2HE3A

Crystal structure of the selenocysteine to cysteine mutant of human glutathionine peroxidase 2 (gpx2)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
185
structure length
185
Chain Sequence
MIAKSFYDLSAINLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutathione peroxidase 2
publication title Crystal structure of the selenocysteine to cysteine mutant of human glutathionine peroxidase 2 (GPX2)
rcsb
source organism Homo sapiens
total genus 58
structure length 185
sequence length 185
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2he3A00
3D4MA 2IMEA 3IA1A 2YNXA 2VO4A 2LRTA 3GMFA 1RQMA 4GSNA 1JLWA 5FHIA 2L57A 1LJRA 2O8VB 3KGKA 2CVDA 3TKSC 1PX6A 3KH7A 4ML1A 1GNWA 2H0HA 2CVBA 2GGTA 1THXA 4BWQA 1FHEA 3P7XA 5ECIB 2HT9A 3EU4A 3WT2A 3GSTA 2P5RA 1YEPA 3HVXA 2GSSA 2JL4A 2A2SA 1UA5A 4BPYA 5COHA 3OR5A 2H73A 3H4KA 2LQOA 2IL3A 4KUNA 4MZBA 3VPQA 2O7KA 4XTSA 1YJ6A 3TGZA 2H74A 1PSQA 1E6BA 1OC9A 4F03A 2R2JA 4FYBA 3KTBA 4PQ1A 3R2QA 1BQ7A 4V1Ap 3J7Yb 3G7JA 1GNEA 1FVKA 3KMOA 1WWJA 1TU7A 2X8CA 3RHBA 5ECLB 4TR1B 2JZRA 2KHPA 2J9HA 2ALBA 2GDRA 1OC3A 1JZDA 4WKWA 2HNLA 3L0HA 5JWRB 6GSSA 4BVYA 3ZFLA 2HZFA 2IMFA 3ZTLA 3GKMA 5IMCA 1UN2A 3BCKA 4ZBBA 5C04A 5IMDA 1Z7RA 4X1UA 3IK7A 3RPPA 2LRCA 4AJ8A 5IO2A 1PQNA 4O32A 2CX4A 1ZMAA 1X0RA 3QFAC 3UL3A 2C4JA 2YN1A 3LXTA 1M7TA 1J0FA 2MMZA 2H70A 4N30A 4KB3A 3HDCA 1K0OA 5G2ZA 1M99A 1XPVA 2C0GA 2KOKA 5HR0A 1QMVA 4OMVA 3W8JA 2C3TA 2FWFA 4RI7A 3G7YA 1I5GA 5G1KA 2HXKA 4GF0A 4DSSA 3S9FA 4LL1B 1GRXA 3FYGA 2IN3A 3RPNA 3TB2A 1XIYA 1TI1A 1CQGA 3WGDA 1GULA 2VL3A 4XS6A 3GA4A 5CYYA 1AXDA 3GUSA 3KZQA 1GSEA 5DAKA 2YWNA 4JZQA 2GQMA 4IHUA 1OC9B 1XWCA 3CYNA 4ZB6A 2L6DA 1SD8A 4OCFA 2MMOA 1V40A 2F8AA 5ECNB 5ABRA 3Q74A 1TRUA 4KDYA 3ERFA 3DMLA 3VURA 2HE3A 2LUSA 3QCPA 4Q5RA 3GYKA 2K9FA 2OADA 2E2MA 1GLPA 1FB6A 4MH2A 4FYCA 2R6KA 2FA8A 4NPBA 2C1YA 3VFIA 11GSA 2E2GA 5IIZA 1ST9A 1QGVA 4POLA 5AIXA 3A2VA 3M0FA 4FO5A 4WBRD 3D22A 4WBJA 1I9DA 1EEJA 4MF7A 1WJKA 3EC3A 4X43A 3P90A 1JZRA 1ZOFA 3CSJA 5GAND 4KX4A 4MDCA 2LNSA 3GRXA 3IK9A 1SJZA 5H5SA 4XS4A 2DLXA 1GLQA 4PX1A 1UVZA 2VLVA 1A23A 1XW6A 4G10A 1O6JA 3F4RA 1K0MA 5DJLA 3TRPA 4K9ZA 4DSSB 4JU5A 2XHFA 5GSTA 3DKSA 3VWVA 5B6MA 2OE1A 4JR6A 5IOXA 4I8BA 5ENUA 3APSA 2GS3A 2R5GA 1VF4A 4LL4B 1SL1B 1WPIA 2ZNMA 4F0CA 4GSSA 4O7HA 1XW5A 1SU9A 2HSHA 3VI7A 3FZ5A 2B3SA 3HKRA 4TN8A 3APOA 5GAPD 1XW9A 3DVWA 3C7MA 1PRXA 2GQLA 2TRXA 4GQFA 1T4ZA 18GSA 2GZYA 1TK8B 5ELAA 1K0DA 2O87A 2LJKA 4YAVA 2F8FA 2WRTA 3WD6A 3F4TA 5LCZA 4RQXA 5IMAA 1AW9A 2YJHA 3VK9A 2C3NA 1U6TA 1X9SB 1TI3A 1JFUA 1A24A 2LS5A 5D9VA 3IHQA 2JACA 1A0RP 3KXOA 2VUPA 1OYJA 4MMMA 1ML6A 3K8NA 1HQOA 1ON4A 1DSBA 1VRSD 1U3AA 4ZL7A 3F3RA 5EPFA 5HR1A 1R7HA 1XWAA 2MYGA 4P3YB 4NMUA 3D0ZA 1DBYA 4L8EA 2YP6A 2A4VA 3UEMA 4WETA 1TTZA 4ZBDA 5D9WA 2WFCA 3IC4A 2YWIA 1SKWB 2H8LA 2O89A 3EU3A 4KSMA 3UAPA 5J3RA 4G9HA 2JU5A 1JZWA 5ECRB 3M3MA 5CO3A 2JSYA 2VLUA 1M2AA 3GKKA 5G5EA 3ZVJA 2OA7A 2VLTA 2LQQA 4TR4A 3Q18A 3GTUA 19GSA 1BG5A 2CV4A 5JWQB 1S3CA 4MJAA 4K7OA 2L5OA 1GTBA 2DJ1A 1XFLA 2WZ9A 4IBPA 1T3BA 4I6XA 1A2JA 1GSYA 2N5FA 2VAFA 1F3BA 4ZXGA 6GSYA 1EP7A 1ZYEA 1TRVA 1N8JA 4RUVA 4HQSA 2CA8A 1WIKA 4XS1A 5HR3A 2L4CA 5F05A 2K8SA 5JCGA 3ZITA 4F2IA 4OD7A 4HJMA 4ID0A 4IW9A 4PNGA 1VGLA 4J56E 3QMXA 5DALA 2IMIA 4PGTA 2PWJA 2CZ2A 1DE1A 1HNAA 3HJOA 4HZ4A 4KGIA 2PMTA 1PGTA 1EV4A 1AUCA 1GTAA 4JR4A 3HZ4A 1PX7A 2N5AA 2EIQA 2FGXA 3GKXA 1JLVA 2LSTA 4GCIA 3BBYA 4PUFC 4LMVA 2B5YA 1BEDA 1GH2A 3MDKA 2KLXA 2ZUPA 1Z3EA 5E4WA 2EIOA 4MZCA 2VL9A 4ZL9A 5CREA 5D96A 4IELA 3C73A 13GSA 3H93A 1XCCA 2CAQA 1OKDA 4TR1A 5IO0A 4IJIA 3GL5A 3P2AA 3WGXA 4HJ2A 6GSXA 4XRDA 5IM9A 4ACSA 12GSA 3QAVA 5ECKB 5J41A 3DYRA 3GTUB 1QXHA 2CAIA 3CBUA 2WB9A 5AISA 3LORA 2HRNA 4IGJA 3ZLPA 3F4SA 4QL9A 4KNDA 2V6KA 5CRGA 3JCML 2YWOA 1B4QA 2V1MA 5AN1A 2IMKA 4N11A 2VCQA 3FEUA 4QL7A 4DSRA 4MH3A 1B4PA 1A2LA 2XPDA 3DXBA 2CVKA 5HFGA 2BMXA 5HFIA 1QQ2A 1F6MC 1ABAA 3IXRA 1JHBA 2GT6A 1T4YA 5F07A 2H0GA 4N0ZA 2NPBA 3KP9A 3GKNA 3P8WA 1O8WA 3IDVA 4ZB8A 3V1WA 3VI5A 3MWHA 4OO4A 5A4WA 5DDLA 5DQSA 5DALB 2YPMA 3LYPA 2ES7A 2OJLA 2DBCA 2I9HA 3ZYWA 3F6DA 5IQYA 1OE8A 1ERTA 1B9YC 2VIMA 2DJ2A 3GL3A 1GSDA 1O8XA 2QC7A 1VF1A 2TIRA 3ZMLA 2XC2A 2JSZA 1OVNA 4F9ZA 2H66A 1NHOA 1A8YA 1USBA 3ZIJA 2HRFA 1R4WA 1SKSB 4NWYA 3FZ9A 1GUHA 3LFLA 4V2NA 2H72A 1A0FA 3TJFA 5H5RA 3IR4A 3TCOA 1X5CA 1XZOA 3FHKA 1NW2A 4EE0A 3C8EA 4LA1A 2VCVA 1QK8A 3W8SA 1BAYA 2YWMA 1EGRA 2FWEA 3CTGA 4NV2A 4ZB9A 4EVMA 1BYEA 2VD1A 1EP8A 2DC5A 4K7IA 4BVXA 2DMLA 3FR9A 1QFNA 2GLRA 20GSA 1M9AA 3RHCA 3FW2A 1G7EA 4WR4A 1Q4JA 2IJYA 5DCGA 4J57E 3UMAA 5B6NA 4YQMA 2PGTA 3APQA 1Y25A 2ON5A 3HJMA 4ULXA 1ZYQB 3TDGA 5CRHA 2FLSA 3LQ7A 3KIJA 4TKYA 4IKHA 4J2FA 4FH8A 1PKWA 2MZCA 4POBA 4HI7A 2WS2A 4K6XA 5A5KA 4DVCA 1GSQA 3EMXA 3HXSA 2FNOA 3ZZXA 5CP1A 3M8NA 3C1SA 4ISDA 4EO3A 2H75A 4IQ1A 2VM2A 2LJRA 3HA9A 4ZL8A 3RBTA 3KD0A 1YKAA 2XPEA 2GVPA 1PA3A 3TKPA 4TXVA 2GTUA 4G2EA 4JBBA 17GSA 5C00A 1B48A 4NAXA 1YDKA 2D2ZA 4IQAA 1UC7A 1ZCPA 4YAPA 3IE3A 3GIXA 5FT3A 9GSSA 3HJPA 3US3A 2YCDA 1NHYA 3TJBA 3KH9A 5H5QA 1GTUA 2L5LA 1GSUA 4X0XA 2CZ3A 2H19A 3F8UA 2AHEA 1HD2A 1K3YA 2CT6A 2IPAA 3IPZA 1X5DA 4Q5NA 2YJ7A 2PU9C 4K7NA 3EINA 2RM6A 1G0TA 3NZNA 3ZMKA 3CTFA 2GT5A 3D6IA 4ZIJA 5HFKA 2Z9SA 4EDYA 1MDIA 4V2MA 1ZL9A 3M9JA 4GLTA 2R4VA 1HNBA 1XWGA 2FCHA 1JZOA 2X99A 1TRSA 2HZEA 4Z7XA 4HQZA 4OO5A 4KSOA 2F9SA 4MF6A 1G6WA 1ACVA 1RK4A 2WGRA 4XIHA 1FO5A 1V9WA 1GL8A 4I2TA 3NOFA 3DEXA 7GSSA 4KA0A 4RI6A 3ISOA 2V6OA 1QUWA 2FWHA 1FG4A 5DBQA 4OFNA 2NBSA 3D21A 4XRAA 2LNTA 2X8GA 4OWYA 2B5EA 4N10A 5ECMB 2N5BA 2WDUA 3A2XA 5J5NA 1ERVA 1ILOA 4EL1A 2GSTA 2K6VA 4TR3A 1KBNA 2YV9A 2H0IA 2DJKA 2YV7A 10GSA 3L9VA 3HVVA 5E59A 2NVLA 1M2BA 3CXGA 2FUG2 4WEYA 2H6ZA 2GSQA 4I5QA 1KTEA 3WYWA 1O85A 3HVSA 3D5JA 1F2EA 1XVQA 3LYKA 3ZVJD 4OFMA 1PMTA 1SKRB 1WOUA 2I1UA 4HS1A 2IFQA 5JCUA 1OE7A 1XWKA 1TP9A 4ECIA 3KEBA 2DIZA 4G19A 2YZUA 1S3DA 4EUYA 1FOVA 4ZILA 2B1LA 2K18A 2OE0A 1N2AA 4LMWA 1YEXA 2J23A 6GSTA 1R5AA 4WF5A 2FHEA 3D4TA 2HZEB 4MJBA 4TW5A 2H6XA 1M0UA 1AQXA 2BJXA 1AQWA 3TOTA 2OBKA 3F3QA 5DJMA 2VL2A 3H8QA 5F06A 1M9BA 4CHSA 2H30A 1R26A 3CRTA 4TXOA 2LTKA 2JADA 1YF0A 4WR5A 1B9XC 2DJJA 3N5OA 3QFBC 2G2QA 3GX0A 3EYTA 1SK2A 3IV4A 2B5XA 1PKZA 1XOBA 1YQ1A 3DIEA 3WGEA 4KE3A 4RQRA 1MDKA 4EKZA 3RDWA 3RAZA 3EMPA 2WCIA 4PUAA 2VCTA 1AAZA 2OACA 4YQUA 1LBKA 3ME7A 3KM6A 2JZTA 5LD0A 1R5PA 3O76A 4KDUA 3CRUA 4KH7A 5FWGA 2XBQA 5D73A 2PUKC 2KP2A 3DVXA 3IAM2 2I3YA 1J08A 3PH9A 5L71A 3FRCA 3Q6OA 5JCWA 3HYPA 1PD21 2IFQB 4IP1A 2VCXA 3AY8A 1AC1A 5CNWA 1EZKA 2ON7A 1TXXA 4KCAA 3UARA 2MMNA 3N9JA 3DGQA 2BTOT 2LEGA 3I6AA 4L0UA 2HLSA 2MMAA 1K0NA 2ZCTA 1U87A 4NHWA 4EDZA 1F9MA 3L9SA 1MTCA 3A5WA 1B8XA 1K0BA 2YANA 2F3MA 4K2DA 5CRWA 2V41A 1CQHA 4OFTA 2L6CA 1FAAA 2A2RA 4BWSA 2X8HA 3VLNA 4YQVA 1SYXA 4FYUA 1OAZA 1LU4A 1BX9A 1T7PB 2B7KA 3ED3A 1AQVA 2JZSA 2GSRA 1EGOA 4GTUA 4NHZA 4TXOB 3Q19A 3TRXA 1A2MA 3VWUA 1IYIA 3GSSA 3HY2A 2QKEA 8GSSA 3TKSE 2EIRA 5F0GA 4LLRA 2OKAA 1YKCA 2P31A 1DE2A 3IOSA 3QOUA 1T00A 3L9UA 4HUAA 5KN1A 2VCZA 2C0EA 1ERUA 4PQIA 2H01A 5D8IA 1EEMA 2I4AA 4V2LA 1GSFA 2DJ3A 3I43A 2PN8A 2H1DA 5ELGA 1PN9A 3VWWA 3C1RA 1Z6NA 3DD3A 3GH9A 1T8EB 4POMA 1TDIA 5ECSA 2GQKA 5B8AA 4OCEA 5KN3A 1FW1A 3TKQA 5B7CA 1O73A 1AIUA 3FY7A 5J9CA 2KUCA 3F0IA 1H4OA 2C3QA 1SENA 3CSIA 3KJYA 1X9WB 5IMVA 4MABA 1GWCA 3SBCA 1EV9A 1SK1A 1HYUA 2B1KA 14GSA 5D9XA 5CAXA 1U3IA 3KP8A 4KW6A 1DUGA 2TRCP 5KN2A 2PERA 2IIYA 3KTLA 5B8BA 5DQYA 3UBLA 2C0DA 1WRYA 4CDOA 1E2YA 1XVWA 2PVOC 2H6YA 4QQ7A 4ECBA 5ECOB 3BJ5A 3DWVA 5AIVA 2CQ9A 3UJ1A 1W89A 3LEFA 3ZFBA 2RUEA 1FB0A 3H79A 1XOAA 1Q98A 2LRNA 1WP0A 1Z9HA 3GN3A 1G6YA 4EF0A 5IOWA 1U88A 5G30A 2GZZA 5AGYA 1GUKA 3SWLA 2RLIA 1V58A 3TRQA 3M1GA 4IJ3A 1SL0B 4MK3A 4ECCA 2YOIA 3IRAA 1Z6MA 1FVJA 4GQCA 4WF4A 4AJ6A 1NM3A 3QDNA 2AAWA 2OBIA 2M80A 3QPMA 1MD3A 4POKA 3O6TA 4MZWA 2AYTA 4HOJA 2L4QA 3F6FA 3UBKA 3M9KA 5J4UA 4D73A 2HYXA 2FD3A 3E9JB 4K1FA 1MD4A 1IYHA 4YH2A 4L5LA 4CW9A 4I2UA 4KAEA 3HZ8A 2DMMA 2WJUA 3MNGA 1TU8A 2C0FA 1K3OA 1GSSA 1K0CA 2P5QA 3FR3A 4DSQA 3QD9A 3CMIA 3ERWA 1YF1A 4F82A 3LG6A 2CX3A 2C80A 5JWOB 3E0UA 2LV3A 4KCEA 5A4VA 3TKSA 3A3TA 3KCMA 4GSTA 2AB6A 2I81A 5IMZA 4AJ7A 2MBTA 1Z7PA 1OC8A 3MAKA 4MPGA 4I97A 3GV1A 3LXZA 1M2DA 4TRXA 2IMDA 5F8BA 2VD0A 2HI7A 4MLYA 1TKDB 3BD2A 2R37A 1O81A 1RW1A 5ECQB 1OKTA 3BCIA 1PL1A 1SYRA 2L59A 2AJQB 1SJ6A 1YY7A 2EC4A 2PBJA 2VL2C 2WULA 3EURA 2FWGA 4Q5FA 1TK0B 3QAGA 3E3EA 2VCWA 1MDJA 2DJ0A 1A8LA 4IS0A 2P0GA 1WE0A 1GTIA 4O92A 4HU7A 5KEJA 3F9UA 4HZ2A 4JE1A 3FKFA 3GH6A 3EWLA 4D73B 5EL8A 4K8MA 4MP4A 6GSUA 4TR0A 3TJKA 4BL7A 5DVBA 5ECPB 2VOCA 5IPHA 2FA4A 2YZHA 3DRNA 1EWXA 5GZZB 2IWTA 1TK5B 1EOGA 3F63A 2DSAA 2H1BA 4NXIA 5HQPA 1K3LA 5IPGA 4ZBAA 6GSVA 4TOPA 5ID2A 1SL2B 4PNFA 4JEDA 4F0BA 2X64A 2VM1A 4GXZA 3PINA 3QAWA 5DAKB 4PQHA 1K0AA 1X5EA 4MJCA 4GWRA 1T1VA 1TOFA 2B6MA 3UIWA 3TJGA 4MA9A 4AF2A 1GUMA 1J9BA 3IAS2 3ZIVA 3GX8A 4AGSA 4XHMA 3EE2A 5EY6A 1V98A 4V1Ag 3GURA 5J9BA 1ZZYA 4BA7A 5GSSA 1V57A 1XXUA 6GSWA 5IMFA 2V32A 5D9TA 5ECHB 4ML6A 2HSYA 3NIVA 4ILFA 1V2AA 1MEKA 2QGVA 3G9BA 2M72A 4XCSA 3FR6A 4E8HA 3BOAA 2NTOA 3GFKA 4ECJA 3LJRA 3FZ4A 5INYA 3U6VA 4HU9A 1C72A 4DEJA 4MCUA 5HR2A 1KEBA 1GP1A 3TKRA 3G7IA 3WT1A 2E0QA 4XS4B 3LWAA 4MPFA 16GSA 4MJEA 4Q5QA 2DIYA 1F37A 3GNJA 1TJDA 4L0WA 1SK0A 3CSHA 3VPTA 2B7JA 2C8UA 1XBSA 1VF3A 5ID2B 4TVEA 1XWBA 3UVHA 5D93A 3J7Yk 1W4VA 3ME8A 1H75A 1VF2A 4IN0A 3A2WA 4IP6A 3IBHA 1WMJA 1G7OA 1URMA 4NV5A 3MSZA 4K0NA 3HD5A 3UOMA 2OE3A 1PL2A 2LJAA 3PR8A 3L4NA 5DCHA 1Z5YE 5G5FA 3EVIA 3ERGA 2R3XA 1X9MB 2PVQA 4JRRA 3ZL5A 5G31A 4MF5A 4N0VA 3TOUA 1HNCA 4HDEA 2H76A 2RM5A 2RIIA 2MBSA 3KMNA 3LSZA 3I69A 1S3AA 2AUVA 2G0FA 2RUFA 3U5RE 3VWXA 2KP1A 3L78A 3QR6A 2XBIA 3ZREA 1YZXA 3HHVA 1THOA 2F51A 4L5OA 1NSWA 2PPTA 1Y6EA 2H71A 2REMA 5A4UA 2QSIA 4GRFA 3UVTA 4PURA 2E7PA 2LKUA 4PXOA 2HFDA 3GHAA 5CRDA 4H86A 3FK8A 2K8VA 5G1LA 4FIWA 2H1AA 2O85A 22GSA 2H1GA 3LGCA 1KNGA 5EVOA 1SD9A 5KN0A 2NDOA 2AV4A 3TUEA 4KDXA 3PGTA 4K0GA 1EOHA 4HEA2 3I9V2 1TRWA 1SJIA 2V2GA 4WXTA 4EC0A 1O7UA 3ZRDA 3C71A 3W6GA 3FZAA 4EXJA 1ERWA 5LNKe 1BJXA 1F3AA 1TW9A 1ZGNA 2M46A 3H1NA 4O5RA 4IVFA 2FY6A 4E8EA 3HCZA 3O3TA 3TJJA 2GZPA
