3G7YA

Crystal structure of oxidized ost6l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
DILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dolichyl-diphosphooligosaccharide-protein glycosyltransferas
publication title Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.4.1.119: Transferred entry: 2.4.99.18.
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3g7yA00
3TJJA 1OVNA 1TRUA 1O8XA 2HI7A 4MJCA 20GSA 3LSZA 3D4MA 4K0GA 5AN1A 4PXOA 3RHBA 4TR1A 4AGSA 1GUMA 3TJBA 2RM5A 4HU7A 4PURA 1SK0A 2FGXA 4YQUA 2CX4A 2J23A 3C8EA 13GSA 3ZL5A 1YKAA 4FYBA 1LBKA 2VL9A 2CX3A 2H1DA 1CQHA 3HJMA 1TRVA 2IIYA 11GSA 1AQWA 3IDVA 4QQ7A 2LRNA 3IXRA 3FEUA 1MD3A 4KDUA 4QL7A 3UBKA 3M9KA 1GLPA 1TK5B 4DVCA 3WT1A 2R5GA 2H1BA 1GUKA 2YP6A 2O85A 5EPFA 4EDZA 5ECRB 3CSJA 2IMKA 4XS4B 2YJHA 5H5SA 2CZ3A 1XVWA 4MCUA 3GKMA 5CYYA 4IS0A 1WP0A 3F3RA 2PWJA 3UVHA 2N5FA 1H75A 3FZ9A 3Q18A 1YQ1A 3I69A 4IELA 3UEMA 4I8BA 2ALBA 1EP7A 2RLIA 3LG6A 4HOJA 4K7NA 4PUAA 1U87A 2CAIA 1XCCA 2HYXA 1PKWA 1Y25A 5G1KA 4F9ZA 3MDKA 1ML6A 2YOIA 5ECMB 2OKAA 2R37A 2VCVA 1QXHA 3UARA 2CAQA 3P8WA 5HFKA 1MDIA 3WYWA 1PX6A 3GSSA 1VGLA 1V9WA 1A8YA 4IHUA 2XBIA 3KM6A 4NPBA 3BJ5A 4G2EA 1OE7A 4MLYA 4E8EA 3GH6A 7GSSA 2HE3A 3GTUA 2KOKA 3EWLA 4DSRA 2LUSA 4IGJA 3UL3A 1UA5A 1YF1A 3ERFA 3FKFA 1N8JA 3KP9A 4N11A 4LMVA 2JSZA 4I2UA 4TR0A 5IPHA 5ECIB 1VF2A 3HYPA 2E2GA 1AAZA 2N5BA 1NW2A 2K6VA 2OE0A 1SYRA 3NZNA 4K1FA 3GKKA 1G0TA 3GX8A 3WGEA 4ACSA 6GSWA 1AUCA 4MZBA 4MF7A 1WPIA 1O85A 1AQVA 2HZEB 6GSSA 5CNWA 1QK8A 3F8UA 4GWRA 1B9YC 4JR4A 5EL8A 2P5RA 2DJ3A 3GKXA 1A2JA 1I9DA 3IRAA 3HY2A 1HNBA 4YQMA 2VCQA 1TKDB 4F0CA 2RUFA 2Z9SA 1T4ZA 3ZVJD 1PX7A 3QFAC 3F3QA 5H5QA 1HNAA 3BBYA 3M0FA 3ME8A 1GUHA 2R4VA 3LYKA 4MMMA 4ZBDA 5G30A 1TRWA 4OCFA 4XS1A 1WRYA 3LORA 1DE1A 5AIVA 4XIHA 1X0RA 2C3QA 4L0WA 1HYUA 5CRGA 1F3BA 1QGVA 1TJDA 3EU3A 2H8LA 5LCZA 2DMLA 3O6TA 3G7YA 5HR2A 3EU4A 2C0GA 1GRXA 9GSSA 3DIEA 3O76A 4WETA 2FUG2 5A5KA 4ZXGA 4HJMA 2OACA 2CV4A 6GSVA 3FK8A 1PKZA 3WGDA 1SENA 3D22A 2VM1A 5DJMA 2G0FA 3WT2A 4NWYA 5D8IA 3HVVA 2LV3A 1G7EA 2FWEA 3EYTA 5GZZB 3QPMA 3LXZA 4ZB6A 2LNTA 5G1LA 3H79A 1PN9A 3BOAA 2LRTA 1ERWA 4IQ1A 1MDJA 3VPTA 1XWBA 3FZAA 2WS2A 3IBHA 2O8VB 1JZOA 2V2GA 4IN0A 2F8AA 2MYGA 5IO2A 1GNEA 1MDKA 2O7KA 3FHKA 1XOAA 4DSQA 4LLRA 4QL9A 4OD7A 1T7PB 2YPMA 1G6YA 4GSNA 3NIVA 1GSQA 2CQ9A 4NHZA 1EZKA 4FYCA 2FWGA 1TP9A 1XW6A 3DRNA 3VPQA 2PN8A 1R26A 5KN1A 4Q5NA 1LJRA 1GULA 1QMVA 4JBBA 4IJIA 2DSAA 5DCGA 3UOMA 1WWJA 2CVKA 1ZL9A 1XXUA 2GSSA 3H93A 1ZYQB 5G2ZA 2C3NA 3DVWA 1NHOA 3A2XA 2HRNA 4JEDA 3A2VA 1X9WB 2WJUA 3ERWA 4PX1A 2VM2A 4KDXA 4NV2A 4F03A 3UBLA 3DXBA 4F2IA 2OADA 2M46A 1EGOA 4KCAA 4KSMA 4WKWA 3TDGA 4ZL9A 4EC0A 1PL1A 3GKNA 4MJEA 2X99A 3MNGA 2IMDA 3L9VA 2E2MA 2L6DA 4D73A 2HSHA 2LQQA 4I6XA 1HD2A 2V1MA 1WMJA 3HZ4A 4ECBA 3WD6A 3RDWA 1OYJA 1UN2A 4KAEA 1JLWA 3TB2A 2ES7A 2OJLA 5DALA 2M72A 1WJKA 1F6MC 3KJYA 2NPBA 4P3YB 2H71A 4PGTA 2C1YA 3P90A 3DGQA 1JLVA 2LJRA 17GSA 5F06A 3HJPA 1R5PA 2XPDA 3EMXA 1SL0B 4FO5A 4K6XA 3GURA 3ZYWA 1EWXA 4RQXA 1K0OA 4FH8A 4TXOB 2DJ0A 2L57A 2CT6A 2C4JA 2F8FA 3TGZA 4JZQA 5F0GA 5IQYA 4TKYA 2OA7A 1DE2A 1XPVA 3CMIA 4OCEA 5CO3A 1M9BA 4KE3A 4DEJA 1V58A 3ISOA 2AHEA 2YWIA 2B5EA 1BG5A 3Q19A 1ON4A 5JCWA 5AGYA 2H0HA 10GSA 1ZOFA 1A24A 3RPPA 3KP8A 2B5YA 2AUVA 1ZYEA 4V1Ag 1X5CA 5DCHA 2RIIA 1FVKA 2XHFA 2K18A 2YWOA 2PVOC 5EVOA 5J9BA 1E6BA 3LEFA 2FCHA 1THOA 1XIYA 3D5JA 16GSA 2DJJA 1SD8A 3HKRA 4BA7A 1M0UA 3E9JB 5J4UA 1K3OA 3QFBC 1URMA 4OFNA 1ZZYA 6GSXA 2FWHA 2HXKA 3A2WA 4BVYA 4O7HA 3HVSA 4HU9A 2AAWA 3VFIA 12GSA 2GT5A 2LTKA 2ZNMA 1SD9A 4GQCA 2NTOA 2AYTA 4NAXA 1MEKA 2P31A 4KSOA 5ECHB 3KTBA 2VLUA 2NBSA 4AF2A 1FO5A 1PA3A 1A23A 4KUNA 5CRWA 4G19A 5E59A 2YWMA 5HQPA 2C0EA 1RQMA 3FYGA 4LL4B 3TKSE 1A0RP 3IAM2 2H75A 2VAFA 3S9FA 2VL3A 3DEXA 1ERVA 1FW1A 1GWCA 4MF6A 3EURA 4GSSA 1O7UA 3VURA 1EOGA 4TOPA 4V2LA 1Q98A 2YNXA 5G5FA 4KH7A 4XS4A 3LFLA 3GIXA 18GSA 1WE0A 2IFQB 4WBJA 3SWLA 2JU5A 3IPZA 5GSSA 1FVJA 3GHAA 1O73A 3CSHA 1AQXA 2C0DA 4H86A 1JZWA 3TKSC 3QR6A 3H1NA 5IMAA 4YAPA 5D9XA 2GZYA 3IHQA 2MMNA 3TJKA 1SKSB 5CAXA 1T3BA 5J3RA 1XWAA 3FR9A 1T4YA 4WF5A 2P0GA 4X0XA 3CRUA 5HR0A 3C73A 5DDLA 1F3AA 3W6GA 5ECSA 2GDRA 3TOUA 4BPYA 1A2LA 2DIYA 2CVDA 4MF5A 5A4WA 2MBSA 3FW2A 3HZ8A 4KW6A 5G5EA 2IMEA 4O5RA 5KN2A 4V2NA 6GSYA 1J08A 4XCSA 2VD1A 4ZB8A 4GXZA 1PMTA 4IBPA 1FOVA 1VF1A 2FHEA 2L5OA 1J9BA 4DSSB 2C8UA 1R7HA 4GQFA 1EV9A 2H0GA 4MJAA 5F05A 3KH7A 4Q5RA 4JU5A 2DJ2A 4MDCA 3M1GA 2H1AA 1OC9B 1SJIA 2GZZA 3R2QA 5AIXA 4TW5A 3Q6OA 3ZRDA 4CDOA 1RW1A 3GSTA 2KLXA 2VOCA 3F4SA 3U6VA 1FAAA 2LKUA 5GAND 1OKTA 2MMAA 1FG4A 3VK9A 2TRXA 5D73A 3MWHA 1ST9A 2J9HA 2HZEA 4OMVA 1XVQA 4J57E 2CA8A 1SJ6A 3EMPA 4MK3A 3IK9A 2O89A 4WXTA 2I1UA 2XPEA 2H0IA 3GRXA 3SBCA 4G9HA 1X5EA 2I81A 5HR1A 4HJ2A 5D9VA 4ILFA 2VCZA 3PINA 4HS1A 3UMAA 4AJ7A 1EEJA 4ML1A 3KMOA 3A5WA 2AJQB 3KMNA 3DVXA 4L0UA 3F6FA 5D96A 1ABAA 3CTGA 3WGXA 2LEGA 2ZUPA 4TXVA 1BEDA 1T8EB 1SKRB 3IV4A 1TDIA 3JCML 1TU7A 3W8JA 3LGCA 3GV1A 2WDUA 3IOSA 5F8BA 2DIZA 1UC7A 4MZWA 1HQOA 2A4VA 2K8VA 1S3DA 4WEYA 1JZDA 3I43A 1YZXA 1M2AA 3KH9A 2R3XA 4KX4A 3FZ5A 2C3TA 4K0NA 4MPFA 5ENUA 1M9AA 5D93A 1JFUA 3UJ1A 2YV7A 3RBTA 1NM3A 2FD3A 1YKCA 5IO0A 3CTFA 4GLTA 4MA9A 2K9FA 4ZL7A 3ZMLA 1GLQA 2RM6A 4ZBBA 2B1KA 1XW9A 4NMUA 2GSRA 1F9MA 2MZCA 2OBKA 3TJFA 3KD0A 2GVPA 5F07A 3L9SA 1B8XA 1I5GA 3GYKA 4JE1A 1OE8A 2JZSA 2JACA 2P5QA 1ZMAA 5CRHA 1SU9A 3APSA 4BL7A 5ECQB 4BWSA 1LU4A 2HLSA 1OKDA 1FHEA 2MBTA 6GSUA 1HNCA 2H76A 5B8BA 1Q4JA 3D0ZA 2B3SA 19GSA 3IK7A 5B8AA 2BTOT 1M99A 5GSTA 1PQNA 1FB0A 3IA1A 3TUEA 2YN1A 1Z5YE 4MABA 4IKHA 3UIWA 2L4QA 2V6OA 5A4VA 3D4TA 4EKZA 3ZIVA 2VL2C 3AY8A 3BCKA 3D6IA 4HQSA 5IMZA 2GZPA 2B7KA 2DLXA 3GA4A 1GH2A 3F0IA 1XWKA 3DYRA 2LQOA 3HA9A 3C1RA 3KTLA 4OFTA 2A2RA 3IR4A 3H4KA 3HXSA 3ZTLA 5DAKB 2H74A 4EXJA 4POLA 2V32A 3U5RE 2GSQA 1GSYA 5D9TA 2PBJA 4Z7XA 2VIMA 1VF4A 5ABRA 1U6TA 2F9SA 5C00A 2HT9A 3LJRA 4IQAA 3GUSA 3LYPA 4WBRD 3VWVA 3L78A 4KGIA 3ZVJA 3HJOA 2GQLA 3EC3A 2QGVA 1B9XC 1VF3A 4XRAA 4HI7A 2H73A 2EIQA 4LMWA 2DBCA 3QOUA 2PU9C 1UVZA 2R2JA 3G7IA 3NOFA 4TXOA 1B4PA 4FYUA 4NXIA 1EP8A 2PPTA 2EC4A 3TCOA 5DQSA 5DBQA 4XHMA 1BQ7A 2FNOA 2I3YA 2HZFA 1CQGA 4TR4A 1SL2B 2GS3A 5L71A 1SL1B 3F9UA 4X1UA 3M3MA 3GH9A 4GSTA 1X5DA 1X9SB 4OWYA 1GTUA 4TN8A 4ID0A 3LXTA 1WOUA 2ON7A 1AC1A 2LJKA 3KZQA 4TVEA 1TOFA 2AB6A 3F4RA 2V41A 2B6MA 2IL3A 2H6XA 2WRTA 5JWQB 4K2DA 3QAWA 2D2ZA 2PMTA 1GSUA 3F4TA 3HCZA 1VRSD 4MH2A 4ZILA 4HDEA 4IP1A 3LQ7A 3I6AA 4N0ZA 3G9BA 4ZIJA 4CHSA 8GSSA 4BWQA 5JCUA 1V57A 1K0MA 5CREA 3GX0A 4BVXA 1M2DA 4G10A 5J41A 1EV4A 3DKSA 4RI7A 3QAGA 3KEBA 4LA1A 2NVLA 3TKQA 2X8GA 2OE3A 4XS6A 2B5XA 3EE2A 1GSEA 4YH2A 5ELAA 2LRCA 4ECIA 3IE3A 5J5NA 5ECPB 3TKRA 4I97A 3DMLA 1K0AA 1GNWA 4YAVA 1FB6A 3M8NA 2C80A 3OR5A 2IWTA 3FR3A 5FWGA 2VO4A 2E7PA 4EO3A 2JADA 1KBNA 4O92A 3ZZXA 3VI7A 3FZ4A 1PL2A 4FIWA 2JZTA 4POBA 4I5QA 3TRQA 5IOWA 2X8HA 3J7Yk 1PRXA 1YDKA 2FLSA 1K3YA 2H19A 1XWCA 2H72A 2E0QA 1TXXA 2NDOA 3ZITA 1EEMA 3ME7A 2IFQA 5AISA 3GMFA 3VWWA 2EIOA 1G7OA 4Q5QA 1K3LA 3F63A 1TI1A 2I4AA 3EINA 2L6CA 2QKEA 1K0BA 2WGRA 4RI6A 5HFGA 4TR1B 4MH3A 3ZMKA 1YEPA 2DMMA 6GSTA 3C7MA 1Z7RA 1A0FA 2I9HA 3HDCA 1F37A 2BMXA 3PR8A 1YJ6A 5FT3A 1JHBA 2GSTA 4ZB9A 3Q74A 1B4QA 4PNFA 2XBQA 5J9CA 2DJ1A 2ON5A 1S3AA 3P7XA 1WIKA 3KCMA 1GSFA 2XC2A 4V2MA 5JCGA 5IPGA 2OE1A 4IVFA 1BYEA 4ECJA 2LS5A 5JWRB 2LJAA 2IJYA 5JWOB 2VLTA 2YWNA 2REMA 2C0FA 4DSSA 1M7TA 3K8NA 5B6NA 1OC3A 1OC9A 2LSTA 2JSYA 3RPNA 5ID2A 4IW9A 1XWGA 1T1VA 2B1LA 3VWUA 1AW9A 1Z6MA 1Z9HA 1AXDA 4GCIA 2GLRA 3ZIJA 1EOHA 3LWAA 1TK8B 4N10A 1DUGA 3KXOA 3O3TA 4E8HA 5KN0A 5ID2B 3N5OA 1NSWA 3APQA 5H5RA 1BAYA 3RHCA 1E2YA 2YANA 1W4VA 2JL4A 1GTIA 4ML6A 4V1Ap 1XW5A 1ERTA 2WCIA 5ECNB 2V6KA 1TU8A 2CVBA 4TRXA 2VD0A 3L0HA 3VWXA 4F0BA 2IMIA 5INYA 1SKWB 1T00A 3CSIA 2EIRA 2ZCTA 1Z6NA 3DD3A 3V1WA 1U3AA 4K7IA 1DSBA 2QSIA 3GTUB 1G6WA 4CW9A 3BD2A 3A3TA 1J0FA 4TR3A 3GL3A 4WR4A 2H6ZA 4EDYA 4NV5A 2O87A 3PH9A 4L5OA 5DJLA 1ILOA 1OAZA 5IIZA 1QFNA 1TI3A 2PUKC 5IMVA 3GNJA 3CRTA 1EGRA 1O6JA 4EUYA 2H01A 3W8SA 4K9ZA 1TW9A 4Q5FA 2YCDA 3G7JA 4J56E 4ULXA 5B7CA 5KEJA 2F51A 2VL2A 4J2FA 2K8SA 3CBUA 5IM9A 3ZFLA 2FA8A 4PQHA 1R5AA 3VI5A 3ZFBA 4XTSA 3ZREA 3QMXA 3BCIA 2L4CA 1KNGA 1K0NA 2WFCA 4XRDA 3FR6A 1R4WA 3IC4A 1V98A 5DVBA 1ZCPA 1U3IA 2FA4A 1SK2A 3US3A 2YV9A 1QUWA 3VLNA 2QC7A 4HQZA 1QQ2A 3N9JA 4WF4A 4JR6A 5A4UA 4RQRA 2BJXA 1GSSA 3KIJA 4YQVA 5CRDA 4EE0A 3TKPA 1Z7PA 3MAKA 3FY7A 1NHYA 1B48A 1OC8A 1Z3EA 5E4WA 1YEXA 1XFLA 2RUEA 2GQKA 3QDNA 2L5LA 2L59A 3CXGA 3TRXA 1A2MA 4WR5A 5DQYA 3APOA 4RUVA 2IMFA 2OBIA 2WB9A 3GL5A 1X9MB 4POKA 4HZ4A 1ACVA 1PGTA 3TOTA 1AIUA 4MJBA 2GT6A 5FHIA 22GSA 5EY6A 1C72A 5KN3A 4K8MA 4AJ8A 2PERA 1JZRA 2G2QA 2PGTA 3MSZA 2M80A 4IP6A 3RAZA 5GAPD 3M9JA 2WULA 1YY7A 3C71A 5ECLB 3C1SA 5G31A 1K0CA 4PQ1A 4F82A 1GSDA 1A8LA 4KNDA 5DAKA 3D21A 3TRPA 2VCXA 2X8CA 2KP1A 4PUFC 2HRFA 1BJXA 4GTUA 4L5LA 2IPAA 2LNSA 5COHA 3UVTA 1BX9A 5D9WA 1SJZA 5IOXA 2YJ7A 1F2EA 4KA0A 4X43A 3QD9A 1GP1A 1THXA 4K7OA 2VLVA 2FWFA 2JZRA 1W89A 2WZ9A 4N0VA 5IMFA 2X64A 1H4OA 2MMZA 4IJ3A 14GSA 1S3CA 1KTEA 3ERGA 4EVMA 4HUAA 5HFIA 1KEBA 1XOBA 3J7Yb 2GTUA 2KUCA 1YF0A 4D73B 1TK0B 4OO5A 3ZLPA 2TIRA 2VCWA 5HR3A 1M2BA 4GRFA 1IYHA 3P2AA 3UAPA 2A2SA 2VUPA 2B7JA 4MPGA 4EF0A 2H66A 4I2TA 1RK4A 2H30A 4AJ6A 3GN3A 3GFKA 5DALB 3ED3A 5ECKB 1XBSA 2IN3A 1PSQA 4KDYA 2AV4A 4JRRA 4HZ2A 2DJKA 1V40A 3CYNA 1SYXA 2PVQA 3F6DA 1GL8A 5IMCA 4HEA2 5CP1A 1O81A 4MP4A 2R6KA 1O8WA 5IMDA 1ERUA 2F3MA 3QCPA 4GF0A 4NHWA 4PQIA 4LL1B 3HD5A 1Y6EA 1ZGNA 3L4NA 4POMA 4N30A 3KGKA 3IAS2 2YZUA 4L8EA 1TRSA 4ECCA 2HFDA 3E3EA 1GTBA 1IYIA 5ELGA 4O32A 4ZL8A 5C04A 3TKSA 1GTAA 1DBYA 2H1GA 2H6YA 4MZCA 4OFMA 2KHPA 3DWVA 2GGTA 3E0UA 4ZBAA 1MD4A 3H8QA 2HNLA 1TTZA 2GQMA 2VCTA 1PD21 4KCEA 2FY6A 3QAVA 2YZHA 1SK1A 1K0DA 1XZOA 2TRCP 5ECOB 2CZ2A 4PNGA 1USBA 5B6MA 3PGTA 2DC5A 5LD0A 3FRCA 3TJGA 2KP2A 1MTCA 1U88A 1V2AA 1N2AA 3L9UA 3HVXA 2MMOA 4OO4A 2N5AA 2H70A 4ISDA 2HSYA 3I9V2 4KB3A 3EVIA 4EL1A 3HHVA 5LNKe
