2FY6A

Structure of the n-terminal domain of neisseria meningitidis pilb
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
VPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title The X-ray Structure of the N-terminal Domain of PILB from Neisseria meningitidis Reveals a Thioredoxin-fold
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 44
structure length 143
sequence length 143
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2006-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fy6A00
3KTBA 2BTOT 2KP1A 1EGOA 5G1LA 5FWGA 3F63A 2HZEB 2L5OA 3C8EA 4I6XA 1UA5A 4YAVA 2PVQA 4ZL7A 1B9YC 4XRDA 4Q5RA 1HD2A 3DEXA 3HCZA 2WRTA 1VF3A 4V1Ag 3HJMA 4BPYA 1ZYQB 2L5LA 3RDWA 2DJ0A 6GSSA 4NPBA 3ZVJA 5J9CA 1WRYA 1MDIA 2JACA 1F6MC 5DQSA 1XIYA 5KN1A 2B5YA 2B7JA 1XWBA 1LU4A 2M80A 3TUEA 5DDLA 3F0IA 1VF4A 1UC7A 4OMVA 4IQ1A 3L4NA 3VWXA 2H70A 3FKFA 1BG5A 5DJMA 3WYWA 1EOHA 1A24A 4OCFA 2PN8A 3IK7A 3GHAA 3WT1A 2B5XA 3IPZA 3GUSA 2FWFA 4FYBA 2FY6A 2PBJA 5JCUA 1GP1A 5LD0A 3A2VA 2MYGA 3EINA 1X5CA 3OR5A 3UMAA 2H6ZA 4GTUA 4RQXA 5DAKA 1A23A 2HSHA 5GAND 4K7NA 4KCAA 4E8HA 4TXOB 4IJ3A 2ZNMA 2NTOA 1TRUA 4N30A 1EEMA 1ERTA 2GQMA 3ED3A 2VCQA 1VRSD 2P0GA 2CAQA 3TOTA 2VUPA 3PINA 4POBA 4MZCA 4KNDA 5DVBA 2B5EA 1T7PB 1SKWB 4WETA 2H1GA 2N5BA 1BYEA 6GSTA 4PGTA 3WGDA 2V6KA 2DIZA 2H73A 3FZ5A 4O32A 1M99A 3GSTA 3IHQA 1XW9A 1AUCA 1K0NA 3QMXA 4KH7A 1JZRA 2R5GA 4EE0A 1EZKA 1KTEA 2C4JA 2AAWA 2LRNA 3HJPA 1PL1A 2F3MA 2YCDA 5AIVA 2O8VB 2IMKA 2CX4A 2HXKA 2AV4A 2JSYA 2YZUA 2AYTA 4IQAA 3M9JA 5G5FA 2IFQA 4OO4A 3JCML 1G0TA 1TTZA 3FZ4A 2I9HA 1TK5B 1EGRA 4F9ZA 2OACA 4I97A 4ZBDA 3GV1A 4GSNA 4WR4A 4TR1A 3UOMA 2MBSA 1PSQA 1AW9A 3EYTA 1GUHA 3HZ8A 4MCUA 6GSUA 4PNFA 4QL9A 2VAFA 3TGZA 1K3LA 3US3A 3IC4A 4HI7A 2VCZA 4X1UA 4WF4A 3TRXA 1VF2A 3LEFA 4AJ6A 3TJGA 1YEXA 4MZWA 2DJ3A 3A2WA 3ISOA 4F03A 4PXOA 1SJZA 22GSA 2YP6A 2EIOA 4GQCA 2B1KA 3KZQA 4ACSA 1OYJA 1JZWA 2LSTA 3SBCA 2C0EA 5ECQB 6GSXA 1URMA 4DEJA 3BBYA 4MDCA 2KLXA 3GX0A 3HY2A 2RUEA 2H72A 1OE7A 2IJYA 2C80A 1TJDA 2O89A 4HUAA 1OVNA 1XW6A 1SK0A 4MA9A 2B7KA 2F8AA 1U87A 1R7HA 1YDKA 2F8FA 2AUVA 1X0RA 3LFLA 1BEDA 1O7UA 2VCXA 3HZ4A 1KEBA 3ZRDA 5CRWA 2DMLA 2R3XA 2DJJA 4I8BA 3W6GA 3UAPA 5IPGA 2IN3A 1FOVA 3FW2A 5IOXA 4K6XA 1T8EB 3E0UA 2GTUA 2V1MA 4GSTA 1F3AA 4XS1A 3VK9A 2O7KA 1MD3A 2V2GA 5DCHA 3UBKA 1PD21 1V9WA 2H71A 2E7PA 3FR3A 1SJIA 4ZB6A 1XZOA 4L5OA 3GKMA 5AISA 2VLVA 3HVXA 4GRFA 3LSZA 6GSVA 1TU8A 13GSA 1F3BA 5A4VA 4Z7XA 2VCTA 3C1RA 1B9XC 1CQHA 1DUGA 5D9XA 2CQ9A 1K0CA 3IA1A 2ZUPA 4HOJA 4ECJA 3CSJA 4AJ7A 4IGJA 2RM5A 2YOIA 3PH9A 3IAS2 2DLXA 4ISDA 1GTUA 4K8MA 4KAEA 2LJAA 4HZ2A 3A5WA 3ZMKA 5L71A 1RW1A 2CAIA 1JLVA 4DSSA 1DE2A 1TK0B 4HDEA 1Z7RA 3V1WA 1XW5A 2GGTA 2GQLA 4O7HA 1M9BA 3I9V2 2H76A 5D9WA 1GWCA 3ZVJD 1PQNA 3L78A 1G7EA 2QGVA 4YAPA 4MJCA 4JR4A 3H79A 1N8JA 2PMTA 3KM6A 3QCPA 1K0MA 5ID2A 3K8NA 3MAKA 3NZNA 2NBSA 3ZFBA 1VF1A 3IE3A 1TI1A 4TXOA 4O92A 1Z5YE 1FAAA 4PQHA 2KUCA 4IJIA 4LMVA 4FO5A 1XWGA 2H8LA 1MDJA 3F8UA 1O85A 4IP6A 2VCVA 3GYKA 5CRGA 1ACVA 1T4ZA 4ZBAA 2YN1A 5CNWA 4WBRD 4KGIA 5JCGA 1B8XA 2YNXA 2GDRA 1T00A 2HRNA 2BJXA 1IYIA 5DCGA 3Q18A 1XWKA 4KB3A 3LGCA 3UARA 4MH2A 4PUFC 4HU7A 5D9VA 4OFNA 4HQSA 3TKQA 16GSA 4KDYA 4H86A 4XHMA 1F9MA 3KGKA 3UVHA 2DIYA 4MMMA 1Z7PA 2DJKA 1O8XA 3LORA 2A4VA 2MZCA 1JLWA 2XBIA 3EWLA 1DBYA 12GSA 2IPAA 2VM2A 2H0GA 2GLRA 2L6CA 3KMNA 4MK3A 2A2SA 3UBLA 4TW5A 1GSYA 4ECBA 4OFTA 1Q4JA 1A8LA 4YH2A 3GH9A 3EMPA 2OJLA 5F07A 3M0FA 2KHPA 2CX3A 4MP4A 2LJKA 1S3DA 2H30A 2C3NA 2VO4A 2C8UA 2IMDA 2VCWA 3IDVA 4MJAA 4DVCA 3E3EA 1GSSA 3M8NA 1ABAA 2LEGA 1PX7A 1GSUA 3D22A 3QAWA 4JRRA 4HU9A 1YZXA 4N11A 1GLPA 5GAPD 4TVEA 4LMWA 2VL2A 4XS4B 1TXXA 19GSA 4NHWA 2QC7A 1TRWA 2X64A 3G9BA 1UVZA 2JZSA 2YV7A 1YEPA 4P3YB 3LWAA 3CYNA 1SL1B 3GX8A 3FEUA 1EV9A 5G5EA 5H5SA 5LCZA 5AIXA 2PERA 1HQOA 3MSZA 3TKSE 5DALB 4MPFA 4IELA 4X0XA 4YQUA 1I9DA 3HVSA 5B6NA 2YWOA 3ZLPA 2KP2A 5HFGA 4OCEA 3GKNA 2IMFA 4MZBA 4BL7A 3VLNA 3DWVA 2F9SA 2HE3A 1U3AA 1YY7A 3ME8A 5IMCA 2REMA 2XBQA 3C73A 2RM6A 1OKDA 1X9MB 5H5RA 3UIWA 1R4WA 2EIRA 4EUYA 4HZ4A 4QL7A 3A3TA 1WP0A 5INYA 3BOAA 5DBQA 5IOWA 4G19A 3C7MA 5HR2A 5IMFA 4L0WA 1NHYA 2FA4A 2AJQB 1HNBA 3GH6A 5E59A 3WD6A 1MD4A 3G7IA 3QPMA 2HNLA 1WJKA 4HQZA 3HA9A 3LXZA 1FO5A 1SL2B 4K0NA 2CZ3A 2NDOA 4JEDA 3VWVA 2PVOC 2J23A 3GL5A 2I1UA 1OE8A 3FRCA 4MF5A 3D0ZA 2L4QA 4KW6A 5E4WA 2PGTA 2J9HA 1TK8B 2YWIA 1GTBA 3DXBA 3IAM2 1T3BA 2H01A 1QGVA 1TW9A 4D73B 4ULXA 4JZQA 2WCIA 5ECHB 2JU5A 1SU9A 2KOKA 2LNSA 2NPBA 1X9SB 3ZYWA 3F4RA 2GSSA 3FZ9A 1XWAA 2I81A 1ZMAA 4BVXA 5JWRB 3DVWA 2IMEA 1Z9HA 2P31A 2OE1A 1OC9A 1M2AA 1XOBA 2FD3A 1U3IA 2V41A 5D9TA 1LBKA 1O73A 1WMJA 1AIUA 1O6JA 3CRUA 2FA8A 2M46A 5ECPB 4HJ2A 4CW9A 2O87A 3FYGA 1GTIA 3J7Yb 2LTKA 4J57E 4CHSA 2O85A 1IYHA 1ST9A 4MABA 3VURA 3CSIA 4ML6A 3U5RE 3DKSA 3L0HA 4KSOA 3ZIJA 1VGLA 2RLIA 1GL8A 3DMLA 2PUKC 4DSRA 2L4CA 3LXTA 2CA8A 2QSIA 5D93A 1B4PA 1SK1A 1EOGA 1GSFA 2H6XA 4KSMA 1RQMA 1FG4A 1AQXA 4PURA 4I2TA 3BD2A 1K0DA 2CVKA 4DSQA 4MF7A 5J41A 3TRPA 3DD3A 2C1YA 4L8EA 3BJ5A 5COHA 4IP1A 2IIYA 1A8YA 2FWHA 5LNKe 3VI5A 2GT5A 4ZB8A 1M2BA 3H4KA 5IPHA 3C1SA 3ME7A 4AF2A 4F82A 2E0QA 3KP8A 5J5NA 2L59A 1T1VA 1EEJA 2H1AA 4HS1A 4PX1A 1H4OA 4GWRA 2WFCA 1Z3EA 3O3TA 3D5JA 2DJ2A 1XVQA 1N2AA 5GSTA 2VD1A 5F05A 1CQGA 4BWQA 4NXIA 4F2IA 4RUVA 5AN1A 3GKKA 4TR4A 4ZIJA 4KA0A 2EC4A 1W4VA 3LYPA 1PX6A 3HVVA 3MNGA 3VFIA 1H75A 5A4WA 2H1DA 4IW9A 2GT6A 3HJOA 5EL8A 1GULA 3CTGA 3DYRA 2H74A 2DMMA 2IWTA 5B6MA 1E2YA 5KEJA 3QOUA 1GUMA 1PKWA 4XS4A 1A2LA 3ZITA 2HZEA 3TKSA 3HXSA 4Q5NA 2DJ1A 2PPTA 2ALBA 1SKSB 3M3MA 2CVDA 3QDNA 4TKYA 2FWGA 4KDXA 3EU4A 1Z6MA 2GSRA 3GMFA 3KJYA 2ON7A 2FHEA 1TRSA 5F0GA 5DALA 3RBTA 1F2EA 3PR8A 5CREA 3QAVA 2YANA 2WZ9A 2LV3A 3FK8A 1LJRA 1ZCPA 2XHFA 4QQ7A 3VPTA 1B4QA 4NAXA 4AGSA 5B8BA 3LJRA 3Q74A 1U88A 4XS6A 4GCIA 1Y25A 3DIEA 3BCKA 1SENA 8GSSA 4POMA 3CXGA 3W8JA 3SWLA 3HYPA 3VWWA 4ZL9A 3Q6OA 4EC0A 3ERWA 4N10A 2FCHA 10GSA 1SYRA 4PQIA 5IO2A 2OE3A 1TU7A 3LYKA 3P90A 3HKRA 1NW2A 5CRDA 3VWUA 1QMVA 4LLRA 2IFQB 1BJXA 1ZZYA 1MTCA 1PRXA 1WIKA 1AC1A 1C72A 5J9BA 1OC3A 4K2DA 1JZDA 1GSEA 1GSQA 3APOA 1XWCA 2CVBA 1USBA 3AY8A 4TR1B 4WEYA 3UEMA 5ABRA 3EU3A 2HT9A 3FR6A 1J08A 5ELAA 1EWXA 2X8HA 1PGTA 1W89A 1AQVA 1DSBA 2C0FA 4OD7A 3TJJA 3M9KA 5JCWA 3D21A 5JWOB 1WPIA 2IMIA 2BMXA 2H75A 4K1FA 1V57A 2HRFA 3CSHA 3O76A 3F6FA 5ECLB 3N9JA 3D4MA 1FHEA 1R5AA 4F0CA 2G0FA 1A2MA 4KX4A 1YKAA 4EDYA 2JL4A 2FLSA 1ZGNA 2LQOA 4D73A 4GSSA 4NV2A 3TJFA 2JADA 3TDGA 2V32A 5J4UA 4TOPA 4NV5A 4ZXGA 1PL2A 5HR3A 2CT6A 4TN8A 18GSA 2WJUA 4ZILA 3GFKA 2LNTA 4WXTA 1KNGA 1FVJA 4TR0A 4BWSA 2H0HA 1RK4A 4TXVA 3KEBA 5F8BA 3WGEA 5HR0A 3TRQA 3H8QA 5CP1A 3ZFLA 4OO5A 5D96A 3N5OA 3FZAA 1ZL9A 2OBIA 4V1Ap 4NHZA 3GN3A 2E2GA 20GSA 5ECKB 11GSA 4BVYA 2FWEA 1K0BA 1JHBA 3NOFA 4TR3A 2OKAA 1OAZA 2OE0A 2VL2C 5GSSA 1S3AA 2VD0A 3QFBC 4F0BA 2AHEA 2LKUA 2X99A 3PGTA 2WB9A 3F3QA 3EC3A 1HNCA 1OC8A 3E9JB 4EL1A 2N5FA 3TJBA 2GQKA 1FB0A 2MMZA 2N5AA 4N0ZA 2FGXA 5ECSA 3GNJA 2X8CA 3RPPA 4FIWA 4XRAA 3F3RA 5IQYA 3J7Yk 4K7IA 2RIIA 1E6BA 2YWNA 4KE3A 4G9HA 2PWJA 2H19A 3CRTA 3GRXA 2TIRA 4V2MA 1NHOA 1JZOA 3M1GA 1XBSA 2TRCP 4JR6A 3ERGA 14GSA 2JSZA 3D4TA 3GKXA 3VPQA 2WGRA 3ZMLA 3G7YA 2R6KA 4I5QA 4MPGA 1YQ1A 3GL3A 2ZCTA 4G2EA 5JWQB 3RPNA 4ILFA 4Q5FA 1A0RP 3A2XA 3QFAC 4DSSB 5FT3A 4J56E 4MLYA 4RI6A 2YWMA 3GA4A 1MDKA 4Q5QA 4BA7A 2R4VA 1O81A 1HYUA 4NWYA 1ERVA 2EIQA 2HZFA 1K0AA 5CYYA 2GVPA 2R2JA 5AGYA 3KP9A 2IL3A 3QAGA 1BQ7A 1NSWA 1QFNA 2OADA 4EXJA 1SD8A 4XIHA 3F6DA 2VLTA 6GSWA 2C3TA 1J9BA 1O8WA 2FNOA 1QK8A 4KCEA 3VI7A 1GRXA 5ID2B 1THOA 4CDOA 2V6OA 2H1BA 4OWYA 4IHUA 5KN0A 5D73A 4V2LA 3KH9A 1R5PA 1GSDA 1GNWA 1YF1A 4POKA 3LG6A 1K3YA 1FVKA 5IO0A 2HSYA 3KXOA 3IV4A 2M72A 1TKDB 2JZTA 3L9VA 2NVLA 5CAXA 1ZYEA 5C00A 3O6TA 2MMOA 4O5RA 2H66A 2K8VA 5IMVA 3GTUB 2C0DA 4ZBBA 4YQMA 3QD9A 5J3RA 4WKWA 2GSTA 3GIXA 1X5EA 4POLA 3ZTLA 2G2QA 3IXRA 4MF6A 3ZZXA 3GSSA 4K0GA 5A5KA 1THXA 2VIMA 2K8SA 3WGXA 1V2AA 3ERFA 4IVFA 1QUWA 4LL1B 1SL0B 1YJ6A 3TCOA 5EVOA 3BCIA 2GZYA 1TRVA 2GZPA 2P5QA 3G7JA 1V58A 1DE1A 1TP9A 1Y6EA 1PN9A 2HYXA 3MWHA 1XFLA 5IMZA 4EVMA 2YJHA 1GUKA 2X8GA 4LA1A 3FHKA 5KN3A 1EP8A 1NM3A 1PKZA 4IKHA 4MH3A 5KN2A 1WWJA 5DQYA 3APQA 4OFMA 3UL3A 2HI7A 5G31A 1V40A 1M0UA 1U6TA 1ERUA 1YKCA 1UN2A 5FHIA 3HHVA 3R2QA 3HDCA 1WOUA 3RHCA 3F4SA 2K9FA 1V98A 2P5RA 1ILOA 1A2JA 4EF0A 5ECIB 5G1KA 2YPMA 1G6YA 3KD0A 4ECCA 1XPVA 4ML1A 1WE0A 3C71A 4GQFA 3I69A 2HLSA 2K6VA 1TDIA 2QKEA 4N0VA 2YV9A 1SD9A 5IMDA 4HJMA 4IN0A 5G30A 2VL3A 2I3YA 4WR5A 2MMNA 2B3SA 1X5DA 2D2ZA 3CBUA 3I43A 4FH8A 3W8SA 1TOFA 3ZL5A 1PMTA 1PA3A 3H93A 4MJBA 2GSQA 4KUNA 1MEKA 1XOAA 1EV4A 2C3QA 2PU9C 3D6IA 4L5LA 3TKRA 4EKZA 1XXUA 2GS3A 3ZREA 1BAYA 2ON5A 1T4YA 4KDUA 2WULA 3RHBA 2Z9SA 4XTSA 3F9UA 1G6WA 1XCCA 4HEA2 3DRNA 2R37A 1QQ2A 2L6DA 5IMAA 2VLUA 3TKSC 5DAKB 1K3OA 2F51A 1M7TA 4XCSA 1SKRB 2C0GA 4ZB9A 4AJ8A 2GZZA 2OA7A 3NIVA 2LQQA 2K18A 4X43A 4L0UA 3H1NA 1Z6NA 2CZ2A 1GH2A 3UJ1A 1QXHA 5CO3A 3I6AA 5D8IA 3EE2A 5A4UA 5EY6A 4NMUA 2YJ7A 3F4TA 2H0IA 1G7OA 5B7CA 2VM1A 2VL9A 1OKTA 3UVTA 1GLQA 5G2ZA 3QR6A 1ERWA 3L9SA 3EMXA 7GSSA 3IK9A 3RAZA 1A0FA 5IM9A 5ECRB 1ON4A 4RI7A 1ML6A 1SYXA 1AQWA 5HR1A 1Q98A 1YF0A 2VOCA 5ELGA 3P7XA 3U6VA 2JZRA 2RUFA 1BX9A 5ECOB 4PNGA 2MBTA 1OC9B 4IBPA 2LS5A 4YQVA 5ECNB 3TB2A 4PQ1A 1K0OA 2DBCA 2E2MA 17GSA 2WS2A 3GURA 3LQ7A 4GF0A 4FYCA 1TI3A 2AB6A 1S3CA 4K9ZA 2CV4A 5ECMB 3Q19A 3KH7A 4PUAA 5IIZA 2LJRA 5F06A 4JU5A 1SJ6A 5CRHA 3FR9A 2H6YA 2DSAA 3P8WA 1M9AA 2XPEA 3IRAA 1R26A 4ZL8A 3KTLA 2B6MA 2LRCA 4RQRA 3L9UA 2A2RA 2WDUA 4J2FA 1AXDA 1GTAA 1KBNA 3TOUA 5C04A 4ID0A 5H5QA 5HQPA 1X9WB 5HFIA 3TKPA 1SK2A 3GTUA 1JFUA 1J0FA 2DC5A 1XVWA 4WF5A 3EURA 4K7OA 3S9FA 2I4AA 1FB6A 4GXZA 2XC2A 4V2NA 3IR4A 1ZOFA 1EP7A 2OBKA 4JE1A 1HNAA 3CMIA 4JBBA 4ECIA 3P2AA 2L57A 3DGQA 3EVIA 4MJEA 3CTFA 3KCMA 5EPFA 6GSYA 3IBHA 5HFKA 3KMOA 2XPDA 3ZIVA 2HFDA 2YZHA 5GZZB 4IS0A 9GSSA 1AAZA 4E8EA 4LL4B 4TRXA 2B1LA 2MMAA 4I2UA 1M2DA 2LRTA 4GLTA 4FYUA 1FW1A 3IOSA 3MDKA 5DJLA 3WT2A 1I5GA 3KIJA 3DVXA 4G10A 1B48A 1F37A 2FUG2 4EDZA 3TJKA 3FY7A 4EO3A 2LUSA 2TRXA 1GNEA 4WBJA 3HD5A 2ES7A 5ENUA 5B8AA 3APSA