chains in the Genus database with same CATH superfamily
3D4MA 2IMEA 3IA1A 2YNXA 2VO4A 2LRTA 3GMFA 1RQMA 4GSNA 1JLWA 5FHIA 2L57A 1LJRA 2O8VB 3KGKA 2CVDA 3TKSC 1PX6A 3KH7A 4ML1A 1GNWA 4K5SA 2H0HA 2CVBA 2GGTA 1THXA 4BWQA 1FHEA 3P7XA 5ECIB 2HT9A 3EU4A 3WT2A 3GSTA 2P5RA 1YEPA 3HVXA 2GSSA 2JL4A 2A2SA 1UA5A 4O5QA 4BPYA 5COHA 3OR5A 2H73A 3H4KA 2LQOA 2IL3A 4KUNA 4MZBA 3VPQA 2O7KA 4XTSA 1YJ6A 3TGZA 2H74A 1PSQA 1E6BA 1OC9A 4F03A 2R2JA 4FYBA 3KTBA 4PQ1A 3R2QA 1BQ7A 4V1Ap 4CY8A 3J7Yb 3G7JA 1GNEA 1FVKA 3KMOA 1WWJA 1TU7A 2X8CA 3RHBA 5ECLB 4TR1B 2JZRA 2KHPA 2J9HA 2ALBA 2GDRA 1OC3A 1JZDA 4WKWA 2HNLA 3L0HA 5JWRB 6GSSA 1XG8A 4BVYA 3ZFLA 2HZFA 2IMFA 3ZTLA 3GKMA 5IMCA 1UN2A 3BCKA 4ZBBA 5BMUA 5C04A 5IMDA 1Z7RA 4X1UA 3IK7A 3RPPA 2LRCA 4AJ8A 5IO2A 1PQNA 4O32A 2CX4A 1ZMAA 1X0RA 3QFAC 3UL3A 2C4JA 2YN1A 3LXTA 1M7TA 1J0FA 2MMZA 2H70A 2QA1A 4N30A 4KB3A 3HDCA 1K0OA 5G2ZA 1M99A 1XPVA 2C0GA 2KOKA 5HR0A 1QMVA 4OMVA 3W8JA 2C3TA 2FWFA 4RI7A 3G7YA 4G0LA 1I5GA 5G1KA 2HXKA 4GF0A 4DSSA 3S9FA 4LL1B 1GRXA 3FYGA 2IN3A 3RPNA 3TB2A 1XIYA 1TI1A 1CQGA 3WGDA 3LW9A 1GULA 2VL3A 4XS6A 3GA4A 5CYYA 1AXDA 3GUSA 3KZQA 1GSEA 5DAKA 2YWNA 4JZQA 2GQMA 4IHUA 1OC9B 1XWCA 3CYNA 4ZB6A 2L6DA 1SD8A 4OCFA 2MMOA 1V40A 2F8AA 5ECNB 5ABRA 3Q74A 1TRUA 4KDYA 3ERFA 4BIKA 3DMLA 3VURA 2HE3A 2LUSA 3QCPA 4Q5RA 3GYKA 2HRKA 2K9FA 4BVYB 2OADA 2E2MA 1GLPA 1FB6A 4MH2A 4FYCA 2R6KA 4BVXB 2FA8A 4NPBA 2C1YA 3VFIA 11GSA 2E2GA 5IIZA 1ST9A 1QGVA 4POLA 5AIXA 3A2VA 3M0FA 4FO5A 1PFOA 4WBRD 1S3RA 3D22A 4WBJA 1I9DA 1EEJA 4MF7A 1WJKA 3EC3A 4X43A 3P90A 1JZRA 1ZOFA 3CSJA 5GAND 4KX4A 4MDCA 2LNSA 3GRXA 3IK9A 1SJZA 5H5SA 4Z2UA 4XS4A 2DLXA 1GLQA 4PX1A 1UVZA 2VLVA 1A23A 1XW6A 4G10A 1O6JA 3F4RA 1K0MA 5DJLA 3TRPA 4K9ZA 4DSSB 4JU5A 2XHFA 5GSTA 3DKSA 3VWVA 5B6MA 2OE1A 4JR6A 5IOXA 4I8BA 5ENUA 3APSA 2GS3A 2R5GA 1VF4A 4LL4B 1SL1B 1WPIA 2ZNMA 4F0CA 4GSSA 4O7HA 1XW5A 1SU9A 2HSHA 3VI7A 3FZ5A 2B3SA 3HKRA 4TN8A 3APOA 5GAPD 1XW9A 3DVWA 3C7MA 1PRXA 2GQLA 2TRXA 4GQFA 1T4ZA 18GSA 2GZYA 1TK8B 5ELAA 1K0DA 2O87A 2LJKA 4YAVA 2F8FA 2WRTA 3WD6A 3F4TA 5LCZA 4RQXA 5IMAA 1AW9A 2YJHA 3VK9A 2C3NA 1U6TA 1X9SB 1TI3A 1JFUA 1A24A 2LS5A 5D9VA 3IHQA 2JACA 1A0RP 3KXOA 2VUPA 1OYJA 4MMMA 1ML6A 3K8NA 1HQOA 1ON4A 1DSBA 1M3IA 1VRSD 1U3AA 4ZL7A 3F3RA 5EPFA 5HR1A 2HSMA 1R7HA 1XWAA 2MYGA 4P3YB 4NMUA 3D0ZA 1DBYA 4L8EA 2YP6A 2A4VA 3UEMA 4WETA 1TTZA 4ZBDA 5D9WA 2WFCA 1ZYNA 3IC4A 2YWIA 1SKWB 2H8LA 2O89A 3EU3A 4KSMA 3UAPA 5J3RA 4G9HA 2JU5A 1JZWA 5ECRB 3M3MA 5CO3A 2JSYA 2VLUA 1M2AA 4A5PA 3GKKA 5G5EA 3ZVJA 2OA7A 2VLTA 2LQQA 4TR4A 3Q18A 3GTUA 19GSA 1BG5A 2CV4A 5JWQB 1S3CA 4MJAA 4K7OA 2L5OA 1GTBA 2DJ1A 1XFLA 2WZ9A 4IBPA 1T3BA 4I6XA 1A2JA 1GSYA 2N5FA 2VAFA 1F3BA 4ZXGA 6GSYA 2R0CA 1EP7A 1ZYEA 1TRVA 1N8JA 4RUVA 4HQSA 2CA8A 1WIKA 4XS1A 5HR3A 2L4CA 5F05A 2K8SA 5JCGA 3ZITA 4F2IA 4OD7A 4HJMA 4ID0A 4IW9A 4PNGA 1VGLA 4J56E 3CQFA 3QMXA 5DALA 2IMIA 4PGTA 2PWJA 2CZ2A 1DE1A 1HNAA 3HJOA 4HZ4A 4KGIA 2PMTA 1PGTA 1EV4A 1AUCA 1GTAA 2DKIA 4JR4A 3HZ4A 1PX7A 2N5AA 2EIQA 2FGXA 3GKXA 1JLVA 2A4HA 2LSTA 4GCIA 2UZ8A 3BBYA 4PUFC 4LMVA 2B5YA 1BEDA 1GH2A 3MDKA 2KLXA 2ZUPA 1Z3EA 5E4WA 2EIOA 4MZCA 2VL9A 4ZL9A 5CREA 5D96A 4IELA 3C73A 13GSA 3H93A 1XCCA 2CAQA 1OKDA 4TR1A 5IO0A 4IJIA 3GL5A 3P2AA 3WGXA 4HJ2A 6GSXA 4XRDA 5IM9A 4ACSA 12GSA 3QAVA 5ECKB 5J41A 3DYRA 3GTUB 1QXHA 2CAIA 3CBUA 2WB9A 5AISA 3LORA 2HRNA 4IGJA 3ZLPA 3F4SA 4QL9A 4KNDA 2V6KA 5CRGA 3JCML 2YWOA 1B4QA 2V1MA 5AN1A 2IMKA 4N11A 2VCQA 3FEUA 4QL7A 4DSRA 4MH3A 1B4PA 1A2LA 2XPDA 3DXBA 2CVKA 5HFGA 2BMXA 5HFIA 1QQ2A 1F6MC 1ABAA 3IXRA 1JHBA 2GT6A 1T4YA 5F07A 2H0GA 4N0ZA 2NPBA 3KP9A 3GKNA 3P8WA 1O8WA 3IDVA 4ZB8A 3V1WA 3VI5A 3MWHA 4OO4A 5A4WA 5DDLA 5DQSA 5DALB 2YPMA 3LYPA 2ES7A 2OJLA 2DBCA 2I9HA 3ZYWA 3F6DA 5IQYA 1OE8A 1ERTA 1B9YC 2VIMA 2DJ2A 3GL3A 1GSDA 1O8XA 2QC7A 1VF1A 2TIRA 3ZMLA 2XC2A 2JSZA 1OVNA 4F9ZA 2H66A 1NHOA 1A8YA 1USBA 3ZIJA 2HRFA 1R4WA 1SKSB 4NWYA 3FZ9A 1GUHA 3LFLA 4V2NA 2H72A 1A0FA 3TJFA 5H5RA 3IR4A 3TCOA 1X5CA 1XZOA 3FHKA 5BRTA 1NW2A 4EE0A 3C8EA 4LA1A 2VCVA 1QK8A 3W8SA 1BAYA 2QA2A 2YWMA 1EGRA 2FWEA 3CTGA 4NV2A 4ZB9A 4EVMA 1BYEA 2VD1A 1EP8A 3EPTA 2DC5A 4K7IA 4BVXA 2DMLA 3FR9A 1QFNA 2GLRA 20GSA 1M9AA 3RHCA 3FW2A 3R3EA 1G7EA 4WR4A 1Q4JA 2IJYA 5DCGA 4J57E 3UMAA 5B6NA 4YQMA 2PGTA 3APQA 1Y25A 2ON5A 3HJMA 4ULXA 1ZYQB 3TDGA 5CRHA 2FLSA 3LQ7A 3KIJA 4TKYA 4IKHA 4J2FA 4FH8A 1PKWA 2MZCA 4POBA 4HI7A 2WS2A 5KOXA 4K6XA 5A5KA 4DVCA 1GSQA 3EMXA 3HXSA 2FNOA 3ZZXA 5CP1A 3M8NA 3C1SA 4ISDA 4EO3A 2H75A 4IQ1A 2VM2A 2LJRA 3HA9A 4ZL8A 3RBTA 3KD0A 4KF9A 1YKAA 4YKFA 2XPEA 2GVPA 1PA3A 3TKPA 4TXVA 2GTUA 4G2EA 4JBBA 17GSA 5C00A 1B48A 4NAXA 1YDKA 2D2ZA 4IQAA 1UC7A 1ZCPA 4YAPA 3IE3A 3GIXA 5FT3A 9GSSA 3HJPA 3US3A 2YCDA 1NHYA 3TJBA 3KH9A 5H5QA 1GTUA 2L5LA 4O5UA 1GSUA 4X0XA 2CZ3A 2H19A 3F8UA 2AHEA 1HD2A 1K3YA 2CT6A 2IPAA 3IPZA 1X5DA 4Q5NA 2YJ7A 2PU9C 4K7NA 3EINA 2RM6A 1G0TA 3NZNA 3ZMKA 3CTFA 2GT5A 3D6IA 4ZIJA 5HFKA 2Z9SA 4EDYA 1MDIA 4V2MA 1ZL9A 3M9JA 4GLTA 2R4VA 1HNBA 1XWGA 2FCHA 1JZOA 2X99A 1TRSA 2HZEA 4Z7XA 4HQZA 2DKHA 4OO5A 4KSOA 2F9SA 4MF6A 1G6WA 1ACVA 1RK4A 2WGRA 4XIHA 1FO5A 1V9WA 1GL8A 4I2TA 3NOFA 3DEXA 7GSSA 4KA0A 4RI6A 3ISOA 2V6OA 1QUWA 2FWHA 1FG4A 5DBQA 4OFNA 2NBSA 3D21A 4XRAA 2LNTA 2X8GA 4OWYA 2B5EA 4N10A 3PPUA 5ECMB 2N5BA 2WDUA 3A2XA 5J5NA 1ERVA 1ILOA 4EL1A 2GSTA 2K6VA 4TR3A 1ZYPA 1KBNA 2YV9A 2H0IA 2DJKA 2YV7A 10GSA 3L9VA 3HVVA 5E59A 2NVLA 1M2BA 3CXGA 2FUG2 4WEYA 2H6ZA 2GSQA 4I5QA 1KTEA 3WYWA 1O85A 3HVSA 3D5JA 1F2EA 1XVQA 3LYKA 3ZVJD 4OFMA 1PMTA 1SKRB 1WOUA 2I1UA 4HS1A 2IFQA 5JCUA 1OE7A 1XWKA 1TP9A 4ECIA 3KEBA 2DIZA 4G19A 2YZUA 1S3DA 4EUYA 1FOVA 4ZILA 2B1LA 2K18A 2OE0A 1N2AA 4LMWA 1YEXA 4YKGA 2J23A 6GSTA 1R5AA 4WF5A 2FHEA 3D4TA 2HZEB 4MJBA 4TW5A 2H6XA 1M0UA 1AQXA 2BJXA 1AQWA 3TOTA 2OBKA 3F3QA 5DJMA 2VL2A 3H8QA 5F06A 1M9BA 4CHSA 2H30A 1R26A 4G0KA 4EIQA 3CRTA 4TXOA 2LTKA 2JADA 1YF0A 4WR5A 1B9XC 2DJJA 3N5OA 3QFBC 2G2QA 3GX0A 3EYTA 1SK2A 3IV4A 2B5XA 1PKZA 1XOBA 1YQ1A 3DIEA 3WGEA 4KE3A 4RQRA 1MDKA 4EKZA 3RDWA 3RAZA 3EMPA 2WCIA 3MIXA 4PUAA 2VCTA 1AAZA 2OACA 4YQUA 1LBKA 3ME7A 3KM6A 4ICYA 2JZTA 5LD0A 1R5PA 3O76A 4KDUA 3CRUA 4KH7A 5FWGA 2XBQA 5D73A 2PUKC 2KP2A 3DVXA 3IAM2 2I3YA 1J08A 3PH9A 5L71A 3FRCA 3Q6OA 5JCWA 3HYPA 1PD21 2IFQB 4IP1A 4EIPA 2VCXA 3AY8A 1AC1A 5CNWA 1EZKA 2ON7A 1TXXA 4KCAA 3UARA 2MMNA 3N9JA 3DGQA 2BTOT 2LEGA 3I6AA 4L0UA 2HLSA 2MMAA 1K0NA 2ZCTA 1U87A 4NHWA 4EDZA 1F9MA 3L9SA 1MTCA 3A5WA 1B8XA 1K0BA 2YANA 2F3MA 4K2DA 5CRWA 2V41A 1CQHA 4OFTA 2L6CA 1FAAA 2A2RA 4BWSA 2X8HA 3VLNA 4YQVA 1SYXA 4FYUA 1OAZA 1LU4A 1BX9A 1T7PB 2HRAA 4HSCX 2B7KA 3ED3A 1AQVA 2JZSA 2GSRA 1EGOA 4GTUA 4NHZA 4TXOB 3Q19A 3TRXA 1A2MA 3VWUA 1IYIA 3GSSA 1FOHA 3HY2A 2QKEA 8GSSA 3TKSE 2EIRA 5F0GA 4LLRA 2OKAA 1YKCA 2P31A 1DE2A 3IOSA 3QOUA 1T00A 3L9UA 4HUAA 5KN1A 2VCZA 2C0EA 1ERUA 4PQIA 2H01A 5D8IA 1EEMA 2I4AA 4V2LA 1GSFA 2DJ3A 3I43A 2PN8A 2H1DA 5ELGA 1PN9A 4CY6A 3VWWA 3C1RA 1Z6NA 3DD3A 3GH9A 1T8EB 4POMA 1TDIA 5ECSA 2GQKA 5B8AA 4OCEA 5KN3A 1FW1A 3TKQA 5B7CA 1O73A 1AIUA 3FY7A 5J9CA 2KUCA 3F0IA 1H4OA 2C3QA 1SENA 3CSIA 3KJYA 1X9WB 5IMVA 4MABA 1GWCA 4G0IA 3SBCA 1EV9A 1SK1A 1HYUA 2B1KA 14GSA 5D9XA 5CAXA 1U3IA 3KP8A 4KW6A 1DUGA 2TRCP 5KN2A 2PERA 2IIYA 3KTLA 5B8BA 5DQYA 3UBLA 2C0DA 1WRYA 4CDOA 1E2YA 1XVWA 2PVOC 2H6YA 4QQ7A 4ECBA 5ECOB 3BJ5A 3DWVA 5AIVA 2CQ9A 3UJ1A 1W89A 3LEFA 3ZFBA 2RUEA 1FB0A 3H79A 1XOAA 1Q98A 2LRNA 1WP0A 1Z9HA 3GN3A 1G6YA 4EF0A 5IOWA 1U88A 5G30A 2GZZA 5AGYA 1GUKA 3SWLA 2RLIA 1V58A 3TRQA 3M1GA 4IJ3A 1SL0B 4MK3A 4ECCA 2YOIA 3IRAA 1Z6MA 2R0GA 1FVJA 4GQCA 4WF4A 4AJ6A 1NM3A 3QDNA 2AAWA 2A2PA 2M80A 2OBIA 3QPMA 1MD3A 4POKA 3O6TA 4MZWA 2AYTA 4HOJA 2L4QA 3F6FA 3UBKA 3M9KA 5J4UA 4D73A 2HYXA 4Z2RA 2FD3A 3E9JB 4K1FA 1MD4A 1IYHA 4YH2A 4L5LA 4CW9A 4I2UA 4KAEA 3HZ8A 2DMMA 2X49A 2WJUA 3MNGA 1TU8A 2C0FA 1K3OA 1GSSA 1K0CA 2P5QA 3FR3A 4DSQA 3QD9A 3CMIA 3ERWA 1YF1A 4F82A 3LG6A 2CX3A 2C80A 5JWOB 3E0UA 2LV3A 4KCEA 5A4VA 3TKSA 3A3TA 3KCMA 4GSTA 2AB6A 2I81A 5IMZA 4AJ7A 2MBTA 1Z7PA 1OC8A 3MAKA 4MPGA 4I97A 3GV1A 3LXZA 1M2DA 4TRXA 2IMDA 5F8BA 2VD0A 2HI7A 4MLYA 1TKDB 3HVNA 3BD2A 2R37A 1O81A 1RW1A 5ECQB 1OKTA 3BCIA 1PL1A 1SYRA 2L59A 2AJQB 1SJ6A 1YY7A 2EC4A 2PBJA 2VL2C 2WULA 3EURA 2FWGA 4Q5FA 1TK0B 3QAGA 3E3EA 2VCWA 1MDJA 2DJ0A 1A8LA 4IS0A 3A5IA 2P0GA 1WE0A 1GTIA 4O92A 4HU7A 5KEJA 3F9UA 4HZ2A 4JE1A 3FKFA 3GH6A 3EWLA 4D73B 5EL8A 4K8MA 4MP4A 6GSUA 4TR0A 3TJKA 4BL7A 5DVBA 5ECPB 2VOCA 5IPHA 2FA4A 4K2XA 2YZHA 3DRNA 1EWXA 5GZZB 2IWTA 1TK5B 1EOGA 3F63A 2DSAA 2H1BA 4NXIA 5HQPA 1K3LA 5IPGA 4ZBAA 6GSVA 4TOPA 5ID2A 