4P3YB

Crystal structure of acinetobacter baumannii dsba in complex with ef-tu
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
181
structure length
181
Chain Sequence
SNAAGKDYTVIANPGKVEVPGKIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Tu
publication title Structure of the Acinetobacter baumannii Dithiol Oxidase DsbA Bound to Elongation Factor EF-Tu Reveals a Novel Protein Interaction Site.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Translation/oxidoreductase
total genus 66
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4p3yB00
2KOKA 3ZL5A 1N8JA 4WETA 4P3YB 2FWHA 1AQXA 3A5WA 4CHSA 3U6VA 1YZXA 2YWIA 3M3MA 2IJYA 5B6MA 1O73A 4F9ZA 5LCZA 1SL2B 1W89A 5CRHA 2OE3A 5CRDA 1GUKA 1CQGA 3RHBA 3EE2A 4ZBAA 4Q5FA 4K7IA 1WIKA 1QFNA 2Z9SA 3PGTA 2I81A 3LJRA 4OFMA 3OR5A 4ULXA 1LJRA 5D93A 3KTLA 3KH7A 1JZOA 2M46A 1G6YA 2X99A 4TXOA 5IMVA 3GV1A 5CRWA 4E8HA 4IVFA 1O7UA 1A24A 3F4TA 1EP8A 4TVEA 1GLQA 5AIVA 4ZB8A 5ENUA 3O76A 4MABA 2H70A 2VM1A 3CSIA 3LXTA 1YKAA 2E7PA 4GSSA 3PH9A 4XS6A 4KDUA 1Z9HA 1SKSB 3E9JB 2L6CA 1GRXA 3CXGA 2GSSA 1AUCA 3BD2A 5LD0A 2ZNMA 1XW9A 1ZMAA 3DRNA 5ECOB 5L71A 1THXA 3GL3A 1MDIA 1NSWA 2V41A 2CVKA 4N0ZA 1UN2A 4LL1B 3TJGA 2VUPA 4I97A 1NM3A 2FWGA 3KMNA 3HCZA 4L5LA 3LQ7A 4N11A 4X1UA 2ZCTA 1YY7A 4H86A 1U87A 5G1LA 4MZBA 1EEMA 1T4ZA 1HNBA 1U6TA 2RUEA 3FZ9A 5KN3A 3LGCA 5F06A 1XIYA 1EGOA 2GTUA 1J0FA 1H4OA 2R4VA 2WULA 5GSTA 3SBCA 4MJAA 5F8BA 3IRAA 3FZ4A 1DE2A 2HRFA 3APSA 2JZRA 3UL3A 2HNLA 3IXRA 3F63A 3FEUA 4ZILA 5KN0A 4IP6A 3P90A 2ALBA 4NMUA 4V1Ap 1V98A 3ME7A 3UVHA 2I1UA 2A4VA 3Q6OA 2K8VA 2QKEA 4MP4A 2HSHA 4FYUA 1AXDA 4PNGA 1BAYA 20GSA 3J7Yb 3KM6A 1OKDA 4XTSA 3LYPA 4IHUA 2XPDA 5JCGA 5CYYA 5J9BA 2EIRA 1UVZA 1FOVA 1PA3A 12GSA 1M99A 3P2AA 2WRTA 1Z5YE 3HXSA 4J2FA 2XHFA 1T00A 4PXOA 1XW5A 2LTKA 5HR3A 4IQ1A 4TR1A 3KGKA 1IYHA 1QMVA 2BJXA 4HOJA 1U88A 4YQVA 2FD3A 1XZOA 4GSTA 3KP9A 3IAM2 3KH9A 3PR8A 3IDVA 1O8WA 5CNWA 3C1RA 4I5QA 2GZYA 3UAPA 2L57A 3HKRA 2XC2A 4G10A 2N5AA 2IFQA 1FG4A 2RLIA 4TRXA 2RM6A 4KA0A 3CRUA 1DUGA 3KJYA 2FWEA 2CAIA 2O89A 5DQSA 4EC0A 4L5OA 3MAKA 1THOA 1GTAA 4KUNA 4O32A 4OFNA 4MF7A 3GN3A 3QR6A 4ECCA 3QD9A 3DXBA 3GNJA 2ZUPA 4NV2A 4L0UA 1QK8A 2VD1A 2WS2A 3A2VA 2PMTA 1Z6NA 5IMDA 4DVCA 2CQ9A 2PGTA 3HDCA 3ZIVA 2JSYA 5G31A 1HD2A 2QGVA 1F2EA 4WXTA 5G5FA 2VCQA 1M2AA 4MJCA 1OE7A 4NHZA 2HLSA 3TCOA 1YEXA 4IJ3A 4MMMA 4J56E 4K8MA 3EURA 1LBKA 1A2JA 5F07A 2REMA 1QXHA 1FAAA 4ZB6A 5IMAA 2RUFA 2OBIA 1BQ7A 3CMIA 1XWKA 3HA9A 1IYIA 3GUSA 5JCUA 4KX4A 4ZBBA 3QPMA 4GQCA 5FHIA 3NZNA 4WBJA 4IELA 2AB6A 2GSQA 3FR6A 4EDZA 3FZ5A 5GZZB 1HQOA 2BTOT 1VRSD 1GH2A 1UC7A 1XOBA 2N5BA 4GQFA 1M2DA 3BBYA 1TU7A 1Z7PA 3ZMKA 4ZL9A 3ZMLA 4FO5A 4IJIA 2P31A 3IAS2 1X9MB 3EVIA 2P5QA 3DWVA 1A2LA 3VI5A 2P0GA 4MF5A 1UA5A 3BJ5A 3KIJA 4KAEA 3G7YA 5DCHA 1G0TA 2H1GA 4K0GA 4I2TA 3ZYWA 3UMAA 4EUYA 3HZ4A 4PGTA 5COHA 1SL0B 5DAKA 1Z6MA 1ZGNA 3IPZA 5D73A 4ACSA 2R37A 1ERTA 3F3QA 5D9TA 2H72A 2DJJA 4PUAA 4QQ7A 1F3BA 1GSEA 2LRCA 3WT1A 4XS4B 3EU3A 2R5GA 4MH3A 5B6NA 2H6YA 1VF4A 3IA1A 5F0GA 4EL1A 3UBLA 4EDYA 1ABAA 5E59A 3GKXA 3TJJA 3W8SA 3VFIA 1BEDA 1ZOFA 3LEFA 2YP6A 14GSA 18GSA 2AV4A 3D0ZA 1F3AA 1TRUA 2GQMA 3N5OA 3C7MA 4IQAA 2GZPA 1O6JA 5IPHA 4FYCA 5F05A 1TI3A 2EIQA 5CP1A 3GTUA 1CQHA 1QQ2A 1PN9A 1X0RA 5IMCA 4G2EA 5A5KA 2OE1A 2D2ZA 5G5EA 4BVYA 3H1NA 3UBKA 4N0VA 5D9VA 2P5RA 4K7OA 2VCVA 2KP1A 3F9UA 5CO3A 4TXOB 2R2JA 4GTUA 2YOIA 1T8EB 4LMWA 3U5RE 3M8NA 4HEA2 4XRDA 2VCZA 1AQWA 3FKFA 2YWNA 2YN1A 3WT2A 3KTBA 1EEJA 5AIXA 2F8AA 5ECHB 1A8LA 4DSSA 3KP8A 3FR9A 5G1KA 2YWOA 4NPBA 5B7CA 4ECJA 3GSSA 1K0NA 1PL1A 3QAWA 3V1WA 2B5XA 1FVJA 4BA7A 4JR4A 1DSBA 1X9SB 2AJQB 4L0WA 1EV4A 4L8EA 4IP1A 1K3LA 3DD3A 4NHWA 3LSZA 2LRTA 1VGLA 1WP0A 2H71A 2XBQA 3SWLA 3GFKA 1YF1A 3ERWA 3I9V2 3VWWA 5AGYA 3ZFLA 2DBCA 1E6BA 3WGXA 2E2GA 3D6IA 2QC7A 17GSA 4N10A 3I6AA 1NHOA 1JZRA 2HI7A 5CAXA 3JCML 5H5QA 1A2MA 3DMLA 5IQYA 1GL8A 3GYKA 1Y6EA 2VCTA 4D73A 4QL9A 1PKZA 4POBA 2DMMA 2IWTA 1BYEA 2JSZA 5GSSA 4GSNA 4BWQA 4PQHA 2OKAA 1ERWA 5AN1A 3TDGA 2R6KA 2OBKA 4Q5NA 2V2GA 1PQNA 1YDKA 2GGTA 5JWQB 3NIVA 1M0UA 1O81A 2J23A 2IL3A 3F3RA 2A2RA 3IK9A 4MPFA 2MMNA 2FWFA 2DJ3A 2ON7A 3FR3A 4POKA 4GWRA 3ED3A 4NWYA 2HRNA 2MBSA 1GLPA 1A0RP 3ZVJA 3HYPA 2NVLA 3VWVA 4OO4A 2DLXA 3Q18A 2WJUA 4GCIA 2B1KA 2YZHA 1W4VA 13GSA 3UOMA 1J08A 1I9DA 4N30A 5DQYA 2KP2A 1NHYA 4KCAA 1MD4A 4MPGA 3QDNA 1T7PB 1TK5B 1ON4A 4HDEA 1M9AA 3HVSA 4JE1A 3M9KA 4V2MA 1F6MC 3M1GA 1PMTA 3QMXA 2AYTA 4XIHA 1GWCA 4JEDA 3AY8A 2L6DA 4TR3A 5IPGA 4TR1B 1JLVA 1R7HA 3RDWA 4EVMA 1EWXA 1B9YC 2GDRA 3GHAA 4XHMA 1TW9A 2VL9A 2LNSA 1K3YA 3BOAA 2MZCA 6GSXA 4OD7A 1SD9A 1SJ6A 2H6XA 3EU4A 4IS0A 2JZTA 2C4JA 2CVBA 3GH6A 2CX3A 2IFQB 4MLYA 4G9HA 7GSSA 3QOUA 3GH9A 4BWSA 3TRPA 3MWHA 5D9WA 3IOSA 2GSRA 2I9HA 3LYKA 4O7HA 4K7NA 1JLWA 4X0XA 4HU9A 2PWJA 2F51A 3TGZA 1XWCA 1BX9A 4X43A 5C00A 3DGQA 4YQMA 2PU9C 2KUCA 5IOXA 1G7EA 3M9JA 3HY2A 4HZ4A 5ID2A 2K8SA 4K2DA 4YH2A 4LMVA 2X8HA 3GX0A 2DJ2A 2H6ZA 4QL7A 4IW9A 2PVQA 2GT6A 1GULA 3HD5A 2DMLA 1FW1A 4DSRA 1X5CA 1I5GA 3P8WA 5GAND 5J9CA 2L5OA 1JFUA 2C0FA 1OC9A 2WDUA 3HVVA 1R26A 2C0EA 1PGTA 3VPQA 1H75A 1TXXA 5A4VA 3IHQA 3W6GA 5KN2A 3QFBC 4HS1A 2C80A 3FK8A 3GKNA 4E8EA 3NOFA 4RUVA 1XWGA 4G19A 2HZEB 3MNGA 2H1DA 1TJDA 4CW9A 1XBSA 1FO5A 1URMA 2LKUA 5IIZA 2H76A 3VPTA 2KHPA 1GSQA 4I6XA 3G7JA 1WRYA 2C3NA 2VLUA 2YPMA 5GAPD 3CTFA 1AIUA 4HU7A 1Y25A 1YJ6A 2GSTA 3TKPA 2YWMA 1B4PA 1OAZA 3I69A 3C73A 3TJBA 1SYRA 2VL2A 4EKZA 2WB9A 4ISDA 3GURA 1MD3A 1TTZA 4EO3A 2OA7A 4OMVA 4F0CA 2PUKC 2E2MA 2IMIA 3DVXA 2MMAA 1A0FA 3EYTA 2YCDA 3PINA 5JWOB 1GSFA 4GLTA 2B7JA 1ERUA 4PNFA 1K0OA 4F2IA 2PBJA 3VWXA 8GSSA 1T4YA 5HFIA 1KNGA 3TJKA 5DAKB 2JL4A 4Z7XA 3A3TA 3F6DA 3TRXA 2X8GA 3ZZXA 2HZEA 2C0GA 4JR6A 4IKHA 3TKSE 9GSSA 2C1YA 2C8UA 2HE3A 3D21A 5ECIB 3I43A 2CX4A 3TOTA 1MDJA 4TOPA 2DIZA 3ZIJA 2LRNA 2LV3A 5EVOA 1GSDA 3N9JA 1EV9A 3QAGA 3ISOA 2O7KA 1F37A 1S3CA 3UEMA 5ECKB 5ECNB 3RPPA 4HUAA 1SK2A 3APOA 3RHCA 3IV4A 4DEJA 6GSYA 2H1BA 3O6TA 4O5RA 3FYGA 2CAQA 1SJZA 3A2WA 2B7KA 5A4WA 1GUHA 2TRCP 4ZXGA 1WOUA 3FZAA 4EXJA 2LQQA 1Q98A 4KH7A 3L9UA 3BCKA 2CT6A 1HYUA 2DC5A 3KXOA 2GLRA 1GTUA 2I3YA 4AJ6A 3GTUB 2LJKA 3L9SA 2H73A 3E3EA 1SD8A 4KSMA 5EPFA 1V9WA 2OACA 2B3SA 1K0CA 2YANA 1VF3A 1V58A 1XXUA 5ELGA 3WD6A 3VI7A 1GSUA 2C3TA 3CSJA 2ON5A 19GSA 3LORA 4V2NA 4RQRA 4MK3A 1X9WB 5FWGA 4DSSB 2WGRA 3GKKA 1TDIA 1HNAA 2GS3A 4KGIA 1ACVA 2LSTA 4KCEA 4AJ7A 3Q19A 2YNXA 3IBHA 5DCGA 1RW1A 2YV9A 4K6XA 2OE0A 1J9BA 5D96A 1JZWA 10GSA 1XVWA 4KE3A 2H19A 2JU5A 2IPAA 2MYGA 2AAWA 4ILFA 5DALA 2H0GA 3H8QA 1SU9A 3L0HA 3S9FA 1O8XA 2LUSA 4XCSA 4ZB9A 4IN0A 1SENA 1FB6A 1PD21 3GSTA 1XFLA 4WEYA 4O92A 2FCHA 3H4KA 2NPBA 2AHEA 4PURA 4OFTA 1N2AA 5KEJA 1V57A 1HNCA 5ECRB 3J7Yk 3C1SA 2WZ9A 1V2AA 3EC3A 4D73B 5AISA 4YAVA 1A23A 2H0IA 3CTGA 3F4RA 4WR5A 2H1AA 1PX6A 3FY7A 1B9XC 3UIWA 1ILOA 2IMEA 4LA1A 6GSSA 1BJXA 1X5EA 1SKRB 1C72A 4HI7A 6GSUA 3G7IA 2H30A 1OE8A 1ZCPA 2PPTA 1OC3A 3HJOA 1F9MA 4WF4A 1SYXA 2DIYA 2PN8A 3D4MA 2B6MA 3EINA 2O8VB 3D5JA 4HJMA 5G30A 2VOCA 4HZ2A 4LLRA 3L4NA 2CV4A 3R2QA 2HSYA 2PERA 2B5EA 2V6OA 4JU5A 2YJHA 1OYJA 3F4SA 2F9SA 3WYWA 4PQIA 3FHKA 3QAVA 2EIOA 2B1LA 3GRXA 4BL7A 1R4WA 1TRSA 4ID0A 1YKCA 1SJIA 4GRFA 2LNTA 2O87A 4MH2A 3TKRA 1GTIA 3EMXA 2TRXA 5ABRA 4YQUA 4KDXA 2GQLA 3DVWA 1SK1A 1ZZYA 1SK0A 3H79A 2VAFA 5DJLA 1PRXA 3RBTA 3LFLA 3RAZA 2HZFA 3VK9A 1TOFA 3US3A 2GVPA 4AGSA 2AUVA 1LU4A 3E0UA 2H8LA 4PX1A 2VM2A 4OCFA 5IMZA 1DE1A 2VLTA 1V40A 4ZL7A 3HJPA 2J9HA 4IBPA 1TRVA 3KEBA 1TKDB 3ZTLA 1FVKA 2EC4A 1USBA 3HZ8A 2K18A 1A8YA 2WCIA 2V32A 2NDOA 2DJKA 4K9ZA 2VLVA 3HHVA 1AC1A 2XPEA 1Q4JA 4KNDA 4POLA 3CYNA 4Q5QA 1K0AA 3EWLA 1YQ1A 2FNOA 2MMOA 3GA4A 3LWAA 2L59A 1X5DA 2JZSA 1RK4A 3VURA 1XOAA 3O3TA 3QCPA 4FIWA 1Z3EA 1WJKA 5B8BA 3D22A 4Q5RA 3TB2A 3DKSA 3QFAC 1MTCA 5ID2B 4AF2A 6GSTA 1OKTA 4F82A 4OCEA 1Z7RA 4TW5A 2O85A 1TK8B 3F0IA 1WWJA 4OWYA 3ZVJD 1FB0A 4V2LA 3GMFA 3KMOA 1TU8A 1AAZA 4MZWA 2RM5A 4FH8A 3H93A 3WGDA 4LL4B 1TP9A 4WBRD 1OC9B 3CBUA 2FA4A 5JCWA 1EZKA 6GSWA 2CZ2A 5ECSA 5KN1A 4ML6A 4KW6A 2HT9A 3BCIA 3KZQA 2FGXA 1KEBA 2LS5A 2B5YA 3K8NA 4NAXA 1RQMA 5D9XA 4XS1A 3C71A 2NTOA 1WE0A 2YV7A 1S3DA 2V1MA 2FHEA 1AW9A 4I2UA 1E2YA 2H01A 4JZQA 4K1FA 3M0FA 5ECQB 2FUG2 2V6KA 1YF0A 2XBIA 5INYA 5FT3A 2M72A 3D4TA 2L5LA 1OVNA 5JWRB 3GL5A 3G9BA 1KBNA 1O85A 4KB3A 4TXVA 5IO0A 1EOGA 3ERGA 4MDCA 4TN8A 2MBTA 1VF1A 2C3QA 1R5AA 3DYRA 3HVXA 3KCMA 1QGVA 1ERVA 1GSYA 1ZYQB 2IMKA 2X64A 4ECBA 2VL2C 4YAPA 1M2BA 4ECIA 4I8BA 3Q74A 2YZUA 1K0MA 1VF2A 1JHBA 2C0DA 3ZITA 4MJEA 5DDLA 2TIRA 3WGEA 5D8IA 3W8JA 1GTBA 4DSQA 4IGJA 3IE3A 5HR1A 2KLXA 5ECLB 4GXZA 2G2QA 4TR0A 4RI7A 2VO4A 1TRWA 4GF0A 2WFCA 3VWUA 4WR4A 5ECMB 2IIYA 2IN3A 5HQPA 5H5SA 2G0FA 4JRRA 1PKWA 3DIEA 2H74A 2FA8A 3HJMA 2LQOA 1OC8A 2JACA 3LXZA 1PX7A 2X8CA 3GX8A 4MZCA 3F8UA 2K9FA 4MJBA 3UJ1A 3TKQA 3GKMA 2VD0A 2LJRA 2I4AA 5A4UA 2HXKA 2IMFA 3ERFA 4HJ2A 5H5RA 1TI1A 2DSAA 5HR2A 1GUMA 3RPNA 2H75A 3MSZA 4XRAA 1B48A 4EE0A 1PSQA 1K0BA 1XPVA 2GQKA 3KD0A 2IMDA 4PUFC 4MA9A 2NBSA 4FYBA 3TOUA 2RIIA 2L4QA 1FHEA 3L9VA 2HYXA 2K6VA 4F03A 5J41A 3TUEA 2PVOC 1BG5A 2CZ3A 2FLSA 5EL8A 4OO5A 5HFKA 6GSVA 2DJ1A 1DBYA 5C04A 3FW2A 2DJ0A 2H0HA 4ZBDA 4RI6A 5CRGA 5J4UA 2E0QA 1ST9A 3ZFBA 3IK7A 3LG6A 1MDKA 1KTEA 1GSSA 5G2ZA 4KSOA 4J57E 2F8FA 3ZREA 4EF0A 4KDYA 1GP1A 4WKWA 4ZL8A 1S3AA 3ZRDA 5HR0A 1WMJA 3ZLPA 3APQA 3P7XA 3IR4A 1B8XA 1YEPA 3UARA 5DALB 2BMXA 3TKSC 2QSIA 5DVBA 3ME8A 5J5NA 5ELAA 1AQVA 3C8EA 5LNKe 1XWAA 4RQXA 1XWBA 1ZYEA 3CSHA 3DEXA 1TK0B 4WF5A 1G7OA 4ZIJA 1M7TA 5IMFA 4HQSA 4HQZA 2F3MA 4CDOA 1ZL9A 5E4WA 3TKSA 4ML1A 4K0NA 2GZZA 11GSA 4JBBA 1XVQA 1SKWB 1R5PA 1MEKA 3EMPA 1K0DA 1K3OA 2N5FA 1WPIA 3GIXA 4AJ8A 4MCUA 1EGRA 3TRQA 2ES7A 2LEGA 2OADA 2VCXA 5EY6A 4MF6A 2VL3A 4V1Ag 5ECPB 1SL1B 22GSA 2FY6A 4PQ1A 1G6WA 2VIMA 4BVXA 5IO2A 2GT5A 3F6FA 1GNEA 3FRCA 4TR4A 5B8AA 1GNWA 1XW6A 3TJFA 2JADA 2A2SA 1B4QA 1XCCA 1EOHA 1PL2A 1NW2A 5IOWA 1QUWA 4NV5A 3A2XA 1EP7A 5CREA 3UVTA 3IC4A 4TKYA 4XS4A 4BPYA 2LJAA 5DBQA 4POMA 1M9BA 2OJLA 16GSA 1ML6A 2R3XA 1U3AA 2L4CA 5HFGA 2CVDA 3MDKA 5DJMA 3CRTA 2H66A 2VCWA 1JZDA 1U3IA 1T1VA 5IM9A 3VLNA 1T3BA 2MMZA 4NXIA 2CA8A 2YJ7A 5J3RA 2M80A 2HFDA 3L78A 4F0BA