chains in the Genus database with same CATH superfamily
3KTBA 2BTOT 2KP1A 1EGOA 5G1LA 4PTSA 5FWGA 3F63A 2HZEB 2L5OA 3C8EA 4I6XA 1UA5A 4YAVA 2PVQA 4ZL7A 1B9YC 4XRDA 4Q5RA 1HD2A 3DEXA 3HCZA 2WRTA 1VF3A 4V1Ag 3HJMA 4BPYA 1ZYQB 2L5LA 3RDWA 2DJ0A 6GSSA 4NPBA 3ZVJA 5J9CA 1WRYA 1MDIA 2JACA 1F6MC 5DQSA 1XIYA 5KN1A 2B5YA 2B7JA 1XWBA 1LU4A 2M80A 3TUEA 5DDLA 3F0IA 1VF4A 1UC7A 4OMVA 4IQ1A 3L4NA 3VWXA 2H70A 3FKFA 1BG5A 5DJMA 3WYWA 1EOHA 1A24A 4OCFA 2PN8A 3IK7A 3GHAA 3WT1A 2B5XA 3IPZA 3GUSA 2FWFA 4FYBA 2FY6A 2PBJA 5JCUA 1GP1A 5LD0A 3A2VA 2MYGA 3EINA 1X5CA 3OR5A 3UMAA 2H6ZA 5KOXA 4GTUA 4RQXA 5DAKA 1PFOA 1A23A 2HSHA 4K5RA 5GAND 4K7NA 4KCAA 4E8HA 4TXOB 4IJ3A 2ZNMA 2NTOA 1TRUA 4N30A 1EEMA 1ERTA 2GQMA 3ED3A 2VCQA 1VRSD 2P0GA 2CAQA 3TOTA 2VUPA 3PINA 4POBA 4MZCA 4KNDA 5DVBA 3HVNA 2B5EA 1T7PB 1SKWB 4WETA 2H1GA 2N5BA 1BYEA 6GSTA 4PGTA 3WGDA 2V6KA 2DIZA 2H73A 3FZ5A 4O32A 1M99A 3GSTA 3IHQA 1XW9A 1AUCA 1K0NA 3QMXA 4KH7A 1JZRA 2R5GA 4EE0A 1EZKA 1KTEA 2C4JA 2AAWA 2LRNA 3HJPA 1PL1A 2F3MA 2YCDA 5AIVA 2O8VB 2IMKA 2CX4A 2HXKA 2AV4A 2JSYA 2YZUA 2AYTA 4IQAA 3M9JA 4K2XA 5G5FA 2IFQA 4OO4A 3JCML 1G0TA 1TTZA 3FZ4A 2I9HA 1TK5B 1EGRA 4F9ZA 2OACA 4I97A 4ZBDA 3GV1A 4GSNA 4WR4A 4TR1A 3UOMA 2MBSA 1PSQA 1AW9A 3EYTA 1GUHA 3HZ8A 2R0CA 4MCUA 6GSUA 4PNFA 4QL9A 2X4AA 2VAFA 3TGZA 1K3LA 3US3A 3IC4A 4HI7A 2VCZA 4X1UA 4WF4A 3TRXA 1VF2A 3R3EA 3LEFA 4AJ6A 3TJGA 4BVYB 1M3IA 1YEXA 4MZWA 2DJ3A 3A2WA 4CY8A 3ISOA 4F03A 4PXOA 1SJZA 22GSA 2YP6A 2A4HA 2EIOA 4GQCA 2B1KA 3KZQA 4ACSA 1OYJA 1JZWA 2LSTA 3SBCA 2C0EA 5ECQB 6GSXA 1URMA 1ZYNA 4DEJA 3BBYA 4MDCA 2KLXA 3GX0A 3HY2A 2RUEA 2H72A 1OE7A 2IJYA 2C80A 1TJDA 2O89A 4HUAA 1OVNA 1XW6A 1SK0A 4MA9A 2B7KA 2F8AA 1U87A 1R7HA 1YDKA 3MIXA 2F8FA 2AUVA 1X0RA 3LFLA 1BEDA 1O7UA 2VCXA 3HZ4A 1KEBA 3ZRDA 5CRWA 2DMLA 2R3XA 2DJJA 4I8BA 3W6GA 3UAPA 5IPGA 2IN3A 1FOVA 3FW2A 5IOXA 4K6XA 1T8EB 3EPTA 3E0UA 2GTUA 2V1MA 4GSTA 1F3AA 4XS1A 3VK9A 2O7KA 1MD3A 2V2GA 5DCHA 3UBKA 1PD21 1V9WA 2H71A 2E7PA 3FR3A 1SJIA 4ZB6A 1XZOA 4L5OA 3GKMA 2DKIA 5AISA 2VLVA 3HVXA 4GRFA 3IHGA 3LSZA 6GSVA 1TU8A 13GSA 1F3BA 5A4VA 4Z7XA 2VCTA 3C1RA 1B9XC 1CQHA 1DUGA 5D9XA 2CQ9A 1K0CA 3IA1A 2ZUPA 4HOJA 4ECJA 3CSJA 4AJ7A 4IGJA 2RM5A 2YOIA 3PH9A 3IAS2 2DLXA 4ISDA 4O5UA 4EIPA 1GTUA 4K8MA 4KAEA 2LJAA 4HZ2A 3A5WA 3ZMKA 5L71A 1RW1A 2CAIA 1JLVA 4DSSA 1DE2A 1TK0B 4HDEA 1Z7RA 3V1WA 1XW5A 2GGTA 2GQLA 4O7HA 1M9BA 3I9V2 4BVXB 2H76A 5D9WA 1GWCA 3ZVJD 1PQNA 3L78A 1G7EA 2QGVA 4YAPA 4MJCA 4JR4A 3H79A 1N8JA 2PMTA 3KM6A 3QCPA 1K0MA 5ID2A 2QA1A 3K8NA 3MAKA 3NZNA 2NBSA 3ZFBA 1VF1A 3IE3A 1TI1A 4TXOA 4O92A 1Z5YE 1FAAA 4PQHA 2KUCA 4IJIA 4LMVA 4FO5A 1XWGA 2H8LA 1MDJA 3F8UA 1O85A 4IP6A 2VCVA 3GYKA 5CRGA 1ACVA 1T4ZA 4ZBAA 2YN1A 5CNWA 4WBRD 1S3RA 4KGIA 5JCGA 1B8XA 2YNXA 2GDRA 1T00A 2HRNA 2BJXA 1IYIA 5DCGA 3Q18A 1XWKA 4KB3A 3LGCA 3UARA 2UZ8A 4MH2A 4PUFC 4HU7A 5D9VA 4OFNA 4HQSA 3TKQA 16GSA 4KDYA 4H86A 4XHMA 1F9MA 3KGKA 3UVHA 2DIYA 4MMMA 1Z7PA 2DJKA 1O8XA 3LORA 2A4VA 2MZCA 1JLWA 2XBIA 3EWLA 1DBYA 12GSA 2IPAA 2VM2A 2H0GA 4KF9A 2GLRA 2L6CA 3KMNA 4MK3A 2A2SA 3UBLA 4TW5A 1GSYA 4ECBA 1ZYPA 4OFTA 1Q4JA 1A8LA 4YH2A 3GH9A 3EMPA 2OJLA 5F07A 3M0FA 2KHPA 2CX3A 4MP4A 2LJKA 1S3DA 2H30A 2C3NA 2VO4A 2C8UA 2IMDA 4O5QA 2VCWA 3IDVA 4MJAA 4DVCA 3E3EA 1GSSA 3M8NA 1ABAA 2LEGA 1PX7A 1GSUA 3D22A 3QAWA 4JRRA 4HU9A 1YZXA 4N11A 1GLPA 2X49A 5GAPD 4TVEA 4LMWA 2VL2A 4XS4B 1TXXA 19GSA 4NHWA 2QC7A 1TRWA 2X64A 4Z2TA 3G9BA 1UVZA 2JZSA 2YV7A 1YEPA 4P3YB 3LWAA 3CYNA 1SL1B 3GX8A 3FEUA 1EV9A 5G5EA 5H5SA 5LCZA 5AIXA 2PERA 1HQOA 3MSZA 3TKSE 5DALB 4MPFA 4IELA 4X0XA 4YQUA 3MYDA 1I9DA 3HVSA 5B6NA 2YWOA 3ZLPA 2KP2A 5HFGA 4OCEA 3GKNA 2IMFA 4MZBA 4BL7A 3VLNA 3DWVA 2F9SA 4YKGA 2HE3A 1U3AA 1YY7A 3ME8A 5IMCA 2REMA 2XBQA 3C73A 2RM6A 1OKDA 1X9MB 5H5RA 3UIWA 1R4WA 2EIRA 4EUYA 4HZ4A 4QL7A 3A3TA 1WP0A 5INYA 3BOAA 5DBQA 5IOWA 4G19A 3C7MA 5HR2A 5IMFA 4L0WA 1NHYA 2FA4A 2AJQB 1HNBA 3GH6A 5E59A 3WD6A 1MD4A 3G7IA 3QPMA 2HNLA 1WJKA 4HQZA 3HA9A 3LXZA 1FO5A 1SL2B 4K0NA 2CZ3A 2NDOA 4JEDA 3VWVA 2PVOC 2J23A 3GL5A 2I1UA 1OE8A 3FRCA 3IC8A 4MF5A 3D0ZA 2L4QA 4KW6A 5E4WA 2PGTA 2J9HA 1TK8B 2YWIA 1GTBA 4CY6A 3DXBA 3IAM2 1T3BA 2H01A 1QGVA 1TW9A 4D73B 4ULXA 4JZQA 2WCIA 5ECHB 2JU5A 1SU9A 2KOKA 2LNSA 2NPBA 1X9SB 3ZYWA 3F4RA 2GSSA 3FZ9A 1XWAA 2I81A 1ZMAA 4BVXA 5JWRB 3DVWA 2IMEA 1Z9HA 2P31A 2OE1A 1OC9A 1M2AA 1XOBA 2FD3A 1U3IA 2V41A 5D9TA 1LBKA 1O73A 1WMJA 1AIUA 1O6JA 3CRUA 2FA8A 2M46A 5ECPB 4HJ2A 4CW9A 2O87A 3FYGA 1GTIA 3J7Yb 2LTKA 3PPUA 4J57E 4CHSA 2O85A 1IYHA 1ST9A 4MABA 3VURA 3CSIA 4ML6A 3U5RE 3DKSA 3L0HA 4G0IA 4KSOA 3ZIJA 1VGLA 2RLIA 1GL8A 3DMLA 2PUKC 4DSRA 2L4CA 3LXTA 2CA8A 2QSIA 5D93A 1B4PA 1SK1A 1EOGA 1GSFA 2H6XA 4KSMA 1RQMA 1FG4A 1AQXA 4PURA 4I2TA 3BD2A 1K0DA 2CVKA 4DSQA 4MF7A 5J41A 3TRPA 3DD3A 2C1YA 4L8EA 3BJ5A 5COHA 4IP1A 2IIYA 1A8YA 2FWHA 5LNKe 3VI5A 2GT5A 4ZB8A 1M2BA 3H4KA 5IPHA 3C1SA 3ME7A 4AF2A 4F82A 2E0QA 3KP8A 5J5NA 2L59A 1T1VA 1EEJA 2H1AA 2HSMA 2R0GA 4HS1A 4PX1A 1H4OA 4GWRA 2WFCA 1Z3EA 3O3TA 3D5JA 2DJ2A 1XVQA 1N2AA 1PN0A 5GSTA 2VD1A 5F05A 1CQGA 4BWQA 4NXIA 4F2IA 4RUVA 5AN1A 3GKKA 4TR4A 4ZIJA 4KA0A 2EC4A 1W4VA 3LYPA 1PX6A 3HVVA 3MNGA 3VFIA 1H75A 5A4WA 2H1DA 4IW9A 2GT6A 3HJOA 5EL8A 1GULA 3CTGA 3DYRA 2H74A 2DMMA 2IWTA 5B6MA 1E2YA 4X4JA 5BRTA 5KEJA 3QOUA 1GUMA 1PKWA 4XS4A 1A2LA 3ZITA 2HZEA 3TKSA 3HXSA 4Q5NA 2DJ1A 2PPTA 2ALBA 1SKSB 3M3MA 2CVDA 3QDNA 4TKYA 2FWGA 4KDXA 3EU4A 1Z6MA 2GSRA 3GMFA 3KJYA 2ON7A 2FHEA 1TRSA 5F0GA 5DALA 3RBTA 1F2EA 3PR8A 5CREA 3QAVA 2YANA 2WZ9A 2LV3A 3FK8A 1LJRA 1ZCPA 2XHFA 4QQ7A 3VPTA 1B4QA 4NAXA 4AGSA 5B8BA 3LJRA 3Q74A 1U88A 2R0PA 4XS6A 4GCIA 1Y25A 3DIEA 3BCKA 2DKHA 1SENA 8GSSA 4POMA 3CXGA 3W8JA 3SWLA 3HYPA 3VWWA 4ZL9A 3Q6OA 4EC0A 4MNNA 3ERWA 4N10A 2FCHA 10GSA 1SYRA 4PQIA 5IO2A 2OE3A 1TU7A 3LYKA 3P90A 3HKRA 1NW2A 5CRDA 3VWUA 1QMVA 4LLRA 2IFQB 1BJXA 1ZZYA 1MTCA 1PRXA 1WIKA 1AC1A 1C72A 5J9BA 1OC3A 4K2DA 1JZDA 1GSEA 1GSQA 3APOA 1XWCA 2CVBA 1USBA 3AY8A 4TR1B 4WEYA 3UEMA 5ABRA 4BIKA 3EU3A 2HT9A 3FR6A 1J08A 5ELAA 1EWXA 2X8HA 1PGTA 1W89A 1AQVA 1DSBA 2C0FA 4OD7A 3TJJA 3M9KA 5JCWA 3D21A 5JWOB 1WPIA 2IMIA 2BMXA 2H75A 4K1FA 1V57A 2HRFA 3CSHA 3O76A 3F6FA 5ECLB 3N9JA 3D4MA 1FHEA 1FOHA 1R5AA 4F0CA 2G0FA 1A2MA 4KX4A 1YKAA 4EDYA 2JL4A 2FLSA 1ZGNA 2LQOA 3A5IA 4D73A 4GSSA 4NV2A 3TJFA 2JADA 3TDGA 2V32A 5J4UA 4TOPA 4NV5A 4ZXGA 1PL2A 5HR3A 2CT6A 4TN8A 18GSA 2WJUA 4ZILA 3GFKA 2LNTA 4WXTA 1KNGA 1FVJA 4TR0A 4BWSA 2H0HA 1RK4A 4TXVA 3KEBA 5F8BA 3WGEA 5HR0A 3TRQA 3H8QA 5CP1A 3ZFLA 4Z2UA 4OO5A 5D96A 3N5OA 3FZAA 1ZL9A 2OBIA 4V1Ap 4NHZA 3GN3A 2E2GA 20GSA 5ECKB 11GSA 4BVYA 2FWEA 1K0BA 1JHBA 3NOFA 4TR3A 2OKAA 1OAZA 2OE0A 2VL2C 5GSSA 1S3AA 2VD0A 3QFBC 4F0BA 4G0LA 2AHEA 2LKUA 2X99A 3PGTA 2WB9A 3F3QA 3EC3A 1HNCA 1OC8A 3E9JB 4EL1A 2N5FA 3TJBA 2GQKA 1FB0A 2MMZA 2N5AA 4N0ZA 2FGXA 3GNJA 5ECSA 2X8CA 3RPPA 4FIWA 4XRAA 4G0KA 3F3RA 5IQYA 3J7Yk 4K7IA 2RIIA 1E6BA 2YWNA 4KE3A 4G9HA 2PWJA 2H19A 3CRTA 3GRXA 2TIRA 4V2MA 1NHOA 1JZOA 3M1GA 1M3JA 1XBSA 2TRCP 4JR6A 3ERGA 14GSA 2JSZA 3D4TA 3GKXA 3VPQA 2WGRA 3ZMLA 3G7YA 2R6KA 4I5QA 4MPGA 4FQUA 1YQ1A 3GL3A 2ZCTA 4G2EA 5JWQB 3RPNA 4ILFA 4Q5FA 1A0RP 3A2XA 3QFAC 4DSSB 5FT3A 4J56E 4MLYA 4RI6A 2YWMA 5BMUA 3GA4A 1MDKA 4Q5QA 4BA7A 2R4VA 1O81A 1HYUA 4NWYA 1ERVA 2EIQA 2HZFA 1K0AA 5CYYA 2GVPA 2R2JA 5AGYA 3KP9A 2IL3A 3QAGA 4HSCX 1BQ7A 1NSWA 1QFNA 2OADA 4EXJA 1SD8A 4XIHA 3F6DA 2VLTA 6GSWA 2C3TA 1J9BA 1O8WA 4A5PA 2FNOA 1QK8A 4KCEA 3VI7A 1GRXA 5ID2B 1THOA 4CDOA 2V6OA 2H1BA 4OWYA 4IHUA 5KN0A 5D73A 4V2LA 3KH9A 1R5PA 1GSDA 1GNWA 1YF1A 4POKA 3LG6A 1K3YA 1FVKA 5IO0A 2HSYA 3KXOA 3IV4A 2M72A 1TKDB 2JZTA 3L9VA 2NVLA 5CAXA 1ZYEA 5C00A 3O6TA 2MMOA 4O5RA 2H66A 2K8VA 5IMVA 3GTUB 2C0DA 4ZBBA 4YQMA 3QD9A 5J3RA 4WKWA 2GSTA 3GIXA 1X5EA 4POLA 3ZTLA 2G2QA 3IXRA 4MF6A 3ZZXA 3GSSA 4K0GA 5A5KA 1THXA 2VIMA 2K8SA 3WGXA 1V2AA 3ERFA 4IVFA 1QUWA 4LL1B 1SL0B 1YJ6A 3TCOA 5EVOA 3BCIA 2GZYA 1TRVA 2GZPA 4Z2RA 2P5QA 3G7JA 1V58A 1DE1A 1TP9A 1Y6EA 1PN9A 2HYXA 3MWHA 1XFLA 5IMZA 4EVMA 2YJHA 2HRKA 1GUKA 2X8GA 4LA1A 3FHKA 5KN3A 1EP8A 1NM3A 1PKZA 4IKHA 4MH3A 5KN2A 1WWJA 5DQYA 3APQA 4OFMA 3UL3A 1XG8A 2HI7A 5G31A 1V40A 1M0UA 1U6TA 1ERUA 1YKCA 1UN2A 5FHIA 3HHVA 3R2QA 3HDCA 1WOUA 3RHCA 3F4SA 2K9FA 1V98A 2P5RA 1ILOA 1A2JA 4EF0A 5ECIB 5G1KA 2YPMA 1G6YA 3KD0A 4ECCA 1XPVA 4ML1A 1WE0A 3C71A 4GQFA 3I69A 2HLSA 2K6VA 1TDIA 2QKEA 4N0VA 2YV9A 1SD9A 5IMDA 4HJMA 4IN0A 5G30A 2VL3A 2I3YA 4WR5A 2MMNA 2B3SA 1X5DA 2D2ZA 3CBUA 3I43A 4FH8A 3W8SA 1TOFA 3ZL5A 1PMTA 1PA3A 3H93A 4MJBA 2GSQA 4KUNA 1MEKA 4BL7B 1XOAA 1EV4A 2C3QA 2PU9C 3D6IA 4L5LA 3TKRA 4EKZA 1XXUA 2GS3A 3ZREA 