chains in the Genus database with same CATH superfamily
3TJJA 1OVNA 1TRUA 1O8XA 2HI7A 4MJCA 20GSA 3LSZA 3D4MA 4K0GA 5AN1A 4PXOA 3RHBA 4TR1A 4AGSA 1GUMA 3TJBA 2RM5A 4HU7A 4PURA 1SK0A 2FGXA 4YQUA 2CX4A 2J23A 3C8EA 13GSA 3ZL5A 1YKAA 4FYBA 1LBKA 2VL9A 2CX3A 2H1DA 1CQHA 3HJMA 1TRVA 4MNNA 2IIYA 11GSA 1AQWA 3IDVA 4QQ7A 2LRNA 3IXRA 3FEUA 1MD3A 4KDUA 4QL7A 3UBKA 3M9KA 1GLPA 1TK5B 3IC8A 4G0IA 4DVCA 3WT1A 2R5GA 2H1BA 1GUKA 2YP6A 2O85A 5EPFA 4EDZA 5ECRB 3CSJA 2IMKA 4XS4B 2YJHA 5H5SA 2CZ3A 1XVWA 4MCUA 3GKMA 5CYYA 4IS0A 1WP0A 3F3RA 2PWJA 3UVHA 2N5FA 1H75A 3FZ9A 4HSCX 3Q18A 1YQ1A 3I69A 4IELA 3UEMA 4I8BA 2ALBA 1EP7A 2RLIA 3LG6A 4HOJA 4K7NA 4PUAA 1U87A 2CAIA 1XCCA 2HYXA 1PKWA 1Y25A 5G1KA 4F9ZA 3MDKA 1ML6A 2YOIA 5ECMB 2OKAA 2R37A 2VCVA 1QXHA 3UARA 2CAQA 3P8WA 5HFKA 1MDIA 3WYWA 1PX6A 3GSSA 1VGLA 1V9WA 1A8YA 4IHUA 2XBIA 3KM6A 4NPBA 3BJ5A 4G2EA 1OE7A 4MLYA 4E8EA 3GH6A 7GSSA 2HE3A 3GTUA 2KOKA 3EWLA 4DSRA 2LUSA 4IGJA 5BMUA 3UL3A 1UA5A 1YF1A 3ERFA 3FKFA 1N8JA 3KP9A 4N11A 4LMVA 2JSZA 4I2UA 4TR0A 5IPHA 5ECIB 1VF2A 3HYPA 2E2GA 1AAZA 2N5BA 1NW2A 2K6VA 2OE0A 1SYRA 3NZNA 4K1FA 3GKKA 1G0TA 3GX8A 3WGEA 4ACSA 6GSWA 1AUCA 4MZBA 4MF7A 1WPIA 1O85A 1AQVA 2HZEB 6GSSA 5CNWA 1QK8A 3F8UA 4GWRA 1B9YC 4JR4A 5EL8A 2P5RA 2DJ3A 3GKXA 1A2JA 1I9DA 3IRAA 3HY2A 1HNBA 4YQMA 2VCQA 1TKDB 4F0CA 2RUFA 2Z9SA 1T4ZA 3ZVJD 1PX7A 3QFAC 3F3QA 5H5QA 1HNAA 3BBYA 3M0FA 3ME8A 1GUHA 2R4VA 3LYKA 4MMMA 4ZBDA 5G30A 1TRWA 4OCFA 4XS1A 1WRYA 3LORA 1DE1A 5AIVA 4XIHA 1X0RA 2C3QA 4L0WA 1HYUA 5CRGA 1F3BA 1QGVA 1TJDA 3EU3A 2H8LA 5LCZA 2DMLA 3O6TA 3G7YA 5HR2A 3EU4A 2C0GA 1GRXA 9GSSA 3DIEA 3O76A 3CQFA 4WETA 2FUG2 5A5KA 3MIXA 4ZXGA 4HJMA 2OACA 2CV4A 6GSVA 3FK8A 1PKZA 3WGDA 1SENA 3D22A 2VM1A 5DJMA 2G0FA 3WT2A 4NWYA 5D8IA 4Z2TA 3HVVA 2LV3A 1G7EA 2FWEA 3EYTA 5GZZB 3QPMA 3LXZA 4ZB6A 2LNTA 5G1LA 3H79A 1PN9A 3BOAA 2LRTA 1ERWA 4IQ1A 1MDJA 3VPTA 1XWBA 3FZAA 2WS2A 3IBHA 2O8VB 4IN0A 1JZOA 2V2GA 2F8AA 1M3IA 2MYGA 5IO2A 1GNEA 1MDKA 2O7KA 3FHKA 1XOAA 4DSQA 4LLRA 4QL9A 4OD7A 1T7PB 2YPMA 1G6YA 4GSNA 3NIVA 1GSQA 2CQ9A 4NHZA 1EZKA 4BL7B 4FYCA 2FWGA 1TP9A 1XW6A 3DRNA 3VPQA 2PN8A 1R26A 5KN1A 4Q5NA 1LJRA 1GULA 1QMVA 4JBBA 4IJIA 2DSAA 5DCGA 3UOMA 1WWJA 2CVKA 1ZL9A 1XXUA 2GSSA 3H93A 1ZYQB 5G2ZA 2C3NA 3DVWA 1NHOA 3A2XA 2HRNA 4JEDA 3HVNA 3A2VA 1X9WB 2WJUA 3ERWA 4PX1A 2VM2A 4KDXA 4NV2A 4F03A 3UBLA 3DXBA 4F2IA 1XG8A 2OADA 2M46A 1EGOA 4KCAA 4KSMA 4WKWA 3TDGA 4ZL9A 4EC0A 1PL1A 3GKNA 4MJEA 2X99A 3MNGA 2IMDA 3L9VA 2E2MA 2L6DA 4D73A 2HSHA 2LQQA 4I6XA 1PN0A 1HD2A 2V1MA 1WMJA 3HZ4A 4ECBA 3WD6A 3RDWA 1OYJA 1UN2A 4KAEA 1JLWA 3TB2A 2ES7A 2OJLA 5DALA 2M72A 1WJKA 1F6MC 3KJYA 2NPBA 4P3YB 2H71A 4PGTA 4K2XA 2C1YA 3P90A 3DGQA 1JLVA 2LJRA 17GSA 5F06A 3HJPA 1R5PA 2XPDA 3EMXA 1SL0B 4FO5A 4K6XA 3GURA 3ZYWA 1EWXA 4RQXA 1K0OA 4FH8A 4TXOB 2DJ0A 2L57A 2CT6A 2C4JA 2F8FA 3TGZA 4JZQA 5F0GA 5IQYA 4TKYA 2OA7A 1DE2A 1XPVA 3R3EA 3CMIA 4OCEA 5CO3A 1M9BA 4KE3A 4DEJA 1V58A 3ISOA 2AHEA 2YWIA 2B5EA 1BG5A 3Q19A 1ON4A 5JCWA 5AGYA 2H0HA 10GSA 1ZOFA 1A24A 3RPPA 3KP8A 2B5YA 2AUVA 1ZYEA 4V1Ag 1X5CA 2X4AA 5DCHA 2RIIA 1FVKA 2DKHA 2XHFA 2K18A 2YWOA 2PVOC 5EVOA 5J9BA 1E6BA 3LEFA 2FCHA 1THOA 1XIYA 3D5JA 16GSA 2DJJA 1SD8A 3HKRA 4BA7A 1M0UA 2R0PA 3E9JB 5J4UA 1K3OA 3QFBC 1URMA 4OFNA 1ZZYA 6GSXA 2FWHA 2HXKA 3A2WA 4BVXB 4BVYA 4O7HA 3HVSA 4HU9A 2AAWA 3VFIA 12GSA 2GT5A 2LTKA 2ZNMA 1SD9A 4GQCA 2NTOA 2AYTA 4NAXA 1MEKA 2P31A 4KSOA 5ECHB 3KTBA 2VLUA 4Z2UA 2NBSA 4AF2A 1FO5A 1PA3A 1A23A 4KUNA 5CRWA 4G19A 4X4JA 5E59A 2YWMA 5HQPA 2C0EA 1RQMA 3FYGA 4LL4B 4G0LA 3TKSE 1A0RP 3IAM2 2H75A 2VAFA 3S9FA 2VL3A 3DEXA 1ERVA 1FW1A 1GWCA 4MF6A 3EURA 4GSSA 1O7UA 3VURA 1EOGA 4TOPA 4V2LA 1Q98A 2YNXA 5G5FA 4KH7A 4XS4A 3LFLA 3GIXA 18GSA 1WE0A 2IFQB 4WBJA 3SWLA 2JU5A 3IPZA 5GSSA 1FVJA 3GHAA 1O73A 3CSHA 1AQXA 2C0DA 4EIQA 4H86A 1JZWA 3TKSC 3QR6A 3H1NA 5IMAA 4YAPA 5D9XA 2GZYA 3IHQA 2MMNA 2HSMA 3TJKA 1SKSB 5CAXA 1T3BA 5J3RA 1XWAA 3FR9A 1T4YA 4WF5A 2P0GA 4X0XA 3CRUA 5HR0A 3C73A 5DDLA 1F3AA 3W6GA 5ECSA 2GDRA 3TOUA 4BPYA 1A2LA 2DIYA 2CVDA 4MF5A 5A4WA 2MBSA 3FW2A 3HZ8A 4KW6A 5G5EA 2IMEA 4O5RA 5KN2A 4V2NA 6GSYA 1J08A 4XCSA 2VD1A 4ZB8A 4GXZA 1PMTA 4IBPA 1FOVA 1VF1A 2FHEA 2L5OA 1J9BA 4DSSB 2C8UA 1R7HA 4GQFA 1EV9A 2H0GA 4MJAA 5F05A 3KH7A 4Q5RA 4A5PA 4JU5A 2DJ2A 1ZYNA 4MDCA 3M1GA 2H1AA 1OC9B 1SJIA 2GZZA 3R2QA 5AIXA 4TW5A 3Q6OA 3ZRDA 4CDOA 1RW1A 3GSTA 2KLXA 2VOCA 3F4SA 3U6VA 1FAAA 2LKUA 5GAND 1OKTA 2MMAA 1FG4A 3VK9A 2TRXA 5D73A 3MWHA 1ST9A 2J9HA 2HZEA 4OMVA 1XVQA 4J57E 2CA8A 1SJ6A 3EMPA 4MK3A 3IK9A 4KF9A 2O89A 4WXTA 4O5UA 2I1UA 2XPEA 2H0IA 3GRXA 3SBCA 4G9HA 1X5EA 2I81A 5HR1A 4HJ2A 5D9VA 4ILFA 2VCZA 3PINA 4HS1A 3UMAA 4AJ7A 1EEJA 4ML1A 4O5QA 3KMOA 3A5WA 2AJQB 3KMNA 3DVXA 4L0UA 3F6FA 5D96A 1ABAA 3CTGA 2X49A 3WGXA 2LEGA 2ZUPA 4TXVA 1BEDA 1T8EB 1SKRB 3IV4A 1TDIA 3JCML 1TU7A 3W8JA 3LGCA 3GV1A 2WDUA 3IOSA 5F8BA 2DIZA 1UC7A 4MZWA 1HQOA 2A4VA 2K8VA 1S3DA 4WEYA 1JZDA 3I43A 1YZXA 1M2AA 3KH9A 2R3XA 4KX4A 3FZ5A 2C3TA 4K0NA 4MPFA 5ENUA 1M9AA 5D93A 1JFUA 3UJ1A 2YV7A 3RBTA 1NM3A 2FD3A 1YKCA 5IO0A 3CTFA 4GLTA 4MA9A 2K9FA 4ZL7A 3ZMLA 1GLQA 2RM6A 4ZBBA 2B1KA 1XW9A 4NMUA 2GSRA 1F9MA 5KOXA 2MZCA 2OBKA 3TJFA 3KD0A 2GVPA 5F07A 3L9SA 1B8XA 1I5GA 3GYKA 4JE1A 1OE8A 2JZSA 2JACA 2P5QA 1ZMAA 5CRHA 1SU9A 3APSA 4BL7A 5ECQB 4BWSA 1LU4A 2HLSA 1OKDA 1FHEA 2MBTA 6GSUA 1HNCA 2H76A 5B8BA 1Q4JA 3D0ZA 2B3SA 5KOWA 19GSA 3IK7A 5B8AA 2BTOT 1M99A 5GSTA 1PQNA 1FB0A 3IA1A 3TUEA 2YN1A 1Z5YE 4MABA 4IKHA 3UIWA 2L4QA 2V6OA 5A4VA 3D4TA 4EKZA 3ZIVA 2VL2C 3AY8A 4EIPA 3A5IA 3BCKA 3D6IA 4HQSA 5IMZA 2GZPA 2B7KA 2DLXA 3GA4A 1GH2A 4BIKA 3F0IA 1XWKA 3DYRA 2LQOA 3HA9A 3C1RA 3KTLA 4OFTA 2A2RA 3IR4A 3IHGA 3H4KA 3HXSA 3ZTLA 5DAKB 2H74A 4EXJA 4POLA 2V32A 3U5RE 2QA2A 2GSQA 1GSYA 5D9TA 2PBJA 4Z7XA 2VIMA 4PTSA 1VF4A 5ABRA 1U6TA 2F9SA 5C00A 2HT9A 3LJRA 4IQAA 2DKIA 3GUSA 3LYPA 4WBRD 3VWVA 3L78A 4KGIA 3ZVJA 3HJOA 2GQLA 3EC3A 2QGVA 1B9XC 1VF3A 4XRAA 4HI7A 2H73A 2EIQA 4LMWA 2DBCA 3QOUA 2PU9C 1UVZA 2R2JA 3G7IA 3NOFA 4TXOA 1B4PA 4FYUA 4NXIA 1EP8A 2PPTA 2EC4A 3TCOA 5DQSA 5DBQA 4XHMA 1BQ7A 4Z2RA 2FNOA 2I3YA 2HZFA 1CQGA 2HRAA 4TR4A 1SL2B 2GS3A 5L71A 1SL1B 3F9UA 4X1UA 3M3MA 3GH9A 4GSTA 1X5DA 1X9SB 4OWYA 1GTUA 4TN8A 4ID0A 3LXTA 1WOUA 2ON7A 2A4HA 1AC1A 2LJKA 3KZQA 4TVEA 1TOFA 2AB6A 3F4RA 2V41A 2B6MA 2IL3A 2H6XA 2WRTA 5JWQB 4K2DA 3QAWA 2D2ZA 2PMTA 1GSUA 3F4TA 3HCZA 1VRSD 4MH2A 4ZILA 4HDEA 4IP1A 3LQ7A 3I6AA 3MYDA 4N0ZA 3G9BA 4ZIJA 4CHSA 8GSSA 2R0GA 4BWQA 5JCUA 1V57A 1K0MA 5CREA 3GX0A 4BVXA 1M2DA 4G10A 5J41A 1EV4A 3DKSA 4RI7A 3QAGA 4YKGA 3KEBA 4LA1A 2NVLA 4CY6A 3TKQA 2X8GA 2OE3A 4XS6A 2B5XA 3EE2A 1GSEA 4YH2A 5ELAA 2LRCA 4ECIA 3IE3A 5J5NA 5ECPB 3TKRA 4I97A 3DMLA 1K0AA 1GNWA 4YAVA 1FB6A 3M8NA 2C80A 3OR5A 2IWTA 3FR3A 5FWGA 2VO4A 2E7PA 4EO3A 2JADA 1KBNA 4O92A 3ZZXA 3EPTA 3VI7A 3FZ4A 1PL2A 4FIWA 2JZTA 4POBA 4I5QA 3TRQA 5IOWA 2X8HA 3J7Yk 1PRXA 1YDKA 2FLSA 1K3YA 2H19A 1XWCA 2H72A 2E0QA 1TXXA 2NDOA 3ZITA 1EEMA 3ME7A 2IFQA 5AISA 3GMFA 3VWWA 2EIOA 1G7OA 4Q5QA 1K3LA 3F63A 1TI1A 2I4AA 3EINA 2L6CA 2QKEA 1K0BA 2WGRA 4ICYA 4RI6A 5HFGA 4TR1B 4MH3A 3ZMKA 1YEPA 2DMMA 6GSTA 3C7MA 1Z7RA 1A0FA 2I9HA 3HDCA 1F37A 2BMXA 3PR8A 4YKFA 1YJ6A 5FT3A 1JHBA 2GSTA 2UZ8A 4ZB9A 3Q74A 1B4QA 4PNFA 2XBQA 5J9CA 2DJ1A 2ON5A 1S3AA 3P7XA 1WIKA 3KCMA 1GSFA 2XC2A 4V2MA 5JCGA 5IPGA 2OE1A 4IVFA 1BYEA 4ECJA 2LS5A 5JWRB 2LJAA 2IJYA 5JWOB 2VLTA 2YWNA 2REMA 2C0FA 4DSSA 1M7TA 2A2PA 3K8NA 5B6NA 1OC3A 1OC9A 2LSTA 2JSYA 3RPNA 5ID2A 4IW9A 1XWGA 1T1VA 2B1LA 3VWUA 1AW9A 1Z6MA 1Z9HA 1AXDA 4GCIA 2GLRA 3ZIJA 1EOHA 3LWAA 1TK8B 4N10A 1DUGA 3KXOA 3O3TA 4E8HA 5KN0A 5ID2B 3N5OA 1NSWA 3APQA 5H5RA 1BAYA 3RHCA 1E2YA 2YANA 1W4VA 2JL4A 1GTIA 4ML6A 4V1Ap 5BRTA 1XW5A 1ERTA 2WCIA 5ECNB 2V6KA 1TU8A 2CVBA 4TRXA 2VD0A 1ZYPA 3L0HA 3VWXA 4F0BA 2IMIA 5INYA 1SKWB 1T00A 3CSIA 2EIRA 2ZCTA 1Z6NA 3DD3A 3V1WA 1U3AA 4K7IA 1DSBA 2QSIA 3GTUB 1G6WA 4CW9A 3BD2A 3A3TA 1J0FA 4TR3A 3GL3A 4FQUA 4WR4A 2H6ZA 4EDYA 4NV5A 2O87A 3PH9A 4L5OA 1M3JA 5DJLA 1ILOA 1OAZA 5IIZA 1QFNA 1TI3A 2PUKC 5IMVA 3GNJA 3CRTA 1EGRA 1O6JA 4EUYA 2H01A 3W8SA 4K9ZA 1TW9A 4Q5FA 2YCDA 3G7JA 4J56E 4ULXA 5B7CA 5KEJA 2F51A 2VL2A 4J2FA 2K8SA 3CBUA 5IM9A 3ZFLA 2FA8A 4PQHA 1R5AA 3VI5A 3ZFBA 4XTSA 3ZREA 3QMXA 3BCIA 2L4CA 1KNGA 1K0NA 2WFCA 4XRDA 3FR6A 1R4WA 3IC4A 1V98A 5DVBA 1ZCPA 1U3IA 2FA4A 1SK2A 3US3A 2YV9A 1QUWA 3VLNA 2QC7A 4HQZA 1QQ2A 3N9JA 4WF4A 4JR6A 5A4UA 4RQRA 2BJXA 1GSSA 3KIJA 4YQVA 5CRDA 4EE0A 3TKPA 1Z7PA 3MAKA 3FY7A 1NHYA 1B48A 1OC8A 1Z3EA 4USSA 5E4WA 2QA1A 1YEXA 1XFLA 2RUEA 2GQKA 3QDNA 2L5LA 2L59A 3CXGA 3TRXA 1A2MA 4WR5A 5DQYA 3APOA 4RUVA 2IMFA 2OBIA 2WB9A 3GL5A 1X9MB 4POKA 4HZ4A 1ACVA 1PGTA 3TOTA 1AIUA 4MJBA 2GT6A 5FHIA 22GSA 5EY6A 1C72A 