chains in the Genus database with same CATH superfamily
2KOKA 3ZL5A 1N8JA 4WETA 2HSMA 2A4HA 4P3YB 2FWHA 1AQXA 3A5WA 4CHSA 3U6VA 1YZXA 2YWIA 3M3MA 2IJYA 5B6MA 1O73A 4F9ZA 5LCZA 1SL2B 1W89A 5CRHA 2OE3A 5CRDA 1GUKA 1CQGA 4Z2UA 3RHBA 3EE2A 4ZBAA 4Q5FA 4K7IA 1WIKA 1QFNA 2Z9SA 3PGTA 2I81A 3LJRA 4OFMA 3OR5A 4ULXA 3IC8A 1LJRA 5D93A 3KTLA 3KH7A 1JZOA 4A5PA 2M46A 1ZYPA 1G6YA 2X99A 4TXOA 5IMVA 3GV1A 5CRWA 4E8HA 4IVFA 1O7UA 1A24A 4ICYA 3F4TA 1EP8A 4TVEA 1GLQA 5AIVA 4ZB8A 5ENUA 3O76A 4MABA 2H70A 2VM1A 3CSIA 3LXTA 1YKAA 2E7PA 4GSSA 3PH9A 4XS6A 4KDUA 1Z9HA 1SKSB 3E9JB 2L6CA 1GRXA 3CXGA 2GSSA 1AUCA 3IHGA 3BD2A 5LD0A 2ZNMA 1XW9A 1ZMAA 3DRNA 5ECOB 5L71A 1THXA 3GL3A 1MDIA 1NSWA 2V41A 2CVKA 4N0ZA 1UN2A 4LL1B 3TJGA 2VUPA 4I97A 1NM3A 2FWGA 3KMNA 3HCZA 4L5LA 3LQ7A 4N11A 4X1UA 2ZCTA 1YY7A 4H86A 1U87A 5G1LA 4MZBA 1EEMA 1T4ZA 1HNBA 1U6TA 2RUEA 3FZ9A 5KN3A 3LGCA 5F06A 1XIYA 1EGOA 2GTUA 1J0FA 1H4OA 2R4VA 2WULA 5GSTA 3SBCA 2R0PA 3LW9A 4MJAA 5F8BA 3IRAA 3FZ4A 1DE2A 2HRFA 3APSA 2JZRA 3UL3A 2HNLA 3IXRA 3F63A 3FEUA 4ZILA 5KN0A 4IP6A 3P90A 2ALBA 4NMUA 4V1Ap 1V98A 3ME7A 3UVHA 2I1UA 2A4VA 1M3IA 1XG8A 3Q6OA 2K8VA 2QKEA 4MP4A 2HSHA 4FYUA 1AXDA 4PNGA 1BAYA 20GSA 3J7Yb 3KM6A 1OKDA 4XTSA 3LYPA 4IHUA 2XPDA 5JCGA 5CYYA 5J9BA 2EIRA 1UVZA 1FOVA 1PA3A 12GSA 1M99A 3P2AA 2WRTA 1Z5YE 3HXSA 4J2FA 2XHFA 1T00A 4PXOA 1XW5A 2LTKA 5HR3A 4IQ1A 4TR1A 3KGKA 1IYHA 1QMVA 2BJXA 4HOJA 4O5QA 1U88A 4YKGA 4YQVA 2FD3A 1XZOA 4GSTA 3KP9A 3IAM2 3KH9A 3PR8A 3IDVA 1O8WA 1S3RA 5CNWA 3C1RA 4I5QA 2GZYA 3UAPA 2L57A 3HKRA 2XC2A 4G10A 2N5AA 2IFQA 1FG4A 2RLIA 4TRXA 2RM6A 4KA0A 5BMUA 3CRUA 1DUGA 3KJYA 2FWEA 2CAIA 1FOHA 2O89A 5DQSA 4EC0A 4L5OA 3MAKA 1THOA 1GTAA 4KUNA 4O32A 4OFNA 4MF7A 3GN3A 3QR6A 4ECCA 3QD9A 3DXBA 3GNJA 2ZUPA 4NV2A 4L0UA 1QK8A 2VD1A 2WS2A 4EIQA 3A2VA 2PMTA 1Z6NA 5IMDA 4DVCA 2CQ9A 2PGTA 3HDCA 3ZIVA 2JSYA 5G31A 1HD2A 2QGVA 1F2EA 4WXTA 5G5FA 2VCQA 1M2AA 4MJCA 1OE7A 4NHZA 2HLSA 3TCOA 1YEXA 4IJ3A 4MMMA 4J56E 4K8MA 3EURA 1LBKA 1A2JA 5F07A 2REMA 1QXHA 1FAAA 4ZB6A 5IMAA 2RUFA 2OBIA 1M3JA 1BQ7A 3CMIA 1XWKA 3HA9A 1IYIA 3GUSA 5JCUA 4KX4A 4ZBBA 3QPMA 4GQCA 5FHIA 3NZNA 4WBJA 4IELA 2AB6A 2GSQA 3FR6A 4EDZA 3FZ5A 5GZZB 1HQOA 2BTOT 1VRSD 1GH2A 1UC7A 1XOBA 2N5BA 4GQFA 1M2DA 3BBYA 1TU7A 1Z7PA 3ZMKA 4ZL9A 3ZMLA 4FO5A 4IJIA 2P31A 3IAS2 1X9MB 3EVIA 2P5QA 3DWVA 1A2LA 3VI5A 2P0GA 4MF5A 1UA5A 3BJ5A 3KIJA 4KAEA 4BVXB 3G7YA 5DCHA 1G0TA 2H1GA 4K0GA 4I2TA 3ZYWA 3UMAA 4EUYA 3HZ4A 4PGTA 5COHA 1SL0B 5DAKA 1Z6MA 1ZGNA 3IPZA 5D73A 4ACSA 2R37A 1ERTA 3F3QA 5D9TA 2H72A 4EIPA 2DJJA 4PUAA 4QQ7A 1F3BA 1GSEA 2LRCA 3WT1A 4XS4B 3EU3A 2R5GA 4MH3A 5B6NA 2H6YA 1VF4A 3IA1A 5F0GA 4EL1A 3UBLA 4EDYA 1ABAA 5E59A 3GKXA 3TJJA 3W8SA 3VFIA 1BEDA 1ZOFA 3LEFA 2YP6A 14GSA 18GSA 2AV4A 3D0ZA 1F3AA 1TRUA 2GQMA 3N5OA 3C7MA 4IQAA 2GZPA 1O6JA 5IPHA 4FYCA 5F05A 1TI3A 2EIQA 5CP1A 3GTUA 1CQHA 1QQ2A 1PN9A 1X0RA 5IMCA 4G2EA 5A5KA 2OE1A 2D2ZA 5G5EA 4BVYA 3H1NA 3UBKA 4N0VA 5D9VA 2P5RA 4K7OA 2VCVA 2KP1A 3F9UA 5CO3A 4TXOB 2R2JA 4GTUA 2YOIA 1T8EB 4LMWA 3U5RE 3M8NA 4HEA2 4XRDA 2VCZA 1AQWA 3FKFA 2YWNA 2YN1A 3WT2A 3KTBA 1EEJA 5AIXA 2F8AA 5ECHB 1A8LA 4DSSA 3KP8A 3FR9A 5G1KA 2YWOA 4NPBA 5B7CA 4ECJA 3GSSA 1K0NA 1PL1A 3QAWA 3V1WA 2B5XA 1FVJA 4BA7A 4JR4A 1DSBA 1X9SB 2AJQB 4L0WA 1EV4A 4L8EA 4IP1A 1K3LA 3DD3A 4NHWA 3LSZA 2LRTA 1VGLA 1WP0A 2H71A 2XBQA 3SWLA 3GFKA 1YF1A 3ERWA 3I9V2 3VWWA 5AGYA 3ZFLA 2DBCA 1E6BA 3WGXA 2E2GA 3D6IA 2QC7A 17GSA 4N10A 3I6AA 1NHOA 1JZRA 1PFOA 2HI7A 5CAXA 3JCML 5H5QA 1A2MA 3DMLA 5IQYA 1GL8A 3GYKA 1Y6EA 2VCTA 4D73A 4QL9A 1PKZA 4POBA 2DMMA 2IWTA 1BYEA 2JSZA 5GSSA 4GSNA 4Z2RA 4BWQA 4PQHA 2OKAA 1ERWA 5AN1A 3TDGA 2R6KA 2OBKA 4Q5NA 2V2GA 1PQNA 1YDKA 2GGTA 5JWQB 3NIVA 1M0UA 1O81A 2J23A 2IL3A 3F3RA 2A2RA 3IK9A 4MPFA 2MMNA 2FWFA 4POKA 2DJ3A 2ON7A 3FR3A 4GWRA 3ED3A 4NWYA 2HRNA 2MBSA 1GLPA 1A0RP 3ZVJA 3HYPA 2NVLA 3VWVA 4OO4A 2DLXA 3Q18A 2WJUA 4GCIA 2B1KA 2YZHA 1W4VA 13GSA 3UOMA 1J08A 1I9DA 2QA1A 4N30A 5DQYA 2KP2A 1NHYA 4G0LA 4KCAA 1MD4A 4MPGA 3QDNA 1T7PB 1TK5B 1ON4A 4HDEA 1M9AA 3HVSA 4JE1A 3M9KA 4V2MA 1F6MC 3M1GA 1PMTA 3QMXA 2AYTA 4XIHA 1GWCA 4JEDA 3AY8A 2L6DA 4TR3A 5IPGA 4TR1B 1JLVA 1R7HA 3RDWA 4EVMA 1EWXA 1B9YC 2GDRA 3GHAA 4XHMA 1TW9A 2VL9A 2LNSA 1K3YA 3BOAA 2MZCA 6GSXA 4OD7A 4PTSA 1SD9A 1SJ6A 2H6XA 3EU4A 4IS0A 2JZTA 2C4JA 2CVBA 3GH6A 2CX3A 2IFQB 4MLYA 4USSA 4G9HA 7GSSA 3QOUA 3GH9A 4BWSA 3TRPA 3MWHA 5D9WA 3IOSA 4HSCX 2GSRA 2I9HA 3LYKA 4G0KA 4O7HA 4K7NA 1JLWA 4X0XA 4HU9A 2PWJA 2F51A 3TGZA 1XWCA 1BX9A 4X43A 5C00A 3DGQA 4YQMA 2PU9C 2KUCA 5IOXA 1G7EA 3M9JA 3HY2A 4HZ4A 5ID2A 2K8SA 4K2DA 4YH2A 4LMVA 2X8HA 3GX0A 2DJ2A 2H6ZA 4QL7A 4IW9A 2PVQA 2GT6A 1GULA 3HD5A 2DMLA 1FW1A 4DSRA 1X5CA 1I5GA 3P8WA 5GAND 5J9CA 2L5OA 1JFUA 2C0FA 1OC9A 2WDUA 3HVVA 1R26A 2C0EA 1PGTA 3VPQA 4CY8A 1H75A 1TXXA 5A4VA 3IHQA 3W6GA 5KN2A 3QFBC 4HS1A 5BRTA 2C80A 3FK8A 3GKNA 4E8EA 3NOFA 4RUVA 1XWGA 4G19A 2HZEB 3MNGA 2H1DA 1TJDA 4CW9A 1XBSA 1FO5A 1URMA 2LKUA 5IIZA 2H76A 3VPTA 2KHPA 1GSQA 4I6XA 3G7JA 1WRYA 2C3NA 2VLUA 2YPMA 5GAPD 3CTFA 1AIUA 4HU7A 1Y25A 1YJ6A 2GSTA 3TKPA 2YWMA 1B4PA 1OAZA 3I69A 3C73A 3TJBA 1SYRA 2VL2A 4EKZA 2WB9A 4ISDA 3GURA 1MD3A 1TTZA 4EO3A 2OA7A 4OMVA 4F0CA 2PUKC 2E2MA 2IMIA 3DVXA 2MMAA 1A0FA 3EYTA 2YCDA 3PINA 5JWOB 1GSFA 4GLTA 2B7JA 1ERUA 4PNFA 1K0OA 4F2IA 2PBJA 3VWXA 8GSSA 1T4YA 5HFIA 1KNGA 3TJKA 5DAKB 2JL4A 4Z7XA 3A3TA 3F6DA 3TRXA 2X8GA 3ZZXA 2HZEA 2DKIA 2C0GA 4JR6A 4IKHA 3TKSE 9GSSA 2C1YA 2C8UA 2HE3A 3D21A 3I43A 5ECIB 2CX4A 3TOTA 1MDJA 4TOPA 2DIZA 3ZIJA 2LRNA 2LV3A 5EVOA 1GSDA 3N9JA 1EV9A 3QAGA 3ISOA 2O7KA 1F37A 1S3CA 3UEMA 5ECKB 5ECNB 3RPPA 4HUAA 1SK2A 3APOA 3RHCA 3IV4A 4DEJA 4K5SA 4K2XA 2H1BA 3O6TA 6GSYA 4O5RA 2QA2A 3FYGA 4BIKA 2CAQA 1SJZA 3A2WA 2B7KA 5A4WA 1GUHA 4G0IA 2TRCP 4ZXGA 1WOUA 3FZAA 4EXJA 2LQQA 1Q98A 4KH7A 3L9UA 3BCKA 2CT6A 1HYUA 2DC5A 3KXOA 2GLRA 1GTUA 2I3YA 4AJ6A 3GTUB 2LJKA 3L9SA 2H73A 3E3EA 1SD8A 4KSMA 4BVYB 5EPFA 4Z2TA 1V9WA 2OACA 2B3SA 1K0CA 2YANA 1VF3A 1V58A 1XXUA 5ELGA 3WD6A 3VI7A 1GSUA 2C3TA 3CSJA 2ON5A 19GSA 3LORA 4V2NA 4RQRA 4MK3A 1X9WB 5FWGA 4DSSB 2WGRA 3GKKA 1TDIA 1HNAA 2GS3A 4KGIA 5KOXA 1ACVA 2LSTA 4KCEA 4AJ7A 3Q19A 2YNXA 4MNNA 3IBHA 5DCGA 1RW1A 2YV9A 4KF9A 4K6XA 2OE0A 1J9BA 5D96A 1JZWA 10GSA 1XVWA 4KE3A 2H19A 2JU5A 2IPAA 2MYGA 2AAWA 4ILFA 5DALA 2H0GA 5KOWA 3H8QA 1SU9A 3L0HA 3S9FA 1O8XA 2LUSA 4XCSA 4ZB9A 4IN0A 4O5UA 1SENA 1FB6A 1PD21 3GSTA 1XFLA 4WEYA 4O92A 2FCHA 3H4KA 2NPBA 2AHEA 4PURA 4OFTA 1N2AA 5KEJA 1V57A 1PN0A 1HNCA 5ECRB 3J7Yk 3C1SA 2WZ9A 1V2AA 3EC3A 4D73B 5AISA 4YAVA 1A23A 2H0IA 3CTGA 3F4RA 4WR5A 2H1AA 1PX6A 3FY7A 1B9XC 3UIWA 1ILOA 2IMEA 4LA1A 6GSSA 1BJXA 1X5EA 1SKRB 1C72A 4HI7A 6GSUA 3G7IA 2H30A 1OE8A 1ZCPA 2PPTA 1OC3A 3HJOA 1F9MA 4WF4A 1SYXA 2DIYA 2PN8A 3D4MA 2B6MA 3EINA 2O8VB 3D5JA 4HJMA 5G30A 2VOCA 4HZ2A 4LLRA 3L4NA 2CV4A 3R2QA 2HSYA 2PERA 2B5EA 2V6OA 4JU5A 2YJHA 4YKFA 1OYJA 3F4SA 2F9SA 3WYWA 4PQIA 3FHKA 3QAVA 2EIOA 2B1LA 3GRXA 4BL7A 1R4WA 1TRSA 4ID0A 1YKCA 1SJIA 4GRFA 2LNTA 3FMWA 2O87A 4MH2A 3TKRA 1GTIA 3EMXA 2TRXA 5ABRA 4YQUA 4KDXA 4K5RA 2GQLA 3DVWA 1SK1A 1ZZYA 1SK0A 3H79A 3HVNA 2VAFA 5DJLA 1PRXA 3RBTA 3LFLA 3RAZA 2HZFA 3VK9A 1TOFA 3US3A 2GVPA 4AGSA 2AUVA 1LU4A 3E0UA 2H8LA 4PX1A 2VM2A 4OCFA 5IMZA 1DE1A 2X49A 2VLTA 1V40A 4ZL7A 4CY6A 3HJPA 2J9HA 4IBPA 1TRVA 3KEBA 1TKDB 3ZTLA 1FVKA 2EC4A 1USBA 3HZ8A 2K18A 1A8YA 2WCIA 2V32A 2NDOA 2DJKA 4K9ZA 2VLVA 3HHVA 1AC1A 2XPEA 1Q4JA 4FQUA 4KNDA 4POLA 3CYNA 4Q5QA 1K0AA 3EWLA 1YQ1A 2FNOA 2MMOA 3GA4A 3LWAA 2L59A 1X5DA 2JZSA 1RK4A 3VURA 1XOAA 3O3TA 3QCPA 4FIWA 1Z3EA 1WJKA 5B8BA 3D22A 4Q5RA 3TB2A 3DKSA 3QFAC 1MTCA 5ID2B 4AF2A 2X4AA 6GSTA 1OKTA 4F82A 4OCEA 1Z7RA 4TW5A 2O85A 1TK8B 3F0IA 1WWJA 4OWYA 3ZVJD 1FB0A 4V2LA 3GMFA 3KMOA 1TU8A 1AAZA 4MZWA 2RM5A 4FH8A 3H93A 3WGDA 4LL4B 1TP9A 4WBRD 1OC9B 3MYDA 3CBUA 2FA4A 5JCWA 1EZKA 6GSWA 2CZ2A 5ECSA 5KN1A 4ML6A 4KW6A 2HT9A 3BCIA 3KZQA 2FGXA 1KEBA 2LS5A 2B5YA 3K8NA 2HRKA 4NAXA 1RQMA 5D9XA 4XS1A 3C71A 2NTOA 3MIXA 1WE0A 2YV7A 1S3DA 2R0CA 2V1MA 2FHEA 1AW9A 4I2UA 1E2YA 2H01A 4JZQA 4K1FA 3M0FA 5ECQB 2FUG2 2V6KA 1YF0A 2XBIA 5INYA 5FT3A 2M72A 3D4TA 2L5LA 1OVNA 5JWRB 3GL5A 3G9BA 1KBNA 3A5IA 1O85A 4KB3A 4TXVA 5IO0A 1EOGA 3ERGA 4MDCA 4TN8A 2MBTA 1VF1A 2C3QA 1R5AA 3DYRA 3HVXA 3KCMA 1QGVA 1ERVA 1GSYA 4X4JA 1ZYQB 2IMKA 2X64A 4ECBA 2VL2C 4YAPA 1M2BA 4ECIA 4I8BA 3Q74A 2YZUA 1K0MA 1VF2A 1JHBA 2C0DA 3ZITA 4MJEA 5DDLA 2TIRA 3WGEA 5D8IA 3PPUA 3W8JA 1GTBA 4DSQA 4IGJA 3IE3A 5HR1A 2KLXA 5ECLB 2R0GA 4GXZA 2G2QA 4TR0A 4RI7A 2VO4A 1TRWA 4GF0A 2WFCA 3VWUA 4WR4A 2DKHA 2IIYA 2IN3A 