1BAYA 2ON5A 1T4YA 4KDUA 2WULA 3RHBA 2Z9SA 4XTSA 3F9UA 2QA2A 1G6WA 2A2PA 1XCCA 4HEA2 3DRNA 2R37A 1QQ2A 2L6DA 5IMAA 2VLUA 3TKSC 5DAKB 1K3OA 2F51A 1M7TA 4XCSA 1SKRB 2C0GA 4ZB9A 4AJ8A 2GZZA 4K5SA 2OA7A 3NIVA 5KOWA 2LQQA 2K18A 4X43A 4L0UA 3H1NA 1Z6NA 2CZ2A 1GH2A 3UJ1A 1QXHA 5CO3A 3I6AA 5D8IA 3EE2A 5A4UA 5EY6A 4NMUA 2YJ7A 3F4TA 2H0IA 1G7OA 5B7CA 2VM1A 2VL9A 1OKTA 2HRAA 4EIQA 3UVTA 1GLQA 5G2ZA 3QR6A 1ERWA 3L9SA 3EMXA 7GSSA 3IK9A 3RAZA 1A0FA 5IM9A 5ECRB 1ON4A 4RI7A 1ML6A 1SYXA 1AQWA 5HR1A 1Q98A 1YF0A 3FMWA 2VOCA 5ELGA 3P7XA 3U6VA 2JZRA 2RUFA 1BX9A 5ECOB 4PNGA 2MBTA 1OC9B 4IBPA 2LS5A 4YQVA 5ECNB 3TB2A 4PQ1A 1K0OA 4ICYA 2DBCA 2E2MA 17GSA 2WS2A 3GURA 3LQ7A 4GF0A 4FYCA 1TI3A 2AB6A 1S3CA 4K9ZA 2CV4A 5ECMB 3Q19A 3KH7A 4PUAA 5IIZA 2LJRA 3LW9A 5F06A 4JU5A 1SJ6A 5CRHA 3FR9A 2H6YA 2DSAA 3P8WA 4USSA 1M9AA 2XPEA 3IRAA 1R26A 4ZL8A 3KTLA 2B6MA 2LRCA 4RQRA 3L9UA 2A2RA 2WDUA 4J2FA 1AXDA 1GTAA 1KBNA 3TOUA 5C04A 4ID0A 5H5QA 5HQPA 1X9WB 5HFIA 3TKPA 1SK2A 3GTUA 1JFUA 1J0FA 2DC5A 1XVWA 4WF5A 3EURA 4K7OA 3S9FA 2I4AA 1FB6A 4GXZA 2XC2A 4V2NA 3IR4A 1ZOFA 1EP7A 2OBKA 4JE1A 1HNAA 3CMIA 4JBBA 4YKFA 4ECIA 3P2AA 2L57A 3DGQA 3EVIA 4MJEA 3CTFA 3KCMA 5EPFA 6GSYA 3IBHA 5HFKA 3KMOA 2XPDA 3ZIVA 2HFDA 2YZHA 5GZZB 4IS0A 9GSSA 1AAZA 4E8EA 4LL4B 4TRXA 2B1LA 2MMAA 4I2UA 1M2DA 2LRTA 4GLTA 4FYUA 1FW1A 3IOSA 3MDKA 5DJLA 3WT2A 1I5GA 3KIJA 3DVXA 4G10A 1B48A 1F37A 2FUG2 4EDZA 3TJKA 3CQFA 3FY7A 4EO3A 2LUSA 2TRXA 1GNEA 4WBJA 3HD5A 2ES7A 5ENUA 5B8AA 3APSA
chains in the Genus database with same CATH topology
3KTBA 2BTOT 2KP1A 1EGOA 5G1LA 4PTSA 5FWGA 3F63A 2HZEB 2L5OA 3C8EA 4I6XA 1UA5A 4YAVA 2PVQA 4ZL7A 1B9YC 4XRDA 4Q5RA 1HD2A 3DEXA 3HCZA 2WRTA 1VF3A 4V1Ag 3HJMA 4BPYA 1ZYQB 2L5LA 3RDWA 2DJ0A 6GSSA 4NPBA 3ZVJA 5J9CA 1WRYA 1MDIA 2JACA 1F6MC 5DQSA 1XIYA 5KN1A 2B5YA 2B7JA 1XWBA 1LU4A 2M80A 3TUEA 5DDLA 3F0IA 1VF4A 1UC7A 4OMVA 4IQ1A 3L4NA 3VWXA 2H70A 3FKFA 1BG5A 5DJMA 3WYWA 1EOHA 1A24A 4OCFA 2PN8A 3IK7A 3GHAA 3WT1A 2B5XA 3IPZA 3GUSA 2FWFA 4FYBA 2FY6A 2PBJA 5JCUA 1GP1A 5LD0A 3A2VA 2MYGA 3EINA 1X5CA 3OR5A 3UMAA 2H6ZA 5KOXA 4GTUA 4RQXA 5DAKA 1A23A 2HSHA 4K5RA 5GAND 4K7NA 4KCAA 4E8HA 4TXOB 4IJ3A 2ZNMA 2NTOA 1TRUA 4N30A 1EEMA 1ERTA 2GQMA 3ED3A 2VCQA 1VRSD 2P0GA 2CAQA 3TOTA 2VUPA 3PINA 4POBA 4MZCA 4KNDA 5DVBA 2B5EA 1T7PB 1SKWB 4WETA 2H1GA 2N5BA 1BYEA 6GSTA 4PGTA 3WGDA 2V6KA 2DIZA 2H73A 3FZ5A 4O32A 1M99A 3GSTA 3IHQA 1XW9A 1AUCA 1K0NA 3QMXA 4KH7A 1JZRA 2R5GA 4EE0A 1EZKA 1KTEA 2C4JA 2AAWA 2LRNA 3HJPA 1PL1A 2F3MA 2YCDA 5AIVA 2O8VB 2IMKA 2CX4A 2HXKA 2AV4A 2JSYA 2YZUA 2AYTA 4IQAA 3M9JA 4K2XA 5G5FA 2IFQA 4OO4A 3JCML 1G0TA 1TTZA 3FZ4A 2I9HA 1TK5B 1EGRA 4F9ZA 2OACA 4I97A 4ZBDA 3GV1A 4GSNA 4WR4A 4TR1A 3UOMA 2MBSA 1PSQA 1AW9A 3EYTA 1GUHA 3HZ8A 2R0CA 4MCUA 6GSUA 4PNFA 4QL9A 2X4AA 2VAFA 3TGZA 1K3LA 3US3A 3IC4A 4HI7A 2VCZA 4X1UA 4WF4A 3TRXA 1VF2A 3R3EA 3LEFA 4AJ6A 3TJGA 4BVYB 1YEXA 4MZWA 2DJ3A 3A2WA 4CY8A 3ISOA 4F03A 4PXOA 1SJZA 22GSA 2YP6A 2A4HA 2EIOA 4GQCA 2B1KA 3KZQA 4ACSA 1OYJA 1JZWA 2LSTA 3SBCA 2C0EA 5ECQB 6GSXA 1URMA 1ZYNA 4DEJA 3BBYA 4MDCA 2KLXA 3GX0A 3HY2A 2RUEA 2H72A 1OE7A 2IJYA 2C80A 1TJDA 2O89A 4HUAA 1OVNA 1XW6A 1SK0A 4MA9A 2B7KA 2F8AA 1U87A 1R7HA 1YDKA 3MIXA 2F8FA 2AUVA 1X0RA 3LFLA 1BEDA 1O7UA 2VCXA 3HZ4A 1KEBA 3ZRDA 5CRWA 2DMLA 2R3XA 2DJJA 4I8BA 3W6GA 3UAPA 5IPGA 2IN3A 1FOVA 3FW2A 5IOXA 4K6XA 1T8EB 3EPTA 3E0UA 2GTUA 2V1MA 4GSTA 1F3AA 4XS1A 3VK9A 2O7KA 1MD3A 2V2GA 5DCHA 3UBKA 1PD21 1V9WA 2H71A 2E7PA 3FR3A 1SJIA 4ZB6A 1XZOA 4L5OA 3GKMA 2DKIA 5AISA 2VLVA 3HVXA 4GRFA 3IHGA 3LSZA 6GSVA 1TU8A 13GSA 1F3BA 5A4VA 4Z7XA 2VCTA 3C1RA 1B9XC 1CQHA 1DUGA 5D9XA 2CQ9A 1K0CA 3IA1A 2ZUPA 4HOJA 4ECJA 3CSJA 4AJ7A 4IGJA 2RM5A 2YOIA 3PH9A 3IAS2 2DLXA 4ISDA 4O5UA 4EIPA 1GTUA 4K8MA 4KAEA 2LJAA 4HZ2A 3A5WA 3ZMKA 5L71A 1RW1A 2CAIA 1JLVA 4DSSA 1DE2A 1TK0B 4HDEA 1Z7RA 3V1WA 1XW5A 2GGTA 2GQLA 4O7HA 1M9BA 3I9V2 4BVXB 2H76A 5D9WA 1GWCA 3ZVJD 1PQNA 3L78A 1G7EA 2QGVA 4YAPA 4MJCA 4JR4A 3H79A 1N8JA 2PMTA 3KM6A 3QCPA 1K0MA 5ID2A 2QA1A 3K8NA 3MAKA 3NZNA 2NBSA 3ZFBA 1VF1A 3IE3A 1TI1A 4TXOA 4O92A 1Z5YE 1FAAA 4PQHA 2KUCA 4IJIA 4LMVA 4FO5A 1XWGA 2H8LA 1MDJA 3F8UA 1O85A 4IP6A 2VCVA 3GYKA 5CRGA 1ACVA 1T4ZA 4ZBAA 2YN1A 5CNWA 4WBRD 4KGIA 5JCGA 1B8XA 2YNXA 2GDRA 1T00A 2HRNA 2BJXA 1IYIA 5DCGA 3Q18A 1XWKA 4KB3A 3LGCA 3UARA 2UZ8A 4MH2A 4PUFC 4HU7A 5D9VA 4OFNA 4HQSA 3TKQA 16GSA 4KDYA 4H86A 4XHMA 1F9MA 3KGKA 3UVHA 2DIYA 4MMMA 1Z7PA 2DJKA 1O8XA 3LORA 2A4VA 2MZCA 1JLWA 2XBIA 3EWLA 1DBYA 12GSA 2IPAA 2VM2A 2H0GA 4KF9A 2GLRA 2L6CA 3KMNA 4MK3A 2A2SA 3UBLA 4TW5A 1GSYA 4ECBA 1ZYPA 4OFTA 1Q4JA 1A8LA 4YH2A 3GH9A 3EMPA 2OJLA 5F07A 3M0FA 2KHPA 2CX3A 4MP4A 2LJKA 1S3DA 2H30A 2C3NA 2VO4A 2C8UA 2IMDA 4O5QA 2VCWA 3IDVA 4MJAA 4DVCA 3E3EA 1GSSA 3M8NA 1ABAA 2LEGA 1PX7A 1GSUA 3D22A 3QAWA 4JRRA 4HU9A 1YZXA 4N11A 1GLPA 2X49A 5GAPD 4TVEA 4LMWA 2VL2A 4XS4B 1TXXA 19GSA 4NHWA 2QC7A 1TRWA 2X64A 4Z2TA 3G9BA 1UVZA 2JZSA 2YV7A 1YEPA 4P3YB 3LWAA 3CYNA 1SL1B 3GX8A 3FEUA 1EV9A 5G5EA 5H5SA 5LCZA 5AIXA 2PERA 1HQOA 3MSZA 3TKSE 5DALB 4MPFA 4IELA 4X0XA 4YQUA 3MYDA 1I9DA 3HVSA 5B6NA 2YWOA 3ZLPA 2KP2A 5HFGA 4OCEA 3GKNA 2IMFA 4MZBA 4BL7A 3VLNA 3DWVA 2F9SA 4YKGA 2HE3A 1U3AA 1YY7A 3ME8A 5IMCA 2REMA 2XBQA 3C73A 2RM6A 1OKDA 1X9MB 5H5RA 3UIWA 1R4WA 2EIRA 4EUYA 4HZ4A 4QL7A 3A3TA 1WP0A 5INYA 3BOAA 5DBQA 5IOWA 4G19A 3C7MA 5HR2A 5IMFA 4L0WA 1NHYA 2FA4A 2AJQB 1HNBA 3GH6A 5E59A 3WD6A 1MD4A 3G7IA 3QPMA 2HNLA 1WJKA 4HQZA 3HA9A 3LXZA 1FO5A 1SL2B 4K0NA 2CZ3A 2NDOA 4JEDA 3VWVA 2PVOC 2J23A 3GL5A 2I1UA 1OE8A 3FRCA 3IC8A 4MF5A 3D0ZA 2L4QA 4KW6A 5E4WA 2PGTA 2J9HA 1TK8B 2YWIA 1GTBA 4CY6A 3DXBA 3IAM2 1T3BA 2H01A 1QGVA 1TW9A 4D73B 4ULXA 4JZQA 2WCIA 5ECHB 2JU5A 1SU9A 2KOKA 2LNSA 2NPBA 1X9SB 3ZYWA 3F4RA 2GSSA 3FZ9A 1XWAA 2I81A 1ZMAA 4BVXA 5JWRB 3DVWA 2IMEA 1Z9HA 2P31A 2OE1A 1OC9A 1M2AA 1XOBA 2FD3A 1U3IA 2V41A 5D9TA 1LBKA 1O73A 1WMJA 1AIUA 1O6JA 3CRUA 2FA8A 2M46A 5ECPB 4HJ2A 4CW9A 2O87A 3FYGA 1GTIA 3J7Yb 2LTKA 3PPUA 4J57E 4CHSA 2O85A 1IYHA 1ST9A 4MABA 3VURA 3CSIA 4ML6A 3U5RE 3DKSA 3L0HA 4G0IA 4KSOA 3ZIJA 1VGLA 2RLIA 1GL8A 3DMLA 2PUKC 4DSRA 2L4CA 3LXTA 2CA8A 2QSIA 5D93A 1B4PA 1SK1A 1EOGA 1GSFA 2H6XA 4KSMA 1RQMA 1FG4A 1AQXA 4PURA 4I2TA 3BD2A 1K0DA 2CVKA 4DSQA 4MF7A 5J41A 3TRPA 3DD3A 2C1YA 4L8EA 3BJ5A 5COHA 4IP1A 2IIYA 1A8YA 2FWHA 5LNKe 3VI5A 2GT5A 4ZB8A 1M2BA 3H4KA 5IPHA 3C1SA 3ME7A 4AF2A 4F82A 2E0QA 3KP8A 5J5NA 2L59A 1T1VA 1EEJA 2H1AA 2HSMA 2R0GA 4HS1A 4PX1A 1H4OA 4GWRA 2WFCA 1Z3EA 3O3TA 3D5JA 2DJ2A 1XVQA 1N2AA 1PN0A 5GSTA 2VD1A 5F05A 1CQGA 4BWQA 4NXIA 4F2IA 4RUVA 5AN1A 3GKKA 4TR4A 4ZIJA 4KA0A 2EC4A 1W4VA 3LYPA 1PX6A 3HVVA 3MNGA 3VFIA 1H75A 5A4WA 2H1DA 4IW9A 2GT6A 3HJOA 5EL8A 1GULA 3CTGA 3DYRA 2H74A 2DMMA 2IWTA 5B6MA 1E2YA 4X4JA 5BRTA 5KEJA 3QOUA 1GUMA 1PKWA 4XS4A 1A2LA 3ZITA 2HZEA 3TKSA 3HXSA 4Q5NA 2DJ1A 2PPTA 2ALBA 1SKSB 3M3MA 2CVDA 3QDNA 4TKYA 2FWGA 4KDXA 3EU4A 1Z6MA 2GSRA 3GMFA 3KJYA 2ON7A 2FHEA 1TRSA 5F0GA 5DALA 3RBTA 1F2EA 3PR8A 5CREA 3QAVA 2YANA 2WZ9A 2LV3A 3FK8A 1LJRA 1ZCPA 2XHFA 4QQ7A 3VPTA 1B4QA 4NAXA 4AGSA 5B8BA 3LJRA 3Q74A 1U88A 2R0PA 4XS6A 4GCIA 1Y25A 3DIEA 3BCKA 2DKHA 1SENA 8GSSA 4POMA 3CXGA 3W8JA 3SWLA 3HYPA 3VWWA 4ZL9A 3Q6OA 4EC0A 4MNNA 3ERWA 4N10A 2FCHA 10GSA 1SYRA 4PQIA 5IO2A 2OE3A 1TU7A 3LYKA 3P90A 3HKRA 1NW2A 5CRDA 3VWUA 1QMVA 4LLRA 2IFQB 1BJXA 1ZZYA 1MTCA 1PRXA 1WIKA 1AC1A 1C72A 5J9BA 1OC3A 4K2DA 1JZDA 1GSEA 1GSQA 3APOA 1XWCA 2CVBA 1USBA 3AY8A 4TR1B 4WEYA 3UEMA 5ABRA 3EU3A 2HT9A 3FR6A 1J08A 5ELAA 1EWXA 2X8HA 1PGTA 1W89A 1AQVA 1DSBA 2C0FA 4OD7A 3TJJA 3M9KA 5JCWA 3D21A 5JWOB 1WPIA 2IMIA 2BMXA 2H75A 4K1FA 1V57A 2HRFA 3CSHA 3O76A 3F6FA 5ECLB 3N9JA 3D4MA 1FHEA 1FOHA 1R5AA 4F0CA 2G0FA 1A2MA 4KX4A 1YKAA 4EDYA 2JL4A 2FLSA 1ZGNA 2LQOA 3A5IA 4D73A 4GSSA 4NV2A 3TJFA 2JADA 3TDGA 2V32A 5J4UA 4TOPA 4NV5A 4ZXGA 1PL2A 5HR3A 2CT6A 4TN8A 18GSA 2WJUA 4ZILA 3GFKA 2LNTA 4WXTA 1KNGA 1FVJA 4TR0A 4BWSA 2H0HA 1RK4A 4TXVA 3KEBA 5F8BA 3WGEA 5HR0A 3TRQA 3H8QA 5CP1A 3ZFLA 4Z2UA 4OO5A 5D96A 3N5OA 3FZAA 1ZL9A 2OBIA 4V1Ap 4NHZA 3GN3A 2E2GA 20GSA 5ECKB 11GSA 4BVYA 2FWEA 1K0BA 1JHBA 3NOFA 4TR3A 2OKAA 1OAZA 2OE0A 2VL2C 5GSSA 1S3AA 2VD0A 3QFBC 4F0BA 4G0LA 2AHEA 2LKUA 2X99A 3PGTA 2WB9A 3F3QA 3EC3A 1HNCA 1OC8A 3E9JB 4EL1A 2N5FA 3TJBA 2GQKA 1FB0A 2MMZA 2N5AA 4N0ZA 2FGXA 3GNJA 5ECSA 2X8CA 3RPPA 4FIWA 4XRAA 4G0KA 3F3RA 5IQYA 3J7Yk 4K7IA 2RIIA 1E6BA 2YWNA 4KE3A 4G9HA 2PWJA 2H19A 3CRTA 3GRXA 2TIRA 4V2MA 1NHOA 1JZOA 3M1GA 1XBSA 2TRCP 4JR6A 3ERGA 14GSA 2JSZA 3D4TA 3GKXA 3VPQA 2WGRA 3ZMLA 3G7YA 2R6KA 4I5QA 4MPGA 4FQUA 1YQ1A 3GL3A 2ZCTA 4G2EA 5JWQB 3RPNA 4ILFA 4Q5FA 1A0RP 3A2XA 3QFAC 4DSSB 5FT3A 4J56E 4MLYA 4RI6A 2YWMA 5BMUA 3GA4A 1MDKA 4Q5QA 4BA7A 2R4VA 1O81A 1HYUA 4NWYA 1ERVA 2EIQA 2HZFA 1K0AA 5CYYA 2GVPA 2R2JA 5AGYA 3KP9A 2IL3A 3QAGA 1BQ7A 1NSWA 1QFNA 2OADA 4EXJA 1SD8A 4XIHA 3F6DA 2VLTA 6GSWA 2C3TA 1J9BA 1O8WA 4A5PA 2FNOA 1QK8A 4KCEA 3VI7A 1GRXA 5ID2B 1THOA 4CDOA 2V6OA 2H1BA 4OWYA 4IHUA 5KN0A 5D73A 4V2LA 3KH9A 1R5PA 1GSDA 1GNWA 1YF1A 4POKA 3LG6A 1K3YA 1FVKA 5IO0A 2HSYA 3KXOA 3IV4A 2M72A 1TKDB 2JZTA 3L9VA 2NVLA 5CAXA 1ZYEA 5C00A 3O6TA 2MMOA 4O5RA 2H66A 2K8VA 5IMVA 3GTUB 2C0DA 4ZBBA 4YQMA 3QD9A 5J3RA 4WKWA 2GSTA 3GIXA 1X5EA 4POLA 3ZTLA 2G2QA 3IXRA 4MF6A 3ZZXA 3GSSA 4K0GA 5A5KA 1THXA 2VIMA 2K8SA 3WGXA 1V2AA 3ERFA 4IVFA 1QUWA 4LL1B 1SL0B 1YJ6A 3TCOA 5EVOA 3BCIA 2GZYA 1TRVA 2GZPA 