3G7YA

Crystal structure of oxidized ost6l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'DILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dolichyl-diphosphooligosaccharide-protein glycosyltransferas
publication title Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.4.1.119: Transferred entry: 2.4.99.18.
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3g7yA00
3ERWA 1RW1A 3KXOA 4BVYA 1GTUA 2AAWA 2MMZA 2ES7A 2PN8A 1JZOA 2YWMA 2XBIA 4EDZA 3H1NA 1OE8A 3L4NA 4ZILA 3H93A 3KMNA 2C0FA 5IO2A 2DBCA 2DSAA 4AJ8A 3W8SA 1EZKA 1XWCA 5EPFA 1PQNA 1A8LA 2CT6A 3A2WA 1SU9A 2IIYA 3M3MA 1XWBA 4POKA 5EY6A 4ZBBA 4K2DA 3IR4A 2X99A 4JEDA 5FWGA 2B5YA 5DAKB 2CZ2A 4EE0A 1V57A 3GN3A 3QFBC 2V41A 3D4TA 5DDLA 4ZL9A 3F9UA 3GURA 2I9HA 3FR6A 3D4MA 5ECMB 3P7XA 4L5LA 1T4ZA 3KGKA 2B1KA 4FYCA 1F3BA 1OKTA 4LL4B 2KOKA 1M2AA 4HEA2 4G9HA 1U87A 5G30A 2C0GA 1I9DA 3F4TA 2DJ1A 3KIJA 3CSIA 2X8CA 5ID2B 3VLNA 8GSSA 1PKZA 1HYUA 5CYYA 1N2AA 2FGXA 3G7JA 4ML6A 2CVDA 4EUYA 4L5OA 5KN0A 1TOFA 1O73A 4K0GA 1WIKA 4LLRA 4EL1A 1BYEA 5G2ZA 1ML6A 1T4YA 1ST9A 5COHA 5HFKA 2VM2A 4GSTA 2L6DA 1XCCA 3EYTA 5G5FA 1VF1A 3PH9A 2GSRA 4DSSA 3TB2A 5ECOB 2R37A 3HZ4A 2YV9A 1SKSB 2YJHA 3ZVJD 3C1SA 3LYKA 2GQLA 4KA0A 2PU9C 5IPHA 1EV9A 1ZL9A 2YPMA 3UARA 2N5FA 1Z6MA 4KDXA 1F6MC 2K9FA 1XZOA 2YJ7A 1A24A 1O7UA 2CAIA 4WF4A 5ECIB 2HYXA 2LJRA 3TJKA 1K0CA 3PR8A 3GYKA 3M8NA 2FNOA 2LQOA 3TRPA 3FRCA 1J0FA 2I1UA 2IL3A 2KHPA 2ALBA 5JCWA 4CW9A 4HQSA 4KDUA 2CVKA 3EVIA 3EMPA 2R4VA 2VAFA 4PURA 3SWLA 3HJMA 1B4QA 3HVVA 3FHKA 2DLXA 1GSSA 2FWFA 3P2AA 3ZITA 5CRHA 4ILFA 1XW6A 3EU3A 3TJJA 1O81A 4F0BA 3NZNA 4MH3A 5HR3A 2AUVA 1KTEA 1F3AA 3ZZXA 3TKSE 3HD5A 1X5CA 4EKZA 2XBQA 4MLYA 2C3TA 4PQ1A 1F37A 2K6VA 4JZQA 3UOMA 4MK3A 4JBBA 3FYGA 4OFNA 2P31A 3TOUA 3IAS2 4TXOA 4G10A 1PGTA 4HZ4A 4I97A 3Q6OA 4DEJA 2VL2A 2B6MA 1F2EA 2B5XA 1U3IA 2AB6A 1GTAA 1OC9B 1WP0A 3O6TA 3O76A 1E2YA 2A2SA 4IVFA 3QOUA 2LKUA 4FYUA 3ZL5A 3QAWA 2WULA 2D2ZA 4RUVA 4DSQA 4WETA 1PX7A 2O7KA 5LNKe 1PD21 4HJ2A 5DCGA 4CHSA 2H72A 2GVPA 4LA1A 4JE1A 4HDEA 1S3CA 2GSTA 5ECQB 5JCGA 4WXTA 2MYGA 3BD2A 4OMVA 2EC4A 2XPDA 2IMKA 3F8UA 3KP9A 4MJCA 2JZSA 5GSTA 2LRNA 4KX4A 1YF0A 4Q5RA 5AISA 3HVXA 1ERTA 3WD6A 3D22A 14GSA 6GSXA 1TW9A 1WOUA 1R4WA 3MNGA 3F4RA 1XOBA 3W6GA 1XPVA 2TIRA 3LORA 2HSYA 1YF1A 5CO3A 4RQRA 3CXGA 1ZZYA 2H73A 1B9YC 5DVBA 1M9AA 3US3A 1UA5A 1VF2A 2VLUA 2A2RA 3UEMA 2ON7A 1PSQA 4XTSA 2NBSA 2JSYA 2O89A 2C0EA 4GSSA 3P8WA 2NPBA 4MMMA 5J9BA 3GHAA 4NPBA 3TKPA 4ZB8A 4JRRA 2RM6A 2RUEA 1EWXA 3WGDA 4XS6A 5HQPA 4LMVA 2HLSA 2Z9SA 3VI5A 3APOA 3UBLA 2MBTA 3GH9A 2REMA 5F0GA 2HZEA 2AYTA 5FT3A 5ECLB 1TI3A 2DMMA 3KCMA 1V2AA 1YZXA 4FH8A 3E9JB 3M1GA 1VF4A 4IJIA 1S3AA 1BG5A 2IMEA 1BAYA 2CV4A 2CAQA 2M46A 4WBRD 1M9BA 3TJGA 2OBKA 1XWAA 1NM3A 2B7KA 1K0DA 3RDWA 1TRVA 2H74A 1K0AA 5F07A 3VWXA 1OKDA 2CQ9A 2YWOA 2WS2A 3RBTA 4I6XA 3ZVJA 5IPGA 1MD4A 3IC4A 4ZB6A 1FO5A 1TJDA 1MDKA 1MDJA 4MF5A 1WWJA 3LJRA 3N9JA 1GTBA 4N11A 3VWVA 3ZIJA 2KP1A 1YY7A 1QFNA 4TXVA 2M80A 5ECKB 1DUGA 4EDYA 4ECJA 3KZQA 4GSNA 5JCUA 3EINA 1SK0A 4N10A 2YWNA 2L4QA 1SENA 2H0GA 2BMXA 3P90A 2VL2C 4BA7A 1BEDA 2LNSA 2OACA 4TW5A 1TRWA 2JU5A 3BOAA 4TR4A 4ECBA 4POLA 5CAXA 4MJEA 1G7OA 4G19A 4IKHA 1URMA 3FW2A 4HOJA 1TKDB 2ON5A 2DMLA 1TI1A 3GSSA 1NHOA 3J7Yk 4FO5A 6GSYA 1NW2A 2V32A 5B6MA 2N5AA 5ELAA 3HZ8A 5B8AA 1WJKA 5D96A 1W4VA 3GX8A 2KP2A 5ECNB 2JSZA 1TRUA 2LJAA 2GQKA 3GMFA 3L9SA 3FKFA 1DE1A 3Q19A 1SYXA 1UC7A 2R2JA 4MA9A 4GWRA 4V1Ap 4XS4A 4Q5NA 1X9WB 2FWHA 1Z3EA 4V2NA 3L9UA 5CRGA 4WR4A 1IYHA 1Z9HA 3CSJA 5JWRB 4OWYA 1A23A 2MMNA 1K3LA 2H0IA 2X8GA 2YP6A 4AJ6A 4PQHA 3KTBA 1EEJA 2F51A 4HS1A 1ZYQB 3KH9A 3UBKA 3DGQA 3DVXA 2R5GA 1MTCA 1A0RP 3Q18A 4K9ZA 4IP1A 2H71A 1O85A 2YOIA 4NMUA 1QK8A 5DALA 4L0UA 3TUEA 4ECCA 5G1LA 2O8VB 4TR0A 2FD3A 3C8EA 3F6DA 1EGRA 19GSA 3W8JA 4ID0A 2GT5A 4XIHA 1XFLA 4ML1A 3ZMLA 1JZDA 2CVBA 5EVOA 1DBYA 1GRXA 5CREA 2J23A 1KEBA 1USBA 1MEKA 4IN0A 1R7HA 2JZTA 4O32A 4K0NA 1ZOFA 4TXOB 3IHQA 2FY6A 5G31A 1XW5A 3QMXA 3KD0A 2DJ0A 3TGZA 3TOTA 3KTLA 1K0NA 1A0FA 2VM1A 2L5LA 2FA8A 2VCXA 2B3SA 1R5PA 1FOVA 1AQXA 4XHMA 5IIZA 1PKWA 1ILOA 2VD1A 3KM6A 1CQHA 1F9MA 2XC2A 5D9WA 5HFIA 5D8IA 2LRCA 2ZNMA 4YH2A 4EXJA 4QL9A 4JR4A 5DQYA 3UVTA 3A5WA 2GSQA 4WBJA 3ISOA 4I2UA 2G2QA 3TKSA 3IDVA 3IPZA 3VPQA 3GIXA 3BCIA 5A4UA 2WDUA 1PA3A 5J9CA 1LBKA 1TDIA 2DC5A 2N5BA 3FZ4A 1J08A 2VCTA 1GSYA 3ZTLA 1V98A 4ZL7A 1XVQA 4OFTA 1V40A 3WT1A 4ZBAA 1UN2A 1SL0B 2B5EA 1FVKA 5D9VA 5ABRA 2BJXA 3LYPA 3M9KA 1FHEA 5GAPD 2VCVA 3GKXA 3TJBA 3VWWA 2RM5A 4POBA 3C1RA 3H79A 2H1AA 4TKYA 4IELA 3CTGA 4ZBDA 2P5QA 3WT2A 3H8QA 1C72A 4KSOA 5J4UA 1MDIA 4MP4A 1AQVA 4MCUA 1E6BA 3DWVA 4FYBA 3HYPA 4IS0A 4IW9A 2F3MA 4POMA 4MF7A 4RI7A 1XOAA 3HHVA 5D9XA 3D5JA 2GQMA 3C7MA 2WFCA 4ISDA 3GRXA 2HZEB 4I8BA 4DSRA 1W89A 4OO5A 5CRWA 5GAND 4EO3A 3ED3A 5IMZA 3C73A 1BX9A 2H1GA 2HRNA 5IQYA 2FWGA 1TU8A 2PGTA 6GSWA 4N30A 3UAPA 2MMAA 4OFMA 2IFQA 1GLQA 5A5KA 1XWGA 3V1WA 4YQUA 3APSA 1TK0B 4K1FA 5H5RA 4E8HA 1PX6A 3I69A 4TR1B 3CSHA 2YN1A 3GUSA 4PXOA 20GSA 3TCOA 3LSZA 1FG4A 2QKEA 2LJKA 2LQQA 5JWOB 1T7PB 4F82A 4PNGA 2L6CA 3LGCA 2JADA 4NXIA 1M99A 1PL1A 2PBJA 4K7IA 1HNAA 1EEMA 1YQ1A 4KH7A 1G6WA 3HXSA 3QCPA 1Q4JA 2GDRA 3TKRA 2OADA 1NSWA 5DBQA 2LRTA 1R26A 1GUKA 2WB9A 2L5OA 3FZ9A 2PWJA 2H6XA 2X8HA 3FK8A 2H75A 3TDGA 4LMWA 3HKRA 2IPAA 3C71A 1H75A 2HXKA 2NDOA 1VF3A 3DMLA 2K8VA 3CRTA 4MPGA 1GSEA 2GTUA 1TK5B 4PUFC 4FIWA 2LNTA 3F3RA 4IQ1A 2OKAA 4ULXA 1Q98A 1PMTA 4TR3A 1GNWA 2IMIA 2EIOA 4AF2A 2YWIA 3AY8A 1K3YA 3FEUA 4IHUA 2WGRA 3PINA 4OD7A 5DJMA 2H6YA 2FCHA 2H66A 1THOA 3HVSA 3HCZA 3IXRA 5EL8A 2NVLA 1TTZA 3IA1A 3QDNA 1EP8A 4ZXGA 4E8EA 2PVQA 2L4CA 3TKSC 4BPYA 1QQ2A 2DJ2A 4O7HA 5CP1A 2L59A 3PGTA 2HSHA 4ZIJA 2O85A 3BJ5A 2HRFA 1IYIA 1ERVA 3O3TA 1T00A 4XS4B 2P0GA 1SK1A 2ZUPA 1PRXA 2YV7A 1GWCA 3MAKA 5AIVA 3IE3A 3D0ZA 2VD0A 4HU9A 1GLPA 5JWQB 6GSSA 1X5EA 5IMAA 4I5QA 4NHWA 1Z6NA 4QL7A 3EMXA 4F03A 3GL3A 3CRUA 2LTKA 4ZB9A 1FB0A 3DRNA 1TXXA 4HUAA 2J9HA 3MDKA 2PMTA 2CX3A 3CYNA 3IK9A 3DYRA 3IOSA 1SKRB 5DALB 3WGXA 3VPTA 3U5RE 2FA4A 2QGVA 3HJOA 1PL2A 3FZAA 3KP8A 3NOFA 1RK4A 4TVEA 2VCQA 3SBCA 1Z7PA 2P5RA 2HI7A 4TR1A 4BL7A 1V58A 4I2TA 4MJAA 3QR6A 2QC7A 2E7PA 3QFAC 2M72A 4J56E 4MABA 2VO4A 1EOHA 3ME8A 4MF6A 4X43A 4K7NA 3CBUA 5IOWA 1Z5YE 3EWLA 2DIYA 2NTOA 3RAZA 1GUHA 1JZWA 2E2MA 1O8WA 1WRYA 2GZZA 1XBSA 5ECRB 3QAVA 4WKWA 3RPPA 3GFKA 4MH2A 5KN1A 1YEXA 4IQAA 5ENUA 5IM9A 5C00A 4AJ7A 1X5DA 2H19A 3UIWA 2YZUA 1ZYEA 1UVZA 2OE1A 2F8FA 1GSFA 1X9SB 2HE3A 2TRCP 4V2LA 3EE2A 4GLTA 4OCEA 5F8BA 1SJ6A 4KCEA 4TRXA 3IV4A 4N0VA 5F06A 1T8EB 1EV4A 3ZMKA 2F9SA 5IO0A 1B9XC 3UL3A 5A4VA 3R2QA 1KBNA 7GSSA 2WZ9A 1OC3A 4HZ2A 1U88A 3GKKA 1AUCA 2DJJA 4RQXA 3FR9A 4XCSA 4KCAA 2C4JA 2LV3A 1LU4A 2VIMA 1XWKA 3GKMA 4WF5A 4HI7A 5L71A 3ZIVA 4X1UA 2AHEA 4AGSA 2JACA 4X0XA 3BBYA 1FB6A 1YJ6A 2OE3A 1CQGA 3DEXA 2AJQB 1VGLA 5INYA 2FWEA 2YNXA 3RHCA 3VFIA 3FR3A 2KUCA 3HA9A 4KSMA 2VL9A 1YDKA 2L57A 2XPEA 1BQ7A 1M7TA 2FUG2 1OE7A 3VWUA 2IFQB 1TU7A 3DIEA 3EC3A 2E0QA 1X9MB 3HDCA 2JL4A 13GSA 5DJLA 5E59A 3KMOA 4IJ3A 1ABAA 3G7IA 3H4KA 4F9ZA 3IK7A 3ME7A 3IAM2 4HQZA 2FLSA 5B6NA 1GH2A 3D6IA 3LQ7A 1G7EA 4G2EA 1VRSD 4ZL8A 1JZRA 2G0FA 5HR2A 2X64A 1Z7RA 2IWTA 4N0ZA 16GSA 3ZFBA 4NAXA 3QAGA 5GZZB 6GSUA 1JLWA 3GV1A 1X0RA 5D73A 2AV4A 2RIIA 4MZCA 2C3NA 4GQCA 4HU7A 4PQIA 1T1VA 2IN3A 1N8JA 5IMFA 2MMOA 1M0UA 2WJUA 5B7CA 5HR0A 1O8XA 3UVHA 2I4AA 4KNDA 4GTUA 1ZCPA 5FHIA 11GSA 2RUFA 2C8UA 2OA7A 1SYRA 3Q74A 5AIXA 3U6VA 4D73B 3VK9A 1LJRA 3WGEA 2H70A 1WPIA 5G1KA 1GSDA 3TJFA 2C0DA 3TKQA 3GX0A 3ZRDA 2EIRA 4KDYA 1SJIA 1A8YA 5CRDA 4NV2A 1GSUA 22GSA 1TK8B 3HJPA 2YCDA 5ECPB 1Y6EA 2VUPA 2H8LA 4KAEA 1OAZA 4EF0A 1FVJA 3E0UA 10GSA 2VLVA 2CA8A 2GSSA 1HNCA 2I3YA 1EP7A 2C1YA 4PX1A 2A4VA 5E4WA 2R6KA 1YEPA 1JHBA 2KLXA 3N5OA 4L8EA 1AC1A 2DJ3A 2VLTA 3CMIA 4GCIA 6GSTA 1A2MA 2CX4A 4P3YB 1AIUA 5H5QA 4KE3A 4Q5QA 3LFLA 5KEJA 1H4OA 5GSSA 4BWQA 1B8XA 5C04A 3CTFA 4OO4A 1I5GA 3I9V2 3G7YA 3UJ1A 4YQMA 3GL5A 1EGOA 3LXZA 2YANA 3M0FA 1QMVA 3DKSA 3I43A 2CZ3A 3L0HA 1TRSA 2HT9A 4DVCA 3APQA 1GSQA 2HNLA 1A2JA 2RLIA 1JLVA 4GRFA 3IBHA 4WEYA 2VL3A 1GNEA 4PGTA 2WCIA 4K8MA 2OBIA 1GUMA 3DVWA 3GKNA 3LG6A 2K18A 3TRQA 2PERA 3JCML 4TOPA 4KGIA 4J57E 1ZMAA 2GZPA 1ZGNA 3F6FA 1K0BA 17GSA 3ZYWA 4XRAA 5DAKA 3S9FA 1AW9A 2E2GA 4EC0A 5ECHB 3QD9A 4YQVA 1T3BA 4LL1B 5HFGA 4Q5FA 1ACVA 4GXZA 1EOGA 4BVXA 1K3OA 1GL8A 3GNJA 2GZYA 1K0OA 1SD9A 2H30A 2WRTA 1ERWA 1QXHA 4RI6A 4CDOA 2H76A 3I6AA 4KB3A 2VCWA 1OYJA 5ID2A 4L0WA 1S3DA 2ZCTA 1G0TA 4MPFA 1QGVA 3EU4A 4GF0A 2LSTA 2I81A 4D73A 2BTOT 3DD3A 1OVNA 1XVWA 3DXBA 1SL1B 2OE0A 3ERGA 1DSBA 1FAAA 1HNBA 1AXDA 3ZFLA 2H6ZA 2H1BA 5IMCA 5J5NA 2MBSA 2GS3A 5KN3A 4ACSA 2MZCA 1PN9A 2V2GA 2OJLA 3KH7A 4EVMA 3TRXA 2LS5A 2GLRA 4PNFA 1B4PA 3OR5A 1AAZA 4JR6A 2FHEA 4TN8A 1WE0A 5B8BA 5DCHA 1XXUA 2GGTA 2V1MA 1YKAA 2LEGA 5LCZA 3GTUB 4MDCA 9GSSA 3LEFA 4MZBA 3FY7A 2H1DA 4F0CA 5KN2A 4O92A 4MZWA 3F4SA 5LD0A 1U6TA 4GQFA 1SKWB 1BJXA 3L9VA 1ERUA 3E3EA 3A2XA 2B1LA 1HD2A 1SJZA 3GSTA 4NWYA 3M9JA 2B7JA 2TRXA 12GSA 3VI7A 1ON4A 1O6JA 4YAPA 4ECIA 3FZ5A 3IRAA 1A2LA 2PVOC 2DJKA 2H0HA 5D9TA 1TP9A 1V9WA 4YAVA 4QQ7A 1YKCA 3QPMA 5IMDA 5CNWA 3HY2A 5J41A 2R3XA 2QSIA 1KNGA 3J7Yb 3A2VA 6GSVA 1WMJA 1K0MA 2DIZA 4IBPA 4F2IA 2YZHA 3F3QA 3RPNA 2K8SA 5IMVA 2XHFA 3D21A 2GT6A 5AGYA 2EIQA 1XIYA 5D93A 1JFUA 2O87A 3NIVA 5HR1A 1GTIA 2JZRA 4KUNA 4NV5A 3UMAA 3MWHA 5ECSA 2F8AA 1M2DA 4IGJA 5F05A 4BWSA 3VURA 2V6KA 2C80A 3K8NA 2PUKC 3ZLPA 1J9BA 1B48A 1NHYA 3L78A 1OC9A 1FW1A 4NHZA 2IMDA 4XS1A 3G9BA 1XW9A 1SL2B 1Y25A 3KEBA 1GULA 2VCZA 3GH6A 3GA4A 4KW6A 3EURA 4H86A 2PPTA 4OCFA 5ELGA 3KJYA 3A3TA 1DE2A 2IJYA 4MJBA 4WR5A 1MD3A 1RQMA 5DQSA 4IP6A 1G6YA 5G5EA 4PUAA 3F0IA 3WYWA 1R5AA 5H5SA 2C3QA 4XRDA 4DSSB 1HQOA 3LXTA 1SK2A 1AQWA 2H01A 3BCKA 1U3AA 2HFDA 3F63A 2V6OA 3MSZA 5A4WA 4J2FA 18GSA 1THXA 1QUWA 5J3RA 1OC8A 4HJMA 3ERFA 4Z7XA 2LUSA 2VOCA 2HZFA 4O5RA 1GP1A 3GTUA 4V2MA 4K7OA 1SD8A 5AN1A 4K6XA 4V1Ag 3LWAA 4JU5A 1M2BA 3ZREA 5IOXA 3RHBA 2IMFA
