4N30A

Crystal structure of pseudomonas aeruginosa dsba2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
182
structure length
182
Chain Sequence
KGLPANHSLYGDAKARWTINEYADLECPFCKVYTPRLKRWVDSHPDVNLVWRHLPLQMHGEAARHQARLVECAGIQGGAKAFWSAIDAIFAQSAGNGGGLPGGTLDFPELDQARLEKCAKDNELIDSDIKLDIDIARSKGITATPTLVIRDNQTGRSVKLEGMADETTLLSAIDWLAKDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Protein disulfide isomerase
publication title Dissecting the machinery that introduces disulfide bonds in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 71
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4n30A00
2A4VA 3D0ZA 2P31A 5JCGA 5AIVA 1G6YA 3UVHA 5DCGA 1QK8A 2YWMA 4BVYA 4MF6A 2CZ3A 2ON5A 4ILFA 1DE1A 1X5CA 4IP1A 3KEBA 5C00A 5HFIA 4EDZA 2GZYA 1O6JA 2PPTA 5IM9A 3QPMA 2VCVA 2HSHA 4IN0A 3CBUA 4K9ZA 4ML1A 2QGVA 2WJUA 2LNTA 1K0OA 2J23A 2K18A 3KH7A 1NHOA 4LL4B 1X9WB 2HZEA 3FR9A 3I43A 2YPMA 1OC8A 4EF0A 1A2JA 1SL0B 2HYXA 4K7NA 2YNXA 4Q5RA 1PKWA 1TRWA 4NV5A 1BJXA 2X8CA 4OFTA 2DJJA 4N0VA 1R4WA 5ID2B 2B5EA 1BYEA 4LL1B 1GSFA 5AGYA 1Q98A 1TRVA 1FVKA 3BJ5A 3GKMA 2KHPA 3KJYA 2H70A 1AXDA 4TRXA 5JWOB 2H1GA 4OFNA 2WZ9A 5F07A 1ERTA 3GV1A 3M9JA 4MZBA 4KNDA 5KN2A 4POLA 4HQSA 2O87A 1OE7A 1G7OA 5A4UA 1YEPA 1T4ZA 3RAZA 1SKSB 1WP0A 2HT9A 1FB6A 2EC4A 2DMLA 2LQOA 1RK4A 1GSQA 2R4VA 3TKSE 2HZEB 5GSSA 3LQ7A 1SYXA 2YOIA 1B9YC 2BTOT 2VL2A 2N5BA 2CX4A 1AQWA 2VLUA 3GX0A 1A23A 1B9XC 3FR6A 1Q4JA 2MMNA 2H73A 3QAGA 4XS4A 4F0BA 3G7IA 1FW1A 4MZWA 1YEXA 1HNAA 2FWHA 4YQMA 1GUKA 3LJRA 3TGZA 2GT6A 3FEUA 4EKZA 4HOJA 3BOAA 3DVWA 5IMFA 3TJJA 1NM3A 2REMA 1TRUA 2V6OA 2GZZA 4MH3A 4PQHA 1PKZA 5H5QA 4V2LA 2HZFA 4K0GA 1PSQA 1X5DA 4JR6A 1GH2A 5HFGA 4TR0A 3K8NA 4CW9A 4I5QA 4GQCA 2H6YA 3VPQA 4DSSA 5CP1A 1GSYA 2AYTA 5CREA 4IQAA 4XHMA 1ZCPA 1J9BA 3F63A 3ZYWA 2K6VA 3ERGA 4DVCA 3D6IA 2DC5A 1RW1A 3IC4A 2YZHA 11GSA 4ISDA 4WR4A 5KN0A 4RI6A 1GLPA 1H4OA 3PH9A 4XRDA 4OO4A 4KE3A 4MMMA 2O7KA 3LSZA 1SENA 2DMMA 3EE2A 1HNBA 1GUHA 1ERWA 3ZREA 4ZL7A 2P5RA 1YDKA 2H1DA 4MJEA 1JZWA 3WD6A 2NTOA 5A5KA 6GSTA 1Z7RA 5ECHB 4TR4A 3ZRDA 2LRTA 1EV9A 5FT3A 5GZZB 5JCUA 4RQXA 4KGIA 5JWQB 3GYKA 3FZ9A 4BA7A 4DSQA 2OBKA 1M99A 1QGVA 5J9BA 2VAFA 3KH9A 1X0RA 4EO3A 4AF2A 1U88A 5HR2A 3IA1A 1XWGA 2VCZA 3MDKA 3C8EA 2GTUA 2H0HA 3HZ8A 4NWYA 3L9UA 3IBHA 3VWWA 2I9HA 2TRCP 2IMEA 1R5AA 2H01A 5IOXA 4OCFA 4KDUA 1MD4A 1AAZA 4KB3A 5HR1A 3IRAA 5ECPB 4HEA2 1A2MA 1J08A 1BQ7A 4MJCA 1K0BA 1UC7A 2PVOC 4OWYA 10GSA 3UBKA 4NAXA 3TDGA 3TB2A 5B6MA 1B4QA 5HQPA 2VCQA 1PMTA 4OO5A 4WR5A 4TR1A 4IS0A 4IQ1A 2J9HA 3FR3A 1V40A 1G7EA 2H0GA 1VF3A 2IMKA 1X9MB 3NZNA 2QKEA 4LMVA 4L0UA 4WBJA 3H1NA 4TXVA 5ECQB 2BJXA 1GSSA 1RQMA 4MF7A 2FA8A 1R5PA 1K3YA 2PU9C 5IMAA 3FRCA 4N10A 4JEDA 1GLQA 5F05A 2P5QA 1EZKA 4JRRA 1X5EA 3UARA 1GWCA 5G31A 3TKSA 2C3TA 4ECCA 5D9VA 1TJDA 2IN3A 2K8SA 1T8EB 5E59A 4HZ2A 4ZBDA 3H79A 3PR8A 1HNCA 2JADA 1MDIA 3QOUA 2M80A 3UIWA 4PUAA 2H1AA 5ECMB 5B7CA 2OBIA 1SYRA 3QFAC 3ZTLA 1GTIA 2M72A 4TR1B 3Q18A 4K6XA 3GH9A 4GRFA 1VGLA 1URMA 3LWAA 5IIZA 3KP9A 3ZIJA 1OKDA 3CTGA 3E9JB 4DSRA 2GS3A 4FIWA 2PN8A 3FZ4A 1V98A 3TCOA 2LJRA 5KN1A 4G10A 1U6TA 1EV4A 3CSJA 5DVBA 3GTUA 5ECSA 2R37A 3RPPA 4NHWA 2YV9A 5DQYA 3D4TA 3G9BA 1W89A 1PN9A 2WGRA 5DAKB 5FWGA 4ML6A 1ILOA 2L5OA 5G5EA 1A8LA 5AISA 4I97A 4MLYA 3WGDA 3IAS2 3IHQA 1EOHA 1FHEA 3VK9A 1ZYEA 2O8VB 3ZITA 1O73A 3GL5A 3SWLA 3VI7A 4V1Ag 5IPHA 2F3MA 1B8XA 1Z5YE 5AN1A 4TR3A 2DJ1A 3Q74A 5FHIA 2PMTA 2VL9A 4GF0A 4YQVA 1DUGA 2PBJA 3VPTA 2FCHA 3FZ5A 4I2TA 1FAAA 1GSDA 4EDYA 3F9UA 1Z7PA 2X8HA 1E2YA 2YWIA 1HYUA 3DVXA 2MBSA 3EMPA 3IOSA 1XWBA 7GSSA 3M3MA 3J7Yk 3GSTA 5IOWA 4Q5NA 5EY6A 1ZOFA 4TN8A 1TU8A 4TW5A 1XBSA 2H19A 3H4KA 1XWAA 1GULA 4K7OA 3GH6A 1YF1A 1S3DA 22GSA 4O7HA 4ZXGA 1V57A 3GHAA 4TVEA 1B48A 1ON4A 4TOPA 4BVXA 3R2QA 4HJMA 2VCWA 2H72A 1A0FA 1WOUA 2OJLA 2L6CA 4J56E 4N0ZA 1OC9A 1AW9A 4TXOB 2H6XA 2WS2A 3MWHA 2CX3A 2X64A 1WWJA 4QL7A 3N9JA 5ELAA 4YAPA 1VF2A 3CSIA 3LORA 4HQZA 4O92A 4WF4A 3M8NA 2C8UA 5GAND 2GSQA 2NPBA 2RM5A 5ECKB 2IWTA 3ZZXA 1TI1A 1A8YA 2L4CA 4HDEA 5IO0A 3DYRA 3VFIA 4F2IA 4OMVA 2B1KA 1GNEA 4NV2A 1V9WA 1AC1A 3VWXA 5D9XA 2EIQA 1PA3A 1FOVA 2CAQA 3FKFA 2KP1A 1ST9A 3QR6A 4X43A 5CRGA 1XW9A 2CVKA 4FYCA 1WPIA 4HUAA 1DSBA 4FH8A 3HHVA 2EIOA 2YJ7A 1GNWA 1T4YA 2ZNMA 1PX7A 3P2AA 1T00A 3EYTA 2R2JA 3L9VA 3GKNA 5GAPD 1OC9B 3ZFLA 2KUCA 2DJ2A 1E6BA 5DBQA 1BEDA 3O3TA 1EWXA 1HD2A 3F4TA 4YQUA 3EINA 2VCXA 3ERWA 2OE0A 5ECLB 4IKHA 2LRCA 2C80A 1KNGA 2AUVA 3GFKA 1QFNA 2C0EA 4F0CA 2LRNA 3TKPA 3KM6A 3NOFA 3KP8A 6GSWA 4WETA 1Y6EA 2E0QA 3HXSA 3VLNA 3GIXA 2V1MA 3GKXA 4WEYA 4PQIA 2F9SA 1SJZA 3DRNA 2AHEA 1GSEA 5DALA 1AQVA 1OYJA 3L4NA 5CRDA 4O5RA 2JSZA 5COHA 1O8XA 1JLVA 20GSA 4F82A 3EU3A 2LSTA 4MZCA 3FYGA 2H74A 1XWKA 3GA4A 1Z9HA 2TRXA 5G1KA 4NXIA 1WIKA 5IQYA 2H6ZA 1FB0A 3LYPA 3LYKA 1FO5A 2G2QA 4FO5A 2Z9SA 5E4WA 2JZTA 3W8SA 3GX8A 3QFBC 4PQ1A 5GSTA 3SBCA 3G7YA 3GL3A 2VOCA 1CQGA 4POBA 4BWQA 3F3RA 1I5GA 1K3OA 1LJRA 4ULXA 4XS4B 3WT1A 5AIXA 1T1VA 3CRUA 4TKYA 2GQLA 2ZCTA 4H86A 2L6DA 4PX1A 1W4VA 4P3YB 2WULA 3FZAA 14GSA 3D21A 1XFLA 2C0GA 2GZPA 4KA0A 3TRPA 3UAPA 1JFUA 3F3QA 5DALB 3CTFA 1A24A 3GN3A 3BCIA 5D93A 1ZZYA 3I69A 1U3AA 1G6WA 1OVNA 4HI7A 2QSIA 3RHCA 4AGSA 4DSSB 1EEJA 2F8AA 3APQA 2FWEA 3DEXA 1XZOA 5IMDA 1O85A 1O81A 3C7MA 6GSYA 1UVZA 4F9ZA 4MK3A 4BL7A 3QD9A 1LBKA 5EL8A 3KTLA 1TXXA 1TDIA 3UBLA 4ZB9A 2GSSA 4K7IA 5H5RA 3IAM2 3US3A 1PD21 2MMAA 3UOMA 3IR4A 3TJGA 3APOA 4KX4A 3LXZA 2HRNA 2H75A 2LQQA 2XBQA 4GXZA 1Y25A 2JU5A 4WXTA 2C3NA 3HD5A 2I81A 4JBBA 1XVWA 5ECRB 2F51A 3OR5A 4ECJA 2EIRA 3J7Yb 3CSHA 4ECIA 3IPZA 3LGCA 3W6GA 4WBRD 4K0NA 2YCDA 2GVPA 3CYNA 2XC2A 2CT6A 1H75A 2FHEA 2DBCA 5HFKA 4MA9A 4RI7A 2AJQB 2JZSA 3D22A 3A3TA 5IMVA 3IK9A 4FYBA 4J57E 1K0AA 4XTSA 2M46A 2LKUA 3ZMLA 3KXOA 1FVJA 1R7HA 2E2MA 4E8EA 3C73A 4O32A 1V58A 2DIZA 5H5SA 3KMNA 2C1YA 2LV3A 1QUWA 5ELGA 3O76A 4JE1A 1B4PA 2DLXA 2V41A 4MP4A 4L8EA 3DD3A 2C0DA 2P0GA 5J4UA 4IELA 2BMXA 2YJHA 2PGTA 2H76A 2I4AA 2JL4A 3NIVA 3D4MA 3P7XA 5J9CA 1XXUA 2JZRA 2I3YA 1YZXA 2NBSA 2H66A 4Z7XA 3JCML 5DQSA 3QMXA 3TJBA 2B3SA 3PGTA 2VCTA 8GSSA 2XHFA 1MDKA 2GSRA 2XBIA 2YN1A 3HJMA 2MMZA 3O6TA 2RIIA 3HJOA 4HU7A 1GRXA 2HLSA 1TOFA 2MMOA 3F4RA 1SJ6A 4NPBA 2AV4A 1M9AA 3TKQA 5EPFA 3HY2A 3ME8A 4LLRA 1EP8A 3PINA 4MDCA 3QDNA 4V2NA 4E8HA 2GSTA 1K3LA 4XS6A 3H8QA 3LEFA 1THOA 4V2MA 1WE0A 2HE3A 2NDOA 4X0XA 4K1FA 1SU9A 2IIYA 3RPNA 1XPVA 2KP2A 1Z6MA 2VIMA 3KMOA 1GUMA 1USBA 2B1LA 3GNJA 1XCCA 3ERFA 1MTCA 3DGQA 3U5RE 3L9SA 2LUSA 1K0CA 4CHSA 1TK5B 2CAIA 2ALBA 4L5LA 2MZCA 1O8WA 3FHKA 3KD0A 1SL2B 3G7JA 12GSA 5ECIB 3WT2A 1N2AA 3F6FA 4QL9A 2FWGA 5LD0A 3ME7A 1M2BA 3KTBA 3M1GA 5HR3A 5DJMA 3GTUB 3IV4A 4IGJA 2GGTA 5ENUA 4PUFC 2YWNA 5J41A 1S3AA 1XOBA 2PWJA 1QQ2A 2FD3A 3D5JA 2CZ2A 3E0UA 3HZ4A 2FWFA 3DMLA 1ZGNA 1K0NA 3ZLPA 1IYHA 2VO4A 1A0RP 1OC3A 1G0TA 4PNGA 4KH7A 4KAEA 1AQXA 4NHZA 4MABA 1Z3EA 17GSA 1OE8A 1AUCA 4AJ6A 4EC0A 1XW5A 1PX6A 1M2AA 1A2LA 4YH2A 1KTEA 3GSSA 3A5WA 2YV7A 2VM2A 2DIYA 2OE3A 2I1UA 3FY7A 1TKDB 4POMA 4ZB6A 3L78A 1I9DA 5CNWA 4IBPA 3MAKA 1XIYA 1JZDA 5A4WA 4ECBA 2IJYA 16GSA 3IDVA 4V1Ap 1QMVA 4ID0A 5C04A 1SL1B 1EGOA 4Q5QA 2LNSA 3FK8A 3A2XA 3HVXA 4N11A 5KEJA 3S9FA 3IE3A 6GSUA 2X99A 2K9FA 3EMXA 1VF4A 4GTUA 1TK0B 1XWCA 5D9WA 3F4SA 4K8MA 1ABAA 1YKCA 2O85A 5D8IA 2CA8A 1EP7A 2DJ0A 3FW2A 2FLSA 3F0IA 2IPAA 1GTUA 5IMZA 2LJAA 6GSXA 5F8BA 4PXOA 4I2UA 1BAYA 4OD7A 2WDUA 2OADA 5CO3A 2B7JA 3KCMA 2H0IA 3UEMA 1ERUA 2IMIA 2PERA 3UMAA 5LCZA 1NSWA 2F8FA 3VWUA 2V2GA 4IJIA 3W8JA 5G30A 5A4VA 1VF1A 2L5LA 1R26A 4I6XA 2ZUPA 4QQ7A 1MEKA 3HDCA 3GRXA 4XIHA 1S3CA 1TP9A 2HSYA 1J0FA 4RUVA 3RDWA 4HS1A 3H93A 4ZBBA 4JZQA 2IMFA 3TRXA 2WB9A 4KCEA 4PNFA 2R6KA 1SK0A 4I8BA 4DEJA 1EOGA 3RBTA 1Z6NA 2DJKA 5EVOA 2RUEA 2GT5A 1EEMA 2AB6A 3A2VA 2V6KA 1QXHA 3TJKA 1NHYA 4POKA 1T7PB 5KN3A 2E7PA 2HRFA 3ZFBA 2WRTA 2VL3A 5ECOB 3C1SA 3VURA 4GWRA 2DJ3A 3HCZA 3DXBA 1SD8A 3TKRA 3DIEA 3IK7A 2WFCA 5J3RA 2L4QA 2FNOA 4ZL8A 2O89A 2RUFA 4HZ4A 1BG5A 2B5YA 4LMWA 2IMDA 3WGEA 2YWOA 2HNLA 3WYWA 2N5FA 2B7KA 2VUPA 2QC7A 1F3AA 4ACSA 4ZBAA 3C71A 1YKAA 3HYPA 3ZVJA 1ACVA 2VL2C 4G2EA 1TW9A 1CQHA 1TI3A 4EL1A 4N30A 3EWLA 2KLXA 5LNKe 3MSZA 4BPYA 4MCUA 4MF5A 2FGXA 5HR0A 3U6VA 5G2ZA 1M0UA 1IYIA 5J5NA 19GSA 1PQNA 3QAWA 2H8LA 1LU4A 2VD1A 4MJBA 2JSYA 4BWSA 2LJKA 3BCKA 1SKWB 4GCIA 4Q5FA 3I9V2 3KZQA 3CXGA 1KEBA 4G19A 3V1WA 1SKRB 1TU7A 5D73A 3ZVJD 4XCSA 1GP1A 4IHUA 4GSNA 2FY6A 5B6NA 1YJ6A 1N8JA 3HJPA 5ABRA 2LTKA 4EVMA 2C0FA 1C72A 2N5AA 3F6DA 3LG6A 3VWVA 5F06A 3EURA 3F8UA 3GKKA 4PGTA 4D73A 3DKSA 2LEGA 2B6MA 5CRHA 3BD2A 4AJ7A 2TIRA 3TOUA 1KBNA 3VI5A 1F37A 2PUKC 4CDOA 5G1LA 1UN2A 3M9KA 2GLRA 2XPDA 3UJ1A 3E3EA 4L5OA 3TRQA 2MYGA 1YF0A 5F0GA 2OE1A 3KGKA 2YANA 1ML6A 2K8VA 4KSOA 1PL1A 3BBYA 4KSMA 4OFMA 1GSUA 4PURA 4GSTA 4WKWA 2GQMA 2FA4A 1F3BA 4ZL9A 5D96A 2IFQA 1YY7A 5B8AA 9GSSA 3HA9A 2GDRA 2X8GA 3ZMKA 5D9TA 1HQOA 2HFDA 3A2WA 4X1UA 2G0FA 4G9HA 2FUG2 1O7UA 1TTZA 1GTBA 5L71A 3RHBA 1SJIA 3P8WA 1JLWA 2MBTA 1DBYA 2VLTA 2HI7A 3CMIA 1JZRA 3ZL5A 3P90A 4D73B 3HVVA 1M9BA 4IJ3A 13GSA 3UVTA 3QCPA 2H1BA 5CRWA 3LXTA 1XW6A 5DAKA 4MPFA 3AY8A 4F03A 1JZOA 2OKAA 2D2ZA 1BX9A 1MDJA 3LFLA 2DSAA 4GSSA 1UA5A 4IP6A 1JHBA 3EC3A 3MNGA 2CQ9A 5ECNB 4EE0A 1PRXA 1XOAA 3ED3A 1F6MC 3I6AA 1OKTA 4KDYA 3ISOA 5CYYA 1GTAA 3M0FA 2CV4A 4MPGA 1DE2A 2ES7A 2IFQB 3APSA 4EUYA 1ZL9A 2L57A 1T3BA 4MJAA 4OCEA 1NW2A 4KW6A 1K0MA 4KUNA 4IVFA 1SK2A 1U87A 3UL3A 2CVBA 1ZYQB 2PVQA 1THXA 1VRSD 4RQRA 18GSA 1SD9A 3TKSC 2IL3A 5CAXA 1WRYA 2CVDA 1SK1A 4MH2A 1WMJA 2R5GA 4ZIJA 1XVQA 3TOTA 4LA1A 3EU4A 3QAVA 4KDXA 2VD0A 5JWRB 1TK8B 5DJLA 1YQ1A 4AJ8A 3CRTA 4ZILA 4ZB8A 2C4JA 3KIJA 2H30A 2L59A 1M7TA 2YZUA 2A2SA 3C1RA 3L0HA 5G5FA 1FG4A 2YP6A 3GMFA 2C3QA 2HXKA 2VLVA 1EGRA 2B5XA 4WF5A 5IPGA 5IMCA 4HU9A 1AIUA 1F9MA 1U3IA 4J2FA 3HVSA 2XPEA 5B8BA 2E2GA 3EVIA 3DWVA 1MD3A 1OAZA 3Q19A 3N5OA 3TUEA 1WJKA 2JACA 1F2EA 2OACA 3IXRA 4TXOA 4HJ2A 2A2RA 2ON7A 4JR4A 1M2DA 1ERVA 5INYA 1X9SB 1V2AA 5DDLA 2WCIA 3Q6OA 3HKRA 3GURA 1GL8A 1PL2A 2RLIA 4YAVA 4IW9A 4XRAA 1PGTA 2GQKA 5IO2A 6GSVA 4JU5A 4K2DA 2VM1A 4L0WA 4EXJA 1K0DA 3WGXA 2OA7A 3ZIVA 4GQFA 5ID2A 3TJFA 4XS1A 4KCAA 5DCHA 2LS5A 4NMUA 6GSSA 2H71A 2V32A 2KOKA 2AAWA 2R3XA 2NVLA 3GUSA 5JCWA 2RM6A 4FYUA 4GLTA 1TRSA 1ZMAA
