4P3YB

Crystal structure of acinetobacter baumannii dsba in complex with ef-tu
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
181
structure length
181
Chain Sequence
SNAAGKDYTVIANPGKVEVPGKIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/oxidoreductase
molecule keywords Elongation factor Tu
publication title Structure of the Acinetobacter baumannii Dithiol Oxidase DsbA Bound to Elongation Factor EF-Tu Reveals a Novel Protein Interaction Site.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 66
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4p3yB00
4QL7A 1M2DA 1V57A 4OD7A 1ZYEA 3L4NA 3FR3A 4WR4A 1SJ6A 4KDYA 2CV4A 2ES7A 1VF2A 3FKFA 4TXOB 2KOKA 3UBLA 2GQLA 5J5NA 5H5SA 2EC4A 2XC2A 4LL1B 4ZILA 3VPQA 3TJFA 17GSA 2HSHA 3RAZA 4IQAA 1GTIA 5CAXA 1F9MA 5B6MA 4OMVA 4RI7A 5A4UA 4DSRA 4QQ7A 3DEXA 1XW5A 1K0MA 1N2AA 2IWTA 3GURA 2MMOA 5A5KA 4IS0A 3EWLA 2AUVA 5HQPA 1EP8A 1TU8A 3KTBA 3LWAA 4MJCA 2NPBA 4E8HA 2IMDA 4O5RA 2DJ2A 2R3XA 5KN2A 1OYJA 3Q19A 3VWWA 3US3A 1ERUA 3D22A 2PU9C 2JSYA 1DE1A 1EWXA 4TR0A 3ZFBA 4WBJA 4XHMA 1AC1A 3DXBA 3WGEA 3C1SA 4POBA 2VL2A 10GSA 5FT3A 5IMFA 1QMVA 2JL4A 3TB2A 4GWRA 1EV4A 1X9SB 4I8BA 5ECQB 3GRXA 5CNWA 3HJPA 1WPIA 3CMIA 1XBSA 2MZCA 1URMA 2LNSA 3DD3A 2J9HA 4MPFA 3WD6A 3IBHA 3QMXA 1A0FA 5JCWA 1IYIA 5B8BA 4PNFA 1R5PA 4Q5FA 5D9XA 3IK7A 3GKXA 1JZOA 2LTKA 1ERWA 2MYGA 4HI7A 1PL2A 2OA7A 3Q18A 2FA8A 4MA9A 3WYWA 4NPBA 4MH3A 4LL4B 4LMWA 1HYUA 1E2YA 2LRTA 3EMXA 3GSTA 2XHFA 2GQKA 3CYNA 4EC0A 3HJOA 3ZLPA 3C7MA 4ZBAA 2GSSA 3TDGA 2HT9A 1PN9A 4EDZA 2V41A 1TRWA 2RLIA 3GMFA 2CX3A 2JSZA 5GSSA 1FO5A 4NAXA 1PMTA 3IOSA 3TKPA 3LJRA 1NM3A 2VCTA 1TTZA 2CA8A 2IFQA 4XS6A 1IYHA 1OE7A 5D9WA 3ZFLA 3QR6A 1QK8A 2MBTA 4TR1A 1U87A 2M80A 5G5EA 3GX0A 4MF5A 3HKRA 5DQYA 1XOAA 3E3EA 1V2AA 3IV4A 4EDYA 2OE0A 4ZL7A 2P0GA 2FHEA 4IGJA 5IMAA 3F3RA 4KSOA 5IPGA 1WOUA 3AY8A 2H30A 3FY7A 4KAEA 5D9VA 1LBKA 3TJBA 4WETA 1XW9A 4KGIA 1MD3A 1A2LA 3TOUA 3H8QA 3KCMA 3LGCA 4NV2A 3GN3A 3P8WA 5AISA 1ST9A 4TR3A 3EU4A 6GSSA 1AXDA 4FH8A 1ZMAA 5JWOB 4HQZA 4F2IA 2ALBA 2HZEA 4WR5A 1SL0B 3DIEA 5IIZA 1GUHA 1KEBA 3KD0A 5C04A 1MDIA 4OO5A 4HOJA 2OJLA 5DAKA 4NWYA 2QGVA 3BOAA 3G7YA 3L9UA 3MDKA 2PERA 1PX7A 5DJMA 4KUNA 3IA1A 5CREA 1YF1A 2LV3A 1B8XA 4ILFA 4F82A 3SBCA 3VWVA 3PH9A 3ERGA 4F0BA 5F07A 3IPZA 2RM6A 2X8GA 1GLQA 4MZCA 4V2NA 2C3TA 4HEA2 3WGDA 1XWBA 1GL8A 4DSSB 2VUPA 1ZYQB 2LUSA 1PKWA 1Z5YE 5ECLB 1J08A 2K6VA 4GTUA 2HSYA 2GQMA 2WZ9A 1GULA 4I2UA 1ACVA 3CSIA 2QKEA 4LLRA 4ECJA 3UEMA 4ZBDA 4IN0A 1GSDA 1GSUA 2YPMA 2FWEA 1XWCA 2L6DA 1SKWB 1TXXA 3GH6A 3U5RE 3O3TA 1TU7A 1V58A 3VI5A 3ZMLA 4YH2A 5IO0A 4EL1A 1KNGA 2D2ZA 2EIOA 1TP9A 2F9SA 5CRWA 4D73B 4F9ZA 4IJIA 5HR0A 4QL9A 3DYRA 12GSA 1B9XC 4IVFA 2YJ7A 4WBRD 1F6MC 2H73A 3D4TA 5H5RA 4PQ1A 1CQHA 4HDEA 5CRHA 1BG5A 1EGRA 1TJDA 2P31A 5CP1A 3EU3A 2YP6A 2VCVA 1JZRA 4ZL8A 2GZPA 3LEFA 1O81A 2I4AA 4NMUA 1A8YA 5L71A 3VURA 1GH2A 2DLXA 2QSIA 4EXJA 1XVWA 2VOCA 1X5EA 1Q98A 4ZB9A 5HFKA 1R26A 5DALA 1B4PA 3RHBA 2WS2A 1H75A 1XOBA 1AQWA 5AGYA 1M9AA 3F3QA 1OC9B 3F4SA 4RUVA 2YOIA 3VK9A 4KCEA 3W6GA 4ID0A 1RQMA 2PUKC 3F6FA 14GSA 1G6WA 1UC7A 4YQVA 2AAWA 1ERVA 1XWAA 4D73A 3D4MA 4WF5A 2RUFA 5F05A 6GSUA 1FHEA 1GUMA 1T4YA 3N9JA 3FK8A 3HDCA 1X9WB 1EV9A 1OKDA 3A3TA 2IMEA 5G31A 3TJKA 4NV5A 4ACSA 2VAFA 1M99A 4GQFA 2BTOT 1OC8A 4N0VA 3UJ1A 3FZ5A 3O6TA 3D0ZA 2CVKA 5B6NA 2MMAA 4CW9A 3G7IA 1J9BA 2BMXA 5EPFA 1T7PB 3ZITA 1BEDA 3QOUA 3KTLA 1M0UA 2A2RA 1YF0A 3EINA 1K0NA 3QPMA 1X0RA 1BJXA 3GHAA 5ECSA 4IP1A 5KN0A 5IM9A 2C0DA 2I3YA 3A5WA 5B8AA 2GLRA 3L78A 3KMNA 3ERWA 4HU7A 1LJRA 3GL5A 3FW2A 2B7KA 3IHQA 3RHCA 4K7NA 2H74A 1M9BA 1H4OA 4JR4A 1TK8B 2IMFA 6GSYA 3GFKA 2A4VA 4ECCA 1R5AA 3KP8A 1Z3EA 3PGTA 3VI7A 4L0WA 3L0HA 2N5BA 4XIHA 4J2FA 1VRSD 4OFMA 2NTOA 2Z9SA 3HZ4A 4FYCA 2OADA 1X5CA 2P5QA 4KDXA 3GKMA 3ZTLA 4KA0A 2AB6A 2B3SA 2F3MA 2YWIA 1T8EB 2IMIA 4IHUA 2WCIA 2DJJA 3NOFA 3L9SA 4HQSA 4K1FA 3ZIVA 1XWGA 4X0XA 1Z7PA 1MTCA 1ZCPA 2B7JA 1TOFA 3C8EA 5F8BA 3P90A 3J7Yb 1PRXA 2YZUA 4KW6A 3HD5A 2H6YA 2YANA 1GNEA 1ABAA 5CYYA 2DMMA 2I9HA 4TR4A 4MJEA 2RUEA 3KMOA 2LRCA 2FLSA 3UMAA 3TRPA 1YEXA 4N11A 4G19A 1ON4A 3QDNA 3K8NA 1FB6A 3L9VA 2IFQB 3M1GA 2VLUA 3I69A 1R4WA 2VM1A 3EMPA 2FWHA 1OVNA 2VCWA 4BWSA 1FVKA 4TR1B 3KGKA 2NBSA 2KHPA 3TRQA 4JZQA 4KSMA 4O7HA 1GSFA 2JZRA 2VO4A 2O8VB 4F0CA 3GNJA 1WMJA 3A2XA 1G0TA 3HA9A 4BA7A 3LYPA 2LQQA 2VM2A 3TJGA 5DCHA 2BJXA 1K3OA 2GVPA 1Y25A 4JE1A 1SL1B 3LYKA 2X8CA 4H86A 2LQOA 5DVBA 4HJ2A 2H1DA 3ZYWA 2FGXA 1A23A 4JEDA 3CSHA 5ENUA 3RPNA 1EOGA 2H19A 4XS4A 2E2GA 1ZL9A 3P2AA 1MDJA 3D6IA 4MABA 4KE3A 2GSRA 5ABRA 1EP7A 4Z7XA 2CT6A 1DBYA 1JZDA 3LXTA 1X5DA 6GSXA 3V1WA 2HZEB 4FO5A 3P7XA 2AHEA 2PBJA 3LG6A 1TDIA 4TN8A 3TCOA 5KN3A 3EURA 4FYUA 4IP6A 2LNTA 3HHVA 2KUCA 2H76A 5DAKB 4XRAA 1HQOA 2ZCTA 4N0ZA 5F0GA 2H72A 1GWCA 5D96A 2YN1A 2V2GA 1EZKA 5FHIA 2OBIA 5ELGA 1V98A 3MNGA 4IBPA 2OBKA 2WULA 1E6BA 3M9KA 2XPDA 1MDKA 4HZ4A 2DJ0A 1KBNA 2QC7A 3DKSA 2DJ1A 2JZTA 1HNBA 4WF4A 2E7PA 2FNOA 2I1UA 1SK0A 2FY6A 1K0CA 5HR1A 4DEJA 1AQVA 4MF7A 2DC5A 1V9WA 2VIMA 4MMMA 1OAZA 3HZ8A 3DGQA 5FWGA 2OE3A 5DJLA 3KH7A 3LXZA 3UAPA 5COHA 2MBSA 1K0AA 2CZ2A 1AUCA 3TKQA 2E2MA 1WRYA 2EIQA 2VLTA 3CRTA 1ZZYA 3VPTA 4CDOA 5ECNB 2X99A 1W89A 1Z7RA 4GSTA 1EEMA 2FD3A 4JBBA 5H5QA 2R5GA 2WRTA 3IR4A 2VCXA 3ERFA 4K8MA 1PKZA 4FIWA 5ECHB 3HY2A 2TIRA 8GSSA 2K18A 1QQ2A 3U6VA 3FHKA 4Q5NA 5B7CA 5IMVA 3F8UA 1TI1A 3QD9A 4OFTA 4EKZA 2LJRA 1XCCA 3FEUA 1XZOA 4EVMA 2M72A 3UBKA 4PQIA 3E0UA 1FW1A 2FCHA 5DCGA 3HCZA 2R37A 3APQA 3ZRDA 4MDCA 3J7Yk 5ECOB 4ML6A 4MLYA 1QXHA 4KCAA 2X8HA 5EY6A 1XFLA 1G7OA 3Q74A 4XS1A 5LCZA 2IL3A 3H93A 4ZL9A 1GTBA 3GTUB 2H1AA 1N8JA 4L8EA 4ZXGA 5HR2A 2L59A 1WIKA 2GGTA 1O85A 2GT6A 2IN3A 1FB0A 1GTUA 3ZMKA 5DALB 1GSYA 2CVDA 2WFCA 3WT1A 4V2LA 5IPHA 1TI3A 1R7HA 2TRXA 2OACA 3H79A 3BCKA 1SYRA 1YY7A 1RW1A 3CXGA 1SYXA 4O92A 19GSA 4L0UA 5J3RA 4BVYA 4RQRA 5D9TA 18GSA 1TRUA 2GSQA 2H75A 3ME7A 4GCIA 4PQHA 3W8SA 2WDUA 4POMA 1NSWA 2AJQB 3KH9A 4EF0A 5J4UA 3APSA 5IOXA 1A0RP 2JZSA 2HE3A 1T4ZA 1GTAA 3GKKA 2OE1A 3H1NA 1C72A 2L57A 1SKSB 4ULXA 3I9V2 4ECBA 2KLXA 1SKRB 1SD8A 4GQCA 2XBIA 2KP1A 3EE2A 1VGLA 1XVQA 4CHSA 3IK9A 1Y6EA 13GSA 2PN8A 4I6XA 2JACA 2C0GA 2V32A 1T3BA 2TRCP 1B4QA 3GTUA 5IMDA 2B5EA 4ZB8A 1FG4A 1AAZA 4XTSA 2I81A 1A24A 3IE3A 2VCZA 1U6TA 2R4VA 4BPYA 4IELA 4PUFC 5LD0A 1WE0A 4AJ8A 1WJKA 3RPPA 3LSZA 5CRDA 1M7TA 3GSSA 3WT2A 2H0HA 4MJBA 3JCML 5G2ZA 3KJYA 3QFAC 3C73A 2L4QA 3TKSE 2GS3A 5JWRB 1VF1A 3ZIJA 3GH9A 2AYTA 2HNLA 1B48A 1SJZA 3GA4A 1XXUA 4HU9A 3IDVA 3TUEA 3C1RA 4V1Ag 3BD2A 2CAQA 4K2DA 4IQ1A 5D8IA 2IPAA 2VL3A 1FOVA 2F51A 2YNXA 2E0QA 4KX4A 4EO3A 2IIYA 2YV9A 3QAGA 3MSZA 3BJ5A 3SWLA 3M0FA 3UVTA 1XW6A 5JCGA 6GSVA 3VFIA 1W4VA 1GSQA 3QCPA 3ME8A 5DBQA 5GAND 1G7EA 2P5RA 2DJ3A 1V40A 2HI7A 3UVHA 4Q5RA 1THOA 1ZOFA 1GP1A 1EEJA 4RQXA 4ZB6A 4ZBBA 2LEGA 3VWUA 1PSQA 5IO2A 1A2MA 2PPTA 4ZIJA 2XBQA 2HZFA 3TKSC 2IMKA 2WJUA 1U88A 4LMVA 5IMZA 2H6ZA 1QUWA 2B5YA 3D21A 2K8SA 4ISDA 2CZ3A 2PGTA 4G10A 5AIXA 3F9UA 5E4WA 1NHOA 3TRXA 2L4CA 5INYA 4P3YB 3E9JB 2B1KA 4TOPA 5HFIA 4V2MA 4PURA 3R2QA 2DIZA 1BYEA 5G30A 2IJYA 2C80A 1M2BA 4O32A 1SJIA 3DVWA 4N30A 2VD1A 3QFBC 4PNGA 3GYKA 2C4JA 1YDKA 5CRGA 11GSA 4MPGA 1TKDB 3FZ9A 5EL8A 4L5LA 16GSA 2EIRA 1K0BA 4MZWA 5C00A 2FUG2 4K7OA 4KNDA 2LS5A 3FZAA 2H71A 2RM5A 3BCIA 3GL3A 1AIUA 1B9YC 5F06A 7GSSA 2C0FA 4XS4B 4TRXA 2B5XA 1YEPA 2GDRA 2H1BA 1WP0A 3M8NA 9GSSA 1M2AA 1AW9A 1GNWA 3TOTA 4HJMA 1MEKA 1Z9HA 3EC3A 1PD21 1I9DA 4MZBA 1A2JA 3FR9A 1AQXA 4MF6A 2B1LA 1TW9A 3D5JA 5A4VA 1K3LA 1SENA 4NHZA 1Q4JA 1T1VA 5ID2B 1EOHA 5KEJA 3MWHA 2H66A 4X43A 4BVXA 4NHWA 3Q6OA 4MH2A 2O85A 5ECMB 4E8EA 3HVVA 1Z6MA 3CSJA 3HVXA 4K0NA 2R2JA 2ZUPA 2HXKA 2DBCA 2GZZA 3ISOA 4JU5A 4TXOA 2K9FA 2FWGA 5J41A 2H0GA 3EYTA 1WWJA 3I43A 4TW5A 4GSSA 2LKUA 1I5GA 2WGRA 4JRRA 5GAPD 3IAM2 4TXVA 5DQSA 4IW9A 4OO4A 1HD2A 2O89A 5KN1A 2V6OA 2KP2A 5E59A 1S3DA 2M46A 3UL3A 3HYPA 4GSNA 1DUGA 1GUKA 1KTEA 5LNKe 5ECPB 5AIVA 3ED3A 3C71A 1QGVA 4K7IA 4LA1A 1BX9A 2G2QA 5IQYA 3KIJA 2LJAA 4AF2A 3ZVJD 3KZQA 2HRFA 4FYBA 3RBTA 2H1GA 4OCFA 3F4TA 4GF0A 4DVCA 2VCQA 1PX6A 1RK4A 1PQNA 3G9BA 2O87A 3CRUA 5ID2A 1K0OA 1JLVA 4GRFA 4GLTA 1U3IA 3LORA 4OCEA 5IOWA 2CAIA 1UA5A 2H70A 1O73A 3H4KA 1CQGA 3DMLA 2GTUA 4YAVA 3F0IA 2CVBA 4I5QA 2VD0A 1GLPA 1USBA 1SU9A 3KEBA 1JFUA 2DMLA 3GIXA 1YZXA 2MMZA 2B6MA 2L5OA 2PVOC 3IC4A 4EUYA 1FVJA 4ECIA 5AN1A 3OR5A 2AV4A 2FWFA 3DRNA 4MJAA 4JR6A 2ZNMA 2HLSA 1TK0B 2JU5A 3LQ7A 1DE2A 5JCUA 1YKCA 2LJKA 1T00A 1YKAA 2YWMA 2OKAA 1Z6NA 4EE0A 2C0EA 5G1LA 4AJ7A 2C8UA 1SD9A 2VL2C 2N5FA 4XCSA 5G5FA 1O8WA 2ON7A 5HR3A 4KB3A 5G1KA 4WEYA 1GSSA 3M9JA 5J9CA 4YQUA 1UVZA 2YCDA 4K0GA 2CX4A 1YJ6A 4KDUA 1FAAA 4BWQA 1PL1A 3G7JA 3F4RA 4NXIA 4F03A 4X1UA 2YJHA 5ELAA 2JADA 3UARA 3GV1A 3CTFA 3QAVA 2PMTA 3KM6A 3NZNA 4RI6A 3ZVJA 1BQ7A 5IMCA 4OFNA 2DSAA 3F63A 1XPVA 2NVLA 3FR6A 3TGZA 1DSBA 1UN2A 4POLA 2LSTA 1LU4A 2G0FA 4TKYA 3ZREA 1O7UA 3DVXA 3TKRA 5CO3A 2C3NA 3O76A 6GSTA 2HFDA 1F2EA 1SL2B 3VWXA 1S3AA 3S9FA 3M3MA 1TK5B 3APOA 2PVQA 5D73A 4J56E 5EVOA 4PXOA 3IRAA 3RDWA 1ERTA 1SK1A 4KH7A 2F8FA 3F6DA 2LRNA 3NIVA 1THXA 2V6KA 3KXOA 4TVEA 3A2VA 3TKSA 3VLNA 2F8AA 1HNAA 1G6YA 1XIYA 1TRVA 2VL9A 3A2WA 2WB9A 3UIWA 2X64A 2C1YA 2NDOA 4PGTA 4YQMA 2N5AA 2V1MA 1OE8A 3EVIA 3CBUA 4G2EA 3CTGA 4ML1A 3ZZXA 3FRCA 4N10A 3QAWA 3IAS2 3I6AA 2C3QA 2HRNA 4DSQA 4XRDA 1EGOA 3BBYA 1S3CA 4L5OA 1NW2A 3N5OA 4AJ6A 4WXTA 1PA3A 1ZGNA 2H0IA 1TRSA 2GZYA 3IXRA 4V1Ap 1VF4A 22GSA 1QFNA 20GSA 1OKTA 1A8LA 3W8JA 2DIYA 1F3BA 4DSSA 5ECKB 3LFLA 2YZHA 3TJJA 2YV7A 3HVSA 2O7KA 2L6CA 4J57E 1SK2A 3HXSA 4I97A 2HYXA 3DWVA 4PX1A 2H8LA 1GRXA 1O8XA 5D93A 4G9HA 4AGSA 2ON5A 3FYGA 4HS1A 1JZWA 1YQ1A 3PR8A 4BL7A 1K0DA 2YWOA 3PINA 4GXZA 4POKA 1XWKA 4YAPA 3GX8A 1VF3A 5ECIB 2H01A 1O6JA 5JWQB 2XPEA 3UOMA 1U3AA 3FZ4A 5DDLA 1GSEA 1F37A 1BAYA 2J23A 2K8VA 4MCUA 3GUSA 1ML6A 1HNCA 6GSWA 2R6KA 1X9MB 4Q5QA 1JLWA 2A2SA 1K3YA 5ECRB 2RIIA 4IJ3A 3WGXA 1ILOA 4OWYA 3GKNA 2L5LA 1F3AA 3HJMA 2VLVA 5GZZB 1J0FA 4MK3A 2GT5A 4HZ2A 2PWJA 4K6XA 1PGTA 1MD4A 2FA4A 2H6XA 2MMNA 2REMA 4WKWA 4I2TA 2DJKA 4HUAA 1JHBA 1NHYA 2YWNA 3KP9A 5J9BA 4IKHA 1OC3A 4PUAA 4K9ZA 2GSTA 3MAKA 5GSTA 1OC9A 5A4WA 2CQ9A 3ZL5A 4MP4A 5HFGA