4Z2RA 2P5QA 3G7JA 1V58A 1DE1A 1TP9A 1Y6EA 1PN9A 2HYXA 3MWHA 1XFLA 5IMZA 4EVMA 2YJHA 2HRKA 1GUKA 2X8GA 4LA1A 3FHKA 5KN3A 1EP8A 1NM3A 1PKZA 4IKHA 4MH3A 5KN2A 1WWJA 5DQYA 3APQA 4OFMA 3UL3A 2HI7A 5G31A 1V40A 1M0UA 1U6TA 1ERUA 1YKCA 1UN2A 5FHIA 3HHVA 3R2QA 3HDCA 1WOUA 3RHCA 3F4SA 2K9FA 1V98A 2P5RA 1ILOA 1A2JA 4EF0A 5ECIB 5G1KA 2YPMA 1G6YA 3KD0A 4ECCA 1XPVA 4ML1A 1WE0A 3C71A 4GQFA 3I69A 2HLSA 2K6VA 1TDIA 2QKEA 4N0VA 2YV9A 1SD9A 5IMDA 4HJMA 4IN0A 5G30A 2VL3A 2I3YA 4WR5A 2MMNA 2B3SA 1X5DA 2D2ZA 3CBUA 3I43A 4FH8A 3W8SA 1TOFA 3ZL5A 1PMTA 1PA3A 3H93A 4MJBA 2GSQA 4KUNA 1MEKA 4BL7B 1XOAA 1EV4A 2C3QA 2PU9C 3D6IA 4L5LA 3TKRA 4EKZA 1XXUA 2GS3A 3ZREA 1BAYA 2ON5A 1T4YA 4KDUA 2WULA 3RHBA 2Z9SA 4XTSA 3F9UA 2QA2A 1G6WA 2A2PA 1XCCA 4HEA2 3DRNA 2R37A 1QQ2A 2L6DA 5IMAA 2VLUA 3TKSC 5DAKB 1K3OA 2F51A 1M7TA 4XCSA 1SKRB 2C0GA 4ZB9A 4AJ8A 2GZZA 4K5SA 2OA7A 3NIVA 5KOWA 2LQQA 2K18A 4X43A 4L0UA 3H1NA 1Z6NA 2CZ2A 1GH2A 3UJ1A 1QXHA 5CO3A 3I6AA 5D8IA 3EE2A 5A4UA 5EY6A 4NMUA 2YJ7A 3F4TA 2H0IA 1G7OA 5B7CA 2VM1A 2VL9A 1OKTA 2HRAA 4EIQA 3UVTA 1GLQA 5G2ZA 3QR6A 1ERWA 3L9SA 3EMXA 7GSSA 3IK9A 3RAZA 1A0FA 5IM9A 5ECRB 1ON4A 4RI7A 1ML6A 1SYXA 1AQWA 5HR1A 1Q98A 1YF0A 3FMWA 2VOCA 5ELGA 3P7XA 3U6VA 2JZRA 2RUFA 1BX9A 5ECOB 4PNGA 2MBTA 1OC9B 4IBPA 2LS5A 4YQVA 5ECNB 3TB2A 4PQ1A 1K0OA 4ICYA 2DBCA 2E2MA 17GSA 2WS2A 3GURA 3LQ7A 4GF0A 4FYCA 1TI3A 2AB6A 1S3CA 4K9ZA 2CV4A 5ECMB 3Q19A 3KH7A 4PUAA 5IIZA 2LJRA 3LW9A 5F06A 4JU5A 1SJ6A 5CRHA 3FR9A 2H6YA 2DSAA 3P8WA 4USSA 1M9AA 2XPEA 3IRAA 1R26A 4ZL8A 3KTLA 2B6MA 2LRCA 4RQRA 3L9UA 2A2RA 2WDUA 4J2FA 1AXDA 1GTAA 1KBNA 3TOUA 5C04A 4ID0A 5H5QA 5HQPA 1X9WB 5HFIA 3TKPA 1SK2A 3GTUA 1JFUA 1J0FA 2DC5A 1XVWA 4WF5A 3EURA 4K7OA 3S9FA 2I4AA 1FB6A 4GXZA 2XC2A 4V2NA 3IR4A 1ZOFA 1EP7A 2OBKA 4JE1A 1HNAA 3CMIA 4JBBA 4YKFA 4ECIA 3P2AA 2L57A 3DGQA 3EVIA 4MJEA 3CTFA 3KCMA 5EPFA 6GSYA 3IBHA 5HFKA 3KMOA 2XPDA 3ZIVA 2HFDA 2YZHA 5GZZB 4IS0A 9GSSA 1AAZA 4E8EA 4LL4B 4TRXA 2B1LA 2MMAA 4I2UA 1M2DA 2LRTA 4GLTA 4FYUA 1FW1A 3IOSA 3MDKA 5DJLA 3WT2A 1I5GA 3KIJA 3DVXA 4G10A 1B48A 1F37A 2FUG2 4EDZA 3TJKA 3FY7A 4EO3A 2LUSA 2TRXA 1GNEA 4WBJA 3HD5A 2ES7A 5ENUA 5B8AA 3APSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTB A;  2BTO T;  2KP1 A;  1EGO A;  5G1L A;  5FWG A;  3F63 A;  2HZE B;  2L5O A;  3C8E A;  4I6X A;  1UA5 A;  4YAV A;  2PVQ A;  4ZL7 A;  1B9Y C;  4XRD A;  4Q5R A;  1HD2 A;  3DEX A;  3HCZ A;  2WRT A;  1VF3 A;  4V1A g;  3HJM A;  4BPY A;  1ZYQ B;  2L5L A;  3RDW A;  2DJ0 A;  6GSS A;  4NPB A;  3ZVJ A;  5J9C A;  1WRY A;  1MDI A;  2JAC A;  1F6M C;  5DQS A;  1XIY A;  5KN1 A;  2B5Y A;  2B7J A;  1XWB A;  1LU4 A;  2M80 A;  3TUE A;  5DDL A;  3F0I A;  1VF4 A;  1UC7 A;  4OMV A;  4IQ1 A;  3L4N A;  3VWX A;  2H70 A;  3FKF A;  1BG5 A;  5DJM A;  3WYW A;  1EOH A;  1A24 A;  4OCF A;  2PN8 A;  3IK7 A;  3GHA A;  3WT1 A;  2B5X A;  3IPZ A;  3GUS A;  2FWF A;  4FYB A;  2FY6 A;  2PBJ A;  5JCU A;  1GP1 A;  5LD0 A;  3A2V A;  2MYG A;  3EIN A;  1X5C A;  3OR5 A;  3UMA A;  2H6Z A;  4GTU A;  4RQX A;  5DAK A;  1A23 A;  2HSH A;  5GAN D;  4K7N A;  4KCA A;  4E8H A;  4TXO B;  4IJ3 A;  2ZNM A;  2NTO A;  1TRU A;  4N30 A;  1EEM A;  1ERT A;  2GQM A;  3ED3 A;  2VCQ A;  1VRS D;  2P0G A;  2CAQ A;  3TOT A;  2VUP A;  3PIN A;  4POB A;  4MZC A;  4KND A;  5DVB A;  2B5E A;  1T7P B;  1SKW B;  4WET A;  2H1G A;  2N5B A;  1BYE A;  6GST A;  4PGT A;  3WGD A;  2V6K A;  2DIZ A;  2H73 A;  3FZ5 A;  4O32 A;  1M99 A;  3GST A;  3IHQ A;  1XW9 A;  1AUC A;  1K0N A;  3QMX A;  4KH7 A;  1JZR A;  2R5G A;  4EE0 A;  1EZK A;  1KTE A;  2C4J A;  2AAW A;  2LRN A;  3HJP A;  1PL1 A;  2F3M A;  2YCD A;  5AIV A;  2O8V B;  2IMK A;  2CX4 A;  2HXK A;  2AV4 A;  2JSY A;  2YZU A;  2AYT A;  4IQA A;  3M9J A;  5G5F A;  2IFQ A;  4OO4 A;  3JCM L;  1G0T A;  1TTZ A;  3FZ4 A;  2I9H A;  1TK5 B;  1EGR A;  4F9Z A;  2OAC A;  4I97 A;  4ZBD A;  3GV1 A;  4GSN A;  4WR4 A;  4TR1 A;  3UOM A;  2MBS A;  1PSQ A;  1AW9 A;  3EYT A;  1GUH A;  3HZ8 A;  4MCU A;  6GSU A;  4PNF A;  4QL9 A;  2VAF A;  3TGZ A;  1K3L A;  3US3 A;  3IC4 A;  4HI7 A;  2VCZ A;  4X1U A;  4WF4 A;  3TRX A;  1VF2 A;  3LEF A;  4AJ6 A;  3TJG A;  1YEX A;  4MZW A;  2DJ3 A;  3A2W A;  3ISO A;  4F03 A;  4PXO A;  1SJZ A;  22GS A;  2YP6 A;  2EIO A;  4GQC A;  2B1K A;  3KZQ A;  4ACS A;  1OYJ A;  1JZW A;  2LST A;  3SBC A;  2C0E A;  5ECQ B;  6GSX A;  1URM A;  4DEJ A;  3BBY A;  4MDC A;  2KLX A;  3GX0 A;  3HY2 A;  2RUE A;  2H72 A;  1OE7 A;  2IJY A;  2C80 A;  1TJD A;  2O89 A;  4HUA A;  1OVN A;  1XW6 A;  1SK0 A;  4MA9 A;  2B7K A;  2F8A A;  1U87 A;  1R7H A;  1YDK A;  2F8F A;  2AUV A;  1X0R A;  3LFL A;  1BED A;  1O7U A;  2VCX A;  3HZ4 A;  1KEB A;  3ZRD A;  5CRW A;  2DML A;  2R3X A;  2DJJ A;  4I8B A;  3W6G A;  3UAP A;  5IPG A;  2IN3 A;  1FOV A;  3FW2 A;  5IOX A;  4K6X A;  1T8E B;  3E0U A;  2GTU A;  2V1M A;  4GST A;  1F3A A;  4XS1 A;  3VK9 A;  2O7K A;  1MD3 A;  2V2G A;  5DCH A;  3UBK A;  1PD2 1;  1V9W A;  2H71 A;  2E7P A;  3FR3 A;  1SJI A;  4ZB6 A;  1XZO A;  4L5O A;  3GKM A;  5AIS A;  2VLV A;  3HVX A;  4GRF A;  3LSZ A;  6GSV A;  1TU8 A;  13GS A;  1F3B A;  5A4V A;  4Z7X A;  2VCT A;  3C1R A;  1B9X C;  1CQH A;  1DUG A;  5D9X A;  2CQ9 A;  1K0C A;  3IA1 A;  2ZUP A;  4HOJ A;  4ECJ A;  3CSJ A;  4AJ7 A;  4IGJ A;  2RM5 A;  2YOI A;  3PH9 A;  3IAS 2;  2DLX A;  4ISD A;  1GTU A;  4K8M A;  4KAE A;  2LJA A;  4HZ2 A;  3A5W A;  3ZMK A;  5L71 A;  1RW1 A;  2CAI A;  1JLV A;  4DSS A;  1DE2 A;  1TK0 B;  4HDE A;  1Z7R A;  3V1W A;  1XW5 A;  2GGT A;  2GQL A;  4O7H A;  1M9B A;  3I9V 2;  2H76 A;  5D9W A;  1GWC A;  3ZVJ D;  1PQN A;  3L78 A;  1G7E A;  2QGV A;  4YAP A;  4MJC A;  4JR4 A;  3H79 A;  1N8J A;  2PMT A;  3KM6 A;  3QCP A;  1K0M A;  5ID2 A;  3K8N A;  3MAK A;  3NZN A;  2NBS A;  3ZFB A;  1VF1 A;  3IE3 A;  1TI1 A;  4TXO A;  4O92 A;  1Z5Y E;  1FAA A;  4PQH A;  2KUC A;  4IJI A;  4LMV A;  4FO5 A;  1XWG A;  2H8L A;  1MDJ A;  3F8U A;  1O85 A;  4IP6 A;  2VCV A;  3GYK A;  5CRG A;  1ACV A;  1T4Z A;  4ZBA A;  2YN1 A;  5CNW A;  4WBR D;  4KGI A;  5JCG A;  1B8X A;  2YNX A;  2GDR A;  1T00 A;  2HRN A;  2BJX A;  1IYI A;  5DCG A;  3Q18 A;  1XWK A;  4KB3 A;  3LGC A;  3UAR A;  4MH2 A;  4PUF C;  4HU7 A;  5D9V A;  4OFN A;  4HQS A;  3TKQ A;  16GS A;  4KDY A;  4H86 A;  4XHM A;  1F9M A;  3KGK A;  3UVH A;  2DIY A;  4MMM A;  1Z7P A;  2DJK A;  1O8X A;  3LOR A;  2A4V A;  2MZC A;  1JLW A;  2XBI A;  3EWL A;  1DBY A;  12GS A;  2IPA A;  2VM2 A;  2H0G A;  2GLR A;  2L6C A;  3KMN A;  4MK3 A;  2A2S A;  3UBL A;  4TW5 A;  1GSY A;  4ECB A;  4OFT A;  1Q4J A;  1A8L A;  4YH2 A;  3GH9 A;  3EMP A;  2OJL A;  5F07 A;  3M0F A;  2KHP A;  2CX3 A;  4MP4 A;  2LJK A;  1S3D A;  2H30 A;  2C3N A;  2VO4 A;  2C8U A;  2IMD A;  2VCW A;  3IDV A;  4MJA A;  4DVC A;  3E3E A;  1GSS A;  3M8N A;  1ABA A;  2LEG A;  1PX7 A;  1GSU A;  3D22 A;  3QAW A;  4JRR A;  4HU9 A;  1YZX A;  4N11 A;  1GLP A;  5GAP D;  4TVE A;  4LMW A;  2VL2 A;  4XS4 B;  1TXX A;  19GS A;  4NHW A;  2QC7 A;  1TRW A;  2X64 A;  3G9B A;  1UVZ A;  2JZS A;  2YV7 A;  1YEP A;  4P3Y B;  3LWA A;  3CYN A;  1SL1 B;  3GX8 A;  3FEU A;  1EV9 A;  5G5E A;  5H5S A;  5LCZ A;  5AIX A;  2PER A;  1HQO A;  3MSZ A;  3TKS E;  5DAL B;  4MPF A;  4IEL A;  4X0X A;  4YQU A;  1I9D A;  3HVS A;  5B6N A;  2YWO A;  3ZLP A;  2KP2 A;  5HFG A;  4OCE A;  3GKN A;  2IMF A;  4MZB A;  4BL7 A;  3VLN A;  3DWV A;  2F9S A;  2HE3 A;  1U3A A;  1YY7 A;  3ME8 A;  5IMC A;  2REM A;  2XBQ A;  3C73 A;  2RM6 A;  1OKD A;  1X9M B;  5H5R A;  3UIW A;  1R4W A;  2EIR A;  4EUY A;  4HZ4 A;  4QL7 A;  3A3T A;  1WP0 A;  5INY A;  3BOA A;  5DBQ A;  5IOW A;  4G19 A;  3C7M A;  5HR2 A;  5IMF A;  4L0W A;  1NHY A;  2FA4 A;  2AJQ B;  1HNB A;  3GH6 A;  5E59 A;  3WD6 A;  1MD4 A;  3G7I A;  3QPM A;  2HNL A;  1WJK A;  4HQZ A;  3HA9 A;  3LXZ A;  1FO5 A;  1SL2 B;  4K0N A;  2CZ3 A;  2NDO A;  4JED A;  3VWV A;  2PVO C;  2J23 A;  3GL5 A;  2I1U A;  1OE8 A;  3FRC A;  4MF5 A;  3D0Z A;  2L4Q A;  4KW6 A;  5E4W A;  2PGT A;  2J9H A;  1TK8 B;  2YWI A;  1GTB A;  3DXB A;  3IAM 2;  1T3B A;  2H01 A;  1QGV A;  1TW9 A;  4D73 B;  4ULX A;  4JZQ A;  2WCI A;  5ECH B;  2JU5 A;  1SU9 A;  2KOK A;  2LNS A;  2NPB A;  1X9S B;  3ZYW A;  3F4R A;  2GSS A;  3FZ9 A;  1XWA A;  2I81 A;  1ZMA A;  4BVX A;  5JWR B;  3DVW A;  2IME A;  1Z9H A;  2P31 A;  2OE1 A;  1OC9 A;  1M2A A;  1XOB A;  2FD3 A;  1U3I A;  2V41 A;  5D9T A;  1LBK A;  1O73 A;  1WMJ A;  1AIU A;  1O6J A;  3CRU A;  2FA8 A;  2M46 A;  5ECP B;  4HJ2 A;  4CW9 A;  2O87 A;  3FYG A;  1GTI A;  3J7Y b;  2LTK A;  4J57 E;  4CHS A;  2O85 A;  1IYH A;  1ST9 A;  4MAB A;  3VUR A;  3CSI A;  4ML6 A;  3U5R E;  3DKS A;  3L0H A;  4KSO A;  3ZIJ A;  1VGL A;  2RLI A;  1GL8 A;  3DML A;  2PUK C;  4DSR A;  2L4C A;  3LXT A;  2CA8 A;  2QSI A;  5D93 A;  1B4P A;  1SK1 A;  1EOG A;  1GSF A;  2H6X A;  4KSM A;  1RQM A;  1FG4 A;  1AQX A;  4PUR A;  4I2T A;  3BD2 A;  1K0D A;  2CVK A;  4DSQ A;  4MF7 A;  5J41 A;  3TRP A;  3DD3 A;  2C1Y A;  4L8E A;  3BJ5 A;  5COH A;  4IP1 A;  2IIY A;  1A8Y A;  2FWH A;  5LNK e;  3VI5 A;  2GT5 A;  4ZB8 A;  1M2B A;  3H4K A;  5IPH A;  3C1S A;  3ME7 A;  4AF2 A;  4F82 A;  2E0Q A;  3KP8 A;  5J5N A;  2L59 A;  1T1V A;  1EEJ A;  2H1A A;  4HS1 A;  4PX1 A;  1H4O A;  4GWR A;  2WFC A;  1Z3E A;  3O3T A;  3D5J A;  2DJ2 A;  1XVQ A;  1N2A A;  5GST A;  2VD1 A;  5F05 A;  1CQG