chains in the Genus database with same CATH superfamily
2A4VA 3D0ZA 2P31A 5JCGA 5AIVA 1G6YA 3UVHA 5DCGA 1QK8A 2YWMA 4BVYA 4MF6A 2CZ3A 2ON5A 4ILFA 1DE1A 1X5CA 4IP1A 3KEBA 5C00A 5HFIA 4EDZA 2GZYA 1O6JA 2PPTA 5IM9A 3QPMA 2VCVA 2HSHA 4IN0A 3CBUA 4K9ZA 4ML1A 2QGVA 2WJUA 2LNTA 1K0OA 2J23A 2K18A 3KH7A 1NHOA 4LL4B 1X9WB 2HZEA 3FR9A 3I43A 2YPMA 1OC8A 4EF0A 1A2JA 3MIXA 1SL0B 2HYXA 4K7NA 2YNXA 4Q5RA 1PKWA 1TRWA 4NV5A 1BJXA 2X8CA 4OFTA 2DJJA 4N0VA 1R4WA 5ID2B 2B5EA 1BYEA 4LL1B 1GSFA 5AGYA 1Q98A 1TRVA 1FVKA 3BJ5A 3GKMA 2KHPA 3KJYA 2H70A 1AXDA 4BVYB 4TRXA 5JWOB 2H1GA 4OFNA 2WZ9A 5F07A 1ERTA 3GV1A 3M9JA 4MZBA 4KNDA 5KN2A 4POLA 4HQSA 2O87A 1OE7A 1G7OA 5A4UA 1YEPA 1T4ZA 3RAZA 1SKSB 1WP0A 2HT9A 1FB6A 2EC4A 2DMLA 2LQOA 1RK4A 1GSQA 2R4VA 3TKSE 2HZEB 5GSSA 3LQ7A 1SYXA 2YOIA 1B9YC 2BTOT 2VL2A 2N5BA 2CX4A 1AQWA 2VLUA 3GX0A 1A23A 1B9XC 3FR6A 1Q4JA 2MMNA 2H73A 3QAGA 4XS4A 4F0BA 3G7IA 1FW1A 4MZWA 1YEXA 4K5SA 1HNAA 2FWHA 4YQMA 1GUKA 3LJRA 3TGZA 2GT6A 3FEUA 4EKZA 4HOJA 3BOAA 3DVWA 5IMFA 3TJJA 1NM3A 2REMA 1TRUA 2V6OA 2GZZA 4MH3A 4PQHA 1PKZA 5H5QA 4V2LA 2HZFA 4K0GA 1PSQA 1X5DA 4JR6A 1GH2A 5HFGA 4TR0A 3K8NA 4FQUA 4CW9A 4I5QA 4GQCA 2H6YA 3VPQA 4DSSA 5CP1A 3MYDA 1GSYA 2AYTA 5CREA 4IQAA 4XHMA 1ZCPA 4G0IA 1J9BA 3F63A 3ZYWA 2K6VA 3ERGA 4DVCA 3D6IA 2DC5A 1RW1A 3IC4A 2YZHA 11GSA 4ISDA 4WR4A 5KN0A 4RI6A 1GLPA 1H4OA 3PH9A 4XRDA 4OO4A 4KE3A 4MMMA 2O7KA 3LSZA 1SENA 2DMMA 3EE2A 1HNBA 1GUHA 1ERWA 3ZREA 4ZL7A 2P5RA 1YDKA 2H1DA 4MJEA 1JZWA 3WD6A 2NTOA 5A5KA 6GSTA 1Z7RA 5ECHB 4TR4A 3ZRDA 2LRTA 1PN0A 1EV9A 5FT3A 5GZZB 5JCUA 4RQXA 4KGIA 5JWQB 3GYKA 3FZ9A 4BA7A 4DSQA 2OBKA 1M99A 1QGVA 5J9BA 2VAFA 3KH9A 1X0RA 4EO3A 4AF2A 1U88A 5HR2A 3IA1A 1XWGA 2VCZA 3MDKA 3C8EA 2GTUA 2H0HA 3HZ8A 4NWYA 3L9UA 3IBHA 3VWWA 2I9HA 2TRCP 2IMEA 1R5AA 2H01A 5IOXA 4OCFA 4KDUA 1MD4A 1AAZA 4KB3A 5HR1A 3IRAA 5ECPB 4HEA2 1A2MA 1J08A 1BQ7A 4MJCA 1K0BA 1UC7A 2PVOC 4OWYA 10GSA 3UBKA 4NAXA 3TDGA 3TB2A 5B6MA 1B4QA 5HQPA 2DKIA 2R0CA 2VCQA 1PMTA 4OO5A 4WR5A 4TR1A 4IS0A 4IQ1A 2J9HA 3FR3A 1V40A 1G7EA 2H0GA 1VF3A 2IMKA 1X9MB 3NZNA 2QKEA 4LMVA 4L0UA 4WBJA 3H1NA 4TXVA 5ECQB 2BJXA 1GSSA 1RQMA 4MF7A 2FA8A 1R5PA 1K3YA 2PU9C 5IMAA 3HVNA 3FRCA 4N10A 4JEDA 1GLQA 5F05A 2P5QA 1EZKA 4JRRA 1X5EA 3UARA 1GWCA 5G31A 3TKSA 2C3TA 4ECCA 5D9VA 1TJDA 2IN3A 2K8SA 1T8EB 4K5RA 5E59A 4HZ2A 4ZBDA 3H79A 3PR8A 1HNCA 2JADA 1MDIA 3QOUA 2M80A 3UIWA 4PUAA 1S3RA 2H1AA 5ECMB 5B7CA 2OBIA 1SYRA 3QFAC 3ZTLA 1GTIA 2M72A 4TR1B 3Q18A 4K6XA 3GH9A 4A5PA 4GRFA 1VGLA 1URMA 3LWAA 5IIZA 3KP9A 3ZIJA 1OKDA 3CTGA 3E9JB 4DSRA 2GS3A 4FIWA 2PN8A 3FZ4A 1V98A 3TCOA 2LJRA 5KN1A 4G10A 1U6TA 1EV4A 3CSJA 5DVBA 3GTUA 5ECSA 2R37A 3RPPA 4NHWA 2YV9A 5DQYA 3D4TA 3G9BA 1W89A 4EIPA 1PN9A 2WGRA 5DAKB 5FWGA 4ML6A 1ILOA 2L5OA 5G5EA 1A8LA 5AISA 4I97A 4MLYA 3WGDA 3IAS2 3IHQA 1EOHA 1FHEA 3VK9A 1ZYEA 2O8VB 3ZITA 1O73A 3GL5A 3SWLA 3VI7A 4V1Ag 3IC8A 5IPHA 2F3MA 1B8XA 1Z5YE 5AN1A 4TR3A 2DJ1A 3Q74A 5FHIA 2PMTA 2VL9A 4GF0A 4YQVA 5KOXA 1DUGA 2PBJA 3VPTA 2FCHA 3FZ5A 4I2TA 1FAAA 1GSDA 4O5QA 4EDYA 3F9UA 1Z7PA 2X8HA 1E2YA 2YWIA 1HYUA 3DVXA 2MBSA 3EMPA 3IOSA 1XWBA 7GSSA 3M3MA 3J7Yk 3GSTA 5IOWA 4Q5NA 5EY6A 1ZOFA 4TN8A 1TU8A 4TW5A 1XBSA 2H19A 3H4KA 1XWAA 1XG8A 1GULA 4K7OA 3GH6A 1YF1A 1S3DA 22GSA 4O7HA 4ZXGA 1V57A 3GHAA 4TVEA 1B48A 1ON4A 4TOPA 4BVXA 3R2QA 4HJMA 2VCWA 2HSMA 2H72A 1A0FA 1WOUA 2OJLA 2L6CA 4J56E 4N0ZA 1OC9A 1AW9A 4TXOB 2H6XA 2WS2A 4Z2RA 3MWHA 2CX3A 2X64A 1WWJA 4QL7A 3N9JA 5ELAA 4YAPA 1VF2A 3CSIA 3LORA 4HQZA 4O92A 4WF4A 3M8NA 2C8UA 5GAND 2GSQA 2NPBA 2RM5A 5ECKB 4G0LA 2IWTA 3ZZXA 1TI1A 1A8YA 2L4CA 4HDEA 5IO0A 2QA2A 3DYRA 3VFIA 4F2IA 4OMVA 2B1KA 1GNEA 4NV2A 1V9WA 1AC1A 3VWXA 5D9XA 2EIQA 1PA3A 1FOVA 2CAQA 3FKFA 2KP1A 1ST9A 3QR6A 4X43A 5CRGA 1XW9A 2CVKA 4FYCA 1WPIA 4HUAA 1DSBA 4FH8A 4BVXB 3HHVA 2EIOA 2YJ7A 1GNWA 1T4YA 2ZNMA 1PX7A 3P2AA 1T00A 3EYTA 2R2JA 3L9VA 3GKNA 5GAPD 1OC9B 3ZFLA 2KUCA 2DJ2A 1E6BA 5DBQA 1BEDA 3O3TA 1EWXA 1HD2A 3F4TA 4YQUA 3EINA 2VCXA 3ERWA 2OE0A 5ECLB 4IKHA 2LRCA 2HRKA 3LW9A 2C80A 1KNGA 2AUVA 3GFKA 1QFNA 2DKHA 2C0EA 4F0CA 2LRNA 3TKPA 3KM6A 3NOFA 3KP8A 6GSWA 4WETA 1Y6EA 2E0QA 3HXSA 3VLNA 3GIXA 2V1MA 3GKXA 4X4JA 1PFOA 4WEYA 4PQIA 2F9SA 1SJZA 3DRNA 2AHEA 1GSEA 5DALA 1AQVA 1OYJA 3L4NA 5CRDA 4O5RA 2JSZA 5COHA 1O8XA 4KF9A 1JLVA 20GSA 4F82A 3EU3A 2LSTA 4MZCA 3FYGA 2H74A 1XWKA 4Z2TA 3GA4A 1Z9HA 2TRXA 5G1KA 4NXIA 1WIKA 5IQYA 2H6ZA 1FB0A 3LYPA 3LYKA 1FO5A 2G2QA 4FO5A 2Z9SA 5E4WA 2JZTA 3W8SA 3GX8A 3QFBC 4PQ1A 5GSTA 3SBCA 3G7YA 3GL3A 2VOCA 1CQGA 4POBA 4BWQA 3F3RA 1I5GA 1K3OA 1LJRA 4G0KA 4ULXA 4XS4B 3WT1A 5AIXA 1T1VA 3CRUA 4TKYA 2GQLA 2ZCTA 4H86A 2L6DA 4PX1A 1W4VA 4P3YB 2WULA 3FZAA 14GSA 3D21A 1XFLA 2C0GA 2GZPA 4KA0A 5KOWA 3TRPA 3UAPA 1JFUA 3F3QA 5DALB 2X49A 3CTFA 1A24A 3GN3A 3BCIA 5D93A 1ZZYA 3I69A 1U3AA 1G6WA 1OVNA 4HI7A 2QSIA 3RHCA 4AGSA 4DSSB 1EEJA 2F8AA 3APQA 2FWEA 3DEXA 1XZOA 5IMDA 1O85A 1O81A 3C7MA 6GSYA 1UVZA 4F9ZA 4MK3A 4BL7A 3QD9A 1LBKA 5EL8A 3KTLA 1TXXA 1TDIA 3UBLA 4ZB9A 2GSSA 4K7IA 5H5RA 3IAM2 3US3A 1PD21 2MMAA 3UOMA 3IR4A 3TJGA 3APOA 3IHGA 2UZ8A 4KX4A 2A2PA 3LXZA 2HRNA 2H75A 2LQQA 2XBQA 4GXZA 1Y25A 2JU5A 4WXTA 2C3NA 3HD5A 2I81A 4JBBA 1XVWA 5ECRB 2F51A 3OR5A 4ECJA 2EIRA 3J7Yb 3CSHA 4ECIA 3IPZA 3LGCA 3W6GA 4WBRD 4K0NA 2YCDA 2GVPA 3CYNA 2XC2A 2CT6A 1H75A 2FHEA 2DBCA 5HFKA 4MA9A 4RI7A 2AJQB 2JZSA 3D22A 3A3TA 5IMVA 3IK9A 4FYBA 4J57E 1K0AA 4XTSA 2M46A 2LKUA 3ZMLA 3KXOA 1FVJA 1R7HA 4YKGA 2E2MA 4BL7B 4E8EA 3C73A 4O32A 1V58A 2DIZA 5H5SA 3KMNA 2C1YA 2LV3A 1QUWA 5ELGA 3O76A 4JE1A 1B4PA 2DLXA 4EIQA 2V41A 4MP4A 4L8EA 3DD3A 2C0DA 2P0GA 5J4UA 4IELA 2BMXA 2YJHA 2PGTA 2H76A 2I4AA 2JL4A 3NIVA 3D4MA 3P7XA 5J9CA 1XXUA 2JZRA 2I3YA 1YZXA 2NBSA 2H66A 4Z7XA 3JCML 5DQSA 3QMXA 3TJBA 2B3SA 3PGTA 2VCTA 8GSSA 2XHFA 1MDKA 2QA1A 2GSRA 2XBIA 2YN1A 3HJMA 2X4AA 5BRTA 2MMZA 3O6TA 2RIIA 3HJOA 4HU7A 1GRXA 2HLSA 1TOFA 2MMOA 3F4RA 1SJ6A 4NPBA 2AV4A 1M9AA 3TKQA 5EPFA 3HY2A 3ME8A 4LLRA 1EP8A 3PINA 4MDCA 3QDNA 4V2NA 4E8HA 4Z2UA 4CY6A 2GSTA 1K3LA 4XS6A 3H8QA 3LEFA 1THOA 4V2MA 1WE0A 2HE3A 2NDOA 4X0XA 4K1FA 1SU9A 2IIYA 3RPNA 1XPVA 2KP2A 1Z6MA 2VIMA 3KMOA 1GUMA 1USBA 4MNNA 2B1LA 3GNJA 1XCCA 3ERFA 1MTCA 3DGQA 3U5RE 3L9SA 3R3EA 2LUSA 1K0CA 4CHSA 1TK5B 2CAIA 2ALBA 4L5LA 2MZCA 1O8WA 3FHKA 3KD0A 1SL2B 3G7JA 12GSA 5ECIB 3WT2A 1N2AA 3F6FA 4QL9A 2FWGA 5LD0A 3ME7A 1M2BA 3KTBA 3M1GA 5HR3A 5DJMA 3GTUB 3IV4A 4IGJA 2GGTA 5ENUA 4PUFC 2YWNA 5J41A 1S3AA 1XOBA 2PWJA 1QQ2A 2FD3A 3D5JA 2CZ2A 3E0UA 3HZ4A 2FWFA 3DMLA 1ZGNA 1K0NA 3ZLPA 1IYHA 2VO4A 1A0RP 1OC3A 1G0TA 4PNGA 4KH7A 4KAEA 1AQXA 4NHZA 4MABA 1Z3EA 17GSA 1OE8A 1AUCA 4AJ6A 4EC0A 1XW5A 1PX6A 1M2AA 1A2LA 4YH2A 1KTEA 3GSSA 3A5WA 2YV7A 2VM2A 2DIYA 2OE3A 2I1UA 3FY7A 1TKDB 4POMA 4ZB6A 2A4HA 3L78A 1I9DA 5CNWA 4IBPA 3MAKA 1XIYA 1JZDA 5A4WA 4ECBA 2IJYA 16GSA 3IDVA 4V1Ap 1QMVA 4ID0A 5C04A 1SL1B 1EGOA 4Q5QA 2LNSA 3FK8A 3A2XA 4YKFA 3HVXA 4N11A 5KEJA 3S9FA 3IE3A 6GSUA 2X99A 2K9FA 3EMXA 1ZYPA 1VF4A 4GTUA 1TK0B 1XWCA 5D9WA 2R0PA 3F4SA 4K8MA 1ABAA 1YKCA 1M3JA 2O85A 5D8IA 2CA8A 1EP7A 2DJ0A 3FW2A 2FLSA 3F0IA 2IPAA 1GTUA 5IMZA 2LJAA 6GSXA 5F8BA 4PXOA 4I2UA 1BAYA 4OD7A 2WDUA 2OADA 5CO3A 2B7JA 3KCMA 2H0IA 3UEMA 1ERUA 2IMIA 2PERA 3UMAA 5LCZA 1NSWA 2F8FA 3VWUA 2V2GA 4IJIA 3W8JA 5G30A 5A4VA 1VF1A 2L5LA 1R26A 4K2XA 4I6XA 2ZUPA 4QQ7A 1MEKA 3EPTA 3HDCA 3GRXA 4XIHA 1S3CA 1TP9A 2HRAA 2HSYA 1J0FA 4RUVA 3RDWA 4HS1A 3H93A 4ZBBA 4JZQA 2IMFA 3TRXA 2WB9A 4KCEA 4PNFA 2R6KA 1SK0A 4I8BA 4DEJA 1EOGA 3RBTA 1Z6NA 2DJKA 5EVOA 2RUEA 2GT5A 1EEMA 2AB6A 3A2VA 2V6KA 1QXHA 3TJKA 1NHYA 4POKA 1T7PB 5KN3A 2E7PA 2HRFA 3ZFBA 2WRTA 2VL3A 5ECOB 3C1SA 3VURA 4GWRA 2DJ3A 3HCZA 3DXBA 1SD8A 3CQFA 3TKRA 3DIEA 3IK7A 2WFCA 5J3RA 2L4QA 2FNOA 4ZL8A 2O89A 2RUFA 4HZ4A 1BG5A 2B5YA 4LMWA 2IMDA 3WGEA 2YWOA 2HNLA 1ZYNA 3WYWA 2N5FA 2B7KA 2VUPA 2QC7A 1F3AA 4ACSA 4ZBAA 3C71A 1YKAA 3HYPA 3ZVJA 1ACVA 1FOHA 2VL2C 4G2EA 1TW9A 1CQHA 1TI3A 4EL1A 4N30A 4USSA 3EWLA 2KLXA 5LNKe 3MSZA 4BPYA 4MCUA 4MF5A 2FGXA 5HR0A 3U6VA 3A5IA 5G2ZA 1M0UA 1IYIA 5J5NA 19GSA 1PQNA 3QAWA 2H8LA 1LU4A 2VD1A 4MJBA 2JSYA 4BWSA 2LJKA 3BCKA 1SKWB 4GCIA 4Q5FA 3I9V2 3KZQA 3CXGA 1KEBA 4G19A 3V1WA 1SKRB 1TU7A 5D73A 3ZVJD 4XCSA 1GP1A 4IHUA 4GSNA 2FY6A 5B6NA 1YJ6A 1N8JA 4CY8A 3HJPA 4BIKA 5ABRA 2LTKA 4EVMA 2C0FA 1C72A 2N5AA 3F6DA 3LG6A 3VWVA 5F06A 3EURA 3F8UA 3GKKA 4PGTA 4D73A 3DKSA 2LEGA 2B6MA 5CRHA 3BD2A 4AJ7A 2TIRA 3TOUA 1KBNA 3VI5A 1F37A 2PUKC 4CDOA 5G1LA 1UN2A 3M9KA 2GLRA 2XPDA 3UJ1A 3E3EA 4L5OA 3TRQA 2MYGA 1YF0A 5F0GA 2OE1A 3KGKA 2YANA 1ML6A 2K8VA 