5ECMB 5HQPA 5H5SA 2G0FA 4JRRA 1PKWA 3DIEA 2H74A 2FA8A 3HJMA 2LQOA 1OC8A 2JACA 3LXZA 1PX7A 2X8CA 3GX8A 4MZCA 3F8UA 2K9FA 4MJBA 3UJ1A 3TKQA 3GKMA 2VD0A 2LJRA 2I4AA 5A4UA 2HXKA 2IMFA 3ERFA 4HJ2A 5H5RA 1TI1A 2DSAA 5HR2A 1GUMA 3RPNA 2H75A 3MSZA 4XRAA 1B48A 4EE0A 1PSQA 1K0BA 1XPVA 2GQKA 3KD0A 2IMDA 4PUFC 4MA9A 2NBSA 4FYBA 3TOUA 2RIIA 2L4QA 1FHEA 3L9VA 2HYXA 2K6VA 4F03A 5J41A 3TUEA 2PVOC 1BG5A 2CZ3A 2FLSA 5EL8A 4OO5A 5HFKA 6GSVA 2DJ1A 1DBYA 5C04A 3FW2A 2DJ0A 2H0HA 4ZBDA 4RI6A 5CRGA 5J4UA 2E0QA 1ST9A 3ZFBA 3IK7A 3LG6A 1MDKA 1KTEA 1GSSA 5G2ZA 4KSOA 4J57E 2F8FA 3ZREA 4EF0A 4KDYA 1GP1A 4WKWA 4ZL8A 1S3AA 3ZRDA 5HR0A 1WMJA 3ZLPA 3APQA 3P7XA 3IR4A 1B8XA 1YEPA 3UARA 5DALB 2BMXA 3TKSC 2QSIA 5DVBA 2HRAA 3ME8A 5J5NA 5ELAA 1AQVA 3C8EA 5LNKe 1XWAA 4RQXA 1XWBA 1ZYEA 3CSHA 3DEXA 1TK0B 4WF5A 2UZ8A 1G7OA 4ZIJA 1M7TA 5IMFA 4HQSA 4HQZA 2F3MA 3CQFA 4CDOA 1ZL9A 5E4WA 3TKSA 4ML1A 4K0NA 2GZZA 11GSA 3EPTA 4JBBA 1XVQA 1SKWB 1R5PA 1MEKA 3EMPA 1K0DA 1K3OA 2N5FA 1WPIA 3GIXA 3R3EA 2A2PA 4AJ8A 4MCUA 1EGRA 3TRQA 2ES7A 2LEGA 2OADA 2VCXA 5EY6A 4MF6A 2VL3A 4V1Ag 5ECPB 1SL1B 22GSA 2FY6A 4PQ1A 1G6WA 2VIMA 4BVXA 5IO2A 2GT5A 3F6FA 1GNEA 3FRCA 4TR4A 5B8AA 1GNWA 1XW6A 3TJFA 2JADA 2A2SA 1B4QA 1XCCA 1EOHA 1PL2A 1NW2A 5IOWA 4BL7B 1QUWA 4NV5A 3A2XA 1EP7A 5CREA 3UVTA 3IC4A 4TKYA 4XS4A 4BPYA 2LJAA 5DBQA 4POMA 1M9BA 2OJLA 16GSA 1ML6A 2R3XA 1U3AA 2L4CA 5HFGA 2CVDA 3MDKA 5DJMA 3CRTA 2H66A 2VCWA 1JZDA 1U3IA 1ZYNA 1T1VA 5IM9A 3VLNA 1T3BA 2MMZA 4NXIA 2CA8A 2YJ7A 5J3RA 2M80A 2HFDA 3L78A 4F0BA
chains in the Genus database with same CATH topology
2KOKA 3ZL5A 1N8JA 4WETA 2HSMA 2A4HA 4P3YB 2FWHA 1AQXA 3A5WA 4CHSA 3U6VA 1YZXA 2YWIA 3M3MA 2IJYA 5B6MA 1O73A 4F9ZA 5LCZA 1SL2B 1W89A 5CRHA 2OE3A 5CRDA 1GUKA 1CQGA 4Z2UA 3RHBA 3EE2A 4ZBAA 4Q5FA 4K7IA 1WIKA 1QFNA 2Z9SA 3PGTA 2I81A 3LJRA 4OFMA 3OR5A 4ULXA 3IC8A 1LJRA 5D93A 3KTLA 3KH7A 1JZOA 4A5PA 2M46A 1ZYPA 1G6YA 2X99A 4TXOA 5IMVA 3GV1A 5CRWA 4E8HA 4IVFA 1O7UA 1A24A 4ICYA 3F4TA 1EP8A 4TVEA 1GLQA 5AIVA 4ZB8A 5ENUA 3O76A 4MABA 2H70A 2VM1A 3CSIA 3LXTA 1YKAA 2E7PA 4GSSA 3PH9A 4XS6A 4KDUA 1Z9HA 1SKSB 3E9JB 2L6CA 1GRXA 3CXGA 2GSSA 1AUCA 3IHGA 3BD2A 5LD0A 2ZNMA 1XW9A 1ZMAA 3DRNA 5ECOB 5L71A 1THXA 3GL3A 1MDIA 1NSWA 2V41A 2CVKA 4N0ZA 1UN2A 4LL1B 3TJGA 2VUPA 4I97A 1NM3A 2FWGA 3KMNA 3HCZA 4L5LA 3LQ7A 4N11A 4X1UA 2ZCTA 1YY7A 4H86A 1U87A 5G1LA 4MZBA 1EEMA 1T4ZA 1HNBA 1U6TA 2RUEA 3FZ9A 5KN3A 3LGCA 5F06A 1XIYA 1EGOA 2GTUA 1J0FA 1H4OA 2R4VA 2WULA 5GSTA 3SBCA 2R0PA 3LW9A 4MJAA 5F8BA 3IRAA 3FZ4A 1DE2A 2HRFA 3APSA 2JZRA 3UL3A 2HNLA 3IXRA 3F63A 3FEUA 4ZILA 5KN0A 4IP6A 3P90A 2ALBA 4NMUA 4V1Ap 1V98A 3ME7A 3UVHA 2I1UA 2A4VA 3Q6OA 2K8VA 2QKEA 4MP4A 2HSHA 4FYUA 1AXDA 4PNGA 1BAYA 20GSA 3J7Yb 3KM6A 1OKDA 4XTSA 3LYPA 4IHUA 2XPDA 5JCGA 5CYYA 5J9BA 2EIRA 1UVZA 1FOVA 1PA3A 12GSA 1M99A 3P2AA 2WRTA 1Z5YE 3HXSA 4J2FA 2XHFA 1T00A 4PXOA 1XW5A 2LTKA 5HR3A 4IQ1A 4TR1A 3KGKA 1IYHA 1QMVA 2BJXA 4HOJA 4O5QA 1U88A 4YKGA 4YQVA 2FD3A 1XZOA 4GSTA 3KP9A 3IAM2 3KH9A 3PR8A 3IDVA 1O8WA 5CNWA 3C1RA 4I5QA 2GZYA 3UAPA 2L57A 3HKRA 2XC2A 4G10A 2N5AA 2IFQA 1FG4A 2RLIA 4TRXA 2RM6A 4KA0A 5BMUA 3CRUA 1DUGA 3KJYA 2FWEA 2CAIA 1FOHA 2O89A 5DQSA 4EC0A 4L5OA 3MAKA 1THOA 1GTAA 4KUNA 4O32A 4OFNA 4MF7A 3GN3A 3QR6A 4ECCA 3QD9A 3DXBA 3GNJA 2ZUPA 4NV2A 4L0UA 1QK8A 2VD1A 2WS2A 4EIQA 3A2VA 2PMTA 1Z6NA 5IMDA 4DVCA 2CQ9A 2PGTA 3HDCA 3ZIVA 2JSYA 5G31A 1HD2A 2QGVA 1F2EA 4WXTA 5G5FA 2VCQA 1M2AA 4MJCA 1OE7A 4NHZA 2HLSA 3TCOA 1YEXA 4IJ3A 4MMMA 4J56E 4K8MA 3EURA 1LBKA 1A2JA 5F07A 2REMA 1QXHA 1FAAA 4ZB6A 5IMAA 2RUFA 2OBIA 1BQ7A 3CMIA 1XWKA 3HA9A 1IYIA 3GUSA 5JCUA 4KX4A 4ZBBA 3QPMA 4GQCA 5FHIA 3NZNA 4WBJA 4IELA 2AB6A 2GSQA 3FR6A 4EDZA 3FZ5A 5GZZB 1HQOA 2BTOT 1VRSD 1GH2A 1UC7A 1XOBA 2N5BA 4GQFA 1M2DA 3BBYA 1TU7A 1Z7PA 3ZMKA 4ZL9A 3ZMLA 4FO5A 4IJIA 2P31A 3IAS2 1X9MB 3EVIA 2P5QA 3DWVA 1A2LA 3VI5A 2P0GA 4MF5A 1UA5A 3BJ5A 3KIJA 4KAEA 4BVXB 3G7YA 5DCHA 1G0TA 2H1GA 4K0GA 4I2TA 3ZYWA 3UMAA 4EUYA 3HZ4A 4PGTA 5COHA 1SL0B 5DAKA 1Z6MA 1ZGNA 3IPZA 5D73A 4ACSA 2R37A 1ERTA 3F3QA 5D9TA 2H72A 4EIPA 2DJJA 4PUAA 4QQ7A 1F3BA 1GSEA 2LRCA 3WT1A 4XS4B 3EU3A 2R5GA 4MH3A 5B6NA 2H6YA 1VF4A 3IA1A 5F0GA 4EL1A 3UBLA 4EDYA 1ABAA 5E59A 3GKXA 3TJJA 3W8SA 3VFIA 1BEDA 1ZOFA 3LEFA 2YP6A 14GSA 18GSA 2AV4A 3D0ZA 1F3AA 1TRUA 2GQMA 3N5OA 3C7MA 4IQAA 2GZPA 1O6JA 5IPHA 4FYCA 5F05A 1TI3A 2EIQA 5CP1A 3GTUA 1CQHA 1QQ2A 1PN9A 1X0RA 5IMCA 4G2EA 5A5KA 2OE1A 2D2ZA 5G5EA 4BVYA 3H1NA 3UBKA 4N0VA 5D9VA 2P5RA 4K7OA 2VCVA 2KP1A 3F9UA 5CO3A 4TXOB 2R2JA 4GTUA 2YOIA 1T8EB 4LMWA 3U5RE 3M8NA 4HEA2 4XRDA 2VCZA 1AQWA 3FKFA 2YWNA 2YN1A 3WT2A 3KTBA 1EEJA 5AIXA 2F8AA 5ECHB 1A8LA 4DSSA 3KP8A 3FR9A 5G1KA 2YWOA 4NPBA 5B7CA 4ECJA 3GSSA 1K0NA 1PL1A 3QAWA 3V1WA 2B5XA 1FVJA 4BA7A 4JR4A 1DSBA 1X9SB 2AJQB 4L0WA 1EV4A 4L8EA 4IP1A 1K3LA 3DD3A 4NHWA 3LSZA 2LRTA 1VGLA 1WP0A 2H71A 2XBQA 3SWLA 3GFKA 1YF1A 3ERWA 3I9V2 3VWWA 5AGYA 3ZFLA 2DBCA 1E6BA 3WGXA 2E2GA 3D6IA 2QC7A 17GSA 4N10A 3I6AA 1NHOA 1JZRA 2HI7A 5CAXA 3JCML 5H5QA 1A2MA 3DMLA 5IQYA 1GL8A 3GYKA 1Y6EA 2VCTA 4D73A 4QL9A 1PKZA 4POBA 2DMMA 2IWTA 1BYEA 2JSZA 5GSSA 4GSNA 4Z2RA 4BWQA 4PQHA 2OKAA 1ERWA 5AN1A 3TDGA 2R6KA 2OBKA 4Q5NA 2V2GA 1PQNA 1YDKA 2GGTA 5JWQB 3NIVA 1M0UA 1O81A 2J23A 2IL3A 3F3RA 2A2RA 3IK9A 4MPFA 2MMNA 2FWFA 4POKA 2DJ3A 2ON7A 3FR3A 4GWRA 3ED3A 4NWYA 2HRNA 2MBSA 1GLPA 1A0RP 3ZVJA 3HYPA 2NVLA 3VWVA 4OO4A 2DLXA 3Q18A 2WJUA 4GCIA 2B1KA 2YZHA 1W4VA 13GSA 3UOMA 1J08A 1I9DA 2QA1A 4N30A 5DQYA 2KP2A 1NHYA 4G0LA 4KCAA 1MD4A 4MPGA 3QDNA 1T7PB 1TK5B 1ON4A 4HDEA 1M9AA 3HVSA 4JE1A 3M9KA 4V2MA 1F6MC 3M1GA 1PMTA 3QMXA 2AYTA 4XIHA 1GWCA 4JEDA 3AY8A 2L6DA 4TR3A 5IPGA 4TR1B 1JLVA 1R7HA 3RDWA 4EVMA 1EWXA 1B9YC 2GDRA 3GHAA 4XHMA 1TW9A 2VL9A 2LNSA 1K3YA 3BOAA 2MZCA 6GSXA 4OD7A 4PTSA 1SD9A 1SJ6A 2H6XA 3EU4A 4IS0A 2JZTA 2C4JA 2CVBA 3GH6A 2CX3A 2IFQB 4MLYA 4USSA 4G9HA 7GSSA 3QOUA 3GH9A 4BWSA 3TRPA 3MWHA 5D9WA 3IOSA 2GSRA 2I9HA 3LYKA 4G0KA 4O7HA 4K7NA 1JLWA 4X0XA 4HU9A 2PWJA 2F51A 3TGZA 1XWCA 1BX9A 4X43A 5C00A 3DGQA 4YQMA 2PU9C 2KUCA 5IOXA 1G7EA 3M9JA 3HY2A 4HZ4A 5ID2A 2K8SA 4K2DA 4YH2A 4LMVA 2X8HA 3GX0A 2DJ2A 2H6ZA 4QL7A 4IW9A 2PVQA 2GT6A 1GULA 3HD5A 2DMLA 1FW1A 4DSRA 1X5CA 1I5GA 3P8WA 5GAND 5J9CA 2L5OA 1JFUA 2C0FA 1OC9A 2WDUA 3HVVA 1R26A 2C0EA 1PGTA 3VPQA 4CY8A 1H75A 1TXXA 5A4VA 3IHQA 3W6GA 5KN2A 3QFBC 4HS1A 5BRTA 2C80A 3FK8A 3GKNA 4E8EA 3NOFA 4RUVA 1XWGA 4G19A 2HZEB 3MNGA 2H1DA 1TJDA 4CW9A 1XBSA 1FO5A 1URMA 2LKUA 5IIZA 2H76A 3VPTA 2KHPA 1GSQA 4I6XA 3G7JA 1WRYA 2C3NA 2VLUA 2YPMA 5GAPD 3CTFA 1AIUA 4HU7A 1Y25A 1YJ6A 2GSTA 3TKPA 2YWMA 1B4PA 1OAZA 3I69A 3C73A 3TJBA 1SYRA 2VL2A 4EKZA 2WB9A 4ISDA 3GURA 1MD3A 1TTZA 4EO3A 2OA7A 4OMVA 4F0CA 2PUKC 2E2MA 2IMIA 3DVXA 2MMAA 1A0FA 3EYTA 2YCDA 3PINA 5JWOB 1GSFA 4GLTA 2B7JA 1ERUA 4PNFA 1K0OA 4F2IA 2PBJA 3VWXA 8GSSA 1T4YA 5HFIA 1KNGA 3TJKA 5DAKB 2JL4A 4Z7XA 3A3TA 3F6DA 3TRXA 2X8GA 3ZZXA 2HZEA 2DKIA 2C0GA 4JR6A 4IKHA 3TKSE 9GSSA 2C1YA 2C8UA 2HE3A 3D21A 3I43A 5ECIB 2CX4A 3TOTA 1MDJA 4TOPA 2DIZA 3ZIJA 2LRNA 2LV3A 5EVOA 1GSDA 3N9JA 1EV9A 3QAGA 3ISOA 2O7KA 1F37A 1S3CA 3UEMA 5ECKB 5ECNB 3RPPA 4HUAA 1SK2A 3APOA 3RHCA 3IV4A 4DEJA 4K5SA 4K2XA 2H1BA 3O6TA 6GSYA 4O5RA 2QA2A 3FYGA 2CAQA 1SJZA 3A2WA 2B7KA 5A4WA 1GUHA 4G0IA 2TRCP 4ZXGA 1WOUA 3FZAA 4EXJA 2LQQA 1Q98A 4KH7A 3L9UA 3BCKA 2CT6A 1HYUA 2DC5A 3KXOA 2GLRA 1GTUA 2I3YA 4AJ6A 3GTUB 2LJKA 3L9SA 2H73A 3E3EA 1SD8A 4KSMA 4BVYB 5EPFA 4Z2TA 1V9WA 2OACA 2B3SA 1K0CA 2YANA 1VF3A 1V58A 1XXUA 5ELGA 3WD6A 3VI7A 1GSUA 2C3TA 3CSJA 2ON5A 19GSA 3LORA 4V2NA 4RQRA 4MK3A 1X9WB 5FWGA 4DSSB 2WGRA 3GKKA 1TDIA 1HNAA 2GS3A 4KGIA 5KOXA 1ACVA 2LSTA 4KCEA 4AJ7A 3Q19A 2YNXA 4MNNA 3IBHA 5DCGA 1RW1A 2YV9A 4KF9A 4K6XA 2OE0A 1J9BA 5D96A 1JZWA 10GSA 1XVWA 4KE3A 2H19A 2JU5A 2IPAA 2MYGA 2AAWA 4ILFA 5DALA 2H0GA 5KOWA 3H8QA 1SU9A 3L0HA 3S9FA 1O8XA 2LUSA 4XCSA 4ZB9A 4IN0A 4O5UA 1SENA 1FB6A 1PD21 3GSTA 1XFLA 4WEYA 4O92A 2FCHA 3H4KA 2NPBA 2AHEA 4PURA 4OFTA 1N2AA 5KEJA 1V57A 1PN0A 1HNCA 5ECRB 3J7Yk 3C1SA 2WZ9A 1V2AA 3EC3A 4D73B 5AISA 4YAVA 1A23A 2H0IA 3CTGA 3F4RA 4WR5A 2H1AA 1PX6A 3FY7A 1B9XC 3UIWA 1ILOA 2IMEA 4LA1A 6GSSA 1BJXA 1X5EA 1SKRB 1C72A 4HI7A 6GSUA 3G7IA 2H30A 1OE8A 1ZCPA 2PPTA 1OC3A 3HJOA 1F9MA 4WF4A 1SYXA 2DIYA 2PN8A 3D4MA 2B6MA 3EINA 2O8VB 3D5JA 4HJMA 5G30A 2VOCA 4HZ2A 4LLRA 3L4NA 2CV4A 3R2QA 2HSYA 2PERA 2B5EA 2V6OA 4JU5A 2YJHA 4YKFA 1OYJA 3F4SA 2F9SA 3WYWA 4PQIA 3FHKA 3QAVA 2EIOA 2B1LA 3GRXA 4BL7A 1R4WA 1TRSA 4ID0A 1YKCA 1SJIA 4GRFA 2LNTA 3FMWA 2O87A 4MH2A 3TKRA 1GTIA 3EMXA 2TRXA 5ABRA 4YQUA 4KDXA 4K5RA 2GQLA 3DVWA 1SK1A 1ZZYA 1SK0A 3H79A 2VAFA 5DJLA 1PRXA 3RBTA 3LFLA 3RAZA 2HZFA 3VK9A 1TOFA 3US3A 2GVPA 4AGSA 2AUVA 1LU4A 3E0UA 2H8LA 4PX1A 2VM2A 4OCFA 5IMZA 1DE1A 2X49A 2VLTA 1V40A 4ZL7A 4CY6A 3HJPA 2J9HA 4IBPA 1TRVA 3KEBA 1TKDB 3ZTLA 1FVKA 2EC4A 1USBA 3HZ8A 2K18A 1A8YA 2WCIA 2V32A 2NDOA 2DJKA 4K9ZA 2VLVA 3HHVA 1AC1A 2XPEA 1Q4JA 4FQUA 4KNDA 4POLA 3CYNA 4Q5QA 1K0AA 3EWLA 1YQ1A 2FNOA 2MMOA 3GA4A 3LWAA 2L59A 1X5DA 2JZSA 1RK4A 3VURA 1XOAA 3O3TA 3QCPA 4FIWA 1Z3EA 1WJKA 5B8BA 3D22A 4Q5RA 3TB2A 3DKSA 3QFAC 1MTCA 5ID2B 4AF2A 2X4AA 6GSTA 1OKTA 4F82A 4OCEA 1Z7RA 4TW5A 2O85A 1TK8B 3F0IA 1WWJA 4OWYA 3ZVJD 1FB0A 4V2LA 3GMFA 3KMOA 1TU8A 1AAZA 4MZWA 2RM5A 4FH8A 3H93A 3WGDA 4LL4B 1TP9A 4WBRD 1OC9B 3MYDA 3CBUA 2FA4A 5JCWA 1EZKA 6GSWA 2CZ2A 5ECSA 5KN1A 4ML6A 4KW6A 2HT9A 3BCIA 