A;  4BWQ A;  4NXI A;  4F2I A;  4RUV A;  5AN1 A;  3GKK A;  4TR4 A;  4ZIJ A;  4KA0 A;  2EC4 A;  1W4V A;  3LYP A;  1PX6 A;  3HVV A;  3MNG A;  3VFI A;  1H75 A;  5A4W A;  2H1D A;  4IW9 A;  2GT6 A;  3HJO A;  5EL8 A;  1GUL A;  3CTG A;  3DYR A;  2H74 A;  2DMM A;  2IWT A;  5B6M A;  1E2Y A;  5KEJ A;  3QOU A;  1GUM A;  1PKW A;  4XS4 A;  1A2L A;  3ZIT A;  2HZE A;  3TKS A;  3HXS A;  4Q5N A;  2DJ1 A;  2PPT A;  2ALB A;  1SKS B;  3M3M A;  2CVD A;  3QDN A;  4TKY A;  2FWG A;  4KDX A;  3EU4 A;  1Z6M A;  2GSR A;  3GMF A;  3KJY A;  2ON7 A;  2FHE A;  1TRS A;  5F0G A;  5DAL A;  3RBT A;  1F2E A;  3PR8 A;  5CRE A;  3QAV A;  2YAN A;  2WZ9 A;  2LV3 A;  3FK8 A;  1LJR A;  1ZCP A;  2XHF A;  4QQ7 A;  3VPT A;  1B4Q A;  4NAX A;  4AGS A;  5B8B A;  3LJR A;  3Q74 A;  1U88 A;  4XS6 A;  4GCI A;  1Y25 A;  3DIE A;  3BCK A;  1SEN A;  8GSS A;  4POM A;  3CXG A;  3W8J A;  3SWL A;  3HYP A;  3VWW A;  4ZL9 A;  3Q6O A;  4EC0 A;  3ERW A;  4N10 A;  2FCH A;  10GS A;  1SYR A;  4PQI A;  5IO2 A;  2OE3 A;  1TU7 A;  3LYK A;  3P90 A;  3HKR A;  1NW2 A;  5CRD A;  3VWU A;  1QMV A;  4LLR A;  2IFQ B;  1BJX A;  1ZZY A;  1MTC A;  1PRX A;  1WIK A;  1AC1 A;  1C72 A;  5J9B A;  1OC3 A;  4K2D A;  1JZD A;  1GSE A;  1GSQ A;  3APO A;  1XWC A;  2CVB A;  1USB A;  3AY8 A;  4TR1 B;  4WEY A;  3UEM A;  5ABR A;  3EU3 A;  2HT9 A;  3FR6 A;  1J08 A;  5ELA A;  1EWX A;  2X8H A;  1PGT A;  1W89 A;  1AQV A;  1DSB A;  2C0F A;  4OD7 A;  3TJJ A;  3M9K A;  5JCW A;  3D21 A;  5JWO B;  1WPI A;  2IMI A;  2BMX A;  2H75 A;  4K1F A;  1V57 A;  2HRF A;  3CSH A;  3O76 A;  3F6F A;  5ECL B;  3N9J A;  3D4M A;  1FHE A;  1R5A A;  4F0C A;  2G0F A;  1A2M A;  4KX4 A;  1YKA A;  4EDY A;  2JL4 A;  2FLS A;  1ZGN A;  2LQO A;  4D73 A;  4GSS A;  4NV2 A;  3TJF A;  2JAD A;  3TDG A;  2V32 A;  5J4U A;  4TOP A;  4NV5 A;  4ZXG A;  1PL2 A;  5HR3 A;  2CT6 A;  4TN8 A;  18GS A;  2WJU A;  4ZIL A;  3GFK A;  2LNT A;  4WXT A;  1KNG A;  1FVJ A;  4TR0 A;  4BWS A;  2H0H A;  1RK4 A;  4TXV A;  3KEB A;  5F8B A;  3WGE A;  5HR0 A;  3TRQ A;  3H8Q A;  5CP1 A;  3ZFL A;  4OO5 A;  5D96 A;  3N5O A;  3FZA A;  1ZL9 A;  2OBI A;  4V1A p;  4NHZ A;  3GN3 A;  2E2G A;  20GS A;  5ECK B;  11GS A;  4BVY A;  2FWE A;  1K0B A;  1JHB A;  3NOF A;  4TR3 A;  2OKA A;  1OAZ A;  2OE0 A;  2VL2 C;  5GSS A;  1S3A A;  2VD0 A;  3QFB C;  4F0B A;  2AHE A;  2LKU A;  2X99 A;  3PGT A;  2WB9 A;  3F3Q A;  3EC3 A;  1HNC A;  1OC8 A;  3E9J B;  4EL1 A;  2N5F A;  3TJB A;  2GQK A;  1FB0 A;  2MMZ A;  2N5A A;  4N0Z A;  2FGX A;  5ECS A;  3GNJ A;  2X8C A;  3RPP A;  4FIW A;  4XRA A;  3F3R A;  5IQY A;  3J7Y k;  4K7I A;  2RII A;  1E6B A;  2YWN A;  4KE3 A;  4G9H A;  2PWJ A;  2H19 A;  3CRT A;  3GRX A;  2TIR A;  4V2M A;  1NHO A;  1JZO A;  3M1G A;  1XBS A;  2TRC P;  4JR6 A;  3ERG A;  14GS A;  2JSZ A;  3D4T A;  3GKX A;  3VPQ A;  2WGR A;  3ZML A;  3G7Y A;  2R6K A;  4I5Q A;  4MPG A;  1YQ1 A;  3GL3 A;  2ZCT A;  4G2E A;  5JWQ B;  3RPN A;  4ILF A;  4Q5F A;  1A0R P;  3A2X A;  3QFA C;  4DSS B;  5FT3 A;  4J56 E;  4MLY A;  4RI6 A;  2YWM A;  3GA4 A;  1MDK A;  4Q5Q A;  4BA7 A;  2R4V A;  1O81 A;  1HYU A;  4NWY A;  1ERV A;  2EIQ A;  2HZF A;  1K0A A;  5CYY A;  2GVP A;  2R2J A;  5AGY A;  3KP9 A;  2IL3 A;  3QAG A;  1BQ7 A;  1NSW A;  1QFN A;  2OAD A;  4EXJ A;  1SD8 A;  4XIH A;  3F6D A;  2VLT A;  6GSW A;  2C3T A;  1J9B A;  1O8W A;  2FNO A;  1QK8 A;  4KCE A;  3VI7 A;  1GRX A;  5ID2 B;  1THO A;  4CDO A;  2V6O A;  2H1B A;  4OWY A;  4IHU A;  5KN0 A;  5D73 A;  4V2L A;  3KH9 A;  1R5P A;  1GSD A;  1GNW A;  1YF1 A;  4POK A;  3LG6 A;  1K3Y A;  1FVK A;  5IO0 A;  2HSY A;  3KXO A;  3IV4 A;  2M72 A;  1TKD B;  2JZT A;  3L9V A;  2NVL A;  5CAX A;  1ZYE A;  5C00 A;  3O6T A;  2MMO A;  4O5R A;  2H66 A;  2K8V A;  5IMV A;  3GTU B;  2C0D A;  4ZBB A;  4YQM A;  3QD9 A;  5J3R A;  4WKW A;  2GST A;  3GIX A;  1X5E A;  4POL A;  3ZTL A;  2G2Q A;  3IXR A;  4MF6 A;  3ZZX A;  3GSS A;  4K0G A;  5A5K A;  1THX A;  2VIM A;  2K8S A;  3WGX A;  1V2A A;  3ERF A;  4IVF A;  1QUW A;  4LL1 B;  1SL0 B;  1YJ6 A;  3TCO A;  5EVO A;  3BCI A;  2GZY A;  1TRV A;  2GZP A;  2P5Q A;  3G7J A;  1V58 A;  1DE1 A;  1TP9 A;  1Y6E A;  1PN9 A;  2HYX A;  3MWH A;  1XFL A;  5IMZ A;  4EVM A;  2YJH A;  1GUK A;  2X8G A;  4LA1 A;  3FHK A;  5KN3 A;  1EP8 A;  1NM3 A;  1PKZ A;  4IKH A;  4MH3 A;  5KN2 A;  1WWJ A;  5DQY A;  3APQ A;  4OFM A;  3UL3 A;  2HI7 A;  5G31 A;  1V40 A;  1M0U A;  1U6T A;  1ERU A;  1YKC A;  1UN2 A;  5FHI A;  3HHV A;  3R2Q A;  3HDC A;  1WOU A;  3RHC A;  3F4S A;  2K9F A;  1V98 A;  2P5R A;  1ILO A;  1A2J A;  4EF0 A;  5ECI B;  5G1K A;  2YPM A;  1G6Y A;  3KD0 A;  4ECC A;  1XPV A;  4ML1 A;  1WE0 A;  3C71 A;  4GQF A;  3I69 A;  2HLS A;  2K6V A;  1TDI A;  2QKE A;  4N0V A;  2YV9 A;  1SD9 A;  5IMD A;  4HJM A;  4IN0 A;  5G30 A;  2VL3 A;  2I3Y A;  4WR5 A;  2MMN A;  2B3S A;  1X5D A;  2D2Z A;  3CBU A;  3I43 A;  4FH8 A;  3W8S A;  1TOF A;  3ZL5 A;  1PMT A;  1PA3 A;  3H93 A;  4MJB A;  2GSQ A;  4KUN A;  1MEK A;  1XOA A;  1EV4 A;  2C3Q A;  2PU9 C;  3D6I A;  4L5L A;  3TKR A;  4EKZ A;  1XXU A;  2GS3 A;  3ZRE A;  1BAY A;  2ON5 A;  1T4Y A;  4KDU A;  2WUL A;  3RHB A;  2Z9S A;  4XTS A;  3F9U A;  1G6W A;  1XCC A;  4HEA 2;  3DRN A;  2R37 A;  1QQ2 A;  2L6D A;  5IMA A;  2VLU A;  3TKS C;  5DAK B;  1K3O A;  2F51 A;  1M7T A;  4XCS A;  1SKR B;  2C0G A;  4ZB9 A;  4AJ8 A;  2GZZ A;  2OA7 A;  3NIV A;  2LQQ A;  2K18 A;  4X43 A;  4L0U A;  3H1N A;  1Z6N A;  2CZ2 A;  1GH2 A;  3UJ1 A;  1QXH A;  5CO3 A;  3I6A A;  5D8I A;  3EE2 A;  5A4U A;  5EY6 A;  4NMU A;  2YJ7 A;  3F4T A;  2H0I A;  1G7O A;  5B7C A;  2VM1 A;  2VL9 A;  1OKT A;  3UVT A;  1GLQ A;  5G2Z A;  3QR6 A;  1ERW A;  3L9S A;  3EMX A;  7GSS A;  3IK9 A;  3RAZ A;  1A0F A;  5IM9 A;  5ECR B;  1ON4 A;  4RI7 A;  1ML6 A;  1SYX A;  1AQW A;  5HR1 A;  1Q98 A;  1YF0 A;  2VOC A;  5ELG A;  3P7X A;  3U6V A;  2JZR A;  2RUF A;  1BX9 A;  5ECO B;  4PNG A;  2MBT A;  1OC9 B;  4IBP A;  2LS5 A;  4YQV A;  5ECN B;  3TB2 A;  4PQ1 A;  1K0O A;  2DBC A;  2E2M A;  17GS A;  2WS2 A;  3GUR A;  3LQ7 A;  4GF0 A;  4FYC A;  1TI3 A;  2AB6 A;  1S3C A;  4K9Z A;  2CV4 A;  5ECM B;  3Q19 A;  3KH7 A;  4PUA A;  5IIZ A;  2LJR A;  5F06 A;  4JU5 A;  1SJ6 A;  5CRH A;  3FR9 A;  2H6Y A;  2DSA A;  3P8W A;  1M9A A;  2XPE A;  3IRA A;  1R26 A;  4ZL8 A;  3KTL A;  2B6M A;  2LRC A;  4RQR A;  3L9U A;  2A2R A;  2WDU A;  4J2F A;  1AXD A;  1GTA A;  1KBN A;  3TOU A;  5C04 A;  4ID0 A;  5H5Q A;  5HQP A;  1X9W B;  5HFI A;  3TKP A;  1SK2 A;  3GTU A;  1JFU A;  1J0F A;  2DC5 A;  1XVW A;  4WF5 A;  3EUR A;  4K7O A;  3S9F A;  2I4A A;  1FB6 A;  4GXZ A;  2XC2 A;  4V2N A;  3IR4 A;  1ZOF A;  1EP7 A;  2OBK A;  4JE1 A;  1HNA A;  3CMI A;  4JBB A;  4ECI A;  3P2A A;  2L57 A;  3DGQ A;  3EVI A;  4MJE A;  3CTF A;  3KCM A;  5EPF A;  6GSY A;  3IBH A;  5HFK A;  3KMO A;  2XPD A;  3ZIV A;  2HFD A;  2YZH A;  5GZZ B;  4IS0 A;  9GSS A;  1AAZ A;  4E8E A;  4LL4 B;  4TRX A;  2B1L A;  2MMA A;  4I2U A;  1M2D A;  2LRT A;  4GLT A;  4FYU A;  1FW1 A;  3IOS A;  3MDK A;  5DJL A;  3WT2 A;  1I5G A;  3KIJ A;  3DVX A;  4G10 A;  1B48 A;  1F37 A;  2FUG 2;  4EDZ A;  3TJK A;  3FY7 A;  4EO3 A;  2LUS A;  2TRX A;  1GNE A;  4WBJ A;  3HD5 A;  2ES7 A;  5ENU A;  5B8A A;  3APS A; 
#chains in the Genus database with same CATH topology
 3KTB A;  2BTO T;  2KP1 A;  1EGO A;  5G1L A;  4PTS A;  5FWG A;  3F63 A;  2HZE B;  2L5O A;  3C8E A;  4I6X A;  1UA5 A;  4YAV A;  2PVQ A;  4ZL7 A;  1B9Y C;  4XRD A;  4Q5R A;  1HD2 A;  3DEX A;  3HCZ A;  2WRT A;  1VF3 A;  4V1A g;  3HJM A;  4BPY A;  1ZYQ B;  2L5L A;  3RDW A;  2DJ0 A;  6GSS A;  4NPB A;  3ZVJ A;  5J9C A;  1WRY A;  1MDI A;  2JAC A;  1F6M C;  5DQS A;  1XIY A;  5KN1 A;  2B5Y A;  2B7J A;  1XWB A;  1LU4 A;  2M80 A;  3TUE A;  5DDL A;  3F0I A;  1VF4 A;  1UC7 A;  4OMV A;  4IQ1 A;  3L4N A;  3VWX A;  2H70 A;  3FKF A;  1BG5 A;  5DJM A;  3WYW A;  1EOH A;  1A24 A;  4OCF A;  2PN8 A;  3IK7 A;  3GHA A;  3WT1 A;  2B5X A;  3IPZ A;  3GUS A;  2FWF A;  4FYB A;  2FY6 A;  2PBJ A;  5JCU A;  1GP1 A;  5LD0 A;  3A2V A;  2MYG A;  3EIN A;  1X5C A;  3OR5 A;  3UMA A;  2H6Z A;  5KOX A;  4GTU A;  4RQX A;  5DAK A;  1PFO A;  1A23 A;  2HSH A;  4K5R A;  5GAN D;  4K7N A;  4KCA A;  4E8H A;  4TXO B;  4IJ3 A;  2ZNM A;  2NTO A;  1TRU A;  4N30 A;  1EEM A;  1ERT A;  2GQM A;  3ED3 A;  2VCQ A;  1VRS D;  2P0G A;  2CAQ A;  3TOT A;  2VUP A;  3PIN A;  4POB A;  4MZC A;  4KND A;  5DVB A;  3HVN A;  2B5E A;  1T7P B;  1SKW B;  4WET A;  2H1G A;  2N5B A;  1BYE A;  6GST A;  4PGT A;  3WGD A;  2V6K A;  2DIZ A;  2H73 A;  3FZ5 A;  4O32 A;  1M99 A;  3GST A;  3IHQ A;  1XW9 A;  1AUC A;  1K0N A;  3QMX A;  4KH7 A;  1JZR A;  2R5G A;  4EE0 A;  1EZK A;  1KTE A;  2C4J A;  2AAW A;  2LRN A;  3HJP A;  1PL1 A;  2F3M A;  2YCD A;  5AIV A;  2O8V B;  2IMK A;  2CX4 A;  2HXK A;  2AV4 A;  2JSY A;  2YZU A;  2AYT A;  4IQA A;  3M9J A;  4K2X A;  5G5F A;  2IFQ A;  4OO4 A;  3JCM L;  1G0T A;  1TTZ A;  3FZ4 A;  2I9H A;  1TK5 B;  1EGR A;  4F9Z A;  2OAC A;  4I97 A;  4ZBD A;  3GV1 A;  4GSN A;  4WR4 A;  4TR1 A;  3UOM A;  2MBS A;  1PSQ A;  1AW9 A;  3EYT A;  1GUH A;  3HZ8 A;  2R0C A;  4MCU A;  6GSU A;  4PNF A;  4QL9 A;  2X4A A;  2VAF A;  3TGZ A;  1K3L A;  3US3 A;  3IC4 A;  4HI7 A;  2VCZ A;  4X1U A;  4WF4 A;  3TRX A;  1VF2 A;  3R3E A;  3LEF A;  4AJ6 A;  3TJG A;  4BVY B;  1M3I A;  1YEX