4KSOA 1PL1A 3BBYA 4KSMA 3PPUA 4OFMA 1GSUA 4PURA 4GSTA 4WKWA 2GQMA 2FA4A 1F3BA 4ZL9A 5D96A 2IFQA 1YY7A 5B8AA 9GSSA 3HA9A 2GDRA 2X8GA 3ZMKA 5D9TA 1HQOA 2HFDA 3A2WA 4X1UA 2G0FA 4G9HA 2FUG2 1O7UA 1TTZA 1GTBA 5L71A 3RHBA 1SJIA 3P8WA 1JLWA 2MBTA 1DBYA 2VLTA 2HI7A 3CMIA 1JZRA 3ZL5A 4PTSA 3P90A 4O5UA 4D73B 3HVVA 1M9BA 4IJ3A 13GSA 3UVTA 3QCPA 2H1BA 5CRWA 3LXTA 1XW6A 5DAKA 4MPFA 3AY8A 4F03A 1JZOA 2OKAA 2D2ZA 1BX9A 1MDJA 3LFLA 2DSAA 4GSSA 1UA5A 4IP6A 1JHBA 3EC3A 3MNGA 2CQ9A 5ECNB 4EE0A 1PRXA 1XOAA 3ED3A 1F6MC 3I6AA 1OKTA 4KDYA 3ISOA 5CYYA 1GTAA 3M0FA 2CV4A 4MPGA 1DE2A 2ES7A 2IFQB 3APSA 4EUYA 1ZL9A 2L57A 1T3BA 4MJAA 4OCEA 1NW2A 4KW6A 1K0MA 4KUNA 4IVFA 1SK2A 1U87A 3UL3A 2CVBA 1ZYQB 2PVQA 1THXA 1VRSD 4RQRA 18GSA 1SD9A 3TKSC 2IL3A 5CAXA 1WRYA 4ICYA 2CVDA 1SK1A 4MH2A 4HSCX 1WMJA 2R5GA 4ZIJA 1XVQA 3TOTA 4LA1A 3EU4A 3QAVA 4KDXA 2VD0A 5JWRB 1TK8B 5DJLA 1YQ1A 4AJ8A 3CRTA 4ZILA 4ZB8A 2C4JA 3KIJA 2H30A 2L59A 1M7TA 2YZUA 2A2SA 3C1RA 3L0HA 5G5FA 3FMWA 1FG4A 2YP6A 3GMFA 2C3QA 2HXKA 2VLVA 1EGRA 2B5XA 4WF5A 5IPGA 5IMCA 4HU9A 1AIUA 1F9MA 1M3IA 1U3IA 4J2FA 3HVSA 2XPEA 5B8BA 2E2GA 3EVIA 3DWVA 1MD3A 1OAZA 3Q19A 3N5OA 3TUEA 1WJKA 2JACA 1F2EA 2OACA 3IXRA 4TXOA 4HJ2A 2A2RA 2ON7A 4JR4A 1M2DA 1ERVA 5INYA 1X9SB 1V2AA 5DDLA 2WCIA 3Q6OA 5BMUA 3HKRA 2R0GA 3GURA 1GL8A 1PL2A 2RLIA 4YAVA 4IW9A 4XRAA 1PGTA 2GQKA 5IO2A 6GSVA 4JU5A 4K2DA 2VM1A 4L0WA 4EXJA 1K0DA 3WGXA 2OA7A 3ZIVA 4GQFA 5ID2A 3TJFA 4XS1A 4KCAA 5DCHA 2LS5A 4NMUA 6GSSA 2H71A 2V32A 2KOKA 2AAWA 2R3XA 2NVLA 3GUSA 5JCWA 2RM6A 4FYUA 4GLTA 1TRSA 1ZMAA
chains in the Genus database with same CATH topology
2A4VA 3D0ZA 2P31A 5JCGA 5AIVA 1G6YA 3UVHA 5DCGA 1QK8A 2YWMA 4BVYA 4MF6A 2CZ3A 2ON5A 4ILFA 1DE1A 1X5CA 4IP1A 3KEBA 5C00A 5HFIA 4EDZA 2GZYA 1O6JA 2PPTA 5IM9A 3QPMA 2VCVA 2HSHA 4IN0A 3CBUA 4K9ZA 4ML1A 2QGVA 2WJUA 2LNTA 1K0OA 2J23A 2K18A 3KH7A 1NHOA 4LL4B 1X9WB 2HZEA 3FR9A 3I43A 2YPMA 1OC8A 4EF0A 1A2JA 3MIXA 1SL0B 2HYXA 4K7NA 2YNXA 4Q5RA 1PKWA 1TRWA 4NV5A 1BJXA 2X8CA 4OFTA 2DJJA 4N0VA 1R4WA 5ID2B 2B5EA 1BYEA 4LL1B 1GSFA 5AGYA 1Q98A 1TRVA 1FVKA 3BJ5A 3GKMA 2KHPA 3KJYA 2H70A 1AXDA 4BVYB 4TRXA 5JWOB 2H1GA 4OFNA 2WZ9A 5F07A 1ERTA 3GV1A 3M9JA 4MZBA 4KNDA 5KN2A 4POLA 4HQSA 2O87A 1OE7A 1G7OA 5A4UA 1YEPA 1T4ZA 3RAZA 1SKSB 1WP0A 2HT9A 1FB6A 2EC4A 2DMLA 2LQOA 1RK4A 1GSQA 2R4VA 3TKSE 2HZEB 5GSSA 3LQ7A 1SYXA 2YOIA 1B9YC 2BTOT 2VL2A 2N5BA 2CX4A 1AQWA 2VLUA 3GX0A 1A23A 1B9XC 3FR6A 1Q4JA 2MMNA 2H73A 3QAGA 4XS4A 4F0BA 3G7IA 1FW1A 4MZWA 1YEXA 4K5SA 1HNAA 2FWHA 4YQMA 1GUKA 3LJRA 3TGZA 2GT6A 3FEUA 4EKZA 4HOJA 3BOAA 3DVWA 5IMFA 3TJJA 1NM3A 2REMA 1TRUA 2V6OA 2GZZA 4MH3A 4PQHA 1PKZA 5H5QA 4V2LA 2HZFA 4K0GA 1PSQA 1X5DA 4JR6A 1GH2A 5HFGA 4TR0A 3K8NA 4FQUA 4CW9A 4I5QA 4GQCA 2H6YA 3VPQA 4DSSA 5CP1A 3MYDA 1GSYA 2AYTA 5CREA 4IQAA 4XHMA 1ZCPA 4G0IA 1J9BA 3F63A 3ZYWA 2K6VA 3ERGA 4DVCA 3D6IA 2DC5A 1RW1A 3IC4A 2YZHA 11GSA 4ISDA 4WR4A 5KN0A 4RI6A 1GLPA 1H4OA 3PH9A 4XRDA 4OO4A 4KE3A 4MMMA 2O7KA 3LSZA 1SENA 2DMMA 3EE2A 1HNBA 1GUHA 1ERWA 3ZREA 4ZL7A 2P5RA 1YDKA 2H1DA 4MJEA 1JZWA 3WD6A 2NTOA 5A5KA 6GSTA 1Z7RA 5ECHB 4TR4A 3ZRDA 2LRTA 1PN0A 1EV9A 5FT3A 5GZZB 5JCUA 4RQXA 4KGIA 5JWQB 3GYKA 3FZ9A 4BA7A 4DSQA 2OBKA 1M99A 1QGVA 5J9BA 2VAFA 3KH9A 1X0RA 4EO3A 4AF2A 1U88A 5HR2A 3IA1A 1XWGA 2VCZA 3MDKA 3C8EA 2GTUA 2H0HA 3HZ8A 4NWYA 3L9UA 3IBHA 3VWWA 2I9HA 2TRCP 2IMEA 1R5AA 2H01A 5IOXA 4OCFA 4KDUA 1MD4A 1AAZA 4KB3A 5HR1A 3IRAA 5ECPB 4HEA2 1A2MA 1J08A 1BQ7A 4MJCA 1K0BA 1UC7A 2PVOC 4OWYA 10GSA 3UBKA 4NAXA 3TDGA 3TB2A 5B6MA 1B4QA 5HQPA 2DKIA 2R0CA 2VCQA 1PMTA 4OO5A 4WR5A 4TR1A 4IS0A 4IQ1A 2J9HA 3FR3A 1V40A 1G7EA 2H0GA 1VF3A 2IMKA 1X9MB 3NZNA 2QKEA 4LMVA 4L0UA 4WBJA 3H1NA 4TXVA 5ECQB 2BJXA 1GSSA 1RQMA 4MF7A 2FA8A 1R5PA 1K3YA 2PU9C 5IMAA 3FRCA 4N10A 4JEDA 1GLQA 5F05A 2P5QA 1EZKA 4JRRA 1X5EA 3UARA 1GWCA 5G31A 3TKSA 2C3TA 4ECCA 5D9VA 1TJDA 2IN3A 2K8SA 1T8EB 4K5RA 5E59A 4HZ2A 4ZBDA 3H79A 3PR8A 1HNCA 2JADA 1MDIA 3QOUA 2M80A 3UIWA 4PUAA 2H1AA 5ECMB 5B7CA 2OBIA 1SYRA 3QFAC 3ZTLA 1GTIA 2M72A 4TR1B 3Q18A 4K6XA 3GH9A 4A5PA 4GRFA 1VGLA 1URMA 3LWAA 5IIZA 3KP9A 3ZIJA 1OKDA 3CTGA 3E9JB 4DSRA 2GS3A 4FIWA 2PN8A 3FZ4A 1V98A 3TCOA 2LJRA 5KN1A 4G10A 1U6TA 1EV4A 3CSJA 5DVBA 3GTUA 5ECSA 2R37A 3RPPA 4NHWA 2YV9A 5DQYA 3D4TA 3G9BA 1W89A 4EIPA 1PN9A 2WGRA 5DAKB 5FWGA 4ML6A 1ILOA 2L5OA 5G5EA 1A8LA 5AISA 4I97A 4MLYA 3WGDA 3IAS2 3IHQA 1EOHA 1FHEA 3VK9A 1ZYEA 2O8VB 3ZITA 1O73A 3GL5A 3SWLA 3VI7A 4V1Ag 3IC8A 5IPHA 2F3MA 1B8XA 1Z5YE 5AN1A 4TR3A 2DJ1A 3Q74A 5FHIA 2PMTA 2VL9A 4GF0A 4YQVA 5KOXA 1DUGA 2PBJA 3VPTA 2FCHA 3FZ5A 4I2TA 1FAAA 1GSDA 4O5QA 4EDYA 3F9UA 1Z7PA 2X8HA 1E2YA 2YWIA 1HYUA 3DVXA 2MBSA 3EMPA 3IOSA 1XWBA 7GSSA 3M3MA 3J7Yk 3GSTA 5IOWA 4Q5NA 5EY6A 1ZOFA 4TN8A 1TU8A 4TW5A 1XBSA 2H19A 3H4KA 1XWAA 1GULA 4K7OA 3GH6A 1YF1A 1S3DA 22GSA 4O7HA 4ZXGA 1V57A 3GHAA 4TVEA 1B48A 1ON4A 4TOPA 4BVXA 3R2QA 4HJMA 2VCWA 2HSMA 2H72A 1A0FA 1WOUA 2OJLA 2L6CA 4J56E 4N0ZA 1OC9A 1AW9A 4TXOB 2H6XA 2WS2A 4Z2RA 3MWHA 2CX3A 2X64A 1WWJA 4QL7A 3N9JA 5ELAA 4YAPA 1VF2A 3CSIA 3LORA 4HQZA 4O92A 4WF4A 3M8NA 2C8UA 5GAND 2GSQA 2NPBA 2RM5A 5ECKB 4G0LA 2IWTA 3ZZXA 1TI1A 1A8YA 2L4CA 4HDEA 5IO0A 2QA2A 3DYRA 3VFIA 4F2IA 4OMVA 2B1KA 1GNEA 4NV2A 1V9WA 1AC1A 3VWXA 5D9XA 2EIQA 1PA3A 1FOVA 2CAQA 3FKFA 2KP1A 1ST9A 3QR6A 4X43A 5CRGA 1XW9A 2CVKA 4FYCA 1WPIA 4HUAA 1DSBA 4FH8A 4BVXB 3HHVA 2EIOA 2YJ7A 1GNWA 1T4YA 2ZNMA 1PX7A 3P2AA 1T00A 3EYTA 2R2JA 3L9VA 3GKNA 5GAPD 1OC9B 3ZFLA 2KUCA 2DJ2A 1E6BA 5DBQA 1BEDA 3O3TA 1EWXA 1HD2A 3F4TA 4YQUA 3EINA 2VCXA 3ERWA 2OE0A 5ECLB 4IKHA 2LRCA 2HRKA 3LW9A 2C80A 1KNGA 2AUVA 3GFKA 1QFNA 2DKHA 2C0EA 4F0CA 2LRNA 3TKPA 3KM6A 3NOFA 3KP8A 6GSWA 4WETA 1Y6EA 2E0QA 3HXSA 3VLNA 3GIXA 2V1MA 3GKXA 4X4JA 4WEYA 4PQIA 2F9SA 1SJZA 3DRNA 2AHEA 1GSEA 5DALA 1AQVA 1OYJA 3L4NA 5CRDA 4O5RA 2JSZA 5COHA 1O8XA 4KF9A 1JLVA 20GSA 4F82A 3EU3A 2LSTA 4MZCA 3FYGA 2H74A 1XWKA 4Z2TA 3GA4A 1Z9HA 2TRXA 5G1KA 4NXIA 1WIKA 5IQYA 2H6ZA 1FB0A 3LYPA 3LYKA 1FO5A 2G2QA 4FO5A 2Z9SA 5E4WA 2JZTA 3W8SA 3GX8A 3QFBC 4PQ1A 5GSTA 3SBCA 3G7YA 3GL3A 2VOCA 1CQGA 4POBA 4BWQA 3F3RA 1I5GA 1K3OA 1LJRA 4G0KA 4ULXA 4XS4B 3WT1A 5AIXA 1T1VA 3CRUA 4TKYA 2GQLA 2ZCTA 4H86A 2L6DA 4PX1A 1W4VA 4P3YB 2WULA 3FZAA 14GSA 3D21A 1XFLA 2C0GA 2GZPA 4KA0A 5KOWA 3TRPA 3UAPA 1JFUA 3F3QA 5DALB 2X49A 3CTFA 1A24A 3GN3A 3BCIA 5D93A 1ZZYA 3I69A 1U3AA 1G6WA 1OVNA 4HI7A 2QSIA 3RHCA 4AGSA 4DSSB 1EEJA 2F8AA 3APQA 2FWEA 3DEXA 1XZOA 5IMDA 1O85A 1O81A 3C7MA 6GSYA 1UVZA 4F9ZA 4MK3A 4BL7A 3QD9A 1LBKA 5EL8A 3KTLA 1TXXA 1TDIA 3UBLA 4ZB9A 2GSSA 4K7IA 5H5RA 3IAM2 3US3A 1PD21 2MMAA 3UOMA 3IR4A 3TJGA 3APOA 3IHGA 2UZ8A 4KX4A 2A2PA 3LXZA 2HRNA 2H75A 2LQQA 2XBQA 4GXZA 1Y25A 2JU5A 4WXTA 2C3NA 3HD5A 2I81A 4JBBA 1XVWA 5ECRB 2F51A 3OR5A 4ECJA 2EIRA 3J7Yb 3CSHA 4ECIA 3IPZA 3LGCA 3W6GA 4WBRD 4K0NA 2YCDA 2GVPA 3CYNA 2XC2A 2CT6A 1H75A 2FHEA 2DBCA 5HFKA 4MA9A 4RI7A 2AJQB 2JZSA 3D22A 3A3TA 5IMVA 3IK9A 4FYBA 4J57E 1K0AA 4XTSA 2M46A 2LKUA 3ZMLA 3KXOA 1FVJA 1R7HA 4YKGA 2E2MA 4BL7B 4E8EA 3C73A 4O32A 1V58A 2DIZA 5H5SA 3KMNA 2C1YA 2LV3A 1QUWA 5ELGA 3O76A 4JE1A 1B4PA 2DLXA 4EIQA 2V41A 4MP4A 4L8EA 3DD3A 2C0DA 2P0GA 5J4UA 4IELA 2BMXA 2YJHA 2PGTA 2H76A 2I4AA 2JL4A 3NIVA 3D4MA 3P7XA 5J9CA 1XXUA 2JZRA 2I3YA 1YZXA 2NBSA 2H66A 4Z7XA 3JCML 5DQSA 3QMXA 3TJBA 2B3SA 3PGTA 2VCTA 8GSSA 2XHFA 1MDKA 2QA1A 2GSRA 2XBIA 2YN1A 3HJMA 2X4AA 5BRTA 2MMZA 3O6TA 2RIIA 3HJOA 4HU7A 1GRXA 2HLSA 1TOFA 2MMOA 3F4RA 1SJ6A 4NPBA 2AV4A 1M9AA 3TKQA 5EPFA 3HY2A 3ME8A 4LLRA 1EP8A 3PINA 4MDCA 3QDNA 4V2NA 4E8HA 4Z2UA 4CY6A 2GSTA 1K3LA 4XS6A 3H8QA 3LEFA 1THOA 4V2MA 1WE0A 2HE3A 2NDOA 4X0XA 4K1FA 1SU9A 2IIYA 3RPNA 1XPVA 2KP2A 1Z6MA 2VIMA 3KMOA 1GUMA 1USBA 4MNNA 2B1LA 3GNJA 1XCCA 3ERFA 1MTCA 3DGQA 3U5RE 3L9SA 3R3EA 2LUSA 1K0CA 4CHSA 1TK5B 2CAIA 2ALBA 4L5LA 2MZCA 1O8WA 3FHKA 3KD0A 1SL2B 3G7JA 12GSA 5ECIB 3WT2A 1N2AA 3F6FA 4QL9A 2FWGA 5LD0A 3ME7A 1M2BA 3KTBA 3M1GA 5HR3A 5DJMA 3GTUB 3IV4A 4IGJA 2GGTA 5ENUA 4PUFC 2YWNA 5J41A 1S3AA 1XOBA 2PWJA 1QQ2A 2FD3A 3D5JA 2CZ2A 3E0UA 3HZ4A 2FWFA 3DMLA 1ZGNA 1K0NA 3ZLPA 1IYHA 2VO4A 1A0RP 1OC3A 1G0TA 4PNGA 4KH7A 4KAEA 1AQXA 4NHZA 4MABA 1Z3EA 17GSA 1OE8A 1AUCA 4AJ6A 4EC0A 1XW5A 1PX6A 1M2AA 1A2LA 4YH2A 1KTEA 3GSSA 3A5WA 2YV7A 2VM2A 2DIYA 2OE3A 2I1UA 3FY7A 1TKDB 4POMA 4ZB6A 2A4HA 3L78A 1I9DA 5CNWA 4IBPA 3MAKA 1XIYA 1JZDA 5A4WA 4ECBA 2IJYA 16GSA 3IDVA 4V1Ap 1QMVA 4ID0A 5C04A 1SL1B 1EGOA 4Q5QA 2LNSA 3FK8A 3A2XA 4YKFA 3HVXA 4N11A 5KEJA 3S9FA 3IE3A 6GSUA 2X99A 2K9FA 3EMXA 1ZYPA 1VF4A 4GTUA 1TK0B 1XWCA 5D9WA 2R0PA 3F4SA 4K8MA 1ABAA 1YKCA 2O85A 5D8IA 2CA8A 1EP7A 2DJ0A 3FW2A 2FLSA 3F0IA 2IPAA 1GTUA 5IMZA 2LJAA 6GSXA 5F8BA 4PXOA 4I2UA 1BAYA 4OD7A 2WDUA 2OADA 5CO3A 2B7JA 3KCMA 2H0IA 3UEMA 1ERUA 2IMIA 2PERA 3UMAA 5LCZA 1NSWA 2F8FA 3VWUA 2V2GA 4IJIA 3W8JA 5G30A 5A4VA 1VF1A 2L5LA 1R26A 4K2XA 4I6XA 2ZUPA 4QQ7A 1MEKA 3EPTA 3HDCA 3GRXA 4XIHA 1S3CA 1TP9A 2HRAA 2HSYA 1J0FA 4RUVA 3RDWA 4HS1A 3H93A 4ZBBA 4JZQA 2IMFA 3TRXA 2WB9A 4KCEA 4PNFA 2R6KA 1SK0A 4I8BA 4DEJA 1EOGA 3RBTA 1Z6NA 2DJKA 5EVOA 2RUEA 2GT5A 1EEMA 2AB6A 3A2VA 2V6KA 1QXHA 3TJKA 1NHYA 4POKA 1T7PB 5KN3A 2E7PA 2HRFA 3ZFBA 2WRTA 2VL3A 5ECOB 3C1SA 3VURA 4GWRA 2DJ3A 3HCZA 3DXBA 1SD8A 3TKRA 3DIEA 3IK7A 2WFCA 5J3RA 2L4QA 2FNOA 4ZL8A 2O89A 2RUFA 4HZ4A 1BG5A 2B5YA 4LMWA 2IMDA 3WGEA 2YWOA 2HNLA 1ZYNA 3WYWA 2N5FA 2B7KA 2VUPA 2QC7A 1F3AA 4ACSA 4ZBAA 3C71A 1YKAA 