2FY6A

Structure of the n-terminal domain of neisseria meningitidis pilb
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
VPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title The X-ray Structure of the N-terminal Domain of PILB from Neisseria meningitidis Reveals a Thioredoxin-fold
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 44
structure length 143
sequence length 143
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2006-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fy6A00
3HJPA 1AW9A 1OKDA 1JLWA 1JZDA 2VO4A 1ZGNA 2C0FA 1FHEA 3BOAA 1SK1A 2VCZA 3QD9A 4HOJA 1U3IA 5C00A 2H73A 2L4QA 5CNWA 3ZRDA 3LGCA 4IGJA 4N0ZA 3DIEA 4DSSB 4EL1A 4WXTA 1WWJA 1XFLA 1PL2A 2NPBA 1FG4A 2F8FA 1K3YA 1TRVA 1SU9A 3FW2A 4G9HA 4ECBA 2JU5A 2VM1A 2N5BA 4J56E 4HU7A 2R2JA 2BTOT 4TRXA 3DKSA 2OE1A 4I5QA 4EO3A 5J41A 1SJ6A 1USBA 1A2JA 5IMFA 1FO5A 4EC0A 3KH9A 2C8UA 1K0BA 3PGTA 2HE3A 5GSTA 3IBHA 2N5AA 1X5DA 2ON5A 4ISDA 3FZ4A 2B1LA 20GSA 3LXTA 4F82A 4ECCA 5DQYA 5LD0A 1MDIA 1Z7RA 1GP1A 3L78A 2LTKA 2ALBA 4KSMA 1PA3A 2H1DA 2IMDA 3ZL5A 5IOXA 5J3RA 2ES7A 3GH6A 2IIYA 1O8XA 2X8CA 4TXOA 2JZTA 1HNAA 2PMTA 3F4TA 3CBUA 3APQA 3DGQA 5J9BA 2PWJA 2FD3A 5A4UA 1B8XA 1O8WA 1YF1A 1ML6A 3GNJA 2FGXA 1G6YA 1R4WA 1Z6NA 2CA8A 2MZCA 2V32A 1Z9HA 3ERGA 4DVCA 2WS2A 1AXDA 3L9UA 3UBLA 2VCVA 4OCFA 1O6JA 5J5NA 3HY2A 1A23A 1EOGA 3GIXA 4LL1B 1XOBA 2GQMA 2LSTA 5G5EA 3L9VA 5IMZA 2BJXA 4ACSA 2VLVA 1TU7A 2R37A 1K3OA 3GSTA 4KAEA 4OMVA 4NXIA 2YANA 4ZIJA 3LJRA 2K9FA 3SWLA 2PGTA 1O81A 4EKZA 3DVXA 4XRDA 1Z7PA 6GSXA 4KUNA 2GT5A 3P7XA 3CSJA 1GSYA 2CQ9A 2GGTA 5HFKA 5IMCA 2B5YA 5F8BA 2HLSA 2WFCA 4K7NA 2HRFA 3WT2A 4EVMA 2GS3A 1X5CA 3KZQA 4ZXGA 4KB3A 4TXOB 4ILFA 5GAND 2LV3A 1MEKA 2VLTA 4BL7A 4KH7A 19GSA 1URMA 3MWHA 4QL9A 1J9BA 4GXZA 1UVZA 4GQCA 3EVIA 4OD7A 3IK9A 2EIRA 1ILOA 1TRUA 4EUYA 2IPAA 2OADA 4TR1A 3GTUA 4JU5A 2OE3A 2DJKA 4WR4A 2VL3A 1MDJA 5GSSA 3IA1A 2AHEA 4IN0A 1U3AA 3OR5A 3TOUA 1GULA 4WF5A 1T4YA 3TKQA 4XS4A 1C72A 5D96A 1VGLA 3FZ9A 4MMMA 5CRGA 4H86A 2A2SA 2VCXA 3RAZA 2GSRA 3F4SA 1EV9A 1GSFA 2LNTA 2RM6A 2WRTA 1V40A 2H30A 1TKDB 2CVKA 1GWCA 3EINA 1TW9A 2RUEA 1V58A 2DC5A 2QC7A 4O32A 2LQOA 1O7UA 1BEDA 2NBSA 3TKRA 2B7JA 1M9BA 4NAXA 3CYNA 3ZIJA 1SYRA 4TW5A 2WDUA 1AUCA 3GHAA 5DAKB 5ECPB 3KM6A 5INYA 1TXXA 2FY6A 3KD0A 4ZL7A 5COHA 2ZNMA 1DBYA 4ID0A 4FYBA 3EE2A 1OKTA 3ZMKA 2YV9A 5ECQB 5ECRB 2KP2A 2MBSA 4F03A 2IJYA 2ON7A 2O7KA 1GSDA 1YEPA 2G2QA 4LL4B 3KEBA 3HA9A 2DJ2A 2E0QA 3QFAC 2KP1A 3VI5A 1GLPA 1B4PA 2REMA 2DIYA 2H01A 2E2GA 4TR1B 5ECNB 2YJ7A 1GUHA 4PX1A 3GTUB 2B6MA 4JR4A 3DWVA 3GX8A 2B3SA 1XVWA 4RQXA 2K6VA 5IM9A 1PRXA 5CRWA 2C1YA 2H0GA 3D22A 5F07A 4BVYA 4XS4B 4NMUA 3EC3A 2OBKA 5KN2A 3WYWA 