A;  4MZW A;  2DJ3 A;  3A2W A;  4CY8 A;  3ISO A;  4F03 A;  4PXO A;  1SJZ A;  22GS A;  2YP6 A;  2A4H A;  2EIO A;  4GQC A;  2B1K A;  3KZQ A;  4ACS A;  1OYJ A;  1JZW A;  2LST A;  3SBC A;  2C0E A;  5ECQ B;  6GSX A;  1URM A;  1ZYN A;  4DEJ A;  3BBY A;  4MDC A;  2KLX A;  3GX0 A;  3HY2 A;  2RUE A;  2H72 A;  1OE7 A;  2IJY A;  2C80 A;  1TJD A;  2O89 A;  4HUA A;  1OVN A;  1XW6 A;  1SK0 A;  4MA9 A;  2B7K A;  2F8A A;  1U87 A;  1R7H A;  1YDK A;  3MIX A;  2F8F A;  2AUV A;  1X0R A;  3LFL A;  1BED A;  1O7U A;  2VCX A;  3HZ4 A;  1KEB A;  3ZRD A;  5CRW A;  2DML A;  2R3X A;  2DJJ A;  4I8B A;  3W6G A;  3UAP A;  5IPG A;  2IN3 A;  1FOV A;  3FW2 A;  5IOX A;  4K6X A;  1T8E B;  3EPT A;  3E0U A;  2GTU A;  2V1M A;  4GST A;  1F3A A;  4XS1 A;  3VK9 A;  2O7K A;  1MD3 A;  2V2G A;  5DCH A;  3UBK A;  1PD2 1;  1V9W A;  2H71 A;  2E7P A;  3FR3 A;  1SJI A;  4ZB6 A;  1XZO A;  4L5O A;  3GKM A;  2DKI A;  5AIS A;  2VLV A;  3HVX A;  4GRF A;  3IHG A;  3LSZ A;  6GSV A;  1TU8 A;  13GS A;  1F3B A;  5A4V A;  4Z7X A;  2VCT A;  3C1R A;  1B9X C;  1CQH A;  1DUG A;  5D9X A;  2CQ9 A;  1K0C A;  3IA1 A;  2ZUP A;  4HOJ A;  4ECJ A;  3CSJ A;  4AJ7 A;  4IGJ A;  2RM5 A;  2YOI A;  3PH9 A;  3IAS 2;  2DLX A;  4ISD A;  4O5U A;  4EIP A;  1GTU A;  4K8M A;  4KAE A;  2LJA A;  4HZ2 A;  3A5W A;  3ZMK A;  5L71 A;  1RW1 A;  2CAI A;  1JLV A;  4DSS A;  1DE2 A;  1TK0 B;  4HDE A;  1Z7R A;  3V1W A;  1XW5 A;  2GGT A;  2GQL A;  4O7H A;  1M9B A;  3I9V 2;  4BVX B;  2H76 A;  5D9W A;  1GWC A;  3ZVJ D;  1PQN A;  3L78 A;  1G7E A;  2QGV A;  4YAP A;  4MJC A;  4JR4 A;  3H79 A;  1N8J A;  2PMT A;  3KM6 A;  3QCP A;  1K0M A;  5ID2 A;  2QA1 A;  3K8N A;  3MAK A;  3NZN A;  2NBS A;  3ZFB A;  1VF1 A;  3IE3 A;  1TI1 A;  4TXO A;  4O92 A;  1Z5Y E;  1FAA A;  4PQH A;  2KUC A;  4IJI A;  4LMV A;  4FO5 A;  1XWG A;  2H8L A;  1MDJ A;  3F8U A;  1O85 A;  4IP6 A;  2VCV A;  3GYK A;  5CRG A;  1ACV A;  1T4Z A;  4ZBA A;  2YN1 A;  5CNW A;  4WBR D;  1S3R A;  4KGI A;  5JCG A;  1B8X A;  2YNX A;  2GDR A;  1T00 A;  2HRN A;  2BJX A;  1IYI A;  5DCG A;  3Q18 A;  1XWK A;  4KB3 A;  3LGC A;  3UAR A;  2UZ8 A;  4MH2 A;  4PUF C;  4HU7 A;  5D9V A;  4OFN A;  4HQS A;  3TKQ A;  16GS A;  4KDY A;  4H86 A;  4XHM A;  1F9M A;  3KGK A;  3UVH A;  2DIY A;  4MMM A;  1Z7P A;  2DJK A;  1O8X A;  3LOR A;  2A4V A;  2MZC A;  1JLW A;  2XBI A;  3EWL A;  1DBY A;  12GS A;  2IPA A;  2VM2 A;  2H0G A;  4KF9 A;  2GLR A;  2L6C A;  3KMN A;  4MK3 A;  2A2S A;  3UBL A;  4TW5 A;  1GSY A;  4ECB A;  1ZYP A;  4OFT A;  1Q4J A;  1A8L A;  4YH2 A;  3GH9 A;  3EMP A;  2OJL A;  5F07 A;  3M0F A;  2KHP A;  2CX3 A;  4MP4 A;  2LJK A;  1S3D A;  2H30 A;  2C3N A;  2VO4 A;  2C8U A;  2IMD A;  4O5Q A;  2VCW A;  3IDV A;  4MJA A;  4DVC A;  3E3E A;  1GSS A;  3M8N A;  1ABA A;  2LEG A;  1PX7 A;  1GSU A;  3D22 A;  3QAW A;  4JRR A;  4HU9 A;  1YZX A;  4N11 A;  1GLP A;  2X49 A;  5GAP D;  4TVE A;  4LMW A;  2VL2 A;  4XS4 B;  1TXX A;  19GS A;  4NHW A;  2QC7 A;  1TRW A;  2X64 A;  4Z2T A;  3G9B A;  1UVZ A;  2JZS A;  2YV7 A;  1YEP A;  4P3Y B;  3LWA A;  3CYN A;  1SL1 B;  3GX8 A;  3FEU A;  1EV9 A;  5G5E A;  5H5S A;  5LCZ A;  5AIX A;  2PER A;  1HQO A;  3MSZ A;  3TKS E;  5DAL B;  4MPF A;  4IEL A;  4X0X A;  4YQU A;  3MYD A;  1I9D A;  3HVS A;  5B6N A;  2YWO A;  3ZLP A;  2KP2 A;  5HFG A;  4OCE A;  3GKN A;  2IMF A;  4MZB A;  4BL7 A;  3VLN A;  3DWV A;  2F9S A;  4YKG A;  2HE3 A;  1U3A A;  1YY7 A;  3ME8 A;  5IMC A;  2REM A;  2XBQ A;  3C73 A;  2RM6 A;  1OKD A;  1X9M B;  5H5R A;  3UIW A;  1R4W A;  2EIR A;  4EUY A;  4HZ4 A;  4QL7 A;  3A3T A;  1WP0 A;  5INY A;  3BOA A;  5DBQ A;  5IOW A;  4G19 A;  3C7M A;  5HR2 A;  5IMF A;  4L0W A;  1NHY A;  2FA4 A;  2AJQ B;  1HNB A;  3GH6 A;  5E59 A;  3WD6 A;  1MD4 A;  3G7I A;  3QPM A;  2HNL A;  1WJK A;  4HQZ A;  3HA9 A;  3LXZ A;  1FO5 A;  1SL2 B;  4K0N A;  2CZ3 A;  2NDO A;  4JED A;  3VWV A;  2PVO C;  2J23 A;  3GL5 A;  2I1U A;  1OE8 A;  3FRC A;  3IC8 A;  4MF5 A;  3D0Z A;  2L4Q A;  4KW6 A;  5E4W A;  2PGT A;  2J9H A;  1TK8 B;  2YWI A;  1GTB A;  4CY6 A;  3DXB A;  3IAM 2;  1T3B A;  2H01 A;  1QGV A;  1TW9 A;  4D73 B;  4ULX A;  4JZQ A;  2WCI A;  5ECH B;  2JU5 A;  1SU9 A;  2KOK A;  2LNS A;  2NPB A;  1X9S B;  3ZYW A;  3F4R A;  2GSS A;  3FZ9 A;  1XWA A;  2I81 A;  1ZMA A;  4BVX A;  5JWR B;  3DVW A;  2IME A;  1Z9H A;  2P31 A;  2OE1 A;  1OC9 A;  1M2A A;  1XOB A;  2FD3 A;  1U3I A;  2V41 A;  5D9T A;  1LBK A;  1O73 A;  1WMJ A;  1AIU A;  1O6J A;  3CRU A;  2FA8 A;  2M46 A;  5ECP B;  4HJ2 A;  4CW9 A;  2O87 A;  3FYG A;  1GTI A;  3J7Y b;  2LTK A;  3PPU A;  4J57 E;  4CHS A;  2O85 A;  1IYH A;  1ST9 A;  4MAB A;  3VUR A;  3CSI A;  4ML6 A;  3U5R E;  3DKS A;  3L0H A;  4G0I A;  4KSO A;  3ZIJ A;  1VGL A;  2RLI A;  1GL8 A;  3DML A;  2PUK C;  4DSR A;  2L4C A;  3LXT A;  2CA8 A;  2QSI A;  5D93 A;  1B4P A;  1SK1 A;  1EOG A;  1GSF A;  2H6X A;  4KSM A;  1RQM A;  1FG4 A;  1AQX A;  4PUR A;  4I2T A;  3BD2 A;  1K0D A;  2CVK A;  4DSQ A;  4MF7 A;  5J41 A;  3TRP A;  3DD3 A;  2C1Y A;  4L8E A;  3BJ5 A;  5COH A;  4IP1 A;  2IIY A;  1A8Y A;  2FWH A;  5LNK e;  3VI5 A;  2GT5 A;  4ZB8 A;  1M2B A;  3H4K A;  5IPH A;  3C1S A;  3ME7 A;  4AF2 A;  4F82 A;  2E0Q A;  3KP8 A;  5J5N A;  2L59 A;  1T1V A;  1EEJ A;  2H1A A;  2HSM A;  2R0G A;  4HS1 A;  4PX1 A;  1H4O A;  4GWR A;  2WFC A;  1Z3E A;  3O3T A;  3D5J A;  2DJ2 A;  1XVQ A;  1N2A A;  1PN0 A;  5GST A;  2VD1 A;  5F05 A;  1CQG A;  4BWQ A;  4NXI A;  4F2I A;  4RUV A;  5AN1 A;  3GKK A;  4TR4 A;  4ZIJ A;  4KA0 A;  2EC4 A;  1W4V A;  3LYP A;  1PX6 A;  3HVV A;  3MNG A;  3VFI A;  1H75 A;  5A4W A;  2H1D A;  4IW9 A;  2GT6 A;  3HJO A;  5EL8 A;  1GUL A;  3CTG A;  3DYR A;  2H74 A;  2DMM A;  2IWT A;  5B6M A;  1E2Y A;  4X4J A;  5BRT A;  5KEJ A;  3QOU A;  1GUM A;  1PKW A;  4XS4 A;  1A2L A;  3ZIT A;  2HZE A;  3TKS A;  3HXS A;  4Q5N A;  2DJ1 A;  2PPT A;  2ALB A;  1SKS B;  3M3M A;  2CVD A;  3QDN A;  4TKY A;  2FWG A;  4KDX A;  3EU4 A;  1Z6M A;  2GSR A;  3GMF A;  3KJY A;  2ON7 A;  2FHE A;  1TRS A;  5F0G A;  5DAL A;  3RBT A;  1F2E A;  3PR8 A;  5CRE A;  3QAV A;  2YAN A;  2WZ9 A;  2LV3 A;  3FK8 A;  1LJR A;  1ZCP A;  2XHF A;  4QQ7 A;  3VPT A;  1B4Q A;  4NAX A;  4AGS A;  5B8B A;  3LJR A;  3Q74 A;  1U88 A;  2R0P A;  4XS6 A;  4GCI A;  1Y25 A;  3DIE A;  3BCK A;  2DKH A;  1SEN A;  8GSS A;  4POM A;  3CXG A;  3W8J A;  3SWL A;  3HYP A;  3VWW A;  4ZL9 A;  3Q6O A;  4EC0 A;  4MNN A;  3ERW A;  4N10 A;  2FCH A;  10GS A;  1SYR A;  4PQI A;  5IO2 A;  2OE3 A;  1TU7 A;  3LYK A;  3P90 A;  3HKR A;  1NW2 A;  5CRD A;  3VWU A;  1QMV A;  4LLR A;  2IFQ B;  1BJX A;  1ZZY A;  1MTC A;  1PRX A;  1WIK A;  1AC1 A;  1C72 A;  5J9B A;  1OC3 A;  4K2D A;  1JZD A;  1GSE A;  1GSQ A;  3APO A;  1XWC A;  2CVB A;  1USB A;  3AY8 A;  4TR1 B;  4WEY A;  3UEM A;  5ABR A;  4BIK A;  3EU3 A;  2HT9 A;  3FR6 A;  1J08 A;  5ELA A;  1EWX A;  2X8H A;  1PGT A;  1W89 A;  1AQV A;  1DSB A;  2C0F A;  4OD7 A;  3TJJ A;  3M9K A;  5JCW A;  3D21 A;  5JWO B;  1WPI A;  2IMI A;  2BMX A;  2H75 A;  4K1F A;  1V57 A;  2HRF A;  3CSH A;  3O76 A;  3F6F A;  5ECL B;  3N9J A;  3D4M A;  1FHE A;  1FOH A;  1R5A A;  4F0C A;  2G0F A;  1A2M A;  4KX4 A;  1YKA A;  4EDY A;  2JL4 A;  2FLS A;  1ZGN A;  2LQO A;  3A5I A;  4D73 A;  4GSS A;  4NV2 A;  3TJF A;  2JAD A;  3TDG A;  2V32 A;  5J4U A;  4TOP A;  4NV5 A;  4ZXG A;  1PL2 A;  5HR3 A;  2CT6 A;  4TN8 A;  18GS A;  2WJU A;  4ZIL A;  3GFK A;  2LNT A;  4WXT A;  1KNG A;  1FVJ A;  4TR0 A;  4BWS A;  2H0H A;  1RK4 A;  4TXV A;  3KEB A;  5F8B A;  3WGE A;  5HR0 A;  3TRQ A;  3H8Q A;  5CP1 A;  3ZFL A;  4Z2U A;  4OO5 A;  5D96 A;  3N5O A;  3FZA A;  1ZL9 A;  2OBI A;  4V1A p;  4NHZ A;  3GN3 A;  2E2G A;  20GS A;  5ECK B;  11GS A;  4BVY A;  2FWE A;  1K0B A;  1JHB A;  3NOF A;  4TR3 A;  2OKA A;  1OAZ A;  2OE0 A;  2VL2 C;  5GSS A;  1S3A A;  2VD0 A;  3QFB C;  4F0B A;  4G0L A;  2AHE A;  2LKU A;  2X99 A;  3PGT A;  2WB9 A;  3F3Q A;  3EC3 A;  1HNC A;  1OC8 A;  3E9J B;  4EL1 A;  2N5F A;  3TJB A;  2GQK A;  1FB0 A;  2MMZ A;  2N5A A;  4N0Z A;  2FGX A;  3GNJ A;  5ECS A;  2X8C A;  3RPP A;  4FIW A;  4XRA A;  4G0K A;  3F3R A;  5IQY A;  3J7Y k;  4K7I A;  2RII A;  1E6B A;  2YWN A;  4KE3 A;  4G9H A;  2PWJ A;  2H19 A;  3CRT A;  3GRX A;  2TIR A;  4V2M A;  1NHO A;  1JZO A;  3M1G A;  1M3J A;  1XBS A;  2TRC P;  4JR6 A;  3ERG A;  14GS A;  2JSZ A;  3D4T A;  3GKX A;  3VPQ A;  2WGR A;  3ZML A;  3G7Y A;  2R6K A;  4I5Q A;  4MPG A;  4FQU A;  1YQ1 A;  3GL3 A;  2ZCT A;  4G2E A;  5JWQ B;  3RPN A;  4ILF A;  4Q5F A;  1A0R P;  3A2X A;  3QFA C;  4DSS B;  5FT3 A;  4J56 E;  4MLY A;  4RI6 A;  2YWM A;  5BMU A;  3GA4 A;  1MDK A;  4Q5Q A;  4BA7 A;  2R4V A;  1O81 A;  1HYU A;  4NWY A;  1ERV A;  2EIQ A;  2HZF A;  1K0A A;  5CYY A;  2GVP A;  2R2J A;  5AGY A;  3KP9 A;  2IL3 A;  3QAG A;  4HSC X;  1BQ7 A;  1NSW A;  1QFN A;  2OAD A;  4EXJ A;  1SD8 A;  4XIH A;  3F6D A;  2VLT A;  6GSW A;  2C3T A;  1J9B A;  1O8W A;  4A5P A;  2FNO A;  1QK8 A;  4KCE A;  3VI7 A;  1GRX A;  5ID2 B;  1THO A;  4CDO A;  2V6O A;  2H1B A;  4OWY A;  4IHU A;  5KN0 A;  5D73 A;  4V2L A;  3KH9 A;  1R5P A;  1GSD A;  1GNW A;  1YF1 A;  4POK A;  3LG6 A;  1K3Y A;  1FVK A;  5IO0 A;  2HSY A;  3KXO A;  3IV4 A;  2M72 A;  1TKD B;  2JZT A;  3L9V A;  2NVL A;  5CAX A;  1ZYE A;  5C00 A;  3O6T A;  2MMO A;  4O5R A;  2H66 A;  2K8V A;  