3G7YA

Crystal structure of oxidized ost6l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
DILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dolichyl-diphosphooligosaccharide-protein glycosyltransferas
publication title Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.4.1.119: Transferred entry: 2.4.99.18.
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3g7yA00
5ECNB 1VF3A 3F9UA 4MH3A 4PGTA 2L59A 3PH9A 5DVBA 4RQRA 1YQ1A 2B5EA 1AQWA 2JACA 2PUKC 5CNWA 2MMOA 2HSYA 1WMJA 1DE1A 2V6KA 1QQ2A 3WT2A 4CDOA 3KP9A 2M72A 2R5GA 3UVHA 1GTAA 2RUEA 2GZPA 2PVQA 4ZL7A 2E2GA 3F6FA 5KEJA 3D5JA 3F0IA 3C1SA 1YKAA 2I3YA 1SYRA 5HFKA 1TRSA 3LXZA 3D6IA 3LEFA 4D73B 1WPIA 3DMLA 3CRUA 3GMFA 4MCUA 1T7PB 1OAZA 4WXTA 1Z7PA 2G2QA 3HZ8A 5HQPA 3VWXA 4NXIA 2FNOA 1DSBA 3QPMA 4H86A 1U3AA 1ILOA 1OKTA 3C1RA 3ISOA 3DIEA 3QR6A 3ME7A 1A24A 4MDCA 3CTGA 1NW2A 3GSSA 2VIMA 4IS0A 3FR6A 2H8LA 4ULXA 2CX3A 3D22A 5B6MA 3UIWA 2DJ1A 2NDOA 3ZIJA 5KN1A 3EURA 1YY7A 4K6XA 3IBHA 4Q5FA 2AUVA 5D96A 3UAPA 1JLWA 3KTBA 5B8AA 5KN0A 3Q19A 5HFIA 12GSA 1ERTA 5F05A 3FR3A 1LBKA 1OE7A 1A23A 2F9SA 2FUG2 5ECHB 3GA4A 3ED3A 5CRHA 4KUNA 3RPNA 3GUSA 3V1WA 4KB3A 2HZEA 2XHFA 2LJAA 4BVXA 1EV4A 4KNDA 4MJEA 4KW6A 3TKRA 1FAAA 4CHSA 3IXRA 4QL7A 3KH7A 1AXDA 5IPGA 4MF7A 4MK3A 1E2YA 2WDUA 1TI1A 1U6TA 4ISDA 2H71A 5IMAA 5AIXA 1ZCPA 4L5OA 1TK5B 3GN3A 4X43A 3EINA 3ZIVA 2PERA 2V41A 1O7UA 5D73A 1AC1A 3GX0A 19GSA 3LGCA 3QMXA 3L9VA 3M9JA 2C0EA 1MEKA 2IIYA 1T00A 3RHCA 1EOHA 3HXSA 2KP1A 2XC2A 3ZL5A 2VOCA 1I5GA 2AAWA 3ZMLA 1PKWA 4RUVA 3EWLA 1T4YA 3GH9A 3Q6OA 2K18A 1I9DA 4AF2A 2QSIA 4EO3A 4OO4A 2OKAA 2WZ9A 4XS6A 4OD7A 2L4CA 1B4PA 3HZ4A 2VL2A 4DSQA 1M2DA 2B7KA 3CBUA 4TW5A 1GUMA 2GSTA 3VK9A 1HYUA 3APOA 1WIKA 4ZBAA 3WYWA 5FHIA 4HQSA 3L4NA 3F63A 5AIVA 1CQGA 2N5BA 4I8BA 3HKRA 5CO3A 3KMNA 2K9FA 1F6MC 3IV4A 5H5SA 2ZUPA 1Q4JA 5F07A 4PNFA 1M9AA 1GRXA 2YP6A 3H4KA 1USBA 2CVDA 4BVYA 3D4MA 8GSSA 4XTSA 5IMVA 2I4AA 2L6DA 4IJIA 3ZVJD 2RM5A 2CAIA 3D21A 3IK9A 3KGKA 1X9SB 3A2VA 3DVWA 3KMOA 5JCWA 3GH6A 1G7EA 2B1KA 1Y6EA 1YDKA 1FB6A 3J7Yb 3UJ1A 6GSTA 3D4TA 5LNKe 3GTUA 1U87A 1U88A 2L4QA 1DE2A 2FGXA 2GQKA 3FR9A 2FHEA 3R2QA 2EIRA 3ZREA 1TTZA 2TIRA 1EGRA 3H93A 1GTUA 2VM1A 3VPTA 2V2GA 3GNJA 1HD2A 3FEUA 1GUHA 2FWEA 5IQYA 13GSA 2ZCTA 5FT3A 3F3RA 2C0FA 2V1MA 5CYYA 2LQOA 2VCXA 3VLNA 4V1Ap 3ZZXA 5EPFA 4Q5NA 2L5OA 2HXKA 3G7JA 4NWYA 5A4UA 2WS2A 5HR0A 2NTOA 3BCKA 5IM9A 3C71A 1AIUA 5B7CA 1QK8A 3UBLA 1TKDB 2H19A 2WRTA 4HDEA 4G10A 2MZCA 1BG5A 1VF2A 3MWHA 1FVKA 3MAKA 2LEGA 3F3QA 4WETA 2DJKA 1Y25A 4L0UA 4IQ1A 5HR3A 2C80A 1W4VA 3IAM2 4TVEA 4OFNA 1YF0A 3NIVA 3MSZA 3TDGA 1B4QA 2H6ZA 1T8EB 4E8HA 2VL9A 1MD4A 2PU9C 3QD9A 2OE1A 2DIYA 1YZXA 3K8NA 4PUFC 3VPQA 2ZNMA 5JWOB 2B3SA 4FYUA 2TRCP 1T4ZA 3FKFA 5D93A 4XIHA 1JZWA 2YCDA 2HZEB 1K0AA 3QAWA 2VM2A 3AY8A 3I9V2 3TOTA 2JSYA 2CVBA 1F3BA 1LJRA 1A0RP 4POKA 1ZYQB 3A2XA 3GL5A 4X0XA 2P0GA 5IIZA 3EE2A 1PMTA 4ZL8A 1AQXA 3HYPA 3KD0A 4ACSA 2PGTA 2H75A 1TRVA 4K0GA 5C00A 1SD9A 1GSYA 4JU5A 2A2RA 2VCVA 3UBKA 2C4JA 2HYXA 1V58A 1QGVA 2FLSA 2QKEA 2L6CA 5EL8A 1THOA 1PSQA 1K0OA 1WOUA 5ABRA 3BCIA 3U5RE 2CT6A 4ZB8A 4IP6A 3GHAA 4ZL9A 2Z9SA 1HNCA 4K0NA 1EEJA 2N5FA 3TCOA 4K7OA 2YV7A 2JADA 1B48A 2YANA 3LG6A 4WEYA 1V40A 2OE3A 3CRTA 4MPGA 2P5RA 2EC4A 1XFLA 4DVCA 1G0TA 2IJYA 3HCZA 3S9FA 2D2ZA 2IMFA 4TXOA 4I5QA 5D8IA 1HQOA 1M99A 1OKDA 2JL4A 1XWCA 4GCIA 4MJBA 3P7XA 1EGOA 4OCFA 4TR3A 1M2BA 3G7IA 1RK4A 1FHEA 2RM6A 4F82A 2FWHA 4IKHA 2XBQA 3EU4A 4GF0A 1M9BA 1JFUA 1GULA 4V2NA 4K2DA 1N8JA 1GSQA 4MH2A 4MABA 5D9VA 2FA4A 2LJKA 1G6WA 3ZMKA 5ECSA 2H6XA 4GSTA 5CRWA 5KN2A 4POMA 2RLIA 1OYJA 3QCPA 4XRAA 4Z7XA 3LFLA 1K0CA 1TXXA 3IPZA 4LA1A 2B5XA 1XVQA 2XPDA 4ZB6A 3GTUB 5E59A 1IYHA 3GKXA 3DVXA 5GAPD 1SL1B 4MJCA 5C04A 1XWGA 5CAXA 1CQHA 3W8JA 1GSSA 1XWAA 3FZ5A 1S3DA 1AQVA 3M8NA 4JR4A 3PR8A 1OVNA 3A3TA 1K0DA 22GSA 4IHUA 1TU7A 4MA9A 2MMAA 3TJJA 1B8XA 5COHA 4WBJA 3APQA 3VI7A 4WF4A 3DEXA 5DBQA 4TR4A 1G7OA 1O6JA 1GP1A 3PINA 1SJIA 1W89A 3KZQA 4O5RA 1SK0A 2VL2C 1GNEA 1O85A 2AHEA 4K9ZA 1MTCA 3QOUA 2K6VA 4PUAA 3FK8A 10GSA 1ON4A 4IQAA 2H73A 4NAXA 1PGTA 2ES7A 3CSIA 3SWLA 2HE3A 4OFTA 3WT1A 1DBYA 1OC9B 5ELGA 4EKZA 2N5AA 1R4WA 2VLVA 4QQ7A 2V6OA 3CXGA 4WF5A 2O87A 1BQ7A 4JZQA 3GX8A 3DYRA 1K3OA 1J08A 4G2EA 4GTUA 2QGVA 4K1FA 3E0UA 4GXZA 1JHBA 1X5DA 1FVJA 2GQMA 2H74A 2H6YA 4Q5QA 1SL0B 4N11A 1B9YC 3M0FA 1K0MA 5IMZA 4N0VA 2LKUA 4N0ZA 1PQNA 1WP0A 3CYNA 1XW5A 5LD0A 2FWGA 2H66A 2F8FA 2GVPA 2AYTA 3H1NA 6GSUA 2VO4A 2H0IA 1EEMA 2M46A 1ERUA 1K0NA 2WJUA 4ZBBA 2B5YA 2V32A 4I97A 5F0GA 5ECRB 2H1GA 2LRNA 2P5QA 5IMFA 2LJRA 6GSYA 2G0FA 5B6NA 1RQMA 3FW2A 2HFDA 1NHOA 5INYA 1EP8A 2KUCA 5IPHA 1M7TA 3GURA 1AUCA 1SJ6A 3ZLPA 2NPBA 5J41A 5J4UA 3GFKA 1Z6MA 3ERFA 3H79A 6GSWA 1M0UA 2HRFA 2X99A 1HNAA 1K0BA 1PA3A 2JZSA 5J9BA 5B8BA 5JCGA 3E9JB 4TXOB 5IOWA 1C72A 2CA8A 4E8EA 2H0GA 3DXBA 2X8CA 3RBTA 2IFQA 1UC7A 4KCAA 4DEJA 3UARA 2MMZA 3IA1A 4K8MA 2YJ7A 4KDYA 5ECMB 4WR4A 3VWWA 4V2LA 1JLVA 4CW9A 3F4TA 2WGRA 4IVFA 1Z9HA 4MF5A 1ZMAA 3QFAC 5G1KA 1J0FA 1ZZYA 4HU7A 1ABAA 1X9WB 4EVMA 1H75A 4HS1A 2WULA 5HFGA 1X0RA 4KDXA 4MF6A 3ZITA 2GTUA 4IBPA 3KIJA 1KNGA 2OBKA 3RAZA 2HRNA 4MP4A 1BX9A 1XIYA 2GSSA 3KXOA 1WE0A 3J7Yk 2YJHA 4FO5A 1ZOFA 4TR0A 2E2MA 4NHZA 4L8EA 4DSRA 3FZAA 1V9WA 4WR5A 3LJRA 3GKNA 3IR4A 2XPEA 4KA0A 1TI3A 2C8UA 3UVTA 1WWJA 5G30A 2O7KA 4HZ2A 1NHYA 1PL2A 1XOAA 4KSOA 3KTLA 3LORA 4F03A 2B7JA 4ECIA 2OA7A 5DDLA 3WD6A 2DIZA 3TKPA 1F2EA 1T3BA 2O8VB 4OO5A 4EUYA 3P90A 2YOIA 2QC7A 1GWCA 3F6DA 1BYEA 2LRTA 4HJ2A 4F9ZA 2NBSA 1PX7A 1O81A 3EMPA 1SU9A 3EVIA 1FO5A 3FZ4A 2LRCA 3O76A 2H01A 4TR1A 5IO2A 3Q18A 4PXOA 1S3CA 3WGDA 1PD21 1ZYEA 1GLPA 2YWMA 2I9HA 2C0DA 4KGIA 1JZOA 3G9BA 4HEA2 4QL9A 2C3TA 3HDCA 2X8HA 2O89A 1UA5A 4MPFA 2PN8A 2KOKA 1XW9A 2GZZA 3L9SA 5G5FA 1OC9A 1PL1A 4ML1A 4YQVA 4GLTA 4F0BA 5J3RA 2MYGA 4JRRA 3W6GA 2DBCA 2YNXA 5CP1A 3I69A 2X64A 2CAQA 3BJ5A 2GGTA 4RI6A 3F8UA 4EDZA 4RI7A 3RPPA 1TRUA 2EIOA 3OR5A 4IGJA 1QFNA 4KAEA 2EIQA 2J9HA 5FWGA 4MZBA 1J9BA 4MLYA 4NMUA 1URMA 1A0FA 1EP7A 4BWQA 4MJAA 2H30A 1DUGA 1VF1A 1A2MA 4BL7A 3ERGA 1BAYA 1MD3A 2F8AA 5J5NA 1N2AA 4N30A 4GSNA 1PX6A 1X5EA 1B9XC 4FYCA 1FW1A 1ACVA 3HHVA 3CTFA 2GZYA 3LSZA 5HR2A 2PWJA 3G7YA 2GQLA 4YQMA 2H1AA 3IAS2 4TN8A 1GH2A 2JZTA 2IMEA 4K7IA 2VL3A 3KJYA 5F8BA 2FCHA 3M9KA 4JR6A 3TUEA 3NZNA 2M80A 4OMVA 3HVXA 1ZL9A 1X9MB 2LNTA 4ECCA 2KLXA 1TJDA 5A5KA 4KE3A 2FY6A 2R6KA 5AN1A 1Q98A 2C3NA 1XWBA 2IFQB 3TGZA 4V2MA 2E0QA 3VWVA 3FHKA 5D9XA 3A2WA 2PPTA 3CSHA 1FB0A 3TKQA 3ERWA 3TKSA 1AW9A 1EV9A 4RQXA 5G2ZA 2ALBA 2H1BA 4JE1A 4OCEA 3IDVA 2VLUA 3TJGA 3ZFLA 1ST9A 1BEDA 4FIWA 4HJMA 2HSHA 5IOXA 1GSEA 1XZOA 4PNGA 1H4OA 3KEBA 1YKCA 5ENUA 1FOVA 2CVKA 2F51A 2GT5A 4ID0A 4TKYA 3TRPA 4F2IA 4YAVA 5A4VA 1RW1A 3TB2A 2C1YA 5KN3A 1IYIA 4IELA 3DD3A 2C0GA 3VI5A 4ILFA 4V1Ag 4EXJA 3TJKA 4P3YB 3P2AA 1GUKA 2HNLA 4GSSA 2YPMA 4WKWA 4ZIJA 5IMDA 2A2SA 4XRDA 1A2LA 1TRWA 2CV4A 4FH8A 4MZCA 1GTBA 2YWIA 3HD5A 3GIXA 1G6YA 2DMMA 3F4SA 1Z3EA 2A4VA 4WBRD 1XXUA 4GQFA 2IPAA 2I81A 2XBIA 3CSJA 3GSTA 7GSSA 2IMDA 5CRDA 3DWVA 4TR1B 3C8EA 2KHPA 3E3EA 1R5PA 5DAKA 2YN1A 2OBIA 4XCSA 1AAZA 2CZ3A 1UN2A 11GSA 2YWOA 2VCQA 3ZYWA 2MBTA 5G31A 5GAND 2WB9A 3IK7A 3MDKA 2JZRA 4I6XA 4ML6A 5ECKB 1VF4A 1THXA 3FY7A 1SK1A 3BOAA 3QAVA 1TP9A 2L57A 3U6VA 5JCUA 4GWRA 3CMIA 4IN0A 1T1VA 3RHBA 2H72A 2IMIA 1X5CA 1OE8A 2DC5A 5GZZB 17GSA 2ON5A 2R2JA 4YH2A 4TRXA 9GSSA 5DJMA 1ZGNA 3QFBC 2IN3A 2LSTA 3C7MA 5DALA 5IO0A 1EZKA 4K7NA 2CQ9A 3GL3A 4XS4A 1V98A 4TOPA 1F37A 2CZ2A 3ZVJA 1A2JA 4AGSA 1SENA 1SK2A 3TRQA 3HJOA 4HU9A 4L0WA 3LQ7A 3NOFA 3N9JA 3DKSA 5DQSA 3TKSE 3KP8A 3HVVA 1NSWA 2BMXA 2H70A 2VLTA 2YV9A 2VD1A 2HZFA 3VURA 1GLQA 1ERWA 1XWKA 3N5OA 1TK8B 1GTIA 4J57E 1E6BA 2K8VA 4DSSA 2JSZA 3EC3A 1GSDA 1KTEA 2HLSA 2BJXA 5DCGA 3PGTA 1GSFA 1A8YA 4NPBA 2OJLA 1EWXA 2LNSA 2PBJA 1YJ6A 1YEXA 3D0ZA 4OFMA 2FD3A 5GSTA 2OACA 1R26A 4LMWA 3RDWA 2R37A 1Z7RA 3EU3A 1NM3A 3UEMA 4BPYA 5A4WA 5IMCA 3FYGA 2JU5A 5EY6A 4PQ1A 20GSA 4IP1A 1ERVA 5L71A 1Z5YE 1YEPA 4AJ8A 1OC8A 1WJKA 4NV5A 4HUAA 2F3MA 2VAFA 3LXTA 4KX4A 2DJJA 1FG4A 3WGEA 2GSRA 6GSSA 2C3QA 5E4WA 1SKRB 1R7HA 4EC0A 2CX4A 2FWFA 4AJ7A 4IW9A 3KH9A 2REMA 3BD2A 4X1UA 2J23A 4LLRA 1QMVA 1GL8A 2PVOC 5H5RA 4AJ6A 3ZRDA 2AB6A 3QDNA 4BWSA 3UOMA 6GSXA 3JCML 1F3AA 4KCEA 1M2AA 3LWAA 1K3YA 5ID2A 3EYTA 2H0HA 1GNWA 1TU8A 2GT6A 2MBSA 3LYPA 2GLRA 2E7PA 5LCZA 5ECIB 4PQHA 18GSA 4MZWA 1PRXA 1ML6A 2LTKA 5ECLB 4GQCA 1YF1A 1KBNA 4PQIA 4JEDA 3BBYA 3IHQA 4O7HA 4NV2A 3HA9A 16GSA 4EDYA 4Q5RA 1JZDA 1JZRA 2DMLA 2H1DA 3M1GA 2R3XA 4G19A 2DLXA 2GSQA 2BTOT 4POLA 4KSMA 3F4RA 2YZHA 2IWTA 2LS5A 4EL1A 1F9MA 1GSUA 3TKSC 5DAKB 1SYXA 2ON7A 4I2UA 1A8LA 3C73A 1PKZA 5D9TA 1O73A 2DJ3A 4BA7A 3GKKA 3TOUA 4YQUA 4D73A 2HI7A 5D9WA 1SL2B 5ECPB 3IRAA 3EMXA 1O8WA 4O92A 1XBSA 1SD8A 1MDKA 2RIIA 2VD0A 3ME8A 4I2TA 5DQYA 1K3LA 4ZILA 2TRXA 3A5WA 2OE0A 5JWRB 2P31A 3KM6A 3QAGA 1V2AA 2WFCA 2I1UA 2LQQA 3TJBA 2L5LA 1V57A 2O85A 4HQZA 4ECJA 3I6AA 4HZ4A 3TJFA 2MMNA 4EE0A 4ZXGA 5DALB 2IL3A 3DGQA 4LL1B 4XS4B 4PX1A 2WCIA 5F06A 5EVOA 5ELAA 3HJPA 4GRFA 4KH7A 1XVWA 3H8QA 3IOSA 3GKMA 3KCMA 1LU4A 3SBCA 4O32A 3O3TA 1O8XA 3UL3A 2K8SA 1MDJA 3W8SA 2R4VA 1TOFA 3L0HA 5H5QA 5HR1A 2VCZA 2LV3A 1S3AA 1HNBA 1TK0B 2VCWA 2LUSA 5CREA 4DSSB 3UMAA 3Q74A 3IE3A 5CRGA 3ZFBA 1QXHA 5G1LA 2AV4A 3I43A 2B6MA 14GSA 1SKWB 3IC4A 4POBA 4L5LA 1U3IA 4MMMA 1XW6A 1EOGA 2NVLA 2VCTA 1XCCA 4J2FA 2DSAA 2GDRA 2B1LA 1TDIA 4ECBA 1PN9A 1VRSD 3VFIA 2YWNA 1QUWA 4LMVA 4HI7A 4JBBA 3GRXA 4EF0A 1XOBA 4HOJA 2DJ0A 2HT9A 5J9CA 3US3A 4LL4B 2X8GA 2PMTA 4IJ3A 4FYBA 2VUPA 3L9UA 1VGLA 5ECQB 3LYKA 3O6TA 4G9HA 2FA8A 1BJXA 3APSA 5DCHA 3M3MA 1MDIA 1R5AA 2IMKA 2OADA 3FZ9A 1SKSB 6GSVA 5AISA 2H76A 1SJZA 5DJLA 1KEBA 3DRNA 5G5EA 1OC3A 2RUFA 4NHWA 5ECOB 2KP2A 4PURA 5JWQB 3VWUA 3GV1A 4J56E 1WRYA 3GYKA 3HJMA 2AJQB 3MNGA 3P8WA 2DJ2A 3ZTLA 5ID2B 3HY2A 3L78A 3TRXA 5AGYA 2GS3A 1UVZA 4ZBDA 4N10A 5GSSA 1Z6NA 4KDUA 4YAPA 4ZB9A 3WGXA 2YZUA 4OWYA 1XPVA 4XS1A 1TW9A 4TXVA 4F0CA 4XHMA 3HVSA 3FRCA