1SL2B 4PNFA 4JEDA 4F0BA 2X64A 2VM1A 4GXZA 3PINA 3QAWA 5DAKB 4PQHA 1K0AA 1X5EA 4MJCA 4GWRA 1T1VA 1TOFA 2B6MA 3UIWA 3TJGA 4MA9A 4AF2A 1GUMA 1J9BA 4X4JA 3IAS2 3ZIVA 3GX8A 4AGSA 4XHMA 3EE2A 3FMWA 5EY6A 1V98A 4V1Ag 3MYDA 3GURA 5J9BA 1ZZYA 4BA7A 5GSSA 1V57A 1XXUA 6GSWA 5IMFA 2V32A 5D9TA 5ECHB 4ML6A 2HSYA 3NIVA 4ILFA 1V2AA 1MEKA 2QGVA 3G9BA 2M72A 4XCSA 3FR6A 4E8HA 3BOAA 2NTOA 3GFKA 4ECJA 3LJRA 3FZ4A 5INYA 3U6VA 4HU9A 4BL7B 1C72A 4DEJA 4MCUA 5HR2A 4K5RA 1KEBA 1GP1A 3TKRA 5KOWA 3G7IA 3WT1A 2E0QA 4XS4B 3LWAA 4MPFA 16GSA 4MJEA 4Q5QA 2DIYA 1F37A 3GNJA 1TJDA 4L0WA 1PN0A 1SK0A 3CSHA 3VPTA 2B7JA 2C8UA 1XBSA 1VF3A 5ID2B 4TVEA 1XWBA 3UVHA 5D93A 3J7Yk 1W4VA 3ME8A 1H75A 1VF2A 4IN0A 3A2WA 4IP6A 3IBHA 2R0PA 1WMJA 1G7OA 1URMA 4NV5A 3MSZA 4K0NA 3HD5A 3UOMA 2OE3A 1PL2A 2LJAA 3PR8A 3L4NA 5DCHA 1Z5YE 5G5FA 3EVIA 3ERGA 2R3XA 1X9MB 3IC8A 2PVQA 4JRRA 3ZL5A 5G31A 4MF5A 4N0VA 3TOUA 4USSA 1HNCA 4HDEA 2H76A 2RM5A 2RIIA 2MBSA 3KMNA 3LSZA 3I69A 1S3AA 2AUVA 2G0FA 2RUFA 3U5RE 3VWXA 2KP1A 3L78A 3QR6A 2XBIA 3ZREA 1YZXA 4Z2TA 3HHVA 1THOA 2F51A 4L5OA 1NSWA 2PPTA 1Y6EA 2H71A 2REMA 5A4UA 2QSIA 4GRFA 3UVTA 4PURA 2E7PA 2LKUA 4PXOA 2HFDA 3GHAA 4MNNA 5CRDA 4H86A 3FK8A 2K8VA 5G1LA 4FIWA 2H1AA 2O85A 22GSA 2H1GA 3LGCA 1KNGA 5EVOA 1SD9A 5KN0A 2NDOA 2AV4A 3TUEA 4KDXA 3PGTA 3IHGA 4K0GA 1EOHA 4HEA2 3I9V2 1TRWA 1SJIA 2V2GA 4WXTA 4EC0A 1O7UA 3ZRDA 4FQUA 3C71A 3W6GA 3FZAA 4EXJA 1ERWA 5LNKe 1BJXA 1F3AA 1TW9A 1ZGNA 2M46A 3H1NA 2X4AA 1M3JA 4O5RA 4IVFA 2FY6A 4E8EA 3HCZA 3O3TA 3TJJA 4PTSA 2GZPA
chains in the Genus database with same CATH topology
3D4MA 2IMEA 3IA1A 2YNXA 2VO4A 2LRTA 3GMFA 1RQMA 4GSNA 1JLWA 5FHIA 2L57A 1LJRA 2O8VB 3KGKA 2CVDA 3TKSC 1PX6A 3KH7A 4ML1A 1GNWA 4K5SA 2H0HA 2CVBA 2GGTA 1THXA 4BWQA 1FHEA 3P7XA 5ECIB 2HT9A 3EU4A 3WT2A 3GSTA 2P5RA 1YEPA 3HVXA 2GSSA 2JL4A 2A2SA 1UA5A 4O5QA 4BPYA 5COHA 3OR5A 2H73A 3H4KA 2LQOA 2IL3A 4KUNA 4MZBA 3VPQA 2O7KA 4XTSA 1YJ6A 3TGZA 2H74A 1PSQA 1E6BA 1OC9A 4F03A 2R2JA 4FYBA 3KTBA 4PQ1A 3R2QA 1BQ7A 4V1Ap 4CY8A 3J7Yb 3G7JA 1GNEA 1FVKA 3KMOA 1WWJA 1TU7A 2X8CA 3RHBA 5ECLB 4TR1B 2JZRA 2KHPA 2J9HA 2ALBA 2GDRA 1OC3A 1JZDA 4WKWA 2HNLA 3L0HA 5JWRB 6GSSA 4BVYA 3ZFLA 2HZFA 2IMFA 3ZTLA 3GKMA 5IMCA 1UN2A 3BCKA 4ZBBA 5BMUA 5C04A 5IMDA 1Z7RA 4X1UA 3IK7A 3RPPA 2LRCA 4AJ8A 5IO2A 1PQNA 4O32A 2CX4A 1ZMAA 1X0RA 3QFAC 3UL3A 2C4JA 2YN1A 3LXTA 1M7TA 1J0FA 2MMZA 2H70A 2QA1A 4N30A 4KB3A 3HDCA 1K0OA 5G2ZA 1M99A 1XPVA 2C0GA 2KOKA 5HR0A 1QMVA 4OMVA 3W8JA 2C3TA 2FWFA 4RI7A 3G7YA 4G0LA 1I5GA 5G1KA 2HXKA 4GF0A 4DSSA 3S9FA 4LL1B 1GRXA 3FYGA 2IN3A 3RPNA 3TB2A 1XIYA 1TI1A 1CQGA 3WGDA 3LW9A 1GULA 2VL3A 4XS6A 3GA4A 5CYYA 1AXDA 3GUSA 3KZQA 1GSEA 5DAKA 2YWNA 4JZQA 2GQMA 4IHUA 1OC9B 1XWCA 3CYNA 4ZB6A 2L6DA 1SD8A 4OCFA 2MMOA 1V40A 2F8AA 5ECNB 5ABRA 3Q74A 1TRUA 4KDYA 3ERFA 3DMLA 3VURA 2HE3A 2LUSA 3QCPA 4Q5RA 3GYKA 2HRKA 2K9FA 4BVYB 2OADA 2E2MA 1GLPA 1FB6A 4MH2A 4FYCA 2R6KA 4BVXB 2FA8A 4NPBA 2C1YA 3VFIA 11GSA 2E2GA 5IIZA 1ST9A 1QGVA 4POLA 5AIXA 3A2VA 3M0FA 4FO5A 4WBRD 3D22A 4WBJA 1I9DA 1EEJA 4MF7A 1WJKA 3EC3A 4X43A 3P90A 1JZRA 1ZOFA 3CSJA 5GAND 4KX4A 4MDCA 2LNSA 3GRXA 3IK9A 1SJZA 5H5SA 4Z2UA 4XS4A 2DLXA 1GLQA 4PX1A 1UVZA 2VLVA 1A23A 1XW6A 4G10A 1O6JA 3F4RA 1K0MA 5DJLA 3TRPA 4K9ZA 4DSSB 4JU5A 2XHFA 5GSTA 3DKSA 3VWVA 5B6MA 2OE1A 4JR6A 5IOXA 4I8BA 5ENUA 3APSA 2GS3A 2R5GA 1VF4A 4LL4B 1SL1B 1WPIA 2ZNMA 4F0CA 4GSSA 4O7HA 1XW5A 1SU9A 2HSHA 3VI7A 3FZ5A 2B3SA 3HKRA 4TN8A 3APOA 5GAPD 1XW9A 3DVWA 3C7MA 1PRXA 2GQLA 2TRXA 4GQFA 1T4ZA 18GSA 2GZYA 1TK8B 5ELAA 1K0DA 2O87A 2LJKA 4YAVA 2F8FA 2WRTA 3WD6A 3F4TA 5LCZA 4RQXA 5IMAA 1AW9A 2YJHA 3VK9A 2C3NA 1U6TA 1X9SB 1TI3A 1JFUA 1A24A 2LS5A 5D9VA 3IHQA 2JACA 1A0RP 3KXOA 2VUPA 1OYJA 4MMMA 1ML6A 3K8NA 1HQOA 1ON4A 1DSBA 1VRSD 1U3AA 4ZL7A 3F3RA 5EPFA 5HR1A 2HSMA 1R7HA 1XWAA 2MYGA 4P3YB 4NMUA 3D0ZA 1DBYA 4L8EA 2YP6A 2A4VA 3UEMA 4WETA 1TTZA 4ZBDA 5D9WA 2WFCA 1ZYNA 3IC4A 2YWIA 1SKWB 2H8LA 2O89A 3EU3A 4KSMA 3UAPA 5J3RA 4G9HA 2JU5A 1JZWA 5ECRB 3M3MA 5CO3A 2JSYA 2VLUA 1M2AA 4A5PA 3GKKA 5G5EA 3ZVJA 2OA7A 2VLTA 2LQQA 4TR4A 3Q18A 3GTUA 19GSA 1BG5A 2CV4A 5JWQB 1S3CA 4MJAA 4K7OA 2L5OA 1GTBA 2DJ1A 1XFLA 2WZ9A 4IBPA 1T3BA 4I6XA 1A2JA 1GSYA 2N5FA 2VAFA 1F3BA 4ZXGA 6GSYA 2R0CA 1EP7A 1ZYEA 1TRVA 1N8JA 4RUVA 4HQSA 2CA8A 1WIKA 4XS1A 5HR3A 2L4CA 5F05A 2K8SA 5JCGA 3ZITA 4F2IA 4OD7A 4HJMA 4ID0A 4IW9A 4PNGA 1VGLA 4J56E 3QMXA 5DALA 2IMIA 4PGTA 2PWJA 2CZ2A 1DE1A 1HNAA 3HJOA 4HZ4A 4KGIA 2PMTA 1PGTA 1EV4A 1AUCA 1GTAA 2DKIA 4JR4A 3HZ4A 1PX7A 2N5AA 2EIQA 2FGXA 3GKXA 1JLVA 2A4HA 2LSTA 4GCIA 2UZ8A 3BBYA 4PUFC 4LMVA 2B5YA 1BEDA 1GH2A 3MDKA 2KLXA 2ZUPA 1Z3EA 5E4WA 2EIOA 4MZCA 2VL9A 4ZL9A 5CREA 5D96A 4IELA 3C73A 13GSA 3H93A 1XCCA 2CAQA 1OKDA 4TR1A 5IO0A 4IJIA 3GL5A 3P2AA 3WGXA 4HJ2A 6GSXA 4XRDA 5IM9A 4ACSA 12GSA 3QAVA 5ECKB 5J41A 3DYRA 3GTUB 1QXHA 2CAIA 3CBUA 2WB9A 5AISA 3LORA 2HRNA 4IGJA 3ZLPA 3F4SA 4QL9A 4KNDA 2V6KA 5CRGA 3JCML 2YWOA 1B4QA 2V1MA 5AN1A 2IMKA 4N11A 2VCQA 3FEUA 4QL7A 4DSRA 4MH3A 1B4PA 1A2LA 2XPDA 3DXBA 2CVKA 5HFGA 2BMXA 5HFIA 1QQ2A 1F6MC 1ABAA 3IXRA 1JHBA 2GT6A 1T4YA 5F07A 2H0GA 4N0ZA 2NPBA 3KP9A 3GKNA 3P8WA 1O8WA 3IDVA 4ZB8A 3V1WA 3VI5A 3MWHA 4OO4A 5A4WA 5DDLA 5DQSA 5DALB 2YPMA 3LYPA 2ES7A 2OJLA 2DBCA 2I9HA 3ZYWA 3F6DA 5IQYA 1OE8A 1ERTA 1B9YC 2VIMA 2DJ2A 3GL3A 1GSDA 1O8XA 2QC7A 1VF1A 2TIRA 3ZMLA 2XC2A 2JSZA 1OVNA 4F9ZA 2H66A 1NHOA 1A8YA 1USBA 3ZIJA 2HRFA 1R4WA 1SKSB 4NWYA 3FZ9A 1GUHA 3LFLA 4V2NA 2H72A 1A0FA 3TJFA 5H5RA 3IR4A 3TCOA 1X5CA 1XZOA 3FHKA 5BRTA 1NW2A 4EE0A 3C8EA 4LA1A 2VCVA 1QK8A 3W8SA 1BAYA 2QA2A 2YWMA 1EGRA 2FWEA 3CTGA 4NV2A 4ZB9A 4EVMA 1BYEA 2VD1A 1EP8A 3EPTA 2DC5A 4K7IA 4BVXA 2DMLA 3FR9A 1QFNA 2GLRA 20GSA 1M9AA 3RHCA 3FW2A 3R3EA 1G7EA 4WR4A 1Q4JA 2IJYA 5DCGA 4J57E 3UMAA 5B6NA 4YQMA 2PGTA 3APQA 1Y25A 2ON5A 3HJMA 4ULXA 1ZYQB 3TDGA 5CRHA 2FLSA 3LQ7A 3KIJA 4TKYA 4IKHA 4J2FA 4FH8A 1PKWA 2MZCA 4POBA 4HI7A 2WS2A 5KOXA 4K6XA 5A5KA 4DVCA 1GSQA 3EMXA 3HXSA 2FNOA 3ZZXA 5CP1A 3M8NA 3C1SA 4ISDA 4EO3A 2H75A 4IQ1A 2VM2A 2LJRA 3HA9A 4ZL8A 3RBTA 3KD0A 4KF9A 1YKAA 4YKFA 2XPEA 2GVPA 1PA3A 3TKPA 4TXVA 2GTUA 4G2EA 4JBBA 17GSA 5C00A 1B48A 4NAXA 1YDKA 2D2ZA 4IQAA 1UC7A 1ZCPA 4YAPA 3IE3A 3GIXA 5FT3A 9GSSA 3HJPA 3US3A 2YCDA 1NHYA 3TJBA 3KH9A 5H5QA 1GTUA 2L5LA 4O5UA 1GSUA 4X0XA 2CZ3A 2H19A 3F8UA 2AHEA 1HD2A 1K3YA 2CT6A 2IPAA 3IPZA 1X5DA 4Q5NA 2YJ7A 2PU9C 4K7NA 3EINA 2RM6A 1G0TA 3NZNA 3ZMKA 3CTFA 2GT5A 3D6IA 4ZIJA 5HFKA 2Z9SA 4EDYA 1MDIA 4V2MA 1ZL9A 3M9JA 4GLTA 2R4VA 1HNBA 1XWGA 2FCHA 1JZOA 2X99A 1TRSA 2HZEA 4Z7XA 4HQZA 2DKHA 4OO5A 4KSOA 2F9SA 4MF6A 1G6WA 1ACVA 1RK4A 2WGRA 4XIHA 1FO5A 1V9WA 1GL8A 4I2TA 3NOFA 3DEXA 7GSSA 4KA0A 4RI6A 3ISOA 2V6OA 1QUWA 2FWHA 1FG4A 5DBQA 4OFNA 2NBSA 3D21A 4XRAA 2LNTA 2X8GA 4OWYA 2B5EA 4N10A 3PPUA 5ECMB 2N5BA 2WDUA 3A2XA 5J5NA 1ERVA 1ILOA 4EL1A 2GSTA 2K6VA 4TR3A 1ZYPA 1KBNA 2YV9A 2H0IA 2DJKA 2YV7A 10GSA 3L9VA 3HVVA 5E59A 2NVLA 1M2BA 3CXGA 2FUG2 4WEYA 2H6ZA 2GSQA 4I5QA 1KTEA 3WYWA 1O85A 3HVSA 3D5JA 1F2EA 1XVQA 3LYKA 3ZVJD 4OFMA 1PMTA 1SKRB 1WOUA 2I1UA 4HS1A 2IFQA 5JCUA 1OE7A 1XWKA 1TP9A 4ECIA 3KEBA 2DIZA 4G19A 2YZUA 1S3DA 4EUYA 1FOVA 4ZILA 2B1LA 2K18A 2OE0A 1N2AA 4LMWA 1YEXA 4YKGA 2J23A 6GSTA 1R5AA 4WF5A 2FHEA 3D4TA 2HZEB 4MJBA 4TW5A 2H6XA 1M0UA 1AQXA 2BJXA 1AQWA 3TOTA 2OBKA 3F3QA 5DJMA 2VL2A 3H8QA 5F06A 1M9BA 4CHSA 2H30A 1R26A 4G0KA 4EIQA 3CRTA 4TXOA 2LTKA 2JADA 1YF0A 4WR5A 1B9XC 2DJJA 3N5OA 3QFBC 2G2QA 3GX0A 3EYTA 1SK2A 3IV4A 2B5XA 1PKZA 1XOBA 1YQ1A 3DIEA 3WGEA 4KE3A 4RQRA 1MDKA 4EKZA 3RDWA 3RAZA 3EMPA 2WCIA 3MIXA 4PUAA 2VCTA 1AAZA 2OACA 4YQUA 1LBKA 3ME7A 3KM6A 4ICYA 2JZTA 5LD0A 1R5PA 3O76A 4KDUA 3CRUA 4KH7A 5FWGA 2XBQA 5D73A 2PUKC 2KP2A 3DVXA 3IAM2 2I3YA 1J08A 3PH9A 5L71A 3FRCA 3Q6OA 5JCWA 3HYPA 1PD21 2IFQB 4IP1A 4EIPA 2VCXA 3AY8A 1AC1A 5CNWA 1EZKA 2ON7A 1TXXA 4KCAA 3UARA 2MMNA 3N9JA 3DGQA 2BTOT 2LEGA 3I6AA 4L0UA 2HLSA 2MMAA 1K0NA 2ZCTA 1U87A 4NHWA 4EDZA 1F9MA 3L9SA 1MTCA 3A5WA 1B8XA 1K0BA 2YANA 2F3MA 4K2DA 5CRWA 2V41A 1CQHA 4OFTA 2L6CA 1FAAA 2A2RA 4BWSA 2X8HA 3VLNA 4YQVA 1SYXA 4FYUA 1OAZA 1LU4A 1BX9A 1T7PB 2HRAA 2B7KA 3ED3A 1AQVA 2JZSA 2GSRA 1EGOA 4GTUA 4NHZA 4TXOB 3Q19A 3TRXA 1A2MA 3VWUA 1IYIA 3GSSA 1FOHA 3HY2A 2QKEA 8GSSA 3TKSE 2EIRA 5F0GA 4LLRA 2OKAA 1YKCA 2P31A 1DE2A 3IOSA 3QOUA 1T00A 3L9UA 4HUAA 5KN1A 2VCZA 2C0EA 1ERUA 4PQIA 2H01A 5D8IA 1EEMA 2I4AA 4V2LA 1GSFA 2DJ3A 3I43A 2PN8A 2H1DA 5ELGA 1PN9A 4CY6A 3VWWA 3C1RA 1Z6NA 3DD3A 3GH9A 1T8EB 4POMA 1TDIA 5ECSA 2GQKA 5B8AA 4OCEA 5KN3A 1FW1A 3TKQA 5B7CA 1O73A 1AIUA 3FY7A 5J9CA 2KUCA 3F0IA 1H4OA 2C3QA 1SENA 3CSIA 3KJYA 1X9WB 5IMVA 4MABA 1GWCA 4G0IA 3SBCA 1EV9A 1SK1A 1HYUA 2B1KA 14GSA 5D9XA 5CAXA 1U3IA 3KP8A 4KW6A 1DUGA 2TRCP 5KN2A 2PERA 2IIYA 3KTLA 5B8BA 5DQYA 3UBLA 2C0DA 1WRYA 4CDOA 1E2YA 1XVWA 2PVOC 2H6YA 4QQ7A 4ECBA 5ECOB 3BJ5A 3DWVA 5AIVA 2CQ9A 3UJ1A 1W89A 3LEFA 3ZFBA 2RUEA 1FB0A 3H79A 1XOAA 1Q98A 2LRNA 1WP0A 1Z9HA 3GN3A 1G6YA 4EF0A 5IOWA 1U88A 5G30A 2GZZA 5AGYA 1GUKA 3SWLA 2RLIA 1V58A 3TRQA 3M1GA 4IJ3A 1SL0B 4MK3A 4ECCA 2YOIA 3IRAA 1Z6MA 2R0GA 1FVJA 4GQCA 4WF4A 4AJ6A 1NM3A 3QDNA 2AAWA 2A2PA 2M80A 2OBIA 3QPMA 1MD3A 4POKA 3O6TA 4MZWA 2AYTA 4HOJA 2L4QA 3F6FA 3UBKA 3M9KA 5J4UA 4D73A 2HYXA 4Z2RA 2FD3A 3E9JB 4K1FA 1MD4A 1IYHA 4YH2A 4L5LA 4CW9A 4I2UA 4KAEA 3HZ8A 2DMMA 2X49A 2WJUA 3MNGA 1TU8A 2C0FA 1K3OA 1GSSA 1K0CA 2P5QA 3FR3A 4DSQA 3QD9A 3CMIA 3ERWA 1YF1A 