chains in the Genus database with same CATH superfamily
3ERWA 1RW1A 3KXOA 1XG8A 4BVYA 1GTUA 2AAWA 2MMZA 2ES7A 2PN8A 1JZOA 2YWMA 2XBIA 4EDZA 3H1NA 1OE8A 3L4NA 4ZILA 1S3RA 3H93A 3KMNA 2C0FA 5IO2A 2DBCA 2DSAA 4AJ8A 3W8SA 1EZKA 1XWCA 4CY8A 5EPFA 1PQNA 1A8LA 2CT6A 3A2WA 1SU9A 2IIYA 3M3MA 1XWBA 4POKA 5EY6A 4ZBBA 4K2DA 3IR4A 2X99A 4JEDA 5FWGA 2B5YA 5DAKB 2CZ2A 4EE0A 1V57A 1FOHA 3GN3A 3QFBC 2V41A 3D4TA 5DDLA 4ZL9A 3F9UA 3GURA 2I9HA 3FR6A 3D4MA 5ECMB 3P7XA 4L5LA 1T4ZA 3KGKA 2B1KA 4FYCA 1F3BA 1OKTA 4LL4B 2KOKA 1M2AA 4HEA2 4G9HA 1U87A 5G30A 2C0GA 1I9DA 3F4TA 2DJ1A 3KIJA 3CSIA 2X8CA 5ID2B 3VLNA 8GSSA 1PKZA 1HYUA 5CYYA 1N2AA 2FGXA 3G7JA 4ML6A 2CVDA 4PTSA 4EUYA 4L5OA 5KN0A 1TOFA 1O73A 4K0GA 4EIPA 1WIKA 4LLRA 4EL1A 1BYEA 5G2ZA 1ML6A 1T4YA 1ST9A 5COHA 5HFKA 2VM2A 4GSTA 2L6DA 1XCCA 3EYTA 5G5FA 1VF1A 3PH9A 2GSRA 4DSSA 3TB2A 5ECOB 2R37A 3HZ4A 2YV9A 1SKSB 2YJHA 3ZVJD 3C1SA 3LYKA 2GQLA 4KA0A 2PU9C 5IPHA 1EV9A 1ZL9A 2YPMA 3UARA 2N5FA 1Z6MA 4KDXA 1F6MC 2K9FA 1XZOA 4YKGA 2YJ7A 1A24A 1O7UA 2CAIA 4WF4A 5ECIB 2HYXA 2LJRA 3TJKA 1K0CA 3PR8A 3GYKA 3M8NA 2FNOA 2LQOA 3TRPA 3FRCA 1J0FA 2X49A 2I1UA 2IL3A 2KHPA 2ALBA 5JCWA 4CW9A 4HQSA 4KDUA 2CVKA 3EVIA 3EMPA 2R4VA 2VAFA 4PURA 3SWLA 3HJMA 1B4QA 3HVVA 3FHKA 2DLXA 1GSSA 2FWFA 3P2AA 3ZITA 5CRHA 4ILFA 1XW6A 3EU3A 3TJJA 1O81A 4F0BA 3NZNA 4MH3A 5HR3A 2AUVA 1KTEA 1F3AA 3ZZXA 3TKSE 3HD5A 1X5CA 2UZ8A 4EKZA 2XBQA 4MLYA 2C3TA 4PQ1A 1F37A 2K6VA 4JZQA 3UOMA 4MK3A 4JBBA 3FYGA 4OFNA 2P31A 3TOUA 3IAS2 4TXOA 4G10A 1PGTA 4HZ4A 4I97A 3Q6OA 4DEJA 2VL2A 2B6MA 1F2EA 2B5XA 1U3IA 2AB6A 1GTAA 1OC9B 1WP0A 3O6TA 3O76A 1E2YA 2A2SA 4IVFA 2A2PA 3QOUA 2LKUA 4FYUA 3ZL5A 3QAWA 4K5RA 2WULA 2D2ZA 4RUVA 4DSQA 4WETA 1PX7A 2O7KA 5LNKe 1PD21 4HJ2A 5DCGA 4CHSA 2H72A 2GVPA 4LA1A 4JE1A 4HDEA 1S3CA 2GSTA 5ECQB 5JCGA 4WXTA 2MYGA 3BD2A 4OMVA 2EC4A 2XPDA 2IMKA 3F8UA 3KP9A 4MJCA 2JZSA 5GSTA 2LRNA 4KX4A 1YF0A 4Q5RA 5AISA 3HVXA 1ERTA 3WD6A 3D22A 14GSA 6GSXA 1TW9A 1WOUA 1R4WA 3MNGA 3F4RA 1XOBA 3W6GA 1XPVA 2TIRA 3LORA 2HSYA 1YF1A 5CO3A 4RQRA 3CXGA 1ZZYA 2H73A 1B9YC 5DVBA 1M9AA 3US3A 1UA5A 2DKHA 1VF2A 2VLUA 2A2RA 3UEMA 2ON7A 1PSQA 4XTSA 2NBSA 2JSYA 2O89A 2C0EA 4GSSA 3P8WA 2NPBA 4MMMA 5J9BA 3GHAA 4NPBA 3TKPA 4ZB8A 4JRRA 2RM6A 2RUEA 4BVYB 1EWXA 3WGDA 4XS6A 5HQPA 4LMVA 2HLSA 2Z9SA 3VI5A 3APOA 3UBLA 2MBTA 3GH9A 2REMA 5F0GA 2HZEA 2AYTA 5FT3A 5ECLB 1TI3A 2DMMA 3KCMA 1V2AA 1YZXA 4FH8A 3E9JB 3M1GA 1VF4A 4IJIA 1S3AA 1BG5A 2IMEA 1BAYA 2CV4A 2CAQA 2M46A 4WBRD 1M9BA 3TJGA 2OBKA 1XWAA 1NM3A 2B7KA 1K0DA 3RDWA 1TRVA 2H74A 1K0AA 5F07A 3VWXA 1OKDA 2CQ9A 2YWOA 2WS2A 3RBTA 4I6XA 3ZVJA 5IPGA 1MD4A 3IC4A 4ZB6A 1FO5A 1TJDA 1MDKA 1MDJA 4MF5A 1WWJA 3LJRA 3N9JA 1GTBA 4N11A 3VWVA 2R0PA 4O5QA 3ZIJA 2KP1A 1YY7A 1QFNA 4TXVA 2M80A 5ECKB 1DUGA 4EDYA 4ECJA 3KZQA 4GSNA 5JCUA 3EINA 1SK0A 3MYDA 4N10A 3LW9A 2YWNA 2L4QA 1SENA 2H0GA 2BMXA 3P90A 2VL2C 4BA7A 1BEDA 2LNSA 2OACA 4TW5A 1TRWA 2JU5A 3BOAA 4TR4A 4ECBA 4POLA 5CAXA 4MJEA 1G7OA 4G19A 4IKHA 1URMA 3FW2A 4HOJA 1TKDB 2ON5A 2DMLA 1TI1A 3GSSA 1NHOA 3J7Yk 4FO5A 6GSYA 1NW2A 2V32A 5B6MA 2N5AA 5ELAA 3HZ8A 5B8AA 1WJKA 5D96A 1W4VA 3GX8A 2KP2A 5ECNB 2JSZA 1TRUA 2LJAA 2GQKA 3GMFA 3L9SA 3FKFA 1DE1A 3Q19A 2R0CA 4G0LA 1SYXA 1UC7A 2R2JA 4MA9A 4GWRA 4V1Ap 4XS4A 4Q5NA 1X9WB 2FWHA 1Z3EA 4V2NA 3L9UA 5CRGA 4WR4A 1IYHA 1Z9HA 3CSJA 5JWRB 4OWYA 1A23A 2MMNA 1K3LA 2H0IA 2X8GA 2YP6A 4AJ6A 4PQHA 3KTBA 1EEJA 2F51A 4HS1A 1ZYQB 3KH9A 3UBKA 3DGQA 1PFOA 3DVXA 2R5GA 1MTCA 1A0RP 3Q18A 4K9ZA 4IP1A 2H71A 1O85A 2YOIA 4NMUA 1QK8A 4X4JA 5DALA 4L0UA 3TUEA 4ECCA 5G1LA 2O8VB 4TR0A 2FD3A 3C8EA 3F6DA 1EGRA 19GSA 3W8JA 4ID0A 2GT5A 4XIHA 1XFLA 4ML1A 3ZMLA 1JZDA 2CVBA 5EVOA 1DBYA 1GRXA 5CREA 4G0KA 2J23A 1KEBA 1USBA 1MEKA 4IN0A 1R7HA 2JZTA 4O32A 4K0NA 1ZOFA 4TXOB 3IHQA 2FY6A 5G31A 1XW5A 3QMXA 3KD0A 2DJ0A 3TGZA 3TOTA 3KTLA 1K0NA 1A0FA 2VM1A 2L5LA 2FA8A 2VCXA 2B3SA 1R5PA 1FOVA 1AQXA 4XHMA 5IIZA 1PKWA 1ILOA 2VD1A 3KM6A 1CQHA 1F9MA 2XC2A 5D9WA 5HFIA 5D8IA 2LRCA 4YKFA 2ZNMA 4YH2A 4EXJA 4QL9A 4JR4A 5DQYA 3UVTA 3A5WA 2GSQA 4WBJA 3ISOA 4I2UA 2G2QA 3TKSA 3IDVA 3IPZA 3VPQA 3GIXA 3BCIA 5A4UA 2WDUA 1PA3A 5J9CA 1LBKA 1TDIA 2DC5A 2N5BA 3FZ4A 1J08A 2VCTA 1GSYA 3ZTLA 1V98A 4ZL7A 1XVQA 4OFTA 1V40A 3WT1A 4ZBAA 1UN2A 1SL0B 2B5EA 1FVKA 5D9VA 5ABRA 2BJXA 3LYPA 3M9KA 1FHEA 5GAPD 2VCVA 3GKXA 3TJBA 4KF9A 3VWWA 5BRTA 2RM5A 4POBA 3C1RA 3H79A 2H1AA 4TKYA 4IELA 3CTGA 4ZBDA 2P5QA 3WT2A 3H8QA 1C72A 4KSOA 5J4UA 1MDIA 4MP4A 1AQVA 4MCUA 1E6BA 3DWVA 4FYBA 3HYPA 4IS0A 4IW9A 2F3MA 4POMA 4MF7A 4RI7A 1XOAA 3HHVA 5D9XA 3D5JA 2GQMA 3C7MA 2WFCA 4ISDA 3GRXA 2HZEB 4I8BA 4DSRA 1W89A 4OO5A 5CRWA 5GAND 4EO3A 3ED3A 5IMZA 3C73A 1BX9A 2H1GA 2HRNA 5IQYA 2FWGA 1TU8A 2PGTA 6GSWA 4N30A 3UAPA 2MMAA 4OFMA 2IFQA 1GLQA 5A5KA 1XWGA 3V1WA 4YQUA 3APSA 1TK0B 4K1FA 5H5RA 4E8HA 1PX6A 3I69A 4TR1B 3CSHA 2YN1A 3GUSA 4PXOA 20GSA 3TCOA 3LSZA 4BIKA 1FG4A 2QKEA 2LJKA 2LQQA 5JWOB 1T7PB 4F82A 4PNGA 2L6CA 3LGCA 5BMUA 2JADA 4NXIA 1M99A 1PL1A 2PBJA 4K7IA 1HNAA 1EEMA 1YQ1A 4KH7A 1G6WA 2QA2A 3HXSA 3QCPA 1Q4JA 2GDRA 3TKRA 2OADA 1NSWA 5DBQA 2LRTA 1R26A 1GUKA 2WB9A 2L5OA 3FZ9A 2PWJA 2H6XA 2X8HA 3FK8A 2H75A 3TDGA 3PPUA 4LMWA 3HKRA 2IPAA 3C71A 1H75A 2HXKA 2NDOA 1VF3A 3DMLA 2K8VA 3CRTA 4MPGA 1GSEA 2GTUA 1TK5B 4PUFC 4FIWA 2LNTA 3F3RA 2A4HA 4IQ1A 2OKAA 4ULXA 1Q98A 1PMTA 4TR3A 1GNWA 2IMIA 2EIOA 4AF2A 2YWIA 3AY8A 1K3YA 3FEUA 4IHUA 2WGRA 3PINA 4OD7A 5DJMA 2H6YA 2FCHA 2H66A 1THOA 3HVSA 3HCZA 3IXRA 5EL8A 2NVLA 1TTZA 3IA1A 3QDNA 1EP8A 4ZXGA 4E8EA 2PVQA 2L4CA 3TKSC 4BPYA 1QQ2A 2DJ2A 4O7HA 5CP1A 2L59A 3PGTA 2HSHA 4ZIJA 2O85A 3BJ5A 2HRFA 1IYIA 1ERVA 3O3TA 1T00A 4XS4B 2P0GA 1SK1A 2ZUPA 1PRXA 2YV7A 1GWCA 3MAKA 5AIVA 3IE3A 3D0ZA 2VD0A 4HU9A 1GLPA 5JWQB 6GSSA 1X5EA 5IMAA 4I5QA 4NHWA 4EIQA 1Z6NA 4QL7A 3EMXA 4F03A 3GL3A 3CRUA 2LTKA 4ZB9A 1FB0A 3DRNA 1TXXA 4HUAA 2J9HA 3MDKA 2PMTA 2CX3A 3CYNA 3IK9A 3DYRA 3IOSA 1SKRB 5DALB 3WGXA 3VPTA 3U5RE 2FA4A 2QGVA 3HJOA 4CY6A 1PL2A 3FZAA 3KP8A 3NOFA 1RK4A 4TVEA 2VCQA 3CQFA 3SBCA 1Z7PA 2P5RA 2HI7A 4TR1A 4BL7A 1V58A 4I2TA 4MJAA 3QR6A 2QC7A 2E7PA 3QFAC 2M72A 4J56E 2R0GA 4MABA 2VO4A 1EOHA 3IHGA 3ME8A 4MF6A 4X43A 4K7NA 3CBUA 5IOWA 1Z5YE 3EWLA 2DIYA 2NTOA 3RAZA 1GUHA 4Z2RA 4K2XA 1JZWA 2E2MA 1O8WA 1WRYA 2GZZA 1XBSA 5ECRB 3QAVA 4WKWA 3RPPA 3GFKA 4MH2A 5KN1A 1YEXA 4IQAA 5ENUA 5IM9A 5C00A 4AJ7A 1X5DA 2H19A 3UIWA 2YZUA 1ZYEA 1UVZA 2OE1A 2F8FA 1GSFA 1X9SB 2HE3A 2TRCP 4V2LA 3EE2A 4GLTA 4OCEA 5F8BA 1SJ6A 4KCEA 4TRXA 3IV4A 4N0VA 5F06A 1T8EB 1EV4A 3ZMKA 2F9SA 5IO0A 1B9XC 3UL3A 5A4VA 3R2QA 1KBNA 7GSSA 2WZ9A 1OC3A 4HZ2A 1PN0A 1U88A 3GKKA 1AUCA 2DJJA 4RQXA 3FR9A 4XCSA 4KCAA 2C4JA 2LV3A 1LU4A 2VIMA 1XWKA 3GKMA 4WF5A 4HI7A 5L71A 3ZIVA 4X1UA 2AHEA 4AGSA 2JACA 4X0XA 4G0IA 3BBYA 1FB6A 1YJ6A 2OE3A 1CQGA 3DEXA 2AJQB 1VGLA 5INYA 2FWEA 2YNXA 3RHCA 3VFIA 3FR3A 2KUCA 3HA9A 4KSMA 2VL9A 1YDKA 3HVNA 2L57A 2XPEA 1BQ7A 1M7TA 2FUG2 1OE7A 3VWUA 2IFQB 1TU7A 3DIEA 3EC3A 2E0QA 1X9MB 3HDCA 2JL4A 13GSA 5DJLA 5E59A 3KMOA 4IJ3A 1ABAA 3G7IA 3H4KA 4F9ZA 3IK7A 3ME7A 3IAM2 4HQZA 2FLSA 5B6NA 1GH2A 3D6IA 3LQ7A 2HRKA 1G7EA 4G2EA 1VRSD 4ZL8A 1JZRA 2G0FA 1ZYNA 5HR2A 2X64A 1Z7RA 2IWTA 4N0ZA 16GSA 3ZFBA 4NAXA 3QAGA 5GZZB 6GSUA 1JLWA 3GV1A 1X0RA 5D73A 2AV4A 2RIIA 4MZCA 4BVXB 2C3NA 4GQCA 4HU7A 4PQIA 1T1VA 2IN3A 1N8JA 5IMFA 2MMOA 1M0UA 2WJUA 5B7CA 5HR0A 1O8XA 3UVHA 2I4AA 4KNDA 4GTUA 1ZCPA 5FHIA 11GSA 1M3IA 2RUFA 2C8UA 2OA7A 1SYRA 3Q74A 5AIXA 3U6VA 4D73B 3VK9A 1LJRA 3WGEA 2H70A 1WPIA 5G1KA 1GSDA 3TJFA 2C0DA 3TKQA 3GX0A 3ZRDA 2EIRA 4Z2TA 4KDYA 1SJIA 1A8YA 5CRDA 4NV2A 1GSUA 22GSA 1TK8B 3HJPA 2YCDA 5ECPB 1Y6EA 2VUPA 4FQUA 2H8LA 4KAEA 1OAZA 4EF0A 1FVJA 3E0UA 10GSA 2VLVA 2CA8A 2GSSA 1HNCA 2I3YA 1EP7A 2C1YA 4PX1A 2A4VA 5E4WA 2R6KA 1YEPA 1JHBA 2KLXA 3N5OA 4L8EA 1AC1A 2DJ3A 2VLTA 3CMIA 4GCIA 6GSTA 1A2MA 2CX4A 4P3YB 1AIUA 2DKIA 5H5QA 4KE3A 4Q5QA 3LFLA 5KEJA 2X4AA 1H4OA 5GSSA 4BWQA 1B8XA 5C04A 3CTFA 4OO4A 1I5GA 3I9V2 3G7YA 3UJ1A 4YQMA 3GL5A 1EGOA 3LXZA 2YANA 3M0FA 1QMVA 3DKSA 3I43A 2CZ3A 3L0HA 1TRSA 2HT9A 4DVCA 3APQA 1GSQA 2HNLA 1A2JA 2RLIA 1JLVA 4GRFA 3IBHA 4WEYA 2VL3A 1GNEA 4PGTA 4BL7B 2WCIA 4K8MA 2OBIA 1GUMA 4USSA 3DVWA 3GKNA 3LG6A 2K18A 3TRQA 2PERA 3JCML 4TOPA 4KGIA 4J57E 1ZMAA 2GZPA 1ZGNA 3R3EA 3F6FA 1K0BA 17GSA 3ZYWA 4XRAA 5DAKA 3S9FA 1AW9A 2E2GA 4EC0A 5ECHB 3QD9A 4YQVA 1T3BA 4LL1B 5HFGA 4Q5FA 1ACVA 5KOWA 4GXZA 1EOGA 4BVXA 1K3OA 1GL8A 3EPTA 3GNJA 2GZYA 1K0OA 1SD9A 2H30A 2WRTA 1ERWA 1QXHA 4RI6A 4CDOA 2H76A 3I6AA 4KB3A 2VCWA 3FMWA 1OYJA 5ID2A 4L0WA 1S3DA 2ZCTA 1G0TA 4MPFA 1QGVA 3EU4A 4GF0A 2LSTA 2I81A 4D73A 2BTOT 3DD3A 1OVNA 1XVWA 3DXBA 3A5IA 1SL1B 2OE0A 3ERGA 1DSBA 1FAAA 1HNBA 1AXDA 3ZFLA 2H6ZA 2H1BA 5IMCA 5J5NA 2MBSA 2GS3A 5KN3A 4ACSA 