3HYPA 3ZVJA 1ACVA 1FOHA 2VL2C 4G2EA 1TW9A 1CQHA 1TI3A 4EL1A 4N30A 4USSA 3EWLA 2KLXA 5LNKe 3MSZA 4BPYA 4MCUA 4MF5A 2FGXA 5HR0A 3U6VA 3A5IA 5G2ZA 1M0UA 1IYIA 5J5NA 19GSA 1PQNA 3QAWA 2H8LA 1LU4A 2VD1A 4MJBA 2JSYA 4BWSA 2LJKA 3BCKA 1SKWB 4GCIA 4Q5FA 3I9V2 3KZQA 3CXGA 1KEBA 4G19A 3V1WA 1SKRB 1TU7A 5D73A 3ZVJD 4XCSA 1GP1A 4IHUA 4GSNA 2FY6A 5B6NA 1YJ6A 1N8JA 4CY8A 3HJPA 5ABRA 2LTKA 4EVMA 2C0FA 1C72A 2N5AA 3F6DA 3LG6A 3VWVA 5F06A 3EURA 3F8UA 3GKKA 4PGTA 4D73A 3DKSA 2LEGA 2B6MA 5CRHA 3BD2A 4AJ7A 2TIRA 3TOUA 1KBNA 3VI5A 1F37A 2PUKC 4CDOA 5G1LA 1UN2A 3M9KA 2GLRA 2XPDA 3UJ1A 3E3EA 4L5OA 3TRQA 2MYGA 1YF0A 5F0GA 2OE1A 3KGKA 2YANA 1ML6A 2K8VA 4KSOA 1PL1A 3BBYA 4KSMA 3PPUA 4OFMA 1GSUA 4PURA 4GSTA 4WKWA 2GQMA 2FA4A 1F3BA 4ZL9A 5D96A 2IFQA 1YY7A 5B8AA 9GSSA 3HA9A 2GDRA 2X8GA 3ZMKA 5D9TA 1HQOA 2HFDA 3A2WA 4X1UA 2G0FA 4G9HA 2FUG2 1O7UA 1TTZA 1GTBA 5L71A 3RHBA 1SJIA 3P8WA 1JLWA 2MBTA 1DBYA 2VLTA 2HI7A 3CMIA 1JZRA 3ZL5A 4PTSA 3P90A 4O5UA 4D73B 3HVVA 1M9BA 4IJ3A 13GSA 3UVTA 3QCPA 2H1BA 5CRWA 3LXTA 1XW6A 5DAKA 4MPFA 3AY8A 4F03A 1JZOA 2OKAA 2D2ZA 1BX9A 1MDJA 3LFLA 2DSAA 4GSSA 1UA5A 4IP6A 1JHBA 3EC3A 3MNGA 2CQ9A 5ECNB 4EE0A 1PRXA 1XOAA 3ED3A 1F6MC 3I6AA 1OKTA 4KDYA 3ISOA 5CYYA 1GTAA 3M0FA 2CV4A 4MPGA 1DE2A 2ES7A 2IFQB 3APSA 4EUYA 1ZL9A 2L57A 1T3BA 4MJAA 4OCEA 1NW2A 4KW6A 1K0MA 4KUNA 4IVFA 1SK2A 1U87A 3UL3A 2CVBA 1ZYQB 2PVQA 1THXA 1VRSD 4RQRA 18GSA 1SD9A 3TKSC 2IL3A 5CAXA 1WRYA 4ICYA 2CVDA 1SK1A 4MH2A 1WMJA 2R5GA 4ZIJA 1XVQA 3TOTA 4LA1A 3EU4A 3QAVA 4KDXA 2VD0A 5JWRB 1TK8B 5DJLA 1YQ1A 4AJ8A 3CRTA 4ZILA 4ZB8A 2C4JA 3KIJA 2H30A 2L59A 1M7TA 2YZUA 2A2SA 3C1RA 3L0HA 5G5FA 3FMWA 1FG4A 2YP6A 3GMFA 2C3QA 2HXKA 2VLVA 1EGRA 2B5XA 4WF5A 5IPGA 5IMCA 4HU9A 1AIUA 1F9MA 1U3IA 4J2FA 3HVSA 2XPEA 5B8BA 2E2GA 3EVIA 3DWVA 1MD3A 1OAZA 3Q19A 3N5OA 3TUEA 1WJKA 2JACA 1F2EA 2OACA 3IXRA 4TXOA 4HJ2A 2A2RA 2ON7A 4JR4A 1M2DA 1ERVA 5INYA 1X9SB 1V2AA 5DDLA 2WCIA 3Q6OA 5BMUA 3HKRA 2R0GA 3GURA 1GL8A 1PL2A 2RLIA 4YAVA 4IW9A 4XRAA 1PGTA 2GQKA 5IO2A 6GSVA 4JU5A 4K2DA 2VM1A 4L0WA 4EXJA 1K0DA 3WGXA 2OA7A 3ZIVA 4GQFA 5ID2A 3TJFA 4XS1A 4KCAA 5DCHA 2LS5A 4NMUA 6GSSA 2H71A 2V32A 2KOKA 2AAWA 2R3XA 2NVLA 3GUSA 5JCWA 2RM6A 4FYUA 4GLTA 1TRSA 1ZMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4V A;  3D0Z A;  2P31 A;  5JCG A;  5AIV A;  1G6Y A;  3UVH A;  5DCG A;  1QK8 A;  2YWM A;  4BVY A;  4MF6 A;  2CZ3 A;  2ON5 A;  4ILF A;  1DE1 A;  1X5C A;  4IP1 A;  3KEB A;  5C00 A;  5HFI A;  4EDZ A;  2GZY A;  1O6J A;  2PPT A;  5IM9 A;  3QPM A;  2VCV A;  2HSH A;  4IN0 A;  3CBU A;  4K9Z A;  4ML1 A;  2QGV A;  2WJU A;  2LNT A;  1K0O A;  2J23 A;  2K18 A;  3KH7 A;  1NHO A;  4LL4 B;  1X9W B;  2HZE A;  3FR9 A;  3I43 A;  2YPM A;  1OC8 A;  4EF0 A;  1A2J A;  1SL0 B;  2HYX A;  4K7N A;  2YNX A;  4Q5R A;  1PKW A;  1TRW A;  4NV5 A;  1BJX A;  2X8C A;  4OFT A;  2DJJ A;  4N0V A;  1R4W A;  5ID2 B;  2B5E A;  1BYE A;  4LL1 B;  1GSF A;  5AGY A;  1Q98 A;  1TRV A;  1FVK A;  3BJ5 A;  3GKM A;  2KHP A;  3KJY A;  2H70 A;  1AXD A;  4TRX A;  5JWO B;  2H1G A;  4OFN A;  2WZ9 A;  5F07 A;  1ERT A;  3GV1 A;  3M9J A;  4MZB A;  4KND A;  5KN2 A;  4POL A;  4HQS A;  2O87 A;  1OE7 A;  1G7O A;  5A4U A;  1YEP A;  1T4Z A;  3RAZ A;  1SKS B;  1WP0 A;  2HT9 A;  1FB6 A;  2EC4 A;  2DML A;  2LQO A;  1RK4 A;  1GSQ A;  2R4V A;  3TKS E;  2HZE B;  5GSS A;  3LQ7 A;  1SYX A;  2YOI A;  1B9Y C;  2BTO T;  2VL2 A;  2N5B A;  2CX4 A;  1AQW A;  2VLU A;  3GX0 A;  1A23 A;  1B9X C;  3FR6 A;  1Q4J A;  2MMN A;  2H73 A;  3QAG A;  4XS4 A;  4F0B A;  3G7I A;  1FW1 A;  4MZW A;  1YEX A;  1HNA A;  2FWH A;  4YQM A;  1GUK A;  3LJR A;  3TGZ A;  2GT6 A;  3FEU A;  4EKZ A;  4HOJ A;  3BOA A;  3DVW A;  5IMF A;  3TJJ A;  1NM3 A;  2REM A;  1TRU A;  2V6O A;  2GZZ A;  4MH3 A;  4PQH A;  1PKZ A;  5H5Q A;  4V2L A;  2HZF A;  4K0G A;  1PSQ A;  1X5D A;  4JR6 A;  1GH2 A;  5HFG A;  4TR0 A;  3K8N A;  4CW9 A;  4I5Q A;  4GQC A;  2H6Y A;  3VPQ A;  4DSS A;  5CP1 A;  1GSY A;  2AYT A;  5CRE A;  4IQA A;  4XHM A;  1ZCP A;  1J9B A;  3F63 A;  3ZYW A;  2K6V A;  3ERG A;  4DVC A;  3D6I A;  2DC5 A;  1RW1 A;  3IC4 A;  2YZH A;  11GS A;  4ISD A;  4WR4 A;  5KN0 A;  4RI6 A;  1GLP A;  1H4O A;  3PH9 A;  4XRD A;  4OO4 A;  4KE3 A;  4MMM A;  2O7K A;  3LSZ A;  1SEN A;  2DMM A;  3EE2 A;  1HNB A;  1GUH A;  1ERW A;  3ZRE A;  4ZL7 A;  2P5R A;  1YDK A;  2H1D A;  4MJE A;  1JZW A;  3WD6 A;  2NTO A;  5A5K A;  6GST A;  1Z7R A;  5ECH B;  4TR4 A;  3ZRD A;  2LRT A;  1EV9 A;  5FT3 A;  5GZZ B;  5JCU A;  4RQX A;  4KGI A;  5JWQ B;  3GYK A;  3FZ9 A;  4BA7 A;  4DSQ A;  2OBK A;  1M99 A;  1QGV A;  5J9B A;  2VAF A;  3KH9 A;  1X0R A;  4EO3 A;  4AF2 A;  1U88 A;  5HR2 A;  3IA1 A;  1XWG A;  2VCZ A;  3MDK A;  3C8E A;  2GTU A;  2H0H A;  3HZ8 A;  4NWY A;  3L9U A;  3IBH A;  3VWW A;  2I9H A;  2TRC P;  2IME A;  1R5A A;  2H01 A;  5IOX A;  4OCF A;  4KDU A;  1MD4 A;  1AAZ A;  4KB3 A;  5HR1 A;  3IRA A;  5ECP B;  4HEA 2;  1A2M A;  1J08 A;  1BQ7 A;  4MJC A;  1K0B A;  1UC7 A;  2PVO C;  4OWY A;  10GS A;  3UBK A;  4NAX A;  3TDG A;  3TB2 A;  5B6M A;  1B4Q A;  5HQP A;  2VCQ A;  1PMT A;  4OO5 A;  4WR5 A;  4TR1 A;  4IS0 A;  4IQ1 A;  2J9H A;  3FR3 A;  1V40 A;  1G7E A;  2H0G A;  1VF3 A;  2IMK A;  1X9M B;  3NZN A;  2QKE A;  4LMV A;  4L0U A;  4WBJ A;  3H1N A;  4TXV A;  5ECQ B;  2BJX A;  1GSS A;  1RQM A;  4MF7 A;  2FA8 A;  1R5P A;  1K3Y A;  2PU9 C;  5IMA A;  3FRC A;  4N10 A;  4JED A;  1GLQ A;  5F05 A;  2P5Q A;  1EZK A;  4JRR A;  1X5E A;  3UAR A;  1GWC A;  5G31 A;  3TKS A;  2C3T A;  4ECC A;  5D9V A;  1TJD A;  2IN3 A;  2K8S A;  1T8E B;  5E59 A;  4HZ2 A;  4ZBD A;  3H79 A;  3PR8 A;  1HNC A;  2JAD A;  1MDI A;  3QOU A;  2M80 A;  3UIW A;  4PUA A;  2H1A A;  5ECM B;  5B7C A;  2OBI A;  1SYR A;  3QFA C;  3ZTL A;  1GTI A;  2M72 A;  4TR1 B;  3Q18 A;  4K6X A;  3GH9 A;  4GRF A;  1VGL A;  1URM A;  3LWA A;  5IIZ A;  3KP9 A;  3ZIJ A;  1OKD A;  3CTG A;  3E9J B;  4DSR A;  2GS3 A;  4FIW A;  2PN8 A;  3FZ4 A;  1V98 A;  3TCO A;  2LJR A;  5KN1 A;  4G10 A;  1U6T A;  1EV4 A;  3CSJ A;  5DVB A;  3GTU A;  5ECS A;  2R37 A;  3RPP A;  4NHW A;  2YV9 A;  5DQY A;  3D4T A;  3G9B A;  1W89 A;  1PN9 A;  2WGR A;  5DAK B;  5FWG A;  4ML6 A;  1ILO A;  2L5O A;  5G5E A;  1A8L A;  5AIS A;  4I97 A;  4MLY A;  3WGD A;  3IAS 2;  3IHQ A;  1EOH A;  1FHE A;  3VK9 A;  1ZYE A;  2O8V B;  3ZIT A;  1O73 A;  3GL5 A;  3SWL A;  3VI7 A;  4V1A g;  5IPH A;  2F3M A;  1B8X A;  1Z5Y E;  5AN1 A;  4TR3 A;  2DJ1 A;  3Q74 A;  5FHI A;  2PMT A;  2VL9 A;  4GF0 A;  4YQV A;  1DUG A;  2PBJ A;  3VPT A;  2FCH A;  3FZ5 A;  4I2T A;  1FAA A;  1GSD A;  4EDY A;  3F9U A;  1Z7P A;  2X8H A;  1E2Y A;  2YWI A;  1HYU A;  3DVX A;  2MBS A;  3EMP A;  3IOS A;  1XWB A;  7GSS A;  3M3M A;  3J7Y k;  3GST A;  5IOW A;  4Q5N A;  5EY6 A;  1ZOF A;  4TN8 A;  1TU8 A;  4TW5 A;  1XBS A;  2H19 A;  3H4K A;  1XWA A;  1GUL A;  4K7O A;  3GH6 A;  1YF1 A;  1S3D A;  22GS A;  4O7H A;  4ZXG A;  1V57 A;  3GHA A;  4TVE A;  1B48 A;  1ON4 A;  4TOP A;  4BVX A;  3R2Q A;  4HJM A;  2VCW A;  2H72 A;  1A0F A;  1WOU A;  2OJL A;  2L6C A;  4J56 E;  4N0Z A;  1OC9 A;  1AW9 A;  4TXO B;  2H6X A;  2WS2 A;  3MWH A;  2CX3 A;  2X64 A;  1WWJ A;  4QL7 A;  3N9J A;  5ELA A;  4YAP A;  1VF2 A;  3CSI A;  3LOR A;  4HQZ A;  4O92 A;  4WF4 A;  3M8N A;  2C8U A;  5GAN D;  2GSQ A;  2NPB A;  2RM5 A;  5ECK B;  2IWT A;  3ZZX A;  1TI1 A;  1A8Y A;  2L4C A;  4HDE A;  5IO0 A;  3DYR A;  3VFI A;  4F2I A;  4OMV A;  2B1K A;  1GNE A;  4NV2 A;  1V9W A;  1AC1 A;  3VWX A;  5D9X A;  2EIQ A;  1PA3 A;  1FOV A;  2CAQ A;  3FKF A;  2KP1 A;  1ST9 A;  3QR6 A;  4X43 A;  5CRG A;  1XW9 A;  2CVK A;  4FYC A;  1WPI A;  4HUA A;  1DSB A;  4FH8 A;  3HHV A;  2EIO A;  2YJ7 A;  1GNW A;  1T4Y A;  2ZNM A;  1PX7 A;  3P2A A;  1T00 A;  3EYT A;  2R2J A;  3L9V A;  3GKN A;  5GAP D;  1OC9 B;  3ZFL A;  2KUC A;  2DJ2 A;  1E6B A;  5DBQ A;  1BED A;  3O3T A;  1EWX A;  1HD2 A;  3F4T A;  4YQU A;  3EIN A;  2VCX A;  3ERW A;  2OE0 A;  5ECL B;  4IKH A;  2LRC A;  2C80 A;  1KNG A;  2AUV A;  3GFK A;  1QFN A;  2C0E A;  4F0C A;  2LRN A;  3TKP A;  3KM6 A;  3NOF A;  3KP8 A;  6GSW A;  4WET A;  1Y6E A;  2E0Q A;  3HXS A;  3VLN A;  3GIX A;  2V1M A;  3GKX A;  4WEY A;  4PQI A;  2F9S A;  1SJZ A;  3DRN A;  2AHE A;  1GSE A;  5DAL A;  1AQV A;  1OYJ A;  3L4N A;  5CRD A;  4O5R A;  2JSZ A;  5COH A;  1O8X A;  1JLV A;  20GS A;  4F82 A;  3EU3 A;  2LST A;  4MZC A;  3FYG A;  2H74 A;  1XWK A;  3GA4 A;  1Z9H A;  2TRX A;  5G1K A;  4NXI A;  1WIK A;  5IQY A;  2H6Z A;  1FB0 A;  3LYP A;  3LYK A;  1FO5 A;  2G2Q A;  4FO5 A;  2Z9S A;  5E4W A;  2JZT A;  3W8S A;  3GX8 A;  3QFB C;  4PQ1 A;  5GST A;  3SBC A;  3G7Y A;  3GL3 A;  2VOC A;  1CQG A;  4POB A;  4BWQ A;  3F3R A;  1I5G A;  1K3O A;  1LJR A;  4ULX A;  4XS4 B;  3WT1 A;  5AIX A;  1T1V A;  3CRU A;  4TKY A;  2GQL A;  2ZCT A;  4H86 A;  2L6D A;  4PX1 A;  1W4V A;  4P3Y B;  2WUL A;  3FZA A;  14GS A;  3D21 A;  1XFL A;  2C0G A;  2GZP A;  4KA0 A;  3TRP A;  3UAP A;  1JFU A;  3F3Q A;  5DAL B;  3CTF A;  1A24 A;  3GN3 A;  3BCI A;  5D93 A;  1ZZY A;  3I69 A;  1U3A A;  1G6W A;  1OVN A;  4HI7 A;  2QSI A;  3RHC A;  4AGS A;  4DSS B;  1EEJ A;  2F8A A;  3APQ A;  2FWE A;  3DEX A;  1XZO A;  5IMD A;  1O85 A;  1O81 A;  3C7M A;  6GSY A;  1UVZ A;  4F9Z A;  4MK3 A;  4BL7 A;  3QD9 A;  1LBK A;  5EL8 A;  3KTL A;  1TXX A;  1TDI A;  3UBL A;  4ZB9 