3KZQA 2FGXA 1KEBA 2LS5A 2B5YA 3K8NA 2HRKA 4NAXA 1RQMA 5D9XA 4XS1A 3C71A 2NTOA 3MIXA 1WE0A 2YV7A 1S3DA 2R0CA 2V1MA 2FHEA 1AW9A 4I2UA 1E2YA 2H01A 4JZQA 4K1FA 3M0FA 5ECQB 2FUG2 2V6KA 1YF0A 2XBIA 5INYA 5FT3A 2M72A 3D4TA 2L5LA 1OVNA 5JWRB 3GL5A 3G9BA 1KBNA 3A5IA 1O85A 4KB3A 4TXVA 5IO0A 1EOGA 3ERGA 4MDCA 4TN8A 2MBTA 1VF1A 2C3QA 1R5AA 3DYRA 3HVXA 3KCMA 1QGVA 1ERVA 1GSYA 4X4JA 1ZYQB 2IMKA 2X64A 4ECBA 2VL2C 4YAPA 1M2BA 4ECIA 4I8BA 3Q74A 2YZUA 1K0MA 1VF2A 1JHBA 2C0DA 3ZITA 4MJEA 5DDLA 2TIRA 3WGEA 5D8IA 3PPUA 3W8JA 1GTBA 4DSQA 4IGJA 3IE3A 5HR1A 2KLXA 5ECLB 2R0GA 4GXZA 2G2QA 4TR0A 4RI7A 2VO4A 1TRWA 4GF0A 2WFCA 3VWUA 4WR4A 2DKHA 2IIYA 2IN3A 5ECMB 5HQPA 5H5SA 2G0FA 4JRRA 1PKWA 3DIEA 2H74A 2FA8A 3HJMA 2LQOA 1OC8A 2JACA 3LXZA 1PX7A 2X8CA 3GX8A 4MZCA 3F8UA 2K9FA 4MJBA 3UJ1A 3TKQA 3GKMA 2VD0A 2LJRA 2I4AA 5A4UA 2HXKA 2IMFA 3ERFA 4HJ2A 5H5RA 1TI1A 2DSAA 5HR2A 1GUMA 3RPNA 2H75A 3MSZA 4XRAA 1B48A 4EE0A 1PSQA 1K0BA 1XPVA 2GQKA 3KD0A 2IMDA 4PUFC 4MA9A 2NBSA 4FYBA 3TOUA 2RIIA 2L4QA 1FHEA 3L9VA 2HYXA 2K6VA 4F03A 5J41A 3TUEA 2PVOC 1BG5A 2CZ3A 2FLSA 5EL8A 4OO5A 5HFKA 6GSVA 2DJ1A 1DBYA 5C04A 3FW2A 2DJ0A 2H0HA 4ZBDA 4RI6A 5CRGA 5J4UA 2E0QA 1ST9A 3ZFBA 3IK7A 3LG6A 1MDKA 1KTEA 1GSSA 5G2ZA 4KSOA 4J57E 2F8FA 3ZREA 4EF0A 4KDYA 1GP1A 4WKWA 4ZL8A 1S3AA 3ZRDA 5HR0A 1WMJA 3ZLPA 3APQA 3P7XA 3IR4A 1B8XA 1YEPA 3UARA 5DALB 2BMXA 3TKSC 2QSIA 5DVBA 2HRAA 3ME8A 5J5NA 5ELAA 1AQVA 3C8EA 5LNKe 1XWAA 4RQXA 1XWBA 1ZYEA 3CSHA 3DEXA 1TK0B 4WF5A 2UZ8A 1G7OA 4ZIJA 1M7TA 5IMFA 4HQSA 4HQZA 2F3MA 4CDOA 1ZL9A 5E4WA 3TKSA 4ML1A 4K0NA 2GZZA 11GSA 3EPTA 4JBBA 1XVQA 1SKWB 1R5PA 1MEKA 3EMPA 1K0DA 1K3OA 2N5FA 1WPIA 3GIXA 3R3EA 2A2PA 4AJ8A 4MCUA 1EGRA 3TRQA 2ES7A 2LEGA 2OADA 2VCXA 5EY6A 4MF6A 2VL3A 4V1Ag 5ECPB 1SL1B 22GSA 2FY6A 4PQ1A 1G6WA 2VIMA 4BVXA 5IO2A 2GT5A 3F6FA 1GNEA 3FRCA 4TR4A 5B8AA 1GNWA 1XW6A 3TJFA 2JADA 2A2SA 1B4QA 1XCCA 1EOHA 1PL2A 1NW2A 5IOWA 4BL7B 1QUWA 4NV5A 3A2XA 1EP7A 5CREA 3UVTA 3IC4A 4TKYA 4XS4A 4BPYA 2LJAA 5DBQA 4POMA 1M9BA 2OJLA 16GSA 1ML6A 2R3XA 1U3AA 2L4CA 5HFGA 2CVDA 3MDKA 5DJMA 3CRTA 2H66A 2VCWA 1JZDA 1U3IA 1ZYNA 1T1VA 5IM9A 3VLNA 1T3BA 2MMZA 4NXIA 2CA8A 2YJ7A 5J3RA 2M80A 2HFDA 3L78A 4F0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOK A;  3ZL5 A;  1N8J A;  4WET A;  4P3Y B;  2FWH A;  1AQX A;  3A5W A;  4CHS A;  3U6V A;  1YZX A;  2YWI A;  3M3M A;  2IJY A;  5B6M A;  1O73 A;  4F9Z A;  5LCZ A;  1SL2 B;  1W89 A;  5CRH A;  2OE3 A;  5CRD A;  1GUK A;  1CQG A;  3RHB A;  3EE2 A;  4ZBA A;  4Q5F A;  4K7I A;  1WIK A;  1QFN A;  2Z9S A;  3PGT A;  2I81 A;  3LJR A;  4OFM A;  3OR5 A;  4ULX A;  1LJR A;  5D93 A;  3KTL A;  3KH7 A;  1JZO A;  2M46 A;  1G6Y A;  2X99 A;  4TXO A;  5IMV A;  3GV1 A;  5CRW A;  4E8H A;  4IVF A;  1O7U A;  1A24 A;  3F4T A;  1EP8 A;  4TVE A;  1GLQ A;  5AIV A;  4ZB8 A;  5ENU A;  3O76 A;  4MAB A;  2H70 A;  2VM1 A;  3CSI A;  3LXT A;  1YKA A;  2E7P A;  4GSS A;  3PH9 A;  4XS6 A;  4KDU A;  1Z9H A;  1SKS B;  3E9J B;  2L6C A;  1GRX A;  3CXG A;  2GSS A;  1AUC A;  3BD2 A;  5LD0 A;  2ZNM A;  1XW9 A;  1ZMA A;  3DRN A;  5ECO B;  5L71 A;  1THX A;  3GL3 A;  1MDI A;  1NSW A;  2V41 A;  2CVK A;  4N0Z A;  1UN2 A;  4LL1 B;  3TJG A;  2VUP A;  4I97 A;  1NM3 A;  2FWG A;  3KMN A;  3HCZ A;  4L5L A;  3LQ7 A;  4N11 A;  4X1U A;  2ZCT A;  1YY7 A;  4H86 A;  1U87 A;  5G1L A;  4MZB A;  1EEM A;  1T4Z A;  1HNB A;  1U6T A;  2RUE A;  3FZ9 A;  5KN3 A;  3LGC A;  5F06 A;  1XIY A;  1EGO A;  2GTU A;  1J0F A;  1H4O A;  2R4V A;  2WUL A;  5GST A;  3SBC A;  4MJA A;  5F8B A;  3IRA A;  3FZ4 A;  1DE2 A;  2HRF A;  3APS A;  2JZR A;  3UL3 A;  2HNL A;  3IXR A;  3F63 A;  3FEU A;  4ZIL A;  5KN0 A;  4IP6 A;  3P90 A;  2ALB A;  4NMU A;  4V1A p;  1V98 A;  3ME7 A;  3UVH A;  2I1U A;  2A4V A;  3Q6O A;  2K8V A;  2QKE A;  4MP4 A;  2HSH A;  4FYU A;  1AXD A;  4PNG A;  1BAY A;  20GS A;  3J7Y b;  3KM6 A;  1OKD A;  4XTS A;  3LYP A;  4IHU A;  2XPD A;  5JCG A;  5CYY A;  5J9B A;  2EIR A;  1UVZ A;  1FOV A;  1PA3 A;  12GS A;  1M99 A;  3P2A A;  2WRT A;  1Z5Y E;  3HXS A;  4J2F A;  2XHF A;  1T00 A;  4PXO A;  1XW5 A;  2LTK A;  5HR3 A;  4IQ1 A;  4TR1 A;  3KGK A;  1IYH A;  1QMV A;  2BJX A;  4HOJ A;  1U88 A;  4YQV A;  2FD3 A;  1XZO A;  4GST A;  3KP9 A;  3IAM 2;  3KH9 A;  3PR8 A;  3IDV A;  1O8W A;  5CNW A;  3C1R A;  4I5Q A;  2GZY A;  3UAP A;  2L57 A;  3HKR A;  2XC2 A;  4G10 A;  2N5A A;  2IFQ A;  1FG4 A;  2RLI A;  4TRX A;  2RM6 A;  4KA0 A;  3CRU A;  1DUG A;  3KJY A;  2FWE A;  2CAI A;  2O89 A;  5DQS A;  4EC0 A;  4L5O A;  3MAK A;  1THO A;  1GTA A;  4KUN A;  4O32 A;  4OFN A;  4MF7 A;  3GN3 A;  3QR6 A;  4ECC A;  3QD9 A;  3DXB A;  3GNJ A;  2ZUP A;  4NV2 A;  4L0U A;  1QK8 A;  2VD1 A;  2WS2 A;  3A2V A;  2PMT A;  1Z6N A;  5IMD A;  4DVC A;  2CQ9 A;  2PGT A;  3HDC A;  3ZIV A;  2JSY A;  5G31 A;  1HD2 A;  2QGV A;  1F2E A;  4WXT A;  5G5F A;  2VCQ A;  1M2A A;  4MJC A;  1OE7 A;  4NHZ A;  2HLS A;  3TCO A;  1YEX A;  4IJ3 A;  4MMM A;  4J56 E;  4K8M A;  3EUR A;  1LBK A;  1A2J A;  5F07 A;  2REM A;  1QXH A;  1FAA A;  4ZB6 A;  5IMA A;  2RUF A;  2OBI A;  1BQ7 A;  3CMI A;  1XWK A;  3HA9 A;  1IYI A;  3GUS A;  5JCU A;  4KX4 A;  4ZBB A;  3QPM A;  4GQC A;  5FHI A;  3NZN A;  4WBJ A;  4IEL A;  2AB6 A;  2GSQ A;  3FR6 A;  4EDZ A;  3FZ5 A;  5GZZ B;  1HQO A;  2BTO T;  1VRS D;  1GH2 A;  1UC7 A;  1XOB A;  2N5B A;  4GQF A;  1M2D A;  3BBY A;  1TU7 A;  1Z7P A;  3ZMK A;  4ZL9 A;  3ZML A;  4FO5 A;  4IJI A;  2P31 A;  3IAS 2;  1X9M B;  3EVI A;  2P5Q A;  3DWV A;  1A2L A;  3VI5 A;  2P0G A;  4MF5 A;  1UA5 A;  3BJ5 A;  3KIJ A;  4KAE A;  3G7Y A;  5DCH A;  1G0T A;  2H1G A;  4K0G A;  4I2T A;  3ZYW A;  3UMA A;  4EUY A;  3HZ4 A;  4PGT A;  5COH A;  1SL0 B;  5DAK A;  1Z6M A;  1ZGN A;  3IPZ A;  5D73 A;  4ACS A;  2R37 A;  1ERT A;  3F3Q A;  5D9T A;  2H72 A;  2DJJ A;  4PUA A;  4QQ7 A;  1F3B A;  1GSE A;  2LRC A;  3WT1 A;  4XS4 B;  3EU3 A;  2R5G A;  4MH3 A;  5B6N A;  2H6Y A;  1VF4 A;  3IA1 A;  5F0G A;  4EL1 A;  3UBL A;  4EDY A;  1ABA A;  5E59 A;  3GKX A;  3TJJ A;  3W8S A;  3VFI A;  1BED A;  1ZOF A;  3LEF A;  2YP6 A;  14GS A;  18GS A;  2AV4 A;  3D0Z A;  1F3A A;  1TRU A;  2GQM A;  3N5O A;  3C7M A;  4IQA A;  2GZP A;  1O6J A;  5IPH A;  4FYC A;  5F05 A;  1TI3 A;  2EIQ A;  5CP1 A;  3GTU A;  1CQH A;  1QQ2 A;  1PN9 A;  1X0R A;  5IMC A;  4G2E A;  5A5K A;  2OE1 A;  2D2Z A;  5G5E A;  4BVY A;  3H1N A;  3UBK A;  4N0V A;  5D9V A;  2P5R A;  4K7O A;  2VCV A;  2KP1 A;  3F9U A;  5CO3 A;  4TXO B;  2R2J A;  4GTU A;  2YOI A;  1T8E B;  4LMW A;  3U5R E;  3M8N A;  4HEA 2;  4XRD A;  2VCZ A;  1AQW A;  3FKF A;  2YWN A;  2YN1 A;  3WT2 A;  3KTB A;  1EEJ A;  5AIX A;  2F8A A;  5ECH B;  1A8L A;  4DSS A;  3KP8 A;  3FR9 A;  5G1K A;  2YWO A;  4NPB A;  5B7C A;  4ECJ A;  3GSS A;  1K0N A;  1PL1 A;  3QAW A;  3V1W A;  2B5X A;  1FVJ A;  4BA7 A;  4JR4 A;  1DSB A;  1X9S B;  2AJQ B;  4L0W A;  1EV4 A;  4L8E A;  4IP1 A;  1K3L A;  3DD3 A;  4NHW A;  3LSZ A;  2LRT A;  1VGL A;  1WP0 A;  2H71 A;  2XBQ A;  3SWL A;  3GFK A;  1YF1 A;  3ERW A;  3I9V 2;  3VWW A;  5AGY A;  3ZFL A;  2DBC A;  1E6B A;  3WGX A;  2E2G A;  3D6I A;  2QC7 A;  17GS A;  4N10 A;  3I6A A;  1NHO A;  1JZR A;  2HI7 A;  5CAX A;  3JCM L;  5H5Q A;  1A2M A;  3DML A;  5IQY A;  1GL8 A;  3GYK A;  1Y6E A;  2VCT A;  4D73 A;  4QL9 A;  1PKZ A;  4POB A;  2DMM A;  2IWT A;  1BYE A;  2JSZ A;  5GSS A;  4GSN A;  4BWQ A;  4PQH A;  2OKA A;  1ERW A;  5AN1 A;  3TDG A;  2R6K A;  2OBK A;  4Q5N A;  2V2G A;  1PQN A;  1YDK A;  2GGT A;  5JWQ B;  3NIV A;  1M0U A;  1O81 A;  2J23 A;  2IL3 A;  3F3R A;  2A2R A;  3IK9 A;  4MPF A;  2MMN A;  2FWF A;  2DJ3 A;  2ON7 A;  3FR3 A;  4POK A;  4GWR A;  3ED3 A;  4NWY A;  2HRN A;  2MBS A;  1GLP A;  1A0R P;  3ZVJ A;  3HYP A;  2NVL A;  3VWV A;  4OO4 A;  2DLX A;  3Q18 A;  2WJU A;  4GCI A;  2B1K A;  2YZH A;  1W4V A;  13GS A;  3UOM A;  1J08 A;  1I9D A;  4N30 A;  5DQY A;  2KP2 A;  1NHY A;  4KCA A;  1MD4 A;  4MPG A;  3QDN A;  1T7P B;  1TK5 B;  1ON4 A;  4HDE A;  1M9A A;  3HVS A;  4JE1 A;  3M9K A;  4V2M A;  1F6M C;  3M1G A;  1PMT A;  3QMX A;  2AYT A;  4XIH A;  1GWC A;  4JED A;  3AY8 A;  2L6D A;  4TR3 A;  5IPG A;  4TR1 B;  1JLV A;  1R7H A;  3RDW A;  4EVM A;  1EWX A;  1B9Y C;  2GDR A;  3GHA A;  4XHM A;  1TW9 A;  2VL9 A;  2LNS A;  1K3Y A;  3BOA A;  2MZC A;  6GSX A;  4OD7 A;  1SD9 A;  1SJ6 A;  2H6X A;  3EU4 A;  4IS0 A;  2JZT A;  2C4J A;  2CVB A;  3GH6 A;  2CX3 A;  2IFQ B;  4MLY A;  4G9H A;  7GSS A;  3QOU A;  3GH9 A;  4BWS A;  3TRP A;  3MWH A;  5D9W A;  3IOS A;  2GSR A;  2I9H A;  3LYK A;  4O7H A;  4K7N A;  1JLW A;  4X0X A;  4HU9 A;  2PWJ A;  2F51 A;  3TGZ A;  1XWC A;  1BX9 A;  4X43 A;  5C00 A;  3DGQ A;  4YQM A;  2PU9 C;  2KUC A;  5IOX A;  1G7E A;  3M9J A;  3HY2 A;  4HZ4 A;  5ID2 A;  2K8S A;  4K2D A;  4YH2 A;  4LMV A;  2X8H A;  3GX0 A;  2DJ2 A;  2H6Z A;  4QL7 A;  4IW9 A;  2PVQ A;  2GT6 A;  1GUL A;  3HD5 A;  2DML A;  1FW1 A;  4DSR A;  1X5C A;  1I5G A;  3P8W A;  5GAN D;  5J9C A;  2L5O A;  1JFU A;  2C0F A;  1OC9 A;  2WDU A;  3HVV A;  1R26 A;  2C0E A;  1PGT A;  3VPQ A;  1H75 A;  1TXX A;  5A4V A;  3IHQ A;  3W6G A;  5KN2 A;  3QFB C;  4HS1 A;  2C80 A;  3FK8 A;  3GKN A;  4E8E A;  3NOF A;  4RUV A;  1XWG A;  4G19 A;  2HZE B;  3MNG A;  2H1D A;  1TJD A;  4CW9 A;  1XBS A;  1FO5 A;  1URM A;  2LKU A;  5IIZ A;  2H76 A;  3VPT A;  2KHP A;  1GSQ A;  4I6X