  4WXT A;  3P7X A;  1GSD A;  1X5D A;  2H6X A;  3L0H A;  3LFL A;  4KND A;  3IV4 A;  1UN2 A;  1Z9H A;  2EIR A;  2IWT A;  3F3Q A;  1PQN A;  2KUC A;  5AIS A;  4OCE A;  1TXX A;  2H1B A;  4MH2 A;  4V1A p;  4N0Z A;  3APQ A;  2IN3 A;  4X4J A;  4AJ6 A;  2AUV A;  3MNG A;  2HSY A;  2XPD A;  2REM A;  5BRT A;  3UAP A;  3AY8 A;  3L4N A;  4LMV A;  1V98 A;  3LOR A;  1A8Y A;  2BJX A;  5CAX A;  3ISO A;  4IS0 A;  2LUS A;  3R2Q A;  5D9W A;  3I43 A;  2OAD A;  1VF1 A;  2TRC P;  1XXU A;  2JAC A;  5E59 A;  4D73 B;  3O76 A;  2C3Q A;  3LXZ A;  1FB0 A;  1WIK A;  2X4A A;  4JZQ A;  1USB A;  4K2D A;  4E8H A;  2VL9 A;  3CTG A;  4NV2 A;  5C00 A;  3PR8 A;  1OVN A;  3CBU A;  3ZYW A;  2CZ3 A;  5ENU A;  2VLT A;  1F37 A;  5KOX A;  2X8G A;  4Z2U A;  5D9V A;  3CSH A;  4ACS A;  4AJ7 A;  4QQ7 A;  6GSX A;  4O7H A;  5IMZ A;  3TDG A;  4Z2T A;  3G7J A;  1EEM A;  4MMM A;  4CY8 A;  1PN9 A;  2XBQ A;  4MJE A;  6GSS A;  1U3A A;  1PRX A;  3GX8 A;  3GHA A;  4K9Z A;  1JLV A;  1OKT A;  2L57 A;  9GSS A;  2L5O A;  3FW2 A;  2YWO A;  3HJO A;  16GS A;  3PPU A;  3WGX A;  2PPT A;  4BVY A;  1TTZ A;  2DJ0 A;  4X1U A;  4G9H A;  3R3E A;  1S3A A;  1PN0 A;  1FB6 A;  3DGQ A;  2GZY A;  3CXG A;  2B5X A;  2G2Q A;  1IYH A;  3L9S A;  3MAK A;  2JSY A;  4GQC A;  5HQP A;  1G6W A;  1M0U A;  4DSS B;  2AV4 A;  1MEK A;  2GQM A;  4MJA A;  2NTO A;  4V2M A;  2WFC A;  2A4H A;  5ECO B;  1QMV A;  4PTS A;  4TXO B;  1TRV A;  3NZN A;  3GNJ A;  5AIV A;  1TI3 A;  3TOT A;  3D21 A;  3IAS 2;  1J0F A;  1YF1 A;  4I6X A;  3F4T A;  4I97 A;  2V6O A;  4XS4 A;  3N9J A;  3FK8 A;  3IHG A;  1SKR B;  2B6M A;  2CX3 A;  3HCZ A;  3RPN A;  2WS2 A;  1XW6 A;  2MMA A;  3GA4 A;  2TRX A;  2ZUP A;  3FZ5 A;  3L78 A;  2GSS A;  1X5E A;  3UVH A;  4PX1 A;  1X0R A;  3HJM A;  2VIM A;  5JWO B;  3CSJ A;  4BVX B;  4ULX A;  2K9F A;  5IO0 A;  4PNG A;  3EUR A;  3ZIT A;  2JZR A;  1W89 A;  4DEJ A;  1Y6E A;  4CW9 A;  3Q6O A;  4PUR A;  2C0G A;  3LEF A;  4DVC A;  1Y25 A;  4YQU A;  2DIY A;  3CTF A;  1R7H A;  3CSI A;  2GQK A;  5CRH A;  3TKS C;  3LJR A;  3UL3 A;  2H0G A;  1K0B A;  2F8A A;  1AQX A;  4HZ2 A;  4K0G A;  5FHI A;  3LYP A;  1GTA A;  3UIW A;  3IOS A;  2B7K A;  1R5P A;  2H74 A;  2LEG A;  1WRY A;  2ON5 A;  3UVT A;  4JBB A;  5ECN B;  2N5B A;  3I9V 2;  5IO2 A;  3EVI A;  1A23 A;  1GSF A;  2YZU A;  4TRX A;  3H1N A;  1WE0 A;  2CVK A;  1T7P B;  1FOH A;  4ZBA A;  1A2M A;  4AGS A;  5HR0 A;  5IQY A;  4YH2 A;  1KBN A;  3ME8 A;  