5IMV A;  3GTU B;  2C0D A;  4ZBB A;  4YQM A;  3QD9 A;  5J3R A;  4WKW A;  2GST A;  3GIX A;  1X5E A;  4POL A;  3ZTL A;  2G2Q A;  3IXR A;  4MF6 A;  3ZZX A;  3GSS A;  4K0G A;  5A5K A;  1THX A;  2VIM A;  2K8S A;  3WGX A;  1V2A A;  3ERF A;  4IVF A;  1QUW A;  4LL1 B;  1SL0 B;  1YJ6 A;  3TCO A;  5EVO A;  3BCI A;  2GZY A;  1TRV A;  2GZP A;  4Z2R A;  2P5Q A;  3G7J A;  1V58 A;  1DE1 A;  1TP9 A;  1Y6E A;  1PN9 A;  2HYX A;  3MWH A;  1XFL A;  5IMZ A;  4EVM A;  2YJH A;  2HRK A;  1GUK A;  2X8G A;  4LA1 A;  3FHK A;  5KN3 A;  1EP8 A;  1NM3 A;  1PKZ A;  4IKH A;  4MH3 A;  5KN2 A;  1WWJ A;  5DQY A;  3APQ A;  4OFM A;  3UL3 A;  1XG8 A;  2HI7 A;  5G31 A;  1V40 A;  1M0U A;  1U6T A;  1ERU A;  1YKC A;  1UN2 A;  5FHI A;  3HHV A;  3R2Q A;  3HDC A;  1WOU A;  3RHC A;  3F4S A;  2K9F A;  1V98 A;  2P5R A;  1ILO A;  1A2J A;  4EF0 A;  5ECI B;  5G1K A;  2YPM A;  1G6Y A;  3KD0 A;  4ECC A;  1XPV A;  4ML1 A;  1WE0 A;  3C71 A;  4GQF A;  3I69 A;  2HLS A;  2K6V A;  1TDI A;  2QKE A;  4N0V A;  2YV9 A;  1SD9 A;  5IMD A;  4HJM A;  4IN0 A;  5G30 A;  2VL3 A;  2I3Y A;  4WR5 A;  2MMN A;  2B3S A;  1X5D A;  2D2Z A;  3CBU A;  3I43 A;  4FH8 A;  3W8S A;  1TOF A;  3ZL5 A;  1PMT A;  1PA3 A;  3H93 A;  4MJB A;  2GSQ A;  4KUN A;  1MEK A;  4BL7 B;  1XOA A;  1EV4 A;  2C3Q A;  2PU9 C;  3D6I A;  4L5L A;  3TKR A;  4EKZ A;  1XXU A;  2GS3 A;  3ZRE A;  1BAY A;  2ON5 A;  1T4Y A;  4KDU A;  2WUL A;  3RHB A;  2Z9S A;  4XTS A;  3F9U A;  2QA2 A;  1G6W A;  2A2P A;  1XCC A;  4HEA 2;  3DRN A;  2R37 A;  1QQ2 A;  2L6D A;  5IMA A;  2VLU A;  3TKS C;  5DAK B;  1K3O A;  2F51 A;  1M7T A;  4XCS A;  1SKR B;  2C0G A;  4ZB9 A;  4AJ8 A;  2GZZ A;  4K5S A;  2OA7 A;  3NIV A;  5KOW A;  2LQQ A;  2K18 A;  4X43 A;  4L0U A;  3H1N A;  1Z6N A;  2CZ2 A;  1GH2 A;  3UJ1 A;  1QXH A;  5CO3 A;  3I6A A;  5D8I A;  3EE2 A;  5A4U A;  5EY6 A;  4NMU A;  2YJ7 A;  3F4T A;  2H0I A;  1G7O A;  5B7C A;  2VM1 A;  2VL9 A;  1OKT A;  2HRA A;  4EIQ A;  3UVT A;  1GLQ A;  5G2Z A;  3QR6 A;  1ERW A;  3L9S A;  3EMX A;  7GSS A;  3IK9 A;  3RAZ A;  1A0F A;  5IM9 A;  5ECR B;  1ON4 A;  4RI7 A;  1ML6 A;  1SYX A;  1AQW A;  5HR1 A;  1Q98 A;  1YF0 A;  3FMW A;  2VOC A;  5ELG A;  3P7X A;  3U6V A;  2JZR A;  2RUF A;  1BX9 A;  5ECO B;  4PNG A;  2MBT A;  1OC9 B;  4IBP A;  2LS5 A;  4YQV A;  5ECN B;  3TB2 A;  4PQ1 A;  1K0O A;  4ICY A;  2DBC A;  2E2M A;  17GS A;  2WS2 A;  3GUR A;  3LQ7 A;  4GF0 A;  4FYC A;  1TI3 A;  2AB6 A;  1S3C A;  4K9Z A;  2CV4 A;  5ECM B;  3Q19 A;  3KH7 A;  4PUA A;  5IIZ A;  2LJR A;  3LW9 A;  5F06 A;  4JU5 A;  1SJ6 A;  5CRH A;  3FR9 A;  2H6Y A;  2DSA A;  3P8W A;  4USS A;  1M9A A;  2XPE A;  3IRA A;  1R26 A;  4ZL8 A;  3KTL A;  2B6M A;  2LRC A;  4RQR A;  3L9U A;  2A2R A;  2WDU A;  4J2F A;  1AXD A;  1GTA A;  1KBN A;  3TOU A;  5C04 A;  4ID0 A;  5H5Q A;  5HQP A;  1X9W B;  5HFI A;  3TKP A;  1SK2 A;  3GTU A;  1JFU A;  1J0F A;  2DC5 A;  1XVW A;  4WF5 A;  3EUR A;  4K7O A;  3S9F A;  2I4A A;  1FB6 A;  4GXZ A;  2XC2 A;  4V2N A;  3IR4 A;  1ZOF A;  1EP7 A;  2OBK A;  4JE1 A;  1HNA A;  3CMI A;  4JBB A;  4YKF A;  4ECI A;  3P2A A;  2L57 A;  3DGQ A;  3EVI A;  4MJE A;  3CTF A;  3KCM A;  5EPF A;  6GSY A;  3IBH A;  5HFK A;  3KMO A;  2XPD A;  3ZIV A;  2HFD A;  2YZH A;  5GZZ B;  4IS0 A;  9GSS A;  1AAZ A;  4E8E A;  4LL4 B;  4TRX A;  2B1L A;  2MMA A;  4I2U A;  1M2D A;  2LRT A;  4GLT A;  4FYU A;  1FW1 A;  3IOS A;  3MDK A;  5DJL A;  3WT2 A;  1I5G A;  3KIJ A;  3DVX A;  4G10 A;  1B48 A;  1F37 A;  2FUG 2;  4EDZ A;  3TJK A;  3CQF A;  3FY7 A;  4EO3 A;  2LUS A;  2TRX A;  1GNE A;  4WBJ A;  3HD5 A;  2ES7 A;  5ENU A;  5B8A A;  3APS A; 
#chains in the Genus database with same CATH homology
 3KTB A;  2BTO T;  2KP1 A;  1EGO A;  5G1L A;  4PTS A;  5FWG A;  3F63 A;  2HZE B;  2L5O A;  3C8E A;  4I6X A;  1UA5 A;  4YAV A;  2PVQ A;  4ZL7 A;  1B9Y C;  4XRD A;  4Q5R A;  1HD2 A;  3DEX A;  3HCZ A;  2WRT A;  1VF3 A;  4V1A g;  3HJM A;  4BPY A;  1ZYQ B;  2L5L A;  3RDW A;  2DJ0 A;  6GSS A;  4NPB A;  3ZVJ A;  5J9C A;  1WRY A;  1MDI A;  2JAC A;  1F6M C;  5DQS A;  1XIY A;  5KN1 A;  2B5Y A;  2B7J A;  1XWB A;  1LU4 A;  2M80 A;  3TUE A;  5DDL A;  3F0I A;  1VF4 A;  1UC7 A;  4OMV A;  4IQ1 A;  3L4N A;  3VWX A;  2H70 A;  3FKF A;  1BG5 A;  5DJM A;  3WYW A;  1EOH A;  1A24 A;  4OCF A;  2PN8 A;  3IK7 A;  3GHA A;  3WT1 A;  2B5X A;  3IPZ A;  3GUS A;  2FWF A;  4FYB A;  2FY6 A;  2PBJ A;  5JCU A;  1GP1 A;  5LD0 A;  3A2V A;  2MYG A;  3EIN A;  1X5C A;  3OR5 A;  3UMA A;  2H6Z A;  5KOX A;  4GTU A;  4RQX A;  5DAK A;  1A23 A;  2HSH A;  4K5R A;  5GAN D;  4K7N A;  4KCA A;  4E8H A;  4TXO B;  4IJ3 A;  2ZNM A;  2NTO A;  1TRU A;  4N30 A;  1EEM A;  1ERT A;  2GQM A;  3ED3 A;  2VCQ A;  1VRS D;  2P0G A;  2CAQ A;  3TOT A;  2VUP A;  3PIN A;  4POB A;  4MZC A;  4KND A;  5DVB A;  2B5E A;  1T7P B;  1SKW B;  4WET A;  2H1G A;  2N5B A;  1BYE A;  6GST A;  4PGT A;  3WGD A;  2V6K A;  2DIZ A;  2H73 A;  3FZ5 A;  4O32 A;  1M99 A;  3GST A;  3IHQ A;  1XW9 A;  1AUC A;  1K0N A;  3QMX A;  4KH7 A;  1JZR A;  2R5G A;  4EE0 A;  1EZK A;  1KTE A;  2C4J A;  2AAW A;  2LRN A;  3HJP A;  1PL1 A;  2F3M A;  2YCD A;  5AIV A;  2O8V B;  2IMK A;  2CX4 A;  2HXK A;  2AV4 A;  2JSY A;  2YZU A;  2AYT A;  4IQA A;  3M9J A;  4K2X A;  5G5F A;  2IFQ A;  4OO4 A;  3JCM L;  1G0T A;  1TTZ A;  3FZ4 A;  2I9H A;  1TK5 B;  1EGR A;  4F9Z A;  2OAC A;  4I97 A;  4ZBD A;  3GV1 A;  4GSN A;  4WR4 A;  4TR1 A;  3UOM A;  2MBS A;  1PSQ A;  1AW9 A;  3EYT A;  1GUH A;  3HZ8 A;  2R0C A;  4MCU A;  6GSU A;  4PNF A;  4QL9 A;  2X4A A;  2VAF A;  3TGZ A;  1K3L A;  3US3 A;  3IC4 A;  4HI7 A;  2VCZ A;  4X1U A;  4WF4 A;  3TRX A;  1VF2 A;  3R3E A;  3LEF A;  4AJ6 A;  3TJG A;  4BVY B;  1YEX A;  4MZW A;  2DJ3 A;  3A2W A;  4CY8 A;  3ISO A;  4F03 A;  4PXO A;  1SJZ A;  22GS A;  2YP6 A;  2A4H A;  2EIO A;  4GQC A;  2B1K A;  3KZQ A;  4ACS A;  1OYJ A;  1JZW A;  2LST A;  3SBC A;  2C0E A;  5ECQ B;  6GSX A;  1URM A;  1ZYN A;  4DEJ A;  3BBY A;  4MDC A;  2KLX A;  3GX0 A;  3HY2 A;  2RUE A;  2H72 A;  1OE7 A;  2IJY A;  2C80 A;  1TJD A;  2O89 A;  4HUA A;  1OVN A;  1XW6 A;  1SK0 A;  4MA9 A;  2B7K A;  2F8A A;  1U87 A;  1R7H A;  1YDK A;  3MIX A;  2F8F A;  2AUV A;  1X0R A;  3LFL A;  1BED A;  1O7U A;  2VCX A;  3HZ4 A;  1KEB A;  3ZRD A;  5CRW A;  2DML A;  2R3X A;  2DJJ A;  4I8B A;  3W6G A;  3UAP A;  5IPG A;  2IN3 A;  1FOV A;  3FW2 A;  5IOX A;  4K6X A;  1T8E B;  3EPT A;  3E0U A;  2GTU A;  2V1M A;  4GST A;  1F3A A;  4XS1 A;  3VK9 A;  2O7K A;  1MD3 A;  2V2G A;  5DCH A;  3UBK A;  1PD2 1;  1V9W A;  2H71 A;  2E7P A;  3FR3 A;  1SJI A;  4ZB6 A;  1XZO A;  4L5O A;  3GKM A;  2DKI A;  5AIS A;  2VLV A;  3HVX A;  4GRF A;  3IHG A;  3LSZ A;  6GSV A;  1TU8 A;  13GS A;  1F3B A;  5A4V A;  4Z7X A;  2VCT A;  3C1R A;  1B9X C;  1CQH A;  1DUG A;  5D9X A;  2CQ9 A;  1K0C A;  3IA1 A;  2ZUP A;  4HOJ A;  4ECJ A;  3CSJ A;  4AJ7 A;  4IGJ A;  2RM5 A;  2YOI A;  3PH9 A;  3IAS 2;  2DLX A;  4ISD A;  4O5U A;  4EIP A;  1GTU A;  4K8M A;  4KAE A;  2LJA A;  4HZ2 A;  3A5W A;  3ZMK A;  5L71 A;  1RW1 A;  2CAI A;  1JLV A;  4DSS A;  1DE2 A;  1TK0 B;  4HDE A;  1Z7R A;  3V1W A;  1XW5 A;  2GGT A;  2GQL A;  4O7H A;  1M9B A;  3I9V 2;  4BVX B;  2H76 A;  5D9W A;  1GWC A;  3ZVJ D;  1PQN A;  3L78 A;  1G7E A;  2QGV A;  4YAP A;  4MJC A;  4JR4 A;  3H79 A;  1N8J A;  2PMT A;  3KM6 A;  3QCP A;  1K0M A;  5ID2 A;  2QA1 A;  3K8N A;  3MAK A;  3NZN A;  2NBS A;  3ZFB A;  1VF1 A;  3IE3 A;  1TI1 A;  4TXO A;  4O92 A;  1Z5Y E;  1FAA A;  4PQH A;  2KUC A;  4IJI A;  4LMV A;  4FO5 A;  1XWG A;  2H8L A;  1MDJ A;  3F8U A;  1O85 A;  4IP6 A;  2VCV A;  3GYK A;  5CRG A;  1ACV A;  1T4Z A;  4ZBA A;  2YN1 A;  5CNW A;  4WBR D;  4KGI A;  5JCG A;  1B8X A;  2YNX A;  2GDR A;  1T00 A;  2HRN A;  2BJX A;  1IYI A;  5DCG A;  3Q18 A;  1XWK A;  4KB3 A;  3LGC A;  3UAR A;  2UZ8 A;  4MH2 A;  4PUF C;  4HU7 A;  5D9V A;  4OFN A;  4HQS A;  3TKQ A;  16GS A;  4KDY A;  4H86 A;  4XHM A;  1F9M A;  3KGK A;  3UVH A;  2DIY A;  4MMM A;  1Z7P A;  2DJK A;  1O8X A;  3LOR A;  2A4V A;  2MZC A;  1JLW A;  2XBI A;  3EWL A;  1DBY A;  12GS A;  2IPA A;  2VM2 A;  2H0G A;  4KF9 A;  2GLR A;  2L6C A;  3KMN A;  4MK3 A;  2A2S A;  3UBL A;  4TW5 A;  1GSY A;  4ECB A;  1ZYP A;  4OFT A;  1Q4J A;  1A8L A;  4YH2 A;  3GH9 A;  3EMP A;  2OJL A;  5F07 A;  3M0F A;  2KHP A;  2CX3 A;  4MP4 A;  2LJK A;  1S3D A;  2H30 A;  2C3N A;  2VO4 A;  2C8U A;  2IMD A;  4O5Q A;  2VCW A;  3IDV A;  4MJA A;  4DVC A;  3E3E A;  1GSS A;  3M8N A;  1ABA A;  2LEG A;  1PX7 A;  1GSU A;  3D22 A;  3QAW A;  4JRR A;  4HU9 A;  1YZX A;  4N11 A;  1GLP A;  2X49 A;  5GAP D;  4TVE A;  4LMW A;  2VL2 A;  4XS4 B;  1TXX A;  19GS A;  4NHW A;  2QC7 A;  1TRW A;  2X64 A;  4Z2T A;  3G9B A;  1UVZ A;  2JZS A;  2YV7 A;  1YEP A;  4P3Y B;  3LWA A;  3CYN A;  1SL1 B;  3GX8 A;  3FEU A;  1EV9 A;  5G5E A;  5H5S A;  5LCZ A;  5AIX A;  2PER A;  1HQO A;  3MSZ A;  3TKS E;  5DAL B;  4MPF A;  4IEL A;  4X0X A;  4YQU A;  3MYD A;  1I9D A;  3HVS A;  5B6N A;  2YWO A;  3ZLP A;  2KP2 A;  5HFG A;  4OCE A;  3GKN A;  2IMF A;  4MZB A;  4BL7 A;  3VLN A;  3DWV A;  2F9S A;  4YKG A;  2HE3 A;  1U3A A;  1YY7 A;  3ME8 A;  5IMC A;  2REM A;  2XBQ A;  3C73 A;  2RM6 A;  1OKD A;  1X9M B;  5H5R A;  3UIW A;  1R4W A;  2EIR A;  4EUY A;  4HZ4 A;  4QL7 A;  3A3T A;  1WP0 A;  5INY A;  3BOA A;  5DBQ A;  5IOW A;  4G19 