A;  2GSS A;  4K7I A;  5H5R A;  3IAM 2;  3US3 A;  1PD2 1;  2MMA A;  3UOM A;  3IR4 A;  3TJG A;  3APO A;  4KX4 A;  3LXZ A;  2HRN A;  2H75 A;  2LQQ A;  2XBQ A;  4GXZ A;  1Y25 A;  2JU5 A;  4WXT A;  2C3N A;  3HD5 A;  2I81 A;  4JBB A;  1XVW A;  5ECR B;  2F51 A;  3OR5 A;  4ECJ A;  2EIR A;  3J7Y b;  3CSH A;  4ECI A;  3IPZ A;  3LGC A;  3W6G A;  4WBR D;  4K0N A;  2YCD A;  2GVP A;  3CYN A;  2XC2 A;  2CT6 A;  1H75 A;  2FHE A;  2DBC A;  5HFK A;  4MA9 A;  4RI7 A;  2AJQ B;  2JZS A;  3D22 A;  3A3T A;  5IMV A;  3IK9 A;  4FYB A;  4J57 E;  1K0A A;  4XTS A;  2M46 A;  2LKU A;  3ZML A;  3KXO A;  1FVJ A;  1R7H A;  2E2M A;  4E8E A;  3C73 A;  4O32 A;  1V58 A;  2DIZ A;  5H5S A;  3KMN A;  2C1Y A;  2LV3 A;  1QUW A;  5ELG A;  3O76 A;  4JE1 A;  1B4P A;  2DLX A;  2V41 A;  4MP4 A;  4L8E A;  3DD3 A;  2C0D A;  2P0G A;  5J4U A;  4IEL A;  2BMX A;  2YJH A;  2PGT A;  2H76 A;  2I4A A;  2JL4 A;  3NIV A;  3D4M A;  3P7X A;  5J9C A;  1XXU A;  2JZR A;  2I3Y A;  1YZX A;  2NBS A;  2H66 A;  4Z7X A;  3JCM L;  5DQS A;  3QMX A;  3TJB A;  2B3S A;  3PGT A;  2VCT A;  8GSS A;  2XHF A;  1MDK A;  2GSR A;  2XBI A;  2YN1 A;  3HJM A;  2MMZ A;  3O6T A;  2RII A;  3HJO A;  4HU7 A;  1GRX A;  2HLS A;  1TOF A;  2MMO A;  3F4R A;  1SJ6 A;  4NPB A;  2AV4 A;  1M9A A;  3TKQ A;  5EPF A;  3HY2 A;  3ME8 A;  4LLR A;  1EP8 A;  3PIN A;  4MDC A;  3QDN A;  4V2N A;  4E8H A;  2GST A;  1K3L A;  4XS6 A;  3H8Q A;  3LEF A;  1THO A;  4V2M A;  1WE0 A;  2HE3 A;  2NDO A;  4X0X A;  4K1F A;  1SU9 A;  2IIY A;  3RPN A;  1XPV A;  2KP2 A;  1Z6M A;  2VIM A;  3KMO A;  1GUM A;  1USB A;  2B1L A;  3GNJ A;  1XCC A;  3ERF A;  1MTC A;  3DGQ A;  3U5R E;  3L9S A;  2LUS A;  1K0C A;  4CHS A;  1TK5 B;  2CAI A;  2ALB A;  4L5L A;  2MZC A;  1O8W A;  3FHK A;  3KD0 A;  1SL2 B;  3G7J A;  12GS A;  5ECI B;  3WT2 A;  1N2A A;  3F6F A;  4QL9 A;  2FWG A;  5LD0 A;  3ME7 A;  1M2B A;  3KTB A;  3M1G A;  5HR3 A;  5DJM A;  3GTU B;  3IV4 A;  4IGJ A;  2GGT A;  5ENU A;  4PUF C;  2YWN A;  5J41 A;  1S3A A;  1XOB A;  2PWJ A;  1QQ2 A;  2FD3 A;  3D5J A;  2CZ2 A;  3E0U A;  3HZ4 A;  2FWF A;  3DML A;  1ZGN A;  1K0N A;  3ZLP A;  1IYH A;  2VO4 A;  1A0R P;  1OC3 A;  1G0T A;  4PNG A;  4KH7 A;  4KAE A;  1AQX A;  4NHZ A;  4MAB A;  1Z3E A;  17GS A;  1OE8 A;  1AUC A;  4AJ6 A;  4EC0 A;  1XW5 A;  1PX6 A;  1M2A A;  1A2L A;  4YH2 A;  1KTE A;  3GSS A;  3A5W A;  2YV7 A;  2VM2 A;  2DIY A;  2OE3 A;  2I1U A;  3FY7 A;  1TKD B;  4POM A;  4ZB6 A;  3L78 A;  1I9D A;  5CNW A;  4IBP A;  3MAK A;  1XIY A;  1JZD A;  5A4W A;  4ECB A;  2IJY A;  16GS A;  3IDV A;  4V1A p;  1QMV A;  4ID0 A;  5C04 A;  1SL1 B;  1EGO A;  4Q5Q A;  2LNS A;  3FK8 A;  3A2X A;  3HVX A;  4N11 A;  5KEJ A;  3S9F A;  3IE3 A;  6GSU A;  2X99 A;  2K9F A;  3EMX A;  1VF4 A;  4GTU A;  1TK0 B;  1XWC A;  5D9W A;  3F4S A;  4K8M A;  1ABA A;  1YKC A;  2O85 A;  5D8I A;  2CA8 A;  1EP7 A;  2DJ0 A;  3FW2 A;  2FLS A;  3F0I A;  2IPA A;  1GTU A;  5IMZ A;  2LJA A;  6GSX A;  5F8B A;  4PXO A;  4I2U A;  1BAY A;  4OD7 A;  2WDU A;  2OAD A;  5CO3 A;  2B7J A;  3KCM A;  2H0I A;  3UEM A;  1ERU A;  2IMI A;  2PER A;  3UMA A;  5LCZ A;  1NSW A;  2F8F A;  3VWU A;  2V2G A;  4IJI A;  3W8J A;  5G30 A;  5A4V A;  1VF1 A;  2L5L A;  1R26 A;  4I6X A;  2ZUP A;  4QQ7 A;  1MEK A;  3HDC A;  3GRX A;  4XIH A;  1S3C A;  1TP9 A;  2HSY A;  1J0F A;  4RUV A;  3RDW A;  4HS1 A;  3H93 A;  4ZBB A;  4JZQ A;  2IMF A;  3TRX A;  2WB9 A;  4KCE A;  4PNF A;  2R6K A;  1SK0 A;  4I8B A;  4DEJ A;  1EOG A;  3RBT A;  1Z6N A;  2DJK A;  5EVO A;  2RUE A;  2GT5 A;  1EEM A;  2AB6 A;  3A2V A;  2V6K A;  1QXH A;  3TJK A;  1NHY A;  4POK A;  1T7P B;  5KN3 A;  2E7P A;  2HRF A;  3ZFB A;  2WRT A;  2VL3 A;  5ECO B;  3C1S A;  3VUR A;  4GWR A;  2DJ3 A;  3HCZ A;  3DXB A;  1SD8 A;  3TKR A;  3DIE A;  3IK7 A;  2WFC A;  5J3R A;  2L4Q A;  2FNO A;  4ZL8 A;  2O89 A;  2RUF A;  4HZ4 A;  1BG5 A;  2B5Y A;  4LMW A;  2IMD A;  3WGE A;  2YWO A;  2HNL A;  3WYW A;  2N5F A;  2B7K A;  2VUP A;  2QC7 A;  1F3A A;  4ACS A;  4ZBA A;  3C71 A;  1YKA A;  3HYP A;  3ZVJ A;  1ACV A;  2VL2 C;  4G2E A;  1TW9 A;  1CQH A;  1TI3 A;  4EL1 A;  4N30 A;  3EWL A;  2KLX A;  5LNK e;  3MSZ A;  4BPY A;  4MCU A;  4MF5 A;  2FGX A;  5HR0 A;  3U6V A;  5G2Z A;  1M0U A;  1IYI A;  5J5N A;  19GS A;  1PQN A;  3QAW A;  2H8L A;  1LU4 A;  2VD1 A;  4MJB A;  2JSY A;  4BWS A;  2LJK A;  3BCK A;  1SKW B;  4GCI A;  4Q5F A;  3I9V 2;  3KZQ A;  3CXG A;  1KEB A;  4G19 A;  3V1W A;  1SKR B;  1TU7 A;  5D73 A;  3ZVJ D;  4XCS A;  1GP1 A;  4IHU A;  4GSN A;  2FY6 A;  5B6N A;  1YJ6 A;  1N8J A;  3HJP A;  5ABR A;  2LTK A;  4EVM A;  2C0F A;  1C72 A;  2N5A A;  3F6D A;  3LG6 A;  3VWV A;  5F06 A;  3EUR A;  3F8U A;  3GKK A;  4PGT A;  4D73 A;  3DKS A;  2LEG A;  2B6M A;  5CRH A;  3BD2 A;  4AJ7 A;  2TIR A;  3TOU A;  1KBN A;  3VI5 A;  1F37 A;  2PUK C;  4CDO A;  5G1L A;  1UN2 A;  3M9K A;  2GLR A;  2XPD A;  3UJ1 A;  3E3E A;  4L5O A;  3TRQ A;  2MYG A;  1YF0 A;  5F0G A;  2OE1 A;  3KGK A;  2YAN A;  1ML6 A;  2K8V A;  4KSO A;  1PL1 A;  3BBY A;  4KSM A;  4OFM A;  1GSU A;  4PUR A;  4GST A;  4WKW A;  2GQM A;  2FA4 A;  1F3B A;  4ZL9 A;  5D96 A;  2IFQ A;  1YY7 A;  5B8A A;  9GSS A;  3HA9 A;  2GDR A;  2X8G A;  3ZMK A;  5D9T A;  1HQO A;  2HFD A;  3A2W A;  4X1U A;  2G0F A;  4G9H A;  2FUG 2;  1O7U A;  1TTZ A;  1GTB A;  5L71 A;  3RHB A;  1SJI A;  3P8W A;  1JLW A;  2MBT A;  1DBY A;  2VLT A;  2HI7 A;  3CMI A;  1JZR A;  3ZL5 A;  3P90 A;  4D73 B;  3HVV A;  1M9B A;  4IJ3 A;  13GS A;  3UVT A;  3QCP A;  2H1B A;  5CRW A;  3LXT A;  1XW6 A;  5DAK A;  4MPF A;  3AY8 A;  4F03 A;  1JZO A;  2OKA A;  2D2Z A;  1BX9 A;  1MDJ A;  3LFL A;  2DSA A;  4GSS A;  1UA5 A;  4IP6 A;  1JHB A;  3EC3 A;  3MNG A;  2CQ9 A;  5ECN B;  4EE0 A;  1PRX A;  1XOA A;  3ED3 A;  1F6M C;  3I6A A;  1OKT A;  4KDY A;  3ISO A;  5CYY A;  1GTA A;  3M0F A;  2CV4 A;  4MPG A;  1DE2 A;  2ES7 A;  2IFQ B;  3APS A;  4EUY A;  1ZL9 A;  2L57 A;  1T3B A;  4MJA A;  4OCE A;  1NW2 A;  4KW6 A;  1K0M A;  4KUN A;  4IVF A;  1SK2 A;  1U87 A;  3UL3 A;  2CVB A;  1ZYQ B;  2PVQ A;  1THX A;  1VRS D;  4RQR A;  18GS A;  1SD9 A;  3TKS C;  2IL3 A;  5CAX A;  1WRY A;  2CVD A;  1SK1 A;  4MH2 A;  1WMJ A;  2R5G A;  4ZIJ A;  1XVQ A;  3TOT A;  4LA1 A;  3EU4 A;  3QAV A;  4KDX A;  2VD0 A;  5JWR B;  1TK8 B;  5DJL A;  1YQ1 A;  4AJ8 A;  3CRT A;  4ZIL A;  4ZB8 A;  2C4J A;  3KIJ A;  2H30 A;  2L59 A;  1M7T A;  2YZU A;  2A2S A;  3C1R A;  3L0H A;  5G5F A;  1FG4 A;  2YP6 A;  3GMF A;  2C3Q A;  2HXK A;  2VLV A;  1EGR A;  2B5X A;  4WF5 A;  5IPG A;  5IMC A;  4HU9 A;  1AIU A;  1F9M A;  1U3I A;  4J2F A;  3HVS A;  2XPE A;  5B8B A;  2E2G A;  3EVI A;  3DWV A;  1MD3 A;  1OAZ A;  3Q19 A;  3N5O A;  3TUE A;  1WJK A;  2JAC A;  1F2E A;  2OAC A;  3IXR A;  4TXO A;  4HJ2 A;  2A2R A;  2ON7 A;  4JR4 A;  1M2D A;  1ERV A;  5INY A;  1X9S B;  1V2A A;  5DDL A;  2WCI A;  3Q6O A;  3HKR A;  3GUR A;  1GL8 A;  1PL2 A;  2RLI A;  4YAV A;  4IW9 A;  4XRA A;  1PGT A;  2GQK A;  5IO2 A;  6GSV A;  4JU5 A;  4K2D A;  2VM1 A;  4L0W A;  4EXJ A;  1K0D A;  3WGX A;  2OA7 A;  3ZIV A;  4GQF A;  5ID2 A;  3TJF A;  4XS1 A;  4KCA A;  5DCH A;  2LS5 A;  4NMU A;  6GSS A;  2H71 A;  2V32 A;  2KOK A;  2AAW A;  2R3X A;  2NVL A;  3GUS A;  5JCW A;  2RM6 A;  4FYU A;  4GLT A;  1TRS A;  1ZMA A; 
#chains in the Genus database with same CATH topology
 2A4V A;  3D0Z A;  2P31 A;  5JCG A;  5AIV A;  1G6Y A;  3UVH A;  5DCG A;  1QK8 A;  2YWM A;  4BVY A;  4MF6 A;  2CZ3 A;  2ON5 A;  4ILF A;  1DE1 A;  1X5C A;  4IP1 A;  3KEB A;  5C00 A;  5HFI A;  4EDZ A;  2GZY A;  1O6J A;  2PPT A;  5IM9 A;  3QPM A;  2VCV A;  2HSH A;  4IN0 A;  3CBU A;  4K9Z A;  4ML1 A;  2QGV A;  2WJU A;  2LNT A;  1K0O A;  2J23 A;  2K18 A;  3KH7 A;  1NHO A;  4LL4 B;  1X9W B;  2HZE A;  3FR9 A;  3I43 A;  2YPM A;  1OC8 A;  4EF0 A;  1A2J A;  3MIX A;  1SL0 B;  2HYX A;  4K7N A;  2YNX A;  4Q5R A;  1PKW A;  1TRW A;  4NV5 A;  1BJX A;  2X8C A;  4OFT A;  2DJJ A;  4N0V A;  1R4W A;  5ID2 B;  2B5E A;  1BYE A;  4LL1 B;  1GSF A;  5AGY A;  1Q98 A;  1TRV A;  1FVK A;  3BJ5 A;  3GKM A;  2KHP A;  3KJY A;  2H70 A;  1AXD A;  4BVY B;  4TRX A;  5JWO B;  2H1G A;  4OFN A;  2WZ9 A;  5F07 A;  1ERT A;  3GV1 A;  3M9J A;  4MZB A;  4KND A;  5KN2 A;  4POL A;  4HQS A;  2O87 A;  1OE7 A;  1G7O A;  5A4U A;  1YEP A;  1T4Z A;  3RAZ A;  1SKS B;  1WP0 A;  2HT9 A;  1FB6 A;  2EC4 A;  2DML A;  2LQO A;  1RK4 A;  1GSQ A;  2R4V A;  3TKS E;  2HZE B;  5GSS A;  3LQ7 A;  1SYX A;  2YOI A;  1B9Y C;  2BTO T;  2VL2 A;  2N5B A;  2CX4 A;  1AQW A;  2VLU A;  3GX0 A;  1A23 A;  1B9X C;  3FR6 A;  1Q4J A;  2MMN A;  2H73 A;  3QAG A;  4XS4 A;  4F0B A;  3G7I A;  1FW1 A;  4MZW A;  1YEX A;  4K5S A;  1HNA A;  2FWH A;  4YQM A;  1GUK A;  3LJR A;  3TGZ A;  2GT6 A;  3FEU A;  4EKZ A;  4HOJ A;  3BOA A;  3DVW A;  5IMF A;  3TJJ A;  1NM3 A;  2REM A;  1TRU A;  2V6O A;  2GZZ A;  4MH3 A;  4PQH A;  1PKZ A;  5H5Q A;  4V2L A;  2HZF A;  4K0G A;  1PSQ A;  1X5D A;  4JR6 A;  1GH2 A;  5HFG A;  4TR0 A;  3K8N A;  4FQU A;  4CW9 A;  4I5Q A;  4GQC A;  2H6Y A;  3VPQ A;  4DSS A;  5CP1 A;  3MYD A;  1GSY A;  2AYT A;  5CRE A;  4IQA A;  4XHM A;  1ZCP A;  4G0I A;  1J9B A;  3F63 A;  3ZYW A;  2K6V A;  3ERG A;  4DVC A;  3D6I A;  2DC5 A;  1RW1 A;  3IC4 A;  2YZH A;  11GS A;  4ISD A;  4WR4 A;  5KN0 A;  4RI6 A;  1GLP A;  1H4O A;  3PH9 A;  4XRD A;  4OO4 A;  4KE3 A;  