A;  3G7J A;  1WRY A;  2C3N A;  2VLU A;  2YPM A;  5GAP D;  3CTF A;  1AIU A;  4HU7 A;  1Y25 A;  1YJ6 A;  2GST A;  3TKP A;  2YWM A;  1B4P A;  1OAZ A;  3I69 A;  3C73 A;  3TJB A;  1SYR A;  2VL2 A;  4EKZ A;  2WB9 A;  4ISD A;  3GUR A;  1MD3 A;  1TTZ A;  4EO3 A;  2OA7 A;  4OMV A;  4F0C A;  2PUK C;  2E2M A;  2IMI A;  3DVX A;  2MMA A;  1A0F A;  3EYT A;  2YCD A;  3PIN A;  5JWO B;  1GSF A;  4GLT A;  2B7J A;  1ERU A;  4PNF A;  1K0O A;  4F2I A;  2PBJ A;  3VWX A;  8GSS A;  1T4Y A;  5HFI A;  1KNG A;  3TJK A;  5DAK B;  2JL4 A;  4Z7X A;  3A3T A;  3F6D A;  3TRX A;  2X8G A;  3ZZX A;  2HZE A;  2C0G A;  4JR6 A;  4IKH A;  3TKS E;  9GSS A;  2C1Y A;  2C8U A;  2HE3 A;  3D21 A;  5ECI B;  3I43 A;  2CX4 A;  3TOT A;  1MDJ A;  4TOP A;  2DIZ A;  3ZIJ A;  2LRN A;  2LV3 A;  5EVO A;  1GSD A;  3N9J A;  1EV9 A;  3QAG A;  3ISO A;  2O7K A;  1F37 A;  1S3C A;  3UEM A;  5ECK B;  5ECN B;  3RPP A;  4HUA A;  1SK2 A;  3APO A;  3RHC A;  3IV4 A;  4DEJ A;  6GSY A;  2H1B A;  3O6T A;  4O5R A;  3FYG A;  2CAQ A;  1SJZ A;  3A2W A;  2B7K A;  5A4W A;  1GUH A;  2TRC P;  4ZXG A;  1WOU A;  3FZA A;  4EXJ A;  2LQQ A;  1Q98 A;  4KH7 A;  3L9U A;  3BCK A;  2CT6 A;  1HYU A;  2DC5 A;  3KXO A;  2GLR A;  1GTU A;  2I3Y A;  4AJ6 A;  3GTU B;  2LJK A;  3L9S A;  2H73 A;  3E3E A;  1SD8 A;  4KSM A;  5EPF A;  1V9W A;  2OAC A;  2B3S A;  1K0C A;  2YAN A;  1VF3 A;  1V58 A;  1XXU A;  5ELG A;  3WD6 A;  3VI7 A;  1GSU A;  2C3T A;  3CSJ A;  2ON5 A;  19GS A;  3LOR A;  4V2N A;  4RQR A;  4MK3 A;  1X9W B;  5FWG A;  4DSS B;  2WGR A;  3GKK A;  1TDI A;  1HNA A;  2GS3 A;  4KGI A;  1ACV A;  2LST A;  4KCE A;  4AJ7 A;  3Q19 A;  2YNX A;  3IBH A;  5DCG A;  1RW1 A;  2YV9 A;  4K6X A;  2OE0 A;  1J9B A;  5D96 A;  1JZW A;  10GS A;  1XVW A;  4KE3 A;  2H19 A;  2JU5 A;  2IPA A;  2MYG A;  2AAW A;  4ILF A;  5DAL A;  2H0G A;  3H8Q A;  1SU9 A;  3L0H A;  3S9F A;  1O8X A;  2LUS A;  4XCS A;  4ZB9 A;  4IN0 A;  1SEN A;  1FB6 A;  1PD2 1;  3GST A;  1XFL A;  4WEY A;  4O92 A;  2FCH A;  3H4K A;  2NPB A;  2AHE A;  4PUR A;  4OFT A;  1N2A A;  5KEJ A;  1V57 A;  1HNC A;  5ECR B;  3J7Y k;  3C1S A;  2WZ9 A;  1V2A A;  3EC3 A;  4D73 B;  5AIS A;  4YAV A;  1A23 A;  2H0I A;  3CTG A;  3F4R A;  4WR5 A;  2H1A A;  1PX6 A;  3FY7 A;  1B9X C;  3UIW A;  1ILO A;  2IME A;  4LA1 A;  6GSS A;  1BJX A;  1X5E A;  1SKR B;  1C72 A;  4HI7 A;  6GSU A;  3G7I A;  2H30 A;  1OE8 A;  1ZCP A;  2PPT A;  1OC3 A;  3HJO A;  1F9M A;  4WF4 A;  1SYX A;  2DIY A;  2PN8 A;  3D4M A;  2B6M A;  3EIN A;  2O8V B;  3D5J A;  4HJM A;  5G30 A;  2VOC A;  4HZ2 A;  4LLR A;  3L4N A;  2CV4 A;  3R2Q A;  2HSY A;  2PER A;  2B5E A;  2V6O A;  4JU5 A;  2YJH A;  1OYJ A;  3F4S A;  2F9S A;  3WYW A;  4PQI A;  3FHK A;  3QAV A;  2EIO A;  2B1L A;  3GRX A;  4BL7 A;  1R4W A;  1TRS A;  4ID0 A;  1YKC A;  1SJI A;  4GRF A;  2LNT A;  2O87 A;  4MH2 A;  3TKR A;  1GTI A;  3EMX A;  2TRX A;  5ABR A;  4YQU A;  4KDX A;  2GQL A;  3DVW A;  1SK1 A;  1ZZY A;  1SK0 A;  3H79 A;  2VAF A;  5DJL A;  1PRX A;  3RBT A;  3LFL A;  3RAZ A;  2HZF A;  3VK9 A;  1TOF A;  3US3 A;  2GVP A;  4AGS A;  2AUV A;  1LU4 A;  3E0U A;  2H8L A;  4PX1 A;  2VM2 A;  4OCF A;  5IMZ A;  1DE1 A;  2VLT A;  1V40 A;  4ZL7 A;  3HJP A;  2J9H A;  4IBP A;  1TRV A;  3KEB A;  1TKD B;  3ZTL A;  1FVK A;  2EC4 A;  1USB A;  3HZ8 A;  2K18 A;  1A8Y A;  2WCI A;  2V32 A;  2NDO A;  2DJK A;  4K9Z A;  2VLV A;  3HHV A;  1AC1 A;  2XPE A;  1Q4J A;  4KND A;  4POL A;  3CYN A;  4Q5Q A;  1K0A A;  3EWL A;  1YQ1 A;  2FNO A;  2MMO A;  3GA4 A;  3LWA A;  2L59 A;  1X5D A;  2JZS A;  1RK4 A;  3VUR A;  1XOA A;  3O3T A;  3QCP A;  4FIW A;  1Z3E A;  1WJK A;  5B8B A;  3D22 A;  4Q5R A;  3TB2 A;  3DKS A;  3QFA C;  1MTC A;  5ID2 B;  4AF2 A;  6GST A;  1OKT A;  4F82 A;  4OCE A;  1Z7R A;  4TW5 A;  2O85 A;  1TK8 B;  3F0I A;  1WWJ A;  4OWY A;  3ZVJ D;  1FB0 A;  4V2L A;  3GMF A;  3KMO A;  1TU8 A;  1AAZ A;  4MZW A;  2RM5 A;  4FH8 A;  3H93 A;  3WGD A;  4LL4 B;  1TP9 A;  4WBR D;  1OC9 B;  3CBU A;  2FA4 A;  5JCW A;  1EZK A;  6GSW A;  2CZ2 A;  5ECS A;  5KN1 A;  4ML6 A;  4KW6 A;  2HT9 A;  3BCI A;  3KZQ A;  2FGX A;  1KEB A;  2LS5 A;  2B5Y A;  3K8N A;  4NAX A;  1RQM A;  5D9X A;  4XS1 A;  3C71 A;  2NTO A;  1WE0 A;  2YV7 A;  1S3D A;  2V1M A;  2FHE A;  1AW9 A;  4I2U A;  1E2Y A;  2H01 A;  4JZQ A;  4K1F A;  3M0F A;  5ECQ B;  2FUG 2;  2V6K A;  1YF0 A;  2XBI A;  5INY A;  5FT3 A;  2M72 A;  3D4T A;  2L5L A;  1OVN A;  5JWR B;  3GL5 A;  3G9B A;  1KBN A;  1O85 A;  4KB3 A;  4TXV A;  5IO0 A;  1EOG A;  3ERG A;  4MDC A;  4TN8 A;  2MBT A;  1VF1 A;  2C3Q A;  1R5A A;  3DYR A;  3HVX A;  3KCM A;  1QGV A;  1ERV A;  1GSY A;  1ZYQ B;  2IMK A;  2X64 A;  4ECB A;  2VL2 C;  4YAP A;  1M2B A;  4ECI A;  4I8B A;  3Q74 A;  2YZU A;  1K0M A;  1VF2 A;  1JHB A;  2C0D A;  3ZIT A;  4MJE A;  5DDL A;  2TIR A;  3WGE A;  5D8I A;  3W8J A;  1GTB A;  4DSQ A;  4IGJ A;  3IE3 A;  5HR1 A;  2KLX A;  5ECL B;  4GXZ A;  2G2Q A;  4TR0 A;  4RI7 A;  2VO4 A;  1TRW A;  4GF0 A;  2WFC A;  3VWU A;  4WR4 A;  5ECM B;  2IIY A;  2IN3 A;  5HQP A;  5H5S A;  2G0F A;  4JRR A;  1PKW A;  3DIE A;  2H74 A;  2FA8 A;  3HJM A;  2LQO A;  1OC8 A;  2JAC A;  3LXZ A;  1PX7 A;  2X8C A;  3GX8 A;  4MZC A;  3F8U A;  2K9F A;  4MJB A;  3UJ1 A;  3TKQ A;  3GKM A;  2VD0 A;  2LJR A;  2I4A A;  5A4U A;  2HXK A;  2IMF A;  3ERF A;  4HJ2 A;  5H5R A;  1TI1 A;  2DSA A;  5HR2 A;  1GUM A;  3RPN A;  2H75 A;  3MSZ A;  4XRA A;  1B48 A;  4EE0 A;  1PSQ A;  1K0B A;  1XPV A;  2GQK A;  3KD0 A;  2IMD A;  4PUF C;  4MA9 A;  2NBS A;  4FYB A;  3TOU A;  2RII A;  2L4Q A;  1FHE A;  3L9V A;  2HYX A;  2K6V A;  4F03 A;  5J41 A;  3TUE A;  2PVO C;  1BG5 A;  2CZ3 A;  2FLS A;  5EL8 A;  4OO5 A;  5HFK A;  6GSV A;  2DJ1 A;  1DBY A;  5C04 A;  3FW2 A;  2DJ0 A;  2H0H A;  4ZBD A;  4RI6 A;  5CRG A;  5J4U A;  2E0Q A;  1ST9 A;  3ZFB A;  3IK7 A;  3LG6 A;  1MDK A;  1KTE A;  1GSS A;  5G2Z A;  4KSO A;  4J57 E;  2F8F A;  3ZRE A;  4EF0 A;  4KDY A;  1GP1 A;  4WKW A;  4ZL8 A;  1S3A A;  3ZRD A;  5HR0 A;  1WMJ A;  3ZLP A;  3APQ A;  3P7X A;  3IR4 A;  1B8X A;  1YEP A;  3UAR A;  5DAL B;  2BMX A;  3TKS C;  2QSI A;  5DVB A;  3ME8 A;  5J5N A;  5ELA A;  1AQV A;  3C8E A;  5LNK e;  1XWA A;  4RQX A;  1XWB A;  1ZYE A;  3CSH A;  3DEX A;  1TK0 B;  4WF5 A;  1G7O A;  4ZIJ A;  1M7T A;  5IMF A;  4HQS A;  4HQZ A;  2F3M A;  4CDO A;  1ZL9 A;  5E4W A;  3TKS A;  4ML1 A;  4K0N A;  2GZZ A;  11GS A;  4JBB A;  1XVQ A;  1SKW B;  1R5P A;  1MEK A;  3EMP A;  1K0D A;  1K3O A;  2N5F A;  1WPI A;  3GIX A;  4AJ8 A;  4MCU A;  1EGR A;  3TRQ A;  2ES7 A;  2LEG A;  2OAD A;  2VCX A;  5EY6 A;  4MF6 A;  2VL3 A;  4V1A g;  5ECP B;  1SL1 B;  22GS A;  2FY6 A;  4PQ1 A;  1G6W A;  2VIM A;  4BVX A;  5IO2 A;  2GT5 A;  3F6F A;  1GNE A;  3FRC A;  4TR4 A;  5B8A A;  1GNW A;  1XW6 A;  3TJF A;  2JAD A;  2A2S A;  1B4Q A;  1XCC A;  1EOH A;  1PL2 A;  1NW2 A;  5IOW A;  1QUW A;  4NV5 A;  3A2X A;  1EP7 A;  5CRE A;  3UVT A;  3IC4 A;  4TKY A;  4XS4 A;  4BPY A;  2LJA A;  5DBQ A;  4POM A;  1M9B A;  2OJL A;  16GS A;  1ML6 A;  2R3X A;  1U3A A;  2L4C A;  5HFG A;  2CVD A;  3MDK A;  5DJM A;  3CRT A;  2H66 A;  2VCW A;  1JZD A;  1U3I A;  1T1V A;  5IM9 A;  3VLN A;  1T3B A;  2MMZ A;  4NXI A;  2CA8 A;  2YJ7 A;  5J3R A;  2M80 A;  2HFD A;  3L78 A;  4F0B A; 
#chains in the Genus database with same CATH topology
 2KOK A;  3ZL5 A;  1N8J A;  4WET A;  2HSM A;  2A4H A;  4P3Y B;  2FWH A;  1AQX A;  3A5W A;  4CHS A;  3U6V A;  1YZX A;  2YWI A;  3M3M A;  2IJY A;  5B6M A;  1O73 A;  4F9Z A;  5LCZ A;  1SL2 B;  1W89 A;  5CRH A;  2OE3 A;  5CRD A;  1GUK A;  1CQG A;  4Z2U A;  3RHB A;  3EE2 A;  4ZBA A;  4Q5F A;  4K7I A;  1WIK A;  1QFN A;  2Z9S A;  3PGT A;  2I81 A;  3LJR A;  4OFM A;  3OR5 A;  4ULX A;  3IC8 A;  1LJR A;  5D93 A;  3KTL A;  3KH7 A;  1JZO A;  4A5P A;  2M46 A;  1ZYP A;  1G6Y A;  2X99 A;  4TXO A;  5IMV A;  3GV1 A;  5CRW A;  4E8H A;  4IVF A;  1O7U A;  1A24 A;  4ICY A;  3F4T A;  1EP8 A;  4TVE A;  1GLQ A;  5AIV A;  4ZB8 A;  5ENU A;  3O76 A;  4MAB A;  2H70 A;  2VM1 A;  3CSI A;  3LXT A;  1YKA A;  2E7P A;  4GSS A;  3PH9 A;  4XS6 A;  4KDU A;  1Z9H A;  1SKS B;  3E9J B;  2L6C A;  1GRX A;  3CXG A;  2GSS A;  1AUC A;  3IHG A;  3BD2 A;  5LD0 A;  2ZNM A;  1XW9 A;  1ZMA A;  3DRN A;  5ECO B;  5L71 A;  1THX A;  3GL3 A;  1MDI A;  1NSW A;  2V41 A;  2CVK A;  4N0Z A;  1UN2 A;  4LL1 B;  3TJG A;  2VUP A;  4I97 A;  1NM3 A;  2FWG A;  3KMN A;  3HCZ A;  4L5L A;  3LQ7 A;  4N11 A;  4X1U A;  2ZCT A;  1YY7 A;  4H86 A;  1U87 A;  5G1L A;  4MZB A;  1EEM A;  1T4Z A;  1HNB A;  1U6T A;  2RUE A;  3FZ9 A;  5KN3 A;  3LGC A;  5F06 A;  1XIY A;  1EGO A;  2GTU A;  1J0F A;  1H4O A;  2R4V A;  2WUL A;  5GST A;  3SBC A;  2R0P A;  3LW9 A;  4MJA A;  5F8B A;  3IRA A;  3FZ4 A;  1DE2 A;  2HRF A;  3APS A;  2JZR A;  3UL3 A;  2HNL A;  3IXR A;  3F63 A;  3FEU A;  4ZIL A;  5KN0 A;  4IP6 A;  3P90 A;  2ALB A;  4NMU A;  4V1A p;  1V98 A;  3ME7 A;  3UVH A;  2I1U A;  2A4V A;  1M3I A;  1XG8 A;  3Q6O A;  2K8V A;  2QKE A;  4MP4 A;  2HSH A;  4FYU A;  1AXD A;  4PNG A;  1BAY A;  20GS A;  3J7Y b;  3KM6 A;  1OKD A;  4XTS A;  3LYP A;  4IHU A;  2XPD A;  5JCG A;  5CYY A;  5J9B A;  2EIR A;  1UVZ A;  1FOV A;  1PA3 A;  12GS A;  1M99 A;  3P2A A;  2WRT A;  1Z5Y E;  3HXS A;  4J2F A;  2XHF A;  1T00 A;  4PXO A;  1XW5 A;  2LTK A;  5HR3 A;  4IQ1 A;  4TR1 A;  3KGK A;  1IYH A;  1QMV