2MZCA 1PN9A 2V2GA 2OJLA 3KH7A 4EVMA 3TRXA 2LS5A 2GLRA 4PNFA 1B4PA 3OR5A 1AAZA 4JR6A 2FHEA 4TN8A 1WE0A 5B8BA 5DCHA 1XXUA 2GGTA 2V1MA 1YKAA 2LEGA 2HSMA 5LCZA 3GTUB 4MDCA 9GSSA 3LEFA 4O5UA 4MZBA 3FY7A 2H1DA 4F0CA 5KN2A 4O92A 4MZWA 3F4SA 5LD0A 1U6TA 4GQFA 1SKWB 1BJXA 3L9VA 1ERUA 3E3EA 3A2XA 4A5PA 2B1LA 1HD2A 1SJZA 3GSTA 4NWYA 3M9JA 2B7JA 2TRXA 12GSA 3VI7A 1ON4A 1O6JA 4YAPA 4ECIA 3FZ5A 3IRAA 1A2LA 2PVOC 2DJKA 2H0HA 5D9TA 1TP9A 1V9WA 4YAVA 4QQ7A 1YKCA 3QPMA 5IMDA 5CNWA 3HY2A 5J41A 2R3XA 2QA1A 2QSIA 1KNGA 3J7Yb 3A2VA 6GSVA 1WMJA 1K0MA 2DIZA 4IBPA 4F2IA 2YZHA 3F3QA 3RPNA 2K8SA 5IMVA 2XHFA 1ZYPA 3D21A 2GT6A 5AGYA 2EIQA 1XIYA 5D93A 1JFUA 2O87A 3NIVA 5HR1A 1GTIA 2JZRA 4KUNA 4NV5A 3UMAA 3MWHA 5ECSA 2F8AA 1M2DA 4IGJA 3IC8A 5F05A 4BWSA 3MIXA 3VURA 2V6KA 2C80A 3K8NA 4HSCX 2PUKC 3ZLPA 1J9BA 1B48A 1NHYA 3L78A 1OC9A 1FW1A 4NHZA 2IMDA 4XS1A 3G9BA 1XW9A 1SL2B 1Y25A 3KEBA 1GULA 2VCZA 3GH6A 3GA4A 4KW6A 3EURA 4H86A 2PPTA 4OCFA 5ELGA 3KJYA 3A3TA 1DE2A 2IJYA 4MJBA 4WR5A 1MD3A 1RQMA 5DQSA 4IP6A 1G6YA 5G5EA 4PUAA 3F0IA 3WYWA 1M3JA 1R5AA 5H5SA 2C3QA 4XRDA 4DSSB 1HQOA 3LXTA 1SK2A 4ICYA 1AQWA 2H01A 3BCKA 1U3AA 2HFDA 3F63A 2V6OA 3MSZA 5A4WA 4Z2UA 4J2FA 18GSA 1THXA 1QUWA 5J3RA 1OC8A 4HJMA 5KOXA 3ERFA 4Z7XA 2LUSA 2VOCA 4K5SA 4MNNA 2HZFA 4O5RA 1GP1A 3GTUA 4V2MA 4K7OA 1SD8A 5AN1A 4K6XA 4V1Ag 3LWAA 4JU5A 1M2BA 3ZREA 5IOXA 3RHBA 2IMFA 2HRAA
chains in the Genus database with same CATH topology
3ERWA 1RW1A 3KXOA 4BVYA 1GTUA 2AAWA 2MMZA 2ES7A 2PN8A 1JZOA 2YWMA 2XBIA 4EDZA 3H1NA 1OE8A 3L4NA 4ZILA 3H93A 3KMNA 2C0FA 5IO2A 2DBCA 2DSAA 4AJ8A 3W8SA 1EZKA 1XWCA 4CY8A 5EPFA 1PQNA 1A8LA 2CT6A 3A2WA 1SU9A 2IIYA 3M3MA 1XWBA 4POKA 5EY6A 4ZBBA 4K2DA 3IR4A 2X99A 4JEDA 5FWGA 2B5YA 5DAKB 2CZ2A 4EE0A 1V57A 1FOHA 3GN3A 3QFBC 2V41A 3D4TA 5DDLA 4ZL9A 3F9UA 3GURA 2I9HA 3FR6A 3D4MA 5ECMB 3P7XA 4L5LA 1T4ZA 3KGKA 2B1KA 4FYCA 1F3BA 1OKTA 4LL4B 2KOKA 1M2AA 4HEA2 4G9HA 1U87A 5G30A 2C0GA 1I9DA 3F4TA 2DJ1A 3KIJA 3CSIA 2X8CA 5ID2B 3VLNA 8GSSA 1PKZA 1HYUA 5CYYA 1N2AA 2FGXA 3G7JA 4ML6A 2CVDA 4PTSA 4EUYA 4L5OA 5KN0A 1TOFA 1O73A 4K0GA 4EIPA 1WIKA 4LLRA 4EL1A 1BYEA 5G2ZA 1ML6A 1T4YA 1ST9A 5COHA 5HFKA 2VM2A 4GSTA 2L6DA 1XCCA 3EYTA 5G5FA 1VF1A 3PH9A 2GSRA 4DSSA 3TB2A 5ECOB 2R37A 3HZ4A 2YV9A 1SKSB 2YJHA 3ZVJD 3C1SA 3LYKA 2GQLA 4KA0A 2PU9C 5IPHA 1EV9A 1ZL9A 2YPMA 3UARA 2N5FA 1Z6MA 4KDXA 1F6MC 2K9FA 1XZOA 4YKGA 2YJ7A 1A24A 1O7UA 2CAIA 4WF4A 5ECIB 2HYXA 2LJRA 3TJKA 1K0CA 3PR8A 3GYKA 3M8NA 2FNOA 2LQOA 3TRPA 3FRCA 1J0FA 2X49A 2I1UA 2IL3A 2KHPA 2ALBA 5JCWA 4CW9A 4HQSA 4KDUA 2CVKA 3EVIA 3EMPA 2R4VA 2VAFA 4PURA 3SWLA 3HJMA 1B4QA 3HVVA 3FHKA 2DLXA 1GSSA 2FWFA 3P2AA 3ZITA 5CRHA 4ILFA 1XW6A 3EU3A 3TJJA 1O81A 4F0BA 3NZNA 4MH3A 5HR3A 2AUVA 1KTEA 1F3AA 3ZZXA 3TKSE 3HD5A 1X5CA 2UZ8A 4EKZA 2XBQA 4MLYA 2C3TA 4PQ1A 1F37A 2K6VA 4JZQA 3UOMA 4MK3A 4JBBA 3FYGA 4OFNA 2P31A 3TOUA 3IAS2 4TXOA 4G10A 1PGTA 4HZ4A 4I97A 3Q6OA 4DEJA 2VL2A 2B6MA 1F2EA 2B5XA 1U3IA 2AB6A 1GTAA 1OC9B 1WP0A 3O6TA 3O76A 1E2YA 2A2SA 4IVFA 2A2PA 3QOUA 2LKUA 4FYUA 3ZL5A 3QAWA 4K5RA 2WULA 2D2ZA 4RUVA 4DSQA 4WETA 1PX7A 2O7KA 5LNKe 1PD21 4HJ2A 5DCGA 4CHSA 2H72A 2GVPA 4LA1A 4JE1A 4HDEA 1S3CA 2GSTA 5ECQB 5JCGA 4WXTA 2MYGA 3BD2A 4OMVA 2EC4A 2XPDA 2IMKA 3F8UA 3KP9A 4MJCA 2JZSA 5GSTA 2LRNA 4KX4A 1YF0A 4Q5RA 5AISA 3HVXA 1ERTA 3WD6A 3D22A 14GSA 6GSXA 1TW9A 1WOUA 1R4WA 3MNGA 3F4RA 1XOBA 3W6GA 1XPVA 2TIRA 3LORA 2HSYA 1YF1A 5CO3A 4RQRA 3CXGA 1ZZYA 2H73A 1B9YC 5DVBA 1M9AA 3US3A 1UA5A 2DKHA 1VF2A 2VLUA 2A2RA 3UEMA 2ON7A 1PSQA 4XTSA 2NBSA 2JSYA 2O89A 2C0EA 4GSSA 3P8WA 2NPBA 4MMMA 5J9BA 3GHAA 4NPBA 3TKPA 4ZB8A 4JRRA 2RM6A 2RUEA 4BVYB 1EWXA 3WGDA 4XS6A 5HQPA 4LMVA 2HLSA 2Z9SA 3VI5A 3APOA 3UBLA 2MBTA 3GH9A 2REMA 5F0GA 2HZEA 2AYTA 5FT3A 5ECLB 1TI3A 2DMMA 3KCMA 1V2AA 1YZXA 4FH8A 3E9JB 3M1GA 1VF4A 4IJIA 1S3AA 1BG5A 2IMEA 1BAYA 2CV4A 2CAQA 2M46A 4WBRD 1M9BA 3TJGA 2OBKA 1XWAA 1NM3A 2B7KA 1K0DA 3RDWA 1TRVA 2H74A 1K0AA 5F07A 3VWXA 1OKDA 2CQ9A 2YWOA 2WS2A 3RBTA 4I6XA 3ZVJA 5IPGA 1MD4A 3IC4A 4ZB6A 1FO5A 1TJDA 1MDKA 1MDJA 4MF5A 1WWJA 3LJRA 3N9JA 1GTBA 4N11A 3VWVA 2R0PA 4O5QA 3ZIJA 2KP1A 1YY7A 1QFNA 4TXVA 2M80A 5ECKB 1DUGA 4EDYA 4ECJA 3KZQA 4GSNA 5JCUA 3EINA 1SK0A 3MYDA 4N10A 3LW9A 2YWNA 2L4QA 1SENA 2H0GA 2BMXA 3P90A 2VL2C 4BA7A 1BEDA 2LNSA 2OACA 4TW5A 1TRWA 2JU5A 3BOAA 4TR4A 4ECBA 4POLA 5CAXA 4MJEA 1G7OA 4G19A 4IKHA 1URMA 3FW2A 4HOJA 1TKDB 2ON5A 2DMLA 1TI1A 3GSSA 1NHOA 3J7Yk 4FO5A 6GSYA 1NW2A 2V32A 5B6MA 2N5AA 5ELAA 3HZ8A 5B8AA 1WJKA 5D96A 1W4VA 3GX8A 2KP2A 5ECNB 2JSZA 1TRUA 2LJAA 2GQKA 3GMFA 3L9SA 3FKFA 1DE1A 3Q19A 2R0CA 4G0LA 1SYXA 1UC7A 2R2JA 4MA9A 4GWRA 4V1Ap 4XS4A 4Q5NA 1X9WB 2FWHA 1Z3EA 4V2NA 3L9UA 5CRGA 4WR4A 1IYHA 1Z9HA 3CSJA 5JWRB 4OWYA 1A23A 2MMNA 1K3LA 2H0IA 2X8GA 2YP6A 4AJ6A 4PQHA 3KTBA 1EEJA 2F51A 4HS1A 1ZYQB 3KH9A 3UBKA 3DGQA 3DVXA 2R5GA 1MTCA 1A0RP 3Q18A 4K9ZA 4IP1A 2H71A 1O85A 2YOIA 4NMUA 1QK8A 4X4JA 5DALA 4L0UA 3TUEA 4ECCA 5G1LA 2O8VB 4TR0A 2FD3A 3C8EA 3F6DA 1EGRA 19GSA 3W8JA 4ID0A 2GT5A 4XIHA 1XFLA 4ML1A 3ZMLA 1JZDA 2CVBA 5EVOA 1DBYA 1GRXA 5CREA 4G0KA 2J23A 1KEBA 1USBA 1MEKA 4IN0A 1R7HA 2JZTA 4O32A 4K0NA 1ZOFA 4TXOB 3IHQA 2FY6A 5G31A 1XW5A 3QMXA 3KD0A 2DJ0A 3TGZA 3TOTA 3KTLA 1K0NA 1A0FA 2VM1A 2L5LA 2FA8A 2VCXA 2B3SA 1R5PA 1FOVA 1AQXA 4XHMA 5IIZA 1PKWA 1ILOA 2VD1A 3KM6A 1CQHA 1F9MA 2XC2A 5D9WA 5HFIA 5D8IA 2LRCA 4YKFA 2ZNMA 4YH2A 4EXJA 4QL9A 4JR4A 5DQYA 3UVTA 3A5WA 2GSQA 4WBJA 3ISOA 4I2UA 2G2QA 3TKSA 3IDVA 3IPZA 3VPQA 3GIXA 3BCIA 5A4UA 2WDUA 1PA3A 5J9CA 1LBKA 1TDIA 2DC5A 2N5BA 3FZ4A 1J08A 2VCTA 1GSYA 3ZTLA 1V98A 4ZL7A 1XVQA 4OFTA 1V40A 3WT1A 4ZBAA 1UN2A 1SL0B 2B5EA 1FVKA 5D9VA 5ABRA 2BJXA 3LYPA 3M9KA 1FHEA 5GAPD 2VCVA 3GKXA 3TJBA 4KF9A 3VWWA 5BRTA 2RM5A 4POBA 3C1RA 3H79A 2H1AA 4TKYA 4IELA 3CTGA 4ZBDA 2P5QA 3WT2A 3H8QA 1C72A 4KSOA 5J4UA 1MDIA 4MP4A 1AQVA 4MCUA 1E6BA 3DWVA 4FYBA 3HYPA 4IS0A 4IW9A 2F3MA 4POMA 4MF7A 4RI7A 1XOAA 3HHVA 5D9XA 3D5JA 2GQMA 3C7MA 2WFCA 4ISDA 3GRXA 2HZEB 4I8BA 4DSRA 1W89A 4OO5A 5CRWA 5GAND 4EO3A 3ED3A 5IMZA 3C73A 1BX9A 2H1GA 2HRNA 5IQYA 2FWGA 1TU8A 2PGTA 6GSWA 4N30A 3UAPA 2MMAA 4OFMA 2IFQA 1GLQA 5A5KA 1XWGA 3V1WA 4YQUA 3APSA 1TK0B 4K1FA 5H5RA 4E8HA 1PX6A 3I69A 4TR1B 3CSHA 2YN1A 3GUSA 4PXOA 20GSA 3TCOA 3LSZA 1FG4A 2QKEA 2LJKA 2LQQA 5JWOB 1T7PB 4F82A 4PNGA 2L6CA 3LGCA 5BMUA 2JADA 4NXIA 1M99A 1PL1A 2PBJA 4K7IA 1HNAA 1EEMA 1YQ1A 4KH7A 1G6WA 2QA2A 3HXSA 3QCPA 1Q4JA 2GDRA 3TKRA 2OADA 1NSWA 5DBQA 2LRTA 1R26A 1GUKA 2WB9A 2L5OA 3FZ9A 2PWJA 2H6XA 2X8HA 3FK8A 2H75A 3TDGA 3PPUA 4LMWA 3HKRA 2IPAA 3C71A 1H75A 2HXKA 2NDOA 1VF3A 3DMLA 2K8VA 3CRTA 4MPGA 1GSEA 2GTUA 1TK5B 4PUFC 4FIWA 2LNTA 3F3RA 2A4HA 4IQ1A 2OKAA 4ULXA 1Q98A 1PMTA 4TR3A 1GNWA 2IMIA 2EIOA 4AF2A 2YWIA 3AY8A 1K3YA 3FEUA 4IHUA 2WGRA 3PINA 4OD7A 5DJMA 2H6YA 2FCHA 2H66A 1THOA 3HVSA 3HCZA 3IXRA 5EL8A 2NVLA 1TTZA 3IA1A 3QDNA 1EP8A 4ZXGA 4E8EA 2PVQA 2L4CA 3TKSC 4BPYA 1QQ2A 2DJ2A 4O7HA 5CP1A 2L59A 3PGTA 2HSHA 4ZIJA 2O85A 3BJ5A 2HRFA 1IYIA 1ERVA 3O3TA 1T00A 4XS4B 2P0GA 1SK1A 2ZUPA 1PRXA 2YV7A 1GWCA 3MAKA 5AIVA 3IE3A 3D0ZA 2VD0A 4HU9A 1GLPA 5JWQB 6GSSA 1X5EA 5IMAA 4I5QA 4NHWA 4EIQA 1Z6NA 4QL7A 3EMXA 4F03A 3GL3A 3CRUA 2LTKA 4ZB9A 1FB0A 3DRNA 1TXXA 4HUAA 2J9HA 3MDKA 2PMTA 2CX3A 3CYNA 3IK9A 3DYRA 3IOSA 1SKRB 5DALB 3WGXA 3VPTA 3U5RE 2FA4A 2QGVA 3HJOA 4CY6A 1PL2A 3FZAA 3KP8A 3NOFA 1RK4A 4TVEA 2VCQA 3SBCA 1Z7PA 2P5RA 2HI7A 4TR1A 4BL7A 1V58A 4I2TA 4MJAA 3QR6A 2QC7A 2E7PA 3QFAC 2M72A 4J56E 2R0GA 4MABA 2VO4A 1EOHA 3IHGA 3ME8A 4MF6A 4X43A 4K7NA 3CBUA 5IOWA 1Z5YE 3EWLA 2DIYA 2NTOA 3RAZA 1GUHA 4Z2RA 4K2XA 1JZWA 2E2MA 1O8WA 1WRYA 2GZZA 1XBSA 5ECRB 3QAVA 4WKWA 3RPPA 3GFKA 4MH2A 5KN1A 1YEXA 4IQAA 5ENUA 5IM9A 5C00A 4AJ7A 1X5DA 2H19A 3UIWA 2YZUA 1ZYEA 1UVZA 2OE1A 2F8FA 1GSFA 1X9SB 2HE3A 2TRCP 4V2LA 3EE2A 4GLTA 4OCEA 5F8BA 1SJ6A 4KCEA 4TRXA 3IV4A 4N0VA 5F06A 1T8EB 1EV4A 3ZMKA 2F9SA 5IO0A 1B9XC 3UL3A 5A4VA 3R2QA 1KBNA 7GSSA 2WZ9A 1OC3A 4HZ2A 1PN0A 1U88A 3GKKA 1AUCA 2DJJA 4RQXA 3FR9A 4XCSA 4KCAA 2C4JA 2LV3A 1LU4A 2VIMA 1XWKA 3GKMA 4WF5A 4HI7A 5L71A 3ZIVA 4X1UA 2AHEA 4AGSA 2JACA 4X0XA 4G0IA 3BBYA 1FB6A 1YJ6A 2OE3A 1CQGA 3DEXA 2AJQB 1VGLA 5INYA 2FWEA 2YNXA 3RHCA 3VFIA 3FR3A 2KUCA 3HA9A 4KSMA 2VL9A 1YDKA 2L57A 2XPEA 1BQ7A 1M7TA 2FUG2 1OE7A 3VWUA 2IFQB 1TU7A 3DIEA 3EC3A 2E0QA 1X9MB 3HDCA 2JL4A 13GSA 5DJLA 5E59A 3KMOA 4IJ3A 1ABAA 3G7IA 3H4KA 4F9ZA 3IK7A 3ME7A 3IAM2 4HQZA 2FLSA 5B6NA 1GH2A 3D6IA 3LQ7A 2HRKA 1G7EA 4G2EA 1VRSD 4ZL8A 1JZRA 2G0FA 1ZYNA 5HR2A 2X64A 1Z7RA 2IWTA 4N0ZA 16GSA 3ZFBA 4NAXA 3QAGA 5GZZB 6GSUA 1JLWA 3GV1A 1X0RA 5D73A 2AV4A 2RIIA 4MZCA 4BVXB 2C3NA 4GQCA 4HU7A 4PQIA 1T1VA 2IN3A 1N8JA 5IMFA 2MMOA 1M0UA 2WJUA 5B7CA 5HR0A 1O8XA 3UVHA 2I4AA 4KNDA 4GTUA 1ZCPA 5FHIA 11GSA 2RUFA 2C8UA 2OA7A 1SYRA 3Q74A 5AIXA 3U6VA 4D73B 3VK9A 1LJRA 3WGEA 2H70A 1WPIA 5G1KA 1GSDA 3TJFA 2C0DA 3TKQA 3GX0A 3ZRDA 2EIRA 4Z2TA 4KDYA 1SJIA 1A8YA 5CRDA 4NV2A 1GSUA 22GSA 1TK8B 3HJPA 2YCDA 5ECPB 1Y6EA 2VUPA 4FQUA 2H8LA 4KAEA 1OAZA 4EF0A 1FVJA 3E0UA 10GSA 2VLVA 2CA8A 2GSSA 1HNCA 2I3YA 1EP7A 2C1YA 4PX1A 2A4VA 5E4WA 2R6KA 1YEPA 1JHBA 2KLXA 3N5OA 4L8EA 1AC1A 2DJ3A 2VLTA 3CMIA 4GCIA 6GSTA 1A2MA 2CX4A 4P3YB 1AIUA 2DKIA 5H5QA 4KE3A 4Q5QA 3LFLA 5KEJA 2X4AA 1H4OA 5GSSA 4BWQA 1B8XA 5C04A 3CTFA 4OO4A 1I5GA 3I9V2 3G7YA 3UJ1A 4YQMA 3GL5A 1EGOA 3LXZA 2YANA 3M0FA 1QMVA 3DKSA 3I43A 2CZ3A 3L0HA 