chains in the Genus database with same CATH superfamily
4QL7A 1M2DA 1V57A 4OD7A 1ZYEA 3L4NA 2HRKA 3FR3A 4WR4A 1SJ6A 4KDYA 2CV4A 2ES7A 1VF2A 3FKFA 4TXOB 2KOKA 3UBLA 2GQLA 5J5NA 5H5SA 2EC4A 2XC2A 2HSMA 4LL1B 4ZILA 3VPQA 3TJFA 17GSA 2HSHA 3RAZA 4IQAA 1GTIA 5CAXA 1F9MA 5B6MA 4OMVA 4RI7A 5A4UA 4DSRA 4QQ7A 3DEXA 1XW5A 1K0MA 1N2AA 2IWTA 3GURA 2MMOA 5A5KA 4IS0A 3EWLA 2AUVA 5HQPA 1EP8A 1TU8A 3KTBA 3LWAA 4MJCA 2NPBA 4E8HA 2IMDA 4O5RA 2DJ2A 2R3XA 5KN2A 1OYJA 4K5RA 3Q19A 3VWWA 3US3A 1ERUA 3D22A 4CY6A 2PU9C 2JSYA 1DE1A 1EWXA 4TR0A 3ZFBA 4WBJA 4XHMA 5BRTA 1AC1A 3DXBA 3WGEA 3C1SA 4POBA 2VL2A 10GSA 5FT3A 5IMFA 1QMVA 2JL4A 3TB2A 3LW9A 4GWRA 1EV4A 1X9SB 4I8BA 5ECQB 3GRXA 5CNWA 3HJPA 1WPIA 3CMIA 1XBSA 2MZCA 1URMA 2LNSA 3DD3A 4X4JA 2J9HA 4MPFA 3WD6A 3IBHA 3QMXA 1A0FA 5JCWA 1IYIA 5B8BA 4PNFA 1R5PA 4Q5FA 5D9XA 3IK7A 3GKXA 1JZOA 2LTKA 1ERWA 2MYGA 4HI7A 1PL2A 2OA7A 3Q18A 2FA8A 4MA9A 3WYWA 4NPBA 4MH3A 4LL4B 4LMWA 1HYUA 1E2YA 2LRTA 3EMXA 3GSTA 2XHFA 2GQKA 3CYNA 4EC0A 3HJOA 3ZLPA 3C7MA 4ZBAA 2GSSA 3TDGA 2HT9A 1PN9A 4EDZA 2V41A 1TRWA 2RLIA 3GMFA 2CX3A 2JSZA 5GSSA 1FO5A 4NAXA 1PMTA 3IOSA 3TKPA 3LJRA 1NM3A 2VCTA 1TTZA 2CA8A 2IFQA 4XS6A 1IYHA 1OE7A 5D9WA 4G0KA 3ZFLA 3QR6A 1QK8A 2MBTA 4TR1A 1U87A 2M80A 5G5EA 3GX0A 4MF5A 3HKRA 5DQYA 1XOAA 3E3EA 1V2AA 3IV4A 4EDYA 2OE0A 4ZL7A 2P0GA 2FHEA 4IGJA 5IMAA 4PTSA 3F3RA 4KSOA 5BMUA 5IPGA 1WOUA 3AY8A 2H30A 3FY7A 4KAEA 5D9VA 1LBKA 3TJBA 4WETA 1XW9A 1PN0A 4KGIA 1MD3A 1A2LA 4KF9A 1ZYPA 3TOUA 3H8QA 3KCMA 3LGCA 4NV2A 3GN3A 3P8WA 5AISA 1ST9A 4TR3A 3EU4A 6GSSA 1AXDA 4FH8A 1ZMAA 5JWOB 4HQZA 4F2IA 2ALBA 2HZEA 4WR5A 1SL0B 3DIEA 5IIZA 1GUHA 1KEBA 3KD0A 5C04A 1MDIA 4OO5A 4HOJA 2OJLA 5DAKA 4NWYA 2QGVA 3BOAA 3G7YA 3L9UA 3MDKA 2PERA 1PX7A 5DJMA 4KUNA 3IA1A 5CREA 1YF1A 2LV3A 1B8XA 4ILFA 4F82A 3SBCA 3VWVA 3PH9A 3ERGA 4F0BA 5F07A 3IPZA 2RM6A 2X8GA 1GLQA 4MZCA 4V2NA 2C3TA 4HEA2 3WGDA 1XWBA 1GL8A 4DSSB 2VUPA 1ZYQB 2LUSA 1PKWA 1Z5YE 5ECLB 1J08A 2K6VA 4GTUA 2HSYA 2GQMA 2WZ9A 1GULA 4I2UA 1ACVA 3CSIA 2QKEA 4LLRA 4ECJA 3UEMA 4ZBDA 4IN0A 1GSDA 1GSUA 2YPMA 2FWEA 1XWCA 2L6DA 1SKWB 1TXXA 3GH6A 3U5RE 3O3TA 1TU7A 1V58A 3VI5A 3ZMLA 4YH2A 5IO0A 4EL1A 1KNGA 2D2ZA 2EIOA 1TP9A 4USSA 2F9SA 5CRWA 4D73B 4F9ZA 4IJIA 5HR0A 4QL9A 3DYRA 12GSA 1B9XC 4IVFA 2YJ7A 4WBRD 1F6MC 2H73A 3D4TA 5H5RA 4PQ1A 1CQHA 4HDEA 5CRHA 1BG5A 1EGRA 1TJDA 2P31A 5CP1A 3EU3A 2YP6A 2VCVA 1JZRA 4ZL8A 2GZPA 3LEFA 1O81A 2I4AA 4NMUA 1A8YA 5L71A 3VURA 1GH2A 2DLXA 4MNNA 2QSIA 4EXJA 1XVWA 2VOCA 2QA1A 1X5EA 1Q98A 4ZB9A 5HFKA 1R26A 5DALA 1B4PA 3RHBA 2WS2A 1H75A 1XOBA 1AQWA 5AGYA 1M9AA 3F3QA 1M3JA 1OC9B 3F4SA 4RUVA 2YOIA 3VK9A 4KCEA 3W6GA 4ID0A 1RQMA 2PUKC 3F6FA 14GSA 1G6WA 1UC7A 4YQVA 2AAWA 1ERVA 1XWAA 4D73A 3D4MA 4WF5A 2RUFA 5F05A 6GSUA 1FHEA 1GUMA 1T4YA 3N9JA 3FK8A 3HDCA 1X9WB 1EV9A 1OKDA 3A3TA 2IMEA 5G31A 3TJKA 4NV5A 4ACSA 2VAFA 1M99A 4GQFA 2BTOT 1OC8A 4N0VA 3UJ1A 3FZ5A 3O6TA 3D0ZA 4O5UA 2CVKA 5B6NA 2MMAA 4CW9A 3G7IA 1J9BA 2BMXA 5EPFA 1T7PB 3ZITA 1BEDA 3QOUA 3KTLA 1M0UA 2A2RA 1YF0A 3EINA 1K0NA 4YKGA 3QPMA 1X0RA 1BJXA 3GHAA 5ECSA 4IP1A 5KN0A 5IM9A 2C0DA 2I3YA 4G0LA 3A5WA 5B8AA 2GLRA 3L78A 3KMNA 3ERWA 4HU7A 1LJRA 3GL5A 3FW2A 2B7KA 3IHQA 3RHCA 4K7NA 2H74A 1M9BA 1H4OA 4JR4A 1TK8B 2IMFA 6GSYA 3GFKA 2A4VA 4ECCA 1R5AA 3KP8A 1Z3EA 3PGTA 3VI7A 4L0WA 3L0HA 2N5BA 4XIHA 4J2FA 1VRSD 4OFMA 2NTOA 2Z9SA 3HZ4A 4FYCA 2OADA 1X5CA 2P5QA 4KDXA 3GKMA 3ZTLA 4KA0A 2AB6A 2B3SA 2F3MA 2YWIA 1T8EB 2IMIA 4IHUA 2WCIA 2DJJA 3NOFA 3L9SA 4HQSA 4K1FA 3ZIVA 1XWGA 4X0XA 1Z7PA 2R0GA 1MTCA 1ZCPA 2B7JA 1TOFA 3C8EA 5F8BA 3P90A 3J7Yb 1PRXA 2YZUA 4KW6A 3HD5A 2H6YA 2YANA 1GNEA 1ABAA 5CYYA 2DMMA 2I9HA 4TR4A 4MJEA 2RUEA 3KMOA 2LRCA 5KOXA 2FLSA 3UMAA 3TRPA 1YEXA 4N11A 4G19A 1ON4A 3QDNA 3K8NA 1FB6A 3L9VA 2IFQB 3M1GA 2VLUA 3I69A 1R4WA 2VM1A 3EMPA 2FWHA 1OVNA 2VCWA 4BWSA 1FVKA 4TR1B 3KGKA 2NBSA 2KHPA 3TRQA 4JZQA 4KSMA 4O7HA 1GSFA 2JZRA 2VO4A 2O8VB 4F0CA 3GNJA 1WMJA 3A2XA 2HRAA 1G0TA 3HA9A 4BA7A 3LYPA 2LQQA 2VM2A 3TJGA 5DCHA 2BJXA 1K3OA 2GVPA 1Y25A 1XG8A 4JE1A 1SL1B 3LYKA 2X8CA 4H86A 2LQOA 2R0PA 5DVBA 4HJ2A 2H1DA 3ZYWA 2FGXA 1A23A 4JEDA 3CSHA 5ENUA 3RPNA 1EOGA 2H19A 4XS4A 2E2GA 1ZL9A 3P2AA 1MDJA 3D6IA 4MABA 4KE3A 2GSRA 5ABRA 1EP7A 4Z7XA 2CT6A 1DBYA 1JZDA 3LXTA 1X5DA 6GSXA 3V1WA 2HZEB 4FO5A 3P7XA 2AHEA 2PBJA 3LG6A 1TDIA 4TN8A 3TCOA 5KN3A 3EURA 4FYUA 4IP6A 2LNTA 3HHVA 2KUCA 2H76A 5DAKB 4XRAA 1HQOA 2ZCTA 4N0ZA 5F0GA 2H72A 1GWCA 4Z2RA 5D96A 2YN1A 2V2GA 1EZKA 5FHIA 2OBIA 5ELGA 1V98A 3MNGA 4IBPA 2OBKA 2WULA 1E6BA 3EPTA 3M9KA 2XPDA 1MDKA 4HZ4A 2DJ0A 1KBNA 2QC7A 3DKSA 2DJ1A 2JZTA 1HNBA 4WF4A 2E7PA 2FNOA 2I1UA 1SK0A 2FY6A 1K0CA 5HR1A 4DEJA 1AQVA 4MF7A 2DC5A 1V9WA 2VIMA 4MMMA 1OAZA 3HZ8A 3DGQA 5FWGA 2OE3A 5DJLA 3KH7A 3LXZA 3UAPA 5COHA 2MBSA 1K0AA 2CZ2A 1AUCA 3TKQA 2E2MA 1WRYA 2EIQA 2VLTA 3CRTA 1ZZYA 3VPTA 4CDOA 5ECNB 2X99A 1W89A 1Z7RA 4GSTA 1EEMA 2FD3A 4JBBA 4Z2TA 5H5QA 2R5GA 2WRTA 3IR4A 2VCXA 3IC8A 3ERFA 4K8MA 1PKZA 4FIWA 5ECHB 3HY2A 2TIRA 8GSSA 2K18A 1QQ2A 3U6VA 3FHKA 4Q5NA 5B7CA 5IMVA 3F8UA 1TI1A 3QD9A 4OFTA 4EKZA 2LJRA 1XCCA 3FEUA 1XZOA 4EVMA 2M72A 3UBKA 4PQIA 3E0UA 1FW1A 2FCHA 5DCGA 3HCZA 2R37A 3APQA 3ZRDA 4MDCA 3J7Yk 5ECOB 4ML6A 4MLYA 1QXHA 4KCAA 2X8HA 5EY6A 1XFLA 1G7OA 3Q74A 4XS1A 5LCZA 2IL3A 3H93A 4ZL9A 1GTBA 3GTUB 2DKHA 2H1AA 1N8JA 4L8EA 4ZXGA 5HR2A 2L59A 1WIKA 2GGTA 1O85A 2GT6A 2IN3A 1FB0A 1GTUA 3ZMKA 5DALB 1GSYA 2CVDA 2WFCA 3WT1A 4V2LA 5IPHA 1TI3A 1R7HA 2TRXA 2OACA 3H79A 3BCKA 1SYRA 1YY7A 1RW1A 3CXGA 1SYXA 4O92A 4BIKA 19GSA 4L0UA 5J3RA 4BVYA 4RQRA 5D9TA 18GSA 1TRUA 2GSQA 2H75A 3ME7A 4GCIA 4PQHA 3W8SA 2WDUA 4POMA 1NSWA 2AJQB 3KH9A 4EF0A 5J4UA 3APSA 5IOXA 1A0RP 2JZSA 1M3IA 2HE3A 1T4ZA 1GTAA 3GKKA 2OE1A 1FOHA 3H1NA 1C72A 2L57A 1SKSB 4ULXA 3I9V2 4ECBA 3IHGA 2KLXA 1SKRB 1SD8A 4GQCA 3R3EA 2XBIA 2KP1A 3EE2A 1VGLA 1XVQA 4CHSA 3IK9A 1Y6EA 13GSA 2PN8A 4I6XA 2JACA 4A5PA 2C0GA 2V32A 1T3BA 2TRCP 1B4QA 3GTUA 5IMDA 2B5EA 4ZB8A 1FG4A 1AAZA 4XTSA 2I81A 1A24A 3IE3A 2VCZA 1U6TA 2R4VA 4BPYA 4IELA 4PUFC 5LD0A 1WE0A 4AJ8A 1WJKA 3RPPA 3LSZA 5CRDA 1M7TA 3GSSA 3WT2A 2H0HA 4MJBA 3JCML 5G2ZA 3KJYA 3QFAC 3C73A 2L4QA 3TKSE 2GS3A 5JWRB 1VF1A 3ZIJA 3GH9A 2AYTA 2HNLA 1B48A 1SJZA 3GA4A 1XXUA 4HU9A 3IDVA 3TUEA 3C1RA 4V1Ag 3BD2A 2CAQA 1ZYNA 4K2DA 4IQ1A 5D8IA 2IPAA 2VL3A 1FOVA 2F51A 2YNXA 2E0QA 3CQFA 4KX4A 4EO3A 2IIYA 4FQUA 2YV9A 3QAGA 3MSZA 3BJ5A 3SWLA 3M0FA 3UVTA 1XW6A 5JCGA 6GSVA 3VFIA 1W4VA 1GSQA 3QCPA 3ME8A 5DBQA 5GAND 1G7EA 2P5RA 2DJ3A 1V40A 2HI7A 3UVHA 4Q5RA 1THOA 1ZOFA 1GP1A 1EEJA 4RQXA 4ZB6A 4ZBBA 2LEGA 3VWUA 1PSQA 1PFOA 5IO2A 1A2MA 2PPTA 4ZIJA 2XBQA 2HZFA 3TKSC 2IMKA 2WJUA 1U88A 4LMVA 5IMZA 2H6ZA 1QUWA 2B5YA 3D21A 2K8SA 4ISDA 2CZ3A 2PGTA 4K5SA 4G10A 5AIXA 3F9UA 2UZ8A 5E4WA 1NHOA 3TRXA 2L4CA 5INYA 4P3YB 3E9JB 4EIQA 2B1KA 4TOPA 5HFIA 4V2MA 4BVXB 4PURA 3R2QA 2DIZA 1BYEA 5G30A 2IJYA 2C80A 1M2BA 4O32A 1SJIA 3DVWA 4N30A 2VD1A 3QFBC 4PNGA 3GYKA 2C4JA 1YDKA 5CRGA 11GSA 4MPGA 1TKDB 3FZ9A 5EL8A 4L5LA 16GSA 2EIRA 1K0BA 4MZWA 5C00A 2FUG2 4K7OA 4KNDA 2LS5A 3FZAA 2H71A 2RM5A 3BCIA 3GL3A 1AIUA 1B9YC 2DKIA 5F06A 7GSSA 2C0FA 3FMWA 4XS4B 4TRXA 2B5XA 1YEPA 2GDRA 2H1BA 1WP0A 3M8NA 9GSSA 1M2AA 1AW9A 1GNWA 3TOTA 4HJMA 1MEKA 1Z9HA 3EC3A 1PD21 1I9DA 2QA2A 4MZBA 1A2JA 3FR9A 1AQXA 4MF6A 2B1LA 1TW9A 3D5JA 5A4VA 1K3LA 1SENA 4NHZA 1Q4JA 1T1VA 5ID2B 1EOHA 5KEJA 3MWHA 2H66A 4X43A 4BVXA 4NHWA 3Q6OA 4MH2A 2O85A 5ECMB 4E8EA 3HVVA 1Z6MA 3CSJA 3HVXA 4K0NA 2R2JA 2ZUPA 2HXKA 2DBCA 2GZZA 3ISOA 4JU5A 4TXOA 2K9FA 2FWGA 5J41A 2H0GA 3EYTA 1WWJA 3I43A 4TW5A 4GSSA 2LKUA 1I5GA 2WGRA 4JRRA 4EIPA 5GAPD 3IAM2 1S3RA 4TXVA 5DQSA 4IW9A 4OO4A 1HD2A 2O89A 5KN1A 2V6OA 2KP2A 5E59A 1S3DA 2M46A 3UL3A 3HYPA 2R0CA 4GSNA 2X4AA 1DUGA 1GUKA 1KTEA 5LNKe 5ECPB 5AIVA 3ED3A 3C71A 1QGVA 4K7IA 4LA1A 1BX9A 2G2QA 5IQYA 3KIJA 2LJAA 4AF2A 3ZVJD 3KZQA 2HRFA 4FYBA 3RBTA 2H1GA 4OCFA 3F4TA 4GF0A 4DVCA 2VCQA 1PX6A 1RK4A 1PQNA 3G9BA 2O87A 3CRUA 5ID2A 1K0OA 1JLVA 4GRFA 4GLTA 1U3IA 3LORA 4OCEA 4YKFA 5IOWA 2CAIA 1UA5A 2H70A 1O73A 3H4KA 1CQGA 3DMLA 2GTUA 4YAVA 3F0IA 2CVBA 4I5QA 2VD0A 1GLPA 1USBA 1SU9A 3KEBA 1JFUA 2DMLA 3GIXA 1YZXA 2MMZA 2B6MA 2L5OA 2PVOC 3IC4A 4EUYA 1FVJA 4ECIA 5AN1A 3OR5A 2AV4A 2FWFA 3DRNA 4MJAA 3A5IA 4JR6A 2ZNMA 2HLSA 1TK0B 2JU5A 3LQ7A 1DE2A 4BVYB 5JCUA 1YKCA 2LJKA 1T00A 1YKAA 2YWMA 2OKAA 1Z6NA 4EE0A 2C0EA 5G1LA 4AJ7A 2C8UA 1SD9A 2VL2C 2N5FA 4XCSA 5G5FA 1O8WA 2ON7A 5HR3A 4KB3A 5G1KA 4WEYA 1GSSA 3M9JA 5J9CA 4YQUA 1UVZA 2YCDA 4K0GA 2CX4A 1YJ6A 4KDUA 1FAAA 4BWQA 1PL1A 3G7JA 3F4RA 4NXIA 4F03A 4X1UA 2YJHA 5ELAA 