4GWR A;  4POM A;  4HJM A;  3I69 A;  5J5N A;  1GWC A;  3VI5 A;  2PUK C;  2HZE A;  3P2A A;  2AB6 A;  1B4Q A;  2MBT A;  2FLS A;  1WWJ A;  1WPI A;  3DVX A;  4KDU A;  2XPE A;  1EP7 A;  5DDL A;  1AQW A;  1WOU A;  1YF0 A;  3C8E A;  3VPQ A;  4IJI A;  2KHP A;  4OWY A;  4PQI A;  3UEM A;  1XW5 A;  1A2J A;  2CA8 A;  4F03 A;  3TKS A;  2H76 A;  2LRN A;  4Q5R A;  2LTK A;  2ON7 A;  4K8M A;  3FKF A;  1FG4 A;  2WJU A;  4GST A;  5G5F A;  5H5S A;  1YZX A;  1QK8 A;  4G2E A;  1GRX A;  3KD0 A;  1G7E A;  1GSQ A;  2DKI A;  5GSS A;  2C0E A;  1TKD B;  3ZRD A;  4YQM A;  3NOF A;  4CHS A;  1ERT A;  1XWB A;  2F3M A;  4MPG A;  3LXT A;  3LYK A;  1XWK A;  1F2E A;  3IE3 A;  4K6X A;  5FT3 A;  5J9C A;  1E6B A;  1ZL9 A;  4ZXG A;  1SJ6 A;  2IPA A;  3RHB A;  2H0I A;  4PUA A;  4EE0 A;  1U3I A;  3I6A A;  3FRC A;  2PVO C;  4ZL9 A;  4N11 A;  4I2U A;  2ALB A;  2L4Q A;  2MMO A;  2NVL A;  2HI7 A;  2HNL A;  1B9Y C;  2GT5 A;  2NBS A;  5ECH B;  3ZLP A;  5KN0 A;  2C8U A;  5G1K A;  2B3S A;  1VGL A;  5B7C A;  3RDW A;  5JCU A;  4YQV A;  3J7Y k;  11GS A;  4PGT A;  3TRQ A;  1YEX A;  5IPH A;  4D73 A;  3S9F A;  3UJ1 A;  1YKA A;  4OD7 A;  4WBJ A;  4KCA A;  5ELA A;  22GS A;  2M72 A;  2LV3 A;  3EIN A;  4MF5 A;  2HRF A;  3BCK A;  1XBS A;  4K0N A;  4J2F A;  4F0B A;  3EMX A;  4I5Q A;  1TDI A;  2YWM A;  3D5J A;  2X8C A;  5G1L A;  4ZB8 A;  5ECR B;  1PX7 A;  4Z2R A;  2VLV A;  3MSZ A;  6GSY A;  4ZBB A;  3DD3 A;  6GSW A;  2EIQ A;  4HEA 2;  4IP6 A;  4IHU A;  2FCH A;  1SK1 A;  5EL8 A;  4NWY A;  3QAV A;  3LWA A;  2I1U A;  2P0G A;  1GTI A;  3IBH A;  4O5U A;  1GNE A;  4J56 E;  1Q98 A;  1GSY A;  4KUN A;  4JE1 A;  5EVO A;  4MPF A;  2B1L A;  5LD0 A;  2L4C A;  3BD2 A;  1B9X C;  3F4S A;  3A2W A;  1H4O A;  2KP1 A;  3PGT A;  4AJ8 A;  1C72 A;  2DBC A;  2N5F A;  1A2L A;  2GQL A;  1K0M A;  1XZO A;  1GLP A;  2N5A A;  1YDK A;  3LSZ A;  5F8B A;  2GZZ A;  1FO5 A;  2I4A A;  5DQS A;  17GS A;  5F06 A;  4DSS A;  3GKK A;  2LQO A;  3EU3 A;  2HRN A;  2J9H A;  5D73 A;  5IOW A;  5DCG A;  2OE0 A;  4L8E A;  4TKY A;  4TR4 A;  5KN3 A;  2E0Q A;  3GFK A;  1RQM A;  1OC9 B;  5GAN D;  1M9B A;  3EC3 A;  1O73 A;  3MYD A;  3TKQ A;  3A5I A;  1F3A A;  4PUF C;  2H72 A;  3TKP A;  3DRN A;  2YN1 A;  1PKW A;  1PX6 A;  3ZIJ A;  2P5Q A;  4HQS A;  1QXH A;  1AXD A;  2H6Y A;  1ZOF A;  2H0H A;  2WCI A;  6GST A;  5DAL B;  3QPM A;  3Q74 A;  2CV4 A;  5IIZ A;  4MF7 A;  4QL9 A;  1VF2 A;  3F0I A;  2OBI A;  5J9B A;  