4F82A 3LG6A 2CX3A 2C80A 5JWOB 3E0UA 2LV3A 4KCEA 5A4VA 3TKSA 3A3TA 3KCMA 4GSTA 2AB6A 2I81A 5IMZA 4AJ7A 2MBTA 1Z7PA 1OC8A 3MAKA 4MPGA 4I97A 3GV1A 3LXZA 1M2DA 4TRXA 2IMDA 5F8BA 2VD0A 2HI7A 4MLYA 1TKDB 3BD2A 2R37A 1O81A 1RW1A 5ECQB 1OKTA 3BCIA 1PL1A 1SYRA 2L59A 2AJQB 1SJ6A 1YY7A 2EC4A 2PBJA 2VL2C 2WULA 3EURA 2FWGA 4Q5FA 1TK0B 3QAGA 3E3EA 2VCWA 1MDJA 2DJ0A 1A8LA 4IS0A 3A5IA 2P0GA 1WE0A 1GTIA 4O92A 4HU7A 5KEJA 3F9UA 4HZ2A 4JE1A 3FKFA 3GH6A 3EWLA 4D73B 5EL8A 4K8MA 4MP4A 6GSUA 4TR0A 3TJKA 4BL7A 5DVBA 5ECPB 2VOCA 5IPHA 2FA4A 4K2XA 2YZHA 3DRNA 1EWXA 5GZZB 2IWTA 1TK5B 1EOGA 3F63A 2DSAA 2H1BA 4NXIA 5HQPA 1K3LA 5IPGA 4ZBAA 6GSVA 4TOPA 5ID2A 1SL2B 4PNFA 4JEDA 4F0BA 2X64A 2VM1A 4GXZA 3PINA 3QAWA 5DAKB 4PQHA 1K0AA 1X5EA 4MJCA 4GWRA 1T1VA 1TOFA 2B6MA 3UIWA 3TJGA 4MA9A 4AF2A 1GUMA 1J9BA 4X4JA 3IAS2 3ZIVA 3GX8A 4AGSA 4XHMA 3EE2A 3FMWA 5EY6A 1V98A 4V1Ag 3MYDA 3GURA 5J9BA 1ZZYA 4BA7A 5GSSA 1V57A 1XXUA 6GSWA 5IMFA 2V32A 5D9TA 5ECHB 4ML6A 2HSYA 3NIVA 4ILFA 1V2AA 1MEKA 2QGVA 3G9BA 2M72A 4XCSA 3FR6A 4E8HA 3BOAA 2NTOA 3GFKA 4ECJA 3LJRA 3FZ4A 5INYA 3U6VA 4HU9A 4BL7B 1C72A 4DEJA 4MCUA 5HR2A 4K5RA 1KEBA 1GP1A 3TKRA 5KOWA 3G7IA 3WT1A 2E0QA 4XS4B 3LWAA 4MPFA 16GSA 4MJEA 4Q5QA 2DIYA 1F37A 3GNJA 1TJDA 4L0WA 1PN0A 1SK0A 3CSHA 3VPTA 2B7JA 2C8UA 1XBSA 1VF3A 5ID2B 4TVEA 1XWBA 3UVHA 5D93A 3J7Yk 1W4VA 3ME8A 1H75A 1VF2A 4IN0A 3A2WA 4IP6A 3IBHA 2R0PA 1WMJA 1G7OA 1URMA 4NV5A 3MSZA 4K0NA 3HD5A 3UOMA 2OE3A 1PL2A 2LJAA 3PR8A 3L4NA 5DCHA 1Z5YE 5G5FA 3EVIA 3ERGA 2R3XA 1X9MB 3IC8A 2PVQA 4JRRA 3ZL5A 5G31A 4MF5A 4N0VA 3TOUA 4USSA 1HNCA 4HDEA 2H76A 2RM5A 2RIIA 2MBSA 3KMNA 3LSZA 3I69A 1S3AA 2AUVA 2G0FA 2RUFA 3U5RE 3VWXA 2KP1A 3L78A 3QR6A 2XBIA 3ZREA 1YZXA 4Z2TA 3HHVA 1THOA 2F51A 4L5OA 1NSWA 2PPTA 1Y6EA 2H71A 2REMA 5A4UA 2QSIA 4GRFA 3UVTA 4PURA 2E7PA 2LKUA 4PXOA 2HFDA 3GHAA 4MNNA 5CRDA 4H86A 3FK8A 2K8VA 5G1LA 4FIWA 2H1AA 2O85A 22GSA 2H1GA 3LGCA 1KNGA 5EVOA 1SD9A 5KN0A 2NDOA 2AV4A 3TUEA 4KDXA 3PGTA 3IHGA 4K0GA 1EOHA 4HEA2 3I9V2 1TRWA 1SJIA 2V2GA 4WXTA 4EC0A 1O7UA 3ZRDA 4FQUA 3C71A 3W6GA 3FZAA 4EXJA 1ERWA 5LNKe 1BJXA 1F3AA 1TW9A 1ZGNA 2M46A 3H1NA 2X4AA 4O5RA 4IVFA 2FY6A 4E8EA 3HCZA 3O3TA 3TJJA 4PTSA 2GZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4M A;  2IME A;  3IA1 A;  2YNX A;  2VO4 A;  2LRT A;  3GMF A;  1RQM A;  4GSN A;  1JLW A;  5FHI A;  2L57 A;  1LJR A;  2O8V B;  3KGK A;  2CVD A;  3TKS C;  1PX6 A;  3KH7 A;  4ML1 A;  1GNW A;  2H0H A;  2CVB A;  2GGT A;  1THX A;  4BWQ A;  1FHE A;  3P7X A;  5ECI B;  2HT9 A;  3EU4 A;  3WT2 A;  3GST A;  2P5R A;  1YEP A;  3HVX A;  2GSS A;  2JL4 A;  2A2S A;  1UA5 A;  4BPY A;  5COH A;  3OR5 A;  2H73 A;  3H4K A;  2LQO A;  2IL3 A;  4KUN A;  4MZB A;  3VPQ A;  2O7K A;  4XTS A;  1YJ6 A;  3TGZ A;  2H74 A;  1PSQ A;  1E6B A;  1OC9 A;  4F03 A;  2R2J A;  4FYB A;  3KTB A;  4PQ1 A;  3R2Q A;  1BQ7 A;  4V1A p;  3J7Y b;  3G7J A;  1GNE A;  1FVK A;  3KMO A;  1WWJ A;  1TU7 A;  2X8C A;  3RHB A;  5ECL B;  4TR1 B;  2JZR A;  2KHP A;  2J9H A;  2ALB A;  2GDR A;  1OC3 A;  1JZD A;  4WKW A;  2HNL A;  3L0H A;  5JWR B;  6GSS A;  4BVY A;  3ZFL A;  2HZF A;  2IMF A;  3ZTL A;  3GKM A;  5IMC A;  1UN2 A;  3BCK A;  4ZBB A;  5C04 A;  5IMD A;  1Z7R A;  4X1U A;  3IK7 A;  3RPP A;  2LRC A;  4AJ8 A;  5IO2 A;  1PQN A;  4O32 A;  2CX4 A;  1ZMA A;  1X0R A;  3QFA C;  3UL3 A;  2C4J A;  2YN1 A;  3LXT A;  1M7T A;  1J0F A;  2MMZ A;  2H70 A;  4N30 A;  4KB3 A;  3HDC A;  1K0O A;  5G2Z A;  1M99 A;  1XPV A;  2C0G A;  2KOK A;  5HR0 A;  1QMV A;  4OMV A;  3W8J A;  2C3T A;  2FWF A;  4RI7 A;  3G7Y A;  1I5G A;  5G1K A;  2HXK A;  4GF0 A;  4DSS A;  3S9F A;  4LL1 B;  1GRX A;  3FYG A;  2IN3 A;  3RPN A;  3TB2 A;  1XIY A;  1TI1 A;  1CQG A;  3WGD A;  1GUL A;  2VL3 A;  4XS6 A;  3GA4 A;  5CYY A;  1AXD A;  3GUS A;  3KZQ A;  1GSE A;  5DAK A;  2YWN A;  4JZQ A;  2GQM A;  4IHU A;  1OC9 B;  1XWC A;  3CYN A;  4ZB6 A;  2L6D A;  1SD8 A;  4OCF A;  2MMO A;  1V40 A;  2F8A A;  5ECN B;  5ABR A;  3Q74 A;  1TRU A;  4KDY A;  3ERF A;  3DML A;  3VUR A;  2HE3 A;  2LUS A;  3QCP A;  4Q5R A;  3GYK A;  2K9F A;  2OAD A;  2E2M A;  1GLP A;  1FB6 A;  4MH2 A;  4FYC A;  2R6K A;  2FA8 A;  4NPB A;  2C1Y A;  3VFI A;  11GS A;  2E2G A;  5IIZ A;  1ST9 A;  1QGV A;  4POL A;  5AIX A;  3A2V A;  3M0F A;  4FO5 A;  4WBR D;  3D22 A;  4WBJ A;  1I9D A;  1EEJ A;  4MF7 A;  1WJK A;  3EC3 A;  4X43 A;  3P90 A;  1JZR A;  1ZOF A;  3CSJ A;  5GAN D;  4KX4 A;  4MDC A;  2LNS A;  3GRX A;  3IK9 A;  1SJZ A;  5H5S A;  4XS4 A;  2DLX A;  1GLQ A;  4PX1 A;  1UVZ A;  2VLV A;  1A23 A;  1XW6 A;  4G10 A;  1O6J A;  3F4R A;  1K0M A;  5DJL A;  3TRP A;  4K9Z A;  4DSS B;  4JU5 A;  2XHF A;  5GST A;  3DKS A;  3VWV A;  5B6M A;  2OE1 A;  4JR6 A;  5IOX A;  4I8B A;  5ENU A;  3APS A;  2GS3 A;  2R5G A;  1VF4 A;  4LL4 B;  1SL1 B;  1WPI A;  2ZNM A;  4F0C A;  4GSS A;  4O7H A;  1XW5 A;  1SU9 A;  2HSH A;  3VI7 A;  3FZ5 A;  2B3S A;  3HKR A;  4TN8 A;  3APO A;  5GAP D;  1XW9 A;  3DVW A;  3C7M A;  1PRX A;  2GQL A;  2TRX A;  4GQF A;  1T4Z A;  18GS A;  2GZY A;  1TK8 B;  5ELA A;  1K0D A;  2O87 A;  2LJK A;  4YAV A;  2F8F A;  2WRT A;  3WD6 A;  3F4T A;  5LCZ A;  4RQX A;  5IMA A;  1AW9 A;  2YJH A;  3VK9 A;  2C3N A;  1U6T A;  1X9S B;  1TI3 A;  1JFU A;  1A24 A;  2LS5 A;  5D9V A;  3IHQ A;  2JAC A;  1A0R P;  3KXO A;  2VUP A;  1OYJ A;  4MMM A;  1ML6 A;  3K8N A;  1HQO A;  1ON4 A;  1DSB A;  1VRS D;  1U3A A;  4ZL7 A;  3F3R A;  5EPF A;  5HR1 A;  1R7H A;  1XWA A;  2MYG A;  4P3Y B;  4NMU A;  3D0Z A;  1DBY A;  4L8E A;  2YP6 A;  2A4V A;  3UEM A;  4WET A;  1TTZ A;  4ZBD A;  5D9W A;  2WFC A;  3IC4 A;  2YWI A;  1SKW B;  2H8L A;  2O89 A;  3EU3 A;  4KSM A;  3UAP A;  5J3R A;  4G9H A;  2JU5 A;  1JZW A;  5ECR B;  3M3M A;  5CO3 A;  2JSY A;  2VLU A;  1M2A A;  3GKK A;  5G5E A;  3ZVJ A;  2OA7 A;  2VLT A;  2LQQ A;  4TR4 A;  3Q18 A;  3GTU A;  19GS A;  1BG5 A;  2CV4 A;  5JWQ B;  1S3C A;  4MJA A;  4K7O A;  2L5O A;  1GTB A;  2DJ1 A;  1XFL A;  2WZ9 A;  4IBP A;  1T3B A;  4I6X A;  1A2J A;  1GSY A;  2N5F A;  2VAF A;  1F3B A;  4ZXG A;  6GSY A;  1EP7 A;  1ZYE A;  1TRV A;  1N8J A;  4RUV A;  4HQS A;  2CA8 A;  1WIK A;  4XS1 A;  5HR3 A;  2L4C A;  5F05 A;  2K8S A;  5JCG A;  3ZIT A;  4F2I A;  4OD7 A;  4HJM A;  4ID0 A;  4IW9 A;  4PNG A;  1VGL A;  4J56 E;  3QMX A;  5DAL A;  2IMI A;  4PGT A;  2PWJ A;  2CZ2 A;  1DE1 A;  1HNA A;  3HJO A;  4HZ4 A;  4KGI A;  2PMT A;  1PGT A;  1EV4 A;  1AUC A;  1GTA A;  4JR4 A;  3HZ4 A;  1PX7 A;  2N5A A;  2EIQ A;  2FGX A;  3GKX A;  1JLV A;  2LST A;  4GCI A;  3BBY A;  4PUF C;  4LMV A;  2B5Y A;  1BED A;  1GH2 A;  3MDK A;  2KLX A;  2ZUP A;  1Z3E A;  5E4W A;  2EIO A;  4MZC A;  2VL9 A;  4ZL9 A;  5CRE A;  5D96 A;  4IEL A;  3C73 A;  13GS A;  3H93 A;  1XCC A;  2CAQ A;  1OKD A;  4TR1 A;  5IO0 A;  4IJI A;  3GL5 A;  3P2A A;  3WGX A;  4HJ2 A;  6GSX A;  4XRD A;  5IM9 A;  4ACS A;  12GS A;  3QAV A;  5ECK B;  5J41 A;  3DYR A;  3GTU B;  1QXH A;  2CAI A;  3CBU A;  2WB9 A;  5AIS A;  3LOR A;  2HRN A;  4IGJ A;  3ZLP A;  3F4S A;  4QL9 A;  4KND A;  2V6K A;  5CRG A;  3JCM L;  2YWO A;  1B4Q A;  2V1M A;  5AN1 A;  2IMK A;  4N11 A;  2VCQ A;  3FEU A;  4QL7 A;  4DSR A;  4MH3 A;  1B4P A;  1A2L A;  2XPD A;  3DXB A;  2CVK A;  5HFG A;  2BMX A;  5HFI A;  1QQ2 A;  1F6M C;  1ABA A;  3IXR A;  1JHB A;  2GT6 A;  1T4Y A;  5F07 A;  2H0G A;  4N0Z A;  2NPB A;  3KP9 A;  3GKN A;  3P8W A;  1O8W A;  3IDV A;  4ZB8 A;  3V1W A;  3VI5 A;  3MWH A;  4OO4 A;  5A4W A;  5DDL A;  5DQS A;  5DAL B;  2YPM A;  3LYP A;  2ES7 A;  2OJL A;  2DBC A;  2I9H A;  3ZYW A;  3F6D A;  5IQY A;  1OE8 A;  1ERT A;  1B9Y C;  2VIM A;  2DJ2 A;  3GL3 A;  1GSD A;  1O8X A;  2QC7 A;  1VF1 A;  2TIR A;  3ZML A;  2XC2 A;  2JSZ A;  1OVN A;  4F9Z A;  2H66 A;  1NHO A;  1A8Y A;  1USB A;  3ZIJ A;  2HRF A;  1R4W A;  1SKS B;  4NWY A;  3FZ9 A;  1GUH A;  3LFL A;  4V2N A;  2H72 A;  1A0F A;  3TJF A;  5H5R A;  3IR4 A;  3TCO A;  1X5C A;  1XZO A;  3FHK A;  1NW2 A;  4EE0 A;  3C8E A;  4LA1 A;  2VCV A;  1QK8 A;  3W8S A;  1BAY A;  2YWM A;  1EGR A;  2FWE A;  3CTG A;  4NV2 A;  4ZB9 A;  4EVM A;  1BYE A;  2VD1 A;  1EP8 A;  2DC5 A;  4K7I A;  4BVX A;  2DML A;  3FR9 A;  1QFN A;  2GLR A;  20GS A;  1M9A A;  3RHC A;  3FW2 A;  1G7E A;  4WR4 A;  1Q4J A;  2IJY A;  5DCG A;  4J57 E;  3UMA A;  5B6N A;  4YQM A;  2PGT A;  3APQ A;  1Y25 A;  2ON5 A;  3HJM A;  4ULX A;  1ZYQ B;  3TDG A;  5CRH A;  2FLS A;  3LQ7 A;  3KIJ A;  4TKY A;  4IKH A;  4J2F A;  4FH8 A;  1PKW A;  2MZC A;  4POB A;  4HI7 A;  2WS2 A;  4K6X A;  5A5K A;  4DVC A;  1GSQ A;  3EMX A;  3HXS A;  2FNO A;  3ZZX A;  5CP1 A;  3M8N A;  3C1S A;  4ISD A;  4EO3 A;  2H75 A;  4IQ1 A;  2VM2 A;  2LJR A;  3HA9 A;  4ZL8 A;  3RBT A;  3KD0 A;  1YKA A;  2XPE A;  2GVP A;  1PA3 A;  3TKP A;  4TXV A;  2GTU A;  4G2E A;  4JBB A;  17GS A;  5C00 A;  1B48 A;  4NAX A;  1YDK A;  2D2Z A;  4IQA A;  1UC7 A;  1ZCP A;  4YAP A;  3IE3 A;  3GIX A;  5FT3 A;  9GSS A;  3HJP A;  3US3 A;  2YCD A;  1NHY A;  3TJB A;  3KH9 A;  5H5Q A;  1GTU A;  2L5L A;  1GSU A;  4X0X A;  2CZ3 A;  2H19 A;  3F8U A;  2AHE A;  1HD2 A;  1K3Y A;  2CT6 A;  2IPA A;  3IPZ A;  1X5D A;  4Q5N A;  2YJ7 A;  2PU9 C;  4K7N A;  3EIN A;  2RM6 A;  1G0T A;  3NZN A;  3ZMK A;  3CTF A;  2GT5 A;  3D6I A;  4ZIJ A;  5HFK A;  2Z9S A;  4EDY A;  1MDI A;  4V2M A;  1ZL9 A;  3M9J A;  4GLT A;  2R4V A;  1HNB A;  1XWG A;  2FCH