2JADA 3UARA 3GV1A 3CTFA 3QAVA 2PMTA 3KM6A 3NZNA 4RI6A 3ZVJA 1BQ7A 5IMCA 4OFNA 2DSAA 3F63A 1XPVA 2NVLA 3FR6A 3TGZA 1DSBA 1UN2A 4POLA 2LSTA 1LU4A 2G0FA 4TKYA 3ZREA 1O7UA 3DVXA 3TKRA 5CO3A 4G0IA 2C3NA 3O76A 6GSTA 2HFDA 1F2EA 1SL2B 3VWXA 1S3AA 3S9FA 3M3MA 1TK5B 3APOA 2PVQA 4ICYA 5KOWA 5D73A 4J56E 5EVOA 4PXOA 3IRAA 3RDWA 1ERTA 1SK1A 4KH7A 2F8FA 3F6DA 2LRNA 3NIVA 1THXA 2V6KA 3KXOA 4TVEA 3A2VA 3TKSA 3VLNA 2F8AA 1HNAA 1G6YA 1XIYA 1TRVA 2VL9A 3A2WA 2WB9A 3UIWA 2X64A 4BL7B 2C1YA 2NDOA 4PGTA 4YQMA 2N5AA 2V1MA 1OE8A 3EVIA 3CBUA 4G2EA 3CTGA 2X49A 4ML1A 3ZZXA 3FRCA 4N10A 3QAWA 3IAS2 3I6AA 2C3QA 2HRNA 4DSQA 4XRDA 1EGOA 3BBYA 1S3CA 4L5OA 1NW2A 3N5OA 4AJ6A 4WXTA 1PA3A 1ZGNA 2H0IA 1TRSA 3PPUA 2GZYA 3IXRA 4V1Ap 1VF4A 22GSA 1QFNA 20GSA 1OKTA 1A8LA 3W8JA 2DIYA 1F3BA 4DSSA 5ECKB 3LFLA 2YZHA 3TJJA 3MIXA 2YV7A 3HVSA 2O7KA 2L6CA 4J57E 1SK2A 3HXSA 4I97A 2HYXA 3DWVA 4PX1A 4O5QA 2H8LA 1GRXA 1O8XA 5D93A 4G9HA 4AGSA 2ON5A 3FYGA 4HS1A 3MYDA 1JZWA 1YQ1A 3PR8A 4BL7A 1K0DA 2YWOA 3PINA 4GXZA 4POKA 1XWKA 4YAPA 3GX8A 1VF3A 5ECIB 4CY8A 2H01A 1O6JA 5JWQB 2XPEA 3UOMA 1U3AA 3FZ4A 5DDLA 1GSEA 1F37A 1BAYA 2J23A 2K8VA 4MCUA 3GUSA 1ML6A 1HNCA 6GSWA 2R6KA 1X9MB 4Q5QA 1JLWA 2A2SA 1K3YA 5ECRB 2RIIA 4IJ3A 3WGXA 1ILOA 4OWYA 3GKNA 2A2PA 2L5LA 1F3AA 4K2XA 3HJMA 2VLVA 5GZZB 1J0FA 4MK3A 4Z2UA 2GT5A 4HSCX 4HZ2A 2PWJA 4K6XA 1PGTA 1MD4A 2FA4A 2H6XA 2MMNA 2REMA 4WKWA 4I2TA 2DJKA 4HUAA 1JHBA 1NHYA 2YWNA 3KP9A 5J9BA 2A4HA 4IKHA 1OC3A 3HVNA 4PUAA 4K9ZA 2GSTA 3MAKA 5GSTA 1OC9A 5A4WA 2CQ9A 3ZL5A 4MP4A 5HFGA
chains in the Genus database with same CATH topology
4QL7A 1M2DA 1V57A 4OD7A 1ZYEA 3L4NA 2HRKA 3FR3A 4WR4A 1SJ6A 4KDYA 2CV4A 2ES7A 1VF2A 3FKFA 4TXOB 2KOKA 3UBLA 2GQLA 5J5NA 5H5SA 2EC4A 2XC2A 2HSMA 4LL1B 4ZILA 3VPQA 3TJFA 17GSA 2HSHA 3RAZA 4IQAA 1GTIA 5CAXA 1F9MA 5B6MA 4OMVA 4RI7A 5A4UA 4DSRA 4QQ7A 3DEXA 1XW5A 1K0MA 1N2AA 2IWTA 3GURA 2MMOA 5A5KA 4IS0A 3EWLA 2AUVA 5HQPA 1EP8A 1TU8A 3KTBA 3LWAA 4MJCA 2NPBA 4E8HA 2IMDA 4O5RA 2DJ2A 2R3XA 5KN2A 1OYJA 4K5RA 3Q19A 3VWWA 3US3A 1ERUA 3D22A 4CY6A 2PU9C 2JSYA 1DE1A 1EWXA 4TR0A 3ZFBA 4WBJA 4XHMA 5BRTA 1AC1A 3DXBA 3WGEA 3C1SA 4POBA 2VL2A 10GSA 5FT3A 5IMFA 1QMVA 2JL4A 3TB2A 3LW9A 4GWRA 1EV4A 1X9SB 4I8BA 5ECQB 3GRXA 5CNWA 3HJPA 1WPIA 3CMIA 1XBSA 2MZCA 1URMA 2LNSA 3DD3A 4X4JA 2J9HA 4MPFA 3WD6A 3IBHA 3QMXA 1A0FA 5JCWA 1IYIA 5B8BA 4PNFA 1R5PA 4Q5FA 5D9XA 3IK7A 3GKXA 1JZOA 2LTKA 1ERWA 2MYGA 4HI7A 1PL2A 2OA7A 3Q18A 2FA8A 4MA9A 3WYWA 4NPBA 4MH3A 4LL4B 4LMWA 1HYUA 1E2YA 2LRTA 3EMXA 3GSTA 2XHFA 2GQKA 3CYNA 4EC0A 3HJOA 3ZLPA 3C7MA 4ZBAA 2GSSA 3TDGA 2HT9A 1PN9A 4EDZA 2V41A 1TRWA 2RLIA 3GMFA 2CX3A 2JSZA 5GSSA 1FO5A 4NAXA 1PMTA 3IOSA 3TKPA 3LJRA 1NM3A 2VCTA 1TTZA 2CA8A 2IFQA 4XS6A 1IYHA 1OE7A 5D9WA 4G0KA 3ZFLA 3QR6A 1QK8A 2MBTA 4TR1A 1U87A 2M80A 5G5EA 3GX0A 4MF5A 3HKRA 5DQYA 1XOAA 3E3EA 1V2AA 3IV4A 4EDYA 2OE0A 4ZL7A 2P0GA 2FHEA 4IGJA 5IMAA 4PTSA 3F3RA 4KSOA 5BMUA 5IPGA 1WOUA 3AY8A 2H30A 3FY7A 4KAEA 5D9VA 1LBKA 3TJBA 4WETA 1XW9A 1PN0A 4KGIA 1MD3A 1A2LA 4KF9A 1ZYPA 3TOUA 3H8QA 3KCMA 3LGCA 4NV2A 3GN3A 3P8WA 5AISA 1ST9A 4TR3A 3EU4A 6GSSA 1AXDA 4FH8A 1ZMAA 5JWOB 4HQZA 4F2IA 2ALBA 2HZEA 4WR5A 1SL0B 3DIEA 5IIZA 1GUHA 1KEBA 3KD0A 5C04A 1MDIA 4OO5A 4HOJA 2OJLA 5DAKA 4NWYA 2QGVA 3BOAA 3G7YA 3L9UA 3MDKA 2PERA 1PX7A 5DJMA 4KUNA 3IA1A 5CREA 1YF1A 2LV3A 1B8XA 4ILFA 4F82A 3SBCA 3VWVA 3PH9A 3ERGA 4F0BA 5F07A 3IPZA 2RM6A 2X8GA 1GLQA 4MZCA 4V2NA 2C3TA 4HEA2 3WGDA 1XWBA 1GL8A 4DSSB 2VUPA 1ZYQB 2LUSA 1PKWA 1Z5YE 5ECLB 1J08A 2K6VA 4GTUA 2HSYA 2GQMA 2WZ9A 1GULA 4I2UA 1ACVA 3CSIA 2QKEA 4LLRA 4ECJA 3UEMA 4ZBDA 4IN0A 1GSDA 1GSUA 2YPMA 2FWEA 1XWCA 2L6DA 1SKWB 1TXXA 3GH6A 3U5RE 3O3TA 1TU7A 1V58A 3VI5A 3ZMLA 4YH2A 5IO0A 4EL1A 1KNGA 2D2ZA 2EIOA 1TP9A 4USSA 2F9SA 5CRWA 4D73B 4F9ZA 4IJIA 5HR0A 4QL9A 3DYRA 12GSA 1B9XC 4IVFA 2YJ7A 4WBRD 1F6MC 2H73A 3D4TA 5H5RA 4PQ1A 1CQHA 4HDEA 5CRHA 1BG5A 1EGRA 1TJDA 2P31A 5CP1A 3EU3A 2YP6A 2VCVA 1JZRA 4ZL8A 2GZPA 3LEFA 1O81A 2I4AA 4NMUA 1A8YA 5L71A 3VURA 1GH2A 2DLXA 4MNNA 2QSIA 4EXJA 1XVWA 2VOCA 2QA1A 1X5EA 1Q98A 4ZB9A 5HFKA 1R26A 5DALA 1B4PA 3RHBA 2WS2A 1H75A 1XOBA 1AQWA 5AGYA 1M9AA 3F3QA 1OC9B 3F4SA 4RUVA 2YOIA 3VK9A 4KCEA 3W6GA 4ID0A 1RQMA 2PUKC 3F6FA 14GSA 1G6WA 1UC7A 4YQVA 2AAWA 1ERVA 1XWAA 4D73A 3D4MA 4WF5A 2RUFA 5F05A 6GSUA 1FHEA 1GUMA 1T4YA 3N9JA 3FK8A 3HDCA 1X9WB 1EV9A 1OKDA 3A3TA 2IMEA 5G31A 3TJKA 4NV5A 4ACSA 2VAFA 1M99A 4GQFA 2BTOT 1OC8A 4N0VA 3UJ1A 3FZ5A 3O6TA 3D0ZA 4O5UA 2CVKA 5B6NA 2MMAA 4CW9A 3G7IA 1J9BA 2BMXA 5EPFA 1T7PB 3ZITA 1BEDA 3QOUA 3KTLA 1M0UA 2A2RA 1YF0A 3EINA 1K0NA 4YKGA 3QPMA 1X0RA 1BJXA 3GHAA 5ECSA 4IP1A 5KN0A 5IM9A 2C0DA 2I3YA 4G0LA 3A5WA 5B8AA 2GLRA 3L78A 3KMNA 3ERWA 4HU7A 1LJRA 3GL5A 3FW2A 2B7KA 3IHQA 3RHCA 4K7NA 2H74A 1M9BA 1H4OA 4JR4A 1TK8B 2IMFA 6GSYA 3GFKA 2A4VA 4ECCA 1R5AA 3KP8A 1Z3EA 3PGTA 3VI7A 4L0WA 3L0HA 2N5BA 4XIHA 4J2FA 1VRSD 4OFMA 2NTOA 2Z9SA 3HZ4A 4FYCA 2OADA 1X5CA 2P5QA 4KDXA 3GKMA 3ZTLA 4KA0A 2AB6A 2B3SA 2F3MA 2YWIA 1T8EB 2IMIA 4IHUA 2WCIA 2DJJA 3NOFA 3L9SA 4HQSA 4K1FA 3ZIVA 1XWGA 4X0XA 1Z7PA 2R0GA 1MTCA 1ZCPA 2B7JA 1TOFA 3C8EA 5F8BA 3P90A 3J7Yb 1PRXA 2YZUA 4KW6A 3HD5A 2H6YA 2YANA 1GNEA 1ABAA 5CYYA 2DMMA 2I9HA 4TR4A 4MJEA 2RUEA 3KMOA 2LRCA 5KOXA 2FLSA 3UMAA 3TRPA 1YEXA 4N11A 4G19A 1ON4A 3QDNA 3K8NA 1FB6A 3L9VA 2IFQB 3M1GA 2VLUA 3I69A 1R4WA 2VM1A 3EMPA 2FWHA 1OVNA 2VCWA 4BWSA 1FVKA 4TR1B 3KGKA 2NBSA 2KHPA 3TRQA 4JZQA 4KSMA 4O7HA 1GSFA 2JZRA 2VO4A 2O8VB 4F0CA 3GNJA 1WMJA 3A2XA 2HRAA 1G0TA 3HA9A 4BA7A 3LYPA 2LQQA 2VM2A 3TJGA 5DCHA 2BJXA 1K3OA 2GVPA 1Y25A 4JE1A 1SL1B 3LYKA 2X8CA 4H86A 2LQOA 2R0PA 5DVBA 4HJ2A 2H1DA 3ZYWA 2FGXA 1A23A 4JEDA 3CSHA 5ENUA 3RPNA 1EOGA 2H19A 4XS4A 2E2GA 1ZL9A 3P2AA 1MDJA 3D6IA 4MABA 4KE3A 2GSRA 5ABRA 1EP7A 4Z7XA 2CT6A 1DBYA 1JZDA 3LXTA 1X5DA 6GSXA 3V1WA 2HZEB 4FO5A 3P7XA 2AHEA 2PBJA 3LG6A 1TDIA 4TN8A 3TCOA 5KN3A 3EURA 4FYUA 4IP6A 2LNTA 3HHVA 2KUCA 2H76A 5DAKB 4XRAA 1HQOA 2ZCTA 4N0ZA 5F0GA 2H72A 1GWCA 4Z2RA 5D96A 2YN1A 2V2GA 1EZKA 5FHIA 2OBIA 5ELGA 1V98A 3MNGA 4IBPA 2OBKA 2WULA 1E6BA 3EPTA 3M9KA 2XPDA 1MDKA 4HZ4A 2DJ0A 1KBNA 2QC7A 3DKSA 2DJ1A 2JZTA 1HNBA 4WF4A 2E7PA 2FNOA 2I1UA 1SK0A 2FY6A 1K0CA 5HR1A 4DEJA 1AQVA 4MF7A 2DC5A 1V9WA 2VIMA 4MMMA 1OAZA 3HZ8A 3DGQA 5FWGA 2OE3A 5DJLA 3KH7A 3LXZA 3UAPA 5COHA 2MBSA 1K0AA 2CZ2A 1AUCA 3TKQA 2E2MA 1WRYA 2EIQA 2VLTA 3CRTA 1ZZYA 3VPTA 4CDOA 5ECNB 2X99A 1W89A 1Z7RA 4GSTA 1EEMA 2FD3A 4JBBA 4Z2TA 5H5QA 2R5GA 2WRTA 3IR4A 2VCXA 3IC8A 3ERFA 4K8MA 1PKZA 4FIWA 5ECHB 3HY2A 2TIRA 8GSSA 2K18A 1QQ2A 3U6VA 3FHKA 4Q5NA 5B7CA 5IMVA 3F8UA 1TI1A 3QD9A 4OFTA 4EKZA 2LJRA 1XCCA 3FEUA 1XZOA 4EVMA 2M72A 3UBKA 4PQIA 3E0UA 1FW1A 2FCHA 5DCGA 3HCZA 2R37A 3APQA 3ZRDA 4MDCA 3J7Yk 5ECOB 4ML6A 4MLYA 1QXHA 4KCAA 2X8HA 5EY6A 1XFLA 1G7OA 3Q74A 4XS1A 5LCZA 2IL3A 3H93A 4ZL9A 1GTBA 3GTUB 2DKHA 2H1AA 1N8JA 4L8EA 4ZXGA 5HR2A 2L59A 1WIKA 2GGTA 1O85A 2GT6A 2IN3A 1FB0A 1GTUA 3ZMKA 5DALB 1GSYA 2CVDA 2WFCA 3WT1A 4V2LA 5IPHA 1TI3A 1R7HA 2TRXA 2OACA 3H79A 3BCKA 1SYRA 1YY7A 1RW1A 3CXGA 1SYXA 4O92A 19GSA 4L0UA 5J3RA 4BVYA 4RQRA 5D9TA 18GSA 1TRUA 2GSQA 2H75A 3ME7A 4GCIA 4PQHA 3W8SA 2WDUA 4POMA 1NSWA 2AJQB 3KH9A 4EF0A 5J4UA 3APSA 5IOXA 1A0RP 2JZSA 2HE3A 1T4ZA 1GTAA 3GKKA 2OE1A 1FOHA 3H1NA 1C72A 2L57A 1SKSB 4ULXA 3I9V2 4ECBA 3IHGA 2KLXA 1SKRB 1SD8A 4GQCA 3R3EA 2XBIA 2KP1A 3EE2A 1VGLA 1XVQA 4CHSA 3IK9A 1Y6EA 13GSA 2PN8A 4I6XA 2JACA 4A5PA 2C0GA 2V32A 1T3BA 2TRCP 1B4QA 3GTUA 5IMDA 2B5EA 4ZB8A 1FG4A 1AAZA 4XTSA 2I81A 1A24A 3IE3A 2VCZA 1U6TA 2R4VA 4BPYA 4IELA 4PUFC 5LD0A 1WE0A 4AJ8A 1WJKA 3RPPA 3LSZA 5CRDA 1M7TA 3GSSA 3WT2A 2H0HA 4MJBA 3JCML 5G2ZA 3KJYA 3QFAC 3C73A 2L4QA 3TKSE 2GS3A 5JWRB 1VF1A 3ZIJA 3GH9A 2AYTA 2HNLA 1B48A 1SJZA 3GA4A 1XXUA 4HU9A 3IDVA 3TUEA 3C1RA 4V1Ag 3BD2A 2CAQA 1ZYNA 4K2DA 4IQ1A 5D8IA 2IPAA 2VL3A 1FOVA 2F51A 2YNXA 2E0QA 4KX4A 4EO3A 2IIYA 4FQUA 2YV9A 3QAGA 3MSZA 3BJ5A 3SWLA 3M0FA 3UVTA 1XW6A 5JCGA 6GSVA 3VFIA 1W4VA 1GSQA 3QCPA 3ME8A 5DBQA 5GAND 1G7EA 2P5RA 2DJ3A 1V40A 2HI7A 3UVHA 4Q5RA 1THOA 1ZOFA 1GP1A 1EEJA 4RQXA 4ZB6A 4ZBBA 2LEGA 3VWUA 1PSQA 5IO2A 1A2MA 2PPTA 4ZIJA 2XBQA 2HZFA 3TKSC 2IMKA 2WJUA 1U88A 4LMVA 5IMZA 2H6ZA 1QUWA 2B5YA 3D21A 2K8SA 4ISDA 2CZ3A 2PGTA 4K5SA 4G10A 5AIXA 3F9UA 2UZ8A 5E4WA 1NHOA 3TRXA 2L4CA 5INYA 4P3YB 3E9JB 4EIQA 2B1KA 4TOPA 5HFIA 4V2MA 4BVXB 4PURA 3R2QA 2DIZA 1BYEA 5G30A 2IJYA 2C80A 1M2BA 4O32A 1SJIA 3DVWA 4N30A 2VD1A 3QFBC 4PNGA 3GYKA 2C4JA 1YDKA 5CRGA 11GSA 4MPGA 1TKDB 3FZ9A 5EL8A 4L5LA 16GSA 2EIRA 1K0BA 4MZWA 5C00A 2FUG2 4K7OA 4KNDA 2LS5A 3FZAA 2H71A 2RM5A 3BCIA 3GL3A 1AIUA 1B9YC 2DKIA 5F06A 7GSSA 2C0FA 3FMWA 4XS4B 4TRXA 2B5XA 1YEPA 2GDRA 2H1BA 1WP0A 3M8NA 9GSSA 1M2AA 1AW9A 1GNWA 3TOTA 4HJMA 1MEKA 1Z9HA 3EC3A 1PD21 1I9DA 2QA2A 4MZBA 1A2JA 3FR9A 1AQXA 4MF6A 2B1LA 1TW9A 3D5JA 5A4VA 1K3LA 1SENA 4NHZA 1Q4JA 1T1VA 5ID2B 1EOHA 5KEJA 3MWHA 2H66A 4X43A 4BVXA 4NHWA 3Q6OA 4MH2A 2O85A 5ECMB 4E8EA 3HVVA 1Z6MA 3CSJA 3HVXA 4K0NA 2R2JA 2ZUPA 2HXKA 2DBCA 2GZZA 3ISOA 4JU5A 4TXOA 2K9FA 2FWGA 5J41A 2H0GA 3EYTA 1WWJA 3I43A 4TW5A 4GSSA 2LKUA 1I5GA 2WGRA 4JRRA 4EIPA 5GAPD 3IAM2 4TXVA 5DQSA 4IW9A 4OO4A 1HD2A 2O89A 5KN1A 2V6OA 2KP2A 5E59A 1S3DA 2M46A 3UL3A 3HYPA 2R0CA 4GSNA 2X4AA 1DUGA 1GUKA 1KTEA 5LNKe 5ECPB 5AIVA 3ED3A 3C71A 1QGVA 4K7IA 4LA1A 1BX9A 2G2QA 5IQYA 3KIJA 2LJAA 4AF2A 3ZVJD 3KZQA 2HRFA 4FYBA 3RBTA 2H1GA 4OCFA 3F4TA 4GF0A 