3IAM2 5B7CA 1BYEA 2FA8A 4QQ7A 5CYYA 3CRTA 4XS6A 5J9CA 1YF0A 4RI6A 3RDWA 2WB9A 4Q5RA 5IIZA 3CTGA 1GTUA 2H0IA 2XBIA 3ZVJD 2PPTA 3J7Yb 1T4ZA 4J57E 2WGRA 1R26A 3TJBA 1OE7A 2OA7A 3GX0A 5ECSA 2WJUA 2IMKA 4HU9A 5DJMA 4WETA 3TRQA 2VL2C 4AF2A 3IXRA 4N10A 4CHSA 1UA5A 2LRCA 5F0GA 3VWUA 3C73A 1M2AA 1M0UA 4XCSA 3GL5A 10GSA 3ERFA 1PQNA 3IHQA 3GSSA 5ECMB 4N30A 3N5OA 5KN1A 4EDZA 1THXA 1YY7A 5CAXA 2VOCA 2DJ0A 2AUVA 3P8WA 5KEJA 3C7MA 3V1WA 4X43A 4G10A 3A2VA 3F8UA 4IBPA 4IP1A 4NV2A 4K7IA 4TKYA 1GNWA 4CW9A 4P3YB 1J08A 4G19A 2QGVA 2HNLA 1UN2A 3GURA 1EGRA 3ZITA 4NWYA 1VF1A 2M80A 2X99A 4L0WA 1ERVA 11GSA 2K8VA 4KCAA 1H4OA 1BQ7A 3FR9A 3FZ5A 4TVEA 1YZXA 2OE0A 3F3QA 1TK0B 1ON4A 4TR4A 4V2LA 3DMLA 4IKHA 3QOUA 2NDOA 3LWAA 4GSSA 2OJLA 4DSQA 6GSYA 2H70A 4NHZA 2J9HA 13GSA 2X8GA 6GSVA 1W89A 4PXOA 1KBNA 3A2XA 2LJKA 1SK0A 3R2QA 3KCMA 1XWGA 2DMMA 5G5FA 1V2AA 6GSSA 1OC3A 3F4RA 2VM2A 1M7TA 3IDVA 1CQGA 3GMFA 1A2MA 4KW6A 2DJJA 3IRAA 4GRFA 1XZOA 2H1BA 1QGVA 4KSOA 2PBJA 1HNBA 4FYCA 2FA4A 3GRXA 2H6ZA 2H0HA 1BJXA 3L4NA 1OVNA 2VL2A 2KUCA 2HSYA 1B9YC 5H5RA 1NSWA 3LQ7A 3RBTA 3P2AA 4GQFA 2H66A 1I5GA 4PQHA 3RPNA 2FWEA 2YJHA 1A2LA 3QDNA 3ZMLA 3ZFBA 1GRXA 1MDKA 3NZNA 4Q5FA 2BMXA 4F0CA 2LJAA 5H5QA 1TU8A 2D2ZA 2LS5A 4MF5A 1KTEA 1AQWA 3G9BA 3ZZXA 4GLTA 16GSA 4K8MA 4MZWA 5DBQA 2G0FA 2FWHA 5FWGA 1JZWA 1V9WA 3UJ1A 2HZFA 1TK8B 2F51A 3LYPA 3TUEA 1O85A 3H4KA 3HHVA 2GZPA 5DQSA 1SJZA 5EVOA 2PVOC 1PN9A 3CMIA 1XW9A 3VWWA 3W6GA 1SD8A 3H93A 2H74A 1J0FA 2H75A 4MH2A 4IJIA 1DE1A 2C3QA 2IN3A 3KH7A 4OFNA 1RK4A 4JR6A 5JCWA 3EWLA 3LSZA 1MD3A 4X0XA 3WD6A 1EEMA 4NHWA 1T1VA 3FR6A 3I6AA 4ECJA 2H71A 4ZBDA 3EURA 4EXJA 2FCHA 4ZILA 6GSTA 3QAGA 3GKMA 3H1NA 4EF0A 3D6IA 4YAPA 4MJEA 4K6XA 5IO2A 1QFNA 3VPQA 4FO5A 2CZ3A 3HJOA 1QMVA 2RIIA 4IVFA 2H1GA 2O89A 3WGXA 2LNSA 5IQYA 5ID2A 3W8JA 1OC9A 2B5XA 4ZL9A 2VAFA 3A5WA 1GTAA 3QFBC 2GZZA 2C0GA 4HZ2A 1DUGA 3HVXA 1ABAA 1VF2A 3TKPA 1PSQA 4XRAA 1R7HA 4MABA 4GF0A 1V98A 12GSA 3F0IA 4ZB9A 5DVBA 1T00A 3TGZA 1F3AA 1PMTA 2HT9A 1EZKA 5HFGA 2V6OA 3TCOA 1XIYA 4OFMA 3UBKA 2XPEA 5D9TA 5H5SA 4HDEA 3W8SA 6GSUA 4F0BA 1G7EA 5D9WA 1XCCA 4JE1A 2HZEA 5AISA 2OKAA 3LYKA 3M9JA 1O73A 3C71A 5EPFA 4PNGA 4LLRA 3D21A 2KHPA 2PN8A 3KP8A 5D9XA 2IFQA 1WRYA 5DALA 3Q74A 4LMWA 5G31A 1IYHA 2CZ2A 2LKUA 2C3NA 1F37A 1NM3A 17GSA 2I3YA 2L4CA 4MDCA 3VWVA 3IE3A 1ST9A 1G7OA 2P5RA 5A4WA 4TR0A 3ZREA 1FAAA 4QL7A 2MMOA 2L57A 5ECLB 3QCPA 5ID2B 2HFDA 1ERWA 1OC9B 2H6XA 3IPZA 4KCEA 3Q19A 2L59A 4KDXA 4IJ3A 1FB0A 2O8VB 5B8AA 1AAZA 2HRNA 4KA0A 1GL8A 4J2FA 2TRXA 1R5PA 3ME7A 1X9SB 3GN3A 1MD4A 1GUMA 1U6TA 1GUKA 3F3RA 3F9UA 4BVXA 1UC7A 1T8EB 4K9ZA 3GV1A 2HSHA 1EOHA 1A24A 4I2UA 1WE0A 1ERTA 4Q5NA 4JEDA 1ZYEA 4FH8A 1M2BA 3CSIA 1XBSA 