5KN3A 4K8MA 4AJ8A 2PERA 4CY8A 1JZRA 2G2QA 2PGTA 3MSZA 2M80A 4IP6A 3RAZA 5GAPD 3M9JA 2WULA 1YY7A 3C71A 5ECLB 3C1SA 5G31A 1K0CA 4PQ1A 4F82A 1GSDA 1A8LA 4KNDA 5DAKA 3D21A 3TRPA 4K5RA 2VCXA 2X8CA 2KP1A 4PUFC 2HRFA 1BJXA 4GTUA 4L5LA 3PPUA 2IPAA 2LNSA 5COHA 3UVTA 1BX9A 5D9WA 1SJZA 5IOXA 2YJ7A 1F2EA 4KA0A 4X43A 3QD9A 1GP1A 1THXA 4K7OA 2VLVA 2FWFA 2JZRA 1W89A 2WZ9A 4N0VA 3FMWA 5IMFA 2X64A 1H4OA 2MMZA 4IJ3A 14GSA 1S3CA 1KTEA 3ERGA 4EVMA 4HUAA 5HFIA 1KEBA 1XOBA 3J7Yb 2GTUA 2KUCA 2R0CA 1YF0A 4D73B 1TK0B 4OO5A 3ZLPA 2TIRA 2VCWA 2HRKA 5HR3A 1M2BA 4GRFA 1IYHA 3P2AA 3UAPA 2A2SA 4K5SA 1PFOA 2VUPA 2B7JA 4MPGA 4EF0A 2H66A 4I2TA 1RK4A 2H30A 4AJ6A 3GN3A 3GFKA 5DALB 3ED3A 5ECKB 1XBSA 2IN3A 1PSQA 4KDYA 2AV4A 4JRRA 4HZ2A 2DJKA 1V40A 3CYNA 1SYXA 2PVQA 3F6DA 1GL8A 5IMCA 4HEA2 5CP1A 1O81A 4MP4A 2R6KA 1O8WA 5IMDA 1ERUA 2F3MA 3QCPA 4GF0A 4NHWA 4PQIA 4LL1B 3HD5A 1Y6EA 1ZGNA 3L4NA 4POMA 4N30A 3LW9A 3KGKA 3IAS2 2YZUA 4L8EA 1TRSA 4ECCA 2HFDA 3E3EA 1GTBA 1S3RA 1IYIA 5ELGA 4O32A 4ZL8A 5C04A 3TKSA 1GTAA 1DBYA 2H1GA 2H6YA 4MZCA 4OFMA 2KHPA 3DWVA 2GGTA 3E0UA 4ZBAA 1MD4A 3H8QA 2HNLA 1TTZA 2GQMA 1FOHA 2VCTA 1PD21 4KCEA 2FY6A 3QAVA 2YZHA 1SK1A 1K0DA 1XZOA 2TRCP 5ECOB 2CZ2A 4PNGA 4G0KA 1USBA 5B6MA 3PGTA 2DC5A 5LD0A 3FRCA 3TJGA 2KP2A 1MTCA 1U88A 1V2AA 1N2AA 3L9UA 3HVXA 2MMOA 4OO4A 2N5AA 2H70A 4BVYB 4ISDA 2HSYA 3I9V2 4KB3A 3EVIA 4EL1A 3HHVA 5LNKe
chains in the Genus database with same CATH topology
3TJJA 1OVNA 1TRUA 1O8XA 2HI7A 4MJCA 20GSA 3LSZA 3D4MA 4K0GA 5AN1A 4PXOA 3RHBA 4TR1A 4AGSA 1GUMA 3TJBA 2RM5A 4HU7A 4PURA 1SK0A 2FGXA 4YQUA 2CX4A 2J23A 3C8EA 13GSA 3ZL5A 1YKAA 4FYBA 1LBKA 2VL9A 2CX3A 2H1DA 1CQHA 3HJMA 1TRVA 4MNNA 2IIYA 11GSA 1AQWA 3IDVA 4QQ7A 2LRNA 3IXRA 3FEUA 1MD3A 4KDUA 4QL7A 3UBKA 3M9KA 1GLPA 1TK5B 3IC8A 4G0IA 4DVCA 3WT1A 2R5GA 2H1BA 1GUKA 2YP6A 2O85A 5EPFA 4EDZA 5ECRB 3CSJA 2IMKA 4XS4B 2YJHA 5H5SA 2CZ3A 1XVWA 4MCUA 3GKMA 5CYYA 4IS0A 1WP0A 3F3RA 2PWJA 3UVHA 2N5FA 1H75A 3FZ9A 3Q18A 1YQ1A 3I69A 4IELA 3UEMA 4I8BA 2ALBA 1EP7A 2RLIA 3LG6A 4HOJA 4K7NA 4PUAA 1U87A 2CAIA 1XCCA 2HYXA 1PKWA 1Y25A 5G1KA 4F9ZA 3MDKA 1ML6A 2YOIA 5ECMB 2OKAA 2R37A 2VCVA 1QXHA 3UARA 2CAQA 3P8WA 5HFKA 1MDIA 3WYWA 1PX6A 3GSSA 1VGLA 1V9WA 1A8YA 4IHUA 2XBIA 3KM6A 4NPBA 3BJ5A 4G2EA 1OE7A 4MLYA 4E8EA 3GH6A 7GSSA 2HE3A 3GTUA 2KOKA 3EWLA 4DSRA 2LUSA 4IGJA 5BMUA 3UL3A 1UA5A 1YF1A 3ERFA 3FKFA 1N8JA 3KP9A 4N11A 4LMVA 2JSZA 4I2UA 4TR0A 5IPHA 5ECIB 1VF2A 3HYPA 2E2GA 1AAZA 2N5BA 1NW2A 2K6VA 2OE0A 1SYRA 3NZNA 4K1FA 3GKKA 1G0TA 3GX8A 3WGEA 4ACSA 6GSWA 1AUCA 4MZBA 4MF7A 1WPIA 1O85A 1AQVA 2HZEB 6GSSA 5CNWA 1QK8A 3F8UA 4GWRA 1B9YC 4JR4A 5EL8A 2P5RA 2DJ3A 3GKXA 1A2JA 1I9DA 3IRAA 3HY2A 1HNBA 4YQMA 2VCQA 1TKDB 4F0CA 2RUFA 2Z9SA 1T4ZA 3ZVJD 1PX7A 3QFAC 3F3QA 5H5QA 1HNAA 3BBYA 3M0FA 3ME8A 1GUHA 2R4VA 3LYKA 4MMMA 4ZBDA 5G30A 1TRWA 4OCFA 4XS1A 1WRYA 3LORA 1DE1A 5AIVA 4XIHA 1X0RA 2C3QA 4L0WA 1HYUA 5CRGA 1F3BA 1QGVA 1TJDA 3EU3A 2H8LA 5LCZA 2DMLA 3O6TA 3G7YA 5HR2A 3EU4A 2C0GA 1GRXA 9GSSA 3DIEA 3O76A 4WETA 2FUG2 5A5KA 3MIXA 4ZXGA 4HJMA 2OACA 2CV4A 6GSVA 3FK8A 1PKZA 3WGDA 1SENA 3D22A 2VM1A 5DJMA 2G0FA 3WT2A 4NWYA 5D8IA 4Z2TA 3HVVA 2LV3A 1G7EA 2FWEA 3EYTA 5GZZB 3QPMA 3LXZA 4ZB6A 2LNTA 5G1LA 3H79A 1PN9A 3BOAA 2LRTA 1ERWA 4IQ1A 1MDJA 3VPTA 1XWBA 3FZAA 2WS2A 3IBHA 2O8VB 1JZOA 2V2GA 4IN0A 2F8AA 2MYGA 5IO2A 1GNEA 1MDKA 2O7KA 3FHKA 1XOAA 4DSQA 4LLRA 4QL9A 4OD7A 1T7PB 2YPMA 1G6YA 4GSNA 3NIVA 1GSQA 2CQ9A 4NHZA 1EZKA 4BL7B 4FYCA 2FWGA 1TP9A 1XW6A 3DRNA 3VPQA 2PN8A 1R26A 5KN1A 4Q5NA 1LJRA 1GULA 1QMVA 4JBBA 4IJIA 2DSAA 5DCGA 3UOMA 1WWJA 2CVKA 1ZL9A 1XXUA 2GSSA 3H93A 1ZYQB 5G2ZA 2C3NA 3DVWA 1NHOA 3A2XA 2HRNA 4JEDA 3A2VA 1X9WB 2WJUA 3ERWA 4PX1A 2VM2A 4KDXA 4NV2A 4F03A 3UBLA 3DXBA 4F2IA 2OADA 2M46A 1EGOA 4KCAA 4KSMA 4WKWA 3TDGA 4ZL9A 4EC0A 1PL1A 3GKNA 4MJEA 2X99A 3MNGA 2IMDA 3L9VA 2E2MA 2L6DA 4D73A 2HSHA 2LQQA 4I6XA 1PN0A 1HD2A 2V1MA 1WMJA 3HZ4A 4ECBA 3WD6A 3RDWA 1OYJA 1UN2A 4KAEA 1JLWA 3TB2A 2ES7A 2OJLA 5DALA 2M72A 1WJKA 1F6MC 3KJYA 2NPBA 4P3YB 2H71A 4PGTA 4K2XA 2C1YA 3P90A 3DGQA 1JLVA 2LJRA 17GSA 5F06A 3HJPA 1R5PA 2XPDA 3EMXA 1SL0B 4FO5A 4K6XA 3GURA 3ZYWA 1EWXA 4RQXA 1K0OA 4FH8A 4TXOB 2DJ0A 2L57A 2CT6A 2C4JA 2F8FA 3TGZA 4JZQA 5F0GA 5IQYA 4TKYA 2OA7A 1DE2A 1XPVA 3R3EA 3CMIA 4OCEA 5CO3A 1M9BA 4KE3A 4DEJA 1V58A 3ISOA 2AHEA 2YWIA 2B5EA 1BG5A 3Q19A 1ON4A 5JCWA 5AGYA 2H0HA 10GSA 1ZOFA 1A24A 3RPPA 3KP8A 2B5YA 2AUVA 1ZYEA 4V1Ag 1X5CA 2X4AA 5DCHA 2RIIA 1FVKA 2DKHA 2XHFA 2K18A 2YWOA 2PVOC 5EVOA 5J9BA 1E6BA 3LEFA 2FCHA 1THOA 1XIYA 3D5JA 16GSA 2DJJA 1SD8A 3HKRA 4BA7A 1M0UA 2R0PA 3E9JB 5J4UA 1K3OA 3QFBC 1URMA 4OFNA 1ZZYA 6GSXA 2FWHA 2HXKA 3A2WA 4BVXB 4BVYA 4O7HA 3HVSA 4HU9A 2AAWA 3VFIA 12GSA 2GT5A 2LTKA 2ZNMA 1SD9A 4GQCA 2NTOA 2AYTA 4NAXA 1MEKA 2P31A 4KSOA 5ECHB 3KTBA 2VLUA 4Z2UA 2NBSA 4AF2A 1FO5A 1PA3A 1A23A 4KUNA 5CRWA 4G19A 4X4JA 5E59A 2YWMA 5HQPA 2C0EA 1RQMA 3FYGA 4LL4B 4G0LA 3TKSE 1A0RP 3IAM2 2H75A 2VAFA 3S9FA 2VL3A 3DEXA 1ERVA 1FW1A 1GWCA 4MF6A 3EURA 4GSSA 1O7UA 3VURA 1EOGA 4TOPA 4V2LA 1Q98A 2YNXA 5G5FA 4KH7A 4XS4A 3LFLA 3GIXA 18GSA 1WE0A 2IFQB 4WBJA 3SWLA 2JU5A 3IPZA 5GSSA 1FVJA 3GHAA 1O73A 3CSHA 1AQXA 2C0DA 4EIQA 4H86A 1JZWA 3TKSC 3QR6A 3H1NA 5IMAA 4YAPA 5D9XA 2GZYA 3IHQA 2MMNA 2HSMA 3TJKA 1SKSB 5CAXA 1T3BA 5J3RA 1XWAA 3FR9A 1T4YA 4WF5A 2P0GA 4X0XA 3CRUA 5HR0A 3C73A 5DDLA 1F3AA 3W6GA 5ECSA 2GDRA 3TOUA 4BPYA 1A2LA 2DIYA 2CVDA 4MF5A 5A4WA 2MBSA 3FW2A 3HZ8A 4KW6A 5G5EA 2IMEA 4O5RA 5KN2A 4V2NA 6GSYA 1J08A 4XCSA 2VD1A 4ZB8A 4GXZA 1PMTA 4IBPA 1FOVA 1VF1A 2FHEA 2L5OA 1J9BA 4DSSB 2C8UA 1R7HA 4GQFA 1EV9A 2H0GA 4MJAA 5F05A 3KH7A 4Q5RA 4A5PA 4JU5A 2DJ2A 1ZYNA 4MDCA 3M1GA 2H1AA 1OC9B 1SJIA 2GZZA 3R2QA 5AIXA 4TW5A 3Q6OA 3ZRDA 4CDOA 1RW1A 3GSTA 2KLXA 2VOCA 3F4SA 3U6VA 1FAAA 2LKUA 5GAND 1OKTA 2MMAA 1FG4A 3VK9A 2TRXA 5D73A 3MWHA 1ST9A 2J9HA 2HZEA 4OMVA 1XVQA 4J57E 2CA8A 1SJ6A 3EMPA 4MK3A 3IK9A 4KF9A 2O89A 4WXTA 4O5UA 2I1UA 2XPEA 2H0IA 3GRXA 3SBCA 4G9HA 1X5EA 2I81A 5HR1A 4HJ2A 5D9VA 4ILFA 2VCZA 3PINA 4HS1A 3UMAA 4AJ7A 1EEJA 4ML1A 4O5QA 3KMOA 3A5WA 2AJQB 3KMNA 3DVXA 4L0UA 3F6FA 5D96A 1ABAA 3CTGA 2X49A 3WGXA 2LEGA 2ZUPA 4TXVA 1BEDA 1T8EB 1SKRB 3IV4A 1TDIA 3JCML 1TU7A 3W8JA 3LGCA 3GV1A 2WDUA 3IOSA 5F8BA 2DIZA 1UC7A 4MZWA 1HQOA 2A4VA 2K8VA 1S3DA 4WEYA 1JZDA 3I43A 1YZXA 1M2AA 3KH9A 2R3XA 4KX4A 3FZ5A 2C3TA 4K0NA 4MPFA 5ENUA 1M9AA 5D93A 1JFUA 3UJ1A 2YV7A 3RBTA 1NM3A 2FD3A 1YKCA 5IO0A 3CTFA 4GLTA 4MA9A 2K9FA 4ZL7A 3ZMLA 1GLQA 2RM6A 4ZBBA 2B1KA 1XW9A 4NMUA 2GSRA 1F9MA 5KOXA 2MZCA 2OBKA 3TJFA 3KD0A 2GVPA 5F07A 3L9SA 1B8XA 1I5GA 3GYKA 4JE1A 1OE8A 2JZSA 2JACA 2P5QA 1ZMAA 5CRHA 1SU9A 3APSA 4BL7A 5ECQB 4BWSA 1LU4A 2HLSA 1OKDA 1FHEA 2MBTA 6GSUA 1HNCA 2H76A 5B8BA 1Q4JA 3D0ZA 2B3SA 5KOWA 19GSA 3IK7A 5B8AA 2BTOT 1M99A 5GSTA 1PQNA 1FB0A 3IA1A 3TUEA 2YN1A 1Z5YE 4MABA 4IKHA 3UIWA 2L4QA 2V6OA 5A4VA 3D4TA 4EKZA 3ZIVA 2VL2C 3AY8A 4EIPA 3A5IA 3BCKA 3D6IA 4HQSA 5IMZA 2GZPA 2B7KA 2DLXA 3GA4A 1GH2A 3F0IA 1XWKA 3DYRA 2LQOA 3HA9A 3C1RA 3KTLA 4OFTA 2A2RA 3IR4A 3IHGA 3H4KA 3HXSA 3ZTLA 5DAKB 2H74A 4EXJA 4POLA 2V32A 3U5RE 2QA2A 2GSQA 1GSYA 5D9TA 2PBJA 4Z7XA 2VIMA 4PTSA 1VF4A 5ABRA 1U6TA 2F9SA 5C00A 2HT9A 3LJRA 4IQAA 2DKIA 3GUSA 3LYPA 4WBRD 3VWVA 3L78A 4KGIA 3ZVJA 3HJOA 2GQLA 3EC3A 2QGVA 1B9XC 1VF3A 4XRAA 4HI7A 2H73A 2EIQA 4LMWA 2DBCA 3QOUA 2PU9C 1UVZA 2R2JA 3G7IA 3NOFA 4TXOA 1B4PA 4FYUA 4NXIA 1EP8A 2PPTA 2EC4A 3TCOA 5DQSA 5DBQA 4XHMA 1BQ7A 4Z2RA 2FNOA 2I3YA 2HZFA 1CQGA 2HRAA 4TR4A 1SL2B 2GS3A 5L71A 1SL1B 3F9UA 4X1UA 3M3MA 3GH9A 4GSTA 1X5DA 1X9SB 4OWYA 1GTUA 4TN8A 4ID0A 3LXTA 1WOUA 2ON7A 2A4HA 1AC1A 2LJKA 3KZQA 4TVEA 1TOFA 2AB6A 3F4RA 2V41A 2B6MA 2IL3A 2H6XA 2WRTA 5JWQB 4K2DA 3QAWA 2D2ZA 2PMTA 1GSUA 3F4TA 3HCZA 1VRSD 4MH2A 4ZILA 4HDEA 4IP1A 3LQ7A 3I6AA 3MYDA 4N0ZA 3G9BA 4ZIJA 4CHSA 8GSSA 2R0GA 4BWQA 5JCUA 1V57A 1K0MA 5CREA 3GX0A 4BVXA 1M2DA 4G10A 5J41A 1EV4A 3DKSA 4RI7A 3QAGA 4YKGA 3KEBA 4LA1A 2NVLA 4CY6A 3TKQA 2X8GA 2OE3A 4XS6A 2B5XA 3EE2A 1GSEA 4YH2A 5ELAA 2LRCA 4ECIA 3IE3A 5J5NA 5ECPB 3TKRA 4I97A 3DMLA 1K0AA 1GNWA 4YAVA 1FB6A 3M8NA 2C80A 3OR5A 2IWTA 3FR3A 5FWGA 2VO4A 2E7PA 4EO3A 2JADA 1KBNA 4O92A 3ZZXA 3EPTA 3VI7A 3FZ4A 1PL2A 4FIWA 2JZTA 4POBA 4I5QA 3TRQA 5IOWA 2X8HA 3J7Yk 1PRXA 1YDKA 2FLSA 1K3YA 2H19A 1XWCA 2H72A 2E0QA 1TXXA 2NDOA 3ZITA 1EEMA 3ME7A 2IFQA 5AISA 3GMFA 3VWWA 2EIOA 1G7OA 4Q5QA 1K3LA 3F63A 1TI1A 2I4AA 3EINA 2L6CA 2QKEA 1K0BA 2WGRA 4ICYA 4RI6A 5HFGA 4TR1B 4MH3A 3ZMKA 1YEPA 2DMMA 6GSTA 3C7MA 1Z7RA 1A0FA 2I9HA 3HDCA 1F37A 2BMXA 3PR8A 4YKFA 1YJ6A 5FT3A 1JHBA 2GSTA 2UZ8A 4ZB9A 3Q74A 1B4QA 4PNFA 2XBQA 5J9CA 2DJ1A 2ON5A 1S3AA 3P7XA 1WIKA 3KCMA 1GSFA 2XC2A 4V2MA 5JCGA 5IPGA 2OE1A 4IVFA 1BYEA 4ECJA 2LS5A 5JWRB 2LJAA 2IJYA 5JWOB 2VLTA 2YWNA 2REMA 2C0FA 4DSSA 1M7TA 2A2PA 3K8NA 5B6NA 1OC3A 1OC9A 2LSTA 2JSYA 3RPNA 5ID2A 4IW9A 1XWGA 1T1VA 2B1LA 3VWUA 1AW9A 1Z6MA 1Z9HA 1AXDA 4GCIA 2GLRA 3ZIJA 1EOHA 3LWAA 1TK8B 4N10A 1DUGA 3KXOA 3O3TA 4E8HA 5KN0A 5ID2B 3N5OA 1NSWA 3APQA 5H5RA 1BAYA 3RHCA 1E2YA 2YANA 1W4VA 2JL4A 1GTIA 4ML6A 4V1Ap 5BRTA 1XW5A 1ERTA 2WCIA 5ECNB 2V6KA 1TU8A 2CVBA 4TRXA 2VD0A 1ZYPA 3L0HA 3VWXA 4F0BA 2IMIA 5INYA 1SKWB 1T00A 3CSIA 2EIRA 2ZCTA 1Z6NA 3DD3A 3V1WA 1U3AA 4K7IA 1DSBA 2QSIA 3GTUB 1G6WA 4CW9A 3BD2A 3A3TA 1J0FA 4TR3A 3GL3A 4FQUA 4WR4A 2H6ZA 4EDYA 4NV5A 2O87A 3PH9A 4L5OA 5DJLA 1ILOA 1OAZA 5IIZA 