4DVCA 2VCQA 1PX6A 1RK4A 1PQNA 3G9BA 2O87A 3CRUA 5ID2A 1K0OA 1JLVA 4GRFA 4GLTA 1U3IA 3LORA 4OCEA 4YKFA 5IOWA 2CAIA 1UA5A 2H70A 1O73A 3H4KA 1CQGA 3DMLA 2GTUA 4YAVA 3F0IA 2CVBA 4I5QA 2VD0A 1GLPA 1USBA 1SU9A 3KEBA 1JFUA 2DMLA 3GIXA 1YZXA 2MMZA 2B6MA 2L5OA 2PVOC 3IC4A 4EUYA 1FVJA 4ECIA 5AN1A 3OR5A 2AV4A 2FWFA 3DRNA 4MJAA 3A5IA 4JR6A 2ZNMA 2HLSA 1TK0B 2JU5A 3LQ7A 1DE2A 4BVYB 5JCUA 1YKCA 2LJKA 1T00A 1YKAA 2YWMA 2OKAA 1Z6NA 4EE0A 2C0EA 5G1LA 4AJ7A 2C8UA 1SD9A 2VL2C 2N5FA 4XCSA 5G5FA 1O8WA 2ON7A 5HR3A 4KB3A 5G1KA 4WEYA 1GSSA 3M9JA 5J9CA 4YQUA 1UVZA 2YCDA 4K0GA 2CX4A 1YJ6A 4KDUA 1FAAA 4BWQA 1PL1A 3G7JA 3F4RA 4NXIA 4F03A 4X1UA 2YJHA 5ELAA 2JADA 3UARA 3GV1A 3CTFA 3QAVA 2PMTA 3KM6A 3NZNA 4RI6A 3ZVJA 1BQ7A 5IMCA 4OFNA 2DSAA 3F63A 1XPVA 2NVLA 3FR6A 3TGZA 1DSBA 1UN2A 4POLA 2LSTA 1LU4A 2G0FA 4TKYA 3ZREA 1O7UA 3DVXA 3TKRA 5CO3A 4G0IA 2C3NA 3O76A 6GSTA 2HFDA 1F2EA 1SL2B 3VWXA 1S3AA 3S9FA 3M3MA 1TK5B 3APOA 2PVQA 4ICYA 5KOWA 5D73A 4J56E 5EVOA 4PXOA 3IRAA 3RDWA 1ERTA 1SK1A 4KH7A 2F8FA 3F6DA 2LRNA 3NIVA 1THXA 2V6KA 3KXOA 4TVEA 3A2VA 3TKSA 3VLNA 2F8AA 1HNAA 1G6YA 1XIYA 1TRVA 2VL9A 3A2WA 2WB9A 3UIWA 2X64A 4BL7B 2C1YA 2NDOA 4PGTA 4YQMA 2N5AA 2V1MA 1OE8A 3EVIA 3CBUA 4G2EA 3CTGA 2X49A 4ML1A 3ZZXA 3FRCA 4N10A 3QAWA 3IAS2 3I6AA 2C3QA 2HRNA 4DSQA 4XRDA 1EGOA 3BBYA 1S3CA 4L5OA 1NW2A 3N5OA 4AJ6A 4WXTA 1PA3A 1ZGNA 2H0IA 1TRSA 3PPUA 2GZYA 3IXRA 4V1Ap 1VF4A 22GSA 1QFNA 20GSA 1OKTA 1A8LA 3W8JA 2DIYA 1F3BA 4DSSA 5ECKB 3LFLA 2YZHA 3TJJA 3MIXA 2YV7A 3HVSA 2O7KA 2L6CA 4J57E 1SK2A 3HXSA 4I97A 2HYXA 3DWVA 4PX1A 4O5QA 2H8LA 1GRXA 1O8XA 5D93A 4G9HA 4AGSA 2ON5A 3FYGA 4HS1A 3MYDA 1JZWA 1YQ1A 3PR8A 4BL7A 1K0DA 2YWOA 3PINA 4GXZA 4POKA 1XWKA 4YAPA 3GX8A 1VF3A 5ECIB 4CY8A 2H01A 1O6JA 5JWQB 2XPEA 3UOMA 1U3AA 3FZ4A 5DDLA 1GSEA 1F37A 1BAYA 2J23A 2K8VA 4MCUA 3GUSA 1ML6A 1HNCA 6GSWA 2R6KA 1X9MB 4Q5QA 1JLWA 2A2SA 1K3YA 5ECRB 2RIIA 4IJ3A 3WGXA 1ILOA 4OWYA 3GKNA 2A2PA 2L5LA 1F3AA 4K2XA 3HJMA 2VLVA 5GZZB 1J0FA 4MK3A 4Z2UA 2GT5A 4HZ2A 2PWJA 4K6XA 1PGTA 1MD4A 2FA4A 2H6XA 2MMNA 2REMA 4WKWA 4I2TA 2DJKA 4HUAA 1JHBA 1NHYA 2YWNA 3KP9A 5J9BA 2A4HA 4IKHA 1OC3A 4PUAA 4K9ZA 2GSTA 3MAKA 5GSTA 1OC9A 5A4WA 2CQ9A 3ZL5A 4MP4A 5HFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL7 A;  1M2D A;  1V57 A;  4OD7 A;  1ZYE A;  3L4N A;  3FR3 A;  4WR4 A;  1SJ6 A;  4KDY A;  2CV4 A;  2ES7 A;  1VF2 A;  3FKF A;  4TXO B;  2KOK A;  3UBL A;  2GQL A;  5J5N A;  5H5S A;  2EC4 A;  2XC2 A;  4LL1 B;  4ZIL A;  3VPQ A;  3TJF A;  17GS A;  2HSH A;  3RAZ A;  4IQA A;  1GTI A;  5CAX A;  1F9M A;  5B6M A;  4OMV A;  4RI7 A;  5A4U A;  4DSR A;  4QQ7 A;  3DEX A;  1XW5 A;  1K0M A;  1N2A A;  2IWT A;  3GUR A;  2MMO A;  5A5K A;  4IS0 A;  3EWL A;  2AUV A;  5HQP A;  1EP8 A;  1TU8 A;  3KTB A;  3LWA A;  4MJC A;  2NPB A;  4E8H A;  2IMD A;  4O5R A;  2DJ2 A;  2R3X A;  5KN2 A;  1OYJ A;  3Q19 A;  3VWW A;  3US3 A;  1ERU A;  3D22 A;  2PU9 C;  2JSY A;  1DE1 A;  1EWX A;  4TR0 A;  3ZFB A;  4WBJ A;  4XHM A;  1AC1 A;  3DXB A;  3WGE A;  3C1S A;  4POB A;  2VL2 A;  10GS A;  5FT3 A;  5IMF A;  1QMV A;  2JL4 A;  3TB2 A;  4GWR A;  1EV4 A;  1X9S B;  4I8B A;  5ECQ B;  3GRX A;  5CNW A;  3HJP A;  1WPI A;  3CMI A;  1XBS A;  2MZC A;  1URM A;  2LNS A;  3DD3 A;  2J9H A;  4MPF A;  3WD6 A;  3IBH A;  3QMX A;  1A0F A;  5JCW A;  1IYI A;  5B8B A;  4PNF A;  1R5P A;  4Q5F A;  5D9X A;  3IK7 A;  3GKX A;  1JZO A;  2LTK A;  1ERW A;  2MYG A;  4HI7 A;  1PL2 A;  2OA7 A;  3Q18 A;  2FA8 A;  4MA9 A;  3WYW A;  4NPB A;  4MH3 A;  4LL4 B;  4LMW A;  1HYU A;  1E2Y A;  2LRT A;  3EMX A;  3GST A;  2XHF A;  2GQK A;  3CYN A;  4EC0 A;  3HJO A;  3ZLP A;  3C7M A;  4ZBA A;  2GSS A;  3TDG A;  2HT9 A;  1PN9 A;  4EDZ A;  2V41 A;  1TRW A;  2RLI A;  3GMF A;  2CX3 A;  2JSZ A;  5GSS A;  1FO5 A;  4NAX A;  1PMT A;  3IOS A;  3TKP A;  3LJR A;  1NM3 A;  2VCT A;  1TTZ A;  2CA8 A;  2IFQ A;  4XS6 A;  1IYH A;  1OE7 A;  5D9W A;  3ZFL A;  3QR6 A;  1QK8 A;  2MBT A;  4TR1 A;  1U87 A;  2M80 A;  5G5E A;  3GX0 A;  4MF5 A;  3HKR A;  5DQY A;  1XOA A;  3E3E A;  1V2A A;  3IV4 A;  4EDY A;  2OE0 A;  4ZL7 A;  2P0G A;  2FHE A;  4IGJ A;  5IMA A;  3F3R A;  4KSO A;  5IPG A;  1WOU A;  3AY8 A;  2H30 A;  3FY7 A;  4KAE A;  5D9V A;  1LBK A;  3TJB A;  4WET A;  1XW9 A;  4KGI A;  1MD3 A;  1A2L A;  3TOU A;  3H8Q A;  3KCM A;  3LGC A;  4NV2 A;  3GN3 A;  3P8W A;  5AIS A;  1ST9 A;  4TR3 A;  3EU4 A;  6GSS A;  1AXD A;  4FH8 A;  1ZMA A;  5JWO B;  4HQZ A;  4F2I A;  2ALB A;  2HZE A;  4WR5 A;  1SL0 B;  3DIE A;  5IIZ A;  1GUH A;  1KEB A;  3KD0 A;  5C04 A;  1MDI A;  4OO5 A;  4HOJ A;  2OJL A;  5DAK A;  4NWY A;  2QGV A;  3BOA A;  3G7Y A;  3L9U A;  3MDK A;  2PER A;  1PX7 A;  5DJM A;  4KUN A;  3IA1 A;  5CRE A;  1YF1 A;  2LV3 A;  1B8X A;  4ILF A;  4F82 A;  3SBC A;  3VWV A;  3PH9 A;  3ERG A;  4F0B A;  5F07 A;  3IPZ A;  2RM6 A;  2X8G A;  1GLQ A;  4MZC A;  4V2N A;  2C3T A;  4HEA 2;  3WGD A;  1XWB A;  1GL8 A;  4DSS B;  2VUP A;  1ZYQ B;  2LUS A;  1PKW A;  1Z5Y E;  5ECL B;  1J08 A;  2K6V A;  4GTU A;  2HSY A;  2GQM A;  2WZ9 A;  1GUL A;  4I2U A;  1ACV A;  3CSI A;  2QKE A;  4LLR A;  4ECJ A;  3UEM A;  4ZBD A;  4IN0 A;  1GSD A;  1GSU A;  2YPM A;  2FWE A;  1XWC A;  2L6D A;  1SKW B;  1TXX A;  3GH6 A;  3U5R E;  3O3T A;  1TU7 A;  1V58 A;  3VI5 A;  3ZML A;  4YH2 A;  5IO0 A;  4EL1 A;  1KNG A;  2D2Z A;  2EIO A;  1TP9 A;  2F9S A;  5CRW A;  4D73 B;  4F9Z A;  4IJI A;  5HR0 A;  4QL9 A;  3DYR A;  12GS A;  1B9X C;  4IVF A;  2YJ7 A;  4WBR D;  1F6M C;  2H73 A;  3D4T A;  5H5R A;  4PQ1 A;  1CQH A;  4HDE A;  5CRH A;  1BG5 A;  1EGR A;  1TJD A;  2P31 A;  5CP1 A;  3EU3 A;  2YP6 A;  2VCV A;  1JZR A;  4ZL8 A;  2GZP A;  3LEF A;  1O81 A;  2I4A A;  4NMU A;  1A8Y A;  5L71 A;  3VUR A;  1GH2 A;  2DLX A;  2QSI A;  4EXJ A;  1XVW A;  2VOC A;  1X5E A;  1Q98 A;  4ZB9 A;  5HFK A;  1R26 A;  5DAL A;  1B4P A;  3RHB A;  2WS2 A;  1H75 A;  1XOB A;  1AQW A;  5AGY A;  1M9A A;  3F3Q A;  1OC9 B;  3F4S A;  4RUV A;  2YOI A;  3VK9 A;  4KCE A;  3W6G A;  4ID0 A;  1RQM A;  2PUK C;  3F6F A;  14GS A;  1G6W A;  1UC7 A;  4YQV A;  2AAW A;  1ERV A;  1XWA A;  4D73 A;  3D4M A;  4WF5 A;  2RUF A;  5F05 A;  6GSU A;  1FHE A;  1GUM A;  1T4Y A;  3N9J A;  3FK8 A;  3HDC A;  1X9W B;  1EV9 A;  1OKD A;  3A3T A;  2IME A;  5G31 A;  3TJK A;  4NV5 A;  4ACS A;  2VAF A;  1M99 A;  4GQF A;  2BTO T;  1OC8 A;  4N0V A;  3UJ1 A;  3FZ5 A;  3O6T A;  3D0Z A;  2CVK A;  5B6N A;  2MMA A;  4CW9 A;  3G7I A;  1J9B A;  2BMX A;  5EPF A;  1T7P B;  3ZIT A;  1BED A;  3QOU A;  3KTL A;  1M0U A;  2A2R A;  1YF0 A;  3EIN A;  1K0N A;  3QPM A;  1X0R A;  1BJX A;  3GHA A;  5ECS A;  4IP1 A;  5KN0 A;  5IM9 A;  2C0D A;  2I3Y A;  3A5W A;  5B8A A;  2GLR A;  3L78 A;  3KMN A;  3ERW A;  4HU7 A;  1LJR A;  3GL5 A;  3FW2 A;  2B7K A;  3IHQ A;  3RHC A;  4K7N A;  2H74 A;  1M9B A;  1H4O A;  4JR4 A;  1TK8 B;  2IMF A;  6GSY A;  3GFK A;  2A4V A;  4ECC A;  1R5A A;  3KP8 A;  1Z3E A;  3PGT A;  3VI7 A;  4L0W A;  3L0H A;  2N5B A;  4XIH A;  4J2F A;  1VRS D;  4OFM A;  2NTO A;  2Z9S A;  3HZ4 A;  4FYC A;  2OAD A;  1X5C A;  2P5Q A;  4KDX A;  3GKM A;  3ZTL A;  4KA0 A;  2AB6 A;  2B3S A;  2F3M A;  2YWI A;  1T8E B;  2IMI A;  4IHU A;  2WCI A;  2DJJ A;  3NOF A;  3L9S A;  4HQS A;  4K1F A;  3ZIV A;  1XWG A;  4X0X A;  1Z7P A;  1MTC A;  1ZCP A;  2B7J A;  1TOF A;  3C8E A;  5F8B A;  3P90 A;  3J7Y b;  1PRX A;  2YZU A;  4KW6 A;  3HD5 A;  2H6Y A;  2YAN A;  1GNE A;  1ABA A;  5CYY A;  2DMM A;  2I9H A;  4TR4 A;  4MJE A;  2RUE A;  3KMO A;  2LRC A;  2FLS A;  3UMA A;  3TRP A;  1YEX A;  4N11 A;  4G19 A;  1ON4 A;  3QDN A;  3K8N A;  1FB6 A;  3L9V A;  2IFQ B;  3M1G A;  2VLU A;  3I69 A;  1R4W A;  2VM1 A;  3EMP A;  2FWH A;  1OVN A;  2VCW A;  4BWS A;  1FVK A;  4TR1 B;  3KGK A;  2NBS A;  2KHP A;  3TRQ A;  4JZQ A;  4KSM A;  4O7H A;  1GSF A;  2JZR A;  2VO4 A;  2O8V B;  4F0C A;  3GNJ A;  1WMJ A;  3A2X A;  1G0T A;  3HA9 A;  4BA7 A;  3LYP A;  2LQQ A;  2VM2 A;  3TJG A;  5DCH A;  2BJX A;  1K3O A;  2GVP A;  1Y25 A;  4JE1 A;  1SL1 B;  3LYK A;  2X8C A;  4H86 A;  2LQO A;  5DVB A;  4HJ2 A;  2H1D A;  3ZYW A;  2FGX A;  1A23 A;  4JED A;  3CSH A;  5ENU A;  3RPN A;  1EOG A;  2H19 A;  4XS4 A;  2E2G A;  1ZL9 A;  3P2A A;  1MDJ A;  3D6I A;  4MAB A;  4KE3 A;  2GSR A;  5ABR A;  1EP7 A;  4Z7X A;  2CT6 A;  1DBY A;  1JZD A;  3LXT A;  1X5D A;  6GSX A;  3V1W A;  2HZE B;  4FO5 A;  3P7X A;  2AHE A;  2PBJ A;  3LG6 A;  1TDI A;  4TN8 A;  3TCO A;  5KN3 A;  3EUR A;  4FYU A;  4IP6 A;  2LNT A;  3HHV A;  2KUC A;  2H76 A;  5DAK B;  4XRA A;  1HQO A;  2ZCT A;  4N0Z A;  5F0G A;  2H72 A;  1GWC A;  5D96 A;  2YN1 A;  2V2G A;  1EZK A;  5FHI A;  2OBI A;  5ELG A;  1V98 A;  3MNG A;  4IBP A;  2OBK A;  2WUL A;  1E6B A;  3M9K A;  2XPD A;  1MDK A;  4HZ4 A;  2DJ0 A;  1KBN A;  2QC7 A;  3DKS A;  2DJ1 A;  2JZT A;  1HNB A;  4WF4 A;  2E7P A;  2FNO A;  2I1U A;  1SK0 A;  2FY6 A;  1K0C A;  5HR1 A;  4DEJ A;  1AQV A;  4MF7 A;  2DC5 A;  1V9W A;  2VIM A;  4MMM A;  1OAZ A;  3HZ8 A;  3DGQ A;  5FWG A;  2OE3 A;  5DJL A;  3KH7 A;  3LXZ A;  3UAP A;  5COH A;  2MBS A;  1K0A A;  2CZ2 A;  1AUC A;  3TKQ A;  2E2M A;  1WRY A;  2EIQ A;  2VLT A;  3CRT A;  1ZZY A;  3VPT A;  4CDO A;  5ECN B;  2X99 A;  1W89 A;  1Z7R A;  4GST A;  1EEM A;  2FD3 A;  4JBB A;  5H5Q A;  2R5G A;  2WRT A;  3IR4 A;  2VCX A;  3ERF A;  4K8M A;  1PKZ A;  4FIW A;  5ECH B;  3HY2 A;  