3PINA 18GSA 2YWIA 3UVHA 4MZBA 2HZEB 3M0FA 1YEXA 3AY8A 1S3DA 4LMVA 1BAYA 5HFIA 4ZBBA 3GFKA 2IFQB 4KNDA 5B6MA 1JZRA 5DALB 4KGIA 1NW2A 2P0GA 3ZFLA 3C8EA 3ME8A 3FHKA 4K0GA 5JWOB 4I97A 2EC4A 3MAKA 1ACVA 2PVQA 2CVDA 5AGYA 3UARA 1F6MC 4PQIA 2VD1A 1PL1A 4GCIA 3BD2A 1F9MA 2AB6A 1KNGA 1S3CA 3GA4A 5ECKB 1U87A 1NHYA 3BCIA 2XBQA 3EMXA 5DCGA 3MDKA 2QSIA 5ELGA 1DE2A 2VD0A 3LFLA 3HYPA 2F3MA 2JZRA 4TN8A 1TOFA 3O3TA 1TI1A 4L5OA 4XIHA 1YDKA 3UIWA 2CAQA 1B48A 4OWYA 5L71A 3LXZA 3TDGA 3VFIA 2IL3A 5D9VA 4PQ1A 5CRHA 3TRPA 1XXUA 4NPBA 3EYTA 4GSNA 3KTBA 4V2MA 5ENUA 3VLNA 4WKWA 2OBIA 4MPFA 4PNFA 2GSTA 2B1KA 1RQMA 2RM5A 5A4VA 2GZYA 2YPMA 4PGTA 4V1Ap 3KMOA 2YWOA 1HQOA 2L5LA 1QK8A 2R5GA 3VPTA 3L9SA 5AIXA 2JL4A 4XS1A 3WGDA 2DJ3A 1EEJA 2VL9A 1XW6A 3ED3A 2F9SA 2C4JA 4AJ7A 3KXOA 2C80A 2E2MA 4OFTA 3IR4A 2DSAA 5J4UA 2MMZA 4WEYA 1X9WB 4BA7A 1X0RA 1TI3A 4L5LA 1SKWB 3H79A 2ZUPA 3HD5A 1OC8A 3HZ8A 4IS0A 4HZ4A 1JLVA 1HNCA 1WJKA 3HZ4A 1Z3EA 4LA1A 4Z7XA 1K0OA 2RLIA 3DXBA 2P31A 2K8SA 3FY7A 1KEBA 2DMLA 2JSZA 5ABRA 1GSSA 3FKFA 1PX6A 3KTLA 2HXKA 1G6WA 2FHEA 4WBRD 1GSUA 2MYGA 1XVQA 1K0MA 5E4WA 3TKSC 2X64A 3VK9A 3GL3A 1FW1A 1T3BA 1XW5A 14GSA 3DVWA 2LEGA 3QR6A 2PUKC 2H8LA 4FIWA 1A0FA 1XPVA 1B9XC 1W4VA 1ZCPA 1LBKA 4IQ1A 2GQKA 2R6KA 1Z6MA 4BPYA 2VCTA 3DRNA 4KDYA 3Q18A 4MCUA 3TOTA 2FWGA 2XHFA 3DD3A 3F63A 1PKWA 4K1FA 4MA9A 1E2YA 5C04A 4L8EA 4ZB6A 4BWSA 3UMAA 5ECIB 4MJCA 4IP6A 2DJ1A 2L6CA 5D93A 4K2DA 3WT1A 1XWAA 5HR1A 5HR3A 2LRTA 3KP9A 3GH9A 3HDCA 5CREA 5IOWA 1EP7A 2H1AA 1BX9A 6GSWA 2LRNA 3L0HA 3RPPA 2IWTA 1NHOA 5ECHB 1JHBA 5AIVA 4HJMA 2GVPA 4ML1A 2YN1A 1A8YA 2N5FA 5F05A 1SL0B 3HXSA 2MBTA 2PU9C 4O92A 4HQZA 4HEA2 1WPIA 1Q98A 2IMFA 3UOMA 3I43A 1K3LA 4MPGA 1AC1A 2CV4A 3BJ5A 3US3A 2O87A 3K8NA 2V6KA 1ZYQB 4MLYA 2GLRA 4MF6A 8GSSA 2GTUA 3SBCA 3D4MA 3EMPA 1IYIA 4MZCA 1SENA 1M2DA 1QQ2A 5G1KA 4GWRA 2WULA 4AJ6A 3M8NA 3LG6A 3ISOA 4AGSA 1SYXA 3A2WA 3ZTLA 3FEUA 22GSA 2GDRA 2YWMA 4L0UA 4HUAA 4POKA 4IW9A 1PX7A 2V2GA 3H8QA 2HI7A 2FWFA 2I9HA 4ECIA 5GZZB 1LJRA 3TKSA 4ZL8A 2B5EA 4POMA 4F2IA 1GH2A 1Z5YE 2EIQA 2KLXA 1BG5A 3E0UA 4YQVA 5JWQB 2LUSA 4WR5A 5G30A 1YQ1A 5CO3A 2YCDA 3NOFA 2C0DA 2VIMA 4XTSA 1G0TA 1TRSA 1K0AA 4TR3A 3O76A 3D0ZA 2L6DA 2PERA 3FRCA 3DEXA 9GSSA 2YNXA 2QKEA 3GKNA 3O6TA 2MMAA 1ZZYA 3ZVJA 5DDLA 4O5RA 3FR3A 1V57A 1F2EA 2RUFA 2GQLA 3G7JA 2V1MA 1K0DA 3FZAA 2H76A 2KOKA 1I9DA 2GT6A 1XWKA 1SD9A 4O7HA 2YP6A 3S9FA 3TJFA 1Y6EA 1GLQA 1WOUA 1GTIA 2CAIA 3TJJA 4WF4A 2I1UA 1JFUA 5E59A 2A2RA 2FLSA 1TTZA 2WZ9A 1TDIA 3G7IA 3LEFA 1GSQA 1YJ6A 2LQQA 3QAWA 1ZL9A 4WBJA 5DAKA 2TIRA 3F6DA 4KX4A 2XPDA 1E6BA 1TJDA 2E7PA 3HVSA 1SKRB 4KDUA 2C0EA 5LCZA 1PGTA 2L5OA 3MNGA 2DLXA 2R4VA 3TRXA 1SL1B 4MJAA 1Y25A 4MF7A 4ULXA 