A;  2BJX A;  4HOJ A;  4O5Q A;  1U88 A;  4YKG A;  4YQV A;  2FD3 A;  1XZO A;  4GST A;  3KP9 A;  3IAM 2;  3KH9 A;  3PR8 A;  3IDV A;  1O8W A;  1S3R A;  5CNW A;  3C1R A;  4I5Q A;  2GZY A;  3UAP A;  2L57 A;  3HKR A;  2XC2 A;  4G10 A;  2N5A A;  2IFQ A;  1FG4 A;  2RLI A;  4TRX A;  2RM6 A;  4KA0 A;  5BMU A;  3CRU A;  1DUG A;  3KJY A;  2FWE A;  2CAI A;  1FOH A;  2O89 A;  5DQS A;  4EC0 A;  4L5O A;  3MAK A;  1THO A;  1GTA A;  4KUN A;  4O32 A;  4OFN A;  4MF7 A;  3GN3 A;  3QR6 A;  4ECC A;  3QD9 A;  3DXB A;  3GNJ A;  2ZUP A;  4NV2 A;  4L0U A;  1QK8 A;  2VD1 A;  2WS2 A;  4EIQ A;  3A2V A;  2PMT A;  1Z6N A;  5IMD A;  4DVC A;  2CQ9 A;  2PGT A;  3HDC A;  3ZIV A;  2JSY A;  5G31 A;  1HD2 A;  2QGV A;  1F2E A;  4WXT A;  5G5F A;  2VCQ A;  1M2A A;  4MJC A;  1OE7 A;  4NHZ A;  2HLS A;  3TCO A;  1YEX A;  4IJ3 A;  4MMM A;  4J56 E;  4K8M A;  3EUR A;  1LBK A;  1A2J A;  5F07 A;  2REM A;  1QXH A;  1FAA A;  4ZB6 A;  5IMA A;  2RUF A;  2OBI A;  1M3J A;  1BQ7 A;  3CMI A;  1XWK A;  3HA9 A;  1IYI A;  3GUS A;  5JCU A;  4KX4 A;  4ZBB A;  3QPM A;  4GQC A;  5FHI A;  3NZN A;  4WBJ A;  4IEL A;  2AB6 A;  2GSQ A;  3FR6 A;  4EDZ A;  3FZ5 A;  5GZZ B;  1HQO A;  2BTO T;  1VRS D;  1GH2 A;  1UC7 A;  1XOB A;  2N5B A;  4GQF A;  1M2D A;  3BBY A;  1TU7 A;  1Z7P A;  3ZMK A;  4ZL9 A;  3ZML A;  4FO5 A;  4IJI A;  2P31 A;  3IAS 2;  1X9M B;  3EVI A;  2P5Q A;  3DWV A;  1A2L A;  3VI5 A;  2P0G A;  4MF5 A;  1UA5 A;  3BJ5 A;  3KIJ A;  4KAE A;  4BVX B;  3G7Y A;  5DCH A;  1G0T A;  2H1G A;  4K0G A;  4I2T A;  3ZYW A;  3UMA A;  4EUY A;  3HZ4 A;  4PGT A;  5COH A;  1SL0 B;  5DAK A;  1Z6M A;  1ZGN A;  3IPZ A;  5D73 A;  4ACS A;  2R37 A;  1ERT A;  3F3Q A;  5D9T A;  2H72 A;  4EIP A;  2DJJ A;  4PUA A;  4QQ7 A;  1F3B A;  1GSE A;  2LRC A;  3WT1 A;  4XS4 B;  3EU3 A;  2R5G A;  4MH3 A;  5B6N A;  2H6Y A;  1VF4 A;  3IA1 A;  5F0G A;  4EL1 A;  3UBL A;  4EDY A;  1ABA A;  5E59 A;  3GKX A;  3TJJ A;  3W8S A;  3VFI A;  1BED A;  1ZOF A;  3LEF A;  2YP6 A;  14GS A;  18GS A;  2AV4 A;  3D0Z A;  1F3A A;  1TRU A;  2GQM A;  3N5O A;  3C7M A;  4IQA A;  2GZP A;  1O6J A;  5IPH A;  4FYC A;  5F05 A;  1TI3 A;  2EIQ A;  5CP1 A;  3GTU A;  1CQH A;  1QQ2 A;  1PN9 A;  1X0R A;  5IMC A;  4G2E A;  5A5K A;  2OE1 A;  2D2Z A;  5G5E A;  4BVY A;  3H1N A;  3UBK A;  4N0V A;  5D9V A;  2P5R A;  4K7O A;  2VCV A;  2KP1 A;  3F9U A;  5CO3 A;  4TXO B;  2R2J A;  4GTU A;  2YOI A;  1T8E B;  4LMW A;  3U5R E;  3M8N A;  4HEA 2;  4XRD A;  2VCZ A;  1AQW A;  3FKF A;  2YWN A;  2YN1 A;  3WT2 A;  3KTB A;  1EEJ A;  5AIX A;  2F8A A;  5ECH B;  1A8L A;  4DSS A;  3KP8 A;  3FR9 A;  5G1K A;  2YWO A;  4NPB A;  5B7C A;  4ECJ A;  3GSS A;  1K0N A;  1PL1 A;  3QAW A;  3V1W A;  2B5X A;  1FVJ A;  4BA7 A;  4JR4 A;  1DSB A;  1X9S B;  2AJQ B;  4L0W A;  1EV4 A;  4L8E A;  4IP1 A;  1K3L A;  3DD3 A;  4NHW A;  3LSZ A;  2LRT A;  1VGL A;  1WP0 A;  2H71 A;  2XBQ A;  3SWL A;  3GFK A;  1YF1 A;  3ERW A;  3I9V 2;  3VWW A;  5AGY A;  3ZFL A;  2DBC A;  1E6B A;  3WGX A;  2E2G A;  3D6I A;  2QC7 A;  17GS A;  4N10 A;  3I6A A;  1NHO A;  1JZR A;  1PFO A;  2HI7 A;  5CAX A;  3JCM L;  5H5Q A;  1A2M A;  3DML A;  5IQY A;  1GL8 A;  3GYK A;  1Y6E A;  2VCT A;  4D73 A;  4QL9 A;  1PKZ A;  4POB A;  2DMM A;  2IWT A;  1BYE A;  2JSZ A;  5GSS A;  4GSN A;  4Z2R A;  4BWQ A;  4PQH A;  2OKA A;  1ERW A;  5AN1 A;  3TDG A;  2R6K A;  2OBK A;  4Q5N A;  2V2G A;  1PQN A;  1YDK A;  2GGT A;  5JWQ B;  3NIV A;  1M0U A;  1O81 A;  2J23 A;  2IL3 A;  3F3R A;  2A2R A;  3IK9 A;  4MPF A;  2MMN A;  2FWF A;  4POK A;  2DJ3 A;  2ON7 A;  3FR3 A;  4GWR A;  3ED3 A;  4NWY A;  2HRN A;  2MBS A;  1GLP A;  1A0R P;  3ZVJ A;  3HYP A;  2NVL A;  3VWV A;  4OO4 A;  2DLX A;  3Q18 A;  2WJU A;  4GCI A;  2B1K A;  2YZH A;  1W4V A;  13GS A;  3UOM A;  1J08 A;  1I9D A;  2QA1 A;  4N30 A;  5DQY A;  2KP2 A;  1NHY A;  4G0L A;  4KCA A;  1MD4 A;  4MPG A;  3QDN A;  1T7P B;  1TK5 B;  1ON4 A;  4HDE A;  1M9A A;  3HVS A;  4JE1 A;  3M9K A;  4V2M A;  1F6M C;  3M1G A;  1PMT A;  3QMX A;  2AYT A;  4XIH A;  1GWC A;  4JED A;  3AY8 A;  2L6D A;  4TR3 A;  5IPG A;  4TR1 B;  1JLV A;  1R7H A;  3RDW A;  4EVM A;  1EWX A;  1B9Y C;  2GDR A;  3GHA A;  4XHM A;  1TW9 A;  2VL9 A;  2LNS A;  1K3Y A;  3BOA A;  2MZC A;  6GSX A;  4OD7 A;  4PTS A;  1SD9 A;  1SJ6 A;  2H6X A;  3EU4 A;  4IS0 A;  2JZT A;  2C4J A;  2CVB A;  3GH6 A;  2CX3 A;  2IFQ B;  4MLY A;  4USS A;  4G9H A;  7GSS A;  3QOU A;  3GH9 A;  4BWS A;  3TRP A;  3MWH A;  5D9W A;  3IOS A;  4HSC X;  2GSR A;  2I9H A;  3LYK A;  4G0K A;  4O7H A;  4K7N A;  1JLW A;  4X0X A;  4HU9 A;  2PWJ A;  2F51 A;  3TGZ A;  1XWC A;  1BX9 A;  4X43 A;  5C00 A;  3DGQ A;  4YQM A;  2PU9 C;  2KUC A;  5IOX A;  1G7E A;  3M9J A;  3HY2 A;  4HZ4 A;  5ID2 A;  2K8S A;  4K2D A;  4YH2 A;  4LMV A;  2X8H A;  3GX0 A;  2DJ2 A;  2H6Z A;  4QL7 A;  4IW9 A;  2PVQ A;  2GT6 A;  1GUL A;  3HD5 A;  2DML A;  1FW1 A;  4DSR A;  1X5C A;  1I5G A;  3P8W A;  5GAN D;  5J9C A;  2L5O A;  1JFU A;  2C0F A;  1OC9 A;  2WDU A;  3HVV A;  1R26 A;  2C0E A;  1PGT A;  3VPQ A;  4CY8 A;  1H75 A;  1TXX A;  5A4V A;  3IHQ A;  3W6G A;  5KN2 A;  3QFB C;  4HS1 A;  5BRT A;  2C80 A;  3FK8 A;  3GKN A;  4E8E A;  3NOF A;  4RUV A;  1XWG A;  4G19 A;  2HZE B;  3MNG A;  2H1D A;  1TJD A;  4CW9 A;  1XBS A;  1FO5 A;  1URM A;  2LKU A;  5IIZ A;  2H76 A;  3VPT A;  2KHP A;  1GSQ A;  4I6X A;  3G7J A;  1WRY A;  2C3N A;  2VLU A;  2YPM A;  5GAP D;  3CTF A;  1AIU A;  4HU7 A;  1Y25 A;  1YJ6 A;  2GST A;  3TKP A;  2YWM A;  1B4P A;  1OAZ A;  3I69 A;  3C73 A;  3TJB A;  1SYR A;  2VL2 A;  4EKZ A;  2WB9 A;  4ISD A;  3GUR A;  1MD3 A;  1TTZ A;  4EO3 A;  2OA7 A;  4OMV A;  4F0C A;  2PUK C;  2E2M A;  2IMI A;  3DVX A;  2MMA A;  1A0F A;  3EYT A;  2YCD A;  3PIN A;  5JWO B;  1GSF A;  4GLT A;  2B7J A;  1ERU A;  4PNF A;  1K0O A;  4F2I A;  2PBJ A;  3VWX A;  8GSS A;  1T4Y A;  5HFI A;  1KNG A;  3TJK A;  5DAK B;  2JL4 A;  4Z7X A;  3A3T A;  3F6D A;  3TRX A;  2X8G A;  3ZZX A;  2HZE A;  2DKI A;  2C0G A;  4JR6 A;  4IKH A;  3TKS E;  9GSS A;  2C1Y A;  2C8U A;  2HE3 A;  3D21 A;  3I43 A;  5ECI B;  2CX4 A;  3TOT A;  1MDJ A;  4TOP A;  2DIZ A;  3ZIJ A;  2LRN A;  2LV3 A;  5EVO A;  1GSD A;  3N9J A;  1EV9 A;  3QAG A;  3ISO A;  2O7K A;  1F37 A;  1S3C A;  3UEM A;  5ECK B;  5ECN B;  3RPP A;  4HUA A;  1SK2 A;  3APO A;  3RHC A;  3IV4 A;  4DEJ A;  4K5S A;  4K2X A;  2H1B A;  3O6T A;  6GSY A;  4O5R A;  2QA2 A;  3FYG A;  4BIK A;  2CAQ A;  1SJZ A;  3A2W A;  2B7K A;  5A4W A;  1GUH A;  4G0I A;  2TRC P;  4ZXG A;  1WOU A;  3FZA A;  4EXJ A;  2LQQ A;  1Q98 A;  4KH7 A;  3L9U A;  3BCK A;  2CT6 A;  1HYU A;  2DC5 A;  3KXO A;  2GLR A;  1GTU A;  2I3Y A;  4AJ6 A;  3GTU B;  2LJK A;  3L9S A;  2H73 A;  3E3E A;  1SD8 A;  4KSM A;  4BVY B;  5EPF A;  4Z2T A;  1V9W A;  2OAC A;  2B3S A;  1K0C A;  2YAN A;  1VF3 A;  1V58 A;  1XXU A;  5ELG A;  3WD6 A;  3VI7 A;  1GSU A;  2C3T A;  3CSJ A;  2ON5 A;  19GS A;  3LOR A;  4V2N A;  4RQR A;  4MK3 A;  1X9W B;  5FWG A;  4DSS B;  2WGR A;  3GKK A;  1TDI A;  1HNA A;  2GS3 A;  4KGI A;  5KOX A;  1ACV A;  2LST A;  4KCE A;  4AJ7 A;  3Q19 A;  2YNX A;  4MNN A;  3IBH A;  5DCG A;  1RW1 A;  2YV9 A;  4KF9 A;  4K6X A;  2OE0 A;  1J9B A;  5D96 A;  1JZW A;  10GS A;  1XVW A;  4KE3 A;  2H19 A;  2JU5 A;  2IPA A;  2MYG A;  2AAW A;  4ILF A;  5DAL A;  2H0G A;  5KOW A;  3H8Q A;  1SU9 A;  3L0H A;  3S9F A;  1O8X A;  2LUS A;  4XCS A;  4ZB9 A;  4IN0 A;  4O5U A;  1SEN A;  1FB6 A;  1PD2 1;  3GST A;  1XFL A;  4WEY A;  4O92 A;  2FCH A;  3H4K A;  2NPB A;  2AHE A;  4PUR A;  4OFT A;  1N2A A;  5KEJ A;  1V57 A;  1PN0 A;  1HNC A;  5ECR B;  3J7Y k;  3C1S A;  2WZ9 A;  1V2A A;  3EC3 A;  4D73 B;  5AIS A;  4YAV A;  1A23 A;  2H0I A;  3CTG A;  3F4R A;  4WR5 A;  2H1A A;  1PX6 A;  3FY7 A;  1B9X C;  3UIW A;  1ILO A;  2IME A;  4LA1 A;  6GSS A;  1BJX A;  1X5E A;  1SKR B;  1C72 A;  4HI7 A;  6GSU A;  3G7I A;  2H30 A;  1OE8 A;  1ZCP A;  2PPT A;  1OC3 A;  3HJO A;  1F9M A;  4WF4 A;  1SYX A;  2DIY A;  2PN8 A;  3D4M A;  2B6M A;  3EIN A;  2O8V B;  3D5J A;  4HJM A;  5G30 A;  2VOC A;  4HZ2 A;  4LLR A;  3L4N A;  2CV4 A;  3R2Q A;  2HSY A;  2PER A;  2B5E A;  2V6O A;  4JU5 A;  2YJH A;  4YKF A;  1OYJ A;  3F4S A;  2F9S A;  3WYW A;  4PQI A;  3FHK A;  3QAV A;  2EIO A;  2B1L A;  3GRX A;  4BL7 A;  1R4W A;  1TRS A;  4ID0 A;  1YKC A;  1SJI A;  4GRF A;  2LNT A;  3FMW A;  2O87 A;  4MH2 A;  3TKR A;  1GTI A;  3EMX A;  2TRX A;  5ABR A;  4YQU A;  4KDX A;  4K5R A;  2GQL A;  3DVW A;  1SK1 A;  1ZZY A;  1SK0 A;  3H79 A;  3HVN A;  2VAF A;  5DJL A;  1PRX A;  3RBT A;  3LFL A;  3RAZ A;  2HZF A;  3VK9 A;  1TOF A;  3US3 A;  2GVP A;  4AGS A;  2AUV A;  1LU4 A;  3E0U A;  2H8L A;  4PX1 A;  2VM2 A;  4OCF A;  5IMZ A;  1DE1 A;  2X49 A;  2VLT A;  1V40 A;  4ZL7 A;  4CY6 A;  3HJP A;  2J9H A;  4IBP A;  1TRV A;  3KEB A;  1TKD B;  3ZTL A;  1FVK A;  2EC4 A;  1USB A;  3HZ8 A;  2K18 A;  1A8Y A;  2WCI A;  2V32 A;  2NDO A;  2DJK A;  4K9Z A;  2VLV A;  3HHV A;  1AC1 A;  2XPE A;  1Q4J A;  4FQU A;  4KND A;  4POL A;  3CYN A;  4Q5Q A;  1K0A A;  3EWL A;  1YQ1 A;  2FNO A;  2MMO A;  3GA4 A;  3LWA A;  2L59 A;  1X5D A;  2JZS A;  1RK4 A;  3VUR A;  1XOA A;  3O3T A;  3QCP A;  4FIW A;  1Z3E A;  1WJK A;  5B8B A;  3D22 A;  4Q5R A;  3TB2 A;  3DKS A;  3QFA C;  1MTC A;  5ID2 B;  4AF2 A;  2X4A A;  6GST A;  1OKT A;  4F82 A;  4OCE A;  1Z7R A;  4TW5 