2TIR A;  8GSS A;  2K18 A;  1QQ2 A;  3U6V A;  3FHK A;  4Q5N A;  5B7C A;  5IMV A;  3F8U A;  1TI1 A;  3QD9 A;  4OFT A;  4EKZ A;  2LJR A;  1XCC A;  3FEU A;  1XZO A;  4EVM A;  2M72 A;  3UBK A;  4PQI A;  3E0U A;  1FW1 A;  2FCH A;  5DCG A;  3HCZ A;  2R37 A;  3APQ A;  3ZRD A;  4MDC A;  3J7Y k;  5ECO B;  4ML6 A;  4MLY A;  1QXH A;  4KCA A;  2X8H A;  5EY6 A;  1XFL A;  1G7O A;  3Q74 A;  4XS1 A;  5LCZ A;  2IL3 A;  3H93 A;  4ZL9 A;  1GTB A;  3GTU B;  2H1A A;  1N8J A;  4L8E A;  4ZXG A;  5HR2 A;  2L59 A;  1WIK A;  2GGT A;  1O85 A;  2GT6 A;  2IN3 A;  1FB0 A;  1GTU A;  3ZMK A;  5DAL B;  1GSY A;  2CVD A;  2WFC A;  3WT1 A;  4V2L A;  5IPH A;  1TI3 A;  1R7H A;  2TRX A;  2OAC A;  3H79 A;  3BCK A;  1SYR A;  1YY7 A;  1RW1 A;  3CXG A;  1SYX A;  4O92 A;  19GS A;  4L0U A;  5J3R A;  4BVY A;  4RQR A;  5D9T A;  18GS A;  1TRU A;  2GSQ A;  2H75 A;  3ME7 A;  4GCI A;  4PQH A;  3W8S A;  2WDU A;  4POM A;  1NSW A;  2AJQ B;  3KH9 A;  4EF0 A;  5J4U A;  3APS A;  5IOX A;  1A0R P;  2JZS A;  2HE3 A;  1T4Z A;  1GTA A;  3GKK A;  2OE1 A;  3H1N A;  1C72 A;  2L57 A;  1SKS B;  4ULX A;  3I9V 2;  4ECB A;  2KLX A;  1SKR B;  1SD8 A;  4GQC A;  2XBI A;  2KP1 A;  3EE2 A;  1VGL A;  1XVQ A;  4CHS A;  3IK9 A;  1Y6E A;  13GS A;  2PN8 A;  4I6X A;  2JAC A;  2C0G A;  2V32 A;  1T3B A;  2TRC P;  1B4Q A;  3GTU A;  5IMD A;  2B5E A;  4ZB8 A;  1FG4 A;  1AAZ A;  4XTS A;  2I81 A;  1A24 A;  3IE3 A;  2VCZ A;  1U6T A;  2R4V A;  4BPY A;  4IEL A;  4PUF C;  5LD0 A;  1WE0 A;  4AJ8 A;  1WJK A;  3RPP A;  3LSZ A;  5CRD A;  1M7T A;  3GSS A;  3WT2 A;  2H0H A;  4MJB A;  3JCM L;  5G2Z A;  3KJY A;  3QFA C;  3C73 A;  2L4Q A;  3TKS E;  2GS3 A;  5JWR B;  1VF1 A;  3ZIJ A;  3GH9 A;  2AYT A;  2HNL A;  1B48 A;  1SJZ A;  3GA4 A;  1XXU A;  4HU9 A;  3IDV A;  3TUE A;  3C1R A;  4V1A g;  3BD2 A;  2CAQ A;  4K2D A;  4IQ1 A;  5D8I A;  2IPA A;  2VL3 A;  1FOV A;  2F51 A;  2YNX A;  2E0Q A;  4KX4 A;  4EO3 A;  2IIY A;  2YV9 A;  3QAG A;  3MSZ A;  3BJ5 A;  3SWL A;  3M0F A;  3UVT A;  1XW6 A;  5JCG A;  6GSV A;  3VFI A;  1W4V A;  1GSQ A;  3QCP A;  3ME8 A;  5DBQ A;  5GAN D;  1G7E A;  2P5R A;  2DJ3 A;  1V40 A;  2HI7 A;  3UVH A;  4Q5R A;  1THO A;  1ZOF A;  1GP1 A;  1EEJ A;  4RQX A;  4ZB6 A;  4ZBB A;  2LEG A;  3VWU A;  1PSQ A;  5IO2 A;  1A2M A;  2PPT A;  4ZIJ A;  2XBQ A;  2HZF A;  3TKS C;  2IMK A;  2WJU A;  1U88 A;  4LMV A;  5IMZ A;  2H6Z A;  1QUW A;  2B5Y A;  3D21 A;  2K8S A;  4ISD A;  2CZ3 A;  2PGT A;  4G10 A;  5AIX A;  3F9U A;  5E4W A;  1NHO A;  3TRX A;  2L4C A;  5INY A;  4P3Y B;  3E9J B;  2B1K A;  4TOP A;  5HFI A;  4V2M A;  4PUR A;  3R2Q A;  2DIZ A;  1BYE A;  5G30 A;  2IJY A;  2C80 A;  1M2B A;  4O32 A;  1SJI A;  3DVW A;  4N30 A;  2VD1 A;  3QFB C;  4PNG A;  3GYK A;  2C4J A;  1YDK A;  5CRG A;  11GS A;  4MPG A;  1TKD B;  3FZ9 A;  5EL8 A;  4L5L A;  16GS A;  2EIR A;  1K0B A;  4MZW A;  5C00 A;  2FUG 2;  4K7O A;  4KND A;  2LS5 A;  3FZA A;  2H71 A;  2RM5 A;  3BCI A;  3GL3 A;  1AIU A;  1B9Y C;  5F06 A;  7GSS A;  2C0F A;  4XS4 B;  4TRX A;  2B5X A;  1YEP A;  2GDR A;  2H1B A;  1WP0 A;  3M8N A;  9GSS A;  1M2A A;  1AW9 A;  1GNW A;  3TOT A;  4HJM A;  1MEK A;  1Z9H A;  3EC3 A;  1PD2 1;  1I9D A;  4MZB A;  1A2J A;  3FR9 A;  1AQX A;  4MF6 A;  2B1L A;  1TW9 A;  3D5J A;  5A4V A;  1K3L A;  1SEN A;  4NHZ A;  1Q4J A;  1T1V A;  5ID2 B;  1EOH A;  5KEJ A;  3MWH A;  2H66 A;  4X43 A;  4BVX A;  4NHW A;  3Q6O A;  4MH2 A;  2O85 A;  5ECM B;  4E8E A;  3HVV A;  1Z6M A;  3CSJ A;  3HVX A;  4K0N A;  2R2J A;  2ZUP A;  2HXK A;  2DBC A;  2GZZ A;  3ISO A;  4JU5 A;  4TXO A;  2K9F A;  2FWG A;  5J41 A;  2H0G A;  3EYT A;  1WWJ A;  3I43 A;  4TW5 A;  4GSS A;  2LKU A;  1I5G A;  2WGR A;  4JRR A;  5GAP D;  3IAM 2;  4TXV A;  5DQS A;  4IW9 A;  4OO4 A;  1HD2 A;  2O89 A;  5KN1 A;  2V6O A;  2KP2 A;  5E59 A;  1S3D A;  2M46 A;  3UL3 A;  3HYP A;  4GSN A;  1DUG A;  1GUK A;  1KTE A;  5LNK e;  5ECP B;  5AIV A;  3ED3 A;  3C71 A;  1QGV A;  4K7I A;  4LA1 A;  1BX9 A;  2G2Q A;  5IQY A;  3KIJ A;  2LJA A;  4AF2 A;  3ZVJ D;  3KZQ A;  2HRF A;  4FYB A;  3RBT A;  2H1G A;  4OCF A;  3F4T A;  4GF0 A;  4DVC A;  2VCQ A;  1PX6 A;  1RK4 A;  1PQN A;  3G9B A;  2O87 A;  3CRU A;  5ID2 A;  1K0O A;  1JLV A;  4GRF A;  4GLT A;  1U3I A;  3LOR A;  4OCE A;  5IOW A;  2CAI A;  1UA5 A;  2H70 A;  1O73 A;  3H4K A;  1CQG A;  3DML A;  2GTU A;  4YAV A;  3F0I A;  2CVB A;  4I5Q A;  2VD0 A;  1GLP A;  1USB A;  1SU9 A;  3KEB A;  1JFU A;  2DML A;  3GIX A;  1YZX A;  2MMZ A;  2B6M A;  2L5O A;  2PVO C;  3IC4 A;  4EUY A;  1FVJ A;  4ECI A;  5AN1 A;  3OR5 A;  2AV4 A;  2FWF A;  3DRN A;  4MJA A;  4JR6 A;  2ZNM A;  2HLS A;  1TK0 B;  2JU5 A;  3LQ7 A;  1DE2 A;  5JCU A;  1YKC A;  2LJK A;  1T00 A;  1YKA A;  2YWM A;  2OKA A;  1Z6N A;  4EE0 A;  2C0E A;  5G1L A;  4AJ7 A;  2C8U A;  1SD9 A;  2VL2 C;  2N5F A;  4XCS A;  5G5F A;  1O8W A;  2ON7 A;  5HR3 A;  4KB3 A;  5G1K A;  4WEY A;  1GSS A;  3M9J A;  5J9C A;  4YQU A;  1UVZ A;  2YCD A;  4K0G A;  2CX4 A;  1YJ6 A;  4KDU A;  1FAA A;  4BWQ A;  1PL1 A;  3G7J A;  3F4R A;  4NXI A;  4F03 A;  4X1U A;  2YJH A;  5ELA A;  2JAD A;  3UAR A;  3GV1 A;  3CTF A;  3QAV A;  2PMT A;  3KM6 A;  3NZN A;  4RI6 A;  3ZVJ A;  1BQ7 A;  5IMC A;  4OFN A;  2DSA A;  3F63 A;  1XPV A;  2NVL A;  3FR6 A;  3TGZ A;  1DSB A;  1UN2 A;  4POL A;  2LST A;  1LU4 A;  2G0F A;  4TKY A;  3ZRE A;  1O7U A;  3DVX A;  3TKR A;  5CO3 A;  2C3N A;  3O76 A;  6GST A;  2HFD A;  1F2E A;  1SL2 B;  3VWX A;  1S3A A;  3S9F A;  3M3M A;  1TK5 B;  3APO A;  2PVQ A;  5D73 A;  4J56 E;  5EVO A;  4PXO A;  3IRA A;  3RDW A;  1ERT A;  1SK1 A;  4KH7 A;  2F8F A;  3F6D A;  2LRN A;  3NIV A;  1THX A;  2V6K A;  3KXO A;  4TVE A;  3A2V A;  3TKS A;  3VLN A;  2F8A A;  1HNA A;  1G6Y A;  1XIY A;  1TRV A;  2VL9 A;  3A2W A;  2WB9 A;  3UIW A;  2X64 A;  2C1Y A;  2NDO A;  4PGT A;  4YQM A;  2N5A A;  2V1M A;  1OE8 A;  3EVI A;  3CBU A;  4G2E A;  3CTG A;  4ML1 A;  3ZZX A;  3FRC A;  4N10 A;  3QAW A;  3IAS 2;  3I6A A;  2C3Q A;  2HRN A;  4DSQ A;  4XRD A;  1EGO A;  3BBY A;  1S3C A;  4L5O A;  1NW2 A;  3N5O A;  4AJ6 A;  4WXT A;  1PA3 A;  1ZGN A;  2H0I A;  1TRS A;  2GZY A;  3IXR A;  4V1A p;  1VF4 A;  22GS A;  1QFN A;  20GS A;  1OKT A;  1A8L A;  3W8J A;  2DIY A;  1F3B A;  4DSS A;  5ECK B;  3LFL A;  2YZH A;  3TJJ A;  2YV7 A;  3HVS A;  2O7K A;  2L6C A;  4J57 E;  1SK2 A;  3HXS A;  4I97 A;  2HYX A;  3DWV A;  4PX1 A;  2H8L A;  1GRX A;  1O8X A;  5D93 A;  4G9H A;  4AGS A;  2ON5 A;  3FYG A;  4HS1 A;  1JZW A;  1YQ1 A;  3PR8 A;  4BL7 A;  1K0D A;  2YWO A;  3PIN A;  4GXZ A;  4POK A;  1XWK A;  4YAP A;  3GX8 A;  1VF3 A;  5ECI B;  2H01 A;  1O6J A;  5JWQ B;  2XPE A;  3UOM A;  1U3A A;  3FZ4 A;  5DDL A;  1GSE A;  1F37 A;  1BAY A;  2J23 A;  2K8V A;  4MCU A;  3GUS A;  1ML6 A;  1HNC A;  6GSW A;  2R6K A;  1X9M B;  4Q5Q A;  1JLW A;  2A2S A;  1K3Y A;  5ECR B;  2RII A;  4IJ3 A;  3WGX A;  1ILO A;  4OWY A;  3GKN A;  2L5L A;  1F3A A;  3HJM A;  2VLV A;  5GZZ B;  1J0F A;  4MK3 A;  2GT5 A;  4HZ2 A;  2PWJ A;  4K6X A;  1PGT A;  1MD4 A;  2FA4 A;  2H6X A;  2MMN A;  2REM A;  4WKW A;  4I2T A;  2DJK A;  4HUA A;  1JHB A;  1NHY A;  2YWN A;  3KP9 A;  5J9B A;  4IKH A;  1OC3 A;  4PUA A;  4K9Z A;  2GST A;  3MAK A;  5GST A;  1OC9 A;  5A4W A;  2CQ9 A;  3ZL5 A;  4MP4 A;  5HFG A; 
#chains in the Genus database with same CATH topology
 4QL7 A;  1M2D A;  1V57 A;  4OD7 A;  1ZYE A;  3L4N A;  2HRK A;  3FR3 A;  4WR4 A;  1SJ6 A;  4KDY A;  2CV4 A;  2ES7 A;  1VF2 A;  3FKF A;  4TXO B;  2KOK A;  3UBL A;  2GQL A;  5J5N A;  5H5S A;  2EC4 A;  2XC2 A;  2HSM A;  4LL1 B;  4ZIL A;  3VPQ A;  3TJF A;  17GS A;  2HSH A;  3RAZ A;  4IQA A;  1GTI A;  5CAX A;  1F9M A;  5B6M A;  4OMV A;  4RI7 A;  5A4U A;  4DSR A;  4QQ7 A;  3DEX A;  1XW5 A;  1K0M A;  1N2A A;  2IWT A;  3GUR A;  2MMO A;  5A5K A;  4IS0 A;  3EWL A;  2AUV A;  5HQP A;  1EP8 A;  1TU8 A;  3KTB A;  3LWA A;  4MJC A;  2NPB A;  4E8H A;  2IMD A;  4O5R A;  2DJ2 A;  2R3X A;  5KN2 A;  1OYJ A;  4K5R A;  3Q19 A;  3VWW A;  3US3 A;  1ERU A;  3D22 A;  4CY6 A;  2PU9 C;  2JSY A;  1DE1 A;  1EWX A;  4TR0 A;  3ZFB A;  4WBJ A;  4XHM A;  5BRT A;  1AC1 A;  3DXB A;  3WGE A;  3C1S A;  4POB A;  2VL2 A;  10GS A;  5FT3 A;  5IMF A;  1QMV A;  2JL4 A;  3TB2 A;  3LW9 A;  4GWR A;  1EV4 A;  1X9S B;  4I8B A;  5ECQ B;  3GRX A;  5CNW A;  3HJP A;  1WPI A;  3CMI A;  1XBS A;  2MZC A;  1URM A;  2LNS A;  3DD3 A;  4X4J A;  2J9H A;  4MPF A;  3WD6 A;  3IBH A;  3QMX A;  1A0F A;  5JCW A;  1IYI A;  5B8B A;  4PNF A;  1R5P A;  4Q5F A;  5D9X A;  3IK7 A;  3GKX A;  1JZO A;  2LTK A;  1ERW A;  2MYG A;  4HI7 A;  1PL2 A;  2OA7 A;  3Q18 A;  2FA8 A;  4MA9 A;  3WYW A;  4NPB A;  4MH3 A;  4LL4 B;  4LMW A;  1HYU A;  1E2Y A;  2LRT A;  3EMX A;  3GST A;  2XHF A;  2GQK A;  3CYN A;  4EC0 A;  3HJO A;  3ZLP A;  3C7M A;  4ZBA A;  2GSS A;  3TDG A;  2HT9 A;  1PN9 A;  4EDZ A;  2V41 A;  1TRW A;  2RLI A;  3GMF A;  2CX3 A;  2JSZ A;  5GSS A;  1FO5 A;  4NAX A;  1PMT A;  3IOS A;  3TKP A;  3LJR A;  1NM3 A;  2VCT A;  1TTZ A;  2CA8 A;  2IFQ A;  4XS6 A;  1IYH A;  1OE7 A;  5D9W A;  4G0K A;  3ZFL A;  3QR6 A;  1QK8 A;  2MBT A;  4TR1 A;  1U87 A;  2M80 A;  5G5E A;  3GX0 A;  4MF5 A;  3HKR A;  5DQY A;  1XOA A;  3E3E A;  1V2A A;  3IV4 A;  4EDY A;  2OE0 A;  4ZL7 A;  2P0G A;  2FHE A;  4IGJ A;  5IMA A;  4PTS A;  3F3R A;  4KSO A;  5BMU A;  5IPG A;  1WOU A;  3AY8 A;  