3F6FA 4GSTA 5KN0A 1F3BA 2FNOA 2TRCP 4RQRA 1X9MB 1FOVA 3A3TA 1Q4JA 2CX3A 3I9V2 2VUPA 1AQXA 3HJMA 2AJQB 5HR2A 4TXVA 3D5JA 3C1SA 1FVJA 1R5AA 4RI7A 5DCHA 4GTUA 3D4TA 4DEJA 3EU3A 4OO4A 1M9AA 5ECOB 2J23A 1GNEA 1VF3A 1QXHA 1B4QA 4EDYA 2JSYA 5IMDA 2HYXA 3UAPA 4YH2A 1RW1A 5D73A 2CVBA 3RHCA 3J7Yk 2VLUA 4N0VA 5KN3A 3CTFA 1PKZA 4NV5A 1ZMAA 1OYJA 5JCGA 3UEMA 3EU4A 3UVTA 2VCQA 3CXGA 2OACA 1TP9A 1AQVA 4K0NA 2JADA 4JZQA 2A4VA 1WP0A 1GSEA 2K18A 3WGEA 3G7YA 3U6VA 5JCUA 2AAWA 2XC2A 2DIZA 1ZOFA 3NIVA 1HD2A 5EL8A 5CRDA 3I69A 3QAVA 3HVVA 4FYUA 1EV4A 5FHIA 1H75A 5GAPD 2MMNA 2WCIA 2YZUA 2O85A 3IK7A 1OE8A 4TOPA 3FYGA 2GSQA 2CT6A 3PH9A 1THOA 2JZSA 3APSA 4E8HA 1TK5B 1VRSD 1U88A 4JBBA 1A8LA 5G1LA 1XOAA 3ERWA 3KGKA 4RUVA 3JCML 1FVKA 1OAZA 3TKSE 1QUWA 2NVLA 1MTCA 2YWNA 2NTOA 1X5EA 1LU4A 4Q5QA 3GKKA 3VWXA 4D73A 4V2NA 3APOA 3HKRA 1ERUA 4K7OA 2I81A 5HR0A 1A0RP 1YKCA 2ZCTA 4PURA 1EWXA 5D8IA 5JWRB 5IPHA 3TB2A 5B6NA 3GKXA 1K0NA 4ZB8A 3TJKA 3ZYWA 3PR8A 2M72A 2H19A 5IMVA 3GUSA 2IMEA 3IAS2 4HI7A 4POBA 5B8BA 3M3MA 2R3XA 3BBYA 5F06A 5IPGA 2EIOA 2JACA 1SKSB 3E3EA 2V41A 3ZIVA 2DBCA 2P5QA 4HQSA 3BCKA 3QPMA 2LJRA 4EE0A 1VF4A 4V1Ag 4HJ2A 3MSZA 2FUG2 3M1GA 4POLA 3TJGA 4PUAA 5LNKe 5FT3A 4YQMA 3U5RE 3GYKA 2VCWA 1N8JA 2YV7A 2CX4A 3DYRA 3VURA 3RHBA 5HQPA 5G2ZA 1M99A 2B7KA 2IMIA 3KJYA 1SL2B 4I2TA 3CSHA 1JZOA 3IOSA 2M46A 1PD21 5A5KA 4IELA 4PUFC 4I6XA 2H6YA 3KIJA 4KE3A 3KMNA 3N9JA 4D73B 4XHMA 2AYTA 1EGOA 4DSSA 3HCZA 1DSBA 4BWQA 1GTBA 2YOIA 1HYUA 1SJIA 4MH3A 4MJBA 1AIUA 1FB6A 1SK2A 4OCEA 5CP1A 2Z9SA 4G2EA 4IHUA 4OO5A 3P90A 4F9ZA 3VI7A 4N11A 4YQUA 5IMAA 5DJLA 1TRWA 3E9JB 1EP8A 3M9KA 4HS1A 4I8BA 5IO0A 3CRUA 2YZHA 1S3AA 7GSSA 4MK3A 1WIKA 1WMJA 5AN1A 3UL3A 4CDOA 4ML6A 2X8HA 1K0CA 2GSSA 4E8EA 2H72A 4ZBAA 1YKAA 1XWCA 4X1UA 4AJ8A 2AV4A 1T7PB 2F8AA 4YAVA 5ELAA 3FK8A 1XWBA 4IQAA 1N2AA 3C1RA 3QMXA 4DSRA 2I4AA 1CQHA 4JRRA 3LORA 3ZLPA 4MP4A 3IV4A 2C3TA 5EY6A 3IC4A 3Q6OA
chains in the Genus database with same CATH superfamily
3HJPA 1AW9A 1OKDA 1JLWA 1JZDA 2VO4A 1ZGNA 2C0FA 1FHEA 3BOAA 1SK1A 2VCZA 3QD9A 4HOJA 1U3IA 5C00A 1FOHA 2H73A 2L4QA 5CNWA 3ZRDA 3LGCA 4IGJA 4N0ZA 3DIEA 4DSSB 4EL1A 4WXTA 1WWJA 1XFLA 1PL2A 2NPBA 1FG4A 2F8FA 4G0KA 1K3YA 1TRVA 1SU9A 3FW2A 4G9HA 4ECBA 2JU5A 2VM1A 2N5BA 4J56E 4HU7A 2R2JA 2BTOT 4TRXA 3DKSA 2OE1A 4I5QA 4A5PA 4EO3A 5J41A 1SJ6A 1USBA 1A2JA 5IMFA 1FO5A 4EC0A 3KH9A 2C8UA 1K0BA 3PGTA 2HE3A 5GSTA 3IBHA 2N5AA 1X5DA 2ON5A 4ISDA 4FQUA 3FZ4A 2B1LA 20GSA 3LXTA 4F82A 4ECCA 5DQYA 5LD0A 1MDIA 1Z7RA 1GP1A 3L78A 2LTKA 2ALBA 4KSMA 1PA3A 2H1DA 2IMDA 3ZL5A 5IOXA 5J3RA 2ES7A 3GH6A 2HRAA 2IIYA 1O8XA 2X8CA 4TXOA 2JZTA 1HNAA 2PMTA 3F4TA 3CBUA 3APQA 3DGQA 5J9BA 2PWJA 2FD3A 5A4UA 1B8XA 1O8WA 