chains in the Genus database with same CATH superfamily
5ECNB 1VF3A 2X4AA 3F9UA 4MH3A 4PGTA 2L59A 3PH9A 5DVBA 4RQRA 1YQ1A 2B5EA 1AQWA 2JACA 2PUKC 5CNWA 2MMOA 2HSYA 1WMJA 1DE1A 2V6KA 1QQ2A 3WT2A 4CDOA 3KP9A 2M72A 2R5GA 3UVHA 1GTAA 2RUEA 2GZPA 2PVQA 4ZL7A 2E2GA 3F6FA 5KEJA 3D5JA 3F0IA 3C1SA 1YKAA 2I3YA 1SYRA 5HFKA 1TRSA 3LXZA 3D6IA 3LEFA 4D73B 1WPIA 3DMLA 3CRUA 3GMFA 4MCUA 1T7PB 1OAZA 4WXTA 1Z7PA 2G2QA 3HZ8A 5HQPA 3VWXA 4NXIA 2FNOA 1DSBA 3QPMA 4H86A 1U3AA 1ILOA 1OKTA 3C1RA 3ISOA 3DIEA 3QR6A 3ME7A 1A24A 4MDCA 3CTGA 1NW2A 3GSSA 4MNNA 2VIMA 4IS0A 3FR6A 2H8LA 4ULXA 2CX3A 4HSCX 3D22A 5B6MA 3UIWA 2DJ1A 2NDOA 3ZIJA 5KN1A 3EURA 1YY7A 4K6XA 3IBHA 4Q5FA 2AUVA 5D96A 3UAPA 1JLWA 3KTBA 5B8AA 5KN0A 3Q19A 5HFIA 12GSA 1ERTA 5F05A 3FR3A 1LBKA 1OE7A 1A23A 2F9SA 2FUG2 5ECHB 3GA4A 3LW9A 3ED3A 5CRHA 4KUNA 3RPNA 3GUSA 3V1WA 4KB3A 2HZEA 2XHFA 4PTSA 2LJAA 4BVXA 1EV4A 4KNDA 4MJEA 4KW6A 3TKRA 1FAAA 4CHSA 3IXRA 4QL7A 3KH7A 1AXDA 5IPGA 4MF7A 4MK3A 2A4HA 1E2YA 2WDUA 2R0PA 1TI1A 1U6TA 4USSA 4ISDA 2H71A 5IMAA 5AIXA 1ZCPA 4L5OA 1TK5B 3GN3A 4X43A 3EINA 3ZIVA 2PERA 2V41A 1O7UA 5D73A 1AC1A 3GX0A 19GSA 3LGCA 3QMXA 3L9VA 3M9JA 2C0EA 1MEKA 2IIYA 1T00A 3RHCA 1EOHA 3HXSA 2KP1A 2XC2A 3ZL5A 2VOCA 1I5GA 2AAWA 3ZMLA 1PKWA 4RUVA 3EWLA 1T4YA 3GH9A 3Q6OA 2K18A 1I9DA 4AF2A 2QSIA 4EO3A 4OO4A 2OKAA 2WZ9A 4XS6A 4OD7A 2L4CA 1B4PA 3HZ4A 2VL2A 4DSQA 1M2DA 2B7KA 3CBUA 4TW5A 1GUMA 2GSTA 3VK9A 1HYUA 3APOA 1WIKA 4ZBAA 3WYWA 5FHIA 4HQSA 3L4NA 3F63A 5AIVA 1CQGA 2N5BA 4I8BA 3HKRA 5CO3A 3KMNA 2K9FA 1F6MC 3IV4A 5H5SA 2ZUPA 1Q4JA 5F07A 4PNFA 1M9AA 1GRXA 2YP6A 3H4KA 1USBA 2CVDA 4BVYA 3D4MA 8GSSA 4XTSA 5IMVA 2I4AA 2L6DA 4IJIA 3ZVJD 2RM5A 2CAIA 3D21A 3IK9A 3KGKA 1X9SB 3A2VA 3DVWA 3KMOA 5JCWA 3GH6A 1G7EA 2B1KA 1Y6EA 1YDKA 1FB6A 3J7Yb 3UJ1A 6GSTA 3D4TA 5LNKe 3GTUA 1U87A 1U88A 2L4QA 1DE2A 2FGXA 2GQKA 3FR9A 2FHEA 4YKGA 3R2QA 2EIRA 3ZREA 1TTZA 2TIRA 1EGRA 3H93A 1GTUA 2VM1A 3VPTA 2V2GA 3GNJA 1HD2A 3FEUA 1GUHA 2R0GA 2FWEA 5IQYA 13GSA 2ZCTA 5FT3A 3F3RA 2C0FA 2V1MA 5CYYA 2LQOA 2VCXA 3VLNA 4V1Ap 3ZZXA 5EPFA 4Q5NA 2L5OA 2HXKA 3G7JA 4NWYA 5A4UA 2WS2A 5HR0A 2NTOA 3BCKA 5IM9A 3C71A 1AIUA 5B7CA 1QK8A 3UBLA 1TKDB 2H19A 2WRTA 4HDEA 4G10A 2MZCA 1BG5A 1VF2A 3MWHA 1FVKA 3MAKA 2LEGA 3F3QA 4WETA 2DJKA 1Y25A 3IC8A 4L0UA 4IQ1A 5HR3A 2C80A 1W4VA 3IAM2 3FMWA 4TVEA 4OFNA 1YF0A 3NIVA 3MSZA 3TDGA 1B4QA 2H6ZA 1T8EB 4E8HA 2VL9A 1MD4A 2PU9C 3QD9A 2OE1A 2DIYA 1YZXA 3K8NA 4PUFC 3VPQA 2ZNMA 5JWOB 2B3SA 4FYUA 2TRCP 1T4ZA 3FKFA 5D93A 4XIHA 1JZWA 2YCDA 2HZEB 1K0AA 3QAWA 4BVXB 2VM2A 3AY8A 3I9V2 3TOTA 2JSYA 2CVBA 1F3BA 3A5IA 1LJRA 1A0RP 4POKA 1ZYQB 3A2XA 4K5RA 3GL5A 4X0XA 2P0GA 5IIZA 3EE2A 1PMTA 4ZL8A 1AQXA 3HYPA 3KD0A 4ACSA 2PGTA 2H75A 1TRVA 4K0GA 5C00A 1SD9A 1GSYA 4JU5A 2A2RA 2VCVA 3UBKA 2C4JA 2HYXA 1V58A 1QGVA 2FLSA 2QKEA 2L6CA 5EL8A 1THOA 1PSQA 1K0OA 1WOUA 5ABRA 3BCIA 3U5RE 2CT6A 4ZB8A 4IP6A 3GHAA 4ZL9A 2Z9SA 1HNCA 4K0NA 1EEJA 2N5FA 3TCOA 1ZYNA 4K7OA 4ICYA 2YV7A 2JADA 1B48A 2YANA 3LG6A 4WEYA 1V40A 2OE3A 3CRTA 4MPGA 2P5RA 2EC4A 1XFLA 4DVCA 1G0TA 2IJYA 3HCZA 3S9FA 2D2ZA 2IMFA 4TXOA 4I5QA 5D8IA 1HQOA 1M99A 1OKDA 2JL4A 1XWCA 4GCIA 4MJBA 3P7XA 1EGOA 4OCFA 4TR3A 1M2BA 3G7IA 1RK4A 1FHEA 2RM6A 4F82A 2FWHA 4IKHA 2XBQA 3EU4A 4GF0A 1M9BA 1JFUA 1GULA 4V2NA 4K2DA 1N8JA 1GSQA 4MH2A 4MABA 5D9VA 2FA4A 2LJKA 1G6WA 3ZMKA 5ECSA 2H6XA 4GSTA 4BVYB 5CRWA 5KN2A 4POMA 4Z2RA 2RLIA 1OYJA 3QCPA 4XRAA 4Z7XA 3LFLA 1K0CA 1TXXA 4O5QA 3IPZA 4LA1A 2B5XA 1XVQA 2XPDA 4ZB6A 3GTUB 5E59A 1IYHA 3GKXA 3DVXA 5GAPD 1SL1B 4MJCA 5C04A 1XWGA 5CAXA 1CQHA 3W8JA 1GSSA 1XWAA 3FZ5A 1S3DA 1AQVA 3M8NA 4JR4A 3PR8A 1OVNA 3A3TA 1K0DA 22GSA 4IHUA 1TU7A 4MA9A 2MMAA 3TJJA 1B8XA 5COHA 4WBJA 3APQA 3VI7A 4A5PA 4WF4A 3DEXA 5DBQA 4TR4A 1G7OA 1O6JA 1GP1A 3PINA 1SJIA 1W89A 3HVNA 3KZQA 4O5RA 1SK0A 2VL2C 1GNEA 1O85A 2AHEA 4K9ZA 1MTCA 3QOUA 2K6VA 4PUAA 3FK8A 10GSA 1ON4A 4IQAA 2H73A 4NAXA 1PGTA 2ES7A 3EPTA 3CSIA 4O5UA 3SWLA 2HE3A 4OFTA 3WT1A 1DBYA 1OC9B 5ELGA 4EKZA 2N5AA 1R4WA 2VLVA 4QQ7A 2V6OA 3CXGA 4WF5A 2O87A 1BQ7A 4JZQA 3GX8A 3DYRA 1K3OA 1J08A 4G2EA 4GTUA 2QGVA 3MIXA 4K1FA 3E0UA 4GXZA 1JHBA 1X5DA 1FVJA 2GQMA 2H74A 2H6YA 4Q5QA 1SL0B 4N11A 1B9YC 3M0FA 1K0MA 5IMZA 4N0VA 2LKUA 4N0ZA 1PQNA 1WP0A 3CYNA 1XW5A 5LD0A 2FWGA 2H66A 2F8FA 2GVPA 2AYTA 3H1NA 6GSUA 2VO4A 4K2XA 2H0IA 1EEMA 2M46A 1ERUA 1K0NA 2WJUA 4ZBBA 2B5YA 2V32A 4I97A 5F0GA 5ECRB 2H1GA 2LRNA 2P5QA 5IMFA 2LJRA 6GSYA 1ZYPA 2G0FA 5B6NA 1RQMA 3FW2A 2HFDA 1NHOA 5INYA 1EP8A 2KUCA 5IPHA 1M7TA 3GURA 1AUCA 1SJ6A 3ZLPA 2NPBA 5J41A 5J4UA 3GFKA 1Z6MA 3ERFA 3H79A 4G0LA 6GSWA 1M0UA 2HRFA 2X99A 1HNAA 1K0BA 1PA3A 2DKIA 2JZSA 5J9BA 5B8BA 5JCGA 3E9JB 4TXOB 5IOWA 1C72A 2CA8A 4E8EA 2H0GA 3DXBA 2X8CA 3RBTA 2IFQA 1UC7A 4KCAA 4DEJA 3UARA 2MMZA 3IA1A 4K8MA 2YJ7A 4KDYA 5ECMB 4WR4A 3VWWA 4V2LA 1JLVA 4CW9A 3F4TA 2WGRA 4IVFA 1S3RA 1Z9HA 4MF5A 1ZMAA 3QFAC 5G1KA 1J0FA 1ZZYA 4HU7A 1ABAA 1X9WB 4EVMA 1H75A 4HS1A 2WULA 5HFGA 1X0RA 4KDXA 4MF6A 3ZITA 2GTUA 4IBPA 3KIJA 1KNGA 2OBKA 3RAZA 2HRNA 4MP4A 1BX9A 1XIYA 2GSSA 3PPUA 3KXOA 1WE0A 3J7Yk 2X49A 2YJHA 4FO5A 1ZOFA 4TR0A 2E2MA 4NHZA 4L8EA 4DSRA 3FZAA 1V9WA 4WR5A 3LJRA 3GKNA 3IR4A 2XPEA 4KA0A 1TI3A 2C8UA 3UVTA 1WWJA 5G30A 2O7KA 4HZ2A 1NHYA 1PL2A 1XOAA 4KSOA 3KTLA 3LORA 4F03A 2B7JA 4ECIA 2OA7A 5DDLA 3WD6A 2DIZA 3TKPA 1F2EA 1T3BA 2O8VB 4OO5A 4EUYA 3P90A 2YOIA 2QC7A 1GWCA 3F6DA 1BYEA 2LRTA 4HJ2A 4F9ZA 2NBSA 1PX7A 1O81A 4KF9A 3EMPA 1SU9A 3EVIA 1FO5A 3FZ4A 2LRCA 3O76A 2H01A 4TR1A 5IO2A 3Q18A 4PXOA 1S3CA 3WGDA 1PD21 1ZYEA 1GLPA 2YWMA 2I9HA 2C0DA 4KGIA 1JZOA 3G9BA 4HEA2 2HRAA 2C3TA 3HDCA 4QL9A 2X8HA 2O89A 1UA5A 4MPFA 2PN8A 2KOKA 1XW9A 2GZZA 3L9SA 5G5FA 1OC9A 1PL1A 4ML1A 4YQVA 4GLTA 4F0BA 5J3RA 2MYGA 4JRRA 3W6GA 2DBCA 2YNXA 5CP1A 3I69A 2X64A 2CAQA 3BJ5A 2GGTA 4RI6A 3F8UA 4EDZA 4RI7A 3RPPA 1TRUA 2EIOA 3OR5A 4IGJA 1QFNA 4KAEA 2EIQA 2J9HA 5FWGA 4MZBA 1J9BA 4MLYA 4NMUA 1URMA 1A0FA 1EP7A 4BWQA 4MJAA 2H30A 1DUGA 1VF1A 1A2MA 4BL7A 3ERGA 1BAYA 1MD3A 2F8AA 5J5NA 1N2AA 4N30A 4GSNA 1PX6A 1X5EA 1B9XC 4FYCA 1FW1A 1ACVA 3HHVA 3CTFA 2GZYA 3LSZA 5HR2A 2PWJA 3G7YA 2GQLA 4YQMA 2H1AA 3IAS2 4TN8A 1GH2A 2JZTA 2IMEA 4K7IA 2VL3A 3KJYA 5F8BA 2FCHA 3M9KA 4JR6A 3TUEA 3CQFA 3NZNA 2M80A 4OMVA 3HVXA 1ZL9A 1X9MB 2LNTA 4ECCA 2KLXA 1TJDA 5A5KA 4KE3A 2FY6A 3MYDA 2R6KA 2HRKA 5AN1A 1Q98A 2C3NA 1XWBA 2IFQB 3TGZA 4V2MA 2E0QA 3VWVA 3FHKA 5D9XA 3A2WA 2PPTA 3CSHA 1FB0A 3TKQA 3ERWA 3TKSA 1AW9A 1EV9A 4RQXA 5G2ZA 2ALBA 2H1BA 4JE1A 4OCEA 3IDVA 2VLUA 3TJGA 3ZFLA 1ST9A 1BEDA 4FIWA 4HJMA 2HSHA 5IOXA 1GSEA 1XZOA 4PNGA 1H4OA 3KEBA 1YKCA 5ENUA 1FOVA 2CVKA 2HSMA 2F51A 2GT5A 4ID0A 4TKYA 3TRPA 4F2IA 4YAVA 5A4VA 1RW1A 3TB2A 1XG8A 2C1YA 5KN3A 1IYIA 4IELA 3DD3A 2C0GA 3VI5A 5BRTA 4ILFA 4V1Ag 4EXJA 3TJKA 4P3YB 3P2AA 1GUKA 2HNLA 4GSSA 2YPMA 4WKWA 4ZIJA 5IMDA 2A2SA 4XRDA 1A2LA 1TRWA 2CV4A 4FH8A 4MZCA 1GTBA 2YWIA 3HD5A 4CY8A 3GIXA 1G6YA 2DMMA 3F4SA 1Z3EA 2A4VA 4WBRD 1XXUA 4GQFA 2IPAA 2I81A 2XBIA 3CSJA 3GSTA 7GSSA 2IMDA 5CRDA 3DWVA 4TR1B 3C8EA 2KHPA 3E3EA 1R5PA 5DAKA 2QA2A 2YN1A 2OBIA 4XCSA 1AAZA 2CZ3A 1UN2A 11GSA 2YWOA 2VCQA 3ZYWA 2MBTA 5G31A 5GAND 2WB9A 3IK7A 3MDKA 2JZRA 4I6XA 4ML6A 5ECKB 1VF4A 1THXA 3FY7A 1SK1A 3BOAA 3QAVA 1TP9A 2L57A 3U6VA 5JCUA 4GWRA 3CMIA 4IN0A 1T1VA 3RHBA 4BIKA 2H72A 2IMIA 1X5CA 1OE8A 2DC5A 5GZZB 17GSA 2ON5A 2R2JA 4YH2A 4TRXA 9GSSA 5DJMA 1ZGNA 3QFBC 2IN3A 2LSTA 3C7MA 5DALA 5IO0A 1EZKA 4K7NA 2CQ9A 3GL3A 4XS4A 1V98A 4G0KA 4YKFA 4TOPA 2UZ8A 1F37A 2CZ2A 3ZVJA 1A2JA 4AGSA 1SENA 1SK2A 3TRQA 3HJOA 4HU9A 4L0WA 3LQ7A 3NOFA 3N9JA 4BL7B 3DKSA 5DQSA 3TKSE 1M3JA 3KP8A 3HVVA 1NSWA 2BMXA 2H70A 2VLTA 2YV9A 2VD1A 2HZFA 3VURA 1GLQA 1ERWA 1XWKA 2DKHA 3N5OA 1TK8B 1GTIA 4J57E 1E6BA 2K8VA 4DSSA 2JSZA 3EC3A 1GSDA 1KTEA 2HLSA 2BJXA 5DCGA 3PGTA 1GSFA 1A8YA 4CY6A 4NPBA 2OJLA 1EWXA 2LNSA 2PBJA 1YJ6A 1YEXA 3D0ZA 4OFMA 2FD3A 5GSTA 2OACA 1R26A 4LMWA 3RDWA 2R37A 1Z7RA 3EU3A 1NM3A 3UEMA 4BPYA 5A4WA 1FOHA 5IMCA 3FYGA 2JU5A 4EIPA 5EY6A 4PQ1A 20GSA 1PFOA 4IP1A 1ERVA 5L71A 1Z5YE 1YEPA 4AJ8A 1OC8A 1WJKA 4NV5A 4HUAA 2F3MA 2VAFA 3LXTA 4KX4A 2DJJA 1FG4A 3WGEA 2GSRA 6GSSA 2C3QA 5E4WA 1SKRB 1R7HA 4EC0A 2CX4A 2FWFA 4AJ7A 4IW9A 3KH9A 2REMA 1PN0A 3BD2A 4X1UA 2J23A 4LLRA 1QMVA 1GL8A 2PVOC 5H5RA 4AJ6A 3ZRDA 4X4JA 2AB6A 3QDNA 4BWSA 3UOMA 6GSXA 3JCML 1F3AA 4KCEA 1M2AA 4K5SA 3LWAA 1K3YA 5ID2A 3EYTA 2H0HA 1GNWA 1TU8A 2GT6A 2MBSA 3LYPA 2GLRA 2E7PA 5LCZA 5ECIB 4PQHA 18GSA 4MZWA 1PRXA 1ML6A 2LTKA 5ECLB 4GQCA 1YF1A 1KBNA 4PQIA 4JEDA 3BBYA 3IHQA 4O7HA 4NV2A 3HA9A 16GSA 4EDYA 4Q5RA 1JZDA 1JZRA 2DMLA 2H1DA 3M1GA 2R3XA 4G19A 2DLXA 2GSQA 2BTOT 4POLA 4KSMA 3F4RA 2YZHA 2IWTA 2LS5A 4EL1A 1F9MA 1GSUA 3TKSC 5DAKB 1SYXA 2ON7A 4I2UA 1A8LA 3C73A 1PKZA 5D9TA 