2H30 A;  3FY7 A;  4KAE A;  5D9V A;  1LBK A;  3TJB A;  4WET A;  1XW9 A;  1PN0 A;  4KGI A;  1MD3 A;  1A2L A;  4KF9 A;  1ZYP A;  3TOU A;  3H8Q A;  3KCM A;  3LGC A;  4NV2 A;  3GN3 A;  3P8W A;  5AIS A;  1ST9 A;  4TR3 A;  3EU4 A;  6GSS A;  1AXD A;  4FH8 A;  1ZMA A;  5JWO B;  4HQZ A;  4F2I A;  2ALB A;  2HZE A;  4WR5 A;  1SL0 B;  3DIE A;  5IIZ A;  1GUH A;  1KEB A;  3KD0 A;  5C04 A;  1MDI A;  4OO5 A;  4HOJ A;  2OJL A;  5DAK A;  4NWY A;  2QGV A;  3BOA A;  3G7Y A;  3L9U A;  3MDK A;  2PER A;  1PX7 A;  5DJM A;  4KUN A;  3IA1 A;  5CRE A;  1YF1 A;  2LV3 A;  1B8X A;  4ILF A;  4F82 A;  3SBC A;  3VWV A;  3PH9 A;  3ERG A;  4F0B A;  5F07 A;  3IPZ A;  2RM6 A;  2X8G A;  1GLQ A;  4MZC A;  4V2N A;  2C3T A;  4HEA 2;  3WGD A;  1XWB A;  1GL8 A;  4DSS B;  2VUP A;  1ZYQ B;  2LUS A;  1PKW A;  1Z5Y E;  5ECL B;  1J08 A;  2K6V A;  4GTU A;  2HSY A;  2GQM A;  2WZ9 A;  1GUL A;  4I2U A;  1ACV A;  3CSI A;  2QKE A;  4LLR A;  4ECJ A;  3UEM A;  4ZBD A;  4IN0 A;  1GSD A;  1GSU A;  2YPM A;  2FWE A;  1XWC A;  2L6D A;  1SKW B;  1TXX A;  3GH6 A;  3U5R E;  3O3T A;  1TU7 A;  1V58 A;  3VI5 A;  3ZML A;  4YH2 A;  5IO0 A;  4EL1 A;  1KNG A;  2D2Z A;  2EIO A;  1TP9 A;  4USS A;  2F9S A;  5CRW A;  4D73 B;  4F9Z A;  4IJI A;  5HR0 A;  4QL9 A;  3DYR A;  12GS A;  1B9X C;  4IVF A;  2YJ7 A;  4WBR D;  1F6M C;  2H73 A;  3D4T A;  5H5R A;  4PQ1 A;  1CQH A;  4HDE A;  5CRH A;  1BG5 A;  1EGR A;  1TJD A;  2P31 A;  5CP1 A;  3EU3 A;  2YP6 A;  2VCV A;  1JZR A;  4ZL8 A;  2GZP A;  3LEF A;  1O81 A;  2I4A A;  4NMU A;  1A8Y A;  5L71 A;  3VUR A;  1GH2 A;  2DLX A;  4MNN A;  2QSI A;  4EXJ A;  1XVW A;  2VOC A;  2QA1 A;  1X5E A;  1Q98 A;  4ZB9 A;  5HFK A;  1R26 A;  5DAL A;  1B4P A;  3RHB A;  2WS2 A;  1H75 A;  1XOB A;  1AQW A;  5AGY A;  1M9A A;  3F3Q A;  1M3J A;  1OC9 B;  3F4S A;  4RUV A;  2YOI A;  3VK9 A;  4KCE A;  3W6G A;  4ID0 A;  1RQM A;  2PUK C;  3F6F A;  14GS A;  1G6W A;  1UC7 A;  4YQV A;  2AAW A;  1ERV A;  1XWA A;  4D73 A;  3D4M A;  4WF5 A;  2RUF A;  5F05 A;  6GSU A;  1FHE A;  1GUM A;  1T4Y A;  3N9J A;  3FK8 A;  3HDC A;  1X9W B;  1EV9 A;  1OKD A;  3A3T A;  2IME A;  5G31 A;  3TJK A;  4NV5 A;  4ACS A;  2VAF A;  1M99 A;  4GQF A;  2BTO T;  1OC8 A;  4N0V A;  3UJ1 A;  3FZ5 A;  3O6T A;  3D0Z A;  4O5U A;  2CVK A;  5B6N A;  2MMA A;  4CW9 A;  3G7I A;  1J9B A;  2BMX A;  5EPF A;  1T7P B;  3ZIT A;  1BED A;  3QOU A;  3KTL A;  1M0U A;  2A2R A;  1YF0 A;  3EIN A;  1K0N A;  4YKG A;  3QPM A;  1X0R A;  1BJX A;  3GHA A;  5ECS A;  4IP1 A;  5KN0 A;  5IM9 A;  2C0D A;  2I3Y A;  4G0L A;  3A5W A;  5B8A A;  2GLR A;  3L78 A;  3KMN A;  3ERW A;  4HU7 A;  1LJR A;  3GL5 A;  3FW2 A;  2B7K A;  3IHQ A;  3RHC A;  4K7N A;  2H74 A;  1M9B A;  1H4O A;  4JR4 A;  1TK8 B;  2IMF A;  6GSY A;  3GFK A;  2A4V A;  4ECC A;  1R5A A;  3KP8 A;  1Z3E A;  3PGT A;  3VI7 A;  4L0W A;  3L0H A;  2N5B A;  4XIH A;  4J2F A;  1VRS D;  4OFM A;  2NTO A;  2Z9S A;  3HZ4 A;  4FYC A;  2OAD A;  1X5C A;  2P5Q A;  4KDX A;  3GKM A;  3ZTL A;  4KA0 A;  2AB6 A;  2B3S A;  2F3M A;  2YWI A;  1T8E B;  2IMI A;  4IHU A;  2WCI A;  2DJJ A;  3NOF A;  3L9S A;  4HQS A;  4K1F A;  3ZIV A;  1XWG A;  4X0X A;  1Z7P A;  2R0G A;  1MTC A;  1ZCP A;  2B7J A;  1TOF A;  3C8E A;  5F8B A;  3P90 A;  3J7Y b;  1PRX A;  2YZU A;  4KW6 A;  3HD5 A;  2H6Y A;  2YAN A;  1GNE A;  1ABA A;  5CYY A;  2DMM A;  2I9H A;  4TR4 A;  4MJE A;  2RUE A;  3KMO A;  2LRC A;  5KOX A;  2FLS A;  3UMA A;  3TRP A;  1YEX A;  4N11 A;  4G19 A;  1ON4 A;  3QDN A;  3K8N A;  1FB6 A;  3L9V A;  2IFQ B;  3M1G A;  2VLU A;  3I69 A;  1R4W A;  2VM1 A;  3EMP A;  2FWH A;  1OVN A;  2VCW A;  4BWS A;  1FVK A;  4TR1 B;  3KGK A;  2NBS A;  2KHP A;  3TRQ A;  4JZQ A;  4KSM A;  4O7H A;  1GSF A;  2JZR A;  2VO4 A;  2O8V B;  4F0C A;  3GNJ A;  1WMJ A;  3A2X A;  2HRA A;  1G0T A;  3HA9 A;  4BA7 A;  3LYP A;  2LQQ A;  2VM2 A;  3TJG A;  5DCH A;  2BJX A;  1K3O A;  2GVP A;  1Y25 A;  1XG8 A;  4JE1 A;  1SL1 B;  3LYK A;  2X8C A;  4H86 A;  2LQO A;  2R0P A;  5DVB A;  4HJ2 A;  2H1D A;  3ZYW A;  2FGX A;  1A23 A;  4JED A;  3CSH A;  5ENU A;  3RPN A;  1EOG A;  2H19 A;  4XS4 A;  2E2G A;  1ZL9 A;  3P2A A;  1MDJ A;  3D6I A;  4MAB A;  4KE3 A;  2GSR A;  5ABR A;  1EP7 A;  4Z7X A;  2CT6 A;  1DBY A;  1JZD A;  3LXT A;  1X5D A;  6GSX A;  3V1W A;  2HZE B;  4FO5 A;  3P7X A;  2AHE A;  2PBJ A;  3LG6 A;  1TDI A;  4TN8 A;  3TCO A;  5KN3 A;  3EUR A;  4FYU A;  4IP6 A;  2LNT A;  3HHV A;  2KUC A;  2H76 A;  5DAK B;  4XRA A;  1HQO A;  2ZCT A;  4N0Z A;  5F0G A;  2H72 A;  1GWC A;  4Z2R A;  5D96 A;  2YN1 A;  2V2G A;  1EZK A;  5FHI A;  2OBI A;  5ELG A;  1V98 A;  3MNG A;  4IBP A;  2OBK A;  2WUL A;  1E6B A;  3EPT A;  3M9K A;  2XPD A;  1MDK A;  4HZ4 A;  2DJ0 A;  1KBN A;  2QC7 A;  3DKS A;  2DJ1 A;  2JZT A;  1HNB A;  4WF4 A;  2E7P A;  2FNO A;  2I1U A;  1SK0 A;  2FY6 A;  1K0C A;  5HR1 A;  4DEJ A;  1AQV A;  4MF7 A;  2DC5 A;  1V9W A;  2VIM A;  4MMM A;  1OAZ A;  3HZ8 A;  3DGQ A;  5FWG A;  2OE3 A;  5DJL A;  3KH7 A;  3LXZ A;  3UAP A;  5COH A;  2MBS A;  1K0A A;  2CZ2 A;  1AUC A;  3TKQ A;  2E2M A;  1WRY A;  2EIQ A;  2VLT A;  3CRT A;  1ZZY A;  3VPT A;  4CDO A;  5ECN B;  2X99 A;  1W89 A;  1Z7R A;  4GST A;  1EEM A;  2FD3 A;  4JBB A;  4Z2T A;  5H5Q A;  2R5G A;  2WRT A;  3IR4 A;  2VCX A;  3IC8 A;  3ERF A;  4K8M A;  1PKZ A;  4FIW A;  5ECH B;  3HY2 A;  2TIR A;  8GSS A;  2K18 A;  1QQ2 A;  3U6V A;  3FHK A;  4Q5N A;  5B7C A;  5IMV A;  3F8U A;  1TI1 A;  3QD9 A;  4OFT A;  4EKZ A;  2LJR A;  1XCC A;  3FEU A;  1XZO A;  4EVM A;  2M72 A;  3UBK A;  4PQI A;  3E0U A;  1FW1 A;  2FCH A;  5DCG A;  3HCZ A;  2R37 A;  3APQ A;  3ZRD A;  4MDC A;  3J7Y k;  5ECO B;  4ML6 A;  4MLY A;  1QXH A;  4KCA A;  2X8H A;  5EY6 A;  1XFL A;  1G7O A;  3Q74 A;  4XS1 A;  5LCZ A;  2IL3 A;  3H93 A;  4ZL9 A;  1GTB A;  3GTU B;  2DKH A;  2H1A A;  1N8J A;  4L8E A;  4ZXG A;  5HR2 A;  2L59 A;  1WIK A;  2GGT A;  1O85 A;  2GT6 A;  2IN3 A;  1FB0 A;  1GTU A;  3ZMK A;  5DAL B;  1GSY A;  2CVD A;  2WFC A;  3WT1 A;  4V2L A;  5IPH A;  1TI3 A;  1R7H A;  2TRX A;  2OAC A;  3H79 A;  3BCK A;  1SYR A;  1YY7 A;  1RW1 A;  3CXG A;  1SYX A;  4O92 A;  4BIK A;  19GS A;  4L0U A;  5J3R A;  4BVY A;  4RQR A;  5D9T A;  18GS A;  1TRU A;  2GSQ A;  2H75 A;  3ME7 A;  4GCI A;  4PQH A;  3W8S A;  2WDU A;  4POM A;  1NSW A;  2AJQ B;  3KH9 A;  4EF0 A;  5J4U A;  3APS A;  5IOX A;  1A0R P;  2JZS A;  1M3I A;  2HE3 A;  1T4Z A;  1GTA A;  3GKK A;  2OE1 A;  1FOH A;  3H1N A;  1C72 A;  2L57 A;  1SKS B;  4ULX A;  3I9V 2;  4ECB A;  3IHG A;  2KLX A;  1SKR B;  1SD8 A;  4GQC A;  3R3E A;  2XBI A;  2KP1 A;  3EE2 A;  1VGL A;  1XVQ A;  4CHS A;  3IK9 A;  1Y6E A;  13GS A;  2PN8 A;  4I6X A;  2JAC A;  4A5P A;  2C0G A;  2V32 A;  1T3B A;  2TRC P;  1B4Q A;  3GTU A;  5IMD A;  2B5E A;  4ZB8 A;  1FG4 A;  1AAZ A;  4XTS A;  2I81 A;  1A24 A;  3IE3 A;  2VCZ A;  1U6T A;  2R4V A;  4BPY A;  4IEL A;  4PUF C;  5LD0 A;  1WE0 A;  4AJ8 A;  1WJK A;  3RPP A;  3LSZ A;  5CRD A;  1M7T A;  3GSS A;  3WT2 A;  2H0H A;  4MJB A;  3JCM L;  5G2Z A;  3KJY A;  3QFA C;  3C73 A;  2L4Q A;  3TKS E;  2GS3 A;  5JWR B;  1VF1 A;  3ZIJ A;  3GH9 A;  2AYT A;  2HNL A;  1B48 A;  1SJZ A;  3GA4 A;  1XXU A;  4HU9 A;  3IDV A;  3TUE A;  3C1R A;  4V1A g;  3BD2 A;  2CAQ A;  1ZYN A;  4K2D A;  4IQ1 A;  5D8I A;  2IPA A;  2VL3 A;  1FOV A;  2F51 A;  2YNX A;  2E0Q A;  3CQF A;  4KX4 A;  4EO3 A;  2IIY A;  4FQU A;  2YV9 A;  3QAG A;  3MSZ A;  3BJ5 A;  3SWL A;  3M0F A;  3UVT A;  1XW6 A;  5JCG A;  6GSV A;  3VFI A;  1W4V A;  1GSQ A;  3QCP A;  3ME8 A;  5DBQ A;  5GAN D;  1G7E A;  2P5R A;  2DJ3 A;  1V40 A;  2HI7 A;  3UVH A;  4Q5R A;  1THO A;  1ZOF A;  1GP1 A;  1EEJ A;  4RQX A;  4ZB6 A;  4ZBB A;  2LEG A;  3VWU A;  1PSQ A;  1PFO A;  5IO2 A;  1A2M A;  2PPT A;  4ZIJ A;  2XBQ A;  2HZF A;  3TKS C;  2IMK A;  2WJU A;  1U88 A;  4LMV A;  5IMZ A;  2H6Z A;  1QUW A;  2B5Y A;  3D21 A;  2K8S A;  4ISD A;  2CZ3 A;  2PGT A;  4K5S A;  4G10 A;  5AIX A;  3F9U A;  2UZ8 A;  5E4W A;  1NHO A;  3TRX A;  2L4C A;  5INY A;  4P3Y B;  3E9J B;  4EIQ A;  2B1K A;  4TOP A;  5HFI A;  4V2M A;  4BVX B;  4PUR A;  3R2Q A;  2DIZ A;  1BYE A;  5G30 A;  2IJY A;  2C80 A;  1M2B A;  4O32 A;  1SJI A;  3DVW A;  4N30 A;  2VD1 A;  3QFB C;  4PNG A;  3GYK A;  2C4J A;  1YDK A;  5CRG A;  11GS A;  4MPG A;  1TKD B;  3FZ9 A;  5EL8 A;  4L5L A;  16GS A;  2EIR A;  1K0B A;  4MZW A;  5C00 A;  2FUG 2;  4K7O A;  4KND A;  2LS5 A;  3FZA A;  2H71 A;  2RM5 A;  3BCI A;  3GL3 A;  1AIU A;  1B9Y C;  2DKI A;  5F06 A;  7GSS A;  2C0F A;  3FMW A;  4XS4 B;  4TRX A;  2B5X A;  1YEP A;  2GDR A;  2H1B A;  1WP0 A;  3M8N A;  9GSS A;  1M2A A;  1AW9 A;  1GNW A;  3TOT A;  4HJM A;  1MEK A;  1Z9H A;  3EC3 A;  1PD2 1;  1I9D A;  2QA2 A;  4MZB A;  1A2J A;  3FR9 A;  1AQX A;  4MF6 A;  2B1L A;  1TW9 A;  3D5J A;  5A4V A;  1K3L A;  1SEN A;  4NHZ A;  1Q4J A;  1T1V A;  5ID2 B;  1EOH A;  5KEJ A;  3MWH A;  2H66 A;  4X43 A;  4BVX A;  4NHW A;  3Q6O A;  4MH2 A;  2O85 A;  5ECM B;  4E8E A;  3HVV A;  1Z6M A;  3CSJ A;  3HVX A;  4K0N A;  2R2J A;  2ZUP A;  2HXK A;  2DBC A;  2GZZ A;  3ISO A;  4JU5 A;  4TXO A;  2K9F A;  2FWG A;  5J41 A;  2H0G A;  3EYT A;  1WWJ A;  3I43 A;  4TW5 A;  4GSS A;  2LKU A;  1I5G A;  2WGR A;  4JRR A;  4EIP A;  5GAP D;  3IAM 2;  1S3R A;  4TXV A;  5DQS A;  4IW9 A;  4OO4 A;  1HD2 A;  2O89 A;  5KN1 A;  2V6O A;  2KP2 A;  5E59 A;  