1YF1A 1ML6A 3GNJA 2FGXA 1G6YA 1R4WA 1Z6NA 2CA8A 2MZCA 2V32A 1Z9HA 3ERGA 4DVCA 2WS2A 1AXDA 3L9UA 3UBLA 2VCVA 4OCFA 1O6JA 3LW9A 5J5NA 3HY2A 1A23A 1EOGA 3GIXA 4LL1B 1XOBA 2GQMA 2LSTA 5G5EA 3L9VA 5IMZA 2BJXA 4ACSA 2VLVA 1TU7A 2R37A 1K3OA 3GSTA 4KAEA 4OMVA 4NXIA 2YANA 4ZIJA 3LJRA 2K9FA 3SWLA 2PGTA 1O81A 4EKZA 3DVXA 4XRDA 1Z7PA 3MYDA 6GSXA 4KUNA 2GT5A 3P7XA 3CSJA 1GSYA 2CQ9A 2GGTA 5HFKA 5IMCA 2B5YA 2HLSA 5F8BA 2WFCA 1S3RA 4K7NA 2HRFA 3WT2A 4EVMA 2GS3A 1X5CA 3KZQA 4ZXGA 4KB3A 4TXOB 4ILFA 5GAND 2LV3A 1MEKA 2VLTA 4BL7A 4KH7A 19GSA 1URMA 3MWHA 4QL9A 1J9BA 4GXZA 1UVZA 4GQCA 3EVIA 4OD7A 3IK9A 2EIRA 1ILOA 1TRUA 4EUYA 2IPAA 2OADA 4TR1A 3GTUA 4JU5A 2OE3A 2DJKA 4WR4A 2VL3A 1MDJA 5GSSA 2HSMA 3IA1A 2AHEA 4IN0A 1U3AA 3OR5A 3TOUA 1GULA 4WF5A 4K5SA 1T4YA 3TKQA 4XS4A 4EIPA 3CQFA 4Z2RA 1C72A 5D96A 1VGLA 3FZ9A 4MMMA 5CRGA 1M3JA 4H86A 2A2SA 2VCXA 3RAZA 2GSRA 3F4SA 1EV9A 1GSFA 2LNTA 2RM6A 2WRTA 1V40A 2H30A 1TKDB 2CVKA 1GWCA 4CY8A 3EINA 1TW9A 2RUEA 1V58A 2DC5A 2QC7A 4O32A 2LQOA 1O7UA 1BEDA 2NBSA 3TKRA 2B7JA 1M9BA 4NAXA 3CYNA 3ZIJA 1SYRA 4TW5A 2HRKA 2WDUA 1AUCA 3GHAA 5DAKB 5ECPB 3KM6A 5INYA 1TXXA 2FY6A 3KD0A 4ZL7A 5COHA 2ZNMA 1DBYA 4ID0A 4FYBA 3EE2A 1OKTA 3ZMKA 2YV9A 5ECQB 5ECRB 2KP2A 2MBSA 4F03A 2IJYA 2ON7A 4BL7B 2O7KA 1GSDA 1YEPA 2G2QA 2R0PA 4LL4B 3KEBA 3HA9A 2DJ2A 2E0QA 3QFAC 2KP1A 3VI5A 1GLPA 1B4PA 1ZYPA 2REMA 2DIYA 2H01A 2E2GA 4TR1B 5ECNB 2YJ7A 1GUHA 4PX1A 3GTUB 2B6MA 4JR4A 3DWVA 3GX8A 2B3SA 1XVWA 4RQXA 2K6VA 5IM9A 1PRXA 5CRWA 2C1YA 2H0GA 3D22A 5F07A 4BVYA 4XS4B 4NMUA 3EC3A 2OBKA 5KN2A 3WYWA 3IAM2 5B7CA 1BYEA 2FA8A 4QQ7A 5CYYA 3CRTA 4XS6A 5J9CA 1YF0A 4RI6A 3RDWA 2WB9A 4Q5RA 5IIZA 3CTGA 2DKIA 1GTUA 2H0IA 2XBIA 3ZVJD 2A2PA 2PPTA 3J7Yb 1T4ZA 4J57E 2WGRA 1R26A 1ZYNA 3TJBA 1OE7A 2OA7A 3GX0A 5ECSA 2WJUA 2IMKA 4HU9A 5DJMA 4WETA 3TRQA 2VL2C 4AF2A 3IXRA 4N10A 4CHSA 1UA5A 2LRCA 5F0GA 3VWUA 3C73A 1M2AA 1M0UA 4XCSA 3GL5A 10GSA 3ERFA 1PQNA 3IHQA 3GSSA 5ECMB 4N30A 3N5OA 5KN1A 4EDZA 1THXA 1YY7A 5CAXA 2VOCA 2DJ0A 2AUVA 3P8WA 5KEJA 5BRTA 3C7MA 3V1WA 4X43A 4G10A 2A4HA 3A2VA 3F8UA 4IBPA 4IP1A 4NV2A 4K7IA 4TKYA 1GNWA 4CW9A 4P3YB 1J08A 4G19A 2QGVA 4BVYB 2HNLA 1UN2A 3GURA 1EGRA 3ZITA 4NWYA 1VF1A 2M80A 2X99A 4L0WA 1ERVA 11GSA 2K8VA 4KCAA 1H4OA 1BQ7A 3FR9A 3FZ5A 4TVEA 1YZXA 2OE0A 3F3QA 2UZ8A 1TK0B 1ON4A 4TR4A 2R0GA 4V2LA 3DMLA 4IKHA 3QOUA 2NDOA 3LWAA 4GSSA 2OJLA 4DSQA 6GSYA 2H70A 4NHZA 4K5RA 2J9HA 13GSA 2X8GA 6GSVA 1W89A 4PXOA 1KBNA 3A2XA 2LJKA 1SK0A 3R2QA 3KCMA 1XWGA 2DMMA 5G5FA 1V2AA 6GSSA 1OC3A 3F4RA 2VM2A 1M7TA 3IDVA 1CQGA 3GMFA 1A2MA 4KW6A 2DJJA 3IRAA 4GRFA 1XZOA 2H1BA 1QGVA 4KSOA 2PBJA 1HNBA 4FYCA 2FA4A 3GRXA 2H6ZA 2H0HA 1BJXA 3L4NA 1OVNA 2VL2A 2KUCA 2HSYA 4PTSA 1B9YC 