A;  1JZO A;  2X99 A;  1TRS A;  2HZE A;  4Z7X A;  4HQZ A;  4OO5 A;  4KSO A;  2F9S A;  4MF6 A;  1G6W A;  1ACV A;  1RK4 A;  2WGR A;  4XIH A;  1FO5 A;  1V9W A;  1GL8 A;  4I2T A;  3NOF A;  3DEX A;  7GSS A;  4KA0 A;  4RI6 A;  3ISO A;  2V6O A;  1QUW A;  2FWH A;  1FG4 A;  5DBQ A;  4OFN A;  2NBS A;  3D21 A;  4XRA A;  2LNT A;  2X8G A;  4OWY A;  2B5E A;  4N10 A;  5ECM B;  2N5B A;  2WDU A;  3A2X A;  5J5N A;  1ERV A;  1ILO A;  4EL1 A;  2GST A;  2K6V A;  4TR3 A;  1KBN A;  2YV9 A;  2H0I A;  2DJK A;  2YV7 A;  10GS A;  3L9V A;  3HVV A;  5E59 A;  2NVL A;  1M2B A;  3CXG A;  2FUG 2;  4WEY A;  2H6Z A;  2GSQ A;  4I5Q A;  1KTE A;  3WYW A;  1O85 A;  3HVS A;  3D5J A;  1F2E A;  1XVQ A;  3LYK A;  3ZVJ D;  4OFM A;  1PMT A;  1SKR B;  1WOU A;  2I1U A;  4HS1 A;  2IFQ A;  5JCU A;  1OE7 A;  1XWK A;  1TP9 A;  4ECI A;  3KEB A;  2DIZ A;  4G19 A;  2YZU A;  1S3D A;  4EUY A;  1FOV A;  4ZIL A;  2B1L A;  2K18 A;  2OE0 A;  1N2A A;  4LMW A;  1YEX A;  2J23 A;  6GST A;  1R5A A;  4WF5 A;  2FHE A;  3D4T A;  2HZE B;  4MJB A;  4TW5 A;  2H6X A;  1M0U A;  1AQX A;  2BJX A;  1AQW A;  3TOT A;  2OBK A;  3F3Q A;  5DJM A;  2VL2 A;  3H8Q A;  5F06 A;  1M9B A;  4CHS A;  2H30 A;  1R26 A;  3CRT A;  4TXO A;  2LTK A;  2JAD A;  1YF0 A;  4WR5 A;  1B9X C;  2DJJ A;  3N5O A;  3QFB C;  2G2Q A;  3GX0 A;  3EYT A;  1SK2 A;  3IV4 A;  2B5X A;  1PKZ A;  1XOB A;  1YQ1 A;  3DIE A;  3WGE A;  4KE3 A;  4RQR A;  1MDK A;  4EKZ A;  3RDW A;  3RAZ A;  3EMP A;  2WCI A;  4PUA A;  2VCT A;  1AAZ A;  2OAC A;  4YQU A;  1LBK A;  3ME7 A;  3KM6 A;  2JZT A;  5LD0 A;  1R5P A;  3O76 A;  4KDU A;  3CRU A;  4KH7 A;  5FWG A;  2XBQ A;  5D73 A;  2PUK C;  2KP2 A;  3DVX A;  3IAM 2;  2I3Y A;  1J08 A;  3PH9 A;  5L71 A;  3FRC A;  3Q6O A;  5JCW A;  3HYP A;  1PD2 1;  2IFQ B;  4IP1 A;  2VCX A;  3AY8 A;  1AC1 A;  5CNW A;  1EZK A;  2ON7 A;  1TXX A;  4KCA A;  3UAR A;  2MMN A;  3N9J A;  3DGQ A;  2BTO T;  2LEG A;  3I6A A;  4L0U A;  2HLS A;  2MMA A;  1K0N A;  2ZCT A;  1U87 A;  4NHW A;  4EDZ A;  1F9M A;  3L9S A;  1MTC A;  3A5W A;  1B8X A;  1K0B A;  2YAN A;  2F3M A;  4K2D A;  5CRW A;  2V41 A;  1CQH A;  4OFT A;  2L6C A;  1FAA A;  2A2R A;  4BWS A;  2X8H A;  3VLN A;  4YQV A;  1SYX A;  4FYU A;  1OAZ A;  1LU4 A;  1BX9 A;  1T7P B;  2B7K A;  3ED3 A;  1AQV A;  2JZS A;  2GSR A;  1EGO A;  4GTU A;  4NHZ A;  4TXO B;  3Q19 A;  3TRX A;  1A2M A;  3VWU A;  1IYI A;  3GSS A;  3HY2 A;  2QKE A;  8GSS A;  3TKS E;  2EIR A;  5F0G A;  4LLR A;  2OKA A;  1YKC A;  2P31 A;  1DE2 A;  3IOS A;  3QOU A;  1T00 A;  3L9U A;  4HUA A;  5KN1 A;  2VCZ A;  2C0E A;  1ERU A;  4PQI A;  2H01 A;  5D8I A;  1EEM A;  2I4A A;  4V2L A;  1GSF A;  2DJ3 A;  3I43 A;  2PN8 A;  2H1D A;  5ELG A;  1PN9 A;  3VWW A;  3C1R A;  1Z6N A;  3DD3 A;  3GH9 A;  1T8E B;  4POM A;  1TDI A;  5ECS A;  2GQK A;  5B8A A;  4OCE A;  5KN3 A;  1FW1 A;  3TKQ A;  5B7C A;  1O73 A;  1AIU A;  3FY7 A;  5J9C A;  2KUC A;  3F0I A;  1H4O A;  2C3Q A;  1SEN A;  3CSI A;  3KJY A;  1X9W B;  5IMV A;  4MAB A;  1GWC A;  3SBC A;  1EV9 A;  1SK1 A;  1HYU A;  2B1K A;  14GS A;  5D9X A;  5CAX A;  1U3I A;  3KP8 A;  4KW6 A;  1DUG A;  2TRC P;  5KN2 A;  2PER A;  2IIY A;  3KTL A;  5B8B A;  5DQY A;  3UBL A;  2C0D A;  1WRY A;  4CDO A;  1E2Y A;  1XVW A;  2PVO C;  2H6Y A;  4QQ7 A;  4ECB A;  5ECO B;  3BJ5 A;  3DWV A;  5AIV A;  2CQ9 A;  3UJ1 A;  1W89 A;  3LEF A;  3ZFB A;  2RUE A;  1FB0 A;  3H79 A;  1XOA A;  1Q98 A;  2LRN A;  1WP0 A;  1Z9H A;  3GN3 A;  1G6Y A;  4EF0 A;  5IOW A;  1U88 A;  5G30 A;  2GZZ A;  5AGY A;  1GUK A;  3SWL A;  2RLI A;  1V58 A;  3TRQ A;  3M1G A;  4IJ3 A;  1SL0 B;  4MK3 A;  4ECC A;  2YOI A;  3IRA A;  1Z6M A;  1FVJ A;  4GQC A;  4WF4 A;  4AJ6 A;  1NM3 A;  3QDN A;  2AAW A;  2OBI A;  2M80 A;  3QPM A;  1MD3 A;  4POK A;  3O6T A;  4MZW A;  2AYT A;  4HOJ A;  2L4Q A;  3F6F A;  3UBK A;  3M9K A;  5J4U A;  4D73 A;  2HYX A;  2FD3 A;  3E9J B;  4K1F A;  1MD4 A;  1IYH A;  4YH2 A;  4L5L A;  4CW9 A;  4I2U A;  4KAE A;  3HZ8 A;  2DMM A;  2WJU A;  3MNG A;  1TU8 A;  2C0F A;  1K3O A;  1GSS A;  1K0C A;  2P5Q A;  3FR3 A;  4DSQ A;  3QD9 A;  3CMI A;  3ERW A;  1YF1 A;  4F82 A;  3LG6 A;  2CX3 A;  2C80 A;  5JWO B;  3E0U A;  2LV3 A;  4KCE A;  5A4V A;  3TKS A;  3A3T A;  3KCM A;  4GST A;  2AB6 A;  2I81 A;  5IMZ A;  4AJ7 A;  2MBT A;  1Z7P A;  1OC8 A;  3MAK A;  4MPG A;  4I97 A;  3GV1 A;  3LXZ A;  1M2D A;  4TRX A;  2IMD A;  5F8B A;  2VD0 A;  2HI7 A;  4MLY A;  1TKD B;  3BD2 A;  2R37 A;  1O81 A;  1RW1 A;  5ECQ B;  1OKT A;  3BCI A;  1PL1 A;  1SYR A;  2L59 A;  2AJQ B;  1SJ6 A;  1YY7 A;  2EC4 A;  2PBJ A;  2VL2 C;  2WUL A;  3EUR A;  2FWG A;  4Q5F A;  1TK0 B;  3QAG A;  3E3E A;  2VCW A;  1MDJ A;  2DJ0 A;  1A8L A;  4IS0 A;  2P0G A;  1WE0 A;  1GTI A;  4O92 A;  4HU7 A;  5KEJ A;  3F9U A;  4HZ2 A;  4JE1 A;  3FKF A;  3GH6 A;  3EWL A;  4D73 B;  5EL8 A;  4K8M A;  4MP4 A;  6GSU A;  4TR0 A;  3TJK A;  4BL7 A;  5DVB A;  5ECP B;  2VOC A;  5IPH A;  2FA4 A;  2YZH A;  3DRN A;  1EWX A;  5GZZ B;  2IWT A;  1TK5 B;  1EOG A;  3F63 A;  2DSA A;  2H1B A;  4NXI A;  5HQP A;  1K3L A;  5IPG A;  4ZBA A;  6GSV A;  4TOP A;  5ID2 A;  1SL2 B;  4PNF A;  4JED A;  4F0B A;  2X64 A;  2VM1 A;  4GXZ A;  3PIN A;  3QAW A;  5DAK B;  4PQH A;  1K0A A;  1X5E A;  4MJC A;  4GWR A;  1T1V A;  1TOF A;  2B6M A;  3UIW A;  3TJG A;  4MA9 A;  4AF2 A;  1GUM A;  1J9B A;  3IAS 2;  3ZIV A;  3GX8 A;  4AGS A;  4XHM A;  3EE2 A;  5EY6 A;  1V98 A;  4V1A g;  3GUR A;  5J9B A;  1ZZY A;  4BA7 A;  5GSS A;  1V57 A;  1XXU A;  6GSW A;  5IMF A;  2V32 A;  5D9T A;  5ECH B;  4ML6 A;  2HSY A;  3NIV A;  4ILF A;  1V2A A;  1MEK A;  2QGV A;  3G9B A;  2M72 A;  4XCS A;  3FR6 A;  4E8H A;  3BOA A;  2NTO A;  3GFK A;  4ECJ A;  3LJR A;  3FZ4 A;  5INY A;  3U6V A;  4HU9 A;  1C72 A;  4DEJ A;  4MCU A;  5HR2 A;  1KEB A;  1GP1 A;  3TKR A;  3G7I A;  3WT1 A;  2E0Q A;  4XS4 B;  3LWA A;  4MPF A;  16GS A;  4MJE A;  4Q5Q A;  2DIY A;  1F37 A;  3GNJ A;  1TJD A;  4L0W A;  1SK0 A;  3CSH A;  3VPT A;  2B7J A;  2C8U A;  1XBS A;  1VF3 A;  5ID2 B;  4TVE A;  1XWB A;  3UVH A;  5D93 A;  3J7Y k;  1W4V A;  3ME8 A;  1H75 A;  1VF2 A;  4IN0 A;  3A2W A;  4IP6 A;  3IBH A;  1WMJ A;  1G7O A;  1URM A;  4NV5 A;  3MSZ A;  4K0N A;  3HD5 A;  3UOM A;  2OE3 A;  1PL2 A;  2LJA A;  3PR8 A;  3L4N A;  5DCH A;  1Z5Y E;  5G5F A;  3EVI A;  3ERG A;  2R3X A;  1X9M B;  2PVQ A;  4JRR A;  3ZL5 A;  5G31 A;  4MF5 A;  4N0V A;  3TOU A;  1HNC A;  4HDE A;  2H76 A;  2RM5 A;  2RII A;  2MBS A;  3KMN A;  3LSZ A;  3I69 A;  1S3A A;  2AUV A;  2G0F A;  2RUF A;  3U5R E;  3VWX A;  2KP1 A;  3L78 A;  3QR6 A;  2XBI A;  3ZRE A;  1YZX A;  3HHV A;  1THO A;  2F51 A;  4L5O A;  1NSW A;  2PPT A;  1Y6E A;  2H71 A;  2REM A;  5A4U A;  2QSI A;  4GRF A;  3UVT A;  4PUR A;  2E7P A;  2LKU A;  4PXO A;  2HFD A;  3GHA A;  5CRD A;  4H86 A;  3FK8 A;  2K8V A;  5G1L A;  4FIW A;  2H1A A;  2O85 A;  22GS A;  2H1G A;  3LGC A;  1KNG A;  5EVO A;  1SD9 A;  5KN0 A;  2NDO A;  2AV4 A;  3TUE A;  4KDX A;  3PGT A;  4K0G A;  1EOH A;  4HEA 2;  3I9V 2;  1TRW A;  1SJI A;  2V2G A;  4WXT A;  4EC0 A;  1O7U A;  3ZRD A;  3C71 A;  3W6G A;  3FZA A;  4EXJ A;  1ERW A;  5LNK e;  1BJX A;  1F3A A;  1TW9 A;  1ZGN A;  2M46 A;  3H1N A;  4O5R A;  4IVF A;  2FY6 A;  4E8E A;  3HCZ A;  3O3T A;  3TJJ A;  2GZP A; 
#chains in the Genus database with same CATH topology
 3D4M A;  2IME A;  3IA1 A;  2YNX A;  2VO4 A;  2LRT A;  3GMF A;  1RQM A;  4GSN A;  1JLW A;  5FHI A;  2L57 A;  1LJR A;  2O8V B;  3KGK A;  2CVD A;  3TKS C;  1PX6 A;  3KH7 A;  4ML1 A;  1GNW A;  4K5S A;  2H0H A;  2CVB A;  2GGT A;  1THX A;  4BWQ A;  1FHE A;  3P7X A;  5ECI B;  2HT9 A;  3EU4 A;  3WT2 A;  3GST A;  2P5R A;  1YEP A;  3HVX A;  2GSS A;  2JL4 A;  2A2S A;  1UA5 A;  4O5Q A;  4BPY A;  5COH A;  3OR5 A;  2H73 A;  3H4K A;  2LQO A;  2IL3 A;  4KUN A;  4MZB A;  3VPQ A;  2O7K A;  4XTS A;  1YJ6 A;  3TGZ A;  2H74 A;  1PSQ A;  1E6B A;  1OC9 A;  4F03 A;  2R2J A;  4FYB A;  3KTB A;  4PQ1 A;  3R2Q A;  1BQ7 A;  4V1A p;  4CY8 A;  3J7Y b;  3G7J A;  1GNE A;  1FVK A;  3KMO A;  1WWJ A;  1TU7 A;  2X8C A;  3RHB A;  5ECL B;  4TR1 B;  2JZR A;  2KHP A;  2J9H A;  2ALB A;  2GDR A;  1OC3 A;  1JZD A;  4WKW A;  2HNL A;  3L0H A;  5JWR B;  6GSS A;  1XG8 A;  4BVY A;  3ZFL A;  2HZF A;  2IMF A;  3ZTL A;  3GKM A;  5IMC A;  1UN2 A;  3BCK A;  4ZBB A;  5BMU A;  5C04 A;  5IMD A;  1Z7R A;  4X1U A;  3IK7 A;  3RPP A;  2LRC A;  4AJ8 A;  5IO2 A;  1PQN A;  4O32 A;  2CX4 A;  1ZMA A;  1X0R A;  3QFA C;  3UL3 A;  2C4J A;  2YN1 A;  3LXT A;  1M7T A;  1J0F A;  2MMZ A;  2H70 A;  2QA1 A;  4N30 A;  4KB3 A;  3HDC A;  1K0O A;  5G2Z A;  1M99 A;  1XPV A;  2C0G A;  2KOK A;  5HR0 A;  1QMV A;  4OMV A;  3W8J A;  2C3T A;  2FWF A;  4RI7 A;  3G7Y A;  4G0L A;  1I5G A;  5G1K A;  2HXK A;  4GF0 A;  4DSS A;  3S9F A;  4LL1 B;  1GRX A;  3FYG A;  2IN3 A;  3RPN A;  3TB2 A;  1XIY A;  1TI1 A;  1CQG A;  3WGD A;  3LW9 A;  1GUL A;  2VL3 A;  4XS6 A;  3GA4 A;  5CYY A;  1AXD A;  3GUS A;  3KZQ A;  1GSE A;  5DAK A;  2YWN A;  4JZQ A;  2GQM A;  4IHU A;  1OC9 B;  1XWC A;  3CYN A;  4ZB6 A;  2L6D A;  1SD8 A;  4OCF A;  2MMO A;  1V40 A;  2F8A A;  5ECN B;  5ABR A;  3Q74 A;  1TRU A;  4KDY A;  3ERF A;  4BIK A;  3DML A;  3VUR A;  2HE3 A;  2LUS A;  3QCP A;  4Q5R A;  3GYK A;  2HRK A;  2K9F A;  4BVY B;  2OAD A;  2E2M A;  1GLP A;  1FB6 A;  4MH2 A;  4FYC A;  2R6K A;  4BVX B;  2FA8 