1O73A 2DJ3A 4BA7A 3GKKA 3TOUA 4YQUA 4D73A 2HI7A 5D9WA 1SL2B 5ECPB 3IRAA 3EMXA 1O8WA 4O92A 1XBSA 1SD8A 1MDKA 2RIIA 2VD0A 3ME8A 4I2TA 5DQYA 1K3LA 4ZILA 2TRXA 5KOWA 3A5WA 2OE0A 5JWRB 5KOXA 2P31A 4FQUA 3KM6A 3QAGA 1V2AA 2WFCA 4Z2UA 2I1UA 2LQQA 3TJBA 2L5LA 1V57A 2O85A 4HQZA 4ECJA 3I6AA 4HZ4A 3TJFA 2MMNA 4EE0A 4ZXGA 5DALB 2IL3A 3DGQA 4LL1B 4XS4B 4PX1A 2WCIA 5F06A 5EVOA 5ELAA 3HJPA 2A2PA 4GRFA 4KH7A 1XVWA 3H8QA 3IOSA 3GKMA 3KCMA 1LU4A 3SBCA 4O32A 3O3TA 1O8XA 3UL3A 3R3EA 2K8SA 1MDJA 3W8SA 2R4VA 1TOFA 3L0HA 5H5QA 5HR1A 2VCZA 2LV3A 1S3AA 1HNBA 1TK0B 2VCWA 2LUSA 5CREA 4DSSB 3UMAA 3Q74A 3IE3A 5CRGA 3ZFBA 1QXHA 5G1LA 2AV4A 3I43A 2B6MA 14GSA 1SKWB 3IHGA 5BMUA 3IC4A 4POBA 4L5LA 1U3IA 2QA1A 4MMMA 1XW6A 1EOGA 2NVLA 2VCTA 1XCCA 4J2FA 2R0CA 2DSAA 2GDRA 2B1LA 1TDIA 4ECBA 1PN9A 1VRSD 3VFIA 2YWNA 1QUWA 4LMVA 4HI7A 4JBBA 3GRXA 4EF0A 1XOBA 4HOJA 2DJ0A 2HT9A 5J9CA 3US3A 4LL4B 4Z2TA 2X8GA 2PMTA 4IJ3A 4FYBA 2VUPA 3L9UA 1VGLA 5ECQB 3LYKA 3O6TA 4G9HA 2FA8A 1BJXA 3APSA 5DCHA 3M3MA 1MDIA 1R5AA 2IMKA 2OADA 3FZ9A 1SKSB 6GSVA 5AISA 2H76A 1SJZA 5DJLA 1KEBA 3DRNA 5G5EA 1OC3A 2RUFA 4EIQA 4NHWA 1M3IA 5ECOB 2KP2A 4PURA 5JWQB 3VWUA 4G0IA 3GV1A 4J56E 1WRYA 3GYKA 3HJMA 2AJQB 3MNGA 3P8WA 2DJ2A 3ZTLA 5ID2B 3HY2A 3L78A 3TRXA 5AGYA 2GS3A 1UVZA 4ZBDA 4N10A 5GSSA 1Z6NA 4KDUA 4YAPA 4ZB9A 3WGXA 2YZUA 4OWYA 1XPVA 4XS1A 1TW9A 4TXVA 4F0CA 4XHMA 3HVSA 3FRCA
chains in the Genus database with same CATH topology
5ECNB 1VF3A 2X4AA 3F9UA 4MH3A 4PGTA 2L59A 3PH9A 5DVBA 4RQRA 1YQ1A 2B5EA 1AQWA 2JACA 2PUKC 5CNWA 2MMOA 2HSYA 1WMJA 1DE1A 2V6KA 1QQ2A 3WT2A 4CDOA 3KP9A 2M72A 2R5GA 3UVHA 1GTAA 2RUEA 2GZPA 2PVQA 4ZL7A 2E2GA 3F6FA 5KEJA 3D5JA 3F0IA 3C1SA 1YKAA 2I3YA 1SYRA 5HFKA 1TRSA 3LXZA 3D6IA 3LEFA 4D73B 1WPIA 3DMLA 3CRUA 3GMFA 4MCUA 1T7PB 1OAZA 4WXTA 1Z7PA 2G2QA 3HZ8A 5HQPA 3VWXA 4NXIA 2FNOA 1DSBA 3QPMA 4H86A 1U3AA 1ILOA 1OKTA 3C1RA 3ISOA 3DIEA 3QR6A 3ME7A 1A24A 4MDCA 3CTGA 1NW2A 3GSSA 4MNNA 2VIMA 4IS0A 3FR6A 2H8LA 4ULXA 2CX3A 3D22A 5B6MA 3UIWA 2DJ1A 2NDOA 3ZIJA 5KN1A 3EURA 1YY7A 4K6XA 3IBHA 4Q5FA 2AUVA 5D96A 3UAPA 1JLWA 3KTBA 5B8AA 5KN0A 3Q19A 5HFIA 12GSA 1ERTA 5F05A 3FR3A 1LBKA 1OE7A 1A23A 2F9SA 2FUG2 5ECHB 3GA4A 3LW9A 3ED3A 5CRHA 4KUNA 3RPNA 3GUSA 3V1WA 4KB3A 2HZEA 2XHFA 4PTSA 2LJAA 4BVXA 1EV4A 4KNDA 4MJEA 4KW6A 3TKRA 1FAAA 4CHSA 3IXRA 4QL7A 3KH7A 1AXDA 5IPGA 4MF7A 4MK3A 2A4HA 1E2YA 2WDUA 2R0PA 1TI1A 1U6TA 4USSA 4ISDA 2H71A 5IMAA 5AIXA 1ZCPA 4L5OA 1TK5B 3GN3A 4X43A 3EINA 3ZIVA 2PERA 2V41A 1O7UA 5D73A 1AC1A 3GX0A 19GSA 3LGCA 3QMXA 3L9VA 3M9JA 2C0EA 1MEKA 2IIYA 1T00A 3RHCA 1EOHA 3HXSA 2KP1A 2XC2A 3ZL5A 2VOCA 1I5GA 2AAWA 3ZMLA 1PKWA 4RUVA 3EWLA 1T4YA 3GH9A 3Q6OA 2K18A 1I9DA 4AF2A 2QSIA 4EO3A 4OO4A 2OKAA 2WZ9A 4XS6A 4OD7A 2L4CA 1B4PA 3HZ4A 2VL2A 4DSQA 1M2DA 2B7KA 3CBUA 4TW5A 1GUMA 2GSTA 3VK9A 1HYUA 3APOA 1WIKA 4ZBAA 3WYWA 5FHIA 4HQSA 3L4NA 3F63A 5AIVA 1CQGA 2N5BA 4I8BA 3HKRA 5CO3A 3KMNA 2K9FA 1F6MC 3IV4A 5H5SA 2ZUPA 1Q4JA 5F07A 4PNFA 1M9AA 1GRXA 2YP6A 3H4KA 1USBA 2CVDA 4BVYA 3D4MA 8GSSA 4XTSA 5IMVA 2I4AA 2L6DA 4IJIA 3ZVJD 2RM5A 2CAIA 3D21A 3IK9A 3KGKA 1X9SB 3A2VA 3DVWA 3KMOA 5JCWA 3GH6A 1G7EA 2B1KA 1Y6EA 1YDKA 1FB6A 3J7Yb 3UJ1A 6GSTA 3D4TA 5LNKe 3GTUA 1U87A 1U88A 2L4QA 1DE2A 2FGXA 2GQKA 3FR9A 2FHEA 4YKGA 3R2QA 2EIRA 3ZREA 1TTZA 2TIRA 1EGRA 3H93A 1GTUA 2VM1A 3VPTA 2V2GA 3GNJA 1HD2A 3FEUA 1GUHA 2R0GA 2FWEA 5IQYA 13GSA 2ZCTA 5FT3A 3F3RA 2C0FA 2V1MA 5CYYA 2LQOA 2VCXA 3VLNA 4V1Ap 3ZZXA 5EPFA 4Q5NA 2L5OA 2HXKA 3G7JA 4NWYA 5A4UA 2WS2A 5HR0A 2NTOA 3BCKA 5IM9A 3C71A 1AIUA 5B7CA 1QK8A 3UBLA 1TKDB 2H19A 2WRTA 4HDEA 4G10A 2MZCA 1BG5A 1VF2A 3MWHA 1FVKA 3MAKA 2LEGA 3F3QA 4WETA 2DJKA 1Y25A 3IC8A 4L0UA 4IQ1A 5HR3A 2C80A 1W4VA 3IAM2 3FMWA 4TVEA 4OFNA 1YF0A 3NIVA 3MSZA 3TDGA 1B4QA 2H6ZA 1T8EB 4E8HA 2VL9A 1MD4A 2PU9C 3QD9A 2OE1A 2DIYA 1YZXA 3K8NA 4PUFC 3VPQA 2ZNMA 5JWOB 2B3SA 4FYUA 2TRCP 1T4ZA 3FKFA 5D93A 4XIHA 1JZWA 2YCDA 2HZEB 1K0AA 3QAWA 4BVXB 2VM2A 3AY8A 3I9V2 3TOTA 2JSYA 2CVBA 1F3BA 3A5IA 1LJRA 1A0RP 4POKA 1ZYQB 3A2XA 4K5RA 3GL5A 4X0XA 2P0GA 5IIZA 3EE2A 1PMTA 4ZL8A 1AQXA 3HYPA 3KD0A 4ACSA 2PGTA 2H75A 1TRVA 4K0GA 5C00A 1SD9A 1GSYA 4JU5A 2A2RA 2VCVA 3UBKA 2C4JA 2HYXA 1V58A 1QGVA 2FLSA 2QKEA 2L6CA 5EL8A 1THOA 1PSQA 1K0OA 1WOUA 5ABRA 3BCIA 3U5RE 2CT6A 4ZB8A 4IP6A 3GHAA 4ZL9A 2Z9SA 1HNCA 4K0NA 1EEJA 2N5FA 3TCOA 1ZYNA 4K7OA 4ICYA 2YV7A 2JADA 1B48A 2YANA 3LG6A 4WEYA 1V40A 2OE3A 3CRTA 4MPGA 2P5RA 2EC4A 1XFLA 4DVCA 1G0TA 2IJYA 3HCZA 3S9FA 2D2ZA 2IMFA 4TXOA 4I5QA 5D8IA 1HQOA 1M99A 1OKDA 2JL4A 1XWCA 4GCIA 4MJBA 3P7XA 1EGOA 4OCFA 4TR3A 1M2BA 3G7IA 1RK4A 1FHEA 2RM6A 4F82A 2FWHA 4IKHA 2XBQA 3EU4A 4GF0A 1M9BA 1JFUA 1GULA 4V2NA 4K2DA 1N8JA 1GSQA 4MH2A 4MABA 5D9VA 2FA4A 2LJKA 1G6WA 3ZMKA 5ECSA 2H6XA 4GSTA 4BVYB 5CRWA 5KN2A 4POMA 4Z2RA 2RLIA 1OYJA 3QCPA 4XRAA 4Z7XA 3LFLA 1K0CA 1TXXA 4O5QA 3IPZA 4LA1A 2B5XA 1XVQA 2XPDA 4ZB6A 3GTUB 5E59A 1IYHA 3GKXA 3DVXA 5GAPD 1SL1B 4MJCA 5C04A 1XWGA 5CAXA 1CQHA 3W8JA 1GSSA 1XWAA 3FZ5A 1S3DA 1AQVA 3M8NA 4JR4A 3PR8A 1OVNA 3A3TA 1K0DA 22GSA 4IHUA 1TU7A 4MA9A 2MMAA 3TJJA 1B8XA 5COHA 4WBJA 3APQA 3VI7A 4A5PA 4WF4A 3DEXA 5DBQA 4TR4A 1G7OA 1O6JA 1GP1A 3PINA 1SJIA 1W89A 3KZQA 4O5RA 1SK0A 2VL2C 1GNEA 1O85A 2AHEA 4K9ZA 1MTCA 3QOUA 2K6VA 4PUAA 3FK8A 10GSA 1ON4A 4IQAA 2H73A 4NAXA 1PGTA 2ES7A 3EPTA 3CSIA 4O5UA 3SWLA 2HE3A 4OFTA 3WT1A 1DBYA 1OC9B 5ELGA 4EKZA 2N5AA 1R4WA 2VLVA 4QQ7A 2V6OA 3CXGA 4WF5A 2O87A 1BQ7A 4JZQA 3GX8A 3DYRA 1K3OA 1J08A 4G2EA 4GTUA 2QGVA 3MIXA 4K1FA 3E0UA 4GXZA 1JHBA 1X5DA 1FVJA 2GQMA 2H74A 2H6YA 4Q5QA 1SL0B 4N11A 1B9YC 3M0FA 1K0MA 5IMZA 4N0VA 2LKUA 4N0ZA 1PQNA 1WP0A 3CYNA 1XW5A 5LD0A 2FWGA 2H66A 2F8FA 2GVPA 2AYTA 3H1NA 6GSUA 2VO4A 4K2XA 2H0IA 1EEMA 2M46A 1ERUA 1K0NA 2WJUA 4ZBBA 2B5YA 2V32A 4I97A 5F0GA 5ECRB 2H1GA 2LRNA 2P5QA 5IMFA 2LJRA 6GSYA 1ZYPA 2G0FA 5B6NA 1RQMA 3FW2A 2HFDA 1NHOA 5INYA 1EP8A 2KUCA 5IPHA 1M7TA 3GURA 1AUCA 1SJ6A 3ZLPA 2NPBA 5J41A 5J4UA 3GFKA 1Z6MA 3ERFA 3H79A 4G0LA 6GSWA 1M0UA 2HRFA 2X99A 1HNAA 1K0BA 1PA3A 2DKIA 2JZSA 5J9BA 5B8BA 5JCGA 3E9JB 4TXOB 5IOWA 1C72A 2CA8A 4E8EA 2H0GA 3DXBA 2X8CA 3RBTA 2IFQA 1UC7A 4KCAA 4DEJA 3UARA 2MMZA 3IA1A 4K8MA 2YJ7A 4KDYA 5ECMB 4WR4A 3VWWA 4V2LA 1JLVA 4CW9A 3F4TA 2WGRA 4IVFA 1Z9HA 4MF5A 1ZMAA 3QFAC 5G1KA 1J0FA 1ZZYA 4HU7A 1ABAA 1X9WB 4EVMA 1H75A 4HS1A 2WULA 5HFGA 1X0RA 4KDXA 4MF6A 3ZITA 2GTUA 4IBPA 3KIJA 1KNGA 2OBKA 3RAZA 2HRNA 4MP4A 1BX9A 1XIYA 2GSSA 3PPUA 3KXOA 1WE0A 3J7Yk 2X49A 2YJHA 4FO5A 1ZOFA 4TR0A 2E2MA 4NHZA 4L8EA 4DSRA 3FZAA 1V9WA 4WR5A 3LJRA 3GKNA 3IR4A 2XPEA 4KA0A 1TI3A 2C8UA 3UVTA 1WWJA 5G30A 2O7KA 4HZ2A 1NHYA 1PL2A 1XOAA 4KSOA 3KTLA 3LORA 4F03A 2B7JA 4ECIA 2OA7A 5DDLA 3WD6A 2DIZA 3TKPA 1F2EA 1T3BA 2O8VB 4OO5A 4EUYA 3P90A 2YOIA 2QC7A 1GWCA 3F6DA 1BYEA 2LRTA 4HJ2A 4F9ZA 2NBSA 1PX7A 1O81A 4KF9A 3EMPA 1SU9A 3EVIA 1FO5A 3FZ4A 2LRCA 3O76A 2H01A 4TR1A 5IO2A 3Q18A 4PXOA 1S3CA 3WGDA 1PD21 1ZYEA 1GLPA 2YWMA 2I9HA 2C0DA 4KGIA 1JZOA 3G9BA 4HEA2 2HRAA 2C3TA 3HDCA 4QL9A 2X8HA 2O89A 1UA5A 4MPFA 2PN8A 2KOKA 1XW9A 2GZZA 3L9SA 5G5FA 1OC9A 1PL1A 4ML1A 4YQVA 4GLTA 4F0BA 5J3RA 2MYGA 4JRRA 3W6GA 2DBCA 2YNXA 5CP1A 3I69A 2X64A 2CAQA 3BJ5A 2GGTA 4RI6A 3F8UA 4EDZA 4RI7A 3RPPA 1TRUA 2EIOA 3OR5A 4IGJA 1QFNA 4KAEA 2EIQA 2J9HA 5FWGA 4MZBA 1J9BA 4MLYA 4NMUA 1URMA 1A0FA 1EP7A 4BWQA 4MJAA 2H30A 1DUGA 1VF1A 1A2MA 4BL7A 3ERGA 1BAYA 1MD3A 2F8AA 5J5NA 1N2AA 4N30A 4GSNA 1PX6A 1X5EA 1B9XC 4FYCA 1FW1A 1ACVA 3HHVA 3CTFA 2GZYA 3LSZA 5HR2A 2PWJA 3G7YA 2GQLA 4YQMA 2H1AA 3IAS2 4TN8A 1GH2A 2JZTA 2IMEA 4K7IA 2VL3A 3KJYA 5F8BA 2FCHA 3M9KA 4JR6A 3TUEA 3NZNA 2M80A 4OMVA 3HVXA 1ZL9A 1X9MB 2LNTA 4ECCA 2KLXA 1TJDA 5A5KA 4KE3A 2FY6A 3MYDA 2R6KA 2HRKA 5AN1A 1Q98A 2C3NA 1XWBA 2IFQB 3TGZA 4V2MA 2E0QA 3VWVA 3FHKA 5D9XA 3A2WA 2PPTA 3CSHA 1FB0A 3TKQA 3ERWA 3TKSA 1AW9A 1EV9A 4RQXA 5G2ZA 2ALBA 2H1BA 4JE1A 4OCEA 3IDVA 2VLUA 3TJGA 3ZFLA 1ST9A 1BEDA 4FIWA 4HJMA 2HSHA 5IOXA 1GSEA 1XZOA 4PNGA 1H4OA 3KEBA 1YKCA 5ENUA 1FOVA 2CVKA 2HSMA 2F51A 2GT5A 4ID0A 4TKYA 3TRPA 4F2IA 4YAVA 5A4VA 1RW1A 3TB2A 2C1YA 5KN3A 1IYIA 4IELA 3DD3A 2C0GA 3VI5A 5BRTA 4ILFA 4V1Ag 4EXJA 3TJKA 4P3YB 3P2AA 1GUKA 2HNLA 4GSSA 2YPMA 4WKWA 4ZIJA 5IMDA 2A2SA 4XRDA 1A2LA 1TRWA 2CV4A 4FH8A 4MZCA 1GTBA 2YWIA 3HD5A 4CY8A 3GIXA 1G6YA 2DMMA 3F4SA 1Z3EA 2A4VA 4WBRD 1XXUA 4GQFA 2IPAA 2I81A 2XBIA 3CSJA 3GSTA 7GSSA 2IMDA 5CRDA 3DWVA 4TR1B 3C8EA 2KHPA 3E3EA 1R5PA 5DAKA 2QA2A 2YN1A 2OBIA 4XCSA 1AAZA 2CZ3A 1UN2A 11GSA 2YWOA 2VCQA 3ZYWA 2MBTA 5G31A 5GAND 2WB9A 3IK7A 3MDKA 2JZRA 4I6XA 4ML6A 5ECKB 1VF4A 1THXA 3FY7A 1SK1A 3BOAA 3QAVA 1TP9A 2L57A 3U6VA 5JCUA 4GWRA 3CMIA 4IN0A 1T1VA 3RHBA 2H72A 2IMIA 1X5CA 1OE8A 2DC5A 5GZZB 17GSA 2ON5A 2R2JA 4YH2A 4TRXA 9GSSA 5DJMA 1ZGNA 3QFBC 2IN3A 2LSTA 3C7MA 5DALA 5IO0A 1EZKA 4K7NA 2CQ9A 3GL3A 4XS4A 1V98A 4G0KA 4YKFA 4TOPA 2UZ8A 1F37A 2CZ2A 3ZVJA 1A2JA 4AGSA 1SENA 1SK2A 3TRQA 3HJOA 4HU9A 4L0WA 3LQ7A 3NOFA 3N9JA 4BL7B 3DKSA 5DQSA 3TKSE 3KP8A 3HVVA 1NSWA 2BMXA 2H70A 2VLTA 2YV9A 2VD1A 2HZFA 3VURA 1GLQA 1ERWA 1XWKA 2DKHA 3N5OA 1TK8B 1GTIA 4J57E 1E6BA 2K8VA 4DSSA 2JSZA 3EC3A 1GSDA 1KTEA 2HLSA 2BJXA 5DCGA 3PGTA 1GSFA 1A8YA 4CY6A 4NPBA 2OJLA 1EWXA 2LNSA 2PBJA 1YJ6A 1YEXA 3D0ZA 4OFMA 2FD3A 5GSTA 2OACA 1R26A 4LMWA 3RDWA 2R37A 1Z7RA 3EU3A 1NM3A 3UEMA 4BPYA 5A4WA 1FOHA 5IMCA 3FYGA 2JU5A 4EIPA 5EY6A 4PQ1A 20GSA 4IP1A 1ERVA 5L71A 1Z5YE 1YEPA 