4MMM A;  2O7K A;  3LSZ A;  1SEN A;  2DMM A;  3EE2 A;  1HNB A;  1GUH A;  1ERW A;  3ZRE A;  4ZL7 A;  2P5R A;  1YDK A;  2H1D A;  4MJE A;  1JZW A;  3WD6 A;  2NTO A;  5A5K A;  6GST A;  1Z7R A;  5ECH B;  4TR4 A;  3ZRD A;  2LRT A;  1PN0 A;  1EV9 A;  5FT3 A;  5GZZ B;  5JCU A;  4RQX A;  4KGI A;  5JWQ B;  3GYK A;  3FZ9 A;  4BA7 A;  4DSQ A;  2OBK A;  1M99 A;  1QGV A;  5J9B A;  2VAF A;  3KH9 A;  1X0R A;  4EO3 A;  4AF2 A;  1U88 A;  5HR2 A;  3IA1 A;  1XWG A;  2VCZ A;  3MDK A;  3C8E A;  2GTU A;  2H0H A;  3HZ8 A;  4NWY A;  3L9U A;  3IBH A;  3VWW A;  2I9H A;  2TRC P;  2IME A;  1R5A A;  2H01 A;  5IOX A;  4OCF A;  4KDU A;  1MD4 A;  1AAZ A;  4KB3 A;  5HR1 A;  3IRA A;  5ECP B;  4HEA 2;  1A2M A;  1J08 A;  1BQ7 A;  4MJC A;  1K0B A;  1UC7 A;  2PVO C;  4OWY A;  10GS A;  3UBK A;  4NAX A;  3TDG A;  3TB2 A;  5B6M A;  1B4Q A;  5HQP A;  2DKI A;  2R0C A;  2VCQ A;  1PMT A;  4OO5 A;  4WR5 A;  4TR1 A;  4IS0 A;  4IQ1 A;  2J9H A;  3FR3 A;  1V40 A;  1G7E A;  2H0G A;  1VF3 A;  2IMK A;  1X9M B;  3NZN A;  2QKE A;  4LMV A;  4L0U A;  4WBJ A;  3H1N A;  4TXV A;  5ECQ B;  2BJX A;  1GSS A;  1RQM A;  4MF7 A;  2FA8 A;  1R5P A;  1K3Y A;  2PU9 C;  5IMA A;  3HVN A;  3FRC A;  4N10 A;  4JED A;  1GLQ A;  5F05 A;  2P5Q A;  1EZK A;  4JRR A;  1X5E A;  3UAR A;  1GWC A;  5G31 A;  3TKS A;  2C3T A;  4ECC A;  5D9V A;  1TJD A;  2IN3 A;  2K8S A;  1T8E B;  4K5R A;  5E59 A;  4HZ2 A;  4ZBD A;  3H79 A;  3PR8 A;  1HNC A;  2JAD A;  1MDI A;  3QOU A;  2M80 A;  3UIW A;  4PUA A;  1S3R A;  2H1A A;  5ECM B;  5B7C A;  2OBI A;  1SYR A;  3QFA C;  3ZTL A;  1GTI A;  2M72 A;  4TR1 B;  3Q18 A;  4K6X A;  3GH9 A;  4A5P A;  4GRF A;  1VGL A;  1URM A;  3LWA A;  5IIZ A;  3KP9 A;  3ZIJ A;  1OKD A;  3CTG A;  3E9J B;  4DSR A;  2GS3 A;  4FIW A;  2PN8 A;  3FZ4 A;  1V98 A;  3TCO A;  2LJR A;  5KN1 A;  4G10 A;  1U6T A;  1EV4 A;  3CSJ A;  5DVB A;  3GTU A;  5ECS A;  2R37 A;  3RPP A;  4NHW A;  2YV9 A;  5DQY A;  3D4T A;  3G9B A;  1W89 A;  4EIP A;  1PN9 A;  2WGR A;  5DAK B;  5FWG A;  4ML6 A;  1ILO A;  2L5O A;  5G5E A;  1A8L A;  5AIS A;  4I97 A;  4MLY A;  3WGD A;  3IAS 2;  3IHQ A;  1EOH A;  1FHE A;  3VK9 A;  1ZYE A;  2O8V B;  3ZIT A;  1O73 A;  3GL5 A;  3SWL A;  3VI7 A;  4V1A g;  3IC8 A;  5IPH A;  2F3M A;  1B8X A;  1Z5Y E;  5AN1 A;  4TR3 A;  2DJ1 A;  3Q74 A;  5FHI A;  2PMT A;  2VL9 A;  4GF0 A;  4YQV A;  5KOX A;  1DUG A;  2PBJ A;  3VPT A;  2FCH A;  3FZ5 A;  4I2T A;  1FAA A;  1GSD A;  4O5Q A;  4EDY A;  3F9U A;  1Z7P A;  2X8H A;  1E2Y A;  2YWI A;  1HYU A;  3DVX A;  2MBS A;  3EMP A;  3IOS A;  1XWB A;  7GSS A;  3M3M A;  3J7Y k;  3GST A;  5IOW A;  4Q5N A;  5EY6 A;  1ZOF A;  4TN8 A;  1TU8 A;  4TW5 A;  1XBS A;  2H19 A;  3H4K A;  1XWA A;  1XG8 A;  1GUL A;  4K7O A;  3GH6 A;  1YF1 A;  1S3D A;  22GS A;  4O7H A;  4ZXG A;  1V57 A;  3GHA A;  4TVE A;  1B48 A;  1ON4 A;  4TOP A;  4BVX A;  3R2Q A;  4HJM A;  2VCW A;  2HSM A;  2H72 A;  1A0F A;  1WOU A;  2OJL A;  2L6C A;  4J56 E;  4N0Z A;  1OC9 A;  1AW9 A;  4TXO B;  2H6X A;  2WS2 A;  4Z2R A;  3MWH A;  2CX3 A;  2X64 A;  1WWJ A;  4QL7 A;  3N9J A;  5ELA A;  4YAP A;  1VF2 A;  3CSI A;  3LOR A;  4HQZ A;  4O92 A;  4WF4 A;  3M8N A;  2C8U A;  5GAN D;  2GSQ A;  2NPB A;  2RM5 A;  5ECK B;  4G0L A;  2IWT A;  3ZZX A;  1TI1 A;  1A8Y A;  2L4C A;  4HDE A;  5IO0 A;  2QA2 A;  3DYR A;  3VFI A;  4F2I A;  4OMV A;  2B1K A;  1GNE A;  4NV2 A;  1V9W A;  1AC1 A;  3VWX A;  5D9X A;  2EIQ A;  1PA3 A;  1FOV A;  2CAQ A;  3FKF A;  2KP1 A;  1ST9 A;  3QR6 A;  4X43 A;  5CRG A;  1XW9 A;  2CVK A;  4FYC A;  1WPI A;  4HUA A;  1DSB A;  4FH8 A;  4BVX B;  3HHV A;  2EIO A;  2YJ7 A;  1GNW A;  1T4Y A;  2ZNM A;  1PX7 A;  3P2A A;  1T00 A;  3EYT A;  2R2J A;  3L9V A;  3GKN A;  5GAP D;  1OC9 B;  3ZFL A;  2KUC A;  2DJ2 A;  1E6B A;  5DBQ A;  1BED A;  3O3T A;  1EWX A;  1HD2 A;  3F4T A;  4YQU A;  3EIN A;  2VCX A;  3ERW A;  2OE0 A;  5ECL B;  4IKH A;  2LRC A;  2HRK A;  3LW9 A;  2C80 A;  1KNG A;  2AUV A;  3GFK A;  1QFN A;  2DKH A;  2C0E A;  4F0C A;  2LRN A;  3TKP A;  3KM6 A;  3NOF A;  3KP8 A;  6GSW A;  4WET A;  1Y6E A;  2E0Q A;  3HXS A;  3VLN A;  3GIX A;  2V1M A;  3GKX A;  4X4J A;  1PFO A;  4WEY A;  4PQI A;  2F9S A;  1SJZ A;  3DRN A;  2AHE A;  1GSE A;  5DAL A;  1AQV A;  1OYJ A;  3L4N A;  5CRD A;  4O5R A;  2JSZ A;  5COH A;  1O8X A;  4KF9 A;  1JLV A;  20GS A;  4F82 A;  3EU3 A;  2LST A;  4MZC A;  3FYG A;  2H74 A;  1XWK A;  4Z2T A;  3GA4 A;  1Z9H A;  2TRX A;  5G1K A;  4NXI A;  1WIK A;  5IQY A;  2H6Z A;  1FB0 A;  3LYP A;  3LYK A;  1FO5 A;  2G2Q A;  4FO5 A;  2Z9S A;  5E4W A;  2JZT A;  3W8S A;  3GX8 A;  3QFB C;  4PQ1 A;  5GST A;  3SBC A;  3G7Y A;  3GL3 A;  2VOC A;  1CQG A;  4POB A;  4BWQ A;  3F3R A;  1I5G A;  1K3O A;  1LJR A;  4G0K A;  4ULX A;  4XS4 B;  3WT1 A;  5AIX A;  1T1V A;  3CRU A;  4TKY A;  2GQL A;  2ZCT A;  4H86 A;  2L6D A;  4PX1 A;  1W4V A;  4P3Y B;  2WUL A;  3FZA A;  14GS A;  3D21 A;  1XFL A;  2C0G A;  2GZP A;  4KA0 A;  5KOW A;  3TRP A;  3UAP A;  1JFU A;  3F3Q A;  5DAL B;  2X49 A;  3CTF A;  1A24 A;  3GN3 A;  3BCI A;  5D93 A;  1ZZY A;  3I69 A;  1U3A A;  1G6W A;  1OVN A;  4HI7 A;  2QSI A;  3RHC A;  4AGS A;  4DSS B;  1EEJ A;  2F8A A;  3APQ A;  2FWE A;  3DEX A;  1XZO A;  5IMD A;  1O85 A;  1O81 A;  3C7M A;  6GSY A;  1UVZ A;  4F9Z A;  4MK3 A;  4BL7 A;  3QD9 A;  1LBK A;  5EL8 A;  3KTL A;  1TXX A;  1TDI A;  3UBL A;  4ZB9 A;  2GSS A;  4K7I A;  5H5R A;  3IAM 2;  3US3 A;  1PD2 1;  2MMA A;  3UOM A;  3IR4 A;  3TJG A;  3APO A;  3IHG A;  2UZ8 A;  4KX4 A;  2A2P A;  3LXZ A;  2HRN A;  2H75 A;  2LQQ A;  2XBQ A;  4GXZ A;  1Y25 A;  2JU5 A;  4WXT A;  2C3N A;  3HD5 A;  2I81 A;  4JBB A;  1XVW A;  5ECR B;  2F51 A;  3OR5 A;  4ECJ A;  2EIR A;  3J7Y b;  3CSH A;  4ECI A;  3IPZ A;  3LGC A;  3W6G A;  4WBR D;  4K0N A;  2YCD A;  2GVP A;  3CYN A;  2XC2 A;  2CT6 A;  1H75 A;  2FHE A;  2DBC A;  5HFK A;  4MA9 A;  4RI7 A;  2AJQ B;  2JZS A;  3D22 A;  3A3T A;  5IMV A;  3IK9 A;  4FYB A;  4J57 E;  1K0A A;  4XTS A;  2M46 A;  2LKU A;  3ZML A;  3KXO A;  1FVJ A;  1R7H A;  4YKG A;  2E2M A;  4BL7 B;  4E8E A;  3C73 A;  4O32 A;  1V58 A;  2DIZ A;  5H5S A;  3KMN A;  2C1Y A;  2LV3 A;  1QUW A;  5ELG A;  3O76 A;  4JE1 A;  1B4P A;  2DLX A;  4EIQ A;  2V41 A;  4MP4 A;  4L8E A;  3DD3 A;  2C0D A;  2P0G A;  5J4U A;  4IEL A;  2BMX A;  2YJH A;  2PGT A;  2H76 A;  2I4A A;  2JL4 A;  3NIV A;  3D4M A;  3P7X A;  5J9C A;  1XXU A;  2JZR A;  2I3Y A;  1YZX A;  2NBS A;  2H66 A;  4Z7X A;  3JCM L;  5DQS A;  3QMX A;  3TJB A;  2B3S A;  3PGT A;  2VCT A;  8GSS A;  2XHF A;  1MDK A;  2QA1 A;  2GSR A;  2XBI A;  2YN1 A;  3HJM A;  2X4A A;  5BRT A;  2MMZ A;  3O6T A;  2RII A;  3HJO A;  4HU7 A;  1GRX A;  2HLS A;  1TOF A;  2MMO A;  3F4R A;  1SJ6 A;  4NPB A;  2AV4 A;  1M9A A;  3TKQ A;  5EPF A;  3HY2 A;  3ME8 A;  4LLR A;  1EP8 A;  3PIN A;  4MDC A;  3QDN A;  4V2N A;  4E8H A;  4Z2U A;  4CY6 A;  2GST A;  1K3L A;  4XS6 A;  3H8Q A;  3LEF A;  1THO A;  4V2M A;  1WE0 A;  2HE3 A;  2NDO A;  4X0X A;  4K1F A;  1SU9 A;  2IIY A;  3RPN A;  1XPV A;  2KP2 A;  1Z6M A;  2VIM A;  3KMO A;  1GUM A;  1USB A;  4MNN A;  2B1L A;  3GNJ A;  1XCC A;  3ERF A;  1MTC A;  3DGQ A;  3U5R E;  3L9S A;  3R3E A;  2LUS A;  1K0C A;  4CHS A;  1TK5 B;  2CAI A;  2ALB A;  4L5L A;  2MZC A;  1O8W A;  3FHK A;  3KD0 A;  1SL2 B;  3G7J A;  12GS A;  5ECI B;  3WT2 A;  1N2A A;  3F6F A;  4QL9 A;  2FWG A;  5LD0 A;  3ME7 A;  1M2B A;  3KTB A;  3M1G A;  5HR3 A;  5DJM A;  3GTU B;  3IV4 A;  4IGJ A;  2GGT A;  5ENU A;  4PUF C;  2YWN A;  5J41 A;  1S3A A;  1XOB A;  2PWJ A;  1QQ2 A;  2FD3 A;  3D5J A;  2CZ2 A;  3E0U A;  3HZ4 A;  2FWF A;  3DML A;  1ZGN A;  1K0N A;  3ZLP A;  1IYH A;  2VO4 A;  1A0R P;  1OC3 A;  1G0T A;  4PNG A;  4KH7 A;  4KAE A;  1AQX A;  4NHZ A;  4MAB A;  1Z3E A;  17GS A;  1OE8 A;  1AUC A;  4AJ6 A;  4EC0 A;  1XW5 A;  1PX6 A;  1M2A A;  1A2L A;  4YH2 A;  1KTE A;  3GSS A;  3A5W A;  2YV7 A;  2VM2 A;  2DIY A;  2OE3 A;  2I1U A;  3FY7 A;  1TKD B;  4POM A;  4ZB6 A;  2A4H A;  3L78 A;  1I9D A;  5CNW A;  4IBP A;  3MAK A;  1XIY A;  1JZD A;  5A4W A;  4ECB A;  2IJY A;  16GS A;  3IDV A;  4V1A p;  1QMV A;  4ID0 A;  5C04 A;  1SL1 B;  1EGO A;  4Q5Q A;  2LNS A;  3FK8 A;  3A2X A;  4YKF A;  3HVX A;  4N11 A;  5KEJ A;  3S9F A;  3IE3 A;  6GSU A;  2X99 A;  2K9F A;  3EMX A;  1ZYP A;  1VF4 A;  4GTU A;  1TK0 B;  1XWC A;  5D9W A;  2R0P A;  3F4S A;  4K8M A;  1ABA A;  1YKC A;  1M3J A;  2O85 A;  5D8I A;  2CA8 A;  1EP7 A;  2DJ0 A;  3FW2 A;  2FLS A;  3F0I A;  2IPA A;  1GTU A;  5IMZ A;  2LJA A;  6GSX A;  5F8B A;  4PXO A;  4I2U A;  1BAY A;  4OD7 A;  2WDU A;  2OAD A;  5CO3 A;  2B7J A;  3KCM A;  2H0I A;  3UEM A;  1ERU A;  2IMI A;  2PER A;  3UMA A;  5LCZ A;  1NSW A;  2F8F A;  3VWU A;  2V2G A;  4IJI A;  3W8J A;  5G30 A;  5A4V A;  1VF1 A;  2L5L A;  1R26 A;  4K2X A;  4I6X A;  2ZUP A;  4QQ7 A;  1MEK A;  3EPT A;  3HDC A;  3GRX A;  4XIH A;  1S3C A;  1TP9 A;  2HRA A;  2HSY A;  1J0F A;  4RUV A;  3RDW A;  4HS1 A;  3H93 A;  4ZBB A;  4JZQ A;  2IMF A;  3TRX A;  2WB9 A;  4KCE A;  4PNF A;  2R6K A;  1SK0 A;  4I8B A;  4DEJ A;  1EOG A;  3RBT A;  1Z6N A;  2DJK A;  5EVO A;  2RUE A;  2GT5 A;  1EEM A;  2AB6 A;  3A2V A;  2V6K A;  1QXH A;  3TJK A;  1NHY A;  4POK A;  1T7P B;  5KN3 A;  2E7P A;  2HRF A;  3ZFB A;  2WRT A;  2VL3 A;  5ECO B;  3C1S A;  3VUR A;  4GWR A;  2DJ3 A;  3HCZ A;  3DXB A;  1SD8 A;  3CQF