A;  3C7M A;  5HR2 A;  5IMF A;  4L0W A;  1NHY A;  2FA4 A;  2AJQ B;  1HNB A;  3GH6 A;  5E59 A;  3WD6 A;  1MD4 A;  3G7I A;  3QPM A;  2HNL A;  1WJK A;  4HQZ A;  3HA9 A;  3LXZ A;  1FO5 A;  1SL2 B;  4K0N A;  2CZ3 A;  2NDO A;  4JED A;  3VWV A;  2PVO C;  2J23 A;  3GL5 A;  2I1U A;  1OE8 A;  3FRC A;  3IC8 A;  4MF5 A;  3D0Z A;  2L4Q A;  4KW6 A;  5E4W A;  2PGT A;  2J9H A;  1TK8 B;  2YWI A;  1GTB A;  4CY6 A;  3DXB A;  3IAM 2;  1T3B A;  2H01 A;  1QGV A;  1TW9 A;  4D73 B;  4ULX A;  4JZQ A;  2WCI A;  5ECH B;  2JU5 A;  1SU9 A;  2KOK A;  2LNS A;  2NPB A;  1X9S B;  3ZYW A;  3F4R A;  2GSS A;  3FZ9 A;  1XWA A;  2I81 A;  1ZMA A;  4BVX A;  5JWR B;  3DVW A;  2IME A;  1Z9H A;  2P31 A;  2OE1 A;  1OC9 A;  1M2A A;  1XOB A;  2FD3 A;  1U3I A;  2V41 A;  5D9T A;  1LBK A;  1O73 A;  1WMJ A;  1AIU A;  1O6J A;  3CRU A;  2FA8 A;  2M46 A;  5ECP B;  4HJ2 A;  4CW9 A;  2O87 A;  3FYG A;  1GTI A;  3J7Y b;  2LTK A;  3PPU A;  4J57 E;  4CHS A;  2O85 A;  1IYH A;  1ST9 A;  4MAB A;  3VUR A;  3CSI A;  4ML6 A;  3U5R E;  3DKS A;  3L0H A;  4G0I A;  4KSO A;  3ZIJ A;  1VGL A;  2RLI A;  1GL8 A;  3DML A;  2PUK C;  4DSR A;  2L4C A;  3LXT A;  2CA8 A;  2QSI A;  5D93 A;  1B4P A;  1SK1 A;  1EOG A;  1GSF A;  2H6X A;  4KSM A;  1RQM A;  1FG4 A;  1AQX A;  4PUR A;  4I2T A;  3BD2 A;  1K0D A;  2CVK A;  4DSQ A;  4MF7 A;  5J41 A;  3TRP A;  3DD3 A;  2C1Y A;  4L8E A;  3BJ5 A;  5COH A;  4IP1 A;  2IIY A;  1A8Y A;  2FWH A;  5LNK e;  3VI5 A;  2GT5 A;  4ZB8 A;  1M2B A;  3H4K A;  5IPH A;  3C1S A;  3ME7 A;  4AF2 A;  4F82 A;  2E0Q A;  3KP8 A;  5J5N A;  2L59 A;  1T1V A;  1EEJ A;  2H1A A;  2HSM A;  2R0G A;  4HS1 A;  4PX1 A;  1H4O A;  4GWR A;  2WFC A;  1Z3E A;  3O3T A;  3D5J A;  2DJ2 A;  1XVQ A;  1N2A A;  1PN0 A;  5GST A;  2VD1 A;  5F05 A;  1CQG A;  4BWQ A;  4NXI A;  4F2I A;  4RUV A;  5AN1 A;  3GKK A;  4TR4 A;  4ZIJ A;  4KA0 A;  2EC4 A;  1W4V A;  3LYP A;  1PX6 A;  3HVV A;  3MNG A;  3VFI A;  1H75 A;  5A4W A;  2H1D A;  4IW9 A;  2GT6 A;  3HJO A;  5EL8 A;  1GUL A;  3CTG A;  3DYR A;  2H74 A;  2DMM A;  2IWT A;  5B6M A;  1E2Y A;  4X4J A;  5BRT A;  5KEJ A;  3QOU A;  1GUM A;  1PKW A;  4XS4 A;  1A2L A;  3ZIT A;  2HZE A;  3TKS A;  3HXS A;  4Q5N A;  2DJ1 A;  2PPT A;  2ALB A;  1SKS B;  3M3M A;  2CVD A;  3QDN A;  4TKY A;  2FWG A;  4KDX A;  3EU4 A;  1Z6M A;  2GSR A;  3GMF A;  3KJY A;  2ON7 A;  2FHE A;  1TRS A;  5F0G A;  5DAL A;  3RBT A;  1F2E A;  3PR8 A;  5CRE A;  3QAV A;  2YAN A;  2WZ9 A;  2LV3 A;  3FK8 A;  1LJR A;  1ZCP A;  2XHF A;  4QQ7 A;  3VPT A;  1B4Q A;  4NAX A;  4AGS A;  5B8B A;  3LJR A;  3Q74 A;  1U88 A;  2R0P A;  4XS6 A;  4GCI A;  1Y25 A;  3DIE A;  3BCK A;  2DKH A;  1SEN A;  8GSS A;  4POM A;  3CXG A;  3W8J A;  3SWL A;  3HYP A;  3VWW A;  4ZL9 A;  3Q6O A;  4EC0 A;  4MNN A;  3ERW A;  4N10 A;  2FCH A;  10GS A;  1SYR A;  4PQI A;  5IO2 A;  2OE3 A;  1TU7 A;  3LYK A;  3P90 A;  3HKR A;  1NW2 A;  5CRD A;  3VWU A;  1QMV A;  4LLR A;  2IFQ B;  1BJX A;  1ZZY A;  1MTC A;  1PRX A;  1WIK A;  1AC1 A;  1C72 A;  5J9B A;  1OC3 A;  4K2D A;  1JZD A;  1GSE A;  1GSQ A;  3APO A;  1XWC A;  2CVB A;  1USB A;  3AY8 A;  4TR1 B;  4WEY A;  3UEM A;  5ABR A;  3EU3 A;  2HT9 A;  3FR6 A;  1J08 A;  5ELA A;  1EWX A;  2X8H A;  1PGT A;  1W89 A;  1AQV A;  1DSB A;  2C0F A;  4OD7 A;  3TJJ A;  3M9K A;  5JCW A;  3D21 A;  5JWO B;  1WPI A;  2IMI A;  2BMX A;  2H75 A;  4K1F A;  1V57 A;  2HRF A;  3CSH A;  3O76 A;  3F6F A;  5ECL B;  3N9J A;  3D4M A;  1FHE A;  1FOH A;  1R5A A;  4F0C A;  2G0F A;  1A2M A;  4KX4 A;  1YKA A;  4EDY A;  2JL4 A;  2FLS A;  1ZGN A;  2LQO A;  3A5I A;  4D73 A;  4GSS A;  4NV2 A;  3TJF A;  2JAD A;  3TDG A;  2V32 A;  5J4U A;  4TOP A;  4NV5 A;  4ZXG A;  1PL2 A;  5HR3 A;  2CT6 A;  4TN8 A;  18GS A;  2WJU A;  4ZIL A;  3GFK A;  2LNT A;  4WXT A;  1KNG A;  1FVJ A;  4TR0 A;  4BWS A;  2H0H A;  1RK4 A;  4TXV A;  3KEB A;  5F8B A;  3WGE A;  5HR0 A;  3TRQ A;  3H8Q A;  5CP1 A;  3ZFL A;  4Z2U A;  4OO5 A;  5D96 A;  3N5O A;  3FZA A;  1ZL9 A;  2OBI A;  4V1A p;  4NHZ A;  3GN3 A;  2E2G A;  20GS A;  5ECK B;  11GS A;  4BVY A;  2FWE A;  1K0B A;  1JHB A;  3NOF A;  4TR3 A;  2OKA A;  1OAZ A;  2OE0 A;  2VL2 C;  5GSS A;  1S3A A;  2VD0 A;  3QFB C;  4F0B A;  4G0L A;  2AHE A;  2LKU A;  2X99 A;  3PGT A;  2WB9 A;  3F3Q A;  3EC3 A;  1HNC A;  1OC8 A;  3E9J B;  4EL1 A;  2N5F A;  3TJB A;  2GQK A;  1FB0 A;  2MMZ A;  2N5A A;  4N0Z A;  2FGX A;  3GNJ A;  5ECS A;  2X8C A;  3RPP A;  4FIW A;  4XRA A;  4G0K A;  3F3R A;  5IQY A;  3J7Y k;  4K7I A;  2RII A;  1E6B A;  2YWN A;  4KE3 A;  4G9H A;  2PWJ A;  2H19 A;  3CRT A;  3GRX A;  2TIR A;  4V2M A;  1NHO A;  1JZO A;  3M1G A;  1XBS A;  2TRC P;  4JR6 A;  3ERG A;  14GS A;  2JSZ A;  3D4T A;  3GKX A;  3VPQ A;  2WGR A;  3ZML A;  3G7Y A;  2R6K A;  4I5Q A;  4MPG A;  4FQU A;  1YQ1 A;  3GL3 A;  2ZCT A;  4G2E A;  5JWQ B;  3RPN A;  4ILF A;  4Q5F A;  1A0R P;  3A2X A;  3QFA C;  4DSS B;  5FT3 A;  4J56 E;  4MLY A;  4RI6 A;  2YWM A;  5BMU A;  3GA4 A;  1MDK A;  4Q5Q A;  4BA7 A;  2R4V A;  1O81 A;  1HYU A;  4NWY A;  1ERV A;  2EIQ A;  2HZF A;  1K0A A;  5CYY A;  2GVP A;  2R2J A;  5AGY A;  3KP9 A;  2IL3 A;  3QAG A;  1BQ7 A;  1NSW A;  1QFN A;  2OAD A;  4EXJ A;  1SD8 A;  4XIH A;  3F6D A;  2VLT A;  6GSW A;  2C3T A;  1J9B A;  1O8W A;  4A5P A;  2FNO A;  1QK8 A;  4KCE A;  3VI7 A;  1GRX A;  5ID2 B;  1THO A;  4CDO A;  2V6O A;  2H1B A;  4OWY A;  4IHU A;  5KN0 A;  5D73 A;  4V2L A;  3KH9 A;  1R5P A;  1GSD A;  1GNW A;  1YF1 A;  4POK A;  3LG6 A;  1K3Y A;  1FVK A;  5IO0 A;  2HSY A;  3KXO A;  3IV4 A;  2M72 A;  1TKD B;  2JZT A;  3L9V A;  2NVL A;  5CAX A;  1ZYE A;  5C00 A;  3O6T A;  2MMO A;  4O5R A;  2H66 A;  2K8V A;  5IMV A;  3GTU B;  2C0D A;  4ZBB A;  4YQM A;  3QD9 A;  5J3R A;  4WKW A;  2GST A;  3GIX A;  1X5E A;  4POL A;  3ZTL A;  2G2Q A;  3IXR A;  4MF6 A;  3ZZX A;  3GSS A;  4K0G A;  5A5K A;  1THX A;  2VIM A;  2K8S A;  3WGX A;  1V2A A;  3ERF A;  4IVF A;  1QUW A;  4LL1 B;  1SL0 B;  1YJ6 A;  3TCO A;  5EVO A;  3BCI A;  2GZY A;  1TRV A;  2GZP A;  4Z2R A;  2P5Q A;  3G7J A;  1V58 A;  1DE1 A;  1TP9 A;  1Y6E A;  1PN9 A;  2HYX A;  3MWH A;  1XFL A;  5IMZ A;  4EVM A;  2YJH A;  2HRK A;  1GUK A;  2X8G A;  4LA1 A;  3FHK A;  5KN3 A;  1EP8 A;  1NM3 A;  1PKZ A;  4IKH A;  4MH3 A;  5KN2 A;  1WWJ A;  5DQY A;  3APQ A;  4OFM A;  3UL3 A;  2HI7 A;  5G31 A;  1V40 A;  1M0U A;  1U6T A;  1ERU A;  1YKC A;  1UN2 A;  5FHI A;  3HHV A;  3R2Q A;  3HDC A;  1WOU A;  3RHC A;  3F4S A;  2K9F A;  1V98 A;  2P5R A;  1ILO A;  1A2J A;  4EF0 A;  5ECI B;  5G1K A;  2YPM A;  1G6Y A;  3KD0 A;  4ECC A;  1XPV A;  4ML1 A;  1WE0 A;  3C71 A;  4GQF A;  3I69 A;  2HLS A;  2K6V A;  1TDI A;  2QKE A;  4N0V A;  2YV9 A;  1SD9 A;  5IMD A;  4HJM A;  4IN0 A;  5G30 A;  2VL3 A;  2I3Y A;  4WR5 A;  2MMN A;  2B3S A;  1X5D A;  2D2Z A;  3CBU A;  3I43 A;  4FH8 A;  3W8S A;  1TOF A;  3ZL5 A;  1PMT A;  1PA3 A;  3H93 A;  4MJB A;  2GSQ A;  4KUN A;  1MEK A;  4BL7 B;  1XOA A;  1EV4 A;  2C3Q A;  2PU9 C;  3D6I A;  4L5L A;  3TKR A;  4EKZ A;  1XXU A;  2GS3 A;  3ZRE A;  1BAY A;  2ON5 A;  1T4Y A;  4KDU A;  2WUL A;  3RHB A;  2Z9S A;  4XTS A;  3F9U A;  2QA2 A;  1G6W A;  2A2P A;  1XCC A;  4HEA 2;  3DRN A;  2R37 A;  1QQ2 A;  2L6D A;  5IMA A;  2VLU A;  3TKS C;  5DAK B;  1K3O A;  2F51 A;  1M7T A;  4XCS A;  1SKR B;  2C0G A;  4ZB9 A;  4AJ8 A;  2GZZ A;  4K5S A;  2OA7 A;  3NIV A;  5KOW A;  2LQQ A;  2K18 A;  4X43 A;  4L0U A;  3H1N A;  1Z6N A;  2CZ2 A;  1GH2 A;  3UJ1 A;  1QXH A;  5CO3 A;  3I6A A;  5D8I A;  3EE2 A;  5A4U A;  5EY6 A;  4NMU A;  2YJ7 A;  3F4T A;  2H0I A;  1G7O A;  5B7C A;  2VM1 A;  2VL9 A;  1OKT A;  2HRA A;  4EIQ A;  3UVT A;  1GLQ A;  5G2Z A;  3QR6 A;  1ERW A;  3L9S A;  3EMX A;  7GSS A;  3IK9 A;  3RAZ A;  1A0F A;  5IM9 A;  5ECR B;  1ON4 A;  4RI7 A;  1ML6 A;  1SYX A;  1AQW A;  5HR1 A;  1Q98 A;  1YF0 A;  3FMW A;  2VOC A;  5ELG A;  3P7X A;  3U6V A;  2JZR A;  2RUF A;  1BX9 A;  5ECO B;  4PNG A;  2MBT A;  1OC9 B;  4IBP A;  2LS5 A;  4YQV A;  5ECN B;  3TB2 A;  4PQ1 A;  1K0O A;  4ICY A;  2DBC A;  2E2M A;  17GS A;  2WS2 A;  3GUR A;  3LQ7 A;  4GF0 A;  4FYC A;  1TI3 A;  2AB6 A;  1S3C A;  4K9Z A;  2CV4 A;  5ECM B;  3Q19 A;  3KH7 A;  4PUA A;  5IIZ A;  2LJR A;  3LW9 A;  5F06 A;  4JU5 A;  1SJ6 A;  5CRH A;  3FR9 A;  2H6Y A;  2DSA A;  3P8W A;  4USS A;  1M9A A;  2XPE A;  3IRA A;  1R26 A;  4ZL8 A;  3KTL A;  2B6M A;  2LRC A;  4RQR A;  3L9U A;  2A2R A;  2WDU A;  4J2F A;  1AXD A;  1GTA A;  1KBN A;  3TOU A;  5C04 A;  4ID0 A;  5H5Q A;  5HQP A;  1X9W B;  5HFI A;  3TKP A;  1SK2 A;  3GTU A;  1JFU A;  1J0F A;  2DC5 A;  1XVW A;  4WF5 A;  3EUR A;  4K7O A;  3S9F A;  2I4A A;  1FB6 A;  4GXZ A;  2XC2 A;  4V2N A;  3IR4 A;  1ZOF A;  1EP7 A;  2OBK A;  4JE1 A;  1HNA A;  3CMI A;  4JBB A;  4YKF A;  4ECI A;  3P2A A;  2L57 A;  3DGQ A;  3EVI A;  4MJE A;  3CTF A;  3KCM A;  5EPF A;  6GSY A;  3IBH A;  5HFK A;  3KMO A;  2XPD A;  3ZIV A;  2HFD A;  2YZH A;  5GZZ B;  4IS0 A;  9GSS A;  1AAZ A;  4E8E A;  4LL4 B;  4TRX A;  2B1L A;  2MMA A;  4I2U A;  1M2D A;  2LRT A;  4GLT A;  4FYU A;  1FW1 A;  3IOS A;  3MDK A;  5DJL A;  3WT2 A;  1I5G A;  3KIJ A;  3DVX A;  4G10 A;  1B48 A;  1F37 A;  2FUG 2;  4EDZ A;  3TJK A;  3FY7 A;  4EO3 A;  2LUS A;  2TRX A;  1GNE A;  4WBJ A;  3HD5 A;  2ES7 A;  5ENU A;  5B8A A;  3APS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...