1TRSA 2HT9A 4DVCA 3APQA 1GSQA 2HNLA 1A2JA 2RLIA 1JLVA 4GRFA 3IBHA 4WEYA 2VL3A 1GNEA 4PGTA 4BL7B 2WCIA 4K8MA 2OBIA 1GUMA 4USSA 3DVWA 3GKNA 3LG6A 2K18A 3TRQA 2PERA 3JCML 4TOPA 4KGIA 4J57E 1ZMAA 2GZPA 1ZGNA 3R3EA 3F6FA 1K0BA 17GSA 3ZYWA 4XRAA 5DAKA 3S9FA 1AW9A 2E2GA 4EC0A 5ECHB 3QD9A 4YQVA 1T3BA 4LL1B 5HFGA 4Q5FA 1ACVA 5KOWA 4GXZA 1EOGA 4BVXA 1K3OA 1GL8A 3EPTA 3GNJA 2GZYA 1K0OA 1SD9A 2H30A 2WRTA 1ERWA 1QXHA 4RI6A 4CDOA 2H76A 3I6AA 4KB3A 2VCWA 3FMWA 1OYJA 5ID2A 4L0WA 1S3DA 2ZCTA 1G0TA 4MPFA 1QGVA 3EU4A 4GF0A 2LSTA 2I81A 4D73A 2BTOT 3DD3A 1OVNA 1XVWA 3DXBA 3A5IA 1SL1B 2OE0A 3ERGA 1DSBA 1FAAA 1HNBA 1AXDA 3ZFLA 2H6ZA 2H1BA 5IMCA 5J5NA 2MBSA 2GS3A 5KN3A 4ACSA 2MZCA 1PN9A 2V2GA 2OJLA 3KH7A 4EVMA 3TRXA 2LS5A 2GLRA 4PNFA 1B4PA 3OR5A 1AAZA 4JR6A 2FHEA 4TN8A 1WE0A 5B8BA 5DCHA 1XXUA 2GGTA 2V1MA 1YKAA 2LEGA 2HSMA 5LCZA 3GTUB 4MDCA 9GSSA 3LEFA 4O5UA 4MZBA 3FY7A 2H1DA 4F0CA 5KN2A 4O92A 4MZWA 3F4SA 5LD0A 1U6TA 4GQFA 1SKWB 1BJXA 3L9VA 1ERUA 3E3EA 3A2XA 4A5PA 2B1LA 1HD2A 1SJZA 3GSTA 4NWYA 3M9JA 2B7JA 2TRXA 12GSA 3VI7A 1ON4A 1O6JA 4YAPA 4ECIA 3FZ5A 3IRAA 1A2LA 2PVOC 2DJKA 2H0HA 5D9TA 1TP9A 1V9WA 4YAVA 4QQ7A 1YKCA 3QPMA 5IMDA 5CNWA 3HY2A 5J41A 2R3XA 2QA1A 2QSIA 1KNGA 3J7Yb 3A2VA 6GSVA 1WMJA 1K0MA 2DIZA 4IBPA 4F2IA 2YZHA 3F3QA 3RPNA 2K8SA 5IMVA 2XHFA 1ZYPA 3D21A 2GT6A 5AGYA 2EIQA 1XIYA 5D93A 1JFUA 2O87A 3NIVA 5HR1A 1GTIA 2JZRA 4KUNA 4NV5A 3UMAA 3MWHA 5ECSA 2F8AA 1M2DA 4IGJA 3IC8A 5F05A 4BWSA 3MIXA 3VURA 2V6KA 2C80A 3K8NA 2PUKC 3ZLPA 1J9BA 1B48A 1NHYA 3L78A 1OC9A 1FW1A 4NHZA 2IMDA 4XS1A 3G9BA 1XW9A 1SL2B 1Y25A 3KEBA 1GULA 2VCZA 3GH6A 3GA4A 4KW6A 3EURA 4H86A 2PPTA 4OCFA 5ELGA 3KJYA 3A3TA 1DE2A 2IJYA 4MJBA 4WR5A 1MD3A 1RQMA 5DQSA 4IP6A 1G6YA 5G5EA 4PUAA 3F0IA 3WYWA 1R5AA 5H5SA 2C3QA 4XRDA 4DSSB 1HQOA 3LXTA 1SK2A 4ICYA 1AQWA 2H01A 3BCKA 1U3AA 2HFDA 3F63A 2V6OA 3MSZA 5A4WA 4Z2UA 4J2FA 18GSA 1THXA 1QUWA 5J3RA 1OC8A 4HJMA 5KOXA 3ERFA 4Z7XA 2LUSA 2VOCA 4K5SA 4MNNA 2HZFA 4O5RA 1GP1A 3GTUA 4V2MA 4K7OA 1SD8A 5AN1A 4K6XA 4V1Ag 3LWAA 4JU5A 1M2BA 3ZREA 5IOXA 3RHBA 2IMFA 2HRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERW A;  1RW1 A;  3KXO A;  4BVY A;  1GTU A;  2AAW A;  2MMZ A;  2ES7 A;  2PN8 A;  1JZO A;  2YWM A;  2XBI A;  4EDZ A;  3H1N A;  1OE8 A;  3L4N A;  4ZIL A;  3H93 A;  3KMN A;  2C0F A;  5IO2 A;  2DBC A;  2DSA A;  4AJ8 A;  3W8S A;  1EZK A;  1XWC A;  5EPF A;  1PQN A;  1A8L A;  2CT6 A;  3A2W A;  1SU9 A;  2IIY A;  3M3M A;  1XWB A;  4POK A;  5EY6 A;  4ZBB A;  4K2D A;  3IR4 A;  2X99 A;  4JED A;  5FWG A;  2B5Y A;  5DAK B;  2CZ2 A;  4EE0 A;  1V57 A;  3GN3 A;  3QFB C;  2V41 A;  3D4T A;  5DDL A;  4ZL9 A;  3F9U A;  3GUR A;  2I9H A;  3FR6 A;  3D4M A;  5ECM B;  3P7X A;  4L5L A;  1T4Z A;  3KGK A;  2B1K A;  4FYC A;  1F3B A;  1OKT A;  4LL4 B;  2KOK A;  1M2A A;  4HEA 2;  4G9H A;  1U87 A;  5G30 A;  2C0G A;  1I9D A;  3F4T A;  2DJ1 A;  3KIJ A;  3CSI A;  2X8C A;  5ID2 B;  3VLN A;  8GSS A;  1PKZ A;  1HYU A;  5CYY A;  1N2A A;  2FGX A;  3G7J A;  4ML6 A;  2CVD A;  4EUY A;  4L5O A;  5KN0 A;  1TOF A;  1O73 A;  4K0G A;  1WIK A;  4LLR A;  4EL1 A;  1BYE A;  5G2Z A;  1ML6 A;  1T4Y A;  1ST9 A;  5COH A;  5HFK A;  2VM2 A;  4GST A;  2L6D A;  1XCC A;  3EYT A;  5G5F A;  1VF1 A;  3PH9 A;  2GSR A;  4DSS A;  3TB2 A;  5ECO B;  2R37 A;  3HZ4 A;  2YV9 A;  1SKS B;  2YJH A;  3ZVJ D;  3C1S A;  3LYK A;  2GQL A;  4KA0 A;  2PU9 C;  5IPH A;  1EV9 A;  1ZL9 A;  2YPM A;  3UAR A;  2N5F A;  1Z6M A;  4KDX A;  1F6M C;  2K9F A;  1XZO A;  2YJ7 A;  1A24 A;  1O7U A;  2CAI A;  4WF4 A;  5ECI B;  2HYX A;  2LJR A;  3TJK A;  1K0C A;  3PR8 A;  3GYK A;  3M8N A;  2FNO A;  2LQO A;  3TRP A;  3FRC A;  1J0F A;  2I1U A;  2IL3 A;  2KHP A;  2ALB A;  5JCW A;  4CW9 A;  4HQS A;  4KDU A;  2CVK A;  3EVI A;  3EMP A;  2R4V A;  2VAF A;  4PUR A;  3SWL A;  3HJM A;  1B4Q A;  3HVV A;  3FHK A;  2DLX A;  1GSS A;  2FWF A;  3P2A A;  3ZIT A;  5CRH A;  4ILF A;  1XW6 A;  3EU3 A;  3TJJ A;  1O81 A;  4F0B A;  3NZN A;  4MH3 A;  5HR3 A;  2AUV A;  1KTE A;  1F3A A;  3ZZX A;  3TKS E;  3HD5 A;  1X5C A;  4EKZ A;  2XBQ A;  4MLY A;  2C3T A;  4PQ1 A;  1F37 A;  2K6V A;  4JZQ A;  3UOM A;  4MK3 A;  4JBB A;  3FYG A;  4OFN A;  2P31 A;  3TOU A;  3IAS 2;  4TXO A;  4G10 A;  1PGT A;  4HZ4 A;  4I97 A;  3Q6O A;  4DEJ A;  2VL2 A;  2B6M A;  1F2E A;  2B5X A;  1U3I A;  2AB6 A;  1GTA A;  1OC9 B;  1WP0 A;  3O6T A;  3O76 A;  1E2Y A;  2A2S A;  4IVF A;  3QOU A;  2LKU A;  4FYU A;  3ZL5 A;  3QAW A;  2WUL A;  2D2Z A;  4RUV A;  4DSQ A;  4WET A;  1PX7 A;  2O7K A;  5LNK e;  1PD2 1;  4HJ2 A;  5DCG A;  4CHS A;  2H72 A;  2GVP A;  4LA1 A;  4JE1 A;  4HDE A;  1S3C A;  2GST A;  5ECQ B;  5JCG A;  4WXT A;  2MYG A;  3BD2 A;  4OMV A;  2EC4 A;  2XPD A;  2IMK A;  3F8U A;  3KP9 A;  4MJC A;  2JZS A;  5GST A;  2LRN A;  4KX4 A;  1YF0 A;  4Q5R A;  5AIS A;  3HVX A;  1ERT A;  3WD6 A;  3D22 A;  14GS A;  6GSX A;  1TW9 A;  1WOU A;  1R4W A;  3MNG A;  3F4R A;  1XOB A;  3W6G A;  1XPV A;  2TIR A;  3LOR A;  2HSY A;  1YF1 A;  5CO3 A;  4RQR A;  3CXG A;  1ZZY A;  2H73 A;  1B9Y C;  5DVB A;  1M9A A;  3US3 A;  1UA5 A;  1VF2 A;  2VLU A;  2A2R A;  3UEM A;  2ON7 A;  1PSQ A;  4XTS A;  2NBS A;  2JSY A;  2O89 A;  2C0E A;  4GSS A;  3P8W A;  2NPB A;  4MMM A;  5J9B A;  3GHA A;  4NPB A;  3TKP A;  4ZB8 A;  4JRR A;  2RM6 A;  2RUE A;  1EWX A;  3WGD A;  4XS6 A;  5HQP A;  4LMV A;  2HLS A;  2Z9S A;  3VI5 A;  3APO A;  3UBL A;  2MBT A;  3GH9 A;  2REM A;  5F0G A;  2HZE A;  2AYT A;  5FT3 A;  5ECL B;  1TI3 A;  2DMM A;  3KCM A;  1V2A A;  1YZX A;  4FH8 A;  3E9J B;  3M1G A;  1VF4 A;  4IJI A;  1S3A A;  1BG5 A;  2IME A;  1BAY A;  2CV4 A;  2CAQ A;  2M46 A;  4WBR D;  1M9B A;  3TJG A;  2OBK A;  1XWA A;  1NM3 A;  2B7K A;  1K0D A;  3RDW A;  1TRV A;  2H74 A;  1K0A A;  5F07 A;  3VWX A;  1OKD A;  2CQ9 A;  2YWO A;  2WS2 A;  3RBT A;  4I6X A;  3ZVJ A;  5IPG A;  1MD4 A;  3IC4 A;  4ZB6 A;  1FO5 A;  1TJD A;  1MDK A;  1MDJ A;  4MF5 A;  1WWJ A;  3LJR A;  3N9J A;  1GTB A;  4N11 A;  3VWV A;  3ZIJ A;  2KP1 A;  1YY7 A;  1QFN A;  4TXV A;  2M80 A;  5ECK B;  1DUG A;  4EDY A;  4ECJ A;  3KZQ A;  4GSN A;  5JCU A;  3EIN A;  1SK0 A;  4N10 A;  2YWN A;  2L4Q A;  1SEN A;  2H0G A;  2BMX A;  3P90 A;  2VL2 C;  4BA7 A;  1BED A;  2LNS A;  2OAC A;  4TW5 A;  1TRW A;  2JU5 A;  3BOA A;  4TR4 A;  4ECB A;  4POL A;  5CAX A;  4MJE A;  1G7O A;  4G19 A;  4IKH A;  1URM A;  3FW2 A;  4HOJ A;  1TKD B;  2ON5 A;  2DML A;  1TI1 A;  3GSS A;  1NHO A;  3J7Y k;  4FO5 A;  6GSY A;  1NW2 A;  2V32 A;  5B6M A;  2N5A A;  5ELA A;  3HZ8 A;  5B8A A;  1WJK A;  5D96 A;  1W4V A;  3GX8 A;  2KP2 A;  5ECN B;  2JSZ A;  1TRU A;  2LJA A;  2GQK A;  3GMF A;  3L9S A;  3FKF A;  1DE1 A;  3Q19 A;  1SYX A;  1UC7 A;  2R2J A;  4MA9 A;  4GWR A;  4V1A p;  4XS4 A;  4Q5N A;  1X9W B;  2FWH A;  1Z3E A;  4V2N A;  3L9U A;  5CRG A;  4WR4 A;  1IYH A;  1Z9H A;  3CSJ A;  5JWR B;  4OWY A;  1A23 A;  2MMN A;  1K3L A;  2H0I A;  2X8G A;  2YP6 A;  4AJ6 A;  4PQH A;  3KTB A;  1EEJ A;  2F51 A;  4HS1 A;  1ZYQ B;  3KH9 A;  3UBK A;  3DGQ A;  3DVX A;  2R5G A;  1MTC A;  1A0R P;  3Q18 A;  4K9Z A;  4IP1 A;  2H71 A;  1O85 A;  2YOI A;  4NMU A;  1QK8 A;  5DAL A;  4L0U A;  3TUE A;  4ECC A;  5G1L A;  2O8V B;  4TR0 A;  2FD3 A;  3C8E A;  3F6D A;  1EGR A;  19GS A;  3W8J A;  4ID0 A;  2GT5 A;  4XIH A;  1XFL A;  4ML1 A;  3ZML A;  1JZD A;  2CVB A;  5EVO A;  1DBY A;  1GRX A;  5CRE A;  2J23 A;  1KEB A;  1USB A;  1MEK A;  4IN0 A;  1R7H A;  2JZT A;  4O32 A;  4K0N A;  1ZOF A;  4TXO B;  3IHQ A;  2FY6 A;  5G31 A;  1XW5 A;  3QMX A;  3KD0 A;  2DJ0 A;  3TGZ A;  3TOT A;  3KTL A;  1K0N A;  1A0F A;  2VM1 A;  2L5L A;  2FA8 A;  2VCX A;  2B3S A;  1R5P A;  1FOV A;  1AQX A;  4XHM A;  5IIZ A;  1PKW A;  1ILO A;  2VD1 A;  3KM6 A;  1CQH A;  1F9M A;  2XC2 A;  5D9W A;  5HFI A;  5D8I A;  2LRC A;  2ZNM A;  4YH2 A;  4EXJ A;  4QL9 A;  4JR4 A;  5DQY A;  3UVT A;  3A5W A;  2GSQ A;  4WBJ A;  3ISO A;  4I2U A;  2G2Q A;  3TKS A;  3IDV A;  3IPZ A;  3VPQ A;  3GIX A;  3BCI A;  5A4U A;  2WDU A;  1PA3 A;  5J9C A;  1LBK A;  1TDI A;  2DC5 A;  2N5B A;  3FZ4 A;  1J08 A;  2VCT A;  1GSY A;  3ZTL A;  1V98 A;  4ZL7 A;  1XVQ A;  4OFT A;  1V40 A;  3WT1 A;  4ZBA A;  1UN2 A;  1SL0 B;  2B5E A;  1FVK A;  5D9V A;  5ABR A;  2BJX A;  3LYP A;  3M9K A;  1FHE A;  5GAP D;  2VCV A;  3GKX A;  3TJB A;  3VWW A;  2RM5 A;  4POB A;  3C1R A;  3H79 A;  2H1A A;  4TKY A;  4IEL A;  3CTG A;  4ZBD A;  2P5Q A;  3WT2 A;  3H8Q A;  1C72 A;  4KSO A;  5J4U A;  1MDI A;  4MP4 A;  1AQV A;  4MCU A;  1E6B A;  3DWV A;  4FYB A;  3HYP A;  4IS0 A;  4IW9 A;  2F3M A;  4POM A;  4MF7 A;  4RI7 A;  1XOA A;  3HHV A;  5D9X A;  3D5J A;  2GQM A;  3C7M A;  2WFC A;  4ISD A;  3GRX A;  2HZE B;  4I8B A;  4DSR A;  1W89 A;  4OO5 A;  5CRW A;  5GAN D;  4EO3 A;  3ED3 A;  5IMZ A;  3C73 A;  1BX9 A;  2H1G A;  2HRN A;  5IQY A;  2FWG A;  1TU8 A;  2PGT A;  6GSW A;  4N30 A;  3UAP A;  2MMA A;  4OFM A;  2IFQ A;  1GLQ A;  5A5K A;  1XWG A;  3V1W A;  4YQU A;  3APS A;  1TK0 B;  4K1F A;  5H5R A;  4E8H A;  1PX6 A;  3I69 A;  4TR1 B;  3CSH A;  2YN1 A;  3GUS A;  4PXO A;  20GS A;  3TCO A;  3LSZ A;  1FG4 A;  2QKE A;  2LJK A;  2LQQ A;  5JWO B;  1T7P B;  4F82 A;  4PNG A;  2L6C A;  3LGC A;  2JAD A;  4NXI A;  1M99 A;  1PL1 A;  2PBJ A;  4K7I A;  1HNA A;  1EEM A;  1YQ1 A;  4KH7 A;  1G6W A;  3HXS A;  3QCP A;  1Q4J