A;  3TKR A;  3DIE A;  3IK7 A;  2WFC A;  5J3R A;  2L4Q A;  2FNO A;  4ZL8 A;  2O89 A;  2RUF A;  4HZ4 A;  1BG5 A;  2B5Y A;  4LMW A;  2IMD A;  3WGE A;  2YWO A;  2HNL A;  1ZYN A;  3WYW A;  2N5F A;  2B7K A;  2VUP A;  2QC7 A;  1F3A A;  4ACS A;  4ZBA A;  3C71 A;  1YKA A;  3HYP A;  3ZVJ A;  1ACV A;  1FOH A;  2VL2 C;  4G2E A;  1TW9 A;  1CQH A;  1TI3 A;  4EL1 A;  4N30 A;  4USS A;  3EWL A;  2KLX A;  5LNK e;  3MSZ A;  4BPY A;  4MCU A;  4MF5 A;  2FGX A;  5HR0 A;  3U6V A;  3A5I A;  5G2Z A;  1M0U A;  1IYI A;  5J5N A;  19GS A;  1PQN A;  3QAW A;  2H8L A;  1LU4 A;  2VD1 A;  4MJB A;  2JSY A;  4BWS A;  2LJK A;  3BCK A;  1SKW B;  4GCI A;  4Q5F A;  3I9V 2;  3KZQ A;  3CXG A;  1KEB A;  4G19 A;  3V1W A;  1SKR B;  1TU7 A;  5D73 A;  3ZVJ D;  4XCS A;  1GP1 A;  4IHU A;  4GSN A;  2FY6 A;  5B6N A;  1YJ6 A;  1N8J A;  4CY8 A;  3HJP A;  4BIK A;  5ABR A;  2LTK A;  4EVM A;  2C0F A;  1C72 A;  2N5A A;  3F6D A;  3LG6 A;  3VWV A;  5F06 A;  3EUR A;  3F8U A;  3GKK A;  4PGT A;  4D73 A;  3DKS A;  2LEG A;  2B6M A;  5CRH A;  3BD2 A;  4AJ7 A;  2TIR A;  3TOU A;  1KBN A;  3VI5 A;  1F37 A;  2PUK C;  4CDO A;  5G1L A;  1UN2 A;  3M9K A;  2GLR A;  2XPD A;  3UJ1 A;  3E3E A;  4L5O A;  3TRQ A;  2MYG A;  1YF0 A;  5F0G A;  2OE1 A;  3KGK A;  2YAN A;  1ML6 A;  2K8V A;  4KSO A;  1PL1 A;  3BBY A;  4KSM A;  3PPU A;  4OFM A;  1GSU A;  4PUR A;  4GST A;  4WKW A;  2GQM A;  2FA4 A;  1F3B A;  4ZL9 A;  5D96 A;  2IFQ A;  1YY7 A;  5B8A A;  9GSS A;  3HA9 A;  2GDR A;  2X8G A;  3ZMK A;  5D9T A;  1HQO A;  2HFD A;  3A2W A;  4X1U A;  2G0F A;  4G9H A;  2FUG 2;  1O7U A;  1TTZ A;  1GTB A;  5L71 A;  3RHB A;  1SJI A;  3P8W A;  1JLW A;  2MBT A;  1DBY A;  2VLT A;  2HI7 A;  3CMI A;  1JZR A;  3ZL5 A;  4PTS A;  3P90 A;  4O5U A;  4D73 B;  3HVV A;  1M9B A;  4IJ3 A;  13GS A;  3UVT A;  3QCP A;  2H1B A;  5CRW A;  3LXT A;  1XW6 A;  5DAK A;  4MPF A;  3AY8 A;  4F03 A;  1JZO A;  2OKA A;  2D2Z A;  1BX9 A;  1MDJ A;  3LFL A;  2DSA A;  4GSS A;  1UA5 A;  4IP6 A;  1JHB A;  3EC3 A;  3MNG A;  2CQ9 A;  5ECN B;  4EE0 A;  1PRX A;  1XOA A;  3ED3 A;  1F6M C;  3I6A A;  1OKT A;  4KDY A;  3ISO A;  5CYY A;  1GTA A;  3M0F A;  2CV4 A;  4MPG A;  1DE2 A;  2ES7 A;  2IFQ B;  3APS A;  4EUY A;  1ZL9 A;  2L57 A;  1T3B A;  4MJA A;  4OCE A;  1NW2 A;  4KW6 A;  1K0M A;  4KUN A;  4IVF A;  1SK2 A;  1U87 A;  3UL3 A;  2CVB A;  1ZYQ B;  2PVQ A;  1THX A;  1VRS D;  4RQR A;  18GS A;  1SD9 A;  3TKS C;  2IL3 A;  5CAX A;  1WRY A;  4ICY A;  2CVD A;  1SK1 A;  4MH2 A;  4HSC X;  1WMJ A;  2R5G A;  4ZIJ A;  1XVQ A;  3TOT A;  4LA1 A;  3EU4 A;  3QAV A;  4KDX A;  2VD0 A;  5JWR B;  1TK8 B;  5DJL A;  1YQ1 A;  4AJ8 A;  3CRT A;  4ZIL A;  4ZB8 A;  2C4J A;  3KIJ A;  2H30 A;  2L59 A;  1M7T A;  2YZU A;  2A2S A;  3C1R A;  3L0H A;  5G5F A;  3FMW A;  1FG4 A;  2YP6 A;  3GMF A;  2C3Q A;  2HXK A;  2VLV A;  1EGR A;  2B5X A;  4WF5 A;  5IPG A;  5IMC A;  4HU9 A;  1AIU A;  1F9M A;  1M3I A;  1U3I A;  4J2F A;  3HVS A;  2XPE A;  5B8B A;  2E2G A;  3EVI A;  3DWV A;  1MD3 A;  1OAZ A;  3Q19 A;  3N5O A;  3TUE A;  1WJK A;  2JAC A;  1F2E A;  2OAC A;  3IXR A;  4TXO A;  4HJ2 A;  2A2R A;  2ON7 A;  4JR4 A;  1M2D A;  1ERV A;  5INY A;  1X9S B;  1V2A A;  5DDL A;  2WCI A;  3Q6O A;  5BMU A;  3HKR A;  2R0G A;  3GUR A;  1GL8 A;  1PL2 A;  2RLI A;  4YAV A;  4IW9 A;  4XRA A;  1PGT A;  2GQK A;  5IO2 A;  6GSV A;  4JU5 A;  4K2D A;  2VM1 A;  4L0W A;  4EXJ A;  1K0D A;  3WGX A;  2OA7 A;  3ZIV A;  4GQF A;  5ID2 A;  3TJF A;  4XS1 A;  4KCA A;  5DCH A;  2LS5 A;  4NMU A;  6GSS A;  2H71 A;  2V32 A;  2KOK A;  2AAW A;  2R3X A;  2NVL A;  3GUS A;  5JCW A;  2RM6 A;  4FYU A;  4GLT A;  1TRS A;  1ZMA A; 
#chains in the Genus database with same CATH homology
 2A4V A;  3D0Z A;  2P31 A;  5JCG A;  5AIV A;  1G6Y A;  3UVH A;  5DCG A;  1QK8 A;  2YWM A;  4BVY A;  4MF6 A;  2CZ3 A;  2ON5 A;  4ILF A;  1DE1 A;  1X5C A;  4IP1 A;  3KEB A;  5C00 A;  5HFI A;  4EDZ A;  2GZY A;  1O6J A;  2PPT A;  5IM9 A;  3QPM A;  2VCV A;  2HSH A;  4IN0 A;  3CBU A;  4K9Z A;  4ML1 A;  2QGV A;  2WJU A;  2LNT A;  1K0O A;  2J23 A;  2K18 A;  3KH7 A;  1NHO A;  4LL4 B;  1X9W B;  2HZE A;  3FR9 A;  3I43 A;  2YPM A;  1OC8 A;  4EF0 A;  1A2J A;  3MIX A;  1SL0 B;  2HYX A;  4K7N A;  2YNX A;  4Q5R A;  1PKW A;  1TRW A;  4NV5 A;  1BJX A;  2X8C A;  4OFT A;  2DJJ A;  4N0V A;  1R4W A;  5ID2 B;  2B5E A;  1BYE A;  4LL1 B;  1GSF A;  5AGY A;  1Q98 A;  1TRV A;  1FVK A;  3BJ5 A;  3GKM A;  2KHP A;  3KJY A;  2H70 A;  1AXD A;  4BVY B;  4TRX A;  5JWO B;  2H1G A;  4OFN A;  2WZ9 A;  5F07 A;  1ERT A;  3GV1 A;  3M9J A;  4MZB A;  4KND A;  5KN2 A;  4POL A;  4HQS A;  2O87 A;  1OE7 A;  1G7O A;  5A4U A;  1YEP A;  1T4Z A;  3RAZ A;  1SKS B;  1WP0 A;  2HT9 A;  1FB6 A;  2EC4 A;  2DML A;  2LQO A;  1RK4 A;  1GSQ A;  2R4V A;  3TKS E;  2HZE B;  5GSS A;  3LQ7 A;  1SYX A;  2YOI A;  1B9Y C;  2BTO T;  2VL2 A;  2N5B A;  2CX4 A;  1AQW A;  2VLU A;  3GX0 A;  1A23 A;  1B9X C;  3FR6 A;  1Q4J A;  2MMN A;  2H73 A;  3QAG A;  4XS4 A;  4F0B A;  3G7I A;  1FW1 A;  4MZW A;  1YEX A;  4K5S A;  1HNA A;  2FWH A;  4YQM A;  1GUK A;  3LJR A;  3TGZ A;  2GT6 A;  3FEU A;  4EKZ A;  4HOJ A;  3BOA A;  3DVW A;  5IMF A;  3TJJ A;  1NM3 A;  2REM A;  1TRU A;  2V6O A;  2GZZ A;  4MH3 A;  4PQH A;  1PKZ A;  5H5Q A;  4V2L A;  2HZF A;  4K0G A;  1PSQ A;  1X5D A;  4JR6 A;  1GH2 A;  5HFG A;  4TR0 A;  3K8N A;  4FQU A;  4CW9 A;  4I5Q A;  4GQC A;  2H6Y A;  3VPQ A;  4DSS A;  5CP1 A;  3MYD A;  1GSY A;  2AYT A;  5CRE A;  4IQA A;  4XHM A;  1ZCP A;  4G0I A;  1J9B A;  3F63 A;  3ZYW A;  2K6V A;  3ERG A;  4DVC A;  3D6I A;  2DC5 A;  1RW1 A;  3IC4 A;  2YZH A;  11GS A;  4ISD A;  4WR4 A;  5KN0 A;  4RI6 A;  1GLP A;  1H4O A;  3PH9 A;  4XRD A;  4OO4 A;  4KE3 A;  4MMM A;  2O7K A;  3LSZ A;  1SEN A;  2DMM A;  3EE2 A;  1HNB A;  1GUH A;  1ERW A;  3ZRE A;  4ZL7 A;  2P5R A;  1YDK A;  2H1D A;  4MJE A;  1JZW A;  3WD6 A;  2NTO A;  5A5K A;  6GST A;  1Z7R A;  5ECH B;  4TR4 A;  3ZRD A;  2LRT A;  1PN0 A;  1EV9 A;  5FT3 A;  5GZZ B;  5JCU A;  4RQX A;  4KGI A;  5JWQ B;  3GYK A;  3FZ9 A;  4BA7 A;  4DSQ A;  2OBK A;  1M99 A;  1QGV A;  5J9B A;  2VAF A;  3KH9 A;  1X0R A;  4EO3 A;  4AF2 A;  1U88 A;  5HR2 A;  3IA1 A;  1XWG A;  2VCZ A;  3MDK A;  3C8E A;  2GTU A;  2H0H A;  3HZ8 A;  4NWY A;  3L9U A;  3IBH A;  3VWW A;  2I9H A;  2TRC P;  2IME A;  1R5A A;  2H01 A;  5IOX A;  4OCF A;  4KDU A;  1MD4 A;  1AAZ A;  4KB3 A;  5HR1 A;  3IRA A;  5ECP B;  4HEA 2;  1A2M A;  1J08 A;  1BQ7 A;  4MJC A;  1K0B A;  1UC7 A;  2PVO C;  4OWY A;  10GS A;  3UBK A;  4NAX A;  3TDG A;  3TB2 A;  5B6M A;  1B4Q A;  5HQP A;  2DKI A;  2R0C A;  2VCQ A;  1PMT A;  4OO5 A;  4WR5 A;  4TR1 A;  4IS0 A;  4IQ1 A;  2J9H A;  3FR3 A;  1V40 A;  1G7E A;  2H0G A;  1VF3 A;  2IMK A;  1X9M B;  3NZN A;  2QKE A;  4LMV A;  4L0U A;  4WBJ A;  3H1N A;  4TXV A;  5ECQ B;  2BJX A;  1GSS A;  1RQM A;  4MF7 A;  2FA8 A;  1R5P A;  1K3Y A;  2PU9 C;  5IMA A;  3FRC A;  4N10 A;  4JED A;  1GLQ A;  5F05 A;  2P5Q A;  1EZK A;  4JRR A;  1X5E A;  3UAR A;  1GWC A;  5G31 A;  3TKS A;  2C3T A;  4ECC A;  5D9V A;  1TJD A;  2IN3 A;  2K8S A;  1T8E B;  4K5R A;  5E59 A;  4HZ2 A;  4ZBD A;  3H79 A;  3PR8 A;  1HNC A;  2JAD A;  1MDI A;  3QOU A;  2M80 A;  3UIW A;  4PUA A;  2H1A A;  5ECM B;  5B7C A;  2OBI A;  1SYR A;  3QFA C;  3ZTL A;  1GTI A;  2M72 A;  4TR1 B;  3Q18 A;  4K6X A;  3GH9 A;  4A5P A;  4GRF A;  1VGL A;  1URM A;  3LWA A;  5IIZ A;  3KP9 A;  3ZIJ A;  1OKD A;  3CTG A;  3E9J B;  4DSR A;  2GS3 A;  4FIW A;  2PN8 A;  3FZ4 A;  1V98 A;  3TCO A;  2LJR A;  5KN1 A;  4G10 A;  1U6T A;  1EV4 A;  3CSJ A;  5DVB A;  3GTU A;  5ECS A;  2R37 A;  3RPP A;  4NHW A;  2YV9 A;  5DQY A;  3D4T A;  3G9B A;  1W89 A;  4EIP A;  1PN9 A;  2WGR A;  5DAK B;  5FWG A;  4ML6 A;  1ILO A;  2L5O A;  5G5E A;  1A8L A;  5AIS A;  4I97 A;  4MLY A;  3WGD A;  3IAS 2;  3IHQ A;  1EOH A;  1FHE A;  3VK9 A;  1ZYE A;  2O8V B;  3ZIT A;  1O73 A;  3GL5 A;  3SWL A;  3VI7 A;  4V1A g;  3IC8 A;  5IPH A;  2F3M A;  1B8X A;  1Z5Y E;  5AN1 A;  4TR3 A;  2DJ1 A;  3Q74 A;  5FHI A;  2PMT A;  2VL9 A;  4GF0 A;  4YQV A;  5KOX A;  1DUG A;  2PBJ A;  3VPT A;  2FCH A;  3FZ5 A;  4I2T A;  1FAA A;  1GSD A;  4O5Q A;  4EDY A;  3F9U A;  1Z7P A;  2X8H A;  1E2Y A;  2YWI A;  1HYU A;  3DVX A;  2MBS A;  3EMP A;  3IOS A;  1XWB A;  7GSS A;  3M3M A;  3J7Y k;  3GST A;  5IOW A;  4Q5N A;  5EY6 A;  1ZOF A;  4TN8 A;  1TU8 A;  4TW5 A;  1XBS A;  2H19 A;  3H4K A;  1XWA A;  1GUL A;  4K7O A;  3GH6 A;  1YF1 A;  1S3D A;  22GS A;  4O7H A;  4ZXG A;  1V57 A;  3GHA A;  4TVE A;  1B48 A;  1ON4 A;  4TOP A;  4BVX A;  3R2Q A;  4HJM A;  2VCW A;  2HSM A;  2H72 A;  1A0F A;  1WOU A;  2OJL A;  2L6C A;  4J56 E;  4N0Z A;  1OC9 A;  1AW9 A;  4TXO B;  2H6X A;  2WS2 A;  4Z2R A;  3MWH A;  2CX3 A;  2X64 A;  1WWJ A;  4QL7 A;  3N9J A;  5ELA A;  4YAP A;  1VF2 A;  3CSI A;  3LOR A;  4HQZ A;  4O92 A;  4WF4 A;  3M8N A;  2C8U A;  5GAN D;  2GSQ A;  2NPB A;  2RM5 A;  5ECK B;  4G0L A;  2IWT A;  3ZZX A;  1TI1 A;  1A8Y A;  2L4C A;  4HDE A;  5IO0 A;  2QA2 A;  3DYR A;  3VFI A;  4F2I A;  4OMV A;  2B1K A;  1GNE A;  4NV2 A;  1V9W A;  1AC1 A;  3VWX A;  5D9X A;  2EIQ A;  1PA3 A;  1FOV A;  2CAQ A;  3FKF A;  2KP1 A;  1ST9 A;  3QR6 A;  4X43 A;  5CRG A;  1XW9 A;  2CVK A;  4FYC A;  1WPI A;  4HUA A;  1DSB A;  4FH8 A;  4BVX B;  3HHV A;  2EIO A;  2YJ7 A;  1GNW A;  1T4Y A;  2ZNM A;  