1S3D A;  2M46 A;  3UL3 A;  3HYP A;  2R0C A;  4GSN A;  2X4A A;  1DUG A;  1GUK A;  1KTE A;  5LNK e;  5ECP B;  5AIV A;  3ED3 A;  3C71 A;  1QGV A;  4K7I A;  4LA1 A;  1BX9 A;  2G2Q A;  5IQY A;  3KIJ A;  2LJA A;  4AF2 A;  3ZVJ D;  3KZQ A;  2HRF A;  4FYB A;  3RBT A;  2H1G A;  4OCF A;  3F4T A;  4GF0 A;  4DVC A;  2VCQ A;  1PX6 A;  1RK4 A;  1PQN A;  3G9B A;  2O87 A;  3CRU A;  5ID2 A;  1K0O A;  1JLV A;  4GRF A;  4GLT A;  1U3I A;  3LOR A;  4OCE A;  4YKF A;  5IOW A;  2CAI A;  1UA5 A;  2H70 A;  1O73 A;  3H4K A;  1CQG A;  3DML A;  2GTU A;  4YAV A;  3F0I A;  2CVB A;  4I5Q A;  2VD0 A;  1GLP A;  1USB A;  1SU9 A;  3KEB A;  1JFU A;  2DML A;  3GIX A;  1YZX A;  2MMZ A;  2B6M A;  2L5O A;  2PVO C;  3IC4 A;  4EUY A;  1FVJ A;  4ECI A;  5AN1 A;  3OR5 A;  2AV4 A;  2FWF A;  3DRN A;  4MJA A;  3A5I A;  4JR6 A;  2ZNM A;  2HLS A;  1TK0 B;  2JU5 A;  3LQ7 A;  1DE2 A;  4BVY B;  5JCU A;  1YKC A;  2LJK A;  1T00 A;  1YKA A;  2YWM A;  2OKA A;  1Z6N A;  4EE0 A;  2C0E A;  5G1L A;  4AJ7 A;  2C8U A;  1SD9 A;  2VL2 C;  2N5F A;  4XCS A;  5G5F A;  1O8W A;  2ON7 A;  5HR3 A;  4KB3 A;  5G1K A;  4WEY A;  1GSS A;  3M9J A;  5J9C A;  4YQU A;  1UVZ A;  2YCD A;  4K0G A;  2CX4 A;  1YJ6 A;  4KDU A;  1FAA A;  4BWQ A;  1PL1 A;  3G7J A;  3F4R A;  4NXI A;  4F03 A;  4X1U A;  2YJH A;  5ELA A;  2JAD A;  3UAR A;  3GV1 A;  3CTF A;  3QAV A;  2PMT A;  3KM6 A;  3NZN A;  4RI6 A;  3ZVJ A;  1BQ7 A;  5IMC A;  4OFN A;  2DSA A;  3F63 A;  1XPV A;  2NVL A;  3FR6 A;  3TGZ A;  1DSB A;  1UN2 A;  4POL A;  2LST A;  1LU4 A;  2G0F A;  4TKY A;  3ZRE A;  1O7U A;  3DVX A;  3TKR A;  5CO3 A;  4G0I A;  2C3N A;  3O76 A;  6GST A;  2HFD A;  1F2E A;  1SL2 B;  3VWX A;  1S3A A;  3S9F A;  3M3M A;  1TK5 B;  3APO A;  2PVQ A;  4ICY A;  5KOW A;  5D73 A;  4J56 E;  5EVO A;  4PXO A;  3IRA A;  3RDW A;  1ERT A;  1SK1 A;  4KH7 A;  2F8F A;  3F6D A;  2LRN A;  3NIV A;  1THX A;  2V6K A;  3KXO A;  4TVE A;  3A2V A;  3TKS A;  3VLN A;  2F8A A;  1HNA A;  1G6Y A;  1XIY A;  1TRV A;  2VL9 A;  3A2W A;  2WB9 A;  3UIW A;  2X64 A;  4BL7 B;  2C1Y A;  2NDO A;  4PGT A;  4YQM A;  2N5A A;  2V1M A;  1OE8 A;  3EVI A;  3CBU A;  4G2E A;  3CTG A;  2X49 A;  4ML1 A;  3ZZX A;  3FRC A;  4N10 A;  3QAW A;  3IAS 2;  3I6A A;  2C3Q A;  2HRN A;  4DSQ A;  4XRD A;  1EGO A;  3BBY A;  1S3C A;  4L5O A;  1NW2 A;  3N5O A;  4AJ6 A;  4WXT A;  1PA3 A;  1ZGN A;  2H0I A;  1TRS A;  3PPU A;  2GZY A;  3IXR A;  4V1A p;  1VF4 A;  22GS A;  1QFN A;  20GS A;  1OKT A;  1A8L A;  3W8J A;  2DIY A;  1F3B A;  4DSS A;  5ECK B;  3LFL A;  2YZH A;  3TJJ A;  3MIX A;  2YV7 A;  3HVS A;  2O7K A;  2L6C A;  4J57 E;  1SK2 A;  3HXS A;  4I97 A;  2HYX A;  3DWV A;  4PX1 A;  4O5Q A;  2H8L A;  1GRX A;  1O8X A;  5D93 A;  4G9H A;  4AGS A;  2ON5 A;  3FYG A;  4HS1 A;  3MYD A;  1JZW A;  1YQ1 A;  3PR8 A;  4BL7 A;  1K0D A;  2YWO A;  3PIN A;  4GXZ A;  4POK A;  1XWK A;  4YAP A;  3GX8 A;  1VF3 A;  5ECI B;  4CY8 A;  2H01 A;  1O6J A;  5JWQ B;  2XPE A;  3UOM A;  1U3A A;  3FZ4 A;  5DDL A;  1GSE A;  1F37 A;  1BAY A;  2J23 A;  2K8V A;  4MCU A;  3GUS A;  1ML6 A;  1HNC A;  6GSW A;  2R6K A;  1X9M B;  4Q5Q A;  1JLW A;  2A2S A;  1K3Y A;  5ECR B;  2RII A;  4IJ3 A;  3WGX A;  1ILO A;  4OWY A;  3GKN A;  2A2P A;  2L5L A;  1F3A A;  4K2X A;  3HJM A;  2VLV A;  5GZZ B;  1J0F A;  4MK3 A;  4Z2U A;  2GT5 A;  4HSC X;  4HZ2 A;  2PWJ A;  4K6X A;  1PGT A;  1MD4 A;  2FA4 A;  2H6X A;  2MMN A;  2REM A;  4WKW A;  4I2T A;  2DJK A;  4HUA A;  1JHB A;  1NHY A;  2YWN A;  3KP9 A;  5J9B A;  2A4H A;  4IKH A;  1OC3 A;  3HVN A;  4PUA A;  4K9Z A;  2GST A;  3MAK A;  5GST A;  1OC9 A;  5A4W A;  2CQ9 A;  3ZL5 A;  4MP4 A;  5HFG A; 
#chains in the Genus database with same CATH homology
 4QL7 A;  1M2D A;  1V57 A;  4OD7 A;  1ZYE A;  3L4N A;  2HRK A;  3FR3 A;  4WR4 A;  1SJ6 A;  4KDY A;  2CV4 A;  2ES7 A;  1VF2 A;  3FKF A;  4TXO B;  2KOK A;  3UBL A;  2GQL A;  5J5N A;  5H5S A;  2EC4 A;  2XC2 A;  2HSM A;  4LL1 B;  4ZIL A;  3VPQ A;  3TJF A;  17GS A;  2HSH A;  3RAZ A;  4IQA A;  1GTI A;  5CAX A;  1F9M A;  5B6M A;  4OMV A;  4RI7 A;  5A4U A;  4DSR A;  4QQ7 A;  3DEX A;  1XW5 A;  1K0M A;  1N2A A;  2IWT A;  3GUR A;  2MMO A;  5A5K A;  4IS0 A;  3EWL A;  2AUV A;  5HQP A;  1EP8 A;  1TU8 A;  3KTB A;  3LWA A;  4MJC A;  2NPB A;  4E8H A;  2IMD A;  4O5R A;  2DJ2 A;  2R3X A;  5KN2 A;  1OYJ A;  4K5R A;  3Q19 A;  3VWW A;  3US3 A;  1ERU A;  3D22 A;  4CY6 A;  2PU9 C;  2JSY A;  1DE1 A;  1EWX A;  4TR0 A;  3ZFB A;  4WBJ A;  4XHM A;  5BRT A;  1AC1 A;  3DXB A;  3WGE A;  3C1S A;  4POB A;  2VL2 A;  10GS A;  5FT3 A;  5IMF A;  1QMV A;  2JL4 A;  3TB2 A;  3LW9 A;  4GWR A;  1EV4 A;  1X9S B;  4I8B A;  5ECQ B;  3GRX A;  5CNW A;  3HJP A;  1WPI A;  3CMI A;  1XBS A;  2MZC A;  1URM A;  2LNS A;  3DD3 A;  4X4J A;  2J9H A;  4MPF A;  3WD6 A;  3IBH A;  3QMX A;  1A0F A;  5JCW A;  1IYI A;  5B8B A;  4PNF A;  1R5P A;  4Q5F A;  5D9X A;  3IK7 A;  3GKX A;  1JZO A;  2LTK A;  1ERW A;  2MYG A;  4HI7 A;  1PL2 A;  2OA7 A;  3Q18 A;  2FA8 A;  4MA9 A;  3WYW A;  4NPB A;  4MH3 A;  4LL4 B;  4LMW A;  1HYU A;  1E2Y A;  2LRT A;  3EMX A;  3GST A;  2XHF A;  2GQK A;  3CYN A;  4EC0 A;  3HJO A;  3ZLP A;  3C7M A;  4ZBA A;  2GSS A;  3TDG A;  2HT9 A;  1PN9 A;  4EDZ A;  2V41 A;  1TRW A;  2RLI A;  3GMF A;  2CX3 A;  2JSZ A;  5GSS A;  1FO5 A;  4NAX A;  1PMT A;  3IOS A;  3TKP A;  3LJR A;  1NM3 A;  2VCT A;  1TTZ A;  2CA8 A;  2IFQ A;  4XS6 A;  1IYH A;  1OE7 A;  5D9W A;  4G0K A;  3ZFL A;  3QR6 A;  1QK8 A;  2MBT A;  4TR1 A;  1U87 A;  2M80 A;  5G5E A;  3GX0 A;  4MF5 A;  3HKR A;  5DQY A;  1XOA A;  3E3E A;  1V2A A;  3IV4 A;  4EDY A;  2OE0 A;  4ZL7 A;  2P0G A;  2FHE A;  4IGJ A;  5IMA A;  4PTS A;  3F3R A;  4KSO A;  5BMU A;  5IPG A;  1WOU A;  3AY8 A;  2H30 A;  3FY7 A;  4KAE A;  5D9V A;  1LBK A;  3TJB A;  4WET A;  1XW9 A;  1PN0 A;  4KGI A;  1MD3 A;  1A2L A;  4KF9 A;  1ZYP A;  3TOU A;  3H8Q A;  3KCM A;  3LGC A;  4NV2 A;  3GN3 A;  3P8W A;  5AIS A;  1ST9 A;  4TR3 A;  3EU4 A;  6GSS A;  1AXD A;  4FH8 A;  1ZMA A;  5JWO B;  4HQZ A;  4F2I A;  2ALB A;  2HZE A;  4WR5 A;  1SL0 B;  3DIE A;  5IIZ A;  1GUH A;  1KEB A;  3KD0 A;  5C04 A;  1MDI A;  4OO5 A;  4HOJ A;  2OJL A;  5DAK A;  4NWY A;  2QGV A;  3BOA A;  3G7Y A;  3L9U A;  3MDK A;  2PER A;  1PX7 A;  5DJM A;  4KUN A;  3IA1 A;  5CRE A;  1YF1 A;  2LV3 A;  1B8X A;  4ILF A;  4F82 A;  3SBC A;  3VWV A;  3PH9 A;  3ERG A;  4F0B A;  5F07 A;  3IPZ A;  2RM6 A;  2X8G A;  1GLQ A;  4MZC A;  4V2N A;  2C3T A;  4HEA 2;  3WGD A;  1XWB A;  1GL8 A;  4DSS B;  2VUP A;  1ZYQ B;  2LUS A;  1PKW A;  1Z5Y E;  5ECL B;  1J08 A;  2K6V A;  4GTU A;  2HSY A;  2GQM A;  2WZ9 A;  1GUL A;  4I2U A;  1ACV A;  3CSI A;  2QKE A;  4LLR A;  4ECJ A;  3UEM A;  4ZBD A;  4IN0 A;  1GSD A;  1GSU A;  2YPM A;  2FWE A;  1XWC A;  2L6D A;  1SKW B;  1TXX A;  3GH6 A;  3U5R E;  3O3T A;  1TU7 A;  1V58 A;  3VI5 A;  3ZML A;  4YH2 A;  5IO0 A;  4EL1 A;  1KNG A;  2D2Z A;  2EIO A;  1TP9 A;  4USS A;  2F9S A;  5CRW A;  4D73 B;  4F9Z A;  4IJI A;  5HR0 A;  4QL9 A;  3DYR A;  12GS A;  1B9X C;  4IVF A;  2YJ7 A;  4WBR D;  1F6M C;  2H73 A;  3D4T A;  5H5R A;  4PQ1 A;  1CQH A;  4HDE A;  5CRH A;  1BG5 A;  1EGR A;  1TJD A;  2P31 A;  5CP1 A;  3EU3 A;  2YP6 A;  2VCV A;  1JZR A;  4ZL8 A;  2GZP A;  3LEF A;  1O81 A;  2I4A A;  4NMU A;  1A8Y A;  5L71 A;  3VUR A;  1GH2 A;  2DLX A;  4MNN A;  2QSI A;  4EXJ A;  1XVW A;  2VOC A;  2QA1 A;  1X5E A;  1Q98 A;  4ZB9 A;  5HFK A;  1R26 A;  5DAL A;  1B4P A;  3RHB A;  2WS2 A;  1H75 A;  1XOB A;  1AQW A;  5AGY A;  1M9A A;  3F3Q A;  1OC9 B;  3F4S A;  4RUV A;  2YOI A;  3VK9 A;  4KCE A;  3W6G A;  4ID0 A;  1RQM A;  2PUK C;  3F6F A;  14GS A;  1G6W A;  1UC7 A;  4YQV A;  2AAW A;  1ERV A;  1XWA A;  4D73 A;  3D4M A;  4WF5 A;  2RUF A;  5F05 A;  6GSU A;  1FHE A;  1GUM A;  1T4Y A;  3N9J A;  3FK8 A;  3HDC A;  1X9W B;  1EV9 A;  1OKD A;  3A3T A;  2IME A;  5G31 A;  3TJK A;  4NV5 A;  4ACS A;  2VAF A;  1M99 A;  4GQF A;  2BTO T;  1OC8 A;  4N0V A;  3UJ1 A;  3FZ5 A;  3O6T A;  3D0Z A;  4O5U A;  2CVK A;  5B6N A;  2MMA A;  4CW9 A;  3G7I A;  1J9B A;  2BMX A;  5EPF A;  1T7P B;  3ZIT A;  1BED A;  3QOU A;  3KTL A;  1M0U A;  2A2R A;  1YF0 A;  3EIN A;  1K0N A;  4YKG A;  3QPM A;  1X0R A;  1BJX A;  3GHA A;  5ECS A;  4IP1 A;  5KN0 A;  5IM9 A;  2C0D A;  2I3Y A;  4G0L A;  3A5W A;  5B8A A;  2GLR A;  3L78 A;  3KMN A;  3ERW A;  4HU7 A;  1LJR A;  3GL5 A;  3FW2 A;  2B7K A;  3IHQ A;  3RHC A;  4K7N A;  2H74 A;  1M9B A;  1H4O A;  4JR4 A;  1TK8 B;  2IMF A;  6GSY A;  3GFK A;  2A4V A;  4ECC A;  1R5A A;  3KP8 A;  1Z3E A;  3PGT A;  3VI7 A;  4L0W A;  3L0H A;  2N5B A;  4XIH A;  4J2F A;  1VRS D;  4OFM A;  2NTO A;  2Z9S A;  3HZ4 A;  4FYC A;  2OAD A;  1X5C A;  2P5Q A;  4KDX A;  3GKM A;  3ZTL A;  4KA0 A;  2AB6 A;  2B3S A;  2F3M A;  2YWI A;  1T8E B;  2IMI A;  4IHU A;  2WCI A;  2DJJ A;  3NOF A;  3L9S A;  4HQS A;  4K1F A;  3ZIV A;  1XWG A;  4X0X A;  1Z7P A;  2R0G A;  1MTC A;  1ZCP A;  2B7J A;  1TOF A;  3C8E A;  5F8B A;  3P90 A;  3J7Y b;  1PRX A;  2YZU A;  4KW6 A;  3HD5 A;  2H6Y A;  2YAN A;  1GNE A;  1ABA A;  5CYY A;  2DMM A;  2I9H A;  4TR4 A;  4MJE A;  2RUE A;  3KMO A;  2LRC A;  5KOX A;  2FLS A;  3UMA A;  3TRP A;  1YEX A;  4N11 A;  4G19 A;  1ON4 A;  3QDN A;  3K8N A;  1FB6 A;  3L9V A;  2IFQ B;  3M1G A;  2VLU A;  3I69 A;  1R4W A;  2VM1 A;  3EMP A;  2FWH A;  1OVN A;  2VCW A;  4BWS