A;  4NPB A;  2C1Y A;  3VFI A;  11GS A;  2E2G A;  5IIZ A;  1ST9 A;  1QGV A;  4POL A;  5AIX A;  3A2V A;  3M0F A;  4FO5 A;  1PFO A;  4WBR D;  1S3R A;  3D22 A;  4WBJ A;  1I9D A;  1EEJ A;  4MF7 A;  1WJK A;  3EC3 A;  4X43 A;  3P90 A;  1JZR A;  1ZOF A;  3CSJ A;  5GAN D;  4KX4 A;  4MDC A;  2LNS A;  3GRX A;  3IK9 A;  1SJZ A;  5H5S A;  4Z2U A;  4XS4 A;  2DLX A;  1GLQ A;  4PX1 A;  1UVZ A;  2VLV A;  1A23 A;  1XW6 A;  4G10 A;  1O6J A;  3F4R A;  1K0M A;  5DJL A;  3TRP A;  4K9Z A;  4DSS B;  4JU5 A;  2XHF A;  5GST A;  3DKS A;  3VWV A;  5B6M A;  2OE1 A;  4JR6 A;  5IOX A;  4I8B A;  5ENU A;  3APS A;  2GS3 A;  2R5G A;  1VF4 A;  4LL4 B;  1SL1 B;  1WPI A;  2ZNM A;  4F0C A;  4GSS A;  4O7H A;  1XW5 A;  1SU9 A;  2HSH A;  3VI7 A;  3FZ5 A;  2B3S A;  3HKR A;  4TN8 A;  3APO A;  5GAP D;  1XW9 A;  3DVW A;  3C7M A;  1PRX A;  2GQL A;  2TRX A;  4GQF A;  1T4Z A;  18GS A;  2GZY A;  1TK8 B;  5ELA A;  1K0D A;  2O87 A;  2LJK A;  4YAV A;  2F8F A;  2WRT A;  3WD6 A;  3F4T A;  5LCZ A;  4RQX A;  5IMA A;  1AW9 A;  2YJH A;  3VK9 A;  2C3N A;  1U6T A;  1X9S B;  1TI3 A;  1JFU A;  1A24 A;  2LS5 A;  5D9V A;  3IHQ A;  2JAC A;  1A0R P;  3KXO A;  2VUP A;  1OYJ A;  4MMM A;  1ML6 A;  3K8N A;  1HQO A;  1ON4 A;  1DSB A;  1M3I A;  1VRS D;  1U3A A;  4ZL7 A;  3F3R A;  5EPF A;  5HR1 A;  2HSM A;  1R7H A;  1XWA A;  2MYG A;  4P3Y B;  4NMU A;  3D0Z A;  1DBY A;  4L8E A;  2YP6 A;  2A4V A;  3UEM A;  4WET A;  1TTZ A;  4ZBD A;  5D9W A;  2WFC A;  1ZYN A;  3IC4 A;  2YWI A;  1SKW B;  2H8L A;  2O89 A;  3EU3 A;  4KSM A;  3UAP A;  5J3R A;  4G9H A;  2JU5 A;  1JZW A;  5ECR B;  3M3M A;  5CO3 A;  2JSY A;  2VLU A;  1M2A A;  4A5P A;  3GKK A;  5G5E A;  3ZVJ A;  2OA7 A;  2VLT A;  2LQQ A;  4TR4 A;  3Q18 A;  3GTU A;  19GS A;  1BG5 A;  2CV4 A;  5JWQ B;  1S3C A;  4MJA A;  4K7O A;  2L5O A;  1GTB A;  2DJ1 A;  1XFL A;  2WZ9 A;  4IBP A;  1T3B A;  4I6X A;  1A2J A;  1GSY A;  2N5F A;  2VAF A;  1F3B A;  4ZXG A;  6GSY A;  2R0C A;  1EP7 A;  1ZYE A;  1TRV A;  1N8J A;  4RUV A;  4HQS A;  2CA8 A;  1WIK A;  4XS1 A;  5HR3 A;  2L4C A;  5F05 A;  2K8S A;  5JCG A;  3ZIT A;  4F2I A;  4OD7 A;  4HJM A;  4ID0 A;  4IW9 A;  4PNG A;  1VGL A;  4J56 E;  3CQF A;  3QMX A;  5DAL A;  2IMI A;  4PGT A;  2PWJ A;  2CZ2 A;  1DE1 A;  1HNA A;  3HJO A;  4HZ4 A;  4KGI A;  2PMT A;  1PGT A;  1EV4 A;  1AUC A;  1GTA A;  2DKI A;  4JR4 A;  3HZ4 A;  1PX7 A;  2N5A A;  2EIQ A;  2FGX A;  3GKX A;  1JLV A;  2A4H A;  2LST A;  4GCI A;  2UZ8 A;  3BBY A;  4PUF C;  4LMV A;  2B5Y A;  1BED A;  1GH2 A;  3MDK A;  2KLX A;  2ZUP A;  1Z3E A;  5E4W A;  2EIO A;  4MZC A;  2VL9 A;  4ZL9 A;  5CRE A;  5D96 A;  4IEL A;  3C73 A;  13GS A;  3H93 A;  1XCC A;  2CAQ A;  1OKD A;  4TR1 A;  5IO0 A;  4IJI A;  3GL5 A;  3P2A A;  3WGX A;  4HJ2 A;  6GSX A;  4XRD A;  5IM9 A;  4ACS A;  12GS A;  3QAV A;  5ECK B;  5J41 A;  3DYR A;  3GTU B;  1QXH A;  2CAI A;  3CBU A;  2WB9 A;  5AIS A;  3LOR A;  2HRN A;  4IGJ A;  3ZLP A;  3F4S A;  4QL9 A;  4KND A;  2V6K A;  5CRG A;  3JCM L;  2YWO A;  1B4Q A;  2V1M A;  5AN1 A;  2IMK A;  4N11 A;  2VCQ A;  3FEU A;  4QL7 A;  4DSR A;  4MH3 A;  1B4P A;  1A2L A;  2XPD A;  3DXB A;  2CVK A;  5HFG A;  2BMX A;  5HFI A;  1QQ2 A;  1F6M C;  1ABA A;  3IXR A;  1JHB A;  2GT6 A;  1T4Y A;  5F07 A;  2H0G A;  4N0Z A;  2NPB A;  3KP9 A;  3GKN A;  3P8W A;  1O8W A;  3IDV A;  4ZB8 A;  3V1W A;  3VI5 A;  3MWH A;  4OO4 A;  5A4W A;  5DDL A;  5DQS A;  5DAL B;  2YPM A;  3LYP A;  2ES7 A;  2OJL A;  2DBC A;  2I9H A;  3ZYW A;  3F6D A;  5IQY A;  1OE8 A;  1ERT A;  1B9Y C;  2VIM A;  2DJ2 A;  3GL3 A;  1GSD A;  1O8X A;  2QC7 A;  1VF1 A;  2TIR A;  3ZML A;  2XC2 A;  2JSZ A;  1OVN A;  4F9Z A;  2H66 A;  1NHO A;  1A8Y A;  1USB A;  3ZIJ A;  2HRF A;  1R4W A;  1SKS B;  4NWY A;  3FZ9 A;  1GUH A;  3LFL A;  4V2N A;  2H72 A;  1A0F A;  3TJF A;  5H5R A;  3IR4 A;  3TCO A;  1X5C A;  1XZO A;  3FHK A;  5BRT A;  1NW2 A;  4EE0 A;  3C8E A;  4LA1 A;  2VCV A;  1QK8 A;  3W8S A;  1BAY A;  2QA2 A;  2YWM A;  1EGR A;  2FWE A;  3CTG A;  4NV2 A;  4ZB9 A;  4EVM A;  1BYE A;  2VD1 A;  1EP8 A;  3EPT A;  2DC5 A;  4K7I A;  4BVX A;  2DML A;  3FR9 A;  1QFN A;  2GLR A;  20GS A;  1M9A A;  3RHC A;  3FW2 A;  3R3E A;  1G7E A;  4WR4 A;  1Q4J A;  2IJY A;  5DCG A;  4J57 E;  3UMA A;  5B6N A;  4YQM A;  2PGT A;  3APQ A;  1Y25 A;  2ON5 A;  3HJM A;  4ULX A;  1ZYQ B;  3TDG A;  5CRH A;  2FLS A;  3LQ7 A;  3KIJ A;  4TKY A;  4IKH A;  4J2F A;  4FH8 A;  1PKW A;  2MZC A;  4POB A;  4HI7 A;  2WS2 A;  5KOX A;  4K6X A;  5A5K A;  4DVC A;  1GSQ A;  3EMX A;  3HXS A;  2FNO A;  3ZZX A;  5CP1 A;  3M8N A;  3C1S A;  4ISD A;  4EO3 A;  2H75 A;  4IQ1 A;  2VM2 A;  2LJR A;  3HA9 A;  4ZL8 A;  3RBT A;  3KD0 A;  4KF9 A;  1YKA A;  4YKF A;  2XPE A;  2GVP A;  1PA3 A;  3TKP A;  4TXV A;  2GTU A;  4G2E A;  4JBB A;  17GS A;  5C00 A;  1B48 A;  4NAX A;  1YDK A;  2D2Z A;  4IQA A;  1UC7 A;  1ZCP A;  4YAP A;  3IE3 A;  3GIX A;  5FT3 A;  9GSS A;  3HJP A;  3US3 A;  2YCD A;  1NHY A;  3TJB A;  3KH9 A;  5H5Q A;  1GTU A;  2L5L A;  4O5U A;  1GSU A;  4X0X A;  2CZ3 A;  2H19 A;  3F8U A;  2AHE A;  1HD2 A;  1K3Y A;  2CT6 A;  2IPA A;  3IPZ A;  1X5D A;  4Q5N A;  2YJ7 A;  2PU9 C;  4K7N A;  3EIN A;  2RM6 A;  1G0T A;  3NZN A;  3ZMK A;  3CTF A;  2GT5 A;  3D6I A;  4ZIJ A;  5HFK A;  2Z9S A;  4EDY A;  1MDI A;  4V2M A;  1ZL9 A;  3M9J A;  4GLT A;  2R4V A;  1HNB A;  1XWG A;  2FCH A;  1JZO A;  2X99 A;  1TRS A;  2HZE A;  4Z7X A;  4HQZ A;  2DKH A;  4OO5 A;  4KSO A;  2F9S A;  4MF6 A;  1G6W A;  1ACV A;  1RK4 A;  2WGR A;  4XIH A;  1FO5 A;  1V9W A;  1GL8 A;  4I2T A;  3NOF A;  3DEX A;  7GSS A;  4KA0 A;  4RI6 A;  3ISO A;  2V6O A;  1QUW A;  2FWH A;  1FG4 A;  5DBQ A;  4OFN A;  2NBS A;  3D21 A;  4XRA A;  2LNT A;  2X8G A;  4OWY A;  2B5E A;  4N10 A;  3PPU A;  5ECM B;  2N5B A;  2WDU A;  3A2X A;  5J5N A;  1ERV A;  1ILO A;  4EL1 A;  2GST A;  2K6V A;  4TR3 A;  1ZYP A;  1KBN A;  2YV9 A;  2H0I A;  2DJK A;  2YV7 A;  10GS A;  3L9V A;  3HVV A;  5E59 A;  2NVL A;  1M2B A;  3CXG A;  2FUG 2;  4WEY A;  2H6Z A;  2GSQ A;  4I5Q A;  1KTE A;  3WYW A;  1O85 A;  3HVS A;  3D5J A;  1F2E A;  1XVQ A;  3LYK A;  3ZVJ D;  4OFM A;  1PMT A;  1SKR B;  1WOU A;  2I1U A;  4HS1 A;  2IFQ A;  5JCU A;  1OE7 A;  1XWK A;  1TP9 A;  4ECI A;  3KEB A;  2DIZ A;  4G19 A;  2YZU A;  1S3D A;  4EUY A;  1FOV A;  4ZIL A;  2B1L A;  2K18 A;  2OE0 A;  1N2A A;  4LMW A;  1YEX A;  4YKG A;  2J23 A;  6GST A;  1R5A A;  4WF5 A;  2FHE A;  3D4T A;  2HZE B;  4MJB A;  4TW5 A;  2H6X A;  1M0U A;  1AQX A;  2BJX A;  1AQW A;  3TOT A;  2OBK A;  3F3Q A;  5DJM A;  2VL2 A;  3H8Q A;  5F06 A;  1M9B A;  4CHS A;  2H30 A;  1R26 A;  4G0K A;  4EIQ A;  3CRT A;  4TXO A;  2LTK A;  2JAD A;  1YF0 A;  4WR5 A;  1B9X C;  2DJJ A;  3N5O A;  3QFB C;  2G2Q A;  3GX0 A;  3EYT A;  1SK2 A;  3IV4 A;  2B5X A;  1PKZ A;  1XOB A;  1YQ1 A;  3DIE A;  3WGE A;  4KE3 A;  4RQR A;  1MDK A;  4EKZ A;  3RDW A;  3RAZ A;  3EMP A;  2WCI A;  3MIX A;  4PUA A;  2VCT A;  1AAZ A;  2OAC A;  4YQU A;  1LBK A;  3ME7 A;  3KM6 A;  4ICY A;  2JZT A;  5LD0 A;  1R5P A;  3O76 A;  4KDU A;  3CRU A;  4KH7 A;  5FWG A;  2XBQ A;  5D73 A;  2PUK C;  2KP2 A;  3DVX A;  3IAM 2;  2I3Y A;  1J08 A;  3PH9 A;  5L71 A;  3FRC A;  3Q6O A;  5JCW A;  3HYP A;  1PD2 1;  2IFQ B;  4IP1 A;  4EIP A;  2VCX A;  3AY8 A;  1AC1 A;  5CNW A;  1EZK A;  2ON7 A;  1TXX A;  4KCA A;  3UAR A;  2MMN A;  3N9J A;  3DGQ A;  2BTO T;  2LEG A;  3I6A A;  4L0U A;  2HLS A;  2MMA A;  1K0N A;  2ZCT A;  1U87 A;  4NHW A;  4EDZ A;  1F9M A;  3L9S A;  1MTC A;  3A5W A;  1B8X A;  1K0B A;  2YAN A;  2F3M A;  4K2D A;  5CRW A;  2V41 A;  1CQH A;  4OFT A;  2L6C A;  1FAA A;  2A2R A;  4BWS A;  2X8H A;  3VLN A;  4YQV A;  1SYX A;  4FYU A;  1OAZ A;  1LU4 A;  1BX9 A;  1T7P B;  2HRA A;  4HSC X;  2B7K A;  3ED3 A;  1AQV A;  2JZS A;  2GSR A;  1EGO A;  4GTU A;  4NHZ A;  4TXO B;  3Q19 A;  3TRX A;  1A2M A;  3VWU A;  1IYI A;  3GSS A;  1FOH A;  3HY2 A;  2QKE A;  8GSS A;  3TKS E;  2EIR A;  5F0G A;  4LLR A;  2OKA A;  1YKC A;  2P31 A;  1DE2 A;  3IOS A;  3QOU A;  1T00 A;  3L9U A;  4HUA A;  5KN1 A;  2VCZ A;  2C0E A;  1ERU A;  4PQI A;  2H01 A;  5D8I A;  1EEM A;  2I4A A;  4V2L A;  1GSF A;  2DJ3 A;  3I43 A;  2PN8 A;  2H1D A;  5ELG A;  1PN9 A;  4CY6 A;  3VWW A;  3C1R A;  1Z6N A;  3DD3 A;  3GH9 A;  1T8E B;  4POM A;  1TDI A;  5ECS A;  2GQK A;  5B8A A;  4OCE A;  5KN3 A;  1FW1 A;  3TKQ A;  5B7C A;  1O73 A;  1AIU A;  3FY7 A;  5J9C A;  2KUC A;  3F0I A;  1H4O A;  2C3Q A;  1SEN A;  3CSI A;  3KJY A;  1X9W B;  5IMV A;  4MAB A;  1GWC A;  4G0I A;  3SBC A;  1EV9 A;  1SK1 A;  1HYU A;  2B1K A;  14GS A;  5D9X A;  5CAX A;  1U3I A;  3KP8 A;  4KW6 A;  1DUG A;  2TRC P;  5KN2 A;  2PER A;  2IIY A;  3KTL A;  5B8B A;  5DQY A;  3UBL A;  2C0D A;  1WRY A;  4CDO A;  1E2Y A;  1XVW A;  2PVO C;  2H6Y A;  4QQ7 A;  4ECB A;  5ECO B;  3BJ5 A;  3DWV A;  5AIV A;  2CQ9 A;  3UJ1 A;  1W89 A;  3LEF A;  3ZFB A;  2RUE A;  1FB0 A;  3H79 A;  1XOA A;  1Q98 A;  2LRN A;  1WP0 A;  1Z9H A;  3GN3 A;  1G6Y A;  4EF0 A;  5IOW A;  1U88 A;  5G30 A;  2GZZ A;  5AGY A;  1GUK A;  3SWL A;  2RLI A;  1V58 A;  3TRQ A;  3M1G A;  4IJ3 A;  1SL0 B;  4MK3 A;  4ECC A;  2YOI A;  3IRA A;  1Z6M A;  2R0G A;  1FVJ A;  4GQC A;  4WF4 A;  4AJ6 A;  1NM3 A;  3QDN A;  2AAW A;  2A2P A;  2M80 A;  2OBI A;  3QPM A;  1MD3 A;  4POK A;  3O6T A;  4MZW A;  2AYT A;  4HOJ A;  2L4Q A;  3F6F