1QFNA 1TI3A 2PUKC 5IMVA 3GNJA 3CRTA 1EGRA 1O6JA 4EUYA 2H01A 3W8SA 4K9ZA 1TW9A 4Q5FA 2YCDA 3G7JA 4J56E 4ULXA 5B7CA 5KEJA 2F51A 2VL2A 4J2FA 2K8SA 3CBUA 5IM9A 3ZFLA 2FA8A 4PQHA 1R5AA 3VI5A 3ZFBA 4XTSA 3ZREA 3QMXA 3BCIA 2L4CA 1KNGA 1K0NA 2WFCA 4XRDA 3FR6A 1R4WA 3IC4A 1V98A 5DVBA 1ZCPA 1U3IA 2FA4A 1SK2A 3US3A 2YV9A 1QUWA 3VLNA 2QC7A 4HQZA 1QQ2A 3N9JA 4WF4A 4JR6A 5A4UA 4RQRA 2BJXA 1GSSA 3KIJA 4YQVA 5CRDA 4EE0A 3TKPA 1Z7PA 3MAKA 3FY7A 1NHYA 1B48A 1OC8A 1Z3EA 4USSA 5E4WA 2QA1A 1YEXA 1XFLA 2RUEA 2GQKA 3QDNA 2L5LA 2L59A 3CXGA 3TRXA 1A2MA 4WR5A 5DQYA 3APOA 4RUVA 2IMFA 2OBIA 2WB9A 3GL5A 1X9MB 4POKA 4HZ4A 1ACVA 1PGTA 3TOTA 1AIUA 4MJBA 2GT6A 5FHIA 22GSA 5EY6A 1C72A 5KN3A 4K8MA 4AJ8A 2PERA 4CY8A 1JZRA 2G2QA 2PGTA 3MSZA 2M80A 4IP6A 3RAZA 5GAPD 3M9JA 2WULA 1YY7A 3C71A 5ECLB 3C1SA 5G31A 1K0CA 4PQ1A 4F82A 1GSDA 1A8LA 4KNDA 5DAKA 3D21A 3TRPA 4K5RA 2VCXA 2X8CA 2KP1A 4PUFC 2HRFA 1BJXA 4GTUA 4L5LA 3PPUA 2IPAA 2LNSA 5COHA 3UVTA 1BX9A 5D9WA 1SJZA 5IOXA 2YJ7A 1F2EA 4KA0A 4X43A 3QD9A 1GP1A 1THXA 4K7OA 2VLVA 2FWFA 2JZRA 1W89A 2WZ9A 4N0VA 3FMWA 5IMFA 2X64A 1H4OA 2MMZA 4IJ3A 14GSA 1S3CA 1KTEA 3ERGA 4EVMA 4HUAA 5HFIA 1KEBA 1XOBA 3J7Yb 2GTUA 2KUCA 2R0CA 1YF0A 4D73B 1TK0B 4OO5A 3ZLPA 2TIRA 2VCWA 2HRKA 5HR3A 1M2BA 4GRFA 1IYHA 3P2AA 3UAPA 2A2SA 4K5SA 2VUPA 2B7JA 4MPGA 4EF0A 2H66A 4I2TA 1RK4A 2H30A 4AJ6A 3GN3A 3GFKA 5DALB 3ED3A 5ECKB 1XBSA 2IN3A 1PSQA 4KDYA 2AV4A 4JRRA 4HZ2A 2DJKA 1V40A 3CYNA 1SYXA 2PVQA 3F6DA 1GL8A 5IMCA 4HEA2 5CP1A 1O81A 4MP4A 2R6KA 1O8WA 5IMDA 1ERUA 2F3MA 3QCPA 4GF0A 4NHWA 4PQIA 4LL1B 3HD5A 1Y6EA 1ZGNA 3L4NA 4POMA 4N30A 3LW9A 3KGKA 3IAS2 2YZUA 4L8EA 1TRSA 4ECCA 2HFDA 3E3EA 1GTBA 1IYIA 5ELGA 4O32A 4ZL8A 5C04A 3TKSA 1GTAA 1DBYA 2H1GA 2H6YA 4MZCA 4OFMA 2KHPA 3DWVA 2GGTA 3E0UA 4ZBAA 1MD4A 3H8QA 2HNLA 1TTZA 2GQMA 1FOHA 2VCTA 1PD21 4KCEA 2FY6A 3QAVA 2YZHA 1SK1A 1K0DA 1XZOA 2TRCP 5ECOB 2CZ2A 4PNGA 4G0KA 1USBA 5B6MA 3PGTA 2DC5A 5LD0A 3FRCA 3TJGA 2KP2A 1MTCA 1U88A 1V2AA 1N2AA 3L9UA 3HVXA 2MMOA 4OO4A 2N5AA 2H70A 4BVYB 4ISDA 2HSYA 3I9V2 4KB3A 3EVIA 4EL1A 3HHVA 5LNKe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJJ A;  1OVN A;  1TRU A;  1O8X A;  2HI7 A;  4MJC A;  20GS A;  3LSZ A;  3D4M A;  4K0G A;  5AN1 A;  4PXO A;  3RHB A;  4TR1 A;  4AGS A;  1GUM A;  3TJB A;  2RM5 A;  4HU7 A;  4PUR A;  1SK0 A;  2FGX A;  4YQU A;  2CX4 A;  2J23 A;  3C8E A;  13GS A;  3ZL5 A;  1YKA A;  4FYB A;  1LBK A;  2VL9 A;  2CX3 A;  2H1D A;  1CQH A;  3HJM A;  1TRV A;  2IIY A;  11GS A;  1AQW A;  3IDV A;  4QQ7 A;  2LRN A;  3IXR A;  3FEU A;  1MD3 A;  4KDU A;  4QL7 A;  3UBK A;  3M9K A;  1GLP A;  1TK5 B;  4DVC A;  3WT1 A;  2R5G A;  2H1B A;  1GUK A;  2YP6 A;  2O85 A;  5EPF A;  4EDZ A;  5ECR B;  3CSJ A;  2IMK A;  4XS4 B;  2YJH A;  5H5S A;  2CZ3 A;  1XVW A;  4MCU A;  3GKM A;  5CYY A;  4IS0 A;  1WP0 A;  3F3R A;  2PWJ A;  3UVH A;  2N5F A;  1H75 A;  3FZ9 A;  3Q18 A;  1YQ1 A;  3I69 A;  4IEL A;  3UEM A;  4I8B A;  2ALB A;  1EP7 A;  2RLI A;  3LG6 A;  4HOJ A;  4K7N A;  4PUA A;  1U87 A;  2CAI A;  1XCC A;  2HYX A;  1PKW A;  1Y25 A;  5G1K A;  4F9Z A;  3MDK A;  1ML6 A;  2YOI A;  5ECM B;  2OKA A;  2R37 A;  2VCV A;  1QXH A;  3UAR A;  2CAQ A;  3P8W A;  5HFK A;  1MDI A;  3WYW A;  1PX6 A;  3GSS A;  1VGL A;  1V9W A;  1A8Y A;  4IHU A;  2XBI A;  3KM6 A;  4NPB A;  3BJ5 A;  4G2E A;  1OE7 A;  4MLY A;  4E8E A;  3GH6 A;  7GSS A;  2HE3 A;  3GTU A;  2KOK A;  3EWL A;  4DSR A;  2LUS A;  4IGJ A;  3UL3 A;  1UA5 A;  1YF1 A;  3ERF A;  3FKF A;  1N8J A;  3KP9 A;  4N11 A;  4LMV A;  2JSZ A;  4I2U A;  4TR0 A;  5IPH A;  5ECI B;  1VF2 A;  3HYP A;  2E2G A;  1AAZ A;  2N5B A;  1NW2 A;  2K6V A;  2OE0 A;  1SYR A;  3NZN A;  4K1F A;  3GKK A;  1G0T A;  3GX8 A;  3WGE A;  4ACS A;  6GSW A;  1AUC A;  4MZB A;  4MF7 A;  1WPI A;  1O85 A;  1AQV A;  2HZE B;  6GSS A;  5CNW A;  1QK8 A;  3F8U A;  4GWR A;  1B9Y C;  4JR4 A;  5EL8 A;  2P5R A;  2DJ3 A;  3GKX A;  1A2J A;  1I9D A;  3IRA A;  3HY2 A;  1HNB A;  4YQM A;  2VCQ A;  1TKD B;  4F0C A;  2RUF A;  2Z9S A;  1T4Z A;  3ZVJ D;  1PX7 A;  3QFA C;  3F3Q A;  5H5Q A;  1HNA A;  3BBY A;  3M0F A;  3ME8 A;  1GUH A;  2R4V A;  3LYK A;  4MMM A;  4ZBD A;  5G30 A;  1TRW A;  4OCF A;  4XS1 A;  1WRY A;  3LOR A;  1DE1 A;  5AIV A;  4XIH A;  1X0R A;  2C3Q A;  4L0W A;  1HYU A;  5CRG A;  1F3B A;  1QGV A;  1TJD A;  3EU3 A;  2H8L A;  5LCZ A;  2DML A;  3O6T A;  3G7Y A;  5HR2 A;  3EU4 A;  2C0G A;  1GRX A;  9GSS A;  3DIE A;  3O76 A;  4WET A;  2FUG 2;  5A5K A;  4ZXG A;  4HJM A;  2OAC A;  2CV4 A;  6GSV A;  3FK8 A;  1PKZ A;  3WGD A;  1SEN A;  3D22 A;  2VM1 A;  5DJM A;  2G0F A;  3WT2 A;  4NWY A;  5D8I A;  3HVV A;  2LV3 A;  1G7E A;  2FWE A;  3EYT A;  5GZZ B;  3QPM A;  3LXZ A;  4ZB6 A;  2LNT A;  5G1L A;  3H79 A;  1PN9 A;  3BOA A;  2LRT A;  1ERW A;  4IQ1 A;  1MDJ A;  3VPT A;  1XWB A;  3FZA A;  2WS2 A;  3IBH A;  2O8V B;  1JZO A;  2V2G A;  4IN0 A;  2F8A A;  2MYG A;  5IO2 A;  1GNE A;  1MDK A;  2O7K A;  3FHK A;  1XOA A;  4DSQ A;  4LLR A;  4QL9 A;  4OD7 A;  1T7P B;  2YPM A;  1G6Y A;  4GSN A;  3NIV A;  1GSQ A;  2CQ9 A;  4NHZ A;  1EZK A;  4FYC A;  2FWG A;  1TP9 A;  1XW6 A;  3DRN A;  3VPQ A;  2PN8 A;  1R26 A;  5KN1 A;  4Q5N A;  1LJR A;  1GUL A;  1QMV A;  4JBB A;  4IJI A;  2DSA A;  5DCG A;  3UOM A;  1WWJ A;  2CVK A;  1ZL9 A;  1XXU A;  2GSS A;  3H93 A;  1ZYQ B;  5G2Z A;  2C3N A;  3DVW A;  1NHO A;  3A2X A;  2HRN A;  4JED A;  3A2V A;  1X9W B;  2WJU A;  3ERW A;  4PX1 A;  2VM2 A;  4KDX A;  4NV2 A;  4F03 A;  3UBL A;  3DXB A;  4F2I A;  2OAD A;  2M46 A;  1EGO A;  4KCA A;  4KSM A;  4WKW A;  3TDG A;  4ZL9 A;  4EC0 A;  1PL1 A;  3GKN A;  4MJE A;  2X99 A;  3MNG A;  2IMD A;  3L9V A;  2E2M A;  2L6D A;  4D73 A;  2HSH A;  2LQQ A;  4I6X A;  1HD2 A;  2V1M A;  1WMJ A;  3HZ4 A;  4ECB A;  3WD6 A;  3RDW A;  1OYJ A;  1UN2 A;  4KAE A;  1JLW A;  3TB2 A;  2ES7 A;  2OJL A;  5DAL A;  2M72 A;  1WJK A;  1F6M C;  3KJY A;  2NPB A;  4P3Y B;  2H71 A;  4PGT A;  2C1Y A;  3P90 A;  3DGQ A;  1JLV A;  2LJR A;  17GS A;  5F06 A;  3HJP A;  1R5P A;  2XPD A;  3EMX A;  1SL0 B;  4FO5 A;  4K6X A;  3GUR A;  3ZYW A;  1EWX A;  4RQX A;  1K0O A;  4FH8 A;  4TXO B;  2DJ0 A;  2L57 A;  2CT6 A;  2C4J A;  2F8F A;  3TGZ A;  4JZQ A;  5F0G A;  5IQY A;  4TKY A;  2OA7 A;  1DE2 A;  1XPV A;  3CMI A;  4OCE A;  5CO3 A;  1M9B A;  4KE3 A;  4DEJ A;  1V58 A;  3ISO A;  2AHE A;  2YWI A;  2B5E A;  1BG5 A;  3Q19 A;  1ON4 A;  5JCW A;  5AGY A;  2H0H A;  10GS A;  1ZOF A;  1A24 A;  3RPP A;  3KP8 A;  2B5Y A;  2AUV A;  1ZYE A;  4V1A g;  1X5C A;  5DCH A;  2RII A;  1FVK A;  2XHF A;  2K18 A;  2YWO A;  2PVO C;  5EVO A;  5J9B A;  1E6B A;  3LEF A;  2FCH A;  1THO A;  1XIY A;  3D5J A;  16GS A;  2DJJ A;  1SD8 A;  3HKR A;  4BA7 A;  1M0U A;  3E9J B;  5J4U A;  1K3O A;  3QFB C;  1URM A;  4OFN A;  1ZZY A;  6GSX A;  2FWH A;  2HXK A;  3A2W A;  4BVY A;  4O7H A;  3HVS A;  4HU9 A;  2AAW A;  3VFI A;  12GS A;  2GT5 A;  2LTK A;  2ZNM A;  1SD9 A;  4GQC A;  2NTO A;  2AYT A;  4NAX A;  1MEK A;  2P31 A;  4KSO A;  5ECH B;  3KTB A;  2VLU A;  2NBS A;  4AF2 A;  1FO5 A;  1PA3 A;  1A23 A;  4KUN A;  5CRW A;  4G19 A;  5E59 A;  2YWM A;  5HQP A;  2C0E A;  1RQM A;  3FYG A;  4LL4 B;  3TKS E;  1A0R P;  3IAM 2;  2H75 A;  2VAF A;  3S9F A;  2VL3 A;  3DEX A;  1ERV A;  1FW1 A;  1GWC A;  4MF6 A;  3EUR A;  4GSS A;  1O7U A;  3VUR A;  1EOG A;  4TOP A;  4V2L A;  1Q98 A;  2YNX A;  5G5F A;  4KH7 A;  4XS4 A;  3LFL A;  3GIX A;  18GS A;  1WE0 A;  2IFQ B;  4WBJ A;  3SWL A;  2JU5 A;  3IPZ A;  5GSS A;  1FVJ A;  3GHA A;  1O73 A;  3CSH A;  1AQX A;  2C0D A;  4H86 A;  1JZW A;  3TKS C;  3QR6 A;  3H1N A;  5IMA A;  4YAP A;  5D9X A;  2GZY A;  3IHQ A;  2MMN A;  3TJK A;  1SKS B;  5CAX A;  1T3B A;  5J3R A;  1XWA A;  3FR9 A;  1T4Y A;  4WF5 A;  2P0G A;  4X0X A;  3CRU A;  5HR0 A;  3C73 A;  5DDL A;  1F3A A;  3W6G A;  5ECS A;  2GDR A;  3TOU A;  4BPY A;  1A2L A;  2DIY A;  2CVD A;  4MF5 A;  5A4W A;  2MBS A;  3FW2 A;  3HZ8 A;  4KW6 A;  5G5E A;  2IME A;  4O5R A;  5KN2 A;  4V2N A;  6GSY A;  1J08 A;  4XCS A;  2VD1 A;  4ZB8 A;  4GXZ A;  1PMT A;  4IBP A;  1FOV A;  1VF1 A;  2FHE A;  2L5O A;  1J9B A;  4DSS B;  2C8U A;  1R7H A;  4GQF A;  1EV9 A;  2H0G A;  4MJA A;  5F05 A;  3KH7 A;  4Q5R A;  4JU5 A;  2DJ2 A;  4MDC A;  3M1G A;  2H1A A;  1OC9 B;  1SJI A;  2GZZ A;  3R2Q A;  5AIX A;  4TW5 A;  3Q6O A;  3ZRD A;  4CDO A;  1RW1 A;  3GST A;  2KLX A;  2VOC A;  3F4S A;  3U6V A;  1FAA A;  2LKU A;  5GAN D;  1OKT A;  2MMA A;  1FG4 A;  3VK9 A;  2TRX A;  5D73 A;  3MWH A;  1ST9 A;  2J9H A;  2HZE A;  4OMV A;  1XVQ A;  4J57 E;  2CA8 A;  1SJ6 A;  3EMP A;  4MK3 A;  3IK9 A;  2O89 A;  4WXT A;  2I1U A;  2XPE A;  2H0I A;  3GRX A;  3SBC A;  4G9H A;  1X5E A;  2I81 A;  5HR1 A;  4HJ2 A;  5D9V A;  4ILF A;  2VCZ A;  3PIN A;  4HS1 A;  3UMA A;  4AJ7 A;  1EEJ A;  4ML1 A;  3KMO A;  3A5W A;  2AJQ B;  3KMN A;  3DVX A;  4L0U A;  3F6F A;  5D96 A;  1ABA A;  3CTG A;  3WGX A;  2LEG A;  2ZUP A;  4TXV A;  1BED A;  1T8E B;  1SKR B;  3IV4 A;  1TDI A;  3JCM L;  1TU7 A;  3W8J A;  3LGC A;  3GV1 A;  2WDU A;  3IOS A;  5F8B A;  2DIZ A;  1UC7 A;  4MZW A;  1HQO A;  2A4V A;  2K8V A;  1S3D A;  4WEY A;  1JZD A;  3I43 A;  1YZX A;  1M2A A;  3KH9 A;  2R3X A;  4KX4 A;  3FZ5 A;  2C3T A;  4K0N A;  4MPF A;  5ENU A;  1M9A A;  5D93 A;  1JFU A;  3UJ1 A;  2YV7 A;  3RBT A;  1NM3 A;  2FD3 A;  1YKC