A;  1FVK A;  4TR1 B;  3KGK A;  2NBS A;  2KHP A;  3TRQ A;  4JZQ A;  4KSM A;  4O7H A;  1GSF A;  2JZR A;  2VO4 A;  2O8V B;  4F0C A;  3GNJ A;  1WMJ A;  3A2X A;  2HRA A;  1G0T A;  3HA9 A;  4BA7 A;  3LYP A;  2LQQ A;  2VM2 A;  3TJG A;  5DCH A;  2BJX A;  1K3O A;  2GVP A;  1Y25 A;  4JE1 A;  1SL1 B;  3LYK A;  2X8C A;  4H86 A;  2LQO A;  2R0P A;  5DVB A;  4HJ2 A;  2H1D A;  3ZYW A;  2FGX A;  1A23 A;  4JED A;  3CSH A;  5ENU A;  3RPN A;  1EOG A;  2H19 A;  4XS4 A;  2E2G A;  1ZL9 A;  3P2A A;  1MDJ A;  3D6I A;  4MAB A;  4KE3 A;  2GSR A;  5ABR A;  1EP7 A;  4Z7X A;  2CT6 A;  1DBY A;  1JZD A;  3LXT A;  1X5D A;  6GSX A;  3V1W A;  2HZE B;  4FO5 A;  3P7X A;  2AHE A;  2PBJ A;  3LG6 A;  1TDI A;  4TN8 A;  3TCO A;  5KN3 A;  3EUR A;  4FYU A;  4IP6 A;  2LNT A;  3HHV A;  2KUC A;  2H76 A;  5DAK B;  4XRA A;  1HQO A;  2ZCT A;  4N0Z A;  5F0G A;  2H72 A;  1GWC A;  4Z2R A;  5D96 A;  2YN1 A;  2V2G A;  1EZK A;  5FHI A;  2OBI A;  5ELG A;  1V98 A;  3MNG A;  4IBP A;  2OBK A;  2WUL A;  1E6B A;  3EPT A;  3M9K A;  2XPD A;  1MDK A;  4HZ4 A;  2DJ0 A;  1KBN A;  2QC7 A;  3DKS A;  2DJ1 A;  2JZT A;  1HNB A;  4WF4 A;  2E7P A;  2FNO A;  2I1U A;  1SK0 A;  2FY6 A;  1K0C A;  5HR1 A;  4DEJ A;  1AQV A;  4MF7 A;  2DC5 A;  1V9W A;  2VIM A;  4MMM A;  1OAZ A;  3HZ8 A;  3DGQ A;  5FWG A;  2OE3 A;  5DJL A;  3KH7 A;  3LXZ A;  3UAP A;  5COH A;  2MBS A;  1K0A A;  2CZ2 A;  1AUC A;  3TKQ A;  2E2M A;  1WRY A;  2EIQ A;  2VLT A;  3CRT A;  1ZZY A;  3VPT A;  4CDO A;  5ECN B;  2X99 A;  1W89 A;  1Z7R A;  4GST A;  1EEM A;  2FD3 A;  4JBB A;  4Z2T A;  5H5Q A;  2R5G A;  2WRT A;  3IR4 A;  2VCX A;  3IC8 A;  3ERF A;  4K8M A;  1PKZ A;  4FIW A;  5ECH B;  3HY2 A;  2TIR A;  8GSS A;  2K18 A;  1QQ2 A;  3U6V A;  3FHK A;  4Q5N A;  5B7C A;  5IMV A;  3F8U A;  1TI1 A;  3QD9 A;  4OFT A;  4EKZ A;  2LJR A;  1XCC A;  3FEU A;  1XZO A;  4EVM A;  2M72 A;  3UBK A;  4PQI A;  3E0U A;  1FW1 A;  2FCH A;  5DCG A;  3HCZ A;  2R37 A;  3APQ A;  3ZRD A;  4MDC A;  3J7Y k;  5ECO B;  4ML6 A;  4MLY A;  1QXH A;  4KCA A;  2X8H A;  5EY6 A;  1XFL A;  1G7O A;  3Q74 A;  4XS1 A;  5LCZ A;  2IL3 A;  3H93 A;  4ZL9 A;  1GTB A;  3GTU B;  2DKH A;  2H1A A;  1N8J A;  4L8E A;  4ZXG A;  5HR2 A;  2L59 A;  1WIK A;  2GGT A;  1O85 A;  2GT6 A;  2IN3 A;  1FB0 A;  1GTU A;  3ZMK A;  5DAL B;  1GSY A;  2CVD A;  2WFC A;  3WT1 A;  4V2L A;  5IPH A;  1TI3 A;  1R7H A;  2TRX A;  2OAC A;  3H79 A;  3BCK A;  1SYR A;  1YY7 A;  1RW1 A;  3CXG A;  1SYX A;  4O92 A;  19GS A;  4L0U A;  5J3R A;  4BVY A;  4RQR A;  5D9T A;  18GS A;  1TRU A;  2GSQ A;  2H75 A;  3ME7 A;  4GCI A;  4PQH A;  3W8S A;  2WDU A;  4POM A;  1NSW A;  2AJQ B;  3KH9 A;  4EF0 A;  5J4U A;  3APS A;  5IOX A;  1A0R P;  2JZS A;  2HE3 A;  1T4Z A;  1GTA A;  3GKK A;  2OE1 A;  1FOH A;  3H1N A;  1C72 A;  2L57 A;  1SKS B;  4ULX A;  3I9V 2;  4ECB A;  3IHG A;  2KLX A;  1SKR B;  1SD8 A;  4GQC A;  3R3E A;  2XBI A;  2KP1 A;  3EE2 A;  1VGL A;  1XVQ A;  4CHS A;  3IK9 A;  1Y6E A;  13GS A;  2PN8 A;  4I6X A;  2JAC A;  4A5P A;  2C0G A;  2V32 A;  1T3B A;  2TRC P;  1B4Q A;  3GTU A;  5IMD A;  2B5E A;  4ZB8 A;  1FG4 A;  1AAZ A;  4XTS A;  2I81 A;  1A24 A;  3IE3 A;  2VCZ A;  1U6T A;  2R4V A;  4BPY A;  4IEL A;  4PUF C;  5LD0 A;  1WE0 A;  4AJ8 A;  1WJK A;  3RPP A;  3LSZ A;  5CRD A;  1M7T A;  3GSS A;  3WT2 A;  2H0H A;  4MJB A;  3JCM L;  5G2Z A;  3KJY A;  3QFA C;  3C73 A;  2L4Q A;  3TKS E;  2GS3 A;  5JWR B;  1VF1 A;  3ZIJ A;  3GH9 A;  2AYT A;  2HNL A;  1B48 A;  1SJZ A;  3GA4 A;  1XXU A;  4HU9 A;  3IDV A;  3TUE A;  3C1R A;  4V1A g;  3BD2 A;  2CAQ A;  1ZYN A;  4K2D A;  4IQ1 A;  5D8I A;  2IPA A;  2VL3 A;  1FOV A;  2F51 A;  2YNX A;  2E0Q A;  4KX4 A;  4EO3 A;  2IIY A;  4FQU A;  2YV9 A;  3QAG A;  3MSZ A;  3BJ5 A;  3SWL A;  3M0F A;  3UVT A;  1XW6 A;  5JCG A;  6GSV A;  3VFI A;  1W4V A;  1GSQ A;  3QCP A;  3ME8 A;  5DBQ A;  5GAN D;  1G7E A;  2P5R A;  2DJ3 A;  1V40 A;  2HI7 A;  3UVH A;  4Q5R A;  1THO A;  1ZOF A;  1GP1 A;  1EEJ A;  4RQX A;  4ZB6 A;  4ZBB A;  2LEG A;  3VWU A;  1PSQ A;  5IO2 A;  1A2M A;  2PPT A;  4ZIJ A;  2XBQ A;  2HZF A;  3TKS C;  2IMK A;  2WJU A;  1U88 A;  4LMV A;  5IMZ A;  2H6Z A;  1QUW A;  2B5Y A;  3D21 A;  2K8S A;  4ISD A;  2CZ3 A;  2PGT A;  4K5S A;  4G10 A;  5AIX A;  3F9U A;  2UZ8 A;  5E4W A;  1NHO A;  3TRX A;  2L4C A;  5INY A;  4P3Y B;  3E9J B;  4EIQ A;  2B1K A;  4TOP A;  5HFI A;  4V2M A;  4BVX B;  4PUR A;  3R2Q A;  2DIZ A;  1BYE A;  5G30 A;  2IJY A;  2C80 A;  1M2B A;  4O32 A;  1SJI A;  3DVW A;  4N30 A;  2VD1 A;  3QFB C;  4PNG A;  3GYK A;  2C4J A;  1YDK A;  5CRG A;  11GS A;  4MPG A;  1TKD B;  3FZ9 A;  5EL8 A;  4L5L A;  16GS A;  2EIR A;  1K0B A;  4MZW A;  5C00 A;  2FUG 2;  4K7O A;  4KND A;  2LS5 A;  3FZA A;  2H71 A;  2RM5 A;  3BCI A;  3GL3 A;  1AIU A;  1B9Y C;  2DKI A;  5F06 A;  7GSS A;  2C0F A;  3FMW A;  4XS4 B;  4TRX A;  2B5X A;  1YEP A;  2GDR A;  2H1B A;  1WP0 A;  3M8N A;  9GSS A;  1M2A A;  1AW9 A;  1GNW A;  3TOT A;  4HJM A;  1MEK A;  1Z9H A;  3EC3 A;  1PD2 1;  1I9D A;  2QA2 A;  4MZB A;  1A2J A;  3FR9 A;  1AQX A;  4MF6 A;  2B1L A;  1TW9 A;  3D5J A;  5A4V A;  1K3L A;  1SEN A;  4NHZ A;  1Q4J A;  1T1V A;  5ID2 B;  1EOH A;  5KEJ A;  3MWH A;  2H66 A;  4X43 A;  4BVX A;  4NHW A;  3Q6O A;  4MH2 A;  2O85 A;  5ECM B;  4E8E A;  3HVV A;  1Z6M A;  3CSJ A;  3HVX A;  4K0N A;  2R2J A;  2ZUP A;  2HXK A;  2DBC A;  2GZZ A;  3ISO A;  4JU5 A;  4TXO A;  2K9F A;  2FWG A;  5J41 A;  2H0G A;  3EYT A;  1WWJ A;  3I43 A;  4TW5 A;  4GSS A;  2LKU A;  1I5G A;  2WGR A;  4JRR A;  4EIP A;  5GAP D;  3IAM 2;  4TXV A;  5DQS A;  4IW9 A;  4OO4 A;  1HD2 A;  2O89 A;  5KN1 A;  2V6O A;  2KP2 A;  5E59 A;  1S3D A;  2M46 A;  3UL3 A;  3HYP A;  2R0C A;  4GSN A;  2X4A A;  1DUG A;  1GUK A;  1KTE A;  5LNK e;  5ECP B;  5AIV A;  3ED3 A;  3C71 A;  1QGV A;  4K7I A;  4LA1 A;  1BX9 A;  2G2Q A;  5IQY A;  3KIJ A;  2LJA A;  4AF2 A;  3ZVJ D;  3KZQ A;  2HRF A;  4FYB A;  3RBT A;  2H1G A;  4OCF A;  3F4T A;  4GF0 A;  4DVC A;  2VCQ A;  1PX6 A;  1RK4 A;  1PQN A;  3G9B A;  2O87 A;  3CRU A;  5ID2 A;  1K0O A;  1JLV A;  4GRF A;  4GLT A;  1U3I A;  3LOR A;  4OCE A;  4YKF A;  5IOW A;  2CAI A;  1UA5 A;  2H70 A;  1O73 A;  3H4K A;  1CQG A;  3DML A;  2GTU A;  4YAV A;  3F0I A;  2CVB A;  4I5Q A;  2VD0 A;  1GLP A;  1USB A;  1SU9 A;  3KEB A;  1JFU A;  2DML A;  3GIX A;  1YZX A;  2MMZ A;  2B6M A;  2L5O A;  2PVO C;  3IC4 A;  4EUY A;  1FVJ A;  4ECI A;  5AN1 A;  3OR5 A;  2AV4 A;  2FWF A;  3DRN A;  4MJA A;  3A5I A;  4JR6 A;  2ZNM A;  2HLS A;  1TK0 B;  2JU5 A;  3LQ7 A;  1DE2 A;  4BVY B;  5JCU A;  1YKC A;  2LJK A;  1T00 A;  1YKA A;  2YWM A;  2OKA A;  1Z6N A;  4EE0 A;  2C0E A;  5G1L A;  4AJ7 A;  2C8U A;  1SD9 A;  2VL2 C;  2N5F A;  4XCS A;  5G5F A;  1O8W A;  2ON7 A;  5HR3 A;  4KB3 A;  5G1K A;  4WEY A;  1GSS A;  3M9J A;  5J9C A;  4YQU A;  1UVZ A;  2YCD A;  4K0G A;  2CX4 A;  1YJ6 A;  4KDU A;  1FAA A;  4BWQ A;  1PL1 A;  3G7J A;  3F4R A;  4NXI A;  4F03 A;  4X1U A;  2YJH A;  5ELA A;  2JAD A;  3UAR A;  3GV1 A;  3CTF A;  3QAV A;  2PMT A;  3KM6 A;  3NZN A;  4RI6 A;  3ZVJ A;  1BQ7 A;  5IMC A;  4OFN A;  2DSA A;  3F63 A;  1XPV A;  2NVL A;  3FR6 A;  3TGZ A;  1DSB A;  1UN2 A;  4POL A;  2LST A;  1LU4 A;  2G0F A;  4TKY A;  3ZRE A;  1O7U A;  3DVX A;  3TKR A;  5CO3 A;  4G0I A;  2C3N A;  3O76 A;  6GST A;  2HFD A;  1F2E A;  1SL2 B;  3VWX A;  1S3A A;  3S9F A;  3M3M A;  1TK5 B;  3APO A;  2PVQ A;  4ICY A;  5KOW A;  5D73 A;  4J56 E;  5EVO A;  4PXO A;  3IRA A;  3RDW A;  1ERT A;  1SK1 A;  4KH7 A;  2F8F A;  3F6D A;  2LRN A;  3NIV A;  1THX A;  2V6K A;  3KXO A;  4TVE A;  3A2V A;  3TKS A;  3VLN A;  2F8A A;  1HNA A;  1G6Y A;  1XIY A;  1TRV A;  2VL9 A;  3A2W A;  2WB9 A;  3UIW A;  2X64 A;  4BL7 B;  2C1Y A;  2NDO A;  4PGT A;  4YQM A;  2N5A A;  2V1M A;  1OE8 A;  3EVI A;  3CBU A;  4G2E A;  3CTG A;  2X49 A;  4ML1 A;  3ZZX A;  3FRC A;  4N10 A;  3QAW A;  3IAS 2;  3I6A A;  2C3Q A;  2HRN A;  4DSQ A;  4XRD A;  1EGO A;  3BBY A;  1S3C A;  4L5O A;  1NW2 A;  3N5O A;  4AJ6 A;  4WXT A;  1PA3 A;  1ZGN A;  2H0I A;  1TRS A;  3PPU A;  2GZY A;  3IXR A;  4V1A p;  1VF4 A;  22GS A;  1QFN A;  20GS A;  1OKT A;  1A8L A;  3W8J A;  2DIY A;  1F3B A;  4DSS A;  5ECK B;  3LFL A;  2YZH A;  3TJJ A;  3MIX A;  2YV7 A;  3HVS A;  2O7K A;  2L6C A;  4J57 E;  1SK2 A;  3HXS A;  4I97 A;  2HYX A;  3DWV A;  4PX1 A;  4O5Q A;  2H8L A;  1GRX A;  1O8X A;  5D93 A;  4G9H A;  4AGS A;  2ON5 A;  3FYG A;  4HS1 A;  3MYD A;  1JZW A;  1YQ1 A;  3PR8 A;  4BL7 A;  1K0D A;  2YWO A;  3PIN A;  4GXZ A;  4POK A;  1XWK A;  4YAP A;  3GX8 A;  1VF3 A;  5ECI B;  4CY8 A;  2H01 A;  1O6J A;  5JWQ B;  2XPE A;  3UOM A;  1U3A A;  3FZ4 A;  5DDL A;  1GSE A;  1F37 A;  1BAY A;  2J23 A;  2K8V A;  4MCU A;  3GUS A;  1ML6 A;  1HNC A;  6GSW A;  2R6K A;  1X9M B;  4Q5Q A;  1JLW A;  2A2S A;  1K3Y A;  5ECR B;  2RII A;  4IJ3 A;  3WGX A;  1ILO A;  4OWY A;  3GKN A;  2A2P A;  2L5L A;  1F3A A;  4K2X A;  3HJM A;  2VLV A;  5GZZ B;  1J0F A;  4MK3 A;  4Z2U A;  2GT5 A;  4HZ2 A;  2PWJ A;  4K6X A;  1PGT A;  1MD4 A;  2FA4 A;  2H6X A;  2MMN A;  2REM A;  4WKW A;  4I2T A;  2DJK A;  4HUA A;  1JHB A;  1NHY A;  2YWN A;  3KP9 A;  5J9B A;  2A4H A;  4IKH A;  1OC3 A;  4PUA A;  4K9Z A;  2GST A;  3MAK A;  5GST A;  1OC9 A;  5A4W A;  2CQ9 A;  3ZL5 A;  4MP4 A;  5HFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...