4AJ8A 1OC8A 1WJKA 4NV5A 4HUAA 2F3MA 2VAFA 3LXTA 4KX4A 2DJJA 1FG4A 3WGEA 2GSRA 6GSSA 2C3QA 5E4WA 1SKRB 1R7HA 4EC0A 2CX4A 2FWFA 4AJ7A 4IW9A 3KH9A 2REMA 1PN0A 3BD2A 4X1UA 2J23A 4LLRA 1QMVA 1GL8A 2PVOC 5H5RA 4AJ6A 3ZRDA 4X4JA 2AB6A 3QDNA 4BWSA 3UOMA 6GSXA 3JCML 1F3AA 4KCEA 1M2AA 4K5SA 3LWAA 1K3YA 5ID2A 3EYTA 2H0HA 1GNWA 1TU8A 2GT6A 2MBSA 3LYPA 2GLRA 2E7PA 5LCZA 5ECIB 4PQHA 18GSA 4MZWA 1PRXA 1ML6A 2LTKA 5ECLB 4GQCA 1YF1A 1KBNA 4PQIA 4JEDA 3BBYA 3IHQA 4O7HA 4NV2A 3HA9A 16GSA 4EDYA 4Q5RA 1JZDA 1JZRA 2DMLA 2H1DA 3M1GA 2R3XA 4G19A 2DLXA 2GSQA 2BTOT 4POLA 4KSMA 3F4RA 2YZHA 2IWTA 2LS5A 4EL1A 1F9MA 1GSUA 3TKSC 5DAKB 1SYXA 2ON7A 4I2UA 1A8LA 3C73A 1PKZA 5D9TA 1O73A 2DJ3A 4BA7A 3GKKA 3TOUA 4YQUA 4D73A 2HI7A 5D9WA 1SL2B 5ECPB 3IRAA 3EMXA 1O8WA 4O92A 1XBSA 1SD8A 1MDKA 2RIIA 2VD0A 3ME8A 4I2TA 5DQYA 1K3LA 4ZILA 2TRXA 5KOWA 3A5WA 2OE0A 5JWRB 5KOXA 2P31A 4FQUA 3KM6A 3QAGA 1V2AA 2WFCA 4Z2UA 2I1UA 2LQQA 3TJBA 2L5LA 1V57A 2O85A 4HQZA 4ECJA 3I6AA 4HZ4A 3TJFA 2MMNA 4EE0A 4ZXGA 5DALB 2IL3A 3DGQA 4LL1B 4XS4B 4PX1A 2WCIA 5F06A 5EVOA 5ELAA 3HJPA 2A2PA 4GRFA 4KH7A 1XVWA 3H8QA 3IOSA 3GKMA 3KCMA 1LU4A 3SBCA 4O32A 3O3TA 1O8XA 3UL3A 3R3EA 2K8SA 1MDJA 3W8SA 2R4VA 1TOFA 3L0HA 5H5QA 5HR1A 2VCZA 2LV3A 1S3AA 1HNBA 1TK0B 2VCWA 2LUSA 5CREA 4DSSB 3UMAA 3Q74A 3IE3A 5CRGA 3ZFBA 1QXHA 5G1LA 2AV4A 3I43A 2B6MA 14GSA 1SKWB 3IHGA 5BMUA 3IC4A 4POBA 4L5LA 1U3IA 2QA1A 4MMMA 1XW6A 1EOGA 2NVLA 2VCTA 1XCCA 4J2FA 2R0CA 2DSAA 2GDRA 2B1LA 1TDIA 4ECBA 1PN9A 1VRSD 3VFIA 2YWNA 1QUWA 4LMVA 4HI7A 4JBBA 3GRXA 4EF0A 1XOBA 4HOJA 2DJ0A 2HT9A 5J9CA 3US3A 4LL4B 4Z2TA 2X8GA 2PMTA 4IJ3A 4FYBA 2VUPA 3L9UA 1VGLA 5ECQB 3LYKA 3O6TA 4G9HA 2FA8A 1BJXA 3APSA 5DCHA 3M3MA 1MDIA 1R5AA 2IMKA 2OADA 3FZ9A 1SKSB 6GSVA 5AISA 2H76A 1SJZA 5DJLA 1KEBA 3DRNA 5G5EA 1OC3A 2RUFA 4EIQA 4NHWA 5ECOB 2KP2A 4PURA 5JWQB 3VWUA 4G0IA 3GV1A 4J56E 1WRYA 3GYKA 3HJMA 2AJQB 3MNGA 3P8WA 2DJ2A 3ZTLA 5ID2B 3HY2A 3L78A 3TRXA 5AGYA 2GS3A 1UVZA 4ZBDA 4N10A 5GSSA 1Z6NA 4KDUA 4YAPA 4ZB9A 3WGXA 2YZUA 4OWYA 1XPVA 4XS1A 1TW9A 4TXVA 4F0CA 4XHMA 3HVSA 3FRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECN B;  1VF3 A;  3F9U A;  4MH3 A;  4PGT A;  2L59 A;  3PH9 A;  5DVB A;  4RQR A;  1YQ1 A;  2B5E A;  1AQW A;  2JAC A;  2PUK C;  5CNW A;  2MMO A;  2HSY A;  1WMJ A;  1DE1 A;  2V6K A;  1QQ2 A;  3WT2 A;  4CDO A;  3KP9 A;  2M72 A;  2R5G A;  3UVH A;  1GTA A;  2RUE A;  2GZP A;  2PVQ A;  4ZL7 A;  2E2G A;  3F6F A;  5KEJ A;  3D5J A;  3F0I A;  3C1S A;  1YKA A;  2I3Y A;  1SYR A;  5HFK A;  1TRS A;  3LXZ A;  3D6I A;  3LEF A;  4D73 B;  1WPI A;  3DML A;  3CRU A;  3GMF A;  4MCU A;  1T7P B;  1OAZ A;  4WXT A;  1Z7P A;  2G2Q A;  3HZ8 A;  5HQP A;  3VWX A;  4NXI A;  2FNO A;  1DSB A;  3QPM A;  4H86 A;  1U3A A;  1ILO A;  1OKT A;  3C1R A;  3ISO A;  3DIE A;  3QR6 A;  3ME7 A;  1A24 A;  4MDC A;  3CTG A;  1NW2 A;  3GSS A;  2VIM A;  4IS0 A;  3FR6 A;  2H8L A;  4ULX A;  2CX3 A;  3D22 A;  5B6M A;  3UIW A;  2DJ1 A;  2NDO A;  3ZIJ A;  5KN1 A;  3EUR A;  1YY7 A;  4K6X A;  3IBH A;  4Q5F A;  2AUV A;  5D96 A;  3UAP A;  1JLW A;  3KTB A;  5B8A A;  5KN0 A;  3Q19 A;  5HFI A;  12GS A;  1ERT A;  5F05 A;  3FR3 A;  1LBK A;  1OE7 A;  1A23 A;  2F9S A;  2FUG 2;  5ECH B;  3GA4 A;  3ED3 A;  5CRH A;  4KUN A;  3RPN A;  3GUS A;  3V1W A;  4KB3 A;  2HZE A;  2XHF A;  2LJA A;  4BVX A;  1EV4 A;  4KND A;  4MJE A;  4KW6 A;  3TKR A;  1FAA A;  4CHS A;  3IXR A;  4QL7 A;  3KH7 A;  1AXD A;  5IPG A;  4MF7 A;  4MK3 A;  1E2Y A;  2WDU A;  1TI1 A;  1U6T A;  4ISD A;  2H71 A;  5IMA A;  5AIX A;  1ZCP A;  4L5O A;  1TK5 B;  3GN3 A;  4X43 A;  3EIN A;  3ZIV A;  2PER A;  2V41 A;  1O7U A;  5D73 A;  1AC1 A;  3GX0 A;  19GS A;  3LGC A;  3QMX A;  3L9V A;  3M9J A;  2C0E A;  1MEK A;  2IIY A;  1T00 A;  3RHC A;  1EOH A;  3HXS A;  2KP1 A;  2XC2 A;  3ZL5 A;  2VOC A;  1I5G A;  2AAW A;  3ZML A;  1PKW A;  4RUV A;  3EWL A;  1T4Y A;  3GH9 A;  3Q6O A;  2K18 A;  1I9D A;  4AF2 A;  2QSI A;  4EO3 A;  4OO4 A;  2OKA A;  2WZ9 A;  4XS6 A;  4OD7 A;  2L4C A;  1B4P A;  3HZ4 A;  2VL2 A;  4DSQ A;  1M2D A;  2B7K A;  3CBU A;  4TW5 A;  1GUM A;  2GST A;  3VK9 A;  1HYU A;  3APO A;  1WIK A;  4ZBA A;  3WYW A;  5FHI A;  4HQS A;  3L4N A;  3F63 A;  5AIV A;  1CQG A;  2N5B A;  4I8B A;  3HKR A;  5CO3 A;  3KMN A;  2K9F A;  1F6M C;  3IV4 A;  5H5S A;  2ZUP A;  1Q4J A;  5F07 A;  4PNF A;  1M9A A;  1GRX A;  2YP6 A;  3H4K A;  1USB A;  2CVD A;  4BVY A;  3D4M A;  8GSS A;  4XTS A;  5IMV A;  2I4A A;  2L6D A;  4IJI A;  3ZVJ D;  2RM5 A;  2CAI A;  3D21 A;  3IK9 A;  3KGK A;  1X9S B;  3A2V A;  3DVW A;  3KMO A;  5JCW A;  3GH6 A;  1G7E A;  2B1K A;  1Y6E A;  1YDK A;  1FB6 A;  3J7Y b;  3UJ1 A;  6GST A;  3D4T A;  5LNK e;  3GTU A;  1U87 A;  1U88 A;  2L4Q A;  1DE2 A;  2FGX A;  2GQK A;  3FR9 A;  2FHE A;  3R2Q A;  2EIR A;  3ZRE A;  1TTZ A;  2TIR A;  1EGR A;  3H93 A;  1GTU A;  2VM1 A;  3VPT A;  2V2G A;  3GNJ A;  1HD2 A;  3FEU A;  1GUH A;  2FWE A;  5IQY A;  13GS A;  2ZCT A;  5FT3 A;  3F3R A;  2C0F A;  2V1M A;  5CYY A;  2LQO A;  2VCX A;  3VLN A;  4V1A p;  3ZZX A;  5EPF A;  4Q5N A;  2L5O A;  2HXK A;  3G7J A;  4NWY A;  5A4U A;  2WS2 A;  5HR0 A;  2NTO A;  3BCK A;  5IM9 A;  3C71 A;  1AIU A;  5B7C A;  1QK8 A;  3UBL A;  1TKD B;  2H19 A;  2WRT A;  4HDE A;  4G10 A;  2MZC A;  1BG5 A;  1VF2 A;  3MWH A;  1FVK A;  3MAK A;  2LEG A;  3F3Q A;  4WET A;  2DJK A;  1Y25 A;  4L0U A;  4IQ1 A;  5HR3 A;  2C80 A;  1W4V A;  3IAM 2;  4TVE A;  4OFN A;  1YF0 A;  3NIV A;  3MSZ A;  3TDG A;  1B4Q A;  2H6Z A;  1T8E B;  4E8H A;  2VL9 A;  1MD4 A;  2PU9 C;  3QD9 A;  2OE1 A;  2DIY A;  1YZX A;  3K8N A;  4PUF C;  3VPQ A;  2ZNM A;  5JWO B;  2B3S A;  4FYU A;  2TRC P;  1T4Z A;  3FKF A;  5D93 A;  4XIH A;  1JZW A;  2YCD A;  2HZE B;  1K0A A;  3QAW A;  2VM2 A;  3AY8 A;  3I9V 2;  3TOT A;  2JSY A;  2CVB A;  1F3B A;  1LJR A;  1A0R P;  4POK A;  1ZYQ B;  3A2X A;  3GL5 A;  4X0X A;  2P0G A;  5IIZ A;  3EE2 A;  1PMT A;  4ZL8 A;  1AQX A;  3HYP A;  3KD0 A;  4ACS A;  2PGT A;  2H75 A;  1TRV A;  4K0G A;  5C00 A;  1SD9 A;  1GSY A;  4JU5 A;  2A2R A;  2VCV A;  3UBK A;  2C4J A;  2HYX A;  1V58 A;  1QGV A;  2FLS A;  2QKE A;  2L6C A;  5EL8 A;  1THO A;  1PSQ A;  1K0O A;  1WOU A;  5ABR A;  3BCI A;  3U5R E;  2CT6 A;  4ZB8 A;  4IP6 A;  3GHA A;  4ZL9 A;  2Z9S A;  1HNC A;  4K0N A;  1EEJ A;  2N5F A;  3TCO A;  4K7O A;  2YV7 A;  2JAD A;  1B48 A;  2YAN A;  3LG6 A;  4WEY A;  1V40 A;  2OE3 A;  3CRT A;  4MPG A;  2P5R A;  2EC4 A;  1XFL A;  4DVC A;  1G0T A;  2IJY A;  3HCZ A;  3S9F A;  2D2Z A;  2IMF A;  4TXO A;  4I5Q A;  5D8I A;  1HQO A;  1M99 A;  1OKD A;  2JL4 A;  1XWC A;  4GCI A;  4MJB A;  3P7X A;  1EGO A;  4OCF A;  4TR3 A;  1M2B A;  3G7I A;  1RK4 A;  1FHE A;  2RM6 A;  4F82 A;  2FWH A;  4IKH A;  2XBQ A;  3EU4 A;  4GF0 A;  1M9B A;  1JFU A;  1GUL A;  4V2N A;  4K2D A;  1N8J A;  1GSQ A;  4MH2 A;  4MAB A;  5D9V A;  2FA4 A;  2LJK A;  1G6W A;  3ZMK A;  5ECS A;  2H6X A;  4GST A;  5CRW A;  5KN2 A;  4POM A;  2RLI A;  1OYJ A;  3QCP A;  4XRA A;  4Z7X A;  3LFL A;  1K0C A;  1TXX A;  3IPZ A;  4LA1 A;  2B5X A;  1XVQ A;  2XPD A;  4ZB6 A;  3GTU B;  5E59 A;  1IYH A;  3GKX A;  3DVX A;  5GAP D;  1SL1 B;  4MJC A;  5C04 A;  1XWG A;  5CAX A;  1CQH A;  3W8J A;  1GSS A;  1XWA A;  3FZ5 A;  1S3D A;  1AQV A;  3M8N A;  4JR4 A;  3PR8 A;  1OVN A;  3A3T A;  1K0D A;  22GS A;  4IHU A;  1TU7 A;  4MA9 A;  2MMA A;  3TJJ A;  1B8X A;  5COH A;  4WBJ A;  3APQ A;  3VI7 A;  4WF4 A;  3DEX A;  5DBQ A;  4TR4 A;  1G7O A;  1O6J A;  1GP1 A;  3PIN A;  1SJI A;  1W89 A;  3KZQ A;  4O5R A;  1SK0 A;  2VL2 C;  1GNE A;  1O85 A;  2AHE A;  4K9Z A;  1MTC A;  3QOU A;  2K6V A;  4PUA A;  3FK8 A;  10GS A;  1ON4 A;  4IQA A;  2H73 A;  4NAX A;  1PGT A;  2ES7 A;  3CSI A;  3SWL A;  2HE3 A;  4OFT A;  3WT1 A;  1DBY A;  1OC9 B;  5ELG A;  4EKZ A;  2N5A A;  1R4W A;  2VLV A;  4QQ7 A;  2V6O A;  3CXG A;  4WF5 A;  2O87 A;  1BQ7 A;  4JZQ A;  3GX8 A;  3DYR A;  1K3O A;  1J08 A;  4G2E A;  4GTU A;  2QGV A;  4K1F A;  3E0U A;  4GXZ A;  1JHB A;  1X5D A;  1FVJ A;  2GQM A;  2H74 A;  2H6Y A;  4Q5Q A;  1SL0 B;  4N11 A;  1B9Y C;  3M0F A;  1K0M A;  5IMZ A;  4N0V A;  2LKU A;  4N0Z A;  1PQN A;  1WP0 A;  3CYN A;  1XW5 A;  5LD0 A;  2FWG A;  2H66 A;  2F8F A;  2GVP A;  2AYT A;  3H1N A;  6GSU A;  2VO4 A;  2H0I A;  1EEM A;  2M46 A;  1ERU A;  1K0N A;  2WJU A;  4ZBB A;  2B5Y A;  2V32 A;  4I97 A;  5F0G A;  5ECR B;  2H1G A;  2LRN A;  2P5Q A;  5IMF A;  2LJR A;  6GSY A;  2G0F A;  5B6N A;  1RQM A;  3FW2 A;  2HFD A;  1NHO A;  5INY A;  1EP8 A;  2KUC A;  5IPH A;  1M7T A;  3GUR A;  1AUC A;  1SJ6 A;  3ZLP A;  2NPB A;  5J41 A;  5J4U A;  3GFK A;  1Z6M A;  3ERF A;  3H79 A;  6GSW A;  1M0U A;  2HRF A;  2X99 A;  1HNA A;  1K0B A;  1PA3 A;  2JZS A;  5J9B A;  5B8B A;  5JCG A;  3E9J B;  4TXO B;  5IOW A;  1C72 A;  2CA8 A;  4E8E A;  2H0G A;  3DXB A;  2X8C A;  3RBT A;  2IFQ A;  1UC7 A;  4KCA A;  4DEJ A;  3UAR A;  2MMZ A;  3IA1 A;  4K8M A;  2YJ7 A;  4KDY A;  5ECM B;  4WR4 A;  3VWW A;  4V2L A;  1JLV A;  4CW9 A;  3F4T A;  2WGR A;  4IVF A;  1Z9H A;  4MF5 A;  1ZMA A;  3QFA C;  5G1K A;  1J0F A;  1ZZY A;  4HU7 A;  1ABA A;  1X9W B;  4EVM A;  1H75 A;  4HS1 A;  2WUL A;  5HFG A;  1X0R A;  4KDX A;  4MF6 A;  3ZIT A;  2GTU A;  4IBP A;  3KIJ A;  1KNG A;  2OBK A;  3RAZ A;  2HRN A;  4MP4 A;  1BX9 A;  1XIY A;  2GSS A;  3KXO A;  1WE0 