1PX7 A;  3P2A A;  1T00 A;  3EYT A;  2R2J A;  3L9V A;  3GKN A;  5GAP D;  1OC9 B;  3ZFL A;  2KUC A;  2DJ2 A;  1E6B A;  5DBQ A;  1BED A;  3O3T A;  1EWX A;  1HD2 A;  3F4T A;  4YQU A;  3EIN A;  2VCX A;  3ERW A;  2OE0 A;  5ECL B;  4IKH A;  2LRC A;  2HRK A;  3LW9 A;  2C80 A;  1KNG A;  2AUV A;  3GFK A;  1QFN A;  2DKH A;  2C0E A;  4F0C A;  2LRN A;  3TKP A;  3KM6 A;  3NOF A;  3KP8 A;  6GSW A;  4WET A;  1Y6E A;  2E0Q A;  3HXS A;  3VLN A;  3GIX A;  2V1M A;  3GKX A;  4X4J A;  4WEY A;  4PQI A;  2F9S A;  1SJZ A;  3DRN A;  2AHE A;  1GSE A;  5DAL A;  1AQV A;  1OYJ A;  3L4N A;  5CRD A;  4O5R A;  2JSZ A;  5COH A;  1O8X A;  4KF9 A;  1JLV A;  20GS A;  4F82 A;  3EU3 A;  2LST A;  4MZC A;  3FYG A;  2H74 A;  1XWK A;  4Z2T A;  3GA4 A;  1Z9H A;  2TRX A;  5G1K A;  4NXI A;  1WIK A;  5IQY A;  2H6Z A;  1FB0 A;  3LYP A;  3LYK A;  1FO5 A;  2G2Q A;  4FO5 A;  2Z9S A;  5E4W A;  2JZT A;  3W8S A;  3GX8 A;  3QFB C;  4PQ1 A;  5GST A;  3SBC A;  3G7Y A;  3GL3 A;  2VOC A;  1CQG A;  4POB A;  4BWQ A;  3F3R A;  1I5G A;  1K3O A;  1LJR A;  4G0K A;  4ULX A;  4XS4 B;  3WT1 A;  5AIX A;  1T1V A;  3CRU A;  4TKY A;  2GQL A;  2ZCT A;  4H86 A;  2L6D A;  4PX1 A;  1W4V A;  4P3Y B;  2WUL A;  3FZA A;  14GS A;  3D21 A;  1XFL A;  2C0G A;  2GZP A;  4KA0 A;  5KOW A;  3TRP A;  3UAP A;  1JFU A;  3F3Q A;  5DAL B;  2X49 A;  3CTF A;  1A24 A;  3GN3 A;  3BCI A;  5D93 A;  1ZZY A;  3I69 A;  1U3A A;  1G6W A;  1OVN A;  4HI7 A;  2QSI A;  3RHC A;  4AGS A;  4DSS B;  1EEJ A;  2F8A A;  3APQ A;  2FWE A;  3DEX A;  1XZO A;  5IMD A;  1O85 A;  1O81 A;  3C7M A;  6GSY A;  1UVZ A;  4F9Z A;  4MK3 A;  4BL7 A;  3QD9 A;  1LBK A;  5EL8 A;  3KTL A;  1TXX A;  1TDI A;  3UBL A;  4ZB9 A;  2GSS A;  4K7I A;  5H5R A;  3IAM 2;  3US3 A;  1PD2 1;  2MMA A;  3UOM A;  3IR4 A;  3TJG A;  3APO A;  3IHG A;  2UZ8 A;  4KX4 A;  2A2P A;  3LXZ A;  2HRN A;  2H75 A;  2LQQ A;  2XBQ A;  4GXZ A;  1Y25 A;  2JU5 A;  4WXT A;  2C3N A;  3HD5 A;  2I81 A;  4JBB A;  1XVW A;  5ECR B;  2F51 A;  3OR5 A;  4ECJ A;  2EIR A;  3J7Y b;  3CSH A;  4ECI A;  3IPZ A;  3LGC A;  3W6G A;  4WBR D;  4K0N A;  2YCD A;  2GVP A;  3CYN A;  2XC2 A;  2CT6 A;  1H75 A;  2FHE A;  2DBC A;  5HFK A;  4MA9 A;  4RI7 A;  2AJQ B;  2JZS A;  3D22 A;  3A3T A;  5IMV A;  3IK9 A;  4FYB A;  4J57 E;  1K0A A;  4XTS A;  2M46 A;  2LKU A;  3ZML A;  3KXO A;  1FVJ A;  1R7H A;  4YKG A;  2E2M A;  4BL7 B;  4E8E A;  3C73 A;  4O32 A;  1V58 A;  2DIZ A;  5H5S A;  3KMN A;  2C1Y A;  2LV3 A;  1QUW A;  5ELG A;  3O76 A;  4JE1 A;  1B4P A;  2DLX A;  4EIQ A;  2V41 A;  4MP4 A;  4L8E A;  3DD3 A;  2C0D A;  2P0G A;  5J4U A;  4IEL A;  2BMX A;  2YJH A;  2PGT A;  2H76 A;  2I4A A;  2JL4 A;  3NIV A;  3D4M A;  3P7X A;  5J9C A;  1XXU A;  2JZR A;  2I3Y A;  1YZX A;  2NBS A;  2H66 A;  4Z7X A;  3JCM L;  5DQS A;  3QMX A;  3TJB A;  2B3S A;  3PGT A;  2VCT A;  8GSS A;  2XHF A;  1MDK A;  2QA1 A;  2GSR A;  2XBI A;  2YN1 A;  3HJM A;  2X4A A;  5BRT A;  2MMZ A;  3O6T A;  2RII A;  3HJO A;  4HU7 A;  1GRX A;  2HLS A;  1TOF A;  2MMO A;  3F4R A;  1SJ6 A;  4NPB A;  2AV4 A;  1M9A A;  3TKQ A;  5EPF A;  3HY2 A;  3ME8 A;  4LLR A;  1EP8 A;  3PIN A;  4MDC A;  3QDN A;  4V2N A;  4E8H A;  4Z2U A;  4CY6 A;  2GST A;  1K3L A;  4XS6 A;  3H8Q A;  3LEF A;  1THO A;  4V2M A;  1WE0 A;  2HE3 A;  2NDO A;  4X0X A;  4K1F A;  1SU9 A;  2IIY A;  3RPN A;  1XPV A;  2KP2 A;  1Z6M A;  2VIM A;  3KMO A;  1GUM A;  1USB A;  4MNN A;  2B1L A;  3GNJ A;  1XCC A;  3ERF A;  1MTC A;  3DGQ A;  3U5R E;  3L9S A;  3R3E A;  2LUS A;  1K0C A;  4CHS A;  1TK5 B;  2CAI A;  2ALB A;  4L5L A;  2MZC A;  1O8W A;  3FHK A;  3KD0 A;  1SL2 B;  3G7J A;  12GS A;  5ECI B;  3WT2 A;  1N2A A;  3F6F A;  4QL9 A;  2FWG A;  5LD0 A;  3ME7 A;  1M2B A;  3KTB A;  3M1G A;  5HR3 A;  5DJM A;  3GTU B;  3IV4 A;  4IGJ A;  2GGT A;  5ENU A;  4PUF C;  2YWN A;  5J41 A;  1S3A A;  1XOB A;  2PWJ A;  1QQ2 A;  2FD3 A;  3D5J A;  2CZ2 A;  3E0U A;  3HZ4 A;  2FWF A;  3DML A;  1ZGN A;  1K0N A;  3ZLP A;  1IYH A;  2VO4 A;  1A0R P;  1OC3 A;  1G0T A;  4PNG A;  4KH7 A;  4KAE A;  1AQX A;  4NHZ A;  4MAB A;  1Z3E A;  17GS A;  1OE8 A;  1AUC A;  4AJ6 A;  4EC0 A;  1XW5 A;  1PX6 A;  1M2A A;  1A2L A;  4YH2 A;  1KTE A;  3GSS A;  3A5W A;  2YV7 A;  2VM2 A;  2DIY A;  2OE3 A;  2I1U A;  3FY7 A;  1TKD B;  4POM A;  4ZB6 A;  2A4H A;  3L78 A;  1I9D A;  5CNW A;  4IBP A;  3MAK A;  1XIY A;  1JZD A;  5A4W A;  4ECB A;  2IJY A;  16GS A;  3IDV A;  4V1A p;  1QMV A;  4ID0 A;  5C04 A;  1SL1 B;  1EGO A;  4Q5Q A;  2LNS A;  3FK8 A;  3A2X A;  4YKF A;  3HVX A;  4N11 A;  5KEJ A;  3S9F A;  3IE3 A;  6GSU A;  2X99 A;  2K9F A;  3EMX A;  1ZYP A;  1VF4 A;  4GTU A;  1TK0 B;  1XWC A;  5D9W A;  2R0P A;  3F4S A;  4K8M A;  1ABA A;  1YKC A;  2O85 A;  5D8I A;  2CA8 A;  1EP7 A;  2DJ0 A;  3FW2 A;  2FLS A;  3F0I A;  2IPA A;  1GTU A;  5IMZ A;  2LJA A;  6GSX A;  5F8B A;  4PXO A;  4I2U A;  1BAY A;  4OD7 A;  2WDU A;  2OAD A;  5CO3 A;  2B7J A;  3KCM A;  2H0I A;  3UEM A;  1ERU A;  2IMI A;  2PER A;  3UMA A;  5LCZ A;  1NSW A;  2F8F A;  3VWU A;  2V2G A;  4IJI A;  3W8J A;  5G30 A;  5A4V A;  1VF1 A;  2L5L A;  1R26 A;  4K2X A;  4I6X A;  2ZUP A;  4QQ7 A;  1MEK A;  3EPT A;  3HDC A;  3GRX A;  4XIH A;  1S3C A;  1TP9 A;  2HRA A;  2HSY A;  1J0F A;  4RUV A;  3RDW A;  4HS1 A;  3H93 A;  4ZBB A;  4JZQ A;  2IMF A;  3TRX A;  2WB9 A;  4KCE A;  4PNF A;  2R6K A;  1SK0 A;  4I8B A;  4DEJ A;  1EOG A;  3RBT A;  1Z6N A;  2DJK A;  5EVO A;  2RUE A;  2GT5 A;  1EEM A;  2AB6 A;  3A2V A;  2V6K A;  1QXH A;  3TJK A;  1NHY A;  4POK A;  1T7P B;  5KN3 A;  2E7P A;  2HRF A;  3ZFB A;  2WRT A;  2VL3 A;  5ECO B;  3C1S A;  3VUR A;  4GWR A;  2DJ3 A;  3HCZ A;  3DXB A;  1SD8 A;  3TKR A;  3DIE A;  3IK7 A;  2WFC A;  5J3R A;  2L4Q A;  2FNO A;  4ZL8 A;  2O89 A;  2RUF A;  4HZ4 A;  1BG5 A;  2B5Y A;  4LMW A;  2IMD A;  3WGE A;  2YWO A;  2HNL A;  1ZYN A;  3WYW A;  2N5F A;  2B7K A;  2VUP A;  2QC7 A;  1F3A A;  4ACS A;  4ZBA A;  3C71 A;  1YKA A;  3HYP A;  3ZVJ A;  1ACV A;  1FOH A;  2VL2 C;  4G2E A;  1TW9 A;  1CQH A;  1TI3 A;  4EL1 A;  4N30 A;  4USS A;  3EWL A;  2KLX A;  5LNK e;  3MSZ A;  4BPY A;  4MCU A;  4MF5 A;  2FGX A;  5HR0 A;  3U6V A;  3A5I A;  5G2Z A;  1M0U A;  1IYI A;  5J5N A;  19GS A;  1PQN A;  3QAW A;  2H8L A;  1LU4 A;  2VD1 A;  4MJB A;  2JSY A;  4BWS A;  2LJK A;  3BCK A;  1SKW B;  4GCI A;  4Q5F A;  3I9V 2;  3KZQ A;  3CXG A;  1KEB A;  4G19 A;  3V1W A;  1SKR B;  1TU7 A;  5D73 A;  3ZVJ D;  4XCS A;  1GP1 A;  4IHU A;  4GSN A;  2FY6 A;  5B6N A;  1YJ6 A;  1N8J A;  4CY8 A;  3HJP A;  5ABR A;  2LTK A;  4EVM A;  2C0F A;  1C72 A;  2N5A A;  3F6D A;  3LG6 A;  3VWV A;  5F06 A;  3EUR A;  3F8U A;  3GKK A;  4PGT A;  4D73 A;  3DKS A;  2LEG A;  2B6M A;  5CRH A;  3BD2 A;  4AJ7 A;  2TIR A;  3TOU A;  1KBN A;  3VI5 A;  1F37 A;  2PUK C;  4CDO A;  5G1L A;  1UN2 A;  3M9K A;  2GLR A;  2XPD A;  3UJ1 A;  3E3E A;  4L5O A;  3TRQ A;  2MYG A;  1YF0 A;  5F0G A;  2OE1 A;  3KGK A;  2YAN A;  1ML6 A;  2K8V A;  4KSO A;  1PL1 A;  3BBY A;  4KSM A;  3PPU A;  4OFM A;  1GSU A;  4PUR A;  4GST A;  4WKW A;  2GQM A;  2FA4 A;  1F3B A;  4ZL9 A;  5D96 A;  2IFQ A;  1YY7 A;  5B8A A;  9GSS A;  3HA9 A;  2GDR A;  2X8G A;  3ZMK A;  5D9T A;  1HQO A;  2HFD A;  3A2W A;  4X1U A;  2G0F A;  4G9H A;  2FUG 2;  1O7U A;  1TTZ A;  1GTB A;  5L71 A;  3RHB A;  1SJI A;  3P8W A;  1JLW A;  2MBT A;  1DBY A;  2VLT A;  2HI7 A;  3CMI A;  1JZR A;  3ZL5 A;  4PTS A;  3P90 A;  4O5U A;  4D73 B;  3HVV A;  1M9B A;  4IJ3 A;  13GS A;  3UVT A;  3QCP A;  2H1B A;  5CRW A;  3LXT A;  1XW6 A;  5DAK A;  4MPF A;  3AY8 A;  4F03 A;  1JZO A;  2OKA A;  2D2Z A;  1BX9 A;  1MDJ A;  3LFL A;  2DSA A;  4GSS A;  1UA5 A;  4IP6 A;  1JHB A;  3EC3 A;  3MNG A;  2CQ9 A;  5ECN B;  4EE0 A;  1PRX A;  1XOA A;  3ED3 A;  1F6M C;  3I6A A;  1OKT A;  4KDY A;  3ISO A;  5CYY A;  1GTA A;  3M0F A;  2CV4 A;  4MPG A;  1DE2 A;  2ES7 A;  2IFQ B;  3APS A;  4EUY A;  1ZL9 A;  2L57 A;  1T3B A;  4MJA A;  4OCE A;  1NW2 A;  4KW6 A;  1K0M A;  4KUN A;  4IVF A;  1SK2 A;  1U87 A;  3UL3 A;  2CVB A;  1ZYQ B;  2PVQ A;  1THX A;  1VRS D;  4RQR A;  18GS A;  1SD9 A;  3TKS C;  2IL3 A;  5CAX A;  1WRY A;  4ICY A;  2CVD A;  1SK1 A;  4MH2 A;  1WMJ A;  2R5G A;  4ZIJ A;  1XVQ A;  3TOT A;  4LA1 A;  3EU4 A;  3QAV A;  4KDX A;  2VD0 A;  5JWR B;  1TK8 B;  5DJL A;  1YQ1 A;  4AJ8 A;  3CRT A;  4ZIL A;  4ZB8 A;  2C4J A;  3KIJ A;  2H30 A;  2L59 A;  1M7T A;  2YZU A;  2A2S A;  3C1R A;  3L0H A;  5G5F A;  3FMW A;  1FG4 A;  2YP6 A;  3GMF A;  2C3Q A;  2HXK A;  2VLV A;  1EGR A;  2B5X A;  4WF5 A;  5IPG A;  5IMC A;  4HU9 A;  1AIU A;  1F9M A;  1U3I A;  4J2F A;  3HVS A;  2XPE A;  5B8B A;  2E2G A;  3EVI A;  3DWV A;  1MD3 A;  1OAZ A;  3Q19 A;  3N5O A;  3TUE A;  1WJK A;  2JAC A;  1F2E A;  2OAC A;  3IXR A;  4TXO A;  4HJ2 A;  2A2R A;  2ON7 A;  4JR4 A;  1M2D A;  1ERV A;  5INY A;  1X9S B;  1V2A A;  5DDL A;  2WCI A;  3Q6O A;  5BMU A;  3HKR A;  2R0G A;  3GUR A;  1GL8 A;  1PL2 A;  2RLI A;  4YAV A;  4IW9 A;  4XRA A;  1PGT A;  2GQK A;  5IO2 A;  6GSV A;  4JU5 A;  4K2D A;  2VM1 A;  4L0W A;  4EXJ A;  1K0D A;  3WGX A;  2OA7 A;  3ZIV A;  4GQF A;  5ID2 A;  3TJF A;  4XS1 A;  4KCA A;  5DCH A;  2LS5 A;  4NMU A;  6GSS A;  2H71 A;  2V32 A;  2KOK A;  2AAW A;  2R3X A;  2NVL A;  3GUS A;  5JCW A;  2RM6 A;  4FYU A;  4GLT A;  1TRS A;  1ZMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...