A;  5IO0 A;  3CTF A;  4GLT A;  4MA9 A;  2K9F A;  4ZL7 A;  3ZML A;  1GLQ A;  2RM6 A;  4ZBB A;  2B1K A;  1XW9 A;  4NMU A;  2GSR A;  1F9M A;  2MZC A;  2OBK A;  3TJF A;  3KD0 A;  2GVP A;  5F07 A;  3L9S A;  1B8X A;  1I5G A;  3GYK A;  4JE1 A;  1OE8 A;  2JZS A;  2JAC A;  2P5Q A;  1ZMA A;  5CRH A;  1SU9 A;  3APS A;  4BL7 A;  5ECQ B;  4BWS A;  1LU4 A;  2HLS A;  1OKD A;  1FHE A;  2MBT A;  6GSU A;  1HNC A;  2H76 A;  5B8B A;  1Q4J A;  3D0Z A;  2B3S A;  19GS A;  3IK7 A;  5B8A A;  2BTO T;  1M99 A;  5GST A;  1PQN A;  1FB0 A;  3IA1 A;  3TUE A;  2YN1 A;  1Z5Y E;  4MAB A;  4IKH A;  3UIW A;  2L4Q A;  2V6O A;  5A4V A;  3D4T A;  4EKZ A;  3ZIV A;  2VL2 C;  3AY8 A;  3BCK A;  3D6I A;  4HQS A;  5IMZ A;  2GZP A;  2B7K A;  2DLX A;  3GA4 A;  1GH2 A;  3F0I A;  1XWK A;  3DYR A;  2LQO A;  3HA9 A;  3C1R A;  3KTL A;  4OFT A;  2A2R A;  3IR4 A;  3H4K A;  3HXS A;  3ZTL A;  5DAK B;  2H74 A;  4EXJ A;  4POL A;  2V32 A;  3U5R E;  2GSQ A;  1GSY A;  5D9T A;  2PBJ A;  4Z7X A;  2VIM A;  1VF4 A;  5ABR A;  1U6T A;  2F9S A;  5C00 A;  2HT9 A;  3LJR A;  4IQA A;  3GUS A;  3LYP A;  4WBR D;  3VWV A;  3L78 A;  4KGI A;  3ZVJ A;  3HJO A;  2GQL A;  3EC3 A;  2QGV A;  1B9X C;  1VF3 A;  4XRA A;  4HI7 A;  2H73 A;  2EIQ A;  4LMW A;  2DBC A;  3QOU A;  2PU9 C;  1UVZ A;  2R2J A;  3G7I A;  3NOF A;  4TXO A;  1B4P A;  4FYU A;  4NXI A;  1EP8 A;  2PPT A;  2EC4 A;  3TCO A;  5DQS A;  5DBQ A;  4XHM A;  1BQ7 A;  2FNO A;  2I3Y A;  2HZF A;  1CQG A;  4TR4 A;  1SL2 B;  2GS3 A;  5L71 A;  1SL1 B;  3F9U A;  4X1U A;  3M3M A;  3GH9 A;  4GST A;  1X5D A;  1X9S B;  4OWY A;  1GTU A;  4TN8 A;  4ID0 A;  3LXT A;  1WOU A;  2ON7 A;  1AC1 A;  2LJK A;  3KZQ A;  4TVE A;  1TOF A;  2AB6 A;  3F4R A;  2V41 A;  2B6M A;  2IL3 A;  2H6X A;  2WRT A;  5JWQ B;  4K2D A;  3QAW A;  2D2Z A;  2PMT A;  1GSU A;  3F4T A;  3HCZ A;  1VRS D;  4MH2 A;  4ZIL A;  4HDE A;  4IP1 A;  3LQ7 A;  3I6A A;  4N0Z A;  3G9B A;  4ZIJ A;  4CHS A;  8GSS A;  4BWQ A;  5JCU A;  1V57 A;  1K0M A;  5CRE A;  3GX0 A;  4BVX A;  1M2D A;  4G10 A;  5J41 A;  1EV4 A;  3DKS A;  4RI7 A;  3QAG A;  3KEB A;  4LA1 A;  2NVL A;  3TKQ A;  2X8G A;  2OE3 A;  4XS6 A;  2B5X A;  3EE2 A;  1GSE A;  4YH2 A;  5ELA A;  2LRC A;  4ECI A;  3IE3 A;  5J5N A;  5ECP B;  3TKR A;  4I97 A;  3DML A;  1K0A A;  1GNW A;  4YAV A;  1FB6 A;  3M8N A;  2C80 A;  3OR5 A;  2IWT A;  3FR3 A;  5FWG A;  2VO4 A;  2E7P A;  4EO3 A;  2JAD A;  1KBN A;  4O92 A;  3ZZX A;  3VI7 A;  3FZ4 A;  1PL2 A;  4FIW A;  2JZT A;  4POB A;  4I5Q A;  3TRQ A;  5IOW A;  2X8H A;  3J7Y k;  1PRX A;  1YDK A;  2FLS A;  1K3Y A;  2H19 A;  1XWC A;  2H72 A;  2E0Q A;  1TXX A;  2NDO A;  3ZIT A;  1EEM A;  3ME7 A;  2IFQ A;  5AIS A;  3GMF A;  3VWW A;  2EIO A;  1G7O A;  4Q5Q A;  1K3L A;  3F63 A;  1TI1 A;  2I4A A;  3EIN A;  2L6C A;  2QKE A;  1K0B A;  2WGR A;  4RI6 A;  5HFG A;  4TR1 B;  4MH3 A;  3ZMK A;  1YEP A;  2DMM A;  6GST A;  3C7M A;  1Z7R A;  1A0F A;  2I9H A;  3HDC A;  1F37 A;  2BMX A;  3PR8 A;  1YJ6 A;  5FT3 A;  1JHB A;  2GST A;  4ZB9 A;  3Q74 A;  1B4Q A;  4PNF A;  2XBQ A;  5J9C A;  2DJ1 A;  2ON5 A;  1S3A A;  3P7X A;  1WIK A;  3KCM A;  1GSF A;  2XC2 A;  4V2M A;  5JCG A;  5IPG A;  2OE1 A;  4IVF A;  1BYE A;  4ECJ A;  2LS5 A;  5JWR B;  2LJA A;  2IJY A;  5JWO B;  2VLT A;  2YWN A;  2REM A;  2C0F A;  4DSS A;  1M7T A;  3K8N A;  5B6N A;  1OC3 A;  1OC9 A;  2LST A;  2JSY A;  3RPN A;  5ID2 A;  4IW9 A;  1XWG A;  1T1V A;  2B1L A;  3VWU A;  1AW9 A;  1Z6M A;  1Z9H A;  1AXD A;  4GCI A;  2GLR A;  3ZIJ A;  1EOH A;  3LWA A;  1TK8 B;  4N10 A;  1DUG A;  3KXO A;  3O3T A;  4E8H A;  5KN0 A;  5ID2 B;  3N5O A;  1NSW A;  3APQ A;  5H5R A;  1BAY A;  3RHC A;  1E2Y A;  2YAN A;  1W4V A;  2JL4 A;  1GTI A;  4ML6 A;  4V1A p;  1XW5 A;  1ERT A;  2WCI A;  5ECN B;  2V6K A;  1TU8 A;  2CVB A;  4TRX A;  2VD0 A;  3L0H A;  3VWX A;  4F0B A;  2IMI A;  5INY A;  1SKW B;  1T00 A;  3CSI A;  2EIR A;  2ZCT A;  1Z6N A;  3DD3 A;  3V1W A;  1U3A A;  4K7I A;  1DSB A;  2QSI A;  3GTU B;  1G6W A;  4CW9 A;  3BD2 A;  3A3T A;  1J0F A;  4TR3 A;  3GL3 A;  4WR4 A;  2H6Z A;  4EDY A;  4NV5 A;  2O87 A;  3PH9 A;  4L5O A;  5DJL A;  1ILO A;  1OAZ A;  5IIZ A;  1QFN A;  1TI3 A;  2PUK C;  5IMV A;  3GNJ A;  3CRT A;  1EGR A;  1O6J A;  4EUY A;  2H01 A;  3W8S A;  4K9Z A;  1TW9 A;  4Q5F A;  2YCD A;  3G7J A;  4J56 E;  4ULX A;  5B7C A;  5KEJ A;  2F51 A;  2VL2 A;  4J2F A;  2K8S A;  3CBU A;  5IM9 A;  3ZFL A;  2FA8 A;  4PQH A;  1R5A A;  3VI5 A;  3ZFB A;  4XTS A;  3ZRE A;  3QMX A;  3BCI A;  2L4C A;  1KNG A;  1K0N A;  2WFC A;  4XRD A;  3FR6 A;  1R4W A;  3IC4 A;  1V98 A;  5DVB A;  1ZCP A;  1U3I A;  2FA4 A;  1SK2 A;  3US3 A;  2YV9 A;  1QUW A;  3VLN A;  2QC7 A;  4HQZ A;  1QQ2 A;  3N9J A;  4WF4 A;  4JR6 A;  5A4U A;  4RQR A;  2BJX A;  1GSS A;  3KIJ A;  4YQV A;  5CRD A;  4EE0 A;  3TKP A;  1Z7P A;  3MAK A;  3FY7 A;  1NHY A;  1B48 A;  1OC8 A;  1Z3E A;  5E4W A;  1YEX A;  1XFL A;  2RUE A;  2GQK A;  3QDN A;  2L5L A;  2L59 A;  3CXG A;  3TRX A;  1A2M A;  4WR5 A;  5DQY A;  3APO A;  4RUV A;  2IMF A;  2OBI A;  2WB9 A;  3GL5 A;  1X9M B;  4POK A;  4HZ4 A;  1ACV A;  1PGT A;  3TOT A;  1AIU A;  4MJB A;  2GT6 A;  5FHI A;  22GS A;  5EY6 A;  1C72 A;  5KN3 A;  4K8M A;  4AJ8 A;  2PER A;  1JZR A;  2G2Q A;  2PGT A;  3MSZ A;  2M80 A;  4IP6 A;  3RAZ A;  5GAP D;  3M9J A;  2WUL A;  1YY7 A;  3C71 A;  5ECL B;  3C1S A;  5G31 A;  1K0C A;  4PQ1 A;  4F82 A;  1GSD A;  1A8L A;  4KND A;  5DAK A;  3D21 A;  3TRP A;  2VCX A;  2X8C A;  2KP1 A;  4PUF C;  2HRF A;  1BJX A;  4GTU A;  4L5L A;  2IPA A;  2LNS A;  5COH A;  3UVT A;  1BX9 A;  5D9W A;  1SJZ A;  5IOX A;  2YJ7 A;  1F2E A;  4KA0 A;  4X43 A;  3QD9 A;  1GP1 A;  1THX A;  4K7O A;  2VLV A;  2FWF A;  2JZR A;  1W89 A;  2WZ9 A;  4N0V A;  5IMF A;  2X64 A;  1H4O A;  2MMZ A;  4IJ3 A;  14GS A;  1S3C A;  1KTE A;  3ERG A;  4EVM A;  4HUA A;  5HFI A;  1KEB A;  1XOB A;  3J7Y b;  2GTU A;  2KUC A;  1YF0 A;  4D73 B;  1TK0 B;  4OO5 A;  3ZLP A;  2TIR A;  2VCW A;  5HR3 A;  1M2B A;  4GRF A;  1IYH A;  3P2A A;  3UAP A;  2A2S A;  2VUP A;  2B7J A;  4MPG A;  4EF0 A;  2H66 A;  4I2T A;  1RK4 A;  2H30 A;  4AJ6 A;  3GN3 A;  3GFK A;  5DAL B;  3ED3 A;  5ECK B;  1XBS A;  2IN3 A;  1PSQ A;  4KDY A;  2AV4 A;  4JRR A;  4HZ2 A;  2DJK A;  1V40 A;  3CYN A;  1SYX A;  2PVQ A;  3F6D A;  1GL8 A;  5IMC A;  4HEA 2;  5CP1 A;  1O81 A;  4MP4 A;  2R6K A;  1O8W A;  5IMD A;  1ERU A;  2F3M A;  3QCP A;  4GF0 A;  4NHW A;  4PQI A;  4LL1 B;  3HD5 A;  1Y6E A;  1ZGN A;  3L4N A;  4POM A;  4N30 A;  3KGK A;  3IAS 2;  2YZU A;  4L8E A;  1TRS A;  4ECC A;  2HFD A;  3E3E A;  1GTB A;  1IYI A;  5ELG A;  4O32 A;  4ZL8 A;  5C04 A;  3TKS A;  1GTA A;  1DBY A;  2H1G A;  2H6Y A;  4MZC A;  4OFM A;  2KHP A;  3DWV A;  2GGT A;  3E0U A;  4ZBA A;  1MD4 A;  3H8Q A;  2HNL A;  1TTZ A;  2GQM A;  2VCT A;  1PD2 1;  4KCE A;  2FY6 A;  3QAV A;  2YZH A;  1SK1 A;  1K0D A;  1XZO A;  2TRC P;  5ECO B;  2CZ2 A;  4PNG A;  1USB A;  5B6M A;  3PGT A;  2DC5 A;  5LD0 A;  3FRC A;  3TJG A;  2KP2 A;  1MTC A;  1U88 A;  1V2A A;  1N2A A;  3L9U A;  3HVX A;  2MMO A;  4OO4 A;  2N5A A;  2H70 A;  4ISD A;  2HSY A;  3I9V 2;  4KB3 A;  3EVI A;  4EL1 A;  3HHV A;  5LNK e; 
#chains in the Genus database with same CATH topology
 3TJJ A;  1OVN A;  1TRU A;  1O8X A;  2HI7 A;  4MJC A;  20GS A;  3LSZ A;  3D4M A;  4K0G A;  5AN1 A;  4PXO A;  3RHB A;  4TR1 A;  4AGS A;  1GUM A;  3TJB A;  2RM5 A;  4HU7 A;  4PUR A;  1SK0 A;  2FGX A;  4YQU A;  2CX4 A;  2J23 A;  3C8E A;  13GS A;  3ZL5 A;  1YKA A;  4FYB A;  1LBK A;  2VL9 A;  2CX3 A;  2H1D A;  1CQH A;  3HJM A;  1TRV A;  4MNN A;  2IIY A;  11GS A;  1AQW A;  3IDV A;  4QQ7 A;  2LRN A;  3IXR A;  3FEU A;  1MD3 A;  4KDU A;  4QL7 A;  3UBK A;  3M9K A;  1GLP A;  1TK5 B;  3IC8 A;  4G0I A;  4DVC A;  3WT1 A;  2R5G A;  2H1B A;  1GUK A;  2YP6 A;  2O85 A;  5EPF A;  4EDZ A;  5ECR B;  3CSJ A;  2IMK A;  4XS4 B;  2YJH A;  5H5S A;  2CZ3 A;  1XVW A;  4MCU A;  3GKM A;  5CYY A;  4IS0 A;  1WP0 A;  3F3R A;  2PWJ A;  3UVH A;  2N5F A;  1H75 A;  3FZ9 A;  4HSC X;  3Q18 A;  1YQ1 A;  3I69 A;  4IEL A;  3UEM A;  4I8B A;  2ALB A;  1EP7 A;  2RLI A;  3LG6 A;  4HOJ A;  4K7N A;  4PUA A;  1U87 A;  2CAI A;  1XCC A;  2HYX A;  1PKW A;  1Y25 A;  5G1K A;  4F9Z A;  3MDK A;  1ML6 A;  2YOI A;  5ECM B;  2OKA A;  2R37 A;  2VCV A;  1QXH A;  3UAR A;  2CAQ A;  3P8W A;  5HFK A;  1MDI A;  3WYW A;  1PX6 A;  3GSS A;  1VGL A;  1V9W A;  1A8Y A;  4IHU A;  2XBI A;  3KM6 A;  4NPB A;  3BJ5 A;  4G2E A;  1OE7 A;  4MLY A;  4E8E A;  3GH6 A;  7GSS A;  2HE3 A;  3GTU A;  2KOK A;  3EWL A;  4DSR A;  2LUS A;  4IGJ A;  5BMU A;  3UL3 A;  1UA5 A;  1YF1 A;  3ERF A;  3FKF A;  1N8J A;  3KP9 A;  4N11 A;  4LMV A;  2JSZ A;  4I2U A;  4TR0 A;  5IPH A;  5ECI B;  1VF2 A;  3HYP A;  2E2G A;  1AAZ A;  2N5B A;  1NW2 A;  2K6V A;  2OE0 A;  1SYR A;  3NZN A;  4K1F A;  3GKK A;  1G0T A;  3GX8 A;  3WGE A;  4ACS A;  6GSW A;  1AUC A;  4MZB A;  4MF7 A;  1WPI A;  1O85 A;  1AQV A;  2HZE B;  6GSS A;  5CNW A;  1QK8 A;  3F8U A;  4GWR A;  1B9Y C;  4JR4 A;  5EL8 A;  2P5R A;  2DJ3 A;  3GKX A;  1A2J A;  1I9D A;  3IRA A;  3HY2 A;  1HNB A;  4YQM A;  2VCQ A;  1TKD B;  4F0C A;  2RUF A;  2Z9S A;  1T4Z A;  3ZVJ D;  1PX7 A;  3QFA C;  3F3Q A;  5H5Q A;  1HNA A;  3BBY A;  3M0F A;  3ME8 A;  1GUH A;  2R4V A;  3LYK A;  4MMM A;  4ZBD A;  5G30 A;  1TRW A;  