4BL7 B;  1BX9 A;  4JR6 A;  4TOP A;  2MYG A;  2VD1 A;  2X64 A;  4K2X A;  5DCH A;  1EGR A;  1X9M B;  1JZR A;  4IBP A;  4LL1 B;  3M9K A;  4BVX A;  4HU7 A;  1PGT A;  4GTU A;  1G7O A;  3VK9 A;  2NPB A;  3VWX A;  1V57 A;  5F07 A;  2RM5 A;  1BQ7 A;  3PH9 A;  2DLX A;  3A2X A;  2HFD A;  4NV5 A;  3K8N A;  2GZP A;  3TJB A;  2R2J A;  3KXO A;  3IA1 A;  4P3Y B;  2VCW A;  1JZO A;  2DKH A;  3VWU A;  4MZW A;  3QAW A;  2WDU A;  1ZZY A;  2L59 A;  4KDY A;  3GUS A;  4HS1 A;  1RW1 A;  5COH A;  2R0G A;  1BYE A;  3FR9 A;  4F9Z A;  3SWL A;  4Q5F A;  2HXK A;  1MDJ A;  5B8B A;  1JFU A;  3IDV A;  3KEB A;  3O3T A;  5DJL A;  5A4V A;  2G0F A;  2H73 A;  4FIW A;  4EUY A;  2X49 A;  4TXV A;  3US3 A;  2A2P A;  4TR1 A;  2YPM A;  3GTU A;  2YCD A;  1FHE A;  2VO4 A;  1SKW B;  2OE1 A;  2JZS A;  2ZNM A;  3F6D A;  4GSS A;  1OE7 A;  1U88 A;  1ZYE A;  4FQU A;  2OBK A;  3BBY A;  5IMF A;  4ECJ A;  3TGZ A;  4G0I A;  5E4W A;  10GS A;  1EZK A;  4GF0 A;  14GS A;  2HSH A;  3JCM L;  3F9U A;  4IKH A;  1DE1 A;  2IMK A;  4E8E A;  4O92 A;  1THX A;  1PMT A;  1K3L A;  3BJ5 A;  2DSA A;  2H30 A;  3D6I A;  2B1K A;  4KAE A;  3UBK A;  1OC8 A;  1AW9 A;  2YAN A;  3DWV A;  4IP1 A;  4KF9 A;  2FGX A;  2VOC A;  1X9S B;  1M2A A;  1O6J A;  3QMX A;  1YKC A;  4HDE A;  3RAZ A;  2GT6 A;  2PWJ A;  1T4Y A;  1UA5 A;  1T3B A;  4FH8 A;  1T8E B;  4LMW A;  2GVP A;  4L0U A;  1Z6N A;  2K8S A;  4WF5 A;  2OA7 A;  1JHB A;  1Z7P A;  1XWA A;  2M46 A;  2YP6 A;  1F6M C;  1PL2 A;  2RM6 A;  1K0C A;  7GSS A;  1TI1 A;  3KGK A;  13GS A;  3A3T A;  1FVJ A;  2A4V A;  4MDC A;  5KN1 A;  2FWH A;  2Z9S A;  2M80 A;  3HVX A;  4JRR A;  2JSZ A;  1HQO A;  5G31 A;  5IPG A;  5ID2 A;  1HYU A;  2KLX A;  2H1G A;  1SL2 B;  1U87 A;  3F63 A;  2H71 A;  3DML A;  1TRS A;  12GS A;  2LJK A;  2R37 A;  4ECC A;  4JED A;  1UVZ A;  3IC8 A;  4FO5 A;  3ZRE A;  2VCT A;  1LJR A;  5H5Q A;  4EDZ A;  2HT9 A;  1A8L A;  4WET A;  1JZW A;  3IC4 A;  2C3N A;  2FHE A;  2VL3 A;  4XCS A;  4WEY A;  5HR1 A;  3WT2 A;  5AGY A;  4EC0 A;  2LJR A;  4EL1 A;  4EF0 A;  4NHW A;  3FZ4 A;  3C7M A;  3KMO A;  3BOA A;  3EWL A;  2PU9 C;  3FR6 A;  5ECS A;  1HNB A;  3G9B A;  3ED3 A;  1RK4 A;  3WGD A;  1AQV A;  3IK9 A;  3CMI A;  3HVV A;  1K0A A;  3LQ7 A;  1TK0 B;  4QL7 A;  3IPZ A;  2DC5 A;  4OFN A;  2R0C A;  5B6M A;  2VLU A;  5JWR B;  4PNF A;  2AJQ B;  4RQR A;  3ZVJ D;  2JAD A;  4J57 E;  4F82 A;  1R4W A;  2IFQ A;  4BWQ A;  1ACV A;  2OKA A;  1GNW A;  2CVB