5H5RA 1NSWA 3LQ7A 3RBTA 3P2AA 4GQFA 2H66A 5KOXA 1I5GA 4PQHA 3RPNA 2FWEA 2YJHA 1A2LA 3QDNA 3ZMLA 3ZFBA 1GRXA 1MDKA 3NZNA 4Q5FA 2BMXA 4F0CA 2LJAA 5H5QA 1TU8A 2D2ZA 2LS5A 4MF5A 1KTEA 1AQWA 3G9BA 3ZZXA 4GLTA 16GSA 4K8MA 4MZWA 5DBQA 2G0FA 2FWHA 5FWGA 1JZWA 1V9WA 3UJ1A 2HZFA 1TK8B 2F51A 3LYPA 3TUEA 1O85A 5KOWA 3H4KA 3HHVA 2GZPA 5DQSA 1SJZA 5EVOA 2PVOC 1PN9A 3CMIA 1XW9A 3VWWA 3W6GA 1SD8A 3H93A 2H74A 1J0FA 2H75A 4MH2A 4IJIA 1DE1A 2C3QA 2IN3A 3KH7A 4OFNA 1RK4A 4JR6A 5JCWA 3EWLA 3LSZA 1MD3A 4X0XA 3WD6A 1EEMA 4NHWA 1T1VA 3FR6A 3I6AA 4ECJA 2H71A 4ZBDA 3EURA 4EXJA 2FCHA 4ZILA 6GSTA 3QAGA 3GKMA 3H1NA 4EF0A 3D6IA 4YAPA 4MJEA 4K6XA 5IO2A 1QFNA 3VPQA 3IHGA 4FO5A 2CZ3A 3HJOA 1QMVA 2X4AA 2RIIA 4IVFA 2H1GA 2O89A 3WGXA 2LNSA 1M3IA 5IQYA 5ID2A 3W8JA 1OC9A 2B5XA 4ZL9A 2VAFA 3A5WA 1GTAA 3QFBC 2GZZA 2C0GA 4HZ2A 1DUGA 3HVXA 1ABAA 1VF2A 3TKPA 1PSQA 4XRAA 1R7HA 4MABA 4GF0A 1V98A 12GSA 3F0IA 4ZB9A 5DVBA 1T00A 3TGZA 1F3AA 1PMTA 2HT9A 1EZKA 5HFGA 2V6OA 3TCOA 1XIYA 4OFMA 3UBKA 2XPEA 5D9TA 5H5SA 4HDEA 3W8SA 6GSUA 4F0BA 1G7EA 5D9WA 1XCCA 4JE1A 2HZEA 5AISA 2OKAA 3LYKA 3M9JA 1O73A 3C71A 4O5UA 5EPFA 4PNGA 4LLRA 3D21A 2KHPA 2PN8A 3KP8A 5D9XA 2IFQA 1WRYA 4O5QA 5DALA 3Q74A 4LMWA 5G31A 1IYHA 2CZ2A 2LKUA 2C3NA 1F37A 1NM3A 17GSA 2I3YA 2L4CA 4MDCA 3VWVA 3IE3A 1ST9A 1G7OA 2P5RA 5A4WA 4TR0A 3ZREA 3HVNA 1FAAA 4QL7A 2MMOA 2L57A 5ECLB 3QCPA 5ID2B 2HFDA 1ERWA 1OC9B 2H6XA 3IPZA 4KCEA 4G0LA 3Q19A 2L59A 4KDXA 4IJ3A 1FB0A 2O8VB 5B8AA 1AAZA 2HRNA 4KA0A 1GL8A 4J2FA 4YKGA 2TRXA 1R5PA 3ME7A 1X9SB 3GN3A 1MD4A 1GUMA 1U6TA 1GUKA 3F3RA 3F9UA 4BVXA 1UC7A 1T8EB 4K9ZA 3GV1A 2HSHA 1EOHA 1A24A 4I2UA 4X4JA 1WE0A 1ERTA 4Q5NA 4JEDA 1ZYEA 4FH8A 2DKHA 1M2BA 3CSIA 1XBSA 3PINA 18GSA 2YWIA 3UVHA 4MZBA 2HZEB 3M0FA 1YEXA 3AY8A 1S3DA 4LMVA 1BAYA 5HFIA 4ZBBA 3GFKA 2IFQB 4G0IA 4KNDA 5B6MA 1JZRA 5DALB 4KGIA 1NW2A 2P0GA 3ZFLA 3C8EA 3ME8A 3FHKA 4K0GA 5JWOB 4I97A 2EC4A 3MAKA 1ACVA 2PVQA 2CVDA 5AGYA 3UARA 1F6MC 4PQIA 2VD1A 1PL1A 4GCIA 3BD2A 1F9MA 2AB6A 1KNGA 1S3CA 3GA4A 5ECKB 1U87A 1NHYA 3BCIA 2XBQA 3EMXA 5DCGA 3FMWA 3MDKA 2QSIA 5ELGA 1DE2A 2VD0A 3LFLA 3HYPA 2F3MA 2JZRA 4TN8A 1TOFA 3O3TA 1TI1A 4L5OA 4XIHA 1YDKA 3UIWA 4CY6A 2QA1A 2CAQA 1B48A 4OWYA 5L71A 3LXZA 3TDGA 3VFIA 2IL3A 5D9VA 4PQ1A 5CRHA 3TRPA 1XXUA 4BVXB 4NPBA 3EYTA 4GSNA 3KTBA 4V2MA 5ENUA 3VLNA 4WKWA 2OBIA 4MPFA 4PNFA 2GSTA 2B1KA 1RQMA 2RM5A 5A4VA 2GZYA 2YPMA 4PGTA 4V1Ap 3KMOA 2YWOA 1HQOA 2L5LA 1QK8A 2R5GA 3VPTA 3L9SA 5AIXA 2JL4A 4XS1A 3WGDA 2DJ3A 1EEJA 2VL9A 1XW6A 3ED3A 2F9SA 2C4JA 4AJ7A 3KXOA 2C80A 2E2MA 4OFTA 3IR4A 2DSAA 5J4UA 2MMZA 4WEYA 1X9WB 4ICYA 4BA7A 1X0RA 1TI3A 4L5LA 1SKWB 3H79A 2ZUPA 3HD5A 1OC8A 3HZ8A 4IS0A 4HZ4A 1JLVA 1HNCA 1WJKA 3HZ4A 1Z3EA 