A;  2GDR A;  3TKR A;  2OAD A;  1NSW A;  5DBQ A;  2LRT A;  1R26 A;  1GUK A;  2WB9 A;  2L5O A;  3FZ9 A;  2PWJ A;  2H6X A;  2X8H A;  3FK8 A;  2H75 A;  3TDG A;  4LMW A;  3HKR A;  2IPA A;  3C71 A;  1H75 A;  2HXK A;  2NDO A;  1VF3 A;  3DML A;  2K8V A;  3CRT A;  4MPG A;  1GSE A;  2GTU A;  1TK5 B;  4PUF C;  4FIW A;  2LNT A;  3F3R A;  4IQ1 A;  2OKA A;  4ULX A;  1Q98 A;  1PMT A;  4TR3 A;  1GNW A;  2IMI A;  2EIO A;  4AF2 A;  2YWI A;  3AY8 A;  1K3Y A;  3FEU A;  4IHU A;  2WGR A;  3PIN A;  4OD7 A;  5DJM A;  2H6Y A;  2FCH A;  2H66 A;  1THO A;  3HVS A;  3HCZ A;  3IXR A;  5EL8 A;  2NVL A;  1TTZ A;  3IA1 A;  3QDN A;  1EP8 A;  4ZXG A;  4E8E A;  2PVQ A;  2L4C A;  3TKS C;  4BPY A;  1QQ2 A;  2DJ2 A;  4O7H A;  5CP1 A;  2L59 A;  3PGT A;  2HSH A;  4ZIJ A;  2O85 A;  3BJ5 A;  2HRF A;  1IYI A;  1ERV A;  3O3T A;  1T00 A;  4XS4 B;  2P0G A;  1SK1 A;  2ZUP A;  1PRX A;  2YV7 A;  1GWC A;  3MAK A;  5AIV A;  3IE3 A;  3D0Z A;  2VD0 A;  4HU9 A;  1GLP A;  5JWQ B;  6GSS A;  1X5E A;  5IMA A;  4I5Q A;  4NHW A;  1Z6N A;  4QL7 A;  3EMX A;  4F03 A;  3GL3 A;  3CRU A;  2LTK A;  4ZB9 A;  1FB0 A;  3DRN A;  1TXX A;  4HUA A;  2J9H A;  3MDK A;  2PMT A;  2CX3 A;  3CYN A;  3IK9 A;  3DYR A;  3IOS A;  1SKR B;  5DAL B;  3WGX A;  3VPT A;  3U5R E;  2FA4 A;  2QGV A;  3HJO A;  1PL2 A;  3FZA A;  3KP8 A;  3NOF A;  1RK4 A;  4TVE A;  2VCQ A;  3SBC A;  1Z7P A;  2P5R A;  2HI7 A;  4TR1 A;  4BL7 A;  1V58 A;  4I2T A;  4MJA A;  3QR6 A;  2QC7 A;  2E7P A;  3QFA C;  2M72 A;  4J56 E;  4MAB A;  2VO4 A;  1EOH A;  3ME8 A;  4MF6 A;  4X43 A;  4K7N A;  3CBU A;  5IOW A;  1Z5Y E;  3EWL A;  2DIY A;  2NTO A;  3RAZ A;  1GUH A;  1JZW A;  2E2M A;  1O8W A;  1WRY A;  2GZZ A;  1XBS A;  5ECR B;  3QAV A;  4WKW A;  3RPP A;  3GFK A;  4MH2 A;  5KN1 A;  1YEX A;  4IQA A;  5ENU A;  5IM9 A;  5C00 A;  4AJ7 A;  1X5D A;  2H19 A;  3UIW A;  2YZU A;  1ZYE A;  1UVZ A;  2OE1 A;  2F8F A;  1GSF A;  1X9S B;  2HE3 A;  2TRC P;  4V2L A;  3EE2 A;  4GLT A;  4OCE A;  5F8B A;  1SJ6 A;  4KCE A;  4TRX A;  3IV4 A;  4N0V A;  5F06 A;  1T8E B;  1EV4 A;  3ZMK A;  2F9S A;  5IO0 A;  1B9X C;  3UL3 A;  5A4V A;  3R2Q A;  1KBN A;  7GSS A;  2WZ9 A;  1OC3 A;  4HZ2 A;  1U88 A;  3GKK A;  1AUC A;  2DJJ A;  4RQX A;  3FR9 A;  4XCS A;  4KCA A;  2C4J A;  2LV3 A;  1LU4 A;  2VIM A;  1XWK A;  3GKM A;  4WF5 A;  4HI7 A;  5L71 A;  3ZIV A;  4X1U A;  2AHE A;  4AGS A;  2JAC A;  4X0X A;  3BBY A;  1FB6 A;  1YJ6 A;  2OE3 A;  1CQG A;  3DEX A;  2AJQ B;  1VGL A;  5INY A;  2FWE A;  2YNX A;  3RHC A;  3VFI A;  3FR3 A;  2KUC A;  3HA9 A;  4KSM A;  2VL9 A;  1YDK A;  2L57 A;  2XPE A;  1BQ7 A;  1M7T A;  2FUG 2;  1OE7 A;  3VWU A;  2IFQ B;  1TU7 A;  3DIE A;  3EC3 A;  2E0Q A;  1X9M B;  3HDC A;  2JL4 A;  13GS A;  5DJL A;  5E59 A;  3KMO A;  4IJ3 A;  1ABA A;  3G7I A;  3H4K A;  4F9Z A;  3IK7 A;  3ME7 A;  3IAM 2;  4HQZ A;  2FLS A;  5B6N A;  1GH2 A;  3D6I A;  3LQ7 A;  1G7E A;  4G2E A;  1VRS D;  4ZL8 A;  1JZR A;  2G0F A;  5HR2 A;  2X64 A;  1Z7R A;  2IWT A;  4N0Z A;  16GS A;  3ZFB A;  4NAX A;  3QAG A;  5GZZ B;  6GSU A;  1JLW A;  3GV1 A;  1X0R A;  5D73 A;  2AV4 A;  2RII A;  4MZC A;  2C3N A;  4GQC A;  4HU7 A;  4PQI A;  1T1V A;  2IN3 A;  1N8J A;  5IMF A;  2MMO A;  1M0U A;  2WJU A;  5B7C A;  5HR0 A;  1O8X A;  3UVH A;  2I4A A;  4KND A;  4GTU A;  1ZCP A;  5FHI A;  11GS A;  2RUF A;  2C8U A;  2OA7 A;  1SYR A;  3Q74 A;  5AIX A;  3U6V A;  4D73 B;  3VK9 A;  1LJR A;  3WGE A;  2H70 A;  1WPI A;  5G1K A;  1GSD A;  3TJF A;  2C0D A;  3TKQ A;  3GX0 A;  3ZRD A;  2EIR A;  4KDY A;  1SJI A;  1A8Y A;  5CRD A;  4NV2 A;  1GSU A;  22GS A;  1TK8 B;  3HJP A;  2YCD A;  5ECP B;  1Y6E A;  2VUP A;  2H8L A;  4KAE A;  1OAZ A;  4EF0 A;  1FVJ A;  3E0U A;  10GS A;  2VLV A;  2CA8 A;  2GSS A;  1HNC A;  2I3Y A;  1EP7 A;  2C1Y A;  4PX1 A;  2A4V A;  5E4W A;  2R6K A;  1YEP A;  1JHB A;  2KLX A;  3N5O A;  4L8E A;  1AC1 A;  2DJ3 A;  2VLT A;  3CMI A;  4GCI A;  6GST A;  1A2M A;  2CX4 A;  4P3Y B;  1AIU A;  5H5Q A;  4KE3 A;  4Q5Q A;  3LFL A;  5KEJ A;  1H4O A;  5GSS A;  4BWQ A;  1B8X A;  5C04 A;  3CTF A;  4OO4 A;  1I5G A;  3I9V 2;  3G7Y A;  3UJ1 A;  4YQM A;  3GL5 A;  1EGO A;  3LXZ A;  2YAN A;  3M0F A;  1QMV A;  3DKS A;  3I43 A;  2CZ3 A;  3L0H A;  1TRS A;  2HT9 A;  4DVC A;  3APQ A;  1GSQ A;  2HNL A;  1A2J A;  2RLI A;  1JLV A;  4GRF A;  3IBH A;  4WEY A;  2VL3 A;  1GNE A;  4PGT A;  2WCI A;  4K8M A;  2OBI A;  1GUM A;  3DVW A;  3GKN A;  3LG6 A;  2K18 A;  3TRQ A;  2PER A;  3JCM L;  4TOP A;  4KGI A;  4J57 E;  1ZMA A;  2GZP A;  1ZGN A;  3F6F A;  1K0B A;  17GS A;  3ZYW A;  4XRA A;  5DAK A;  3S9F A;  1AW9 A;  2E2G A;  4EC0 A;  5ECH B;  3QD9 A;  4YQV A;  1T3B A;  4LL1 B;  5HFG A;  4Q5F A;  1ACV A;  4GXZ A;  1EOG A;  4BVX A;  1K3O A;  1GL8 A;  3GNJ A;  2GZY A;  1K0O A;  1SD9 A;  2H30 A;  2WRT A;  1ERW A;  1QXH A;  4RI6 A;  4CDO A;  2H76 A;  3I6A A;  4KB3 A;  2VCW A;  1OYJ A;  5ID2 A;  4L0W A;  1S3D A;  2ZCT A;  1G0T A;  4MPF A;  1QGV A;  3EU4 A;  4GF0 A;  2LST A;  2I81 A;  4D73 A;  2BTO T;  3DD3 A;  1OVN A;  1XVW A;  3DXB A;  1SL1 B;  2OE0 A;  3ERG A;  1DSB A;  1FAA A;  1HNB A;  1AXD A;  3ZFL A;  2H6Z A;  2H1B A;  5IMC A;  5J5N A;  2MBS A;  2GS3 A;  5KN3 A;  4ACS A;  2MZC A;  1PN9 A;  2V2G A;  2OJL A;  3KH7 A;  4EVM A;  3TRX A;  2LS5 A;  2GLR A;  4PNF A;  1B4P A;  3OR5 A;  1AAZ A;  4JR6 A;  2FHE A;  4TN8 A;  1WE0 A;  5B8B A;  5DCH A;  1XXU A;  2GGT A;  2V1M A;  1YKA A;  2LEG A;  5LCZ A;  3GTU B;  4MDC A;  9GSS A;  3LEF A;  4MZB A;  3FY7 A;  2H1D A;  4F0C A;  5KN2 A;  4O92 A;  4MZW A;  3F4S A;  5LD0 A;  1U6T A;  4GQF A;  1SKW B;  1BJX A;  3L9V A;  1ERU A;  3E3E A;  3A2X A;  2B1L A;  1HD2 A;  1SJZ A;  3GST A;  4NWY A;  3M9J A;  2B7J A;  2TRX A;  12GS A;  3VI7 A;  1ON4 A;  1O6J A;  4YAP A;  4ECI A;  3FZ5 A;  3IRA A;  1A2L A;  2PVO C;  2DJK A;  2H0H A;  5D9T A;  1TP9 A;  1V9W A;  4YAV A;  4QQ7 A;  1YKC A;  3QPM A;  5IMD A;  5CNW A;  3HY2 A;  5J41 A;  2R3X A;  2QSI A;  1KNG A;  3J7Y b;  3A2V A;  6GSV A;  1WMJ A;  1K0M A;  2DIZ A;  4IBP A;  4F2I A;  2YZH A;  3F3Q A;  3RPN A;  2K8S A;  5IMV A;  2XHF A;  3D21 A;  2GT6 A;  5AGY A;  2EIQ A;  1XIY A;  5D93 A;  1JFU A;  2O87 A;  3NIV A;  5HR1 A;  1GTI A;  2JZR A;  4KUN A;  4NV5 A;  3UMA A;  3MWH A;  5ECS A;  2F8A A;  1M2D A;  4IGJ A;  5F05 A;  4BWS A;  3VUR A;  2V6K A;  2C80 A;  3K8N A;  2PUK C;  3ZLP A;  1J9B A;  1B48 A;  1NHY A;  3L78 A;  1OC9 A;  1FW1 A;  4NHZ A;  2IMD A;  4XS1 A;  3G9B A;  1XW9 A;  1SL2 B;  1Y25 A;  3KEB A;  1GUL A;  2VCZ A;  3GH6 A;  3GA4 A;  4KW6 A;  3EUR A;  4H86 A;  2PPT A;  4OCF A;  5ELG A;  3KJY A;  3A3T A;  1DE2 A;  2IJY A;  4MJB A;  4WR5 A;  1MD3 A;  1RQM A;  5DQS A;  4IP6 A;  1G6Y A;  5G5E A;  4PUA A;  3F0I A;  3WYW A;  1R5A A;  5H5S A;  2C3Q A;  4XRD A;  4DSS B;  1HQO A;  3LXT A;  1SK2 A;  1AQW A;  2H01 A;  3BCK A;  1U3A A;  2HFD A;  3F63 A;  2V6O A;  3MSZ A;  5A4W A;  4J2F A;  18GS A;  1THX A;  1QUW A;  5J3R A;  1OC8 A;  4HJM A;  3ERF A;  4Z7X A;  2LUS A;  2VOC A;  2HZF A;  4O5R A;  1GP1 A;  3GTU A;  4V2M A;  4K7O A;  1SD8 A;  5AN1 A;  4K6X A;  4V1A g;  3LWA A;  4JU5 A;  1M2B A;  3ZRE A;  5IOX A;  3RHB A;  2IMF A; 
#chains in the Genus database with same CATH topology
 3ERW A;  1RW1 A;  3KXO A;  1XG8 A;  4BVY A;  1GTU A;  2AAW A;  2MMZ A;  2ES7 A;  2PN8 A;  1JZO A;  2YWM A;  2XBI A;  4EDZ A;  3H1N A;  1OE8 A;  3L4N A;  4ZIL A;  1S3R A;  3H93 A;  3KMN A;  2C0F A;  5IO2 A;  2DBC A;  2DSA A;  4AJ8 A;  3W8S A;  1EZK A;  1XWC A;  4CY8 A;  5EPF A;  1PQN A;  1A8L A;  2CT6 A;  3A2W A;  1SU9 A;  2IIY A;  3M3M A;  1XWB A;  4POK A;  5EY6 A;  4ZBB A;  4K2D A;  3IR4 A;  2X99 A;  4JED A;  5FWG A;  2B5Y A;  5DAK B;  2CZ2 A;  4EE0 A;  1V57 A;  1FOH A;  3GN3 A;  3QFB C;  2V41 A;  3D4T A;  5DDL A;  4ZL9 A;  3F9U A;  3GUR A;  2I9H A;  3FR6 A;  3D4M A;  5ECM B;  3P7X A;  4L5L A;  1T4Z A;  3KGK A;  2B1K A;  4FYC A;  1F3B A;  1OKT A;  4LL4 B;  2KOK A;  1M2A A;  4HEA 2;  4G9H A;  1U87 A;  5G30 A;  2C0G A;  1I9D A;  3F4T A;  2DJ1 A;  3KIJ A;  3CSI A;  2X8C A;  5ID2 B;  3VLN A;  8GSS A;  1PKZ A;  1HYU A;  5CYY A;  1N2A A;  2FGX A;  3G7J A;  4ML6 A;  2CVD A;  4PTS A;  4EUY A;  4L5O A;  5KN0 A;  1TOF A;  1O73 A;  4K0G A;  4EIP A;  1WIK A;  4LLR A;  4EL1 A;  1BYE A;  5G2Z A;  1ML6 A;  1T4Y A;  1ST9 A;  5COH A;  5HFK A;  2VM2 A;  4GST A;  2L6D A;  1XCC A;  3EYT A;  5G5F A;  1VF1 A;  3PH9 A;  2GSR A;  4DSS A;  3TB2 A;  5ECO B;  2R37 A;  3HZ4 A;  2YV9 A;  1SKS B;  2YJH A;  3ZVJ D;  3C1S A;  3LYK A;  2GQL A;  4KA0 A;  2PU9 C;  5IPH A;  1EV9 A;  1ZL9 A;  2YPM A;  3UAR A;  2N5F A;  1Z6M A;  4KDX A;  1F6M C;  2K9F A;  1XZO A;  4YKG A;  2YJ7 A;  1A24 A;  1O7U A;  2CAI A;  4WF4 A;  5ECI B;  2HYX A;  2LJR A;  3TJK A;  1K0C A;  3PR8 A;  3GYK A;  3M8N A;  2FNO A;  2LQO A;  3TRP A;  3FRC A;  1J0F A;  2X49 A;  2I1U A;  2IL3 A;  2KHP A;  2ALB A;  5JCW A;  4CW9 A;  4HQS A;  4KDU A;  2CVK A;  3EVI A;  3EMP A;  2R4V A;  2VAF A;  4PUR A;  3SWL A;  3HJM A;  1B4Q A;  3HVV A;  3FHK A;  2DLX A;  1GSS A;  2FWF A;  3P2A A;  3ZIT A;  5CRH A;  4ILF A;  1XW6 A;  3EU3 A;  3TJJ A;  1O81 A;  4F0B A;  3NZN A;  4MH3 A;  5HR3 A;  2AUV A;  1KTE A;  1F3A A;  3ZZX A;  3TKS E;  3HD5 A;  1X5C A;  2UZ8 A;  4EKZ A;  2XBQ A;  4MLY A;  2C3T A;  4PQ1 A;  1F37 A;  2K6V A;  4JZQ A;  