A;  3J7Y k;  2YJH A;  4FO5 A;  1ZOF A;  4TR0 A;  2E2M A;  4NHZ A;  4L8E A;  4DSR A;  3FZA A;  1V9W A;  4WR5 A;  3LJR A;  3GKN A;  3IR4 A;  2XPE A;  4KA0 A;  1TI3 A;  2C8U A;  3UVT A;  1WWJ A;  5G30 A;  2O7K A;  4HZ2 A;  1NHY A;  1PL2 A;  1XOA A;  4KSO A;  3KTL A;  3LOR A;  4F03 A;  2B7J A;  4ECI A;  2OA7 A;  5DDL A;  3WD6 A;  2DIZ A;  3TKP A;  1F2E A;  1T3B A;  2O8V B;  4OO5 A;  4EUY A;  3P90 A;  2YOI A;  2QC7 A;  1GWC A;  3F6D A;  1BYE A;  2LRT A;  4HJ2 A;  4F9Z A;  2NBS A;  1PX7 A;  1O81 A;  3EMP A;  1SU9 A;  3EVI A;  1FO5 A;  3FZ4 A;  2LRC A;  3O76 A;  2H01 A;  4TR1 A;  5IO2 A;  3Q18 A;  4PXO A;  1S3C A;  3WGD A;  1PD2 1;  1ZYE A;  1GLP A;  2YWM A;  2I9H A;  2C0D A;  4KGI A;  1JZO A;  3G9B A;  4HEA 2;  4QL9 A;  2C3T A;  3HDC A;  2X8H A;  2O89 A;  1UA5 A;  4MPF A;  2PN8 A;  2KOK A;  1XW9 A;  2GZZ A;  3L9S A;  5G5F A;  1OC9 A;  1PL1 A;  4ML1 A;  4YQV A;  4GLT A;  4F0B A;  5J3R A;  2MYG A;  4JRR A;  3W6G A;  2DBC A;  2YNX A;  5CP1 A;  3I69 A;  2X64 A;  2CAQ A;  3BJ5 A;  2GGT A;  4RI6 A;  3F8U A;  4EDZ A;  4RI7 A;  3RPP A;  1TRU A;  2EIO A;  3OR5 A;  4IGJ A;  1QFN A;  4KAE A;  2EIQ A;  2J9H A;  5FWG A;  4MZB A;  1J9B A;  4MLY A;  4NMU A;  1URM A;  1A0F A;  1EP7 A;  4BWQ A;  4MJA A;  2H30 A;  1DUG A;  1VF1 A;  1A2M A;  4BL7 A;  3ERG A;  1BAY A;  1MD3 A;  2F8A A;  5J5N A;  1N2A A;  4N30 A;  4GSN A;  1PX6 A;  1X5E A;  1B9X C;  4FYC A;  1FW1 A;  1ACV A;  3HHV A;  3CTF A;  2GZY A;  3LSZ A;  5HR2 A;  2PWJ A;  3G7Y A;  2GQL A;  4YQM A;  2H1A A;  3IAS 2;  4TN8 A;  1GH2 A;  2JZT A;  2IME A;  4K7I A;  2VL3 A;  3KJY A;  5F8B A;  2FCH A;  3M9K A;  4JR6 A;  3TUE A;  3NZN A;  2M80 A;  4OMV A;  3HVX A;  1ZL9 A;  1X9M B;  2LNT A;  4ECC A;  2KLX A;  1TJD A;  5A5K A;  4KE3 A;  2FY6 A;  2R6K A;  5AN1 A;  1Q98 A;  2C3N A;  1XWB A;  2IFQ B;  3TGZ A;  4V2M A;  2E0Q A;  3VWV A;  3FHK A;  5D9X A;  3A2W A;  2PPT A;  3CSH A;  1FB0 A;  3TKQ A;  3ERW A;  3TKS A;  1AW9 A;  1EV9 A;  4RQX A;  5G2Z A;  2ALB A;  2H1B A;  4JE1 A;  4OCE A;  3IDV A;  2VLU A;  3TJG A;  3ZFL A;  1ST9 A;  1BED A;  4FIW A;  4HJM A;  2HSH A;  5IOX A;  1GSE A;  1XZO A;  4PNG A;  1H4O A;  3KEB A;  1YKC A;  5ENU A;  1FOV A;  2CVK A;  2F51 A;  2GT5 A;  4ID0 A;  4TKY A;  3TRP A;  4F2I A;  4YAV A;  5A4V A;  1RW1 A;  3TB2 A;  2C1Y A;  5KN3 A;  1IYI A;  4IEL A;  3DD3 A;  2C0G A;  3VI5 A;  4ILF A;  4V1A g;  4EXJ A;  3TJK A;  4P3Y B;  3P2A A;  1GUK A;  2HNL A;  4GSS A;  2YPM A;  4WKW A;  4ZIJ A;  5IMD A;  2A2S A;  4XRD A;  1A2L A;  1TRW A;  2CV4 A;  4FH8 A;  4MZC A;  1GTB A;  2YWI A;  3HD5 A;  3GIX A;  1G6Y A;  2DMM A;  3F4S A;  1Z3E A;  2A4V A;  4WBR D;  1XXU A;  4GQF A;  2IPA A;  2I81 A;  2XBI A;  3CSJ A;  3GST A;  7GSS A;  2IMD A;  5CRD A;  3DWV A;  4TR1 B;  3C8E A;  2KHP A;  3E3E A;  1R5P A;  5DAK A;  2YN1 A;  2OBI A;  4XCS A;  1AAZ A;  2CZ3 A;  1UN2 A;  11GS A;  2YWO A;  2VCQ A;  3ZYW A;  2MBT A;  5G31 A;  5GAN D;  2WB9 A;  3IK7 A;  3MDK A;  2JZR A;  4I6X A;  4ML6 A;  5ECK B;  1VF4 A;  1THX A;  3FY7 A;  1SK1 A;  3BOA A;  3QAV A;  1TP9 A;  2L57 A;  3U6V A;  5JCU A;  4GWR A;  3CMI A;  4IN0 A;  1T1V A;  3RHB A;  2H72 A;  2IMI A;  1X5C A;  1OE8 A;  2DC5 A;  5GZZ B;  17GS A;  2ON5 A;  2R2J A;  4YH2 A;  4TRX A;  9GSS A;  5DJM A;  1ZGN A;  3QFB C;  2IN3 A;  2LST A;  3C7M A;  5DAL A;  5IO0 A;  1EZK A;  4K7N A;  2CQ9 A;  3GL3 A;  4XS4 A;  1V98 A;  4TOP A;  1F37 A;  2CZ2 A;  3ZVJ A;  1A2J A;  4AGS A;  1SEN A;  1SK2 A;  3TRQ A;  3HJO A;  4HU9 A;  4L0W A;  3LQ7 A;  3NOF A;  3N9J A;  3DKS A;  5DQS A;  3TKS E;  3KP8 A;  3HVV A;  1NSW A;  2BMX A;  2H70 A;  2VLT A;  2YV9 A;  2VD1 A;  2HZF A;  3VUR A;  1GLQ A;  1ERW A;  1XWK A;  3N5O A;  1TK8 B;  1GTI A;  4J57 E;  1E6B A;  2K8V A;  4DSS A;  2JSZ A;  3EC3 A;  1GSD A;  1KTE A;  2HLS A;  2BJX A;  5DCG A;  3PGT A;  1GSF A;  1A8Y A;  4NPB A;  2OJL A;  1EWX A;  2LNS A;  2PBJ A;  1YJ6 A;  1YEX A;  3D0Z A;  4OFM A;  2FD3 A;  5GST A;  2OAC A;  1R26 A;  4LMW A;  3RDW A;  2R37 A;  1Z7R A;  3EU3 A;  1NM3 A;  3UEM A;  4BPY A;  5A4W A;  5IMC A;  3FYG A;  2JU5 A;  5EY6 A;  4PQ1 A;  20GS A;  4IP1 A;  1ERV A;  5L71 A;  1Z5Y E;  1YEP A;  4AJ8 A;  1OC8 A;  1WJK A;  4NV5 A;  4HUA A;  2F3M A;  2VAF A;  3LXT A;  4KX4 A;  2DJJ A;  1FG4 A;  3WGE A;  2GSR A;  6GSS A;  2C3Q A;  5E4W A;  1SKR B;  1R7H A;  4EC0 A;  2CX4 A;  2FWF A;  4AJ7 A;  4IW9 A;  3KH9 A;  2REM A;  3BD2 A;  4X1U A;  2J23 A;  4LLR A;  1QMV A;  1GL8 A;  2PVO C;  5H5R A;  4AJ6 A;  3ZRD A;  2AB6 A;  3QDN A;  4BWS A;  3UOM A;  6GSX A;  3JCM L;  1F3A A;  4KCE A;  1M2A A;  3LWA A;  1K3Y A;  5ID2 A;  3EYT A;  2H0H A;  1GNW A;  1TU8 A;  2GT6 A;  2MBS A;  3LYP A;  2GLR A;  2E7P A;  5LCZ A;  5ECI B;  4PQH A;  18GS A;  4MZW A;  1PRX A;  1ML6 A;  2LTK A;  5ECL B;  4GQC A;  1YF1 A;  1KBN A;  4PQI A;  4JED A;  3BBY A;  3IHQ A;  4O7H A;  4NV2 A;  3HA9 A;  16GS A;  4EDY A;  4Q5R A;  1JZD A;  1JZR A;  2DML A;  2H1D A;  3M1G A;  2R3X A;  4G19 A;  2DLX A;  2GSQ A;  2BTO T;  4POL A;  4KSM A;  3F4R A;  2YZH A;  2IWT A;  2LS5 A;  4EL1 A;  1F9M A;  1GSU A;  3TKS C;  5DAK B;  1SYX A;  2ON7 A;  4I2U A;  1A8L A;  3C73 A;  1PKZ A;  5D9T A;  1O73 A;  2DJ3 A;  4BA7 A;  3GKK A;  3TOU A;  4YQU A;  4D73 A;  2HI7 A;  5D9W A;  1SL2 B;  5ECP B;  3IRA A;  3EMX A;  1O8W A;  4O92 A;  1XBS A;  1SD8 A;  1MDK A;  2RII A;  2VD0 A;  3ME8 A;  4I2T A;  5DQY A;  1K3L A;  4ZIL A;  2TRX A;  3A5W A;  2OE0 A;  5JWR B;  2P31 A;  3KM6 A;  3QAG A;  1V2A A;  2WFC A;  2I1U A;  2LQQ A;  3TJB A;  2L5L A;  1V57 A;  2O85 A;  4HQZ A;  4ECJ A;  3I6A A;  4HZ4 A;  3TJF A;  2MMN A;  4EE0 A;  4ZXG A;  5DAL B;  2IL3 A;  3DGQ A;  4LL1 B;  4XS4 B;  4PX1 A;  2WCI A;  5F06 A;  5EVO A;  5ELA A;  3HJP A;  4GRF A;  4KH7 A;  1XVW A;  3H8Q A;  3IOS A;  3GKM A;  3KCM A;  1LU4 A;  3SBC A;  4O32 A;  3O3T A;  1O8X A;  3UL3 A;  2K8S A;  1MDJ A;  3W8S A;  2R4V A;  1TOF A;  3L0H A;  5H5Q A;  5HR1 A;  2VCZ A;  2LV3 A;  1S3A A;  1HNB A;  1TK0 B;  2VCW A;  2LUS A;  5CRE A;  4DSS B;  3UMA A;  3Q74 A;  3IE3 A;  5CRG A;  3ZFB A;  1QXH A;  5G1L A;  2AV4 A;  3I43 A;  2B6M A;  14GS A;  1SKW B;  3IC4 A;  4POB A;  4L5L A;  1U3I A;  4MMM A;  1XW6 A;  1EOG A;  2NVL A;  2VCT A;  1XCC A;  4J2F A;  2DSA A;  2GDR A;  2B1L A;  1TDI A;  4ECB A;  1PN9 A;  1VRS D;  3VFI A;  2YWN A;  1QUW A;  4LMV A;  4HI7 A;  4JBB A;  3GRX A;  4EF0 A;  1XOB A;  4HOJ A;  2DJ0 A;  2HT9 A;  5J9C A;  3US3 A;  4LL4 B;  2X8G A;  2PMT A;  4IJ3 A;  4FYB A;  2VUP A;  3L9U A;  1VGL A;  5ECQ B;  3LYK A;  3O6T A;  4G9H A;  2FA8 A;  1BJX A;  3APS A;  5DCH A;  3M3M A;  1MDI A;  1R5A A;  2IMK A;  2OAD A;  3FZ9 A;  1SKS B;  6GSV A;  5AIS A;  2H76 A;  1SJZ A;  5DJL A;  1KEB A;  3DRN A;  5G5E A;  1OC3 A;  2RUF A;  4NHW A;  5ECO B;  2KP2 A;  4PUR A;  5JWQ B;  3VWU A;  3GV1 A;  4J56 E;  1WRY A;  3GYK A;  3HJM A;  2AJQ B;  3MNG A;  3P8W A;  2DJ2 A;  3ZTL A;  5ID2 B;  3HY2 A;  3L78 A;  3TRX A;  5AGY A;  2GS3 A;  1UVZ A;  4ZBD A;  4N10 A;  5GSS A;  1Z6N A;  4KDU A;  4YAP A;  4ZB9 A;  3WGX A;  2YZU A;  4OWY A;  1XPV A;  4XS1 A;  1TW9 A;  4TXV A;  4F0C A;  4XHM A;  3HVS A;  3FRC A; 
#chains in the Genus database with same CATH topology
 5ECN B;  1VF3 A;  2X4A A;  3F9U A;  4MH3 A;  4PGT A;  2L59 A;  3PH9 A;  5DVB A;  4RQR A;  1YQ1 A;  2B5E A;  1AQW A;  2JAC A;  2PUK C;  5CNW A;  2MMO A;  2HSY A;  1WMJ A;  1DE1 A;  2V6K A;  1QQ2 A;  3WT2 A;  4CDO A;  3KP9 A;  2M72 A;  2R5G A;  3UVH A;  1GTA A;  2RUE A;  2GZP A;  2PVQ A;  4ZL7 A;  2E2G A;  3F6F A;  5KEJ A;  3D5J A;  3F0I A;  3C1S A;  1YKA A;  2I3Y A;  1SYR A;  5HFK A;  1TRS A;  3LXZ A;  3D6I A;  3LEF A;  4D73 B;  1WPI A;  3DML A;  3CRU A;  3GMF A;  4MCU A;  1T7P B;  1OAZ A;  4WXT A;  1Z7P A;  2G2Q A;  3HZ8 A;  5HQP A;  3VWX A;  4NXI A;  2FNO A;  1DSB A;  3QPM A;  4H86 A;  1U3A A;  1ILO A;  1OKT A;  3C1R A;  3ISO A;  3DIE A;  3QR6 A;  3ME7 A;  1A24 A;  4MDC A;  3CTG A;  1NW2 A;  3GSS A;  4MNN A;  2VIM A;  4IS0 A;  3FR6 A;  2H8L A;  4ULX A;  2CX3 A;  4HSC X;  3D22 A;  5B6M A;  3UIW A;  2DJ1 A;  2NDO A;  3ZIJ A;  5KN1 A;  3EUR A;  1YY7 A;  4K6X A;  3IBH A;  4Q5F A;  2AUV A;  5D96 A;  3UAP A;  1JLW A;  3KTB A;  5B8A A;  5KN0 A;  3Q19 A;  5HFI A;  12GS A;  1ERT A;  5F05 A;  3FR3 A;  1LBK A;  1OE7 A;  1A23 A;  2F9S A;  2FUG 2;  5ECH B;  3GA4 A;  3LW9 A;  3ED3 A;  5CRH A;  4KUN A;  3RPN A;  3GUS A;  3V1W A;  4KB3 A;  2HZE A;  2XHF A;  4PTS A;  2LJA A;  4BVX A;  1EV4 A;  4KND A;  4MJE A;  4KW6 A;  3TKR A;  1FAA A;  4CHS A;  3IXR A;  4QL7 A;  3KH7 A;  1AXD A;  5IPG A;  4MF7 A;  4MK3 A;  2A4H A;  1E2Y A;  2WDU A;  2R0P A;  1TI1 A;  1U6T A;  4USS A;  4ISD A;  2H71 A;  5IMA A;  5AIX A;  1ZCP A;  4L5O A;  1TK5 B;  3GN3 A;  4X43 A;  3EIN A;  3ZIV A;  2PER A;  2V41 A;  1O7U A;  5D73 A;  1AC1 A;  3GX0 A;  19GS A;  3LGC A;  3QMX A;  3L9V A;  3M9J A;  2C0E A;  1MEK A;  2IIY A;  1T00 A;  3RHC A;  1EOH A;  3HXS A;  2KP1 A;  2XC2 A;  3ZL5 A;  2VOC A;  1I5G A;  2AAW A;  3ZML A;  1PKW A;  4RUV A;  3EWL A;  1T4Y A;  3GH9 A;  3Q6O A;  2K18 A;  1I9D A;  4AF2 A;  2QSI A;  4EO3 A;  4OO4 A;  2OKA A;  2WZ9 A;  4XS6 A;  4OD7 A;  2L4C A;  1B4P A;  3HZ4 A;  2VL2 A;  4DSQ A;  1M2D A;  2B7K A;  3CBU A;  4TW5 A;  1GUM A;  2GST A;  3VK9 A;  1HYU A;  3APO A;  1WIK A;  