A;  2O85 A;  1TK8 B;  3F0I A;  1WWJ A;  4OWY A;  3ZVJ D;  1FB0 A;  4V2L A;  3GMF A;  3KMO A;  1TU8 A;  1AAZ A;  4MZW A;  2RM5 A;  4FH8 A;  3H93 A;  3WGD A;  4LL4 B;  1TP9 A;  4WBR D;  1OC9 B;  3MYD A;  3CBU A;  2FA4 A;  5JCW A;  1EZK A;  6GSW A;  2CZ2 A;  5ECS A;  5KN1 A;  4ML6 A;  4KW6 A;  2HT9 A;  3BCI A;  3KZQ A;  2FGX A;  1KEB A;  2LS5 A;  2B5Y A;  3K8N A;  2HRK A;  4NAX A;  1RQM A;  5D9X A;  4XS1 A;  3C71 A;  2NTO A;  3MIX A;  1WE0 A;  2YV7 A;  1S3D A;  2R0C A;  2V1M A;  2FHE A;  1AW9 A;  4I2U A;  1E2Y A;  2H01 A;  4JZQ A;  4K1F A;  3M0F A;  5ECQ B;  2FUG 2;  2V6K A;  1YF0 A;  2XBI A;  5INY A;  5FT3 A;  2M72 A;  3D4T A;  2L5L A;  1OVN A;  5JWR B;  3GL5 A;  3G9B A;  1KBN A;  3A5I A;  1O85 A;  4KB3 A;  4TXV A;  5IO0 A;  1EOG A;  3ERG A;  4MDC A;  4TN8 A;  2MBT A;  1VF1 A;  2C3Q A;  1R5A A;  3DYR A;  3HVX A;  3KCM A;  1QGV A;  1ERV A;  1GSY A;  4X4J A;  1ZYQ B;  2IMK A;  2X64 A;  4ECB A;  2VL2 C;  4YAP A;  1M2B A;  4ECI A;  4I8B A;  3Q74 A;  2YZU A;  1K0M A;  1VF2 A;  1JHB A;  2C0D A;  3ZIT A;  4MJE A;  5DDL A;  2TIR A;  3WGE A;  5D8I A;  3PPU A;  3W8J A;  1GTB A;  4DSQ A;  4IGJ A;  3IE3 A;  5HR1 A;  2KLX A;  5ECL B;  2R0G A;  4GXZ A;  2G2Q A;  4TR0 A;  4RI7 A;  2VO4 A;  1TRW A;  4GF0 A;  2WFC A;  3VWU A;  4WR4 A;  2DKH A;  2IIY A;  2IN3 A;  5ECM B;  5HQP A;  5H5S A;  2G0F A;  4JRR A;  1PKW A;  3DIE A;  2H74 A;  2FA8 A;  3HJM A;  2LQO A;  1OC8 A;  2JAC A;  3LXZ A;  1PX7 A;  2X8C A;  3GX8 A;  4MZC A;  3F8U A;  2K9F A;  4MJB A;  3UJ1 A;  3TKQ A;  3GKM A;  2VD0 A;  2LJR A;  2I4A A;  5A4U A;  2HXK A;  2IMF A;  3ERF A;  4HJ2 A;  5H5R A;  1TI1 A;  2DSA A;  5HR2 A;  1GUM A;  3RPN A;  2H75 A;  3MSZ A;  4XRA A;  1B48 A;  4EE0 A;  1PSQ A;  1K0B A;  1XPV A;  2GQK A;  3KD0 A;  2IMD A;  4PUF C;  4MA9 A;  2NBS A;  4FYB A;  3TOU A;  2RII A;  2L4Q A;  1FHE A;  3L9V A;  2HYX A;  2K6V A;  4F03 A;  5J41 A;  3TUE A;  2PVO C;  1BG5 A;  2CZ3 A;  2FLS A;  5EL8 A;  4OO5 A;  5HFK A;  6GSV A;  2DJ1 A;  1DBY A;  5C04 A;  3FW2 A;  2DJ0 A;  2H0H A;  4ZBD A;  4RI6 A;  5CRG A;  5J4U A;  2E0Q A;  1ST9 A;  3ZFB A;  3IK7 A;  3LG6 A;  1MDK A;  1KTE A;  1GSS A;  5G2Z A;  4KSO A;  4J57 E;  2F8F A;  3ZRE A;  4EF0 A;  4KDY A;  1GP1 A;  4WKW A;  4ZL8 A;  1S3A A;  3ZRD A;  5HR0 A;  1WMJ A;  3ZLP A;  3APQ A;  3P7X A;  3IR4 A;  1B8X A;  1YEP A;  3UAR A;  5DAL B;  2BMX A;  3TKS C;  2QSI A;  5DVB A;  2HRA A;  3ME8 A;  5J5N A;  5ELA A;  1AQV A;  3C8E A;  5LNK e;  1XWA A;  4RQX A;  1XWB A;  1ZYE A;  3CSH A;  3DEX A;  1TK0 B;  4WF5 A;  2UZ8 A;  1G7O A;  4ZIJ A;  1M7T A;  5IMF A;  4HQS A;  4HQZ A;  2F3M A;  3CQF A;  4CDO A;  1ZL9 A;  5E4W A;  3TKS A;  4ML1 A;  4K0N A;  2GZZ A;  11GS A;  3EPT A;  4JBB A;  1XVQ A;  1SKW B;  1R5P A;  1MEK A;  3EMP A;  1K0D A;  1K3O A;  2N5F A;  1WPI A;  3GIX A;  3R3E A;  2A2P A;  4AJ8 A;  4MCU A;  1EGR A;  3TRQ A;  2ES7 A;  2LEG A;  2OAD A;  2VCX A;  5EY6 A;  4MF6 A;  2VL3 A;  4V1A g;  5ECP B;  1SL1 B;  22GS A;  2FY6 A;  4PQ1 A;  1G6W A;  2VIM A;  4BVX A;  5IO2 A;  2GT5 A;  3F6F A;  1GNE A;  3FRC A;  4TR4 A;  5B8A A;  1GNW A;  1XW6 A;  3TJF A;  2JAD A;  2A2S A;  1B4Q A;  1XCC A;  1EOH A;  1PL2 A;  1NW2 A;  5IOW A;  4BL7 B;  1QUW A;  4NV5 A;  3A2X A;  1EP7 A;  5CRE A;  3UVT A;  3IC4 A;  4TKY A;  4XS4 A;  4BPY A;  2LJA A;  5DBQ A;  4POM A;  1M9B A;  2OJL A;  16GS A;  1ML6 A;  2R3X A;  1U3A A;  2L4C A;  5HFG A;  2CVD A;  3MDK A;  5DJM A;  3CRT A;  2H66 A;  2VCW A;  1JZD A;  1U3I A;  1ZYN A;  1T1V A;  5IM9 A;  3VLN A;  1T3B A;  2MMZ A;  4NXI A;  2CA8 A;  2YJ7 A;  5J3R A;  2M80 A;  2HFD A;  3L78 A;  4F0B A; 
#chains in the Genus database with same CATH homology
 2KOK A;  3ZL5 A;  1N8J A;  4WET A;  2HSM A;  2A4H A;  4P3Y B;  2FWH A;  1AQX A;  3A5W A;  4CHS A;  3U6V A;  1YZX A;  2YWI A;  3M3M A;  2IJY A;  5B6M A;  1O73 A;  4F9Z A;  5LCZ A;  1SL2 B;  1W89 A;  5CRH A;  2OE3 A;  5CRD A;  1GUK A;  1CQG A;  4Z2U A;  3RHB A;  3EE2 A;  4ZBA A;  4Q5F A;  4K7I A;  1WIK A;  1QFN A;  2Z9S A;  3PGT A;  2I81 A;  3LJR A;  4OFM A;  3OR5 A;  4ULX A;  3IC8 A;  1LJR A;  5D93 A;  3KTL A;  3KH7 A;  1JZO A;  4A5P A;  2M46 A;  1ZYP A;  1G6Y A;  2X99 A;  4TXO A;  5IMV A;  3GV1 A;  5CRW A;  4E8H A;  4IVF A;  1O7U A;  1A24 A;  4ICY A;  3F4T A;  1EP8 A;  4TVE A;  1GLQ A;  5AIV A;  4ZB8 A;  5ENU A;  3O76 A;  4MAB A;  2H70 A;  2VM1 A;  3CSI A;  3LXT A;  1YKA A;  2E7P A;  4GSS A;  3PH9 A;  4XS6 A;  4KDU A;  1Z9H A;  1SKS B;  3E9J B;  2L6C A;  1GRX A;  3CXG A;  2GSS A;  1AUC A;  3IHG A;  3BD2 A;  5LD0 A;  2ZNM A;  1XW9 A;  1ZMA A;  3DRN A;  5ECO B;  5L71 A;  1THX A;  3GL3 A;  1MDI A;  1NSW A;  2V41 A;  2CVK A;  4N0Z A;  1UN2 A;  4LL1 B;  3TJG A;  2VUP A;  4I97 A;  1NM3 A;  2FWG A;  3KMN A;  3HCZ A;  4L5L A;  3LQ7 A;  4N11 A;  4X1U A;  2ZCT A;  1YY7 A;  4H86 A;  1U87 A;  5G1L A;  4MZB A;  1EEM A;  1T4Z A;  1HNB A;  1U6T A;  2RUE A;  3FZ9 A;  5KN3 A;  3LGC A;  5F06 A;  1XIY A;  1EGO A;  2GTU A;  1J0F A;  1H4O A;  2R4V A;  2WUL A;  5GST A;  3SBC A;  2R0P A;  3LW9 A;  4MJA A;  5F8B A;  3IRA A;  3FZ4 A;  1DE2 A;  2HRF A;  3APS A;  2JZR A;  3UL3 A;  2HNL A;  3IXR A;  3F63 A;  3FEU A;  4ZIL A;  5KN0 A;  4IP6 A;  3P90 A;  2ALB A;  4NMU A;  4V1A p;  1V98 A;  3ME7 A;  3UVH A;  2I1U A;  2A4V A;  3Q6O A;  2K8V A;  2QKE A;  4MP4 A;  2HSH A;  4FYU A;  1AXD A;  4PNG A;  1BAY A;  20GS A;  3J7Y b;  3KM6 A;  1OKD A;  4XTS A;  3LYP A;  4IHU A;  2XPD A;  5JCG A;  5CYY A;  5J9B A;  2EIR A;  1UVZ A;  1FOV A;  1PA3 A;  12GS A;  1M99 A;  3P2A A;  2WRT A;  1Z5Y E;  3HXS A;  4J2F A;  2XHF A;  1T00 A;  4PXO A;  1XW5 A;  2LTK A;  5HR3 A;  4IQ1 A;  4TR1 A;  3KGK A;  1IYH A;  1QMV A;  2BJX A;  4HOJ A;  4O5Q A;  1U88 A;  4YKG A;  4YQV A;  2FD3 A;  1XZO A;  4GST A;  3KP9 A;  3IAM 2;  3KH9 A;  3PR8 A;  3IDV A;  1O8W A;  5CNW A;  3C1R A;  4I5Q A;  2GZY A;  3UAP A;  2L57 A;  3HKR A;  2XC2 A;  4G10 A;  2N5A A;  2IFQ A;  1FG4 A;  2RLI A;  4TRX A;  2RM6 A;  4KA0 A;  5BMU A;  3CRU A;  1DUG A;  3KJY A;  2FWE A;  2CAI A;  1FOH A;  2O89 A;  5DQS A;  4EC0 A;  4L5O A;  3MAK A;  1THO A;  1GTA A;  4KUN A;  4O32 A;  4OFN A;  4MF7 A;  3GN3 A;  3QR6 A;  4ECC A;  3QD9 A;  3DXB A;  3GNJ A;  2ZUP A;  4NV2 A;  4L0U A;  1QK8 A;  2VD1 A;  2WS2 A;  4EIQ A;  3A2V A;  2PMT A;  1Z6N A;  5IMD A;  4DVC A;  2CQ9 A;  2PGT A;  3HDC A;  3ZIV A;  2JSY A;  5G31 A;  1HD2 A;  2QGV A;  1F2E A;  4WXT A;  5G5F A;  2VCQ A;  1M2A A;  4MJC A;  1OE7 A;  4NHZ A;  2HLS A;  3TCO A;  1YEX A;  4IJ3 A;  4MMM A;  4J56 E;  4K8M A;  3EUR A;  1LBK A;  1A2J A;  5F07 A;  2REM A;  1QXH A;  1FAA A;  4ZB6 A;  5IMA A;  2RUF A;  2OBI A;  1BQ7 A;  3CMI A;  1XWK A;  3HA9 A;  1IYI A;  3GUS A;  5JCU A;  4KX4 A;  4ZBB A;  3QPM A;  4GQC A;  5FHI A;  3NZN A;  4WBJ A;  4IEL A;  2AB6 A;  2GSQ A;  3FR6 A;  4EDZ A;  3FZ5 A;  5GZZ B;  1HQO A;  2BTO T;  1VRS D;  1GH2 A;  1UC7 A;  1XOB A;  2N5B A;  4GQF A;  1M2D A;  3BBY A;  1TU7 A;  1Z7P A;  3ZMK A;  4ZL9 A;  3ZML A;  4FO5 A;  4IJI A;  2P31 A;  3IAS 2;  1X9M B;  3EVI A;  2P5Q A;  3DWV A;  1A2L A;  3VI5 A;  2P0G A;  4MF5 A;  1UA5 A;  3BJ5 A;  3KIJ A;  4KAE A;  4BVX B;  3G7Y A;  5DCH A;  1G0T A;  2H1G A;  4K0G A;  4I2T A;  3ZYW A;  3UMA A;  4EUY A;  3HZ4 A;  4PGT A;  5COH A;  1SL0 B;  5DAK A;  1Z6M A;  1ZGN A;  3IPZ A;  5D73 A;  4ACS A;  2R37 A;  1ERT A;  3F3Q A;  5D9T A;  2H72 A;  4EIP A;  2DJJ A;  4PUA A;  4QQ7 A;  1F3B A;  1GSE A;  2LRC A;  3WT1 A;  4XS4 B;  3EU3 A;  2R5G A;  4MH3 A;  5B6N A;  2H6Y A;  1VF4 A;  3IA1 A;  5F0G A;  4EL1 A;  3UBL A;  4EDY A;  1ABA A;  5E59 A;  3GKX A;  3TJJ A;  3W8S A;  3VFI A;  1BED A;  1ZOF A;  3LEF A;  2YP6 A;  14GS A;  18GS A;  2AV4 A;  3D0Z A;  1F3A A;  1TRU A;  2GQM A;  3N5O A;  3C7M A;  4IQA A;  2GZP A;  1O6J A;  5IPH A;  4FYC A;  5F05 A;  1TI3 A;  2EIQ A;  5CP1 A;  3GTU A;  1CQH A;  1QQ2 A;  1PN9 A;  1X0R A;  5IMC A;  4G2E A;  5A5K A;  2OE1 A;  2D2Z A;  5G5E A;  4BVY A;  3H1N A;  3UBK A;  4N0V A;  5D9V A;  2P5R A;  4K7O A;  2VCV A;  2KP1 A;  3F9U A;  5CO3 A;  4TXO B;  2R2J A;  4GTU A;  2YOI A;  1T8E B;  4LMW A;  3U5R E;  3M8N A;  4HEA 2;  4XRD A;  2VCZ A;  1AQW A;  3FKF A;  2YWN A;  2YN1 A;  3WT2 A;  3KTB A;  1EEJ A;  5AIX A;  2F8A A;  5ECH B;  1A8L A;  4DSS A;  3KP8 A;  3FR9 A;  5G1K A;  2YWO A;  4NPB A;  5B7C A;  4ECJ A;  3GSS A;  1K0N A;  1PL1 A;  3QAW A;  3V1W A;  2B5X A;  1FVJ A;  4BA7 A;  4JR4 A;  1DSB A;  1X9S B;  2AJQ B;  4L0W A;  1EV4 A;  4L8E A;  4IP1 A;  1K3L A;  3DD3 A;  4NHW A;  3LSZ A;  2LRT A;  1VGL A;  1WP0 A;  2H71 A;  2XBQ A;  3SWL A;  3GFK A;  1YF1 A;  3ERW A;  3I9V 2;  3VWW A;  5AGY A;  3ZFL A;  2DBC A;  1E6B A;  3WGX A;  2E2G A;  3D6I A;  2QC7 A;  17GS A;  4N10 A;  3I6A A;  1NHO A;  1JZR A;  2HI7 A;  5CAX A;  3JCM L;  5H5Q A;  1A2M A;  3DML A;  5IQY A;  1GL8 A;  3GYK A;  1Y6E A;  2VCT A;  4D73 A;  4QL9 A;  1PKZ A;  4POB A;  2DMM A;  2IWT A;  1BYE A;  2JSZ A;  5GSS A;  4GSN A;  4Z2R A;  4BWQ A;  4PQH A;  2OKA A;  1ERW A;  5AN1 A;  3TDG A;  2R6K A;  2OBK A;  4Q5N A;  2V2G A;  1PQN A;  1YDK A;  2GGT A;  5JWQ B;  3NIV A;  1M0U A;  1O81 A;  2J23 A;  2IL3 A;  3F3R A;  2A2R A;  3IK9 A;  4MPF A;  2MMN A;  2FWF A;  4POK A;  2DJ3 A;  2ON7 A;  3FR3 A;  4GWR A;  3ED3 A;  4NWY A;  2HRN A;  2MBS A;  1GLP A;  1A0R P;  3ZVJ A;  3HYP