3UOM A;  4MK3 A;  4JBB A;  3FYG A;  4OFN A;  2P31 A;  3TOU A;  3IAS 2;  4TXO A;  4G10 A;  1PGT A;  4HZ4 A;  4I97 A;  3Q6O A;  4DEJ A;  2VL2 A;  2B6M A;  1F2E A;  2B5X A;  1U3I A;  2AB6 A;  1GTA A;  1OC9 B;  1WP0 A;  3O6T A;  3O76 A;  1E2Y A;  2A2S A;  4IVF A;  2A2P A;  3QOU A;  2LKU A;  4FYU A;  3ZL5 A;  3QAW A;  4K5R A;  2WUL A;  2D2Z A;  4RUV A;  4DSQ A;  4WET A;  1PX7 A;  2O7K A;  5LNK e;  1PD2 1;  4HJ2 A;  5DCG A;  4CHS A;  2H72 A;  2GVP A;  4LA1 A;  4JE1 A;  4HDE A;  1S3C A;  2GST A;  5ECQ B;  5JCG A;  4WXT A;  2MYG A;  3BD2 A;  4OMV A;  2EC4 A;  2XPD A;  2IMK A;  3F8U A;  3KP9 A;  4MJC A;  2JZS A;  5GST A;  2LRN A;  4KX4 A;  1YF0 A;  4Q5R A;  5AIS A;  3HVX A;  1ERT A;  3WD6 A;  3D22 A;  14GS A;  6GSX A;  1TW9 A;  1WOU A;  1R4W A;  3MNG A;  3F4R A;  1XOB A;  3W6G A;  1XPV A;  2TIR A;  3LOR A;  2HSY A;  1YF1 A;  5CO3 A;  4RQR A;  3CXG A;  1ZZY A;  2H73 A;  1B9Y C;  5DVB A;  1M9A A;  3US3 A;  1UA5 A;  2DKH A;  1VF2 A;  2VLU A;  2A2R A;  3UEM A;  2ON7 A;  1PSQ A;  4XTS A;  2NBS A;  2JSY A;  2O89 A;  2C0E A;  4GSS A;  3P8W A;  2NPB A;  4MMM A;  5J9B A;  3GHA A;  4NPB A;  3TKP A;  4ZB8 A;  4JRR A;  2RM6 A;  2RUE A;  4BVY B;  1EWX A;  3WGD A;  4XS6 A;  5HQP A;  4LMV A;  2HLS A;  2Z9S A;  3VI5 A;  3APO A;  3UBL A;  2MBT A;  3GH9 A;  2REM A;  5F0G A;  2HZE A;  2AYT A;  5FT3 A;  5ECL B;  1TI3 A;  2DMM A;  3KCM A;  1V2A A;  1YZX A;  4FH8 A;  3E9J B;  3M1G A;  1VF4 A;  4IJI A;  1S3A A;  1BG5 A;  2IME A;  1BAY A;  2CV4 A;  2CAQ A;  2M46 A;  4WBR D;  1M9B A;  3TJG A;  2OBK A;  1XWA A;  1NM3 A;  2B7K A;  1K0D A;  3RDW A;  1TRV A;  2H74 A;  1K0A A;  5F07 A;  3VWX A;  1OKD A;  2CQ9 A;  2YWO A;  2WS2 A;  3RBT A;  4I6X A;  3ZVJ A;  5IPG A;  1MD4 A;  3IC4 A;  4ZB6 A;  1FO5 A;  1TJD A;  1MDK A;  1MDJ A;  4MF5 A;  1WWJ A;  3LJR A;  3N9J A;  1GTB A;  4N11 A;  3VWV A;  2R0P A;  4O5Q A;  3ZIJ A;  2KP1 A;  1YY7 A;  1QFN A;  4TXV A;  2M80 A;  5ECK B;  1DUG A;  4EDY A;  4ECJ A;  3KZQ A;  4GSN A;  5JCU A;  3EIN A;  1SK0 A;  3MYD A;  4N10 A;  3LW9 A;  2YWN A;  2L4Q A;  1SEN A;  2H0G A;  2BMX A;  3P90 A;  2VL2 C;  4BA7 A;  1BED A;  2LNS A;  2OAC A;  4TW5 A;  1TRW A;  2JU5 A;  3BOA A;  4TR4 A;  4ECB A;  4POL A;  5CAX A;  4MJE A;  1G7O A;  4G19 A;  4IKH A;  1URM A;  3FW2 A;  4HOJ A;  1TKD B;  2ON5 A;  2DML A;  1TI1 A;  3GSS A;  1NHO A;  3J7Y k;  4FO5 A;  6GSY A;  1NW2 A;  2V32 A;  5B6M A;  2N5A A;  5ELA A;  3HZ8 A;  5B8A A;  1WJK A;  5D96 A;  1W4V A;  3GX8 A;  2KP2 A;  5ECN B;  2JSZ A;  1TRU A;  2LJA A;  2GQK A;  3GMF A;  3L9S A;  3FKF A;  1DE1 A;  3Q19 A;  2R0C A;  4G0L A;  1SYX A;  1UC7 A;  2R2J A;  4MA9 A;  4GWR A;  4V1A p;  4XS4 A;  4Q5N A;  1X9W B;  2FWH A;  1Z3E A;  4V2N A;  3L9U A;  5CRG A;  4WR4 A;  1IYH A;  1Z9H A;  3CSJ A;  5JWR B;  4OWY A;  1A23 A;  2MMN A;  1K3L A;  2H0I A;  2X8G A;  2YP6 A;  4AJ6 A;  4PQH A;  3KTB A;  1EEJ A;  2F51 A;  4HS1 A;  1ZYQ B;  3KH9 A;  3UBK A;  3DGQ A;  1PFO A;  3DVX A;  2R5G A;  1MTC A;  1A0R P;  3Q18 A;  4K9Z A;  4IP1 A;  2H71 A;  1O85 A;  2YOI A;  4NMU A;  1QK8 A;  4X4J A;  5DAL A;  4L0U A;  3TUE A;  4ECC A;  5G1L A;  2O8V B;  4TR0 A;  2FD3 A;  3C8E A;  3F6D A;  1EGR A;  19GS A;  3W8J A;  4ID0 A;  2GT5 A;  4XIH A;  1XFL A;  4ML1 A;  3ZML A;  1JZD A;  2CVB A;  5EVO A;  1DBY A;  1GRX A;  5CRE A;  4G0K A;  2J23 A;  1KEB A;  1USB A;  1MEK A;  4IN0 A;  1R7H A;  2JZT A;  4O32 A;  4K0N A;  1ZOF A;  4TXO B;  3IHQ A;  2FY6 A;  5G31 A;  1XW5 A;  3QMX A;  3KD0 A;  2DJ0 A;  3TGZ A;  3TOT A;  3KTL A;  1K0N A;  1A0F A;  2VM1 A;  2L5L A;  2FA8 A;  2VCX A;  2B3S A;  1R5P A;  1FOV A;  1AQX A;  4XHM A;  5IIZ A;  1PKW A;  1ILO A;  2VD1 A;  3KM6 A;  1CQH A;  1F9M A;  2XC2 A;  5D9W A;  5HFI A;  5D8I A;  2LRC A;  4YKF A;  2ZNM A;  4YH2 A;  4EXJ A;  4QL9 A;  4JR4 A;  5DQY A;  3UVT A;  3A5W A;  2GSQ A;  4WBJ A;  3ISO A;  4I2U A;  2G2Q A;  3TKS A;  3IDV A;  3IPZ A;  3VPQ A;  3GIX A;  3BCI A;  5A4U A;  2WDU A;  1PA3 A;  5J9C A;  1LBK A;  1TDI A;  2DC5 A;  2N5B A;  3FZ4 A;  1J08 A;  2VCT A;  1GSY A;  3ZTL A;  1V98 A;  4ZL7 A;  1XVQ A;  4OFT A;  1V40 A;  3WT1 A;  4ZBA A;  1UN2 A;  1SL0 B;  2B5E A;  1FVK A;  5D9V A;  5ABR A;  2BJX A;  3LYP A;  3M9K A;  1FHE A;  5GAP D;  2VCV A;  3GKX A;  3TJB A;  4KF9 A;  3VWW A;  5BRT A;  2RM5 A;  4POB A;  3C1R A;  3H79 A;  2H1A A;  4TKY A;  4IEL A;  3CTG A;  4ZBD A;  2P5Q A;  3WT2 A;  3H8Q A;  1C72 A;  4KSO A;  5J4U A;  1MDI A;  4MP4 A;  1AQV A;  4MCU A;  1E6B A;  3DWV A;  4FYB A;  3HYP A;  4IS0 A;  4IW9 A;  2F3M A;  4POM A;  4MF7 A;  4RI7 A;  1XOA A;  3HHV A;  5D9X A;  3D5J A;  2GQM A;  3C7M A;  2WFC A;  4ISD A;  3GRX A;  2HZE B;  4I8B A;  4DSR A;  1W89 A;  4OO5 A;  5CRW A;  5GAN D;  4EO3 A;  3ED3 A;  5IMZ A;  3C73 A;  1BX9 A;  2H1G A;  2HRN A;  5IQY A;  2FWG A;  1TU8 A;  2PGT A;  6GSW A;  4N30 A;  3UAP A;  2MMA A;  4OFM A;  2IFQ A;  1GLQ A;  5A5K A;  1XWG A;  3V1W A;  4YQU A;  3APS A;  1TK0 B;  4K1F A;  5H5R A;  4E8H A;  1PX6 A;  3I69 A;  4TR1 B;  3CSH A;  2YN1 A;  3GUS A;  4PXO A;  20GS A;  3TCO A;  3LSZ A;  4BIK A;  1FG4 A;  2QKE A;  2LJK A;  2LQQ A;  5JWO B;  1T7P B;  4F82 A;  4PNG A;  2L6C A;  3LGC A;  5BMU A;  2JAD A;  4NXI A;  1M99 A;  1PL1 A;  2PBJ A;  4K7I A;  1HNA A;  1EEM A;  1YQ1 A;  4KH7 A;  1G6W A;  2QA2 A;  3HXS A;  3QCP A;  1Q4J A;  2GDR A;  3TKR A;  2OAD A;  1NSW A;  5DBQ A;  2LRT A;  1R26 A;  1GUK A;  2WB9 A;  2L5O A;  3FZ9 A;  2PWJ A;  2H6X A;  2X8H A;  3FK8 A;  2H75 A;  3TDG A;  3PPU A;  4LMW A;  3HKR A;  2IPA A;  3C71 A;  1H75 A;  2HXK A;  2NDO A;  1VF3 A;  3DML A;  2K8V A;  3CRT A;  4MPG A;  1GSE A;  2GTU A;  1TK5 B;  4PUF C;  4FIW A;  2LNT A;  3F3R A;  2A4H A;  4IQ1 A;  2OKA A;  4ULX A;  1Q98 A;  1PMT A;  4TR3 A;  1GNW A;  2IMI A;  2EIO A;  4AF2 A;  2YWI A;  3AY8 A;  1K3Y A;  3FEU A;  4IHU A;  2WGR A;  3PIN A;  4OD7 A;  5DJM A;  2H6Y A;  2FCH A;  2H66 A;  1THO A;  3HVS A;  3HCZ A;  3IXR A;  5EL8 A;  2NVL A;  1TTZ A;  3IA1 A;  3QDN A;  1EP8 A;  4ZXG A;  4E8E A;  2PVQ A;  2L4C A;  3TKS C;  4BPY A;  1QQ2 A;  2DJ2 A;  4O7H A;  5CP1 A;  2L59 A;  3PGT A;  2HSH A;  4ZIJ A;  2O85 A;  3BJ5 A;  2HRF A;  1IYI A;  1ERV A;  3O3T A;  1T00 A;  4XS4 B;  2P0G A;  1SK1 A;  2ZUP A;  1PRX A;  2YV7 A;  1GWC A;  3MAK A;  5AIV A;  3IE3 A;  3D0Z A;  2VD0 A;  4HU9 A;  1GLP A;  5JWQ B;  6GSS A;  1X5E A;  5IMA A;  4I5Q A;  4NHW A;  4EIQ A;  1Z6N A;  4QL7 A;  3EMX A;  4F03 A;  3GL3 A;  3CRU A;  2LTK A;  4ZB9 A;  1FB0 A;  3DRN A;  1TXX A;  4HUA A;  2J9H A;  3MDK A;  2PMT A;  2CX3 A;  3CYN A;  3IK9 A;  3DYR A;  3IOS A;  1SKR B;  5DAL B;  3WGX A;  3VPT A;  3U5R E;  2FA4 A;  2QGV A;  3HJO A;  4CY6 A;  1PL2 A;  3FZA A;  3KP8 A;  3NOF A;  1RK4 A;  4TVE A;  2VCQ A;  3CQF A;  3SBC A;  1Z7P A;  2P5R A;  2HI7 A;  4TR1 A;  4BL7 A;  1V58 A;  4I2T A;  4MJA A;  3QR6 A;  2QC7 A;  2E7P A;  3QFA C;  2M72 A;  4J56 E;  2R0G A;  4MAB A;  2VO4 A;  1EOH A;  3IHG A;  3ME8 A;  4MF6 A;  4X43 A;  4K7N A;  3CBU A;  5IOW A;  1Z5Y E;  3EWL A;  2DIY A;  2NTO A;  3RAZ A;  1GUH A;  4Z2R A;  4K2X A;  1JZW A;  2E2M A;  1O8W A;  1WRY A;  2GZZ A;  1XBS A;  5ECR B;  3QAV A;  4WKW A;  3RPP A;  3GFK A;  4MH2 A;  5KN1 A;  1YEX A;  4IQA A;  5ENU A;  5IM9 A;  5C00 A;  4AJ7 A;  1X5D A;  2H19 A;  3UIW A;  2YZU A;  1ZYE A;  1UVZ A;  2OE1 A;  2F8F A;  1GSF A;  1X9S B;  2HE3 A;  2TRC P;  4V2L A;  3EE2 A;  4GLT A;  4OCE A;  5F8B A;  1SJ6 A;  4KCE A;  4TRX A;  3IV4 A;  4N0V A;  5F06 A;  1T8E B;  1EV4 A;  3ZMK A;  2F9S A;  5IO0 A;  1B9X C;  3UL3 A;  5A4V A;  3R2Q A;  1KBN A;  7GSS A;  2WZ9 A;  1OC3 A;  4HZ2 A;  1PN0 A;  1U88 A;  3GKK A;  1AUC A;  2DJJ A;  4RQX A;  3FR9 A;  4XCS A;  4KCA A;  2C4J A;  2LV3 A;  1LU4 A;  2VIM A;  1XWK A;  3GKM A;  4WF5 A;  4HI7 A;  5L71 A;  3ZIV A;  4X1U A;  2AHE A;  4AGS A;  2JAC A;  4X0X A;  4G0I A;  3BBY A;  1FB6 A;  1YJ6 A;  2OE3 A;  1CQG A;  3DEX A;  2AJQ B;  1VGL A;  5INY A;  2FWE A;  2YNX A;  3RHC A;  3VFI A;  3FR3 A;  2KUC A;  3HA9 A;  4KSM A;  2VL9 A;  1YDK A;  3HVN A;  2L57 A;  2XPE A;  1BQ7 A;  1M7T A;  2FUG 2;  1OE7 A;  3VWU A;  2IFQ B;  1TU7 A;  3DIE A;  3EC3 A;  2E0Q A;  1X9M B;  3HDC A;  2JL4 A;  13GS A;  5DJL A;  5E59 A;  3KMO A;  4IJ3 A;  1ABA A;  3G7I A;  3H4K A;  4F9Z A;  3IK7 A;  3ME7 A;  3IAM 2;  4HQZ A;  2FLS A;  5B6N A;  1GH2 A;  3D6I A;  3LQ7 A;  2HRK A;  1G7E A;  4G2E A;  1VRS D;  4ZL8 A;  1JZR A;  2G0F A;  1ZYN A;  5HR2 A;  2X64 A;  1Z7R A;  2IWT A;  4N0Z A;  16GS A;  3ZFB A;  4NAX A;  3QAG A;  5GZZ B;  6GSU A;  1JLW A;  3GV1 A;  1X0R A;  5D73 A;  2AV4 A;  2RII A;  4MZC A;  4BVX B;  2C3N A;  4GQC A;  4HU7 A;  4PQI A;  1T1V A;  2IN3 A;  1N8J A;  5IMF A;  2MMO A;  1M0U A;  2WJU A;  5B7C A;  5HR0 A;  1O8X A;  3UVH A;  2I4A A;  4KND A;  4GTU A;  1ZCP A;  5FHI A;  11GS A;  1M3I A;  2RUF A;  2C8U A;  2OA7 A;  1SYR A;  3Q74 A;  5AIX A;  3U6V A;  4D73 B;  3VK9 A;  1LJR A;  3WGE A;  2H70 A;  1WPI A;  5G1K A;  1GSD A;  3TJF A;  2C0D A;  3TKQ A;  3GX0 A;  3ZRD A;  2EIR A;  4Z2T A;  4KDY A;  1SJI A;  1A8Y A;  5CRD A;  4NV2 A;  1GSU A;  22GS A;  1TK8 B;  3HJP A;  2YCD A;  5ECP B;  1Y6E A;  2VUP A;  4FQU A;  2H8L A;  4KAE A;  1OAZ A;  4EF0 A;  1FVJ A;  3E0U A;  10GS A;  2VLV A;  2CA8 A;  2GSS A;  1HNC A;  2I3Y A;  1EP7 A;  2C1Y A;  4PX1 