A;  3UBK A;  3M9K A;  5J4U A;  4D73 A;  2HYX A;  4Z2R A;  2FD3 A;  3E9J B;  4K1F A;  1MD4 A;  1IYH A;  4YH2 A;  4L5L A;  4CW9 A;  4I2U A;  4KAE A;  3HZ8 A;  2DMM A;  2X49 A;  2WJU A;  3MNG A;  1TU8 A;  2C0F A;  1K3O A;  1GSS A;  1K0C A;  2P5Q A;  3FR3 A;  4DSQ A;  3QD9 A;  3CMI A;  3ERW A;  1YF1 A;  4F82 A;  3LG6 A;  2CX3 A;  2C80 A;  5JWO B;  3E0U A;  2LV3 A;  4KCE A;  5A4V A;  3TKS A;  3A3T A;  3KCM A;  4GST A;  2AB6 A;  2I81 A;  5IMZ A;  4AJ7 A;  2MBT A;  1Z7P A;  1OC8 A;  3MAK A;  4MPG A;  4I97 A;  3GV1 A;  3LXZ A;  1M2D A;  4TRX A;  2IMD A;  5F8B A;  2VD0 A;  2HI7 A;  4MLY A;  1TKD B;  3HVN A;  3BD2 A;  2R37 A;  1O81 A;  1RW1 A;  5ECQ B;  1OKT A;  3BCI A;  1PL1 A;  1SYR A;  2L59 A;  2AJQ B;  1SJ6 A;  1YY7 A;  2EC4 A;  2PBJ A;  2VL2 C;  2WUL A;  3EUR A;  2FWG A;  4Q5F A;  1TK0 B;  3QAG A;  3E3E A;  2VCW A;  1MDJ A;  2DJ0 A;  1A8L A;  4IS0 A;  3A5I A;  2P0G A;  1WE0 A;  1GTI A;  4O92 A;  4HU7 A;  5KEJ A;  3F9U A;  4HZ2 A;  4JE1 A;  3FKF A;  3GH6 A;  3EWL A;  4D73 B;  5EL8 A;  4K8M A;  4MP4 A;  6GSU A;  4TR0 A;  3TJK A;  4BL7 A;  5DVB A;  5ECP B;  2VOC A;  5IPH A;  2FA4 A;  4K2X A;  2YZH A;  3DRN A;  1EWX A;  5GZZ B;  2IWT A;  1TK5 B;  1EOG A;  3F63 A;  2DSA A;  2H1B A;  4NXI A;  5HQP A;  1K3L A;  5IPG A;  4ZBA A;  6GSV A;  4TOP A;  5ID2 A;  1SL2 B;  4PNF A;  4JED A;  4F0B A;  2X64 A;  2VM1 A;  4GXZ A;  3PIN A;  3QAW A;  5DAK B;  4PQH A;  1K0A A;  1X5E A;  4MJC A;  4GWR A;  1T1V A;  1TOF A;  2B6M A;  3UIW A;  3TJG A;  4MA9 A;  4AF2 A;  1GUM A;  1J9B A;  4X4J A;  3IAS 2;  3ZIV A;  3GX8 A;  4AGS A;  4XHM A;  3EE2 A;  3FMW A;  5EY6 A;  1V98 A;  4V1A g;  3MYD A;  3GUR A;  5J9B A;  1ZZY A;  4BA7 A;  5GSS A;  1V57 A;  1XXU A;  6GSW A;  5IMF A;  2V32 A;  5D9T A;  5ECH B;  4ML6 A;  2HSY A;  3NIV A;  4ILF A;  1V2A A;  1MEK A;  2QGV A;  3G9B A;  2M72 A;  4XCS A;  3FR6 A;  4E8H A;  3BOA A;  2NTO A;  3GFK A;  4ECJ A;  3LJR A;  3FZ4 A;  5INY A;  3U6V A;  4HU9 A;  4BL7 B;  1C72 A;  4DEJ A;  4MCU A;  5HR2 A;  4K5R A;  1KEB A;  1GP1 A;  3TKR A;  5KOW A;  3G7I A;  3WT1 A;  2E0Q A;  4XS4 B;  3LWA A;  4MPF A;  16GS A;  4MJE A;  4Q5Q A;  2DIY A;  1F37 A;  3GNJ A;  1TJD A;  4L0W A;  1PN0 A;  1SK0 A;  3CSH A;  3VPT A;  2B7J A;  2C8U A;  1XBS A;  1VF3 A;  5ID2 B;  4TVE A;  1XWB A;  3UVH A;  5D93 A;  3J7Y k;  1W4V A;  3ME8 A;  1H75 A;  1VF2 A;  4IN0 A;  3A2W A;  4IP6 A;  3IBH A;  2R0P A;  1WMJ A;  1G7O A;  1URM A;  4NV5 A;  3MSZ A;  4K0N A;  3HD5 A;  3UOM A;  2OE3 A;  1PL2 A;  2LJA A;  3PR8 A;  3L4N A;  5DCH A;  1Z5Y E;  5G5F A;  3EVI A;  3ERG A;  2R3X A;  1X9M B;  3IC8 A;  2PVQ A;  4JRR A;  3ZL5 A;  5G31 A;  4MF5 A;  4N0V A;  3TOU A;  4USS A;  1HNC A;  4HDE A;  2H76 A;  2RM5 A;  2RII A;  2MBS A;  3KMN A;  3LSZ A;  3I69 A;  1S3A A;  2AUV A;  2G0F A;  2RUF A;  3U5R E;  3VWX A;  2KP1 A;  3L78 A;  3QR6 A;  2XBI A;  3ZRE A;  1YZX A;  4Z2T A;  3HHV A;  1THO A;  2F51 A;  4L5O A;  1NSW A;  2PPT A;  1Y6E A;  2H71 A;  2REM A;  5A4U A;  2QSI A;  4GRF A;  3UVT A;  4PUR A;  2E7P A;  2LKU A;  4PXO A;  2HFD A;  3GHA A;  4MNN A;  5CRD A;  4H86 A;  3FK8 A;  2K8V A;  5G1L A;  4FIW A;  2H1A A;  2O85 A;  22GS A;  2H1G A;  3LGC A;  1KNG A;  5EVO A;  1SD9 A;  5KN0 A;  2NDO A;  2AV4 A;  3TUE A;  4KDX A;  3PGT A;  3IHG A;  4K0G A;  1EOH A;  4HEA 2;  3I9V 2;  1TRW A;  1SJI A;  2V2G A;  4WXT A;  4EC0 A;  1O7U A;  3ZRD A;  4FQU A;  3C71 A;  3W6G A;  3FZA A;  4EXJ A;  1ERW A;  5LNK e;  1BJX A;  1F3A A;  1TW9 A;  1ZGN A;  2M46 A;  3H1N A;  2X4A A;  1M3J A;  4O5R A;  4IVF A;  2FY6 A;  4E8E A;  3HCZ A;  3O3T A;  3TJJ A;  4PTS A;  2GZP A; 
#chains in the Genus database with same CATH homology
 3D4M A;  2IME A;  3IA1 A;  2YNX A;  2VO4 A;  2LRT A;  3GMF A;  1RQM A;  4GSN A;  1JLW A;  5FHI A;  2L57 A;  1LJR A;  2O8V B;  3KGK A;  2CVD A;  3TKS C;  1PX6 A;  3KH7 A;  4ML1 A;  1GNW A;  4K5S A;  2H0H A;  2CVB A;  2GGT A;  1THX A;  4BWQ A;  1FHE A;  3P7X A;  5ECI B;  2HT9 A;  3EU4 A;  3WT2 A;  3GST A;  2P5R A;  1YEP A;  3HVX A;  2GSS A;  2JL4 A;  2A2S A;  1UA5 A;  4O5Q A;  4BPY A;  5COH A;  3OR5 A;  2H73 A;  3H4K A;  2LQO A;  2IL3 A;  4KUN A;  4MZB A;  3VPQ A;  2O7K A;  4XTS A;  1YJ6 A;  3TGZ A;  2H74 A;  1PSQ A;  1E6B A;  1OC9 A;  4F03 A;  2R2J A;  4FYB A;  3KTB A;  4PQ1 A;  3R2Q A;  1BQ7 A;  4V1A p;  4CY8 A;  3J7Y b;  3G7J A;  1GNE A;  1FVK A;  3KMO A;  1WWJ A;  1TU7 A;  2X8C A;  3RHB A;  5ECL B;  4TR1 B;  2JZR A;  2KHP A;  2J9H A;  2ALB A;  2GDR A;  1OC3 A;  1JZD A;  4WKW A;  2HNL A;  3L0H A;  5JWR B;  6GSS A;  4BVY A;  3ZFL A;  2HZF A;  2IMF A;  3ZTL A;  3GKM A;  5IMC A;  1UN2 A;  3BCK A;  4ZBB A;  5BMU A;  5C04 A;  5IMD A;  1Z7R A;  4X1U A;  3IK7 A;  3RPP A;  2LRC A;  4AJ8 A;  5IO2 A;  1PQN A;  4O32 A;  2CX4 A;  1ZMA A;  1X0R A;  3QFA C;  3UL3 A;  2C4J A;  2YN1 A;  3LXT A;  1M7T A;  1J0F A;  2MMZ A;  2H70 A;  2QA1 A;  4N30 A;  4KB3 A;  3HDC A;  1K0O A;  5G2Z A;  1M99 A;  1XPV A;  2C0G A;  2KOK A;  5HR0 A;  1QMV A;  4OMV A;  3W8J A;  2C3T A;  2FWF A;  4RI7 A;  3G7Y A;  4G0L A;  1I5G A;  5G1K A;  2HXK A;  4GF0 A;  4DSS A;  3S9F A;  4LL1 B;  1GRX A;  3FYG A;  2IN3 A;  3RPN A;  3TB2 A;  1XIY A;  1TI1 A;  1CQG A;  3WGD A;  3LW9 A;  1GUL A;  2VL3 A;  4XS6 A;  3GA4 A;  5CYY A;  1AXD A;  3GUS A;  3KZQ A;  1GSE A;  5DAK A;  2YWN A;  4JZQ A;  2GQM A;  4IHU A;  1OC9 B;  1XWC A;  3CYN A;  4ZB6 A;  2L6D A;  1SD8 A;  4OCF A;  2MMO A;  1V40 A;  2F8A A;  5ECN B;  5ABR A;  3Q74 A;  1TRU A;  4KDY A;  3ERF A;  3DML A;  3VUR A;  2HE3 A;  2LUS A;  3QCP A;  4Q5R A;  3GYK A;  2HRK A;  2K9F A;  4BVY B;  2OAD A;  2E2M A;  1GLP A;  1FB6 A;  4MH2 A;  4FYC A;  2R6K A;  4BVX B;  2FA8 A;  4NPB A;  2C1Y A;  3VFI A;  11GS A;  2E2G A;  5IIZ A;  1ST9 A;  1QGV A;  4POL A;  5AIX A;  3A2V A;  3M0F A;  4FO5 A;  4WBR D;  3D22 A;  4WBJ A;  1I9D A;  1EEJ A;  4MF7 A;  1WJK A;  3EC3 A;  4X43 A;  3P90 A;  1JZR A;  1ZOF A;  3CSJ A;  5GAN D;  4KX4 A;  4MDC A;  2LNS A;  3GRX A;  3IK9 A;  1SJZ A;  5H5S A;  4Z2U A;  4XS4 A;  2DLX A;  1GLQ A;  4PX1 A;  1UVZ A;  2VLV A;  1A23 A;  1XW6 A;  4G10 A;  1O6J A;  3F4R A;  1K0M A;  5DJL A;  3TRP A;  4K9Z A;  4DSS B;  4JU5 A;  2XHF A;  5GST A;  3DKS A;  3VWV A;  5B6M A;  2OE1 A;  4JR6 A;  5IOX A;  4I8B A;  5ENU A;  3APS A;  2GS3 A;  2R5G A;  1VF4 A;  4LL4 B;  1SL1 B;  1WPI A;  2ZNM A;  4F0C A;  4GSS A;  4O7H A;  1XW5 A;  1SU9 A;  2HSH A;  3VI7 A;  3FZ5 A;  2B3S A;  3HKR A;  4TN8 A;  3APO A;  5GAP D;  1XW9 A;  3DVW A;  3C7M A;  1PRX A;  2GQL A;  2TRX A;  4GQF A;  1T4Z A;  18GS A;  2GZY A;  1TK8 B;  5ELA A;  1K0D A;  2O87 A;  2LJK A;  4YAV A;  2F8F A;  2WRT A;  3WD6 A;  3F4T A;  5LCZ A;  4RQX A;  5IMA A;  1AW9 A;  2YJH A;  3VK9 A;  2C3N A;  1U6T A;  1X9S B;  1TI3 A;  1JFU A;  1A24 A;  2LS5 A;  5D9V A;  3IHQ A;  2JAC A;  1A0R P;  3KXO A;  2VUP A;  1OYJ A;  4MMM A;  1ML6 A;  3K8N A;  1HQO A;  1ON4 A;  1DSB A;  1VRS D;  1U3A A;  4ZL7 A;  3F3R A;  5EPF A;  5HR1 A;  2HSM A;  1R7H A;  1XWA A;  2MYG A;  4P3Y B;  4NMU A;  3D0Z A;  1DBY A;  4L8E A;  2YP6 A;  2A4V A;  3UEM A;  4WET A;  1TTZ A;  4ZBD A;  5D9W A;  2WFC A;  1ZYN A;  3IC4 A;  2YWI A;  1SKW B;  2H8L A;  2O89 A;  3EU3 A;  4KSM A;  3UAP A;  5J3R A;  4G9H A;  2JU5 A;  1JZW A;  5ECR B;  3M3M A;  5CO3 A;  2JSY A;  2VLU A;  1M2A A;  4A5P A;  3GKK A;  5G5E A;  3ZVJ A;  2OA7 A;  2VLT A;  2LQQ A;  4TR4 A;  3Q18 A;  3GTU A;  19GS A;  1BG5 A;  2CV4 A;  5JWQ B;  1S3C A;  4MJA A;  4K7O A;  2L5O A;  1GTB A;  2DJ1 A;  1XFL A;  2WZ9 A;  4IBP A;  1T3B A;  4I6X A;  1A2J A;  1GSY A;  2N5F A;  2VAF A;  1F3B A;  4ZXG A;  6GSY A;  2R0C A;  1EP7 A;  1ZYE A;  1TRV A;  1N8J A;  4RUV A;  4HQS A;  2CA8 A;  1WIK A;  4XS1 A;  5HR3 A;  2L4C A;  5F05 A;  2K8S A;  5JCG A;  3ZIT A;  4F2I A;  4OD7 A;  4HJM A;  4ID0 A;  4IW9 A;  4PNG A;  1VGL A;  4J56 E;  3QMX A;  5DAL A;  2IMI A;  4PGT A;  2PWJ A;  2CZ2 A;  1DE1 A;  1HNA A;  3HJO A;  4HZ4 A;  4KGI A;  2PMT A;  1PGT A;  1EV4 A;  1AUC A;  1GTA A;  2DKI A;  4JR4 A;  3HZ4 A;  1PX7 A;  2N5A A;  2EIQ A;  2FGX A;  3GKX A;  1JLV A;  2A4H A;  2LST A;  4GCI A;  2UZ8 A;  3BBY A;  4PUF C;  4LMV A;  2B5Y A;  1BED A;  1GH2 A;  3MDK A;  2KLX A;  2ZUP A;  1Z3E A;  5E4W A;  2EIO A;  4MZC A;  2VL9 A;  4ZL9 A;  5CRE A;  5D96 A;  4IEL A;  3C73 A;  13GS A;  3H93 A;  1XCC A;  2CAQ A;  1OKD A;  4TR1 A;  5IO0 A;  4IJI A;  3GL5 A;  3P2A A;  3WGX A;  4HJ2 A;  6GSX A;  4XRD A;  5IM9 A;  4ACS A;  12GS A;  3QAV A;  5ECK B;  5J41 A;  3DYR A;  3GTU B;  1QXH A;  2CAI A;  3CBU A;  2WB9 A;  5AIS A;  3LOR A;  2HRN A;  4IGJ A;  3ZLP A;  3F4S A;  4QL9 A;  4KND A;  2V6K A;  5CRG A;  3JCM L;  2YWO A;  1B4Q A;  2V1M A;  5AN1 A;  2IMK A;  4N11 A;  2VCQ A;  3FEU A;  4QL7 A;  4DSR A;  4MH3 A;  1B4P A;  1A2L A;  2XPD A;  3DXB A;  2CVK A;  5HFG A;  2BMX A;  5HFI A;  1QQ2 A;  1F6M C;  1ABA A;  3IXR A;  1JHB A;  2GT6 A;  1T4Y A;  5F07 A;  2H0G A;  4N0Z A;  2NPB A;  3KP9 A;  3GKN A;  3P8W A;  1O8W A;  3IDV A;  4ZB8 A;  3V1W A;  3VI5 A;  3MWH A;  4OO4 A;  5A4W A;  5DDL A;  5DQS A;  5DAL B;  2YPM A;  3LYP A;  2ES7 A;  2OJL A;  2DBC A;  2I9H A;  3ZYW A;  3F6D A;  5IQY A;  1OE8 A;  1ERT A;  1B9Y C;  2VIM A;  2DJ2 A;  3GL3 A;  1GSD A;  1O8X A;  2QC7 A;  1VF1 A;  2TIR A;  3ZML A;  2XC2 A;  2JSZ A;  1OVN A;  4F9Z A;  2H66 