A;  4FYU A;  1O8W A;  2WUL A;  5LCZ A;  5KEJ A;  1NHO A;  1TW9 A;  2YWI A;  3GX0 A;  2C3T A;  3E0U A;  4K7I A;  2O85 A;  1IYI A;  3MIX A;  4O32 A;  3FHK A;  2V32 A;  2PER A;  1N2A A;  2H70 A;  3ERF A;  4RUV A;  1V9W A;  4HOJ A;  1SU9 A;  4WKW A;  4N10 A;  4OFT A;  3VWW A;  4FYB A;  2YOI A;  3FYG A;  3WD6 A;  2P31 A;  1I9D A;  1ML6 A;  5A4U A;  2PN8 A;  5D8I A;  1ILO A;  2C80 A;  4K7O A;  4XS6 A;  3TUE A;  4EDY A;  2OE3 A;  2DJ1 A;  2YNX A;  2CZ2 A;  4TW5 A;  5GAP D;  4GQF A;  3VLN A;  1SK2 A;  1J9B A;  3CRT A;  3QAG A;  1F3B A;  2HSM A;  3KP9 A;  4BVY B;  3P8W A;  2IME A;  3ZFB A;  5JCW A;  2GTU A;  5LNK e;  4KGI A;  3QFB C;  4RI6 A;  3W6G A;  3HHV A;  1H75 A;  2C4J A;  5B6N A;  3VUR A;  2V1M A;  3HZ4 A;  2OJL A;  1B48 A;  2RLI A;  3Q19 A;  5D93 A;  1UC7 A;  3VWV A;  1OC3 A;  3H8Q A;  4HZ4 A;  3C71 A;  4TR3 A;  1ZYQ B;  1EV4 A;  2VCZ A;  2VUP A;  3GKX A;  5B8A A;  4ILF A;  3ZVJ A;  1OAZ A;  5DQY A;  5CRE A;  3LG6 A;  2B7J A;  2QGV A;  4MNN A;  3UOM A;  1R5A A;  1M2D A;  2IMF A;  2V41 A;  1S3D A;  2L6D A;  4V2N A;  3ME7 A;  1TJD A;  1GUK A;  2MZC A;  5CNW A;  4H86 A;  2YZH A;  5CRD A;  2V6K A;  3QD9 A;  5HR2 A;  1PL1 A;  1VF3 A;  2PGT A;  1FVK A;  3F4R A;  4POK A;  3U6V A;  3KM6 A;  2CX4 A;  1PSQ A;  1HNA A;  4IGJ A;  2FA4 A;  1KNG A;  1B4P A;  2RII A;  5C04 A;  4OO4 A;  4V2L A;  4AF2 A;  1QGV A;  20GS A;  2PBJ A;  4HJ2 A;  4NHZ A;  1T1V A;  1GUL A;  4CY6 A;  1OKD A;  5ECK B;  5ECL B;  3HDC A;  4DSR A;  1SD8 A;  1TOF A;  3MWH A;  4ZL7 A;  4MK3 A;  2J23 A;  4EVM A;  5HFK A;  2O7K A;  2B5Y A;  1TK5 B;  1G0T A;  1TK8 B;  2H1A A;  1F9M A;  3H79 A;  4IQ1 A;  1PD2 1;  4OCF A;  3EU4 A;  4Q5Q A;  5IM9 A;  1XOA A;  3RPP A;  4IQA A;  3GSS A;  4ZIJ A;  3UBL A;  3W8S A;  3FZA A;  3L9V A;  3P90 A;  4NMU A;  5CYY A;  5G5E A;  2GGT A;  3KTL A;  2XHF A;  5CP1 A;  2BMX A;  4WR5 A;  1URM A;  4MJB A;  3FEU A;  4ICY A;  1BJX A;  2A2S A;  2R3X A;  3TJK A;  1JLW A;  3FY7 A;  2P5R A;  3HZ8 A;  2E2M A;  2GSQ A;  3J7Y b;  4TR0 A;  3ERG A;  4OO5 A;  2HZE B;  2FD3 A;  2EIO A;  2H1D A;  2FA8 A;  5FWG A;  4TXO A;  3HKR A;  2LS5 A;  2WRT A;  4JR4 A;  4PQ1 A;  2QA2 A;  3CYN A;  8GSS A;  1M9A A;  3C73 A;  1QUW A;  2GST A;  1NHY A;  2IMD A;  1BG5 A;  4MZC A;  1A24 A;  4OFM A;  4K5S A;  1MDK A;  2BTO T;  2PVQ A;  3N5O A;  2MMZ A;  2DMM A;  5D96 A;  1QQ2 A;  3QOU A;  4X43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...