A;  2A4V A;  5E4W A;  2R6K A;  1YEP A;  1JHB A;  2KLX A;  3N5O A;  4L8E A;  1AC1 A;  2DJ3 A;  2VLT A;  3CMI A;  4GCI A;  6GST A;  1A2M A;  2CX4 A;  4P3Y B;  1AIU A;  2DKI A;  5H5Q A;  4KE3 A;  4Q5Q A;  3LFL A;  5KEJ A;  2X4A A;  1H4O A;  5GSS A;  4BWQ A;  1B8X A;  5C04 A;  3CTF A;  4OO4 A;  1I5G A;  3I9V 2;  3G7Y A;  3UJ1 A;  4YQM A;  3GL5 A;  1EGO A;  3LXZ A;  2YAN A;  3M0F A;  1QMV A;  3DKS A;  3I43 A;  2CZ3 A;  3L0H A;  1TRS A;  2HT9 A;  4DVC A;  3APQ A;  1GSQ A;  2HNL A;  1A2J A;  2RLI A;  1JLV A;  4GRF A;  3IBH A;  4WEY A;  2VL3 A;  1GNE A;  4PGT A;  4BL7 B;  2WCI A;  4K8M A;  2OBI A;  1GUM A;  4USS A;  3DVW A;  3GKN A;  3LG6 A;  2K18 A;  3TRQ A;  2PER A;  3JCM L;  4TOP A;  4KGI A;  4J57 E;  1ZMA A;  2GZP A;  1ZGN A;  3R3E A;  3F6F A;  1K0B A;  17GS A;  3ZYW A;  4XRA A;  5DAK A;  3S9F A;  1AW9 A;  2E2G A;  4EC0 A;  5ECH B;  3QD9 A;  4YQV A;  1T3B A;  4LL1 B;  5HFG A;  4Q5F A;  1ACV A;  5KOW A;  4GXZ A;  1EOG A;  4BVX A;  1K3O A;  1GL8 A;  3EPT A;  3GNJ A;  2GZY A;  1K0O A;  1SD9 A;  2H30 A;  2WRT A;  1ERW A;  1QXH A;  4RI6 A;  4CDO A;  2H76 A;  3I6A A;  4KB3 A;  2VCW A;  3FMW A;  1OYJ A;  5ID2 A;  4L0W A;  1S3D A;  2ZCT A;  1G0T A;  4MPF A;  1QGV A;  3EU4 A;  4GF0 A;  2LST A;  2I81 A;  4D73 A;  2BTO T;  3DD3 A;  1OVN A;  1XVW A;  3DXB A;  3A5I A;  1SL1 B;  2OE0 A;  3ERG A;  1DSB A;  1FAA A;  1HNB A;  1AXD A;  3ZFL A;  2H6Z A;  2H1B A;  5IMC A;  5J5N A;  2MBS A;  2GS3 A;  5KN3 A;  4ACS A;  2MZC A;  1PN9 A;  2V2G A;  2OJL A;  3KH7 A;  4EVM A;  3TRX A;  2LS5 A;  2GLR A;  4PNF A;  1B4P A;  3OR5 A;  1AAZ A;  4JR6 A;  2FHE A;  4TN8 A;  1WE0 A;  5B8B A;  5DCH A;  1XXU A;  2GGT A;  2V1M A;  1YKA A;  2LEG A;  2HSM A;  5LCZ A;  3GTU B;  4MDC A;  9GSS A;  3LEF A;  4O5U A;  4MZB A;  3FY7 A;  2H1D A;  4F0C A;  5KN2 A;  4O92 A;  4MZW A;  3F4S A;  5LD0 A;  1U6T A;  4GQF A;  1SKW B;  1BJX A;  3L9V A;  1ERU A;  3E3E A;  3A2X A;  4A5P A;  2B1L A;  1HD2 A;  1SJZ A;  3GST A;  4NWY A;  3M9J A;  2B7J A;  2TRX A;  12GS A;  3VI7 A;  1ON4 A;  1O6J A;  4YAP A;  4ECI A;  3FZ5 A;  3IRA A;  1A2L A;  2PVO C;  2DJK A;  2H0H A;  5D9T A;  1TP9 A;  1V9W A;  4YAV A;  4QQ7 A;  1YKC A;  3QPM A;  5IMD A;  5CNW A;  3HY2 A;  5J41 A;  2R3X A;  2QA1 A;  2QSI A;  1KNG A;  3J7Y b;  3A2V A;  6GSV A;  1WMJ A;  1K0M A;  2DIZ A;  4IBP A;  4F2I A;  2YZH A;  3F3Q A;  3RPN A;  2K8S A;  5IMV A;  2XHF A;  1ZYP A;  3D21 A;  2GT6 A;  5AGY A;  2EIQ A;  1XIY A;  5D93 A;  1JFU A;  2O87 A;  3NIV A;  5HR1 A;  1GTI A;  2JZR A;  4KUN A;  4NV5 A;  3UMA A;  3MWH A;  5ECS A;  2F8A A;  1M2D A;  4IGJ A;  3IC8 A;  5F05 A;  4BWS A;  3MIX A;  3VUR A;  2V6K A;  2C80 A;  3K8N A;  4HSC X;  2PUK C;  3ZLP A;  1J9B A;  1B48 A;  1NHY A;  3L78 A;  1OC9 A;  1FW1 A;  4NHZ A;  2IMD A;  4XS1 A;  3G9B A;  1XW9 A;  1SL2 B;  1Y25 A;  3KEB A;  1GUL A;  2VCZ A;  3GH6 A;  3GA4 A;  4KW6 A;  3EUR A;  4H86 A;  2PPT A;  4OCF A;  5ELG A;  3KJY A;  3A3T A;  1DE2 A;  2IJY A;  4MJB A;  4WR5 A;  1MD3 A;  1RQM A;  5DQS A;  4IP6 A;  1G6Y A;  5G5E A;  4PUA A;  3F0I A;  3WYW A;  1M3J A;  1R5A A;  5H5S A;  2C3Q A;  4XRD A;  4DSS B;  1HQO A;  3LXT A;  1SK2 A;  4ICY A;  1AQW A;  2H01 A;  3BCK A;  1U3A A;  2HFD A;  3F63 A;  2V6O A;  3MSZ A;  5A4W A;  4Z2U A;  4J2F A;  18GS A;  1THX A;  1QUW A;  5J3R A;  1OC8 A;  4HJM A;  5KOX A;  3ERF A;  4Z7X A;  2LUS A;  2VOC A;  4K5S A;  4MNN A;  2HZF A;  4O5R A;  1GP1 A;  3GTU A;  4V2M A;  4K7O A;  1SD8 A;  5AN1 A;  4K6X A;  4V1A g;  3LWA A;  4JU5 A;  1M2B A;  3ZRE A;  5IOX A;  3RHB A;  2IMF A;  2HRA A; 
#chains in the Genus database with same CATH homology
 3ERW A;  1RW1 A;  3KXO A;  4BVY A;  1GTU A;  2AAW A;  2MMZ A;  2ES7 A;  2PN8 A;  1JZO A;  2YWM A;  2XBI A;  4EDZ A;  3H1N A;  1OE8 A;  3L4N A;  4ZIL A;  3H93 A;  3KMN A;  2C0F A;  5IO2 A;  2DBC A;  2DSA A;  4AJ8 A;  3W8S A;  1EZK A;  1XWC A;  4CY8 A;  5EPF A;  1PQN A;  1A8L A;  2CT6 A;  3A2W A;  1SU9 A;  2IIY A;  3M3M A;  1XWB A;  4POK A;  5EY6 A;  4ZBB A;  4K2D A;  3IR4 A;  2X99 A;  4JED A;  5FWG A;  2B5Y A;  5DAK B;  2CZ2 A;  4EE0 A;  1V57 A;  1FOH A;  3GN3 A;  3QFB C;  2V41 A;  3D4T A;  5DDL A;  4ZL9 A;  3F9U A;  3GUR A;  2I9H A;  3FR6 A;  3D4M A;  5ECM B;  3P7X A;  4L5L A;  1T4Z A;  3KGK A;  2B1K A;  4FYC A;  1F3B A;  1OKT A;  4LL4 B;  2KOK A;  1M2A A;  4HEA 2;  4G9H A;  1U87 A;  5G30 A;  2C0G A;  1I9D A;  3F4T A;  2DJ1 A;  3KIJ A;  3CSI A;  2X8C A;  5ID2 B;  3VLN A;  8GSS A;  1PKZ A;  1HYU A;  5CYY A;  1N2A A;  2FGX A;  3G7J A;  4ML6 A;  2CVD A;  4PTS A;  4EUY A;  4L5O A;  5KN0 A;  1TOF A;  1O73 A;  4K0G A;  4EIP A;  1WIK A;  4LLR A;  4EL1 A;  1BYE A;  5G2Z A;  1ML6 A;  1T4Y A;  1ST9 A;  5COH A;  5HFK A;  2VM2 A;  4GST A;  2L6D A;  1XCC A;  3EYT A;  5G5F A;  1VF1 A;  3PH9 A;  2GSR A;  4DSS A;  3TB2 A;  5ECO B;  2R37 A;  3HZ4 A;  2YV9 A;  1SKS B;  2YJH A;  3ZVJ D;  3C1S A;  3LYK A;  2GQL A;  4KA0 A;  2PU9 C;  5IPH A;  1EV9 A;  1ZL9 A;  2YPM A;  3UAR A;  2N5F A;  1Z6M A;  4KDX A;  1F6M C;  2K9F A;  1XZO A;  4YKG A;  2YJ7 A;  1A24 A;  1O7U A;  2CAI A;  4WF4 A;  5ECI B;  2HYX A;  2LJR A;  3TJK A;  1K0C A;  3PR8 A;  3GYK A;  3M8N A;  2FNO A;  2LQO A;  3TRP A;  3FRC A;  1J0F A;  2X49 A;  2I1U A;  2IL3 A;  2KHP A;  2ALB A;  5JCW A;  4CW9 A;  4HQS A;  4KDU A;  2CVK A;  3EVI A;  3EMP A;  2R4V A;  2VAF A;  4PUR A;  3SWL A;  3HJM A;  1B4Q A;  3HVV A;  3FHK A;  2DLX A;  1GSS A;  2FWF A;  3P2A A;  3ZIT A;  5CRH A;  4ILF A;  1XW6 A;  3EU3 A;  3TJJ A;  1O81 A;  4F0B A;  3NZN A;  4MH3 A;  5HR3 A;  2AUV A;  1KTE A;  1F3A A;  3ZZX A;  3TKS E;  3HD5 A;  1X5C A;  2UZ8 A;  4EKZ A;  2XBQ A;  4MLY A;  2C3T A;  4PQ1 A;  1F37 A;  2K6V A;  4JZQ A;  3UOM A;  4MK3 A;  4JBB A;  3FYG A;  4OFN A;  2P31 A;  3TOU A;  3IAS 2;  4TXO A;  4G10 A;  1PGT A;  4HZ4 A;  4I97 A;  3Q6O A;  4DEJ A;  2VL2 A;  2B6M A;  1F2E A;  2B5X A;  1U3I A;  2AB6 A;  1GTA A;  1OC9 B;  1WP0 A;  3O6T A;  3O76 A;  1E2Y A;  2A2S A;  4IVF A;  2A2P A;  3QOU A;  2LKU A;  4FYU A;  3ZL5 A;  3QAW A;  4K5R A;  2WUL A;  2D2Z A;  4RUV A;  4DSQ A;  4WET A;  1PX7 A;  2O7K A;  5LNK e;  1PD2 1;  4HJ2 A;  5DCG A;  4CHS A;  2H72 A;  2GVP A;  4LA1 A;  4JE1 A;  4HDE A;  1S3C A;  2GST A;  5ECQ B;  5JCG A;  4WXT A;  2MYG A;  3BD2 A;  4OMV A;  2EC4 A;  2XPD A;  2IMK A;  3F8U A;  3KP9 A;  4MJC A;  2JZS A;  5GST A;  2LRN A;  4KX4 A;  1YF0 A;  4Q5R A;  5AIS A;  3HVX A;  1ERT A;  3WD6 A;  3D22 A;  14GS A;  6GSX A;  1TW9 A;  1WOU A;  1R4W A;  3MNG A;  3F4R A;  1XOB A;  3W6G A;  1XPV A;  2TIR A;  3LOR A;  2HSY A;  1YF1 A;  5CO3 A;  4RQR A;  3CXG A;  1ZZY A;  2H73 A;  1B9Y C;  5DVB A;  1M9A A;  3US3 A;  1UA5 A;  2DKH A;  1VF2 A;  2VLU A;  2A2R A;  3UEM A;  2ON7 A;  1PSQ A;  4XTS A;  2NBS A;  2JSY A;  2O89 A;  2C0E A;  4GSS A;  3P8W A;  2NPB A;  4MMM A;  5J9B A;  3GHA A;  4NPB A;  3TKP A;  4ZB8 A;  4JRR A;  2RM6 A;  2RUE A;  4BVY B;  1EWX A;  3WGD A;  4XS6 A;  5HQP A;  4LMV A;  2HLS A;  2Z9S A;  3VI5 A;  3APO A;  3UBL A;  2MBT A;  3GH9 A;  2REM A;  5F0G A;  2HZE A;  2AYT A;  5FT3 A;  5ECL B;  1TI3 A;  2DMM A;  3KCM A;  1V2A A;  1YZX A;  4FH8 A;  3E9J B;  3M1G A;  1VF4 A;  4IJI A;  1S3A A;  1BG5 A;  2IME A;  1BAY A;  2CV4 A;  2CAQ A;  2M46 A;  4WBR D;  1M9B A;  3TJG A;  2OBK A;  1XWA A;  1NM3 A;  2B7K A;  1K0D A;  3RDW A;  1TRV A;  2H74 A;  1K0A A;  5F07 A;  3VWX A;  1OKD A;  2CQ9 A;  2YWO A;  2WS2 A;  3RBT A;  4I6X A;  3ZVJ A;  5IPG A;  1MD4 A;  3IC4 A;  4ZB6 A;  1FO5 A;  1TJD A;  1MDK A;  1MDJ A;  4MF5 A;  1WWJ A;  3LJR A;  3N9J A;  1GTB A;  4N11 A;  3VWV A;  2R0P A;  4O5Q A;  3ZIJ A;  2KP1 A;  1YY7 A;  1QFN A;  4TXV A;  2M80 A;  5ECK B;  1DUG A;  4EDY A;  4ECJ A;  3KZQ A;  4GSN A;  5JCU A;  3EIN A;  1SK0 A;  3MYD A;  4N10 A;  3LW9 A;  2YWN A;  2L4Q A;  1SEN A;  2H0G A;  2BMX A;  3P90 A;  2VL2 C;  4BA7 A;  1BED A;  2LNS A;  2OAC A;  4TW5 A;  1TRW A;  2JU5 A;  3BOA A;  4TR4 A;  4ECB A;  4POL A;  5CAX A;  4MJE A;  1G7O A;  4G19 A;  4IKH A;  1URM A;  3FW2 A;  4HOJ A;  1TKD B;  2ON5 A;  2DML A;  1TI1 A;  3GSS A;  1NHO A;  3J7Y k;  4FO5 A;  6GSY A;  1NW2 A;  2V32 A;  5B6M A;  2N5A A;  5ELA A;  3HZ8 A;  5B8A A;  1WJK A;  5D96 A;  1W4V A;  3GX8 A;  2KP2 A;  5ECN B;  2JSZ A;  1TRU A;  2LJA A;  2GQK A;  3GMF A;  3L9S A;  3FKF A;  1DE1 A;  3Q19 A;  2R0C A;  4G0L A;  1SYX A;  1UC7 A;  2R2J A;  4MA9 A;  4GWR A;  4V1A p;  4XS4 A;  4Q5N A;  1X9W B;  2FWH A;  1Z3E A;  4V2N A;  3L9U A;  5CRG A;  4WR4 A;  1IYH A;  1Z9H A;  3CSJ A;  5JWR B;  4OWY A;  1A23 A;  2MMN A;  1K3L A;  2H0I A;  2X8G A;  2YP6 A;  4AJ6 A;  4PQH A;  3KTB A;  1EEJ A;  2F51 A;  4HS1 A;  1ZYQ B;  3KH9 A;  3UBK A;  3DGQ A;  3DVX A;  2R5G A;  1MTC A;  1A0R P;  3Q18 A;  4K9Z A;  4IP1 A;  2H71 A;  1O85 A;  2YOI A;  4NMU A;  1QK8 A;  4X4J A;  5DAL A;  4L0U A;  3TUE A;  4ECC A;  5G1L A;  2O8V B;  4TR0 A;  2FD3 A;  3C8E A;  3F6D A;  1EGR A;  19GS A;  3W8J A;  4ID0 A;  2GT5 A;  4XIH A;  1XFL A;  4ML1 A;  3ZML A;  1JZD A;  2CVB A;  5EVO A;  1DBY A;  1GRX A;  5CRE A;  4G0K A;  2J23 A;  1KEB A;  1USB A;  1MEK A;  4IN0 A;  1R7H A;  2JZT A;  4O32 A;  4K0N A;  1ZOF A;  4TXO B;  3IHQ A;  2FY6 A;  5G31 A;  1XW5 A;  3QMX A;  3KD0 A;  2DJ0 A;  3TGZ A;  3TOT A;  3KTL A;  1K0N A;  1A0F A;  2VM1 A;  2L5L A;  2FA8 A;  2VCX A;  2B3S A;  1R5P A;  1FOV A;  1AQX A;  4XHM A;  5IIZ A;  1PKW A;  1ILO A;  2VD1 A;  3KM6 A;  1CQH A;  1F9M A;  2XC2 A;  5D9W A;  5HFI A;  5D8I A;  2LRC A;  4YKF A;  2ZNM A;  4YH2 A;  4EXJ A;  4QL9 A;  4JR4 A;  5DQY A;  3UVT A;  3A5W A;  2GSQ A;  4WBJ A;  3ISO A;  4I2U A;  2G2Q A;  3TKS A;  3IDV A;  3IPZ A;  3VPQ A;  3GIX A;  3BCI A;  5A4U A;  2WDU A;  1PA3 A;  5J9C A;  1LBK A;  1TDI A;  2DC5 A;  2N5B A;  3FZ4 A;  1J08 A;  2VCT A;  1GSY A;  3ZTL A;  1V98 A;  4ZL7 A;  1XVQ A;  4OFT A;  1V40 A;  3WT1 A;  4ZBA A;  1UN2 A;  1SL0 B;  2B5E A;  1FVK A;  5D9V A;  5ABR A;  2BJX A;  3LYP A;  3M9K A;  1FHE A;  5GAP D;  2VCV A;  3GKX A;  3TJB A;  4KF9 A;  3VWW A;  5BRT A;  2RM5 A;  4POB A;  3C1R A;  3H79 A;  2H1A A;  4TKY A;  4IEL A;  3CTG A;  4ZBD A;  2P5Q A;  3WT2 A;  3H8Q A;  1C72 A;  4KSO A;  5J4U A;  1MDI A;  4MP4 A;  1AQV A;  4MCU A;  1E6B A;  3DWV A;  4FYB A;  3HYP A;  4IS0 A;  4IW9 A;  2F3M A;  4POM A;  4MF7 A;  4RI7 A;  1XOA A;  3HHV A;  5D9X A;  3D5J A;  2GQM A;  3C7M A;  2WFC A;  4ISD A;  3GRX A;  2HZE B;  4I8B A;  4DSR A;  1W89 A;  4OO5 A;  5CRW A;  5GAN D;  4EO3 A;  3ED3 A;  5IMZ A;  3C73 A;  1BX9 A;  2H1G A;  2HRN A;  5IQY A;  2FWG A;  1TU8 A;  2PGT A;  6GSW A;  4N30 A;  3UAP A;  2MMA A;  4OFM A;  2IFQ A;  1GLQ A;  5A5K A;  1XWG A;  3V1W A;  4YQU A;  3APS A;  1TK0 B;  4K1F A;  5H5R A;  4E8H A;  1PX6 A;  3I69 A;  4TR1 B;  3CSH A;  2YN1 A;  3GUS A;  4PXO A;  20GS A;  3TCO A;  3LSZ A;  1FG4 A;  2QKE A;  2LJK A;  2LQQ A;  5JWO B;  1T7P B;  4F82 A;  4PNG A;  2L6C A;  3LGC A;  5BMU A;  2JAD A;  4NXI A;  1M99 A;  1PL1 A;  2PBJ A;  4K7I A;  1HNA A;  1EEM A;  1YQ1 A;  4KH7 A;  1G6W A;  2QA2 A;  3HXS A;  3QCP A;  1Q4J A;  2GDR A;  3TKR A;  2OAD A;  1NSW A;  5DBQ A;  2LRT A;  1R26 A;  1GUK A;  2WB9 A;  2L5O A;  3FZ9 A;  2PWJ A;  2H6X A;  2X8H A;  3FK8 A;  2H75 A;  3TDG A;  3PPU A;  4LMW A;  3HKR A;  2IPA A;  3C71 A;  1H75 A;  2HXK A;  2NDO A;  1VF3 A;  3DML A;  2K8V A;  3CRT A;  4MPG A;  1GSE A;  2GTU A;  1TK5 B;  4PUF C;  4FIW A;  2LNT A;  3F3R A;  2A4H A;  4IQ1 A;  2OKA A;  4ULX A;  1Q98 A;  1PMT A;  4TR3 A;  1GNW A;  2IMI A;  2EIO A;  4AF2 A;  2YWI A;  3AY8 A;  1K3Y A;  3FEU A;  4IHU A;  2WGR A;  3PIN A;  4OD7 A;  5DJM A;  2H6Y A;  2FCH A;  2H66 A;  1THO A;  3HVS A;  3HCZ A;  3IXR A;  5EL8 A;  2NVL A;  1TTZ A;  3IA1 A;  3QDN A;  1EP8 A;  4ZXG A;  4E8E A;  2PVQ A;  2L4C A;  3TKS C;  4BPY A;  1QQ2 A;  2DJ2 A;  4O7H A;  5CP1 A;  2L59 A;  3PGT A;  2HSH A;  4ZIJ A;  2O85 A;  3BJ5 A;  2HRF A;  1IYI A;  1ERV A;  3O3T A;  1T00 A;  4XS4 B;  2P0G A;  1SK1 A;  2ZUP A;  1PRX A;  2YV7 A;  1GWC A;  3MAK A;  5AIV A;  3IE3 A;  3D0Z A;  2VD0 A;  4HU9 A;  1GLP A;  5JWQ B;  6GSS A;  1X5E A;  5IMA A;  4I5Q A;  4NHW A;  4EIQ A;  1Z6N A;  4QL7 A;  3EMX A;  4F03 A;  3GL3 A;  3CRU A;  2LTK A;  4ZB9 A;  1FB0 A;  3DRN A;  1TXX A;  4HUA A;  2J9H A;  3MDK A;  2PMT A;  2CX3 A;  3CYN A;  3IK9 A;  3DYR A;  3IOS A;  1SKR B;  5DAL B;  3WGX A;  3VPT A;  3U5R E;  2FA4 A;  2QGV A;  3HJO A;  4CY6 A;  1PL2 A;  3FZA A;  3KP8 A;  3NOF A;  1RK4 A;  4TVE A;  2VCQ A;  3SBC A;  1Z7P A;  2P5R A;  2HI7 A;  4TR1 A;  4BL7 A;  1V58 A;  4I2T A;  4MJA A;  3QR6 A;  2QC7 A;  2E7P A;  3QFA C;  2M72 A;  4J56 E;  2R0G A;  4MAB A;  2VO4 A;  1EOH A;  3IHG A;  3ME8 A;  4MF6 A;  4X43 A;  4K7N A;  3CBU A;  5IOW A;  1Z5Y E;  3EWL A;  2DIY A;  2NTO A;  3RAZ A;  1GUH A;  4Z2R A;  4K2X A;  1JZW A;  2E2M A;  1O8W A;  1WRY A;  2GZZ A;  1XBS A;  5ECR B;  3QAV A;  4WKW A;  3RPP A;  3GFK A;  4MH2 A;  5KN1 A;  1YEX A;  4IQA A;  5ENU A;  5IM9 A;  5C00 A;  4AJ7 A;  1X5D A;  2H19 A;  3UIW A;  2YZU A;  1ZYE A;  1UVZ A;  2OE1 A;  2F8F A;  1GSF A;  1X9S B;  2HE3 A;  2TRC P;  4V2L A;  3EE2 A;  4GLT A;  4OCE A;  5F8B A;  1SJ6 A;  4KCE A;  4TRX A;  3IV4 A;  4N0V A;  5F06 A;  1T8E B;  1EV4 A;  3ZMK A;  2F9S A;  5IO0 A;  1B9X C;  3UL3 A;  5A4V A;  3R2Q A;  1KBN A;  7GSS A;  2WZ9 A;  1OC3 A;  4HZ2 A;  1PN0 A;  1U88 A;  3GKK A;  1AUC A;  2DJJ A;  4RQX A;  3FR9 A;  4XCS A;  4KCA A;  2C4J A;  2LV3 A;  1LU4 A;  2VIM A;  1XWK A;  3GKM A;  4WF5 A;  4HI7 A;  5L71 A;  3ZIV A;  4X1U A;  2AHE A;  4AGS A;  2JAC A;  4X0X A;  4G0I A;  3BBY A;  1FB6 A;  1YJ6 A;  2OE3 A;  1CQG A;  3DEX A;  2AJQ B;  1VGL A;  5INY A;  2FWE A;  2YNX A;  3RHC A;  3VFI A;  3FR3 A;  2KUC A;  3HA9 A;  4KSM A;  2VL9 A;  1YDK A;  2L57 A;  2XPE A;  1BQ7 A;  1M7T A;  2FUG 2;  1OE7 A;  3VWU A;  2IFQ B;  1TU7 A;  3DIE A;  3EC3 A;  2E0Q A;  1X9M B;  3HDC A;  2JL4 A;  13GS A;  5DJL A;  5E59 A;  3KMO A;  4IJ3 A;  1ABA A;  3G7I A;  3H4K A;  4F9Z A;  3IK7 A;  3ME7 A;  3IAM 2;  4HQZ A;  2FLS A;  5B6N A;  1GH2 A;  3D6I A;  3LQ7 A;  2HRK A;  1G7E A;  4G2E A;  1VRS D;  4ZL8 A;  1JZR A;  2G0F A;  1ZYN A;  5HR2 A;  2X64 A;  1Z7R A;  2IWT A;  4N0Z A;  16GS A;  3ZFB A;  4NAX A;  3QAG A;  5GZZ B;  6GSU A;  1JLW A;  3GV1 A;  1X0R A;  5D73 A;  2AV4 A;  2RII A;  4MZC A;  4BVX B;  2C3N A;  4GQC A;  4HU7 A;  4PQI A;  1T1V A;  2IN3 A;  1N8J A;  5IMF A;  2MMO A;  1M0U A;  2WJU A;  5B7C A;  5HR0 A;  1O8X A;  3UVH A;  2I4A A;  4KND A;  4GTU A;  1ZCP A;  5FHI A;  11GS A;  2RUF A;  2C8U A;  2OA7 A;  1SYR A;  3Q74 A;  5AIX A;  3U6V A;  4D73 B;  3VK9 A;  1LJR A;  3WGE A;  2H70 A;  1WPI A;  5G1K A;  1GSD A;  3TJF A;  2C0D A;  3TKQ A;  3GX0 A;  3ZRD A;  2EIR A;  4Z2T A;  4KDY A;  1SJI A;  1A8Y A;  5CRD A;  4NV2 A;  1GSU A;  22GS A;  1TK8 B;  3HJP A;  2YCD A;  5ECP B;  1Y6E A;  2VUP A;  4FQU A;  2H8L A;  4KAE A;  1OAZ A;  4EF0 A;  1FVJ A;  3E0U A;  10GS A;  2VLV A;  2CA8 A;  2GSS A;  1HNC A;  2I3Y A;  1EP7 A;  2C1Y A;  4PX1 A;  2A4V A;  5E4W A;  2R6K A;  1YEP A;  1JHB A;  2KLX A;  3N5O A;  4L8E A;  1AC1 A;  2DJ3 A;  2VLT A;  3CMI A;  4GCI A;  6GST A;  1A2M A;  2CX4 A;  4P3Y B;  1AIU A;  2DKI A;  5H5Q A;  4KE3 A;  4Q5Q A;  3LFL A;  5KEJ A;  2X4A A;  1H4O A;  5GSS A;  4BWQ A;  1B8X A;  5C04 A;  3CTF A;  4OO4 A;  1I5G A;  3I9V 2;  3G7Y A;  3UJ1 A;  4YQM A;  3GL5 A;  1EGO A;  3LXZ A;  2YAN A;  3M0F A;  1QMV A;  3DKS A;  3I43 A;  2CZ3 A;  3L0H A;  1TRS A;  2HT9 A;  4DVC A;  3APQ A;  1GSQ A;  2HNL A;  1A2J A;  2RLI A;  1JLV A;  4GRF A;  3IBH A;  4WEY A;  2VL3 A;  1GNE A;  4PGT A;  4BL7 B;  2WCI A;  4K8M A;  2OBI A;  1GUM A;  4USS A;  3DVW A;  3GKN A;  3LG6 A;  2K18 A;  3TRQ A;  2PER A;  3JCM L;  4TOP A;  4KGI A;  4J57 E;  1ZMA A;  2GZP A;  1ZGN A;  3R3E A;  3F6F A;  1K0B A;  17GS A;  3ZYW A;  4XRA A;  5DAK A;  3S9F A;  1AW9 A;  2E2G A;  4EC0 A;  5ECH B;  3QD9 A;  4YQV A;  1T3B A;  4LL1 B;  5HFG A;  4Q5F A;  1ACV A;  5KOW A;  4GXZ A;  1EOG A;  4BVX A;  1K3O A;  1GL8 A;  3EPT A;  3GNJ A;  2GZY A;  1K0O A;  1SD9 A;  2H30 A;  2WRT A;  1ERW A;  1QXH A;  4RI6 A;  4CDO A;  2H76 A;  3I6A A;  4KB3 A;  2VCW A;  3FMW A;  1OYJ A;  5ID2 A;  4L0W A;  1S3D A;  2ZCT A;  1G0T A;  4MPF A;  1QGV A;  3EU4 A;  4GF0 A;  2LST A;  2I81 A;  4D73 A;  2BTO T;  3DD3 A;  1OVN A;  1XVW A;  3DXB A;  3A5I A;  1SL1 B;  2OE0 A;  3ERG A;  1DSB A;  1FAA A;  1HNB A;  1AXD A;  3ZFL A;  2H6Z A;  2H1B A;  5IMC A;  5J5N A;  2MBS A;  2GS3 A;  5KN3 A;  4ACS A;  2MZC A;  1PN9 A;  2V2G A;  2OJL A;  3KH7 A;  4EVM A;  3TRX A;  2LS5 A;  2GLR A;  4PNF A;  1B4P A;  3OR5 A;  1AAZ A;  4JR6 A;  2FHE A;  4TN8 A;  1WE0 A;  5B8B A;  5DCH A;  1XXU A;  2GGT A;  2V1M A;  1YKA A;  2LEG A;  2HSM A;  5LCZ A;  3GTU B;  4MDC A;  9GSS A;  3LEF A;  4O5U A;  4MZB A;  3FY7 A;  2H1D A;  4F0C A;  5KN2 A;  4O92 A;  4MZW A;  3F4S A;  5LD0 A;  1U6T A;  4GQF A;  1SKW B;  1BJX A;  3L9V A;  1ERU A;  3E3E A;  3A2X A;  4A5P A;  2B1L A;  1HD2 A;  1SJZ A;  3GST A;  4NWY A;  3M9J A;  2B7J A;  2TRX A;  12GS A;  3VI7 A;  1ON4 A;  1O6J A;  4YAP A;  4ECI A;  3FZ5 A;  3IRA A;  1A2L A;  2PVO C;  2DJK A;  2H0H A;  5D9T A;  1TP9 A;  1V9W A;  4YAV A;  4QQ7 A;  1YKC A;  3QPM A;  5IMD A;  5CNW A;  3HY2 A;  5J41 A;  2R3X A;  2QA1 A;  2QSI A;  1KNG A;  3J7Y b;  3A2V A;  6GSV A;  1WMJ A;  1K0M A;  2DIZ A;  4IBP A;  4F2I A;  2YZH A;  3F3Q A;  3RPN A;  2K8S A;  5IMV A;  2XHF A;  1ZYP A;  3D21 A;  2GT6 A;  5AGY A;  2EIQ A;  1XIY A;  5D93 A;  1JFU A;  2O87 A;  3NIV A;  5HR1 A;  1GTI A;  2JZR A;  4KUN A;  4NV5 A;  3UMA A;  3MWH A;  5ECS A;  2F8A A;  1M2D A;  4IGJ A;  3IC8 A;  5F05 A;  4BWS A;  3MIX A;  3VUR A;  2V6K A;  2C80 A;  3K8N A;  2PUK C;  3ZLP A;  1J9B A;  1B48 A;  1NHY A;  3L78 A;  1OC9 A;  1FW1 A;  4NHZ A;  2IMD A;  4XS1 A;  3G9B A;  1XW9 A;  1SL2 B;  1Y25 A;  3KEB A;  1GUL A;  2VCZ A;  3GH6 A;  3GA4 A;  4KW6 A;  3EUR A;  4H86 A;  2PPT A;  4OCF A;  5ELG A;  3KJY A;  3A3T A;  1DE2 A;  2IJY A;  4MJB A;  4WR5 A;  1MD3 A;  1RQM A;  5DQS A;  4IP6 A;  1G6Y A;  5G5E A;  4PUA A;  3F0I A;  3WYW A;  1R5A A;  5H5S A;  2C3Q A;  4XRD A;  4DSS B;  1HQO A;  3LXT A;  1SK2 A;  4ICY A;  1AQW A;  2H01 A;  3BCK A;  1U3A A;  2HFD A;  3F63 A;  2V6O A;  3MSZ A;  5A4W A;  4Z2U A;  4J2F A;  18GS A;  1THX A;  1QUW A;  5J3R A;  1OC8 A;  4HJM A;  5KOX A;  3ERF A;  4Z7X A;  2LUS A;  2VOC A;  4K5S A;  4MNN A;  2HZF A;  4O5R A;  1GP1 A;  3GTU A;  4V2M A;  4K7O A;  1SD8 A;  5AN1 A;  4K6X A;  4V1A g;  3LWA A;  4JU5 A;  1M2B A;  3ZRE A;  5IOX A;  3RHB A;  2IMF A;  2HRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...