4ZBA A;  3WYW A;  5FHI A;  4HQS A;  3L4N A;  3F63 A;  5AIV A;  1CQG A;  2N5B A;  4I8B A;  3HKR A;  5CO3 A;  3KMN A;  2K9F A;  1F6M C;  3IV4 A;  5H5S A;  2ZUP A;  1Q4J A;  5F07 A;  4PNF A;  1M9A A;  1GRX A;  2YP6 A;  3H4K A;  1USB A;  2CVD A;  4BVY A;  3D4M A;  8GSS A;  4XTS A;  5IMV A;  2I4A A;  2L6D A;  4IJI A;  3ZVJ D;  2RM5 A;  2CAI A;  3D21 A;  3IK9 A;  3KGK A;  1X9S B;  3A2V A;  3DVW A;  3KMO A;  5JCW A;  3GH6 A;  1G7E A;  2B1K A;  1Y6E A;  1YDK A;  1FB6 A;  3J7Y b;  3UJ1 A;  6GST A;  3D4T A;  5LNK e;  3GTU A;  1U87 A;  1U88 A;  2L4Q A;  1DE2 A;  2FGX A;  2GQK A;  3FR9 A;  2FHE A;  4YKG A;  3R2Q A;  2EIR A;  3ZRE A;  1TTZ A;  2TIR A;  1EGR A;  3H93 A;  1GTU A;  2VM1 A;  3VPT A;  2V2G A;  3GNJ A;  1HD2 A;  3FEU A;  1GUH A;  2R0G A;  2FWE A;  5IQY A;  13GS A;  2ZCT A;  5FT3 A;  3F3R A;  2C0F A;  2V1M A;  5CYY A;  2LQO A;  2VCX A;  3VLN A;  4V1A p;  3ZZX A;  5EPF A;  4Q5N A;  2L5O A;  2HXK A;  3G7J A;  4NWY A;  5A4U A;  2WS2 A;  5HR0 A;  2NTO A;  3BCK A;  5IM9 A;  3C71 A;  1AIU A;  5B7C A;  1QK8 A;  3UBL A;  1TKD B;  2H19 A;  2WRT A;  4HDE A;  4G10 A;  2MZC A;  1BG5 A;  1VF2 A;  3MWH A;  1FVK A;  3MAK A;  2LEG A;  3F3Q A;  4WET A;  2DJK A;  1Y25 A;  3IC8 A;  4L0U A;  4IQ1 A;  5HR3 A;  2C80 A;  1W4V A;  3IAM 2;  3FMW A;  4TVE A;  4OFN A;  1YF0 A;  3NIV A;  3MSZ A;  3TDG A;  1B4Q A;  2H6Z A;  1T8E B;  4E8H A;  2VL9 A;  1MD4 A;  2PU9 C;  3QD9 A;  2OE1 A;  2DIY A;  1YZX A;  3K8N A;  4PUF C;  3VPQ A;  2ZNM A;  5JWO B;  2B3S A;  4FYU A;  2TRC P;  1T4Z A;  3FKF A;  5D93 A;  4XIH A;  1JZW A;  2YCD A;  2HZE B;  1K0A A;  3QAW A;  4BVX B;  2VM2 A;  3AY8 A;  3I9V 2;  3TOT A;  2JSY A;  2CVB A;  1F3B A;  3A5I A;  1LJR A;  1A0R P;  4POK A;  1ZYQ B;  3A2X A;  4K5R A;  3GL5 A;  4X0X A;  2P0G A;  5IIZ A;  3EE2 A;  1PMT A;  4ZL8 A;  1AQX A;  3HYP A;  3KD0 A;  4ACS A;  2PGT A;  2H75 A;  1TRV A;  4K0G A;  5C00 A;  1SD9 A;  1GSY A;  4JU5 A;  2A2R A;  2VCV A;  3UBK A;  2C4J A;  2HYX A;  1V58 A;  1QGV A;  2FLS A;  2QKE A;  2L6C A;  5EL8 A;  1THO A;  1PSQ A;  1K0O A;  1WOU A;  5ABR A;  3BCI A;  3U5R E;  2CT6 A;  4ZB8 A;  4IP6 A;  3GHA A;  4ZL9 A;  2Z9S A;  1HNC A;  4K0N A;  1EEJ A;  2N5F A;  3TCO A;  1ZYN A;  4K7O A;  4ICY A;  2YV7 A;  2JAD A;  1B48 A;  2YAN A;  3LG6 A;  4WEY A;  1V40 A;  2OE3 A;  3CRT A;  4MPG A;  2P5R A;  2EC4 A;  1XFL A;  4DVC A;  1G0T A;  2IJY A;  3HCZ A;  3S9F A;  2D2Z A;  2IMF A;  4TXO A;  4I5Q A;  5D8I A;  1HQO A;  1M99 A;  1OKD A;  2JL4 A;  1XWC A;  4GCI A;  4MJB A;  3P7X A;  1EGO A;  4OCF A;  4TR3 A;  1M2B A;  3G7I A;  1RK4 A;  1FHE A;  2RM6 A;  4F82 A;  2FWH A;  4IKH A;  2XBQ A;  3EU4 A;  4GF0 A;  1M9B A;  1JFU A;  1GUL A;  4V2N A;  4K2D A;  1N8J A;  1GSQ A;  4MH2 A;  4MAB A;  5D9V A;  2FA4 A;  2LJK A;  1G6W A;  3ZMK A;  5ECS A;  2H6X A;  4GST A;  4BVY B;  5CRW A;  5KN2 A;  4POM A;  4Z2R A;  2RLI A;  1OYJ A;  3QCP A;  4XRA A;  4Z7X A;  3LFL A;  1K0C A;  1TXX A;  4O5Q A;  3IPZ A;  4LA1 A;  2B5X A;  1XVQ A;  2XPD A;  4ZB6 A;  3GTU B;  5E59 A;  1IYH A;  3GKX A;  3DVX A;  5GAP D;  1SL1 B;  4MJC A;  5C04 A;  1XWG A;  5CAX A;  1CQH A;  3W8J A;  1GSS A;  1XWA A;  3FZ5 A;  1S3D A;  1AQV A;  3M8N A;  4JR4 A;  3PR8 A;  1OVN A;  3A3T A;  1K0D A;  22GS A;  4IHU A;  1TU7 A;  4MA9 A;  2MMA A;  3TJJ A;  1B8X A;  5COH A;  4WBJ A;  3APQ A;  3VI7 A;  4A5P A;  4WF4 A;  3DEX A;  5DBQ A;  4TR4 A;  1G7O A;  1O6J A;  1GP1 A;  3PIN A;  1SJI A;  1W89 A;  3HVN A;  3KZQ A;  4O5R A;  1SK0 A;  2VL2 C;  1GNE A;  1O85 A;  2AHE A;  4K9Z A;  1MTC A;  3QOU A;  2K6V A;  4PUA A;  3FK8 A;  10GS A;  1ON4 A;  4IQA A;  2H73 A;  4NAX A;  1PGT A;  2ES7 A;  3EPT A;  3CSI A;  4O5U A;  3SWL A;  2HE3 A;  4OFT A;  3WT1 A;  1DBY A;  1OC9 B;  5ELG A;  4EKZ A;  2N5A A;  1R4W A;  2VLV A;  4QQ7 A;  2V6O A;  3CXG A;  4WF5 A;  2O87 A;  1BQ7 A;  4JZQ A;  3GX8 A;  3DYR A;  1K3O A;  1J08 A;  4G2E A;  4GTU A;  2QGV A;  3MIX A;  4K1F A;  3E0U A;  4GXZ A;  1JHB A;  1X5D A;  1FVJ A;  2GQM A;  2H74 A;  2H6Y A;  4Q5Q A;  1SL0 B;  4N11 A;  1B9Y C;  3M0F A;  1K0M A;  5IMZ A;  4N0V A;  2LKU A;  4N0Z A;  1PQN A;  1WP0 A;  3CYN A;  1XW5 A;  5LD0 A;  2FWG A;  2H66 A;  2F8F A;  2GVP A;  2AYT A;  3H1N A;  6GSU A;  2VO4 A;  4K2X A;  2H0I A;  1EEM A;  2M46 A;  1ERU A;  1K0N A;  2WJU A;  4ZBB A;  2B5Y A;  2V32 A;  4I97 A;  5F0G A;  5ECR B;  2H1G A;  2LRN A;  2P5Q A;  5IMF A;  2LJR A;  6GSY A;  1ZYP A;  2G0F A;  5B6N A;  1RQM A;  3FW2 A;  2HFD A;  1NHO A;  5INY A;  1EP8 A;  2KUC A;  5IPH A;  1M7T A;  3GUR A;  1AUC A;  1SJ6 A;  3ZLP A;  2NPB A;  5J41 A;  5J4U A;  3GFK A;  1Z6M A;  3ERF A;  3H79 A;  4G0L A;  6GSW A;  1M0U A;  2HRF A;  2X99 A;  1HNA A;  1K0B A;  1PA3 A;  2DKI A;  2JZS A;  5J9B A;  5B8B A;  5JCG A;  3E9J B;  4TXO B;  5IOW A;  1C72 A;  2CA8 A;  4E8E A;  2H0G A;  3DXB A;  2X8C A;  3RBT A;  2IFQ A;  1UC7 A;  4KCA A;  4DEJ A;  3UAR A;  2MMZ A;  3IA1 A;  4K8M A;  2YJ7 A;  4KDY A;  5ECM B;  4WR4 A;  3VWW A;  4V2L A;  1JLV A;  4CW9 A;  3F4T A;  2WGR A;  4IVF A;  1S3R A;  1Z9H A;  4MF5 A;  1ZMA A;  3QFA C;  5G1K A;  1J0F A;  1ZZY A;  4HU7 A;  1ABA A;  1X9W B;  4EVM A;  1H75 A;  4HS1 A;  2WUL A;  5HFG A;  1X0R A;  4KDX A;  4MF6 A;  3ZIT A;  2GTU A;  4IBP A;  3KIJ A;  1KNG A;  2OBK A;  3RAZ A;  2HRN A;  4MP4 A;  1BX9 A;  1XIY A;  2GSS A;  3PPU A;  3KXO A;  1WE0 A;  3J7Y k;  2X49 A;  2YJH A;  4FO5 A;  1ZOF A;  4TR0 A;  2E2M A;  4NHZ A;  4L8E A;  4DSR A;  3FZA A;  1V9W A;  4WR5 A;  3LJR A;  3GKN A;  3IR4 A;  2XPE A;  4KA0 A;  1TI3 A;  2C8U A;  3UVT A;  1WWJ A;  5G30 A;  2O7K A;  4HZ2 A;  1NHY A;  1PL2 A;  1XOA A;  4KSO A;  3KTL A;  3LOR A;  4F03 A;  2B7J A;  4ECI A;  2OA7 A;  5DDL A;  3WD6 A;  2DIZ A;  3TKP A;  1F2E A;  1T3B A;  2O8V B;  4OO5 A;  4EUY A;  3P90 A;  2YOI A;  2QC7 A;  1GWC A;  3F6D A;  1BYE A;  2LRT A;  4HJ2 A;  4F9Z A;  2NBS A;  1PX7 A;  1O81 A;  4KF9 A;  3EMP A;  1SU9 A;  3EVI A;  1FO5 A;  3FZ4 A;  2LRC A;  3O76 A;  2H01 A;  4TR1 A;  5IO2 A;  3Q18 A;  4PXO A;  1S3C A;  3WGD A;  1PD2 1;  1ZYE A;  1GLP A;  2YWM A;  2I9H A;  2C0D A;  4KGI A;  1JZO A;  3G9B A;  4HEA 2;  2HRA A;  2C3T A;  3HDC A;  4QL9 A;  2X8H A;  2O89 A;  1UA5 A;  4MPF A;  2PN8 A;  2KOK A;  1XW9 A;  2GZZ A;  3L9S A;  5G5F A;  1OC9 A;  1PL1 A;  4ML1 A;  4YQV A;  4GLT A;  4F0B A;  5J3R A;  2MYG A;  4JRR A;  3W6G A;  2DBC A;  2YNX A;  5CP1 A;  3I69 A;  2X64 A;  2CAQ A;  3BJ5 A;  2GGT A;  4RI6 A;  3F8U A;  4EDZ A;  4RI7 A;  3RPP A;  1TRU A;  2EIO A;  3OR5 A;  4IGJ A;  1QFN A;  4KAE A;  2EIQ A;  2J9H A;  5FWG A;  4MZB A;  1J9B A;  4MLY A;  4NMU A;  1URM A;  1A0F A;  1EP7 A;  4BWQ A;  4MJA A;  2H30 A;  1DUG A;  1VF1 A;  1A2M A;  4BL7 A;  3ERG A;  1BAY A;  1MD3 A;  2F8A A;  5J5N A;  1N2A A;  4N30 A;  4GSN A;  1PX6 A;  1X5E A;  1B9X C;  4FYC A;  1FW1 A;  1ACV A;  3HHV A;  3CTF A;  2GZY A;  3LSZ A;  5HR2 A;  2PWJ A;  3G7Y A;  2GQL A;  4YQM A;  2H1A A;  3IAS 2;  4TN8 A;  1GH2 A;  2JZT A;  2IME A;  4K7I A;  2VL3 A;  3KJY A;  5F8B A;  2FCH A;  3M9K A;  4JR6 A;  3TUE A;  3CQF A;  3NZN A;  2M80 A;  4OMV A;  3HVX A;  1ZL9 A;  1X9M B;  2LNT A;  4ECC A;  2KLX A;  1TJD A;  5A5K A;  4KE3 A;  2FY6 A;  3MYD A;  2R6K A;  2HRK A;  5AN1 A;  1Q98 A;  2C3N A;  1XWB A;  2IFQ B;  3TGZ A;  4V2M A;  2E0Q A;  3VWV A;  3FHK A;  5D9X A;  3A2W A;  2PPT A;  3CSH A;  1FB0 A;  3TKQ A;  3ERW A;  3TKS A;  1AW9 A;  1EV9 A;  4RQX A;  5G2Z A;  2ALB A;  2H1B A;  4JE1 A;  4OCE A;  3IDV A;  2VLU A;  3TJG A;  3ZFL A;  1ST9 A;  1BED A;  4FIW A;  4HJM A;  2HSH A;  5IOX A;  1GSE A;  1XZO A;  4PNG A;  1H4O A;  3KEB A;  1YKC A;  5ENU A;  1FOV A;  2CVK A;  2HSM A;  2F51 A;  2GT5 A;  4ID0 A;  4TKY A;  3TRP A;  4F2I A;  4YAV A;  5A4V A;  1RW1 A;  3TB2 A;  1XG8 A;  2C1Y A;  5KN3 A;  1IYI A;  4IEL A;  3DD3 A;  2C0G A;  3VI5 A;  5BRT A;  4ILF A;  4V1A g;  4EXJ A;  3TJK A;  4P3Y B;  3P2A A;  1GUK A;  2HNL A;  4GSS A;  2YPM A;  4WKW A;  4ZIJ A;  5IMD A;  2A2S A;  4XRD A;  1A2L A;  1TRW A;  2CV4 A;  4FH8 A;  4MZC A;  1GTB A;  2YWI A;  3HD5 A;  4CY8 A;  3GIX A;  1G6Y A;  2DMM A;  3F4S A;  1Z3E A;  2A4V A;  4WBR D;  1XXU A;  4GQF A;  2IPA A;  2I81 A;  2XBI A;  3CSJ A;  3GST A;  7GSS A;  2IMD A;  5CRD A;  3DWV A;  4TR1 B;  3C8E A;  2KHP A;  3E3E A;  1R5P A;  5DAK A;  2QA2 A;  2YN1 A;  2OBI A;  4XCS A;  1AAZ A;  2CZ3 A;  1UN2 A;  11GS A;  2YWO A;  2VCQ A;  3ZYW A;  2MBT A;  5G31 A;  5GAN D;  2WB9 A;  3IK7 A;  3MDK A;  2JZR A;  4I6X A;  4ML6 A;  5ECK B;  1VF4 A;  1THX A;  3FY7 A;  1SK1 A;  3BOA A;  3QAV A;  1TP9 A;  2L57 A;  3U6V A;  5JCU A;  4GWR A;  3CMI A;  4IN0 A;  1T1V A;  3RHB A;  4BIK A;  2H72 A;  2IMI A;  1X5C A;  1OE8 A;  2DC5 A;  5GZZ B;  17GS A;  2ON5 A;  2R2J A;  4YH2 A;  4TRX A;  9GSS A;  5DJM A;  1ZGN A;  3QFB C;  2IN3 A;  2LST A;  3C7M A;  5DAL A;  5IO0 A;  1EZK A;  4K7N A;  2CQ9 A;  3GL3 A;  4XS4 A;  1V98 A;  4G0K A;  4YKF A;  4TOP A;  2UZ8 A;  1F37 A;  2CZ2 A;  3ZVJ A;  1A2J A;  4AGS A;  1SEN A;  1SK2 A;  3TRQ A;  3HJO A;  4HU9 A;  4L0W A;  3LQ7 A;  3NOF A;  3N9J A;  4BL7 B;  3DKS A;  5DQS A;  3TKS E;  1M3J A;  3KP8 A;  3HVV A;  1NSW A;  2BMX A;  2H70 A;  2VLT A;  2YV9 A;  2VD1 A;  2HZF A;  3VUR A;  1GLQ A;  1ERW A;  1XWK A;  2DKH A;  3N5O A;  1TK8 B;  1GTI A;  4J57 E;  1E6B A;  2K8V