4LA1A 4Z7XA 1K0OA 2RLIA 3DXBA 2P31A 2K8SA 3FY7A 1KEBA 2DMLA 2JSZA 5ABRA 1GSSA 3FKFA 1PX6A 3KTLA 2HXKA 1G6WA 2FHEA 4WBRD 1GSUA 2MYGA 1XVQA 1K0MA 5E4WA 3TKSC 2X64A 3VK9A 3GL3A 1FW1A 1T3BA 1XW5A 14GSA 3DVWA 2LEGA 3QR6A 4Z2TA 2PUKC 2H8LA 4FIWA 1A0FA 2QA2A 1XPVA 1B9XC 1W4VA 1ZCPA 1LBKA 4IQ1A 2GQKA 2R6KA 1Z6MA 4BPYA 2VCTA 3DRNA 4KDYA 3Q18A 4MCUA 3TOTA 2FWGA 2XHFA 3DD3A 3F63A 3IC8A 1PKWA 4K1FA 4MA9A 1E2YA 5C04A 4L8EA 4ZB6A 4BWSA 3UMAA 5ECIB 4MJCA 4IP6A 2DJ1A 2L6CA 5D93A 4K2DA 3WT1A 1XWAA 5HR1A 5HR3A 2LRTA 3KP9A 3GH9A 3HDCA 5CREA 5IOWA 1EP7A 2H1AA 1BX9A 6GSWA 2LRNA 3L0HA 3RPPA 2IWTA 1NHOA 5ECHB 1JHBA 5AIVA 4HJMA 2GVPA 4ML1A 2YN1A 1A8YA 2N5FA 5F05A 1SL0B 3HXSA 2MBTA 2PU9C 4O92A 4HQZA 4HEA2 1WPIA 1Q98A 2IMFA 3UOMA 3I43A 1K3LA 4MPGA 1AC1A 2CV4A 3BJ5A 3US3A 2O87A 3K8NA 2V6KA 1ZYQB 4MLYA 2GLRA 4MF6A 8GSSA 2GTUA 3SBCA 3D4MA 3EMPA 1IYIA 4MZCA 1SENA 1M2DA 1QQ2A 5G1KA 4GWRA 2WULA 4AJ6A 3M8NA 3LG6A 3ISOA 4AGSA 1SYXA 3A2WA 3ZTLA 3FEUA 1PFOA 22GSA 3A5IA 2GDRA 2YWMA 4EIQA 4L0UA 4HUAA 4POKA 4IW9A 1PX7A 2V2GA 3H8QA 2HI7A 2FWFA 2I9HA 4ECIA 5GZZB 1LJRA 3TKSA 4ZL8A 2B5EA 4POMA 4F2IA 1GH2A 1Z5YE 2EIQA 2KLXA 1BG5A 3E0UA 4YQVA 5JWQB 2LUSA 4WR5A 5G30A 1YQ1A 5CO3A 2YCDA 3NOFA 2C0DA 2VIMA 4XTSA 1G0TA 1TRSA 4K2XA 4TR3A 3O76A 1K0AA 3D0ZA 2L6DA 2PERA 3FRCA 3DEXA 9GSSA 2YNXA 2QKEA 3GKNA 3O6TA 2MMAA 1ZZYA 3ZVJA 5DDLA 4O5RA 3FR3A 1V57A 1F2EA 2RUFA 2GQLA 3G7JA 2V1MA 1K0DA 3FZAA 2H76A 2KOKA 1I9DA 2GT6A 1XWKA 1SD9A 4O7HA 2YP6A 3S9FA 3TJFA 1Y6EA 1GLQA 1WOUA 1GTIA 2CAIA 3TJJA 4WF4A 2I1UA 1JFUA 5E59A 2A2RA 2FLSA 1TTZA 2WZ9A 1TDIA 3G7IA 3LEFA 1GSQA 1YJ6A 2LQQA 3QAWA 1ZL9A 4WBJA 5DAKA 2TIRA 3F6DA 4KX4A 2XPDA 1E6BA 1TJDA 2E7PA 3HVSA 1SKRB 4KDUA 2C0EA 5LCZA 1PGTA 2L5OA 3MNGA 4KF9A 2DLXA 2R4VA 3TRXA 1SL1B 1PN0A 4MJAA 1Y25A 4MF7A 4ULXA 4Z2UA 3F6FA 4GSTA 5KN0A 1F3BA 2FNOA 2TRCP 4RQRA 1X9MB 1FOVA 3A3TA 1Q4JA 2CX3A 3I9V2 2VUPA 4USSA 1AQXA 3HJMA 2AJQB 5HR2A 4TXVA 3D5JA 3C1SA 1FVJA 1R5AA 4RI7A 5DCHA 4GTUA 3D4TA 4DEJA 3EU3A 4OO4A 1M9AA 4MNNA 5ECOB 2J23A 1GNEA 1VF3A 1QXHA 1B4QA 4EDYA 2JSYA 5IMDA 2HYXA 3UAPA 4YH2A 1RW1A 5D73A 2CVBA 3RHCA 3J7Yk 2VLUA 4N0VA 5KN3A 3CTFA 1PKZA 4NV5A 1ZMAA 1OYJA 5JCGA 3UEMA 3EU4A 3UVTA 2VCQA 3CXGA 2OACA 1TP9A 1AQVA 4K0NA 2JADA 4JZQA 5BMUA 2A4VA 1WP0A 1GSEA 2K18A 3WGEA 3G7YA 3U6VA 5JCUA 3MIXA 2AAWA 2XC2A 2DIZA 1ZOFA 3NIVA 1HD2A 2R0CA 5EL8A 5CRDA 3I69A 3QAVA 3HVVA 4FYUA 1EV4A 5FHIA 1H75A 5GAPD 2MMNA 2WCIA 2YZUA 2O85A 3IK7A 1OE8A 4TOPA 3FYGA 2GSQA 2CT6A 3PH9A 1THOA 2JZSA 3APSA 4E8HA 1TK5B 1VRSD 1U88A 4JBBA 1A8LA 5G1LA 1XOAA 3ERWA 3KGKA 4RUVA 3JCML 1FVKA 1OAZA 3TKSE 1QUWA 2NVLA 1MTCA 2YWNA 2NTOA 1X5EA 1LU4A 4Q5QA 3GKKA 3VWXA 4D73A 4V2NA 3APOA 3HKRA 1ERUA 4K7OA 