A;  2NVL A;  3VWV A;  4OO4 A;  2DLX A;  3Q18 A;  2WJU A;  4GCI A;  2B1K A;  2YZH A;  1W4V A;  13GS A;  3UOM A;  1J08 A;  1I9D A;  2QA1 A;  4N30 A;  5DQY A;  2KP2 A;  1NHY A;  4G0L A;  4KCA A;  1MD4 A;  4MPG A;  3QDN A;  1T7P B;  1TK5 B;  1ON4 A;  4HDE A;  1M9A A;  3HVS A;  4JE1 A;  3M9K A;  4V2M A;  1F6M C;  3M1G A;  1PMT A;  3QMX A;  2AYT A;  4XIH A;  1GWC A;  4JED A;  3AY8 A;  2L6D A;  4TR3 A;  5IPG A;  4TR1 B;  1JLV A;  1R7H A;  3RDW A;  4EVM A;  1EWX A;  1B9Y C;  2GDR A;  3GHA A;  4XHM A;  1TW9 A;  2VL9 A;  2LNS A;  1K3Y A;  3BOA A;  2MZC A;  6GSX A;  4OD7 A;  4PTS A;  1SD9 A;  1SJ6 A;  2H6X A;  3EU4 A;  4IS0 A;  2JZT A;  2C4J A;  2CVB A;  3GH6 A;  2CX3 A;  2IFQ B;  4MLY A;  4USS A;  4G9H A;  7GSS A;  3QOU A;  3GH9 A;  4BWS A;  3TRP A;  3MWH A;  5D9W A;  3IOS A;  2GSR A;  2I9H A;  3LYK A;  4G0K A;  4O7H A;  4K7N A;  1JLW A;  4X0X A;  4HU9 A;  2PWJ A;  2F51 A;  3TGZ A;  1XWC A;  1BX9 A;  4X43 A;  5C00 A;  3DGQ A;  4YQM A;  2PU9 C;  2KUC A;  5IOX A;  1G7E A;  3M9J A;  3HY2 A;  4HZ4 A;  5ID2 A;  2K8S A;  4K2D A;  4YH2 A;  4LMV A;  2X8H A;  3GX0 A;  2DJ2 A;  2H6Z A;  4QL7 A;  4IW9 A;  2PVQ A;  2GT6 A;  1GUL A;  3HD5 A;  2DML A;  1FW1 A;  4DSR A;  1X5C A;  1I5G A;  3P8W A;  5GAN D;  5J9C A;  2L5O A;  1JFU A;  2C0F A;  1OC9 A;  2WDU A;  3HVV A;  1R26 A;  2C0E A;  1PGT A;  3VPQ A;  4CY8 A;  1H75 A;  1TXX A;  5A4V A;  3IHQ A;  3W6G A;  5KN2 A;  3QFB C;  4HS1 A;  5BRT A;  2C80 A;  3FK8 A;  3GKN A;  4E8E A;  3NOF A;  4RUV A;  1XWG A;  4G19 A;  2HZE B;  3MNG A;  2H1D A;  1TJD A;  4CW9 A;  1XBS A;  1FO5 A;  1URM A;  2LKU A;  5IIZ A;  2H76 A;  3VPT A;  2KHP A;  1GSQ A;  4I6X A;  3G7J A;  1WRY A;  2C3N A;  2VLU A;  2YPM A;  5GAP D;  3CTF A;  1AIU A;  4HU7 A;  1Y25 A;  1YJ6 A;  2GST A;  3TKP A;  2YWM A;  1B4P A;  1OAZ A;  3I69 A;  3C73 A;  3TJB A;  1SYR A;  2VL2 A;  4EKZ A;  2WB9 A;  4ISD A;  3GUR A;  1MD3 A;  1TTZ A;  4EO3 A;  2OA7 A;  4OMV A;  4F0C A;  2PUK C;  2E2M A;  2IMI A;  3DVX A;  2MMA A;  1A0F A;  3EYT A;  2YCD A;  3PIN A;  5JWO B;  1GSF A;  4GLT A;  2B7J A;  1ERU A;  4PNF A;  1K0O A;  4F2I A;  2PBJ A;  3VWX A;  8GSS A;  1T4Y A;  5HFI A;  1KNG A;  3TJK A;  5DAK B;  2JL4 A;  4Z7X A;  3A3T A;  3F6D A;  3TRX A;  2X8G A;  3ZZX A;  2HZE A;  2DKI A;  2C0G A;  4JR6 A;  4IKH A;  3TKS E;  9GSS A;  2C1Y A;  2C8U A;  2HE3 A;  3D21 A;  3I43 A;  5ECI B;  2CX4 A;  3TOT A;  1MDJ A;  4TOP A;  2DIZ A;  3ZIJ A;  2LRN A;  2LV3 A;  5EVO A;  1GSD A;  3N9J A;  1EV9 A;  3QAG A;  3ISO A;  2O7K A;  1F37 A;  1S3C A;  3UEM A;  5ECK B;  5ECN B;  3RPP A;  4HUA A;  1SK2 A;  3APO A;  3RHC A;  3IV4 A;  4DEJ A;  4K5S A;  4K2X A;  2H1B A;  3O6T A;  6GSY A;  4O5R A;  2QA2 A;  3FYG A;  2CAQ A;  1SJZ A;  3A2W A;  2B7K A;  5A4W A;  1GUH A;  4G0I A;  2TRC P;  4ZXG A;  1WOU A;  3FZA A;  4EXJ A;  2LQQ A;  1Q98 A;  4KH7 A;  3L9U A;  3BCK A;  2CT6 A;  1HYU A;  2DC5 A;  3KXO A;  2GLR A;  1GTU A;  2I3Y A;  4AJ6 A;  3GTU B;  2LJK A;  3L9S A;  2H73 A;  3E3E A;  1SD8 A;  4KSM A;  4BVY B;  5EPF A;  4Z2T A;  1V9W A;  2OAC A;  2B3S A;  1K0C A;  2YAN A;  1VF3 A;  1V58 A;  1XXU A;  5ELG A;  3WD6 A;  3VI7 A;  1GSU A;  2C3T A;  3CSJ A;  2ON5 A;  19GS A;  3LOR A;  4V2N A;  4RQR A;  4MK3 A;  1X9W B;  5FWG A;  4DSS B;  2WGR A;  3GKK A;  1TDI A;  1HNA A;  2GS3 A;  4KGI A;  5KOX A;  1ACV A;  2LST A;  4KCE A;  4AJ7 A;  3Q19 A;  2YNX A;  4MNN A;  3IBH A;  5DCG A;  1RW1 A;  2YV9 A;  4KF9 A;  4K6X A;  2OE0 A;  1J9B A;  5D96 A;  1JZW A;  10GS A;  1XVW A;  4KE3 A;  2H19 A;  2JU5 A;  2IPA A;  2MYG A;  2AAW A;  4ILF A;  5DAL A;  2H0G A;  5KOW A;  3H8Q A;  1SU9 A;  3L0H A;  3S9F A;  1O8X A;  2LUS A;  4XCS A;  4ZB9 A;  4IN0 A;  4O5U A;  1SEN A;  1FB6 A;  1PD2 1;  3GST A;  1XFL A;  4WEY A;  4O92 A;  2FCH A;  3H4K A;  2NPB A;  2AHE A;  4PUR A;  4OFT A;  1N2A A;  5KEJ A;  1V57 A;  1PN0 A;  1HNC A;  5ECR B;  3J7Y k;  3C1S A;  2WZ9 A;  1V2A A;  3EC3 A;  4D73 B;  5AIS A;  4YAV A;  1A23 A;  2H0I A;  3CTG A;  3F4R A;  4WR5 A;  2H1A A;  1PX6 A;  3FY7 A;  1B9X C;  3UIW A;  1ILO A;  2IME A;  4LA1 A;  6GSS A;  1BJX A;  1X5E A;  1SKR B;  1C72 A;  4HI7 A;  6GSU A;  3G7I A;  2H30 A;  1OE8 A;  1ZCP A;  2PPT A;  1OC3 A;  3HJO A;  1F9M A;  4WF4 A;  1SYX A;  2DIY A;  2PN8 A;  3D4M A;  2B6M A;  3EIN A;  2O8V B;  3D5J A;  4HJM A;  5G30 A;  2VOC A;  4HZ2 A;  4LLR A;  3L4N A;  2CV4 A;  3R2Q A;  2HSY A;  2PER A;  2B5E A;  2V6O A;  4JU5 A;  2YJH A;  4YKF A;  1OYJ A;  3F4S A;  2F9S A;  3WYW A;  4PQI A;  3FHK A;  3QAV A;  2EIO A;  2B1L A;  3GRX A;  4BL7 A;  1R4W A;  1TRS A;  4ID0 A;  1YKC A;  1SJI A;  4GRF A;  2LNT A;  3FMW A;  2O87 A;  4MH2 A;  3TKR A;  1GTI A;  3EMX A;  2TRX A;  5ABR A;  4YQU A;  4KDX A;  4K5R A;  2GQL A;  3DVW A;  1SK1 A;  1ZZY A;  1SK0 A;  3H79 A;  2VAF A;  5DJL A;  1PRX A;  3RBT A;  3LFL A;  3RAZ A;  2HZF A;  3VK9 A;  1TOF A;  3US3 A;  2GVP A;  4AGS A;  2AUV A;  1LU4 A;  3E0U A;  2H8L A;  4PX1 A;  2VM2 A;  4OCF A;  5IMZ A;  1DE1 A;  2X49 A;  2VLT A;  1V40 A;  4ZL7 A;  4CY6 A;  3HJP A;  2J9H A;  4IBP A;  1TRV A;  3KEB A;  1TKD B;  3ZTL A;  1FVK A;  2EC4 A;  1USB A;  3HZ8 A;  2K18 A;  1A8Y A;  2WCI A;  2V32 A;  2NDO A;  2DJK A;  4K9Z A;  2VLV A;  3HHV A;  1AC1 A;  2XPE A;  1Q4J A;  4FQU A;  4KND A;  4POL A;  3CYN A;  4Q5Q A;  1K0A A;  3EWL A;  1YQ1 A;  2FNO A;  2MMO A;  3GA4 A;  3LWA A;  2L59 A;  1X5D A;  2JZS A;  1RK4 A;  3VUR A;  1XOA A;  3O3T A;  3QCP A;  4FIW A;  1Z3E A;  1WJK A;  5B8B A;  3D22 A;  4Q5R A;  3TB2 A;  3DKS A;  3QFA C;  1MTC A;  5ID2 B;  4AF2 A;  2X4A A;  6GST A;  1OKT A;  4F82 A;  4OCE A;  1Z7R A;  4TW5 A;  2O85 A;  1TK8 B;  3F0I A;  1WWJ A;  4OWY A;  3ZVJ D;  1FB0 A;  4V2L A;  3GMF A;  3KMO A;  1TU8 A;  1AAZ A;  4MZW A;  2RM5 A;  4FH8 A;  3H93 A;  3WGD A;  4LL4 B;  1TP9 A;  4WBR D;  1OC9 B;  3MYD A;  3CBU A;  2FA4 A;  5JCW A;  1EZK A;  6GSW A;  2CZ2 A;  5ECS A;  5KN1 A;  4ML6 A;  4KW6 A;  2HT9 A;  3BCI A;  3KZQ A;  2FGX A;  1KEB A;  2LS5 A;  2B5Y A;  3K8N A;  2HRK A;  4NAX A;  1RQM A;  5D9X A;  4XS1 A;  3C71 A;  2NTO A;  3MIX A;  1WE0 A;  2YV7 A;  1S3D A;  2R0C A;  2V1M A;  2FHE A;  1AW9 A;  4I2U A;  1E2Y A;  2H01 A;  4JZQ A;  4K1F A;  3M0F A;  5ECQ B;  2FUG 2;  2V6K A;  1YF0 A;  2XBI A;  5INY A;  5FT3 A;  2M72 A;  3D4T A;  2L5L A;  1OVN A;  5JWR B;  3GL5 A;  3G9B A;  1KBN A;  3A5I A;  1O85 A;  4KB3 A;  4TXV A;  5IO0 A;  1EOG A;  3ERG A;  4MDC A;  4TN8 A;  2MBT A;  1VF1 A;  2C3Q A;  1R5A A;  3DYR A;  3HVX A;  3KCM A;  1QGV A;  1ERV A;  1GSY A;  4X4J A;  1ZYQ B;  2IMK A;  2X64 A;  4ECB A;  2VL2 C;  4YAP A;  1M2B A;  4ECI A;  4I8B A;  3Q74 A;  2YZU A;  1K0M A;  1VF2 A;  1JHB A;  2C0D A;  3ZIT A;  4MJE A;  5DDL A;  2TIR A;  3WGE A;  5D8I A;  3PPU A;  3W8J A;  1GTB A;  4DSQ A;  4IGJ A;  3IE3 A;  5HR1 A;  2KLX A;  5ECL B;  2R0G A;  4GXZ A;  2G2Q A;  4TR0 A;  4RI7 A;  2VO4 A;  1TRW A;  4GF0 A;  2WFC A;  3VWU A;  4WR4 A;  2DKH A;  2IIY A;  2IN3 A;  5ECM B;  5HQP A;  5H5S A;  2G0F A;  4JRR A;  1PKW A;  3DIE A;  2H74 A;  2FA8 A;  3HJM A;  2LQO A;  1OC8 A;  2JAC A;  3LXZ A;  1PX7 A;  2X8C A;  3GX8 A;  4MZC A;  3F8U A;  2K9F A;  4MJB A;  3UJ1 A;  3TKQ A;  3GKM A;  2VD0 A;  2LJR A;  2I4A A;  5A4U A;  2HXK A;  2IMF A;  3ERF A;  4HJ2 A;  5H5R A;  1TI1 A;  2DSA A;  5HR2 A;  1GUM A;  3RPN A;  2H75 A;  3MSZ A;  4XRA A;  1B48 A;  4EE0 A;  1PSQ A;  1K0B A;  1XPV A;  2GQK A;  3KD0 A;  2IMD A;  4PUF C;  4MA9 A;  2NBS A;  4FYB A;  3TOU A;  2RII A;  2L4Q A;  1FHE A;  3L9V A;  2HYX A;  2K6V A;  4F03 A;  5J41 A;  3TUE A;  2PVO C;  1BG5 A;  2CZ3 A;  2FLS A;  5EL8 A;  4OO5 A;  5HFK A;  6GSV A;  2DJ1 A;  1DBY A;  5C04 A;  3FW2 A;  2DJ0 A;  2H0H A;  4ZBD A;  4RI6 A;  5CRG A;  5J4U A;  2E0Q A;  1ST9 A;  3ZFB A;  3IK7 A;  3LG6 A;  1MDK A;  1KTE A;  1GSS A;  5G2Z A;  4KSO A;  4J57 E;  2F8F A;  3ZRE A;  4EF0 A;  4KDY A;  1GP1 A;  4WKW A;  4ZL8 A;  1S3A A;  3ZRD A;  5HR0 A;  1WMJ A;  3ZLP A;  3APQ A;  3P7X A;  3IR4 A;  1B8X A;  1YEP A;  3UAR A;  5DAL B;  2BMX A;  3TKS C;  2QSI A;  5DVB A;  2HRA A;  3ME8 A;  5J5N A;  5ELA A;  1AQV A;  3C8E A;  5LNK e;  1XWA A;  4RQX A;  1XWB A;  1ZYE A;  3CSH A;  3DEX A;  1TK0 B;  4WF5 A;  2UZ8 A;  1G7O A;  4ZIJ A;  1M7T A;  5IMF A;  4HQS A;  4HQZ A;  2F3M A;  4CDO A;  1ZL9 A;  5E4W A;  3TKS A;  4ML1 A;  4K0N A;  2GZZ A;  11GS A;  3EPT A;  4JBB A;  1XVQ A;  1SKW B;  1R5P A;  1MEK A;  3EMP A;  1K0D A;  1K3O A;  2N5F A;  1WPI A;  3GIX A;  3R3E A;  2A2P A;  4AJ8 A;  4MCU A;  1EGR A;  3TRQ A;  2ES7 A;  2LEG A;  2OAD A;  2VCX A;  5EY6 A;  4MF6 A;  2VL3 A;  4V1A g;  5ECP B;  1SL1 B;  22GS A;  2FY6 A;  4PQ1 A;  1G6W A;  2VIM A;  4BVX A;  5IO2 A;  2GT5 A;  3F6F A;  1GNE A;  3FRC A;  4TR4 A;  5B8A A;  1GNW A;  1XW6 A;  3TJF A;  2JAD A;  2A2S A;  1B4Q A;  1XCC A;  1EOH A;  1PL2 A;  1NW2 A;  5IOW A;  4BL7 B;  1QUW A;  4NV5 A;  3A2X A;  1EP7 A;  5CRE A;  3UVT A;  3IC4 A;  4TKY A;  4XS4 A;  4BPY A;  2LJA A;  5DBQ A;  4POM A;  1M9B A;  2OJL A;  16GS A;  1ML6 A;  2R3X A;  1U3A A;  2L4C A;  5HFG A;  2CVD A;  3MDK A;  5DJM A;  3CRT A;  2H66 A;  2VCW A;  1JZD A;  1U3I A;  1ZYN A;  1T1V A;  5IM9 A;  3VLN A;  1T3B A;  2MMZ A;  4NXI A;  2CA8 A;  2YJ7 A;  5J3R A;  2M80 A;  2HFD A;  3L78 A;  4F0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...