A;  4DSS A;  2JSZ A;  3EC3 A;  1GSD A;  1KTE A;  2HLS A;  2BJX A;  5DCG A;  3PGT A;  1GSF A;  1A8Y A;  4CY6 A;  4NPB A;  2OJL A;  1EWX A;  2LNS A;  2PBJ A;  1YJ6 A;  1YEX A;  3D0Z A;  4OFM A;  2FD3 A;  5GST A;  2OAC A;  1R26 A;  4LMW A;  3RDW A;  2R37 A;  1Z7R A;  3EU3 A;  1NM3 A;  3UEM A;  4BPY A;  5A4W A;  1FOH A;  5IMC A;  3FYG A;  2JU5 A;  4EIP A;  5EY6 A;  4PQ1 A;  20GS A;  1PFO A;  4IP1 A;  1ERV A;  5L71 A;  1Z5Y E;  1YEP A;  4AJ8 A;  1OC8 A;  1WJK A;  4NV5 A;  4HUA A;  2F3M A;  2VAF A;  3LXT A;  4KX4 A;  2DJJ A;  1FG4 A;  3WGE A;  2GSR A;  6GSS A;  2C3Q A;  5E4W A;  1SKR B;  1R7H A;  4EC0 A;  2CX4 A;  2FWF A;  4AJ7 A;  4IW9 A;  3KH9 A;  2REM A;  1PN0 A;  3BD2 A;  4X1U A;  2J23 A;  4LLR A;  1QMV A;  1GL8 A;  2PVO C;  5H5R A;  4AJ6 A;  3ZRD A;  4X4J A;  2AB6 A;  3QDN A;  4BWS A;  3UOM A;  6GSX A;  3JCM L;  1F3A A;  4KCE A;  1M2A A;  4K5S A;  3LWA A;  1K3Y A;  5ID2 A;  3EYT A;  2H0H A;  1GNW A;  1TU8 A;  2GT6 A;  2MBS A;  3LYP A;  2GLR A;  2E7P A;  5LCZ A;  5ECI B;  4PQH A;  18GS A;  4MZW A;  1PRX A;  1ML6 A;  2LTK A;  5ECL B;  4GQC A;  1YF1 A;  1KBN A;  4PQI A;  4JED A;  3BBY A;  3IHQ A;  4O7H A;  4NV2 A;  3HA9 A;  16GS A;  4EDY A;  4Q5R A;  1JZD A;  1JZR A;  2DML A;  2H1D A;  3M1G A;  2R3X A;  4G19 A;  2DLX A;  2GSQ A;  2BTO T;  4POL A;  4KSM A;  3F4R A;  2YZH A;  2IWT A;  2LS5 A;  4EL1 A;  1F9M A;  1GSU A;  3TKS C;  5DAK B;  1SYX A;  2ON7 A;  4I2U A;  1A8L A;  3C73 A;  1PKZ A;  5D9T A;  1O73 A;  2DJ3 A;  4BA7 A;  3GKK A;  3TOU A;  4YQU A;  4D73 A;  2HI7 A;  5D9W A;  1SL2 B;  5ECP B;  3IRA A;  3EMX A;  1O8W A;  4O92 A;  1XBS A;  1SD8 A;  1MDK A;  2RII A;  2VD0 A;  3ME8 A;  4I2T A;  5DQY A;  1K3L A;  4ZIL A;  2TRX A;  5KOW A;  3A5W A;  2OE0 A;  5JWR B;  5KOX A;  2P31 A;  4FQU A;  3KM6 A;  3QAG A;  1V2A A;  2WFC A;  4Z2U A;  2I1U A;  2LQQ A;  3TJB A;  2L5L A;  1V57 A;  2O85 A;  4HQZ A;  4ECJ A;  3I6A A;  4HZ4 A;  3TJF A;  2MMN A;  4EE0 A;  4ZXG A;  5DAL B;  2IL3 A;  3DGQ A;  4LL1 B;  4XS4 B;  4PX1 A;  2WCI A;  5F06 A;  5EVO A;  5ELA A;  3HJP A;  2A2P A;  4GRF A;  4KH7 A;  1XVW A;  3H8Q A;  3IOS A;  3GKM A;  3KCM A;  1LU4 A;  3SBC A;  4O32 A;  3O3T A;  1O8X A;  3UL3 A;  3R3E A;  2K8S A;  1MDJ A;  3W8S A;  2R4V A;  1TOF A;  3L0H A;  5H5Q A;  5HR1 A;  2VCZ A;  2LV3 A;  1S3A A;  1HNB A;  1TK0 B;  2VCW A;  2LUS A;  5CRE A;  4DSS B;  3UMA A;  3Q74 A;  3IE3 A;  5CRG A;  3ZFB A;  1QXH A;  5G1L A;  2AV4 A;  3I43 A;  2B6M A;  14GS A;  1SKW B;  3IHG A;  5BMU A;  3IC4 A;  4POB A;  4L5L A;  1U3I A;  2QA1 A;  4MMM A;  1XW6 A;  1EOG A;  2NVL A;  2VCT A;  1XCC A;  4J2F A;  2R0C A;  2DSA A;  2GDR A;  2B1L A;  1TDI A;  4ECB A;  1PN9 A;  1VRS D;  3VFI A;  2YWN A;  1QUW A;  4LMV A;  4HI7 A;  4JBB A;  3GRX A;  4EF0 A;  1XOB A;  4HOJ A;  2DJ0 A;  2HT9 A;  5J9C A;  3US3 A;  4LL4 B;  4Z2T A;  2X8G A;  2PMT A;  4IJ3 A;  4FYB A;  2VUP A;  3L9U A;  1VGL A;  5ECQ B;  3LYK A;  3O6T A;  4G9H A;  2FA8 A;  1BJX A;  3APS A;  5DCH A;  3M3M A;  1MDI A;  1R5A A;  2IMK A;  2OAD A;  3FZ9 A;  1SKS B;  6GSV A;  5AIS A;  2H76 A;  1SJZ A;  5DJL A;  1KEB A;  3DRN A;  5G5E A;  1OC3 A;  2RUF A;  4EIQ A;  4NHW A;  1M3I A;  5ECO B;  2KP2 A;  4PUR A;  5JWQ B;  3VWU A;  4G0I A;  3GV1 A;  4J56 E;  1WRY A;  3GYK A;  3HJM A;  2AJQ B;  3MNG A;  3P8W A;  2DJ2 A;  3ZTL A;  5ID2 B;  3HY2 A;  3L78 A;  3TRX A;  5AGY A;  2GS3 A;  1UVZ A;  4ZBD A;  4N10 A;  5GSS A;  1Z6N A;  4KDU A;  4YAP A;  4ZB9 A;  3WGX A;  2YZU A;  4OWY A;  1XPV A;  4XS1 A;  1TW9 A;  4TXV A;  4F0C A;  4XHM A;  3HVS A;  3FRC A; 
#chains in the Genus database with same CATH homology
 5ECN B;  1VF3 A;  2X4A A;  3F9U A;  4MH3 A;  4PGT A;  2L59 A;  3PH9 A;  5DVB A;  4RQR A;  1YQ1 A;  2B5E A;  1AQW A;  2JAC A;  2PUK C;  5CNW A;  2MMO A;  2HSY A;  1WMJ A;  1DE1 A;  2V6K A;  1QQ2 A;  3WT2 A;  4CDO A;  3KP9 A;  2M72 A;  2R5G A;  3UVH A;  1GTA A;  2RUE A;  2GZP A;  2PVQ A;  4ZL7 A;  2E2G A;  3F6F A;  5KEJ A;  3D5J A;  3F0I A;  3C1S A;  1YKA A;  2I3Y A;  1SYR A;  5HFK A;  1TRS A;  3LXZ A;  3D6I A;  3LEF A;  4D73 B;  1WPI A;  3DML A;  3CRU A;  3GMF A;  4MCU A;  1T7P B;  1OAZ A;  4WXT A;  1Z7P A;  2G2Q A;  3HZ8 A;  5HQP A;  3VWX A;  4NXI A;  2FNO A;  1DSB A;  3QPM A;  4H86 A;  1U3A A;  1ILO A;  1OKT A;  3C1R A;  3ISO A;  3DIE A;  3QR6 A;  3ME7 A;  1A24 A;  4MDC A;  3CTG A;  1NW2 A;  3GSS A;  4MNN A;  2VIM A;  4IS0 A;  3FR6 A;  2H8L A;  4ULX A;  2CX3 A;  3D22 A;  5B6M A;  3UIW A;  2DJ1 A;  2NDO A;  3ZIJ A;  5KN1 A;  3EUR A;  1YY7 A;  4K6X A;  3IBH A;  4Q5F A;  2AUV A;  5D96 A;  3UAP A;  1JLW A;  3KTB A;  5B8A A;  5KN0 A;  3Q19 A;  5HFI A;  12GS A;  1ERT A;  5F05 A;  3FR3 A;  1LBK A;  1OE7 A;  1A23 A;  2F9S A;  2FUG 2;  5ECH B;  3GA4 A;  3LW9 A;  3ED3 A;  5CRH A;  4KUN A;  3RPN A;  3GUS A;  3V1W A;  4KB3 A;  2HZE A;  2XHF A;  4PTS A;  2LJA A;  4BVX A;  1EV4 A;  4KND A;  4MJE A;  4KW6 A;  3TKR A;  1FAA A;  4CHS A;  3IXR A;  4QL7 A;  3KH7 A;  1AXD A;  5IPG A;  4MF7 A;  4MK3 A;  2A4H A;  1E2Y A;  2WDU A;  2R0P A;  1TI1 A;  1U6T A;  4USS A;  4ISD A;  2H71 A;  5IMA A;  5AIX A;  1ZCP A;  4L5O A;  1TK5 B;  3GN3 A;  4X43 A;  3EIN A;  3ZIV A;  2PER A;  2V41 A;  1O7U A;  5D73 A;  1AC1 A;  3GX0 A;  19GS A;  3LGC A;  3QMX A;  3L9V A;  3M9J A;  2C0E A;  1MEK A;  2IIY A;  1T00 A;  3RHC A;  1EOH A;  3HXS A;  2KP1 A;  2XC2 A;  3ZL5 A;  2VOC A;  1I5G A;  2AAW A;  3ZML A;  1PKW A;  4RUV A;  3EWL A;  1T4Y A;  3GH9 A;  3Q6O A;  2K18 A;  1I9D A;  4AF2 A;  2QSI A;  4EO3 A;  4OO4 A;  2OKA A;  2WZ9 A;  4XS6 A;  4OD7 A;  2L4C A;  1B4P A;  3HZ4 A;  2VL2 A;  4DSQ A;  1M2D A;  2B7K A;  3CBU A;  4TW5 A;  1GUM A;  2GST A;  3VK9 A;  1HYU A;  3APO A;  1WIK A;  4ZBA A;  3WYW A;  5FHI A;  4HQS A;  3L4N A;  3F63 A;  5AIV A;  1CQG A;  2N5B A;  4I8B A;  3HKR A;  5CO3 A;  3KMN A;  2K9F A;  1F6M C;  3IV4 A;  5H5S A;  2ZUP A;  1Q4J A;  5F07 A;  4PNF A;  1M9A A;  1GRX A;  2YP6 A;  3H4K A;  1USB A;  2CVD A;  4BVY A;  3D4M A;  8GSS A;  4XTS A;  5IMV A;  2I4A A;  2L6D A;  4IJI A;  3ZVJ D;  2RM5 A;  2CAI A;  3D21 A;  3IK9 A;  3KGK A;  1X9S B;  3A2V A;  3DVW A;  3KMO A;  5JCW A;  3GH6 A;  1G7E A;  2B1K A;  1Y6E A;  1YDK A;  1FB6 A;  3J7Y b;  3UJ1 A;  6GST A;  3D4T A;  5LNK e;  3GTU A;  1U87 A;  1U88 A;  2L4Q A;  1DE2 A;  2FGX A;  2GQK A;  3FR9 A;  2FHE A;  4YKG A;  3R2Q A;  2EIR A;  3ZRE A;  1TTZ A;  2TIR A;  1EGR A;  3H93 A;  1GTU A;  2VM1 A;  3VPT A;  2V2G A;  3GNJ A;  1HD2 A;  3FEU A;  1GUH A;  2R0G A;  2FWE A;  5IQY A;  13GS A;  2ZCT A;  5FT3 A;  3F3R A;  2C0F A;  2V1M A;  5CYY A;  2LQO A;  2VCX A;  3VLN A;  4V1A p;  3ZZX A;  5EPF A;  4Q5N A;  2L5O A;  2HXK A;  3G7J A;  4NWY A;  5A4U A;  2WS2 A;  5HR0 A;  2NTO A;  3BCK A;  5IM9 A;  3C71 A;  1AIU A;  5B7C A;  1QK8 A;  3UBL A;  1TKD B;  2H19 A;  2WRT A;  4HDE A;  4G10 A;  2MZC A;  1BG5 A;  1VF2 A;  3MWH A;  1FVK A;  3MAK A;  2LEG A;  3F3Q A;  4WET A;  2DJK A;  1Y25 A;  3IC8 A;  4L0U A;  4IQ1 A;  5HR3 A;  2C80 A;  1W4V A;  3IAM 2;  3FMW A;  4TVE A;  4OFN A;  1YF0 A;  3NIV A;  3MSZ A;  3TDG A;  1B4Q A;  2H6Z A;  1T8E B;  4E8H A;  2VL9 A;  1MD4 A;  2PU9 C;  3QD9 A;  2OE1 A;  2DIY A;  1YZX A;  3K8N A;  4PUF C;  3VPQ A;  2ZNM A;  5JWO B;  2B3S A;  4FYU A;  2TRC P;  1T4Z A;  3FKF A;  5D93 A;  4XIH A;  1JZW A;  2YCD A;  2HZE B;  1K0A A;  3QAW A;  4BVX B;  2VM2 A;  3AY8 A;  3I9V 2;  3TOT A;  2JSY A;  2CVB A;  1F3B A;  3A5I A;  1LJR A;  1A0R P;  4POK A;  1ZYQ B;  3A2X A;  4K5R A;  3GL5 A;  4X0X A;  2P0G A;  5IIZ A;  3EE2 A;  1PMT A;  4ZL8 A;  1AQX A;  3HYP A;  3KD0 A;  4ACS A;  2PGT A;  2H75 A;  1TRV A;  4K0G A;  5C00 A;  1SD9 A;  1GSY A;  4JU5 A;  2A2R A;  2VCV A;  3UBK A;  2C4J A;  2HYX A;  1V58 A;  1QGV A;  2FLS A;  2QKE A;  2L6C A;  5EL8 A;  1THO A;  1PSQ A;  1K0O A;  1WOU A;  5ABR A;  3BCI A;  3U5R E;  2CT6 A;  4ZB8 A;  4IP6 A;  3GHA A;  4ZL9 A;  2Z9S A;  1HNC A;  4K0N A;  1EEJ A;  2N5F A;  3TCO A;  1ZYN A;  4K7O A;  4ICY A;  2YV7 A;  2JAD A;  1B48 A;  2YAN A;  3LG6 A;  4WEY A;  1V40 A;  2OE3 A;  3CRT A;  4MPG A;  2P5R A;  2EC4 A;  1XFL A;  4DVC A;  1G0T A;  2IJY A;  3HCZ A;  3S9F A;  2D2Z A;  2IMF A;  4TXO A;  4I5Q A;  5D8I A;  1HQO A;  1M99 A;  1OKD A;  2JL4 A;  1XWC A;  4GCI A;  4MJB A;  3P7X A;  1EGO A;  4OCF A;  4TR3 A;  1M2B A;  3G7I A;  1RK4 A;  1FHE A;  2RM6 A;  4F82 A;  2FWH A;  4IKH A;  2XBQ A;  3EU4 A;  4GF0 A;  1M9B A;  1JFU A;  1GUL A;  4V2N A;  4K2D A;  1N8J A;  1GSQ A;  4MH2 A;  4MAB A;  5D9V A;  2FA4 A;  2LJK A;  1G6W A;  3ZMK A;  5ECS A;  2H6X A;  4GST A;  4BVY B;  5CRW A;  5KN2 A;  4POM A;  4Z2R A;  2RLI A;  1OYJ A;  3QCP A;  4XRA A;  4Z7X A;  3LFL A;  1K0C A;  1TXX A;  4O5Q A;  3IPZ A;  4LA1 A;  2B5X A;  1XVQ A;  2XPD A;  4ZB6 A;  3GTU B;  5E59 A;  1IYH A;  3GKX A;  3DVX A;  5GAP D;  1SL1 B;  4MJC A;  5C04 A;  1XWG A;  5CAX A;  1CQH A;  3W8J A;  1GSS A;  1XWA A;  3FZ5 A;  1S3D A;  1AQV A;  3M8N A;  4JR4 A;  3PR8 A;  1OVN A;  3A3T A;  1K0D A;  22GS A;  4IHU A;  1TU7 A;  4MA9 A;  2MMA A;  3TJJ A;  1B8X A;  5COH A;  4WBJ A;  3APQ A;  3VI7 A;  4A5P A;  4WF4 A;  3DEX A;  5DBQ A;  4TR4 A;  1G7O A;  1O6J A;  1GP1 A;  3PIN A;  1SJI A;  1W89 A;  3KZQ A;  4O5R A;  1SK0 A;  2VL2 C;  1GNE A;  1O85 A;  2AHE A;  4K9Z A;  1MTC A;  3QOU A;  