A;  1NHO A;  1A8Y A;  1USB A;  3ZIJ A;  2HRF A;  1R4W A;  1SKS B;  4NWY A;  3FZ9 A;  1GUH A;  3LFL A;  4V2N A;  2H72 A;  1A0F A;  3TJF A;  5H5R A;  3IR4 A;  3TCO A;  1X5C A;  1XZO A;  3FHK A;  5BRT A;  1NW2 A;  4EE0 A;  3C8E A;  4LA1 A;  2VCV A;  1QK8 A;  3W8S A;  1BAY A;  2QA2 A;  2YWM A;  1EGR A;  2FWE A;  3CTG A;  4NV2 A;  4ZB9 A;  4EVM A;  1BYE A;  2VD1 A;  1EP8 A;  3EPT A;  2DC5 A;  4K7I A;  4BVX A;  2DML A;  3FR9 A;  1QFN A;  2GLR A;  20GS A;  1M9A A;  3RHC A;  3FW2 A;  3R3E A;  1G7E A;  4WR4 A;  1Q4J A;  2IJY A;  5DCG A;  4J57 E;  3UMA A;  5B6N A;  4YQM A;  2PGT A;  3APQ A;  1Y25 A;  2ON5 A;  3HJM A;  4ULX A;  1ZYQ B;  3TDG A;  5CRH A;  2FLS A;  3LQ7 A;  3KIJ A;  4TKY A;  4IKH A;  4J2F A;  4FH8 A;  1PKW A;  2MZC A;  4POB A;  4HI7 A;  2WS2 A;  5KOX A;  4K6X A;  5A5K A;  4DVC A;  1GSQ A;  3EMX A;  3HXS A;  2FNO A;  3ZZX A;  5CP1 A;  3M8N A;  3C1S A;  4ISD A;  4EO3 A;  2H75 A;  4IQ1 A;  2VM2 A;  2LJR A;  3HA9 A;  4ZL8 A;  3RBT A;  3KD0 A;  4KF9 A;  1YKA A;  4YKF A;  2XPE A;  2GVP A;  1PA3 A;  3TKP A;  4TXV A;  2GTU A;  4G2E A;  4JBB A;  17GS A;  5C00 A;  1B48 A;  4NAX A;  1YDK A;  2D2Z A;  4IQA A;  1UC7 A;  1ZCP A;  4YAP A;  3IE3 A;  3GIX A;  5FT3 A;  9GSS A;  3HJP A;  3US3 A;  2YCD A;  1NHY A;  3TJB A;  3KH9 A;  5H5Q A;  1GTU A;  2L5L A;  4O5U A;  1GSU A;  4X0X A;  2CZ3 A;  2H19 A;  3F8U A;  2AHE A;  1HD2 A;  1K3Y A;  2CT6 A;  2IPA A;  3IPZ A;  1X5D A;  4Q5N A;  2YJ7 A;  2PU9 C;  4K7N A;  3EIN A;  2RM6 A;  1G0T A;  3NZN A;  3ZMK A;  3CTF A;  2GT5 A;  3D6I A;  4ZIJ A;  5HFK A;  2Z9S A;  4EDY A;  1MDI A;  4V2M A;  1ZL9 A;  3M9J A;  4GLT A;  2R4V A;  1HNB A;  1XWG A;  2FCH A;  1JZO A;  2X99 A;  1TRS A;  2HZE A;  4Z7X A;  4HQZ A;  2DKH A;  4OO5 A;  4KSO A;  2F9S A;  4MF6 A;  1G6W A;  1ACV A;  1RK4 A;  2WGR A;  4XIH A;  1FO5 A;  1V9W A;  1GL8 A;  4I2T A;  3NOF A;  3DEX A;  7GSS A;  4KA0 A;  4RI6 A;  3ISO A;  2V6O A;  1QUW A;  2FWH A;  1FG4 A;  5DBQ A;  4OFN A;  2NBS A;  3D21 A;  4XRA A;  2LNT A;  2X8G A;  4OWY A;  2B5E A;  4N10 A;  3PPU A;  5ECM B;  2N5B A;  2WDU A;  3A2X A;  5J5N A;  1ERV A;  1ILO A;  4EL1 A;  2GST A;  2K6V A;  4TR3 A;  1ZYP A;  1KBN A;  2YV9 A;  2H0I A;  2DJK A;  2YV7 A;  10GS A;  3L9V A;  3HVV A;  5E59 A;  2NVL A;  1M2B A;  3CXG A;  2FUG 2;  4WEY A;  2H6Z A;  2GSQ A;  4I5Q A;  1KTE A;  3WYW A;  1O85 A;  3HVS A;  3D5J A;  1F2E A;  1XVQ A;  3LYK A;  3ZVJ D;  4OFM A;  1PMT A;  1SKR B;  1WOU A;  2I1U A;  4HS1 A;  2IFQ A;  5JCU A;  1OE7 A;  1XWK A;  1TP9 A;  4ECI A;  3KEB A;  2DIZ A;  4G19 A;  2YZU A;  1S3D A;  4EUY A;  1FOV A;  4ZIL A;  2B1L A;  2K18 A;  2OE0 A;  1N2A A;  4LMW A;  1YEX A;  4YKG A;  2J23 A;  6GST A;  1R5A A;  4WF5 A;  2FHE A;  3D4T A;  2HZE B;  4MJB A;  4TW5 A;  2H6X A;  1M0U A;  1AQX A;  2BJX A;  1AQW A;  3TOT A;  2OBK A;  3F3Q A;  5DJM A;  2VL2 A;  3H8Q A;  5F06 A;  1M9B A;  4CHS A;  2H30 A;  1R26 A;  4G0K A;  4EIQ A;  3CRT A;  4TXO A;  2LTK A;  2JAD A;  1YF0 A;  4WR5 A;  1B9X C;  2DJJ A;  3N5O A;  3QFB C;  2G2Q A;  3GX0 A;  3EYT A;  1SK2 A;  3IV4 A;  2B5X A;  1PKZ A;  1XOB A;  1YQ1 A;  3DIE A;  3WGE A;  4KE3 A;  4RQR A;  1MDK A;  4EKZ A;  3RDW A;  3RAZ A;  3EMP A;  2WCI A;  3MIX A;  4PUA A;  2VCT A;  1AAZ A;  2OAC A;  4YQU A;  1LBK A;  3ME7 A;  3KM6 A;  4ICY A;  2JZT A;  5LD0 A;  1R5P A;  3O76 A;  4KDU A;  3CRU A;  4KH7 A;  5FWG A;  2XBQ A;  5D73 A;  2PUK C;  2KP2 A;  3DVX A;  3IAM 2;  2I3Y A;  1J08 A;  3PH9 A;  5L71 A;  3FRC A;  3Q6O A;  5JCW A;  3HYP A;  1PD2 1;  2IFQ B;  4IP1 A;  4EIP A;  2VCX A;  3AY8 A;  1AC1 A;  5CNW A;  1EZK A;  2ON7 A;  1TXX A;  4KCA A;  3UAR A;  2MMN A;  3N9J A;  3DGQ A;  2BTO T;  2LEG A;  3I6A A;  4L0U A;  2HLS A;  2MMA A;  1K0N A;  2ZCT A;  1U87 A;  4NHW A;  4EDZ A;  1F9M A;  3L9S A;  1MTC A;  3A5W A;  1B8X A;  1K0B A;  2YAN A;  2F3M A;  4K2D A;  5CRW A;  2V41 A;  1CQH A;  4OFT A;  2L6C A;  1FAA A;  2A2R A;  4BWS A;  2X8H A;  3VLN A;  4YQV A;  1SYX A;  4FYU A;  1OAZ A;  1LU4 A;  1BX9 A;  1T7P B;  2HRA A;  2B7K A;  3ED3 A;  1AQV A;  2JZS A;  2GSR A;  1EGO A;  4GTU A;  4NHZ A;  4TXO B;  3Q19 A;  3TRX A;  1A2M A;  3VWU A;  1IYI A;  3GSS A;  1FOH A;  3HY2 A;  2QKE A;  8GSS A;  3TKS E;  2EIR A;  5F0G A;  4LLR A;  2OKA A;  1YKC A;  2P31 A;  1DE2 A;  3IOS A;  3QOU A;  1T00 A;  3L9U A;  4HUA A;  5KN1 A;  2VCZ A;  2C0E A;  1ERU A;  4PQI A;  2H01 A;  5D8I A;  1EEM A;  2I4A A;  4V2L A;  1GSF A;  2DJ3 A;  3I43 A;  2PN8 A;  2H1D A;  5ELG A;  1PN9 A;  4CY6 A;  3VWW A;  3C1R A;  1Z6N A;  3DD3 A;  3GH9 A;  1T8E B;  4POM A;  1TDI A;  5ECS A;  2GQK A;  5B8A A;  4OCE A;  5KN3 A;  1FW1 A;  3TKQ A;  5B7C A;  1O73 A;  1AIU A;  3FY7 A;  5J9C A;  2KUC A;  3F0I A;  1H4O A;  2C3Q A;  1SEN A;  3CSI A;  3KJY A;  1X9W B;  5IMV A;  4MAB A;  1GWC A;  4G0I A;  3SBC A;  1EV9 A;  1SK1 A;  1HYU A;  2B1K A;  14GS A;  5D9X A;  5CAX A;  1U3I A;  3KP8 A;  4KW6 A;  1DUG A;  2TRC P;  5KN2 A;  2PER A;  2IIY A;  3KTL A;  5B8B A;  5DQY A;  3UBL A;  2C0D A;  1WRY A;  4CDO A;  1E2Y A;  1XVW A;  2PVO C;  2H6Y A;  4QQ7 A;  4ECB A;  5ECO B;  3BJ5 A;  3DWV A;  5AIV A;  2CQ9 A;  3UJ1 A;  1W89 A;  3LEF A;  3ZFB A;  2RUE A;  1FB0 A;  3H79 A;  1XOA A;  1Q98 A;  2LRN A;  1WP0 A;  1Z9H A;  3GN3 A;  1G6Y A;  4EF0 A;  5IOW A;  1U88 A;  5G30 A;  2GZZ A;  5AGY A;  1GUK A;  3SWL A;  2RLI A;  1V58 A;  3TRQ A;  3M1G A;  4IJ3 A;  1SL0 B;  4MK3 A;  4ECC A;  2YOI A;  3IRA A;  1Z6M A;  2R0G A;  1FVJ A;  4GQC A;  4WF4 A;  4AJ6 A;  1NM3 A;  3QDN A;  2AAW A;  2A2P A;  2M80 A;  2OBI A;  3QPM A;  1MD3 A;  4POK A;  3O6T A;  4MZW A;  2AYT A;  4HOJ A;  2L4Q A;  3F6F A;  3UBK A;  3M9K A;  5J4U A;  4D73 A;  2HYX A;  4Z2R A;  2FD3 A;  3E9J B;  4K1F A;  1MD4 A;  1IYH A;  4YH2 A;  4L5L A;  4CW9 A;  4I2U A;  4KAE A;  3HZ8 A;  2DMM A;  2X49 A;  2WJU A;  3MNG A;  1TU8 A;  2C0F A;  1K3O A;  1GSS A;  1K0C A;  2P5Q A;  3FR3 A;  4DSQ A;  3QD9 A;  3CMI A;  3ERW A;  1YF1 A;  4F82 A;  3LG6 A;  2CX3 A;  2C80 A;  5JWO B;  3E0U A;  2LV3 A;  4KCE A;  5A4V A;  3TKS A;  3A3T A;  3KCM A;  4GST A;  2AB6 A;  2I81 A;  5IMZ A;  4AJ7 A;  2MBT A;  1Z7P A;  1OC8 A;  3MAK A;  4MPG A;  4I97 A;  3GV1 A;  3LXZ A;  1M2D A;  4TRX A;  2IMD A;  5F8B A;  2VD0 A;  2HI7 A;  4MLY A;  1TKD B;  3BD2 A;  2R37 A;  1O81 A;  1RW1 A;  5ECQ B;  1OKT A;  3BCI A;  1PL1 A;  1SYR A;  2L59 A;  2AJQ B;  1SJ6 A;  1YY7 A;  2EC4 A;  2PBJ A;  2VL2 C;  2WUL A;  3EUR A;  2FWG A;  4Q5F A;  1TK0 B;  3QAG A;  3E3E A;  2VCW A;  1MDJ A;  2DJ0 A;  1A8L A;  4IS0 A;  3A5I A;  2P0G A;  1WE0 A;  1GTI A;  4O92 A;  4HU7 A;  5KEJ A;  3F9U A;  4HZ2 A;  4JE1 A;  3FKF A;  3GH6 A;  3EWL A;  4D73 B;  5EL8 A;  4K8M A;  4MP4 A;  6GSU A;  4TR0 A;  3TJK A;  4BL7 A;  5DVB A;  5ECP B;  2VOC A;  5IPH A;  2FA4 A;  4K2X A;  2YZH A;  3DRN A;  1EWX A;  5GZZ B;  2IWT A;  1TK5 B;  1EOG A;  3F63 A;  2DSA A;  2H1B A;  4NXI A;  5HQP A;  1K3L A;  5IPG A;  4ZBA A;  6GSV A;  4TOP A;  5ID2 A;  1SL2 B;  4PNF A;  4JED A;  4F0B A;  2X64 A;  2VM1 A;  4GXZ A;  3PIN A;  3QAW A;  5DAK B;  4PQH A;  1K0A A;  1X5E A;  4MJC A;  4GWR A;  1T1V A;  1TOF A;  2B6M A;  3UIW A;  3TJG A;  4MA9 A;  4AF2 A;  1GUM A;  1J9B A;  4X4J A;  3IAS 2;  3ZIV A;  3GX8 A;  4AGS A;  4XHM A;  3EE2 A;  3FMW A;  5EY6 A;  1V98 A;  4V1A g;  3MYD A;  3GUR A;  5J9B A;  1ZZY A;  4BA7 A;  5GSS A;  1V57 A;  1XXU A;  6GSW A;  5IMF A;  2V32 A;  5D9T A;  5ECH B;  4ML6 A;  2HSY A;  3NIV A;  4ILF A;  1V2A A;  1MEK A;  2QGV A;  3G9B A;  2M72 A;  4XCS A;  3FR6 A;  4E8H A;  3BOA A;  2NTO A;  3GFK A;  4ECJ A;  3LJR A;  3FZ4 A;  5INY A;  3U6V A;  4HU9 A;  4BL7 B;  1C72 A;  4DEJ A;  4MCU A;  5HR2 A;  4K5R A;  1KEB A;  1GP1 A;  3TKR A;  5KOW A;  3G7I A;  3WT1 A;  2E0Q A;  4XS4 B;  3LWA A;  4MPF A;  16GS A;  4MJE A;  4Q5Q A;  2DIY A;  1F37 A;  3GNJ A;  1TJD A;  4L0W A;  1PN0 A;  1SK0 A;  3CSH A;  3VPT A;  2B7J A;  2C8U A;  1XBS A;  1VF3 A;  5ID2 B;  4TVE A;  1XWB A;  3UVH A;  5D93 A;  3J7Y k;  1W4V A;  3ME8 A;  1H75 A;  1VF2 A;  4IN0 A;  3A2W A;  4IP6 A;  3IBH A;  2R0P A;  1WMJ A;  1G7O A;  1URM A;  4NV5 A;  3MSZ A;  4K0N A;  3HD5 A;  3UOM A;  2OE3 A;  1PL2 A;  2LJA A;  3PR8 A;  3L4N A;  5DCH A;  1Z5Y E;  5G5F A;  3EVI A;  3ERG A;  2R3X A;  1X9M B;  3IC8 A;  2PVQ A;  4JRR A;  3ZL5 A;  5G31 A;  4MF5 A;  4N0V A;  3TOU A;  4USS A;  1HNC A;  4HDE A;  2H76 A;  2RM5 A;  2RII A;  2MBS A;  3KMN A;  3LSZ A;  3I69 A;  1S3A A;  2AUV A;  2G0F A;  2RUF A;  3U5R E;  3VWX A;  2KP1 A;  3L78 A;  3QR6 A;  2XBI A;  3ZRE A;  1YZX A;  4Z2T A;  3HHV A;  1THO A;  2F51 A;  4L5O A;  1NSW A;  2PPT A;  1Y6E A;  2H71 A;  2REM A;  5A4U A;  2QSI A;  4GRF A;  3UVT A;  4PUR A;  2E7P A;  2LKU A;  4PXO A;  2HFD A;  3GHA A;  4MNN A;  5CRD A;  4H86 A;  3FK8 A;  2K8V A;  5G1L A;  4FIW A;  2H1A A;  2O85 A;  22GS A;  2H1G A;  3LGC A;  1KNG A;  5EVO A;  1SD9 A;  5KN0 A;  2NDO A;  2AV4 A;  3TUE A;  4KDX A;  3PGT A;  3IHG A;  4K0G A;  1EOH A;  4HEA 2;  3I9V 2;  1TRW A;  1SJI A;  2V2G A;  4WXT A;  4EC0 A;  1O7U A;  3ZRD A;  4FQU A;  3C71 A;  3W6G A;  3FZA A;  4EXJ A;  1ERW A;  5LNK e;  1BJX A;  1F3A A;  1TW9 A;  1ZGN A;  2M46 A;  3H1N A;  2X4A A;  4O5R A;  4IVF A;  2FY6 A;  4E8E A;  3HCZ A;  3O3T A;  3TJJ A;  4PTS A;  2GZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...