4OCF A;  4XS1 A;  1WRY A;  3LOR A;  1DE1 A;  5AIV A;  4XIH A;  1X0R A;  2C3Q A;  4L0W A;  1HYU A;  5CRG A;  1F3B A;  1QGV A;  1TJD A;  3EU3 A;  2H8L A;  5LCZ A;  2DML A;  3O6T A;  3G7Y A;  5HR2 A;  3EU4 A;  2C0G A;  1GRX A;  9GSS A;  3DIE A;  3O76 A;  3CQF A;  4WET A;  2FUG 2;  5A5K A;  3MIX A;  4ZXG A;  4HJM A;  2OAC A;  2CV4 A;  6GSV A;  3FK8 A;  1PKZ A;  3WGD A;  1SEN A;  3D22 A;  2VM1 A;  5DJM A;  2G0F A;  3WT2 A;  4NWY A;  5D8I A;  4Z2T A;  3HVV A;  2LV3 A;  1G7E A;  2FWE A;  3EYT A;  5GZZ B;  3QPM A;  3LXZ A;  4ZB6 A;  2LNT A;  5G1L A;  3H79 A;  1PN9 A;  3BOA A;  2LRT A;  1ERW A;  4IQ1 A;  1MDJ A;  3VPT A;  1XWB A;  3FZA A;  2WS2 A;  3IBH A;  2O8V B;  4IN0 A;  1JZO A;  2V2G A;  2F8A A;  1M3I A;  2MYG A;  5IO2 A;  1GNE A;  1MDK A;  2O7K A;  3FHK A;  1XOA A;  4DSQ A;  4LLR A;  4QL9 A;  4OD7 A;  1T7P B;  2YPM A;  1G6Y A;  4GSN A;  3NIV A;  1GSQ A;  2CQ9 A;  4NHZ A;  1EZK A;  4BL7 B;  4FYC A;  2FWG A;  1TP9 A;  1XW6 A;  3DRN A;  3VPQ A;  2PN8 A;  1R26 A;  5KN1 A;  4Q5N A;  1LJR A;  1GUL A;  1QMV A;  4JBB A;  4IJI A;  2DSA A;  5DCG A;  3UOM A;  1WWJ A;  2CVK A;  1ZL9 A;  1XXU A;  2GSS A;  3H93 A;  1ZYQ B;  5G2Z A;  2C3N A;  3DVW A;  1NHO A;  3A2X A;  2HRN A;  4JED A;  3HVN A;  3A2V A;  1X9W B;  2WJU A;  3ERW A;  4PX1 A;  2VM2 A;  4KDX A;  4NV2 A;  4F03 A;  3UBL A;  3DXB A;  4F2I A;  1XG8 A;  2OAD A;  2M46 A;  1EGO A;  4KCA A;  4KSM A;  4WKW A;  3TDG A;  4ZL9 A;  4EC0 A;  1PL1 A;  3GKN A;  4MJE A;  2X99 A;  3MNG A;  2IMD A;  3L9V A;  2E2M A;  2L6D A;  4D73 A;  2HSH A;  2LQQ A;  4I6X A;  1PN0 A;  1HD2 A;  2V1M A;  1WMJ A;  3HZ4 A;  4ECB A;  3WD6 A;  3RDW A;  1OYJ A;  1UN2 A;  4KAE A;  1JLW A;  3TB2 A;  2ES7 A;  2OJL A;  5DAL A;  2M72 A;  1WJK A;  1F6M C;  3KJY A;  2NPB A;  4P3Y B;  2H71 A;  4PGT A;  4K2X A;  2C1Y A;  3P90 A;  3DGQ A;  1JLV A;  2LJR A;  17GS A;  5F06 A;  3HJP A;  1R5P A;  2XPD A;  3EMX A;  1SL0 B;  4FO5 A;  4K6X A;  3GUR A;  3ZYW A;  1EWX A;  4RQX A;  1K0O A;  4FH8 A;  4TXO B;  2DJ0 A;  2L57 A;  2CT6 A;  2C4J A;  2F8F A;  3TGZ A;  4JZQ A;  5F0G A;  5IQY A;  4TKY A;  2OA7 A;  1DE2 A;  1XPV A;  3R3E A;  3CMI A;  4OCE A;  5CO3 A;  1M9B A;  4KE3 A;  4DEJ A;  1V58 A;  3ISO A;  2AHE A;  2YWI A;  2B5E A;  1BG5 A;  3Q19 A;  1ON4 A;  5JCW A;  5AGY A;  2H0H A;  10GS A;  1ZOF A;  1A24 A;  3RPP A;  3KP8 A;  2B5Y A;  2AUV A;  1ZYE A;  4V1A g;  1X5C A;  2X4A A;  5DCH A;  2RII A;  1FVK A;  2DKH A;  2XHF A;  2K18 A;  2YWO A;  2PVO C;  5EVO A;  5J9B A;  1E6B A;  3LEF A;  2FCH A;  1THO A;  1XIY A;  3D5J A;  16GS A;  2DJJ A;  1SD8 A;  3HKR A;  4BA7 A;  1M0U A;  2R0P A;  3E9J B;  5J4U A;  1K3O A;  3QFB C;  1URM A;  4OFN A;  1ZZY A;  6GSX A;  2FWH A;  2HXK A;  3A2W A;  4BVX B;  4BVY A;  4O7H A;  3HVS A;  4HU9 A;  2AAW A;  3VFI A;  12GS A;  2GT5 A;  2LTK A;  2ZNM A;  1SD9 A;  4GQC A;  2NTO A;  2AYT A;  4NAX A;  1MEK A;  2P31 A;  4KSO A;  5ECH B;  3KTB A;  2VLU A;  4Z2U A;  2NBS A;  4AF2 A;  1FO5 A;  1PA3 A;  1A23 A;  4KUN A;  5CRW A;  4G19 A;  4X4J A;  5E59 A;  2YWM A;  5HQP A;  2C0E A;  1RQM A;  3FYG A;  4LL4 B;  4G0L A;  3TKS E;  1A0R P;  3IAM 2;  2H75 A;  2VAF A;  3S9F A;  2VL3 A;  3DEX A;  1ERV A;  1FW1 A;  1GWC A;  4MF6 A;  3EUR A;  4GSS A;  1O7U A;  3VUR A;  1EOG A;  4TOP A;  4V2L A;  1Q98 A;  2YNX A;  5G5F A;  4KH7 A;  4XS4 A;  3LFL A;  3GIX A;  18GS A;  1WE0 A;  2IFQ B;  4WBJ A;  3SWL A;  2JU5 A;  3IPZ A;  5GSS A;  1FVJ A;  3GHA A;  1O73 A;  3CSH A;  1AQX A;  2C0D A;  4EIQ A;  4H86 A;  1JZW A;  3TKS C;  3QR6 A;  3H1N A;  5IMA A;  4YAP A;  5D9X A;  2GZY A;  3IHQ A;  2MMN A;  2HSM A;  3TJK A;  1SKS B;  5CAX A;  1T3B A;  5J3R A;  1XWA A;  3FR9 A;  1T4Y A;  4WF5 A;  2P0G A;  4X0X A;  3CRU A;  5HR0 A;  3C73 A;  5DDL A;  1F3A A;  3W6G A;  5ECS A;  2GDR A;  3TOU A;  4BPY A;  1A2L A;  2DIY A;  2CVD A;  4MF5 A;  5A4W A;  2MBS A;  3FW2 A;  3HZ8 A;  4KW6 A;  5G5E A;  2IME A;  4O5R A;  5KN2 A;  4V2N A;  6GSY A;  1J08 A;  4XCS A;  2VD1 A;  4ZB8 A;  4GXZ A;  1PMT A;  4IBP A;  1FOV A;  1VF1 A;  2FHE A;  2L5O A;  1J9B A;  4DSS B;  2C8U A;  1R7H A;  4GQF A;  1EV9 A;  2H0G A;  4MJA A;  5F05 A;  3KH7 A;  4Q5R A;  4A5P A;  4JU5 A;  2DJ2 A;  1ZYN A;  4MDC A;  3M1G A;  2H1A A;  1OC9 B;  1SJI A;  2GZZ A;  3R2Q A;  5AIX A;  4TW5 A;  3Q6O A;  3ZRD A;  4CDO A;  1RW1 A;  3GST A;  2KLX A;  2VOC A;  3F4S A;  3U6V A;  1FAA A;  2LKU A;  5GAN D;  1OKT A;  2MMA A;  1FG4 A;  3VK9 A;  2TRX A;  5D73 A;  3MWH A;  1ST9 A;  2J9H A;  2HZE A;  4OMV A;  1XVQ A;  4J57 E;  2CA8 A;  1SJ6 A;  3EMP A;  4MK3 A;  3IK9 A;  4KF9 A;  2O89 A;  4WXT A;  4O5U A;  2I1U A;  2XPE A;  2H0I A;  3GRX A;  3SBC A;  4G9H A;  1X5E A;  2I81 A;  5HR1 A;  4HJ2 A;  5D9V A;  4ILF A;  2VCZ A;  3PIN A;  4HS1 A;  3UMA A;  4AJ7 A;  1EEJ A;  4ML1 A;  4O5Q A;  3KMO A;  3A5W A;  2AJQ B;  3KMN A;  3DVX A;  4L0U A;  3F6F A;  5D96 A;  1ABA A;  3CTG A;  2X49 A;  3WGX A;  2LEG A;  2ZUP A;  4TXV A;  1BED A;  1T8E B;  1SKR B;  3IV4 A;  1TDI A;  3JCM L;  1TU7 A;  3W8J A;  3LGC A;  3GV1 A;  2WDU A;  3IOS A;  5F8B A;  2DIZ A;  1UC7 A;  4MZW A;  1HQO A;  2A4V A;  2K8V A;  1S3D A;  4WEY A;  1JZD A;  3I43 A;  1YZX A;  1M2A A;  3KH9 A;  2R3X A;  4KX4 A;  3FZ5 A;  2C3T A;  4K0N A;  4MPF A;  5ENU A;  1M9A A;  5D93 A;  1JFU A;  3UJ1 A;  2YV7 A;  3RBT A;  1NM3 A;  2FD3 A;  1YKC A;  5IO0 A;  3CTF A;  4GLT A;  4MA9 A;  2K9F A;  4ZL7 A;  3ZML A;  1GLQ A;  2RM6 A;  4ZBB A;  2B1K A;  1XW9 A;  4NMU A;  2GSR A;  1F9M A;  5KOX A;  2MZC A;  2OBK A;  3TJF A;  3KD0 A;  2GVP A;  5F07 A;  3L9S A;  1B8X A;  1I5G A;  3GYK A;  4JE1 A;  1OE8 A;  2JZS A;  2JAC A;  2P5Q A;  1ZMA A;  5CRH A;  1SU9 A;  3APS A;  4BL7 A;  5ECQ B;  4BWS A;  1LU4 A;  2HLS A;  1OKD A;  1FHE A;  2MBT A;  6GSU A;  1HNC A;  2H76 A;  5B8B A;  1Q4J A;  3D0Z A;  2B3S A;  5KOW A;  19GS A;  3IK7 A;  5B8A A;  2BTO T;  1M99 A;  5GST A;  1PQN A;  1FB0 A;  3IA1 A;  3TUE A;  2YN1 A;  1Z5Y E;  4MAB A;  4IKH A;  3UIW A;  2L4Q A;  2V6O A;  5A4V A;  3D4T A;  4EKZ A;  3ZIV A;  2VL2 C;  3AY8 A;  4EIP A;  3A5I A;  3BCK A;  3D6I A;  4HQS A;  5IMZ A;  2GZP A;  2B7K A;  2DLX A;  3GA4 A;  1GH2 A;  4BIK A;  3F0I A;  1XWK A;  3DYR A;  2LQO A;  3HA9 A;  3C1R A;  3KTL A;  4OFT A;  2A2R A;  3IR4 A;  3IHG A;  3H4K A;  3HXS A;  3ZTL A;  5DAK B;  2H74 A;  4EXJ A;  4POL A;  2V32 A;  3U5R E;  2QA2 A;  2GSQ A;  1GSY A;  5D9T A;  2PBJ A;  4Z7X A;  2VIM A;  4PTS A;  1VF4 A;  5ABR A;  1U6T A;  2F9S A;  5C00 A;  2HT9 A;  3LJR A;  4IQA A;  2DKI A;  3GUS A;  3LYP A;  4WBR D;  3VWV A;  3L78 A;  4KGI A;  3ZVJ A;  3HJO A;  2GQL A;  3EC3 A;  2QGV A;  1B9X C;  1VF3 A;  4XRA A;  4HI7 A;  2H73 A;  2EIQ A;  4LMW A;  2DBC A;  3QOU A;  2PU9 C;  1UVZ A;  2R2J A;  3G7I A;  3NOF A;  4TXO A;  1B4P A;  4FYU A;  4NXI A;  1EP8 A;  2PPT A;  2EC4 A;  3TCO A;  5DQS A;  5DBQ A;  4XHM A;  1BQ7 A;  4Z2R A;  2FNO A;  2I3Y A;  2HZF A;  1CQG A;  2HRA A;  4TR4 A;  1SL2 B;  2GS3 A;  5L71 A;  1SL1 B;  3F9U A;  4X1U A;  3M3M A;  3GH9 A;  4GST A;  1X5D A;  1X9S B;  4OWY A;  1GTU A;  4TN8 A;  4ID0 A;  3LXT A;  1WOU A;  2ON7 A;  2A4H A;  1AC1 A;  2LJK A;  3KZQ A;  4TVE A;  1TOF A;  2AB6 A;  3F4R A;  2V41 A;  2B6M A;  2IL3 A;  2H6X A;  2WRT A;  5JWQ B;  4K2D A;  3QAW A;  2D2Z A;  2PMT A;  1GSU A;  3F4T A;  3HCZ A;  1VRS D;  4MH2 A;  4ZIL A;  4HDE A;  4IP1 A;  3LQ7 A;  3I6A A;  3MYD A;  4N0Z A;  3G9B A;  4ZIJ A;  4CHS A;  8GSS A;  2R0G A;  4BWQ A;  5JCU A;  1V57 A;  1K0M A;  5CRE A;  3GX0 A;  4BVX A;  1M2D A;  4G10 A;  5J41 A;  1EV4 A;  3DKS A;  4RI7 A;  3QAG A;  4YKG A;  3KEB A;  4LA1 A;  2NVL A;  4CY6 A;  3TKQ A;  2X8G A;  2OE3 A;  4XS6 A;  2B5X A;  3EE2 A;  1GSE A;  4YH2 A;  5ELA A;  2LRC A;  4ECI A;  3IE3 A;  5J5N A;  5ECP B;  3TKR A;  4I97 A;  3DML A;  1K0A A;  1GNW A;  4YAV A;  1FB6 A;  3M8N A;  2C80 A;  3OR5 A;  2IWT A;  3FR3 A;  5FWG A;  2VO4 A;  2E7P A;  4EO3 A;  2JAD A;  1KBN A;  4O92 A;  3ZZX A;  3EPT A;  3VI7 A;  3FZ4 A;  1PL2 A;  4FIW A;  2JZT A;  4POB A;  4I5Q A;  3TRQ A;  5IOW A;  2X8H A;  3J7Y k;  1PRX A;  1YDK A;  2FLS A;  1K3Y A;  2H19 A;  1XWC A;  2H72 A;  2E0Q A;  1TXX A;  2NDO A;  3ZIT A;  1EEM A;  3ME7 A;  2IFQ A;  5AIS A;  3GMF A;  3VWW A;  2EIO A;  1G7O A;  4Q5Q A;  1K3L A;  3F63 A;  1TI1 A;  2I4A A;  3EIN A;  2L6C A;  2QKE A;  1K0B A;  2WGR A;  4ICY A;  4RI6 A;  5HFG A;  4TR1 B;  4MH3 A;  3ZMK A;  1YEP A;  2DMM A;  6GST A;  3C7M A;  1Z7R A;  1A0F A;  2I9H A;  3HDC A;  1F37 A;  2BMX A;  3PR8 A;  4YKF A;  1YJ6 A;  5FT3 A;  1JHB A;  2GST A;  2UZ8 A;  4ZB9 A;  3Q74 A;  1B4Q A;  4PNF A;  2XBQ A;  5J9C A;  2DJ1 A;  2ON5 A;  1S3A A;  3P7X A;  1WIK A;  3KCM A;  1GSF A;  2XC2 A;  4V2M A;  5JCG A;  5IPG A;  2OE1 A;  4IVF A;  1BYE A;  4ECJ A;  2LS5 A;  5JWR B;  2LJA A;  2IJY A;  5JWO B;  2VLT A;  2YWN A;  2REM A;  2C0F A;  4DSS A;  1M7T A;  2A2P A;  3K8N A;  5B6N A;  1OC3 A;  1OC9 A;  2LST A;  2JSY A;  3RPN A;  5ID2 A;  4IW9 A;  1XWG A;  1T1V A;  2B1L A;  3VWU A;  1AW9 A;  1Z6M A;  1Z9H A;  1AXD A;  4GCI A;  2GLR A;  3ZIJ A;  1EOH A;  3LWA A;  1TK8 B;  4N10 A;  1DUG A;  3KXO A;  3O3T A;  4E8H A;  5KN0 A;  5ID2 B;  3N5O A;  1NSW A;  3APQ A;  5H5R A;  1BAY A;  3RHC A;  1E2Y A;  2YAN A;  1W4V A;  2JL4 A;  1GTI A;  4ML6 A;  4V1A p;  5BRT A;  1XW5 A;  