2K6V A;  4PUA A;  3FK8 A;  10GS A;  1ON4 A;  4IQA A;  2H73 A;  4NAX A;  1PGT A;  2ES7 A;  3EPT A;  3CSI A;  4O5U A;  3SWL A;  2HE3 A;  4OFT A;  3WT1 A;  1DBY A;  1OC9 B;  5ELG A;  4EKZ A;  2N5A A;  1R4W A;  2VLV A;  4QQ7 A;  2V6O A;  3CXG A;  4WF5 A;  2O87 A;  1BQ7 A;  4JZQ A;  3GX8 A;  3DYR A;  1K3O A;  1J08 A;  4G2E A;  4GTU A;  2QGV A;  3MIX A;  4K1F A;  3E0U A;  4GXZ A;  1JHB A;  1X5D A;  1FVJ A;  2GQM A;  2H74 A;  2H6Y A;  4Q5Q A;  1SL0 B;  4N11 A;  1B9Y C;  3M0F A;  1K0M A;  5IMZ A;  4N0V A;  2LKU A;  4N0Z A;  1PQN A;  1WP0 A;  3CYN A;  1XW5 A;  5LD0 A;  2FWG A;  2H66 A;  2F8F A;  2GVP A;  2AYT A;  3H1N A;  6GSU A;  2VO4 A;  4K2X A;  2H0I A;  1EEM A;  2M46 A;  1ERU A;  1K0N A;  2WJU A;  4ZBB A;  2B5Y A;  2V32 A;  4I97 A;  5F0G A;  5ECR B;  2H1G A;  2LRN A;  2P5Q A;  5IMF A;  2LJR A;  6GSY A;  1ZYP A;  2G0F A;  5B6N A;  1RQM A;  3FW2 A;  2HFD A;  1NHO A;  5INY A;  1EP8 A;  2KUC A;  5IPH A;  1M7T A;  3GUR A;  1AUC A;  1SJ6 A;  3ZLP A;  2NPB A;  5J41 A;  5J4U A;  3GFK A;  1Z6M A;  3ERF A;  3H79 A;  4G0L A;  6GSW A;  1M0U A;  2HRF A;  2X99 A;  1HNA A;  1K0B A;  1PA3 A;  2DKI A;  2JZS A;  5J9B A;  5B8B A;  5JCG A;  3E9J B;  4TXO B;  5IOW A;  1C72 A;  2CA8 A;  4E8E A;  2H0G A;  3DXB A;  2X8C A;  3RBT A;  2IFQ A;  1UC7 A;  4KCA A;  4DEJ A;  3UAR A;  2MMZ A;  3IA1 A;  4K8M A;  2YJ7 A;  4KDY A;  5ECM B;  4WR4 A;  3VWW A;  4V2L A;  1JLV A;  4CW9 A;  3F4T A;  2WGR A;  4IVF A;  1Z9H A;  4MF5 A;  1ZMA A;  3QFA C;  5G1K A;  1J0F A;  1ZZY A;  4HU7 A;  1ABA A;  1X9W B;  4EVM A;  1H75 A;  4HS1 A;  2WUL A;  5HFG A;  1X0R A;  4KDX A;  4MF6 A;  3ZIT A;  2GTU A;  4IBP A;  3KIJ A;  1KNG A;  2OBK A;  3RAZ A;  2HRN A;  4MP4 A;  1BX9 A;  1XIY A;  2GSS A;  3PPU A;  3KXO A;  1WE0 A;  3J7Y k;  2X49 A;  2YJH A;  4FO5 A;  1ZOF A;  4TR0 A;  2E2M A;  4NHZ A;  4L8E A;  4DSR A;  3FZA A;  1V9W A;  4WR5 A;  3LJR A;  3GKN A;  3IR4 A;  2XPE A;  4KA0 A;  1TI3 A;  2C8U A;  3UVT A;  1WWJ A;  5G30 A;  2O7K A;  4HZ2 A;  1NHY A;  1PL2 A;  1XOA A;  4KSO A;  3KTL A;  3LOR A;  4F03 A;  2B7J A;  4ECI A;  2OA7 A;  5DDL A;  3WD6 A;  2DIZ A;  3TKP A;  1F2E A;  1T3B A;  2O8V B;  4OO5 A;  4EUY A;  3P90 A;  2YOI A;  2QC7 A;  1GWC A;  3F6D A;  1BYE A;  2LRT A;  4HJ2 A;  4F9Z A;  2NBS A;  1PX7 A;  1O81 A;  4KF9 A;  3EMP A;  1SU9 A;  3EVI A;  1FO5 A;  3FZ4 A;  2LRC A;  3O76 A;  2H01 A;  4TR1 A;  5IO2 A;  3Q18 A;  4PXO A;  1S3C A;  3WGD A;  1PD2 1;  1ZYE A;  1GLP A;  2YWM A;  2I9H A;  2C0D A;  4KGI A;  1JZO A;  3G9B A;  4HEA 2;  2HRA A;  2C3T A;  3HDC A;  4QL9 A;  2X8H A;  2O89 A;  1UA5 A;  4MPF A;  2PN8 A;  2KOK A;  1XW9 A;  2GZZ A;  3L9S A;  5G5F A;  1OC9 A;  1PL1 A;  4ML1 A;  4YQV A;  4GLT A;  4F0B A;  5J3R A;  2MYG A;  4JRR A;  3W6G A;  2DBC A;  2YNX A;  5CP1 A;  3I69 A;  2X64 A;  2CAQ A;  3BJ5 A;  2GGT A;  4RI6 A;  3F8U A;  4EDZ A;  4RI7 A;  3RPP A;  1TRU A;  2EIO A;  3OR5 A;  4IGJ A;  1QFN A;  4KAE A;  2EIQ A;  2J9H A;  5FWG A;  4MZB A;  1J9B A;  4MLY A;  4NMU A;  1URM A;  1A0F A;  1EP7 A;  4BWQ A;  4MJA A;  2H30 A;  1DUG A;  1VF1 A;  1A2M A;  4BL7 A;  3ERG A;  1BAY A;  1MD3 A;  2F8A A;  5J5N A;  1N2A A;  4N30 A;  4GSN A;  1PX6 A;  1X5E A;  1B9X C;  4FYC A;  1FW1 A;  1ACV A;  3HHV A;  3CTF A;  2GZY A;  3LSZ A;  5HR2 A;  2PWJ A;  3G7Y A;  2GQL A;  4YQM A;  2H1A A;  3IAS 2;  4TN8 A;  1GH2 A;  2JZT A;  2IME A;  4K7I A;  2VL3 A;  3KJY A;  5F8B A;  2FCH A;  3M9K A;  4JR6 A;  3TUE A;  3NZN A;  2M80 A;  4OMV A;  3HVX A;  1ZL9 A;  1X9M B;  2LNT A;  4ECC A;  2KLX A;  1TJD A;  5A5K A;  4KE3 A;  2FY6 A;  3MYD A;  2R6K A;  2HRK A;  5AN1 A;  1Q98 A;  2C3N A;  1XWB A;  2IFQ B;  3TGZ A;  4V2M A;  2E0Q A;  3VWV A;  3FHK A;  5D9X A;  3A2W A;  2PPT A;  3CSH A;  1FB0 A;  3TKQ A;  3ERW A;  3TKS A;  1AW9 A;  1EV9 A;  4RQX A;  5G2Z A;  2ALB A;  2H1B A;  4JE1 A;  4OCE A;  3IDV A;  2VLU A;  3TJG A;  3ZFL A;  1ST9 A;  1BED A;  4FIW A;  4HJM A;  2HSH A;  5IOX A;  1GSE A;  1XZO A;  4PNG A;  1H4O A;  3KEB A;  1YKC A;  5ENU A;  1FOV A;  2CVK A;  2HSM A;  2F51 A;  2GT5 A;  4ID0 A;  4TKY A;  3TRP A;  4F2I A;  4YAV A;  5A4V A;  1RW1 A;  3TB2 A;  2C1Y A;  5KN3 A;  1IYI A;  4IEL A;  3DD3 A;  2C0G A;  3VI5 A;  5BRT A;  4ILF A;  4V1A g;  4EXJ A;  3TJK A;  4P3Y B;  3P2A A;  1GUK A;  2HNL A;  4GSS A;  2YPM A;  4WKW A;  4ZIJ A;  5IMD A;  2A2S A;  4XRD A;  1A2L A;  1TRW A;  2CV4 A;  4FH8 A;  4MZC A;  1GTB A;  2YWI A;  3HD5 A;  4CY8 A;  3GIX A;  1G6Y A;  2DMM A;  3F4S A;  1Z3E A;  2A4V A;  4WBR D;  1XXU A;  4GQF A;  2IPA A;  2I81 A;  2XBI A;  3CSJ A;  3GST A;  7GSS A;  2IMD A;  5CRD A;  3DWV A;  4TR1 B;  3C8E A;  2KHP A;  3E3E A;  1R5P A;  5DAK A;  2QA2 A;  2YN1 A;  2OBI A;  4XCS A;  1AAZ A;  2CZ3 A;  1UN2 A;  11GS A;  2YWO A;  2VCQ A;  3ZYW A;  2MBT A;  5G31 A;  5GAN D;  2WB9 A;  3IK7 A;  3MDK A;  2JZR A;  4I6X A;  4ML6 A;  5ECK B;  1VF4 A;  1THX A;  3FY7 A;  1SK1 A;  3BOA A;  3QAV A;  1TP9 A;  2L57 A;  3U6V A;  5JCU A;  4GWR A;  3CMI A;  4IN0 A;  1T1V A;  3RHB A;  2H72 A;  2IMI A;  1X5C A;  1OE8 A;  2DC5 A;  5GZZ B;  17GS A;  2ON5 A;  2R2J A;  4YH2 A;  4TRX A;  9GSS A;  5DJM A;  1ZGN A;  3QFB C;  2IN3 A;  2LST A;  3C7M A;  5DAL A;  5IO0 A;  1EZK A;  4K7N A;  2CQ9 A;  3GL3 A;  4XS4 A;  1V98 A;  4G0K A;  4YKF A;  4TOP A;  2UZ8 A;  1F37 A;  2CZ2 A;  3ZVJ A;  1A2J A;  4AGS A;  1SEN A;  1SK2 A;  3TRQ A;  3HJO A;  4HU9 A;  4L0W A;  3LQ7 A;  3NOF A;  3N9J A;  4BL7 B;  3DKS A;  5DQS A;  3TKS E;  3KP8 A;  3HVV A;  1NSW A;  2BMX A;  2H70 A;  2VLT A;  2YV9 A;  2VD1 A;  2HZF A;  3VUR A;  1GLQ A;  1ERW A;  1XWK A;  2DKH A;  3N5O A;  1TK8 B;  1GTI A;  4J57 E;  1E6B A;  2K8V A;  4DSS A;  2JSZ A;  3EC3 A;  1GSD A;  1KTE A;  2HLS A;  2BJX A;  5DCG A;  3PGT A;  1GSF A;  1A8Y A;  4CY6 A;  4NPB A;  2OJL A;  1EWX A;  2LNS A;  2PBJ A;  1YJ6 A;  1YEX A;  3D0Z A;  4OFM A;  2FD3 A;  5GST A;  2OAC A;  1R26 A;  4LMW A;  3RDW A;  2R37 A;  1Z7R A;  3EU3 A;  1NM3 A;  3UEM A;  4BPY A;  5A4W A;  1FOH A;  5IMC A;  3FYG A;  2JU5 A;  4EIP A;  5EY6 A;  4PQ1 A;  20GS A;  4IP1 A;  1ERV A;  5L71 A;  1Z5Y E;  1YEP A;  4AJ8 A;  1OC8 A;  1WJK A;  4NV5 A;  4HUA A;  2F3M A;  2VAF A;  3LXT A;  4KX4 A;  2DJJ A;  1FG4 A;  3WGE A;  2GSR A;  6GSS A;  2C3Q A;  5E4W A;  1SKR B;  1R7H A;  4EC0 A;  2CX4 A;  2FWF A;  4AJ7 A;  4IW9 A;  3KH9 A;  2REM A;  1PN0 A;  3BD2 A;  4X1U A;  2J23 A;  4LLR A;  1QMV A;  1GL8 A;  2PVO C;  5H5R A;  4AJ6 A;  3ZRD A;  4X4J A;  2AB6 A;  3QDN A;  4BWS A;  3UOM A;  6GSX A;  3JCM L;  1F3A A;  4KCE A;  1M2A A;  4K5S A;  3LWA A;  1K3Y A;  5ID2 A;  3EYT A;  2H0H A;  1GNW A;  1TU8 A;  2GT6 A;  2MBS A;  3LYP A;  2GLR A;  2E7P A;  5LCZ A;  5ECI B;  4PQH A;  18GS A;  4MZW A;  1PRX A;  1ML6 A;  2LTK A;  5ECL B;  4GQC A;  1YF1 A;  1KBN A;  4PQI A;  4JED A;  3BBY A;  3IHQ A;  4O7H A;  4NV2 A;  3HA9 A;  16GS A;  4EDY A;  4Q5R A;  1JZD A;  1JZR A;  2DML A;  2H1D A;  3M1G A;  2R3X A;  4G19 A;  2DLX A;  2GSQ A;  2BTO T;  4POL A;  4KSM A;  3F4R A;  2YZH A;  2IWT A;  2LS5 A;  4EL1 A;  1F9M A;  1GSU A;  3TKS C;  5DAK B;  1SYX A;  2ON7 A;  4I2U A;  1A8L A;  3C73 A;  1PKZ A;  5D9T A;  1O73 A;  2DJ3 A;  4BA7 A;  3GKK A;  3TOU A;  4YQU A;  4D73 A;  2HI7 A;  5D9W A;  1SL2 B;  5ECP B;  3IRA A;  3EMX A;  1O8W A;  4O92 A;  1XBS A;  1SD8 A;  1MDK A;  2RII A;  2VD0 A;  3ME8 A;  4I2T A;  5DQY A;  1K3L A;  4ZIL A;  2TRX A;  5KOW A;  3A5W A;  2OE0 A;  5JWR B;  5KOX A;  2P31 A;  4FQU A;  3KM6 A;  3QAG A;  1V2A A;  2WFC A;  4Z2U A;  2I1U A;  2LQQ A;  3TJB A;  2L5L A;  1V57 A;  2O85 A;  4HQZ A;  4ECJ A;  3I6A A;  4HZ4 A;  3TJF A;  2MMN A;  4EE0 A;  4ZXG A;  5DAL B;  2IL3 A;  3DGQ A;  4LL1 B;  4XS4 B;  4PX1 A;  2WCI A;  5F06 A;  5EVO A;  5ELA A;  3HJP A;  2A2P A;  4GRF A;  4KH7 A;  1XVW A;  3H8Q A;  3IOS A;  3GKM A;  3KCM A;  1LU4 A;  3SBC A;  4O32 A;  3O3T A;  1O8X A;  3UL3 A;  3R3E A;  2K8S A;  1MDJ A;  3W8S A;  2R4V A;  1TOF A;  3L0H A;  5H5Q A;  5HR1 A;  2VCZ A;  2LV3 A;  1S3A A;  1HNB A;  1TK0 B;  2VCW A;  2LUS A;  5CRE A;  4DSS B;  3UMA A;  3Q74 A;  3IE3 A;  5CRG A;  3ZFB A;  1QXH A;  5G1L A;  2AV4 A;  3I43 A;  2B6M A;  14GS A;  1SKW B;  3IHG A;  5BMU A;  3IC4 A;  4POB A;  4L5L A;  1U3I A;  2QA1 A;  4MMM A;  1XW6 A;  1EOG A;  2NVL A;  2VCT A;  1XCC A;  4J2F A;  2R0C A;  2DSA A;  2GDR A;  2B1L A;  1TDI A;  4ECB A;  1PN9 A;  1VRS D;  3VFI A;  2YWN A;  1QUW A;  4LMV A;  4HI7 A;  4JBB A;  3GRX A;  4EF0 A;  1XOB A;  4HOJ A;  2DJ0 A;  2HT9 A;  5J9C A;  3US3 A;  4LL4 B;  4Z2T A;  2X8G A;  2PMT A;  4IJ3 A;  4FYB A;  2VUP A;  3L9U A;  1VGL A;  5ECQ B;  3LYK A;  3O6T A;  4G9H A;  2FA8 A;  1BJX A;  3APS A;  5DCH A;  3M3M A;  1MDI A;  1R5A A;  2IMK A;  2OAD A;  3FZ9 A;  1SKS B;  6GSV A;  5AIS A;  2H76 A;  1SJZ A;  5DJL A;  1KEB A;  3DRN A;  5G5E A;  1OC3 A;  2RUF A;  4EIQ A;  4NHW A;  5ECO B;  2KP2 A;  4PUR A;  5JWQ B;  3VWU A;  4G0I A;  3GV1 A;  4J56 E;  1WRY A;  3GYK A;  3HJM A;  2AJQ B;  3MNG A;  3P8W A;  2DJ2 A;  3ZTL A;  5ID2 B;  3HY2 A;  3L78 A;  3TRX A;  5AGY A;  2GS3 A;  1UVZ A;  4ZBD A;  4N10 A;  5GSS A;  1Z6N A;  4KDU A;  4YAP A;  4ZB9 A;  3WGX A;  2YZU A;  4OWY A;  1XPV A;  4XS1 A;  1TW9 A;  4TXV A;  4F0C A;  4XHM A;  3HVS A;  3FRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...