1ERT A;  2WCI A;  5ECN B;  2V6K A;  1TU8 A;  2CVB A;  4TRX A;  2VD0 A;  1ZYP A;  3L0H A;  3VWX A;  4F0B A;  2IMI A;  5INY A;  1SKW B;  1T00 A;  3CSI A;  2EIR A;  2ZCT A;  1Z6N A;  3DD3 A;  3V1W A;  1U3A A;  4K7I A;  1DSB A;  2QSI A;  3GTU B;  1G6W A;  4CW9 A;  3BD2 A;  3A3T A;  1J0F A;  4TR3 A;  3GL3 A;  4FQU A;  4WR4 A;  2H6Z A;  4EDY A;  4NV5 A;  2O87 A;  3PH9 A;  4L5O A;  1M3J A;  5DJL A;  1ILO A;  1OAZ A;  5IIZ A;  1QFN A;  1TI3 A;  2PUK C;  5IMV A;  3GNJ A;  3CRT A;  1EGR A;  1O6J A;  4EUY A;  2H01 A;  3W8S A;  4K9Z A;  1TW9 A;  4Q5F A;  2YCD A;  3G7J A;  4J56 E;  4ULX A;  5B7C A;  5KEJ A;  2F51 A;  2VL2 A;  4J2F A;  2K8S A;  3CBU A;  5IM9 A;  3ZFL A;  2FA8 A;  4PQH A;  1R5A A;  3VI5 A;  3ZFB A;  4XTS A;  3ZRE A;  3QMX A;  3BCI A;  2L4C A;  1KNG A;  1K0N A;  2WFC A;  4XRD A;  3FR6 A;  1R4W A;  3IC4 A;  1V98 A;  5DVB A;  1ZCP A;  1U3I A;  2FA4 A;  1SK2 A;  3US3 A;  2YV9 A;  1QUW A;  3VLN A;  2QC7 A;  4HQZ A;  1QQ2 A;  3N9J A;  4WF4 A;  4JR6 A;  5A4U A;  4RQR A;  2BJX A;  1GSS A;  3KIJ A;  4YQV A;  5CRD A;  4EE0 A;  3TKP A;  1Z7P A;  3MAK A;  3FY7 A;  1NHY A;  1B48 A;  1OC8 A;  1Z3E A;  4USS A;  5E4W A;  2QA1 A;  1YEX A;  1XFL A;  2RUE A;  2GQK A;  3QDN A;  2L5L A;  2L59 A;  3CXG A;  3TRX A;  1A2M A;  4WR5 A;  5DQY A;  3APO A;  4RUV A;  2IMF A;  2OBI A;  2WB9 A;  3GL5 A;  1X9M B;  4POK A;  4HZ4 A;  1ACV A;  1PGT A;  3TOT A;  1AIU A;  4MJB A;  2GT6 A;  5FHI A;  22GS A;  5EY6 A;  1C72 A;  5KN3 A;  4K8M A;  4AJ8 A;  2PER A;  4CY8 A;  1JZR A;  2G2Q A;  2PGT A;  3MSZ A;  2M80 A;  4IP6 A;  3RAZ A;  5GAP D;  3M9J A;  2WUL A;  1YY7 A;  3C71 A;  5ECL B;  3C1S A;  5G31 A;  1K0C A;  4PQ1 A;  4F82 A;  1GSD A;  1A8L A;  4KND A;  5DAK A;  3D21 A;  3TRP A;  4K5R A;  2VCX A;  2X8C A;  2KP1 A;  4PUF C;  2HRF A;  1BJX A;  4GTU A;  4L5L A;  3PPU A;  2IPA A;  2LNS A;  5COH A;  3UVT A;  1BX9 A;  5D9W A;  1SJZ A;  5IOX A;  2YJ7 A;  1F2E A;  4KA0 A;  4X43 A;  3QD9 A;  1GP1 A;  1THX A;  4K7O A;  2VLV A;  2FWF A;  2JZR A;  1W89 A;  2WZ9 A;  4N0V A;  3FMW A;  5IMF A;  2X64 A;  1H4O A;  2MMZ A;  4IJ3 A;  14GS A;  1S3C A;  1KTE A;  3ERG A;  4EVM A;  4HUA A;  5HFI A;  1KEB A;  1XOB A;  3J7Y b;  2GTU A;  2KUC A;  2R0C A;  1YF0 A;  4D73 B;  1TK0 B;  4OO5 A;  3ZLP A;  2TIR A;  2VCW A;  2HRK A;  5HR3 A;  1M2B A;  4GRF A;  1IYH A;  3P2A A;  3UAP A;  2A2S A;  4K5S A;  1PFO A;  2VUP A;  2B7J A;  4MPG A;  4EF0 A;  2H66 A;  4I2T A;  1RK4 A;  2H30 A;  4AJ6 A;  3GN3 A;  3GFK A;  5DAL B;  3ED3 A;  5ECK B;  1XBS A;  2IN3 A;  1PSQ A;  4KDY A;  2AV4 A;  4JRR A;  4HZ2 A;  2DJK A;  1V40 A;  3CYN A;  1SYX A;  2PVQ A;  3F6D A;  1GL8 A;  5IMC A;  4HEA 2;  5CP1 A;  1O81 A;  4MP4 A;  2R6K A;  1O8W A;  5IMD A;  1ERU A;  2F3M A;  3QCP A;  4GF0 A;  4NHW A;  4PQI A;  4LL1 B;  3HD5 A;  1Y6E A;  1ZGN A;  3L4N A;  4POM A;  4N30 A;  3LW9 A;  3KGK A;  3IAS 2;  2YZU A;  4L8E A;  1TRS A;  4ECC A;  2HFD A;  3E3E A;  1GTB A;  1S3R A;  1IYI A;  5ELG A;  4O32 A;  4ZL8 A;  5C04 A;  3TKS A;  1GTA A;  1DBY A;  2H1G A;  2H6Y A;  4MZC A;  4OFM A;  2KHP A;  3DWV A;  2GGT A;  3E0U A;  4ZBA A;  1MD4 A;  3H8Q A;  2HNL A;  1TTZ A;  2GQM A;  1FOH A;  2VCT A;  1PD2 1;  4KCE A;  2FY6 A;  3QAV A;  2YZH A;  1SK1 A;  1K0D A;  1XZO A;  2TRC P;  5ECO B;  2CZ2 A;  4PNG A;  4G0K A;  1USB A;  5B6M A;  3PGT A;  2DC5 A;  5LD0 A;  3FRC A;  3TJG A;  2KP2 A;  1MTC A;  1U88 A;  1V2A A;  1N2A A;  3L9U A;  3HVX A;  2MMO A;  4OO4 A;  2N5A A;  2H70 A;  4BVY B;  4ISD A;  2HSY A;  3I9V 2;  4KB3 A;  3EVI A;  4EL1 A;  3HHV A;  5LNK e; 
#chains in the Genus database with same CATH homology
 3TJJ A;  1OVN A;  1TRU A;  1O8X A;  2HI7 A;  4MJC A;  20GS A;  3LSZ A;  3D4M A;  4K0G A;  5AN1 A;  4PXO A;  3RHB A;  4TR1 A;  4AGS A;  1GUM A;  3TJB A;  2RM5 A;  4HU7 A;  4PUR A;  1SK0 A;  2FGX A;  4YQU A;  2CX4 A;  2J23 A;  3C8E A;  13GS A;  3ZL5 A;  1YKA A;  4FYB A;  1LBK A;  2VL9 A;  2CX3 A;  2H1D A;  1CQH A;  3HJM A;  1TRV A;  4MNN A;  2IIY A;  11GS A;  1AQW A;  3IDV A;  4QQ7 A;  2LRN A;  3IXR A;  3FEU A;  1MD3 A;  4KDU A;  4QL7 A;  3UBK A;  3M9K A;  1GLP A;  1TK5 B;  3IC8 A;  4G0I A;  4DVC A;  3WT1 A;  2R5G A;  2H1B A;  1GUK A;  2YP6 A;  2O85 A;  5EPF A;  4EDZ A;  5ECR B;  3CSJ A;  2IMK A;  4XS4 B;  2YJH A;  5H5S A;  2CZ3 A;  1XVW A;  4MCU A;  3GKM A;  5CYY A;  4IS0 A;  1WP0 A;  3F3R A;  2PWJ A;  3UVH A;  2N5F A;  1H75 A;  3FZ9 A;  3Q18 A;  1YQ1 A;  3I69 A;  4IEL A;  3UEM A;  4I8B A;  2ALB A;  1EP7 A;  2RLI A;  3LG6 A;  4HOJ A;  4K7N A;  4PUA A;  1U87 A;  2CAI A;  1XCC A;  2HYX A;  1PKW A;  1Y25 A;  5G1K A;  4F9Z A;  3MDK A;  1ML6 A;  2YOI A;  5ECM B;  2OKA A;  2R37 A;  2VCV A;  1QXH A;  3UAR A;  2CAQ A;  3P8W A;  5HFK A;  1MDI A;  3WYW A;  1PX6 A;  3GSS A;  1VGL A;  1V9W A;  1A8Y A;  4IHU A;  2XBI A;  3KM6 A;  4NPB A;  3BJ5 A;  4G2E A;  1OE7 A;  4MLY A;  4E8E A;  3GH6 A;  7GSS A;  2HE3 A;  3GTU A;  2KOK A;  3EWL A;  4DSR A;  2LUS A;  4IGJ A;  5BMU A;  3UL3 A;  1UA5 A;  1YF1 A;  3ERF A;  3FKF A;  1N8J A;  3KP9 A;  4N11 A;  4LMV A;  2JSZ A;  4I2U A;  4TR0 A;  5IPH A;  5ECI B;  1VF2 A;  3HYP A;  2E2G A;  1AAZ A;  2N5B A;  1NW2 A;  2K6V A;  2OE0 A;  1SYR A;  3NZN A;  4K1F A;  3GKK A;  1G0T A;  3GX8 A;  3WGE A;  4ACS A;  6GSW A;  1AUC A;  4MZB A;  4MF7 A;  1WPI A;  1O85 A;  1AQV A;  2HZE B;  6GSS A;  5CNW A;  1QK8 A;  3F8U A;  4GWR A;  1B9Y C;  4JR4 A;  5EL8 A;  2P5R A;  2DJ3 A;  3GKX A;  1A2J A;  1I9D A;  3IRA A;  3HY2 A;  1HNB A;  4YQM A;  2VCQ A;  1TKD B;  4F0C A;  2RUF A;  2Z9S A;  1T4Z A;  3ZVJ D;  1PX7 A;  3QFA C;  3F3Q A;  5H5Q A;  1HNA A;  3BBY A;  3M0F A;  3ME8 A;  1GUH A;  2R4V A;  3LYK A;  4MMM A;  4ZBD A;  5G30 A;  1TRW A;  4OCF A;  4XS1 A;  1WRY A;  3LOR A;  1DE1 A;  5AIV A;  4XIH A;  1X0R A;  2C3Q A;  4L0W A;  1HYU A;  5CRG A;  1F3B A;  1QGV A;  1TJD A;  3EU3 A;  2H8L A;  5LCZ A;  2DML A;  3O6T A;  3G7Y A;  5HR2 A;  3EU4 A;  2C0G A;  1GRX A;  9GSS A;  3DIE A;  3O76 A;  4WET A;  2FUG 2;  5A5K A;  3MIX A;  4ZXG A;  4HJM A;  2OAC A;  2CV4 A;  6GSV A;  3FK8 A;  1PKZ A;  3WGD A;  1SEN A;  3D22 A;  2VM1 A;  5DJM A;  2G0F A;  3WT2 A;  4NWY A;  5D8I A;  4Z2T A;  3HVV A;  2LV3 A;  1G7E A;  2FWE A;  3EYT A;  5GZZ B;  3QPM A;  3LXZ A;  4ZB6 A;  2LNT A;  5G1L A;  3H79 A;  1PN9 A;  3BOA A;  2LRT A;  1ERW A;  4IQ1 A;  1MDJ A;  3VPT A;  1XWB A;  3FZA A;  2WS2 A;  3IBH A;  2O8V B;  1JZO A;  2V2G A;  4IN0 A;  2F8A A;  2MYG A;  5IO2 A;  1GNE A;  1MDK A;  2O7K A;  3FHK A;  1XOA A;  4DSQ A;  4LLR A;  4QL9 A;  4OD7 A;  1T7P B;  2YPM A;  1G6Y A;  4GSN A;  3NIV A;  1GSQ A;  2CQ9 A;  4NHZ A;  1EZK A;  4BL7 B;  4FYC A;  2FWG A;  1TP9 A;  1XW6 A;  3DRN A;  3VPQ A;  2PN8 A;  1R26 A;  5KN1 A;  4Q5N A;  1LJR A;  1GUL A;  1QMV A;  4JBB A;  4IJI A;  2DSA A;  5DCG A;  3UOM A;  1WWJ A;  2CVK A;  1ZL9 A;  1XXU A;  2GSS A;  3H93 A;  1ZYQ B;  5G2Z A;  2C3N A;  3DVW A;  1NHO A;  3A2X A;  2HRN A;  4JED A;  3A2V A;  1X9W B;  2WJU A;  3ERW A;  4PX1 A;  2VM2 A;  4KDX A;  4NV2 A;  4F03 A;  3UBL A;  3DXB A;  4F2I A;  2OAD A;  2M46 A;  1EGO A;  4KCA A;  4KSM A;  4WKW A;  3TDG A;  4ZL9 A;  4EC0 A;  1PL1 A;  3GKN A;  4MJE A;  2X99 A;  3MNG A;  2IMD A;  3L9V A;  2E2M A;  2L6D A;  4D73 A;  2HSH A;  2LQQ A;  4I6X A;  1PN0 A;  1HD2 A;  2V1M A;  1WMJ A;  3HZ4 A;  4ECB A;  3WD6 A;  3RDW A;  1OYJ A;  1UN2 A;  4KAE A;  1JLW A;  3TB2 A;  2ES7 A;  2OJL A;  5DAL A;  2M72 A;  1WJK A;  1F6M C;  3KJY A;  2NPB A;  4P3Y B;  2H71 A;  4PGT A;  4K2X A;  2C1Y A;  3P90 A;  3DGQ A;  1JLV A;  2LJR A;  17GS A;  5F06 A;  3HJP A;  1R5P A;  2XPD A;  3EMX A;  1SL0 B;  4FO5 A;  4K6X A;  3GUR A;  3ZYW A;  1EWX A;  4RQX A;  1K0O A;  4FH8 A;  4TXO B;  2DJ0 A;  2L57 A;  2CT6 A;  2C4J A;  2F8F A;  3TGZ A;  4JZQ A;  5F0G A;  5IQY A;  4TKY A;  2OA7 A;  1DE2 A;  1XPV A;  3R3E A;  3CMI A;  4OCE A;  5CO3 A;  1M9B A;  4KE3 A;  4DEJ A;  1V58 A;  3ISO A;  2AHE A;  2YWI A;  2B5E A;  1BG5 A;  3Q19 A;  1ON4 A;  5JCW A;  5AGY A;  2H0H A;  10GS A;  1ZOF A;  1A24 A;  3RPP A;  3KP8 A;  2B5Y A;  2AUV A;  1ZYE A;  4V1A g;  1X5C A;  2X4A A;  5DCH A;  2RII A;  1FVK A;  2DKH A;  2XHF A;  2K18 A;  2YWO A;  2PVO C;  5EVO A;  5J9B A;  1E6B A;  3LEF A;  2FCH A;  1THO A;  1XIY A;  3D5J A;  16GS A;  2DJJ A;  1SD8 A;  3HKR A;  4BA7 A;  1M0U A;  2R0P A;  3E9J B;  5J4U A;  1K3O A;  3QFB C;  1URM A;  4OFN A;  1ZZY A;  6GSX A;  2FWH A;  2HXK A;  3A2W A;  4BVX B;  4BVY A;  4O7H A;  3HVS A;  4HU9 A;  2AAW A;  3VFI A;  12GS A;  2GT5 A;  2LTK A;  2ZNM A;  1SD9 A;  4GQC A;  2NTO A;  2AYT A;  4NAX A;  1MEK A;  2P31 A;  4KSO A;  5ECH B;  3KTB A;  2VLU A;  4Z2U A;  2NBS A;  4AF2 A;  1FO5 A;  1PA3 A;  1A23 A;  4KUN A;  5CRW A;  4G19 A;  4X4J A;  5E59 A;  2YWM A;  5HQP A;  2C0E A;  1RQM A;  3FYG A;  4LL4 B;  4G0L A;  3TKS E;  1A0R P;  3IAM 2;  2H75 A;  2VAF A;  3S9F A;  2VL3 A;  3DEX A;  1ERV A;  1FW1 A;  1GWC A;  4MF6 A;  3EUR A;  4GSS A;  1O7U A;  3VUR A;  1EOG A;  4TOP A;  4V2L A;  1Q98 A;  2YNX A;  5G5F A;  4KH7 A;  4XS4 A;  3LFL A;  3GIX A;  18GS A;  1WE0 A;  2IFQ B;  4WBJ A;  3SWL A;  2JU5 A;  3IPZ A;  5GSS A;  1FVJ A;  3GHA A;  1O73 A;  3CSH A;  1AQX A;  2C0D A;  4EIQ A;  4H86 A;  1JZW A;  3TKS C;  3QR6 A;  3H1N A;  5IMA A;  4YAP A;  5D9X A;  2GZY A;  3IHQ A;  2MMN A;  2HSM A;  3TJK A;  1SKS B;  5CAX A;  1T3B A;  5J3R A;  1XWA A;  3FR9 A;  1T4Y A;  4WF5 A;  2P0G A;  4X0X A;  3CRU A;  5HR0 A;  3C73 A;  5DDL A;  1F3A A;  3W6G A;  5ECS A;  2GDR A;  3TOU A;  4BPY A;  1A2L A;  2DIY A;  2CVD A;  4MF5 A;  5A4W A;  2MBS A;  3FW2 A;  3HZ8 A;  4KW6 A;  5G5E A;  2IME A;  4O5R A;  5KN2 A;  4V2N A;  6GSY A;  1J08 A;  4XCS A;  2VD1 A;  4ZB8 A;  4GXZ A;  1PMT A;  4IBP A;  1FOV A;  1VF1 A;  2FHE A;  2L5O A;  1J9B A;  4DSS B;  2C8U A;  1R7H A;  4GQF A;  1EV9 A;  2H0G A;  4MJA A;  5F05 A;  3KH7 A;  4Q5R A;  4A5P A;  4JU5 A;  2DJ2 A;  1ZYN A;  4MDC A;  3M1G A;  2H1A A;  1OC9 B;  1SJI A;  2GZZ A;  3R2Q A;  5AIX A;  4TW5 A;  3Q6O A;  3ZRD A;  4CDO A;  1RW1 A;  3GST A;  2KLX A;  2VOC A;  3F4S A;  3U6V A;  1FAA A;  2LKU A;  5GAN D;  1OKT A;  2MMA A;  1FG4 A;  3VK9 A;  2TRX A;  5D73 A;  3MWH A;  1ST9 A;  2J9H A;  2HZE A;  4OMV A;  1XVQ A;  4J57 E;  2CA8 A;  1SJ6 A;  3EMP A;  4MK3 A;  3IK9 A;  4KF9 A;  2O89 A;  4WXT A;  4O5U A;  2I1U A;  2XPE A;  2H0I A;  3GRX A;  3SBC A;  4G9H A;  1X5E A;  2I81 A;  5HR1 A;  4HJ2 A;  5D9V A;  4ILF A;  2VCZ A;  3PIN A;  4HS1 A;  3UMA A;  4AJ7 A;  1EEJ A;  4ML1 A;  4O5Q A;  3KMO A;  3A5W A;  2AJQ B;  3KMN A;  3DVX A;  4L0U A;  3F6F A;  5D96 A;  1ABA A;  3CTG A;  2X49 A;  3WGX A;  2LEG A;  2ZUP A;  4TXV A;  1BED A;  1T8E B;  1SKR B;  3IV4 A;  1TDI A;  3JCM L;  1TU7 A;  3W8J A;  3LGC A;  3GV1 A;  2WDU A;  3IOS A;  5F8B A;  2DIZ A;  1UC7 A;  4MZW A;  1HQO A;  2A4V A;  2K8V A;  1S3D A;  4WEY A;  1JZD A;  3I43 A;  1YZX A;  1M2A A;  3KH9 A;  2R3X A;  4KX4 A;  3FZ5 A;  2C3T A;  4K0N A;  4MPF A;  5ENU A;  1M9A A;  5D93 A;  1JFU A;  3UJ1 A;  2YV7 A;  3RBT A;  1NM3 A;  2FD3 A;  1YKC A;  5IO0 A;  3CTF A;  4GLT A;  4MA9 A;  2K9F A;  4ZL7 A;  3ZML A;  1GLQ A;  2RM6 A;  4ZBB A;  2B1K A;  1XW9 A;  4NMU A;  2GSR A;  1F9M A;  5KOX A;  2MZC A;  2OBK A;  3TJF A;  3KD0 A;  2GVP A;  5F07 A;  3L9S A;  1B8X A;  1I5G A;  3GYK A;  4JE1 A;  1OE8 A;  2JZS A;  2JAC A;  2P5Q A;  1ZMA A;  5CRH A;  1SU9 A;  3APS A;  4BL7 A;  5ECQ B;  4BWS A;  1LU4 A;  2HLS A;  1OKD A;  1FHE A;  2MBT A;  6GSU A;  1HNC A;  2H76 A;  5B8B A;  1Q4J A;  3D0Z A;  2B3S A;  5KOW A;  19GS A;  3IK7 A;  5B8A A;  2BTO T;  1M99 A;  5GST A;  1PQN A;  1FB0 A;  3IA1 A;  3TUE A;  2YN1 A;  1Z5Y E;  4MAB A;  4IKH A;  3UIW A;  2L4Q A;  2V6O A;  5A4V A;  3D4T A;  4EKZ A;  3ZIV A;  2VL2 C;  3AY8 A;  4EIP A;  3A5I A;  3BCK A;  3D6I A;  4HQS A;  5IMZ A;  2GZP A;  2B7K A;  2DLX A;  3GA4 A;  1GH2 A;  3F0I A;  1XWK A;  3DYR A;  2LQO A;  3HA9 A;  3C1R A;  3KTL A;  4OFT A;  2A2R A;  3IR4 A;  3IHG A;  3H4K A;  3HXS A;  3ZTL A;  5DAK B;  2H74 A;  4EXJ A;  4POL A;  2V32 A;  3U5R E;  2QA2 A;  2GSQ A;  1GSY A;  5D9T A;  2PBJ A;  4Z7X A;  2VIM A;  4PTS A;  1VF4 A;  5ABR A;  1U6T A;  2F9S A;  5C00 A;  2HT9 A;  3LJR A;  4IQA A;  2DKI A;  3GUS A;  3LYP A;  4WBR D;  3VWV A;  3L78 A;  4KGI A;  3ZVJ A;  3HJO A;  2GQL A;  3EC3 A;  2QGV A;  1B9X C;  1VF3 A;  4XRA A;  4HI7 A;  2H73 A;  2EIQ A;  4LMW A;  2DBC A;  3QOU A;  2PU9 C;  1UVZ A;  2R2J A;  3G7I A;  3NOF A;  4TXO A;  1B4P A;  4FYU A;  4NXI A;  1EP8 A;  2PPT A;  2EC4 A;  3TCO A;  5DQS A;  5DBQ A;  4XHM A;  1BQ7 A;  4Z2R A;  2FNO A;  2I3Y A;  2HZF A;  1CQG A;  2HRA A;  4TR4 A;  1SL2 B;  2GS3 A;  5L71 A;  1SL1 B;  3F9U A;  4X1U A;  3M3M A;  3GH9 A;  4GST A;  1X5D A;  1X9S B;  4OWY A;  1GTU A;  4TN8 A;  4ID0 A;  3LXT A;  1WOU A;  2ON7 A;  2A4H A;  1AC1 A;  2LJK A;  3KZQ A;  4TVE A;  1TOF A;  2AB6 A;  3F4R A;  2V41 A;  2B6M A;  2IL3 A;  2H6X A;  2WRT A;  5JWQ B;  4K2D A;  3QAW A;  2D2Z A;  2PMT A;  1GSU A;  3F4T A;  3HCZ A;  1VRS D;  4MH2 A;  4ZIL A;  4HDE A;  4IP1 A;  3LQ7 A;  3I6A A;  3MYD A;  4N0Z A;  3G9B A;  4ZIJ A;  4CHS A;  8GSS A;  2R0G A;  4BWQ A;  5JCU A;  1V57 A;  1K0M A;  5CRE A;  3GX0 A;  4BVX A;  1M2D A;  4G10 A;  5J41 A;  1EV4 A;  3DKS A;  4RI7 A;  3QAG A;  4YKG A;  3KEB A;  4LA1 A;  2NVL A;  4CY6 A;  3TKQ A;  2X8G A;  2OE3 A;  4XS6 A;  2B5X A;  3EE2 A;  1GSE A;  4YH2 A;  5ELA A;  2LRC A;  4ECI A;  3IE3 A;  5J5N A;  5ECP B;  3TKR A;  4I97 A;  3DML A;  1K0A A;  1GNW A;  4YAV A;  1FB6 A;  3M8N A;  2C80 A;  3OR5 A;  2IWT A;  3FR3 A;  5FWG A;  2VO4 A;  2E7P A;  4EO3 A;  2JAD A;  1KBN A;  4O92 A;  3ZZX A;  3EPT A;  3VI7 A;  3FZ4 A;  1PL2 A;  4FIW A;  2JZT A;  4POB A;  4I5Q A;  3TRQ A;  5IOW A;  2X8H A;  3J7Y k;  1PRX A;  1YDK A;  2FLS A;  1K3Y A;  2H19 A;  1XWC A;  2H72 A;  2E0Q A;  1TXX A;  2NDO A;  3ZIT A;  1EEM A;  3ME7 A;  2IFQ A;  5AIS A;  3GMF A;  3VWW A;  2EIO A;  1G7O A;  4Q5Q A;  1K3L A;  3F63 A;  1TI1 A;  2I4A A;  3EIN A;  2L6C A;  2QKE A;  1K0B A;  2WGR A;  4ICY A;  4RI6 A;  5HFG A;  4TR1 B;  4MH3 A;  3ZMK A;  1YEP A;  2DMM A;  6GST A;  3C7M A;  1Z7R A;  1A0F A;  2I9H A;  3HDC A;  1F37 A;  2BMX A;  3PR8 A;  4YKF A;  1YJ6 A;  5FT3 A;  1JHB A;  2GST A;  2UZ8 A;  4ZB9 A;  3Q74 A;  1B4Q A;  4PNF A;  2XBQ A;  5J9C A;  2DJ1 A;  2ON5 A;  1S3A A;  3P7X A;  1WIK A;  3KCM A;  1GSF A;  2XC2 A;  4V2M A;  5JCG A;  5IPG A;  2OE1 A;  4IVF A;  1BYE A;  4ECJ A;  2LS5 A;  5JWR B;  2LJA A;  2IJY A;  5JWO B;  2VLT A;  2YWN A;  2REM A;  2C0F A;  4DSS A;  1M7T A;  2A2P A;  3K8N A;  5B6N A;  1OC3 A;  1OC9 A;  2LST A;  2JSY A;  3RPN A;  5ID2 A;  4IW9 A;  1XWG A;  1T1V A;  2B1L A;  3VWU A;  1AW9 A;  1Z6M A;  1Z9H A;  1AXD A;  4GCI A;  2GLR A;  3ZIJ A;  1EOH A;  3LWA A;  1TK8 B;  4N10 A;  1DUG A;  3KXO A;  3O3T A;  4E8H A;  5KN0 A;  5ID2 B;  3N5O A;  1NSW A;  3APQ A;  5H5R A;  1BAY A;  3RHC A;  1E2Y A;  2YAN A;  1W4V A;  2JL4 A;  1GTI A;  4ML6 A;  4V1A p;  5BRT A;  1XW5 A;  1ERT A;  2WCI A;  5ECN B;  2V6K A;  1TU8 A;  2CVB A;  4TRX A;  2VD0 A;  1ZYP A;  3L0H A;  3VWX A;  4F0B A;  2IMI A;  5INY A;  1SKW B;  1T00 A;  3CSI A;  2EIR A;  2ZCT A;  1Z6N A;  3DD3 A;  3V1W A;  1U3A A;  4K7I A;  1DSB A;  2QSI A;  3GTU B;  1G6W A;  4CW9 A;  3BD2 A;  3A3T A;  1J0F A;  4TR3 A;  3GL3 A;  4FQU A;  4WR4 A;  2H6Z A;  4EDY A;  4NV5 A;  2O87 A;  3PH9 A;  4L5O A;  5DJL A;  1ILO A;  1OAZ A;  5IIZ A;  1QFN A;  1TI3 A;  2PUK C;  5IMV A;  3GNJ A;  3CRT A;  1EGR A;  1O6J A;  4EUY A;  2H01 A;  3W8S A;  4K9Z A;  1TW9 A;  4Q5F A;  2YCD A;  3G7J A;  4J56 E;  4ULX A;  5B7C A;  5KEJ A;  2F51 A;  2VL2 A;  4J2F A;  2K8S A;  3CBU A;  5IM9 A;  3ZFL A;  2FA8 A;  4PQH A;  1R5A A;  3VI5 A;  3ZFB A;  4XTS A;  3ZRE A;  3QMX A;  3BCI A;  2L4C A;  1KNG A;  1K0N A;  2WFC A;  4XRD A;  3FR6 A;  1R4W A;  3IC4 A;  1V98 A;  5DVB A;  1ZCP A;  1U3I A;  2FA4 A;  1SK2 A;  3US3 A;  2YV9 A;  1QUW A;  3VLN A;  2QC7 A;  4HQZ A;  1QQ2 A;  3N9J A;  4WF4 A;  4JR6 A;  5A4U A;  4RQR A;  2BJX A;  1GSS A;  3KIJ A;  4YQV A;  5CRD A;  4EE0 A;  3TKP A;  1Z7P A;  3MAK A;  3FY7 A;  1NHY A;  1B48 A;  1OC8 A;  1Z3E A;  4USS A;  5E4W A;  2QA1 A;  1YEX A;  1XFL A;  2RUE A;  2GQK A;  3QDN A;  2L5L A;  2L59 A;  3CXG A;  3TRX A;  1A2M A;  4WR5 A;  5DQY A;  3APO A;  4RUV A;  2IMF A;  2OBI A;  2WB9 A;  3GL5 A;  1X9M B;  4POK A;  4HZ4 A;  1ACV A;  1PGT A;  3TOT A;  1AIU A;  4MJB A;  2GT6 A;  5FHI A;  22GS A;  5EY6 A;  1C72 A;  5KN3 A;  4K8M A;  4AJ8 A;  2PER A;  4CY8 A;  1JZR A;  2G2Q A;  2PGT A;  3MSZ A;  2M80 A;  4IP6 A;  3RAZ A;  5GAP D;  3M9J A;  2WUL A;  1YY7 A;  3C71 A;  5ECL B;  3C1S A;  5G31 A;  1K0C A;  4PQ1 A;  4F82 A;  1GSD A;  1A8L A;  4KND A;  5DAK A;  3D21 A;  3TRP A;  4K5R A;  2VCX A;  2X8C A;  2KP1 A;  4PUF C;  2HRF A;  1BJX A;  4GTU A;  4L5L A;  3PPU A;  2IPA A;  2LNS A;  5COH A;  3UVT A;  1BX9 A;  5D9W A;  1SJZ A;  5IOX A;  2YJ7 A;  1F2E A;  4KA0 A;  4X43 A;  3QD9 A;  1GP1 A;  1THX A;  4K7O A;  2VLV A;  2FWF A;  2JZR A;  1W89 A;  2WZ9 A;  4N0V A;  3FMW A;  5IMF A;  2X64 A;  1H4O A;  2MMZ A;  4IJ3 A;  14GS A;  1S3C A;  1KTE A;  3ERG A;  4EVM A;  4HUA A;  5HFI A;  1KEB A;  1XOB A;  3J7Y b;  2GTU A;  2KUC A;  2R0C A;  1YF0 A;  4D73 B;  1TK0 B;  4OO5 A;  3ZLP A;  2TIR A;  2VCW A;  2HRK A;  5HR3 A;  1M2B A;  4GRF A;  1IYH A;  3P2A A;  3UAP A;  2A2S A;  4K5S A;  2VUP A;  2B7J A;  4MPG A;  4EF0 A;  2H66 A;  4I2T A;  1RK4 A;  2H30 A;  4AJ6 A;  3GN3 A;  3GFK A;  5DAL B;  3ED3 A;  5ECK B;  1XBS A;  2IN3 A;  1PSQ A;  4KDY A;  2AV4 A;  4JRR A;  4HZ2 A;  2DJK A;  1V40 A;  3CYN A;  1SYX A;  2PVQ A;  3F6D A;  1GL8 A;  5IMC A;  4HEA 2;  5CP1 A;  1O81 A;  4MP4 A;  2R6K A;  1O8W A;  5IMD A;  1ERU A;  2F3M A;  3QCP A;  4GF0 A;  4NHW A;  4PQI A;  4LL1 B;  3HD5 A;  1Y6E A;  1ZGN A;  3L4N A;  4POM A;  4N30 A;  3LW9 A;  3KGK A;  3IAS 2;  2YZU A;  4L8E A;  1TRS A;  4ECC A;  2HFD A;  3E3E A;  1GTB A;  1IYI A;  5ELG A;  4O32 A;  4ZL8 A;  5C04 A;  3TKS A;  1GTA A;  1DBY A;  2H1G A;  2H6Y A;  4MZC A;  4OFM A;  2KHP A;  3DWV A;  2GGT A;  3E0U A;  4ZBA A;  1MD4 A;  3H8Q A;  2HNL A;  1TTZ A;  2GQM A;  1FOH A;  2VCT A;  1PD2 1;  4KCE A;  2FY6 A;  3QAV A;  2YZH A;  1SK1 A;  1K0D A;  1XZO A;  2TRC P;  5ECO B;  2CZ2 A;  4PNG A;  4G0K A;  1USB A;  5B6M A;  3PGT A;  2DC5 A;  5LD0 A;  3FRC A;  3TJG A;  2KP2 A;  1MTC A;  1U88 A;  1V2A A;  1N2A A;  3L9U A;  3HVX A;  2MMO A;  4OO4 A;  2N5A A;  2H70 A;  4BVY B;  4ISD A;  2HSY A;  3I9V 2;  4KB3 A;  3EVI A;  4EL1 A;  3HHV A;  5LNK e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...