2I81A 5HR0A 1A0RP 1YKCA 2ZCTA 4PURA 1EWXA 4BIKA 5D8IA 5JWRB 5IPHA 3TB2A 5B6NA 3GKXA 1K0NA 4ZB8A 3TJKA 3ZYWA 3PR8A 2M72A 2H19A 5IMVA 3GUSA 2IMEA 3IAS2 4HI7A 4POBA 5B8BA 3M3MA 2R3XA 3BBYA 5F06A 5IPGA 2EIOA 2JACA 1SKSB 3E3EA 2V41A 4YKFA 3ZIVA 2DBCA 2P5QA 4HQSA 3BCKA 3QPMA 2LJRA 4EE0A 1VF4A 4V1Ag 4HJ2A 3MSZA 2FUG2 3M1GA 4POLA 3TJGA 4PUAA 5LNKe 5FT3A 4YQMA 3U5RE 3GYKA 2VCWA 3EPTA 1XG8A 1N8JA 2YV7A 2CX4A 3DYRA 3VURA 3RHBA 5HQPA 5G2ZA 1M99A 2B7KA 2IMIA 3KJYA 1SL2B 4I2TA 3CSHA 1JZOA 3IOSA 2M46A 1PD21 5A5KA 4IELA 4PUFC 4I6XA 2H6YA 3KIJA 4KE3A 3KMNA 3N9JA 4D73B 4XHMA 2AYTA 1EGOA 4DSSA 3HCZA 1DSBA 4BWQA 1GTBA 2YOIA 1HYUA 1SJIA 4MH3A 4MJBA 1AIUA 1FB6A 1SK2A 4OCEA 5CP1A 2Z9SA 4G2EA 4IHUA 4OO5A 3P90A 4F9ZA 3VI7A 4N11A 4YQUA 5IMAA 5DJLA 1TRWA 3E9JB 1EP8A 3M9KA 4HS1A 4I8BA 5IO0A 3CRUA 2X49A 2YZHA 1S3AA 7GSSA 4MK3A 1WIKA 1WMJA 5AN1A 3UL3A 3R3EA 4CDOA 4ML6A 3PPUA 2X8HA 1K0CA 2GSSA 4E8EA 2H72A 4ZBAA 1YKAA 1XWCA 4X1UA 4AJ8A 2AV4A 1T7PB 2F8AA 4YAVA 5ELAA 3FK8A 1XWBA 4IQAA 1N2AA 3C1RA 4HSCX 3QMXA 4DSRA 2I4AA 1CQHA 4JRRA 3LORA 3ZLPA 4MP4A 3IV4A 2C3TA 5EY6A 3IC4A 3Q6OA
chains in the Genus database with same CATH topology
3HJPA 1AW9A 1OKDA 1JLWA 1JZDA 2VO4A 1ZGNA 2C0FA 1FHEA 3BOAA 1SK1A 2VCZA 3QD9A 4HOJA 1U3IA 5C00A 1FOHA 2H73A 2L4QA 5CNWA 3ZRDA 3LGCA 4IGJA 4N0ZA 3DIEA 4DSSB 4EL1A 4WXTA 1WWJA 1XFLA 1PL2A 2NPBA 1FG4A 2F8FA 4G0KA 1K3YA 1TRVA 1SU9A 3FW2A 4G9HA 4ECBA 2JU5A 2VM1A 2N5BA 4J56E 4HU7A 2R2JA 2BTOT 4TRXA 3DKSA 2OE1A 4I5QA 4A5PA 4EO3A 5J41A 1SJ6A 1USBA 1A2JA 5IMFA 1FO5A 4EC0A 3KH9A 2C8UA 1K0BA 3PGTA 2HE3A 5GSTA 3IBHA 2N5AA 1X5DA 2ON5A 4ISDA 4FQUA 3FZ4A 2B1LA 20GSA 3LXTA 4F82A 4ECCA 5DQYA 5LD0A 1MDIA 1Z7RA 1GP1A 3L78A 2LTKA 2ALBA 4KSMA 1PA3A 2H1DA 2IMDA 3ZL5A 5IOXA 5J3RA 2ES7A 3GH6A 2HRAA 2IIYA 1O8XA 2X8CA 4TXOA 2JZTA 1HNAA 2PMTA 3F4TA 3CBUA 3APQA 3DGQA 5J9BA 2PWJA 2FD3A 5A4UA 1B8XA 1O8WA 1YF1A 1ML6A 3GNJA 2FGXA 1G6YA 1R4WA 1Z6NA 2CA8A 2MZCA 2V32A 1Z9HA 3ERGA 4DVCA 2WS2A 1AXDA 3L9UA 3UBLA 2VCVA 4OCFA 1O6JA 3LW9A 5J5NA 3HY2A 1A23A 1EOGA 3GIXA 4LL1B 1XOBA 2GQMA 2LSTA 5G5EA 3L9VA 5IMZA 2BJXA 4ACSA 2VLVA 1TU7A 2R37A 1K3OA 3GSTA 4KAEA 4OMVA 4NXIA 2YANA 4ZIJA 3LJRA 2K9FA 3SWLA 2PGTA 1O81A 4EKZA 3DVXA 4XRDA 1Z7PA 3MYDA 6GSXA 4KUNA 2GT5A 3P7XA 3CSJA 1GSYA 2CQ9A 2GGTA 5HFKA 5IMCA 2B5YA 2HLSA 5F8BA 2WFCA 4K7NA 2HRFA 3WT2A 4EVMA 2GS3A 1X5CA 3KZQA 4ZXGA 4KB3A 4TXOB 4ILFA 5GAND 2LV3A 1MEKA 2VLTA 4BL7A 4KH7A 19GSA 1URMA 3MWHA 4QL9A 1J9BA 4GXZA 1UVZA 4GQCA 3EVIA 4OD7A 3IK9A 2EIRA 1ILOA 1TRUA 4EUYA 2IPAA 2OADA 4TR1A 3GTUA 4JU5A 2OE3A 2DJKA 4WR4A 2VL3A 1MDJA 5GSSA 2HSMA 3IA1A 2AHEA 4IN0A 1U3AA 3OR5A 3TOUA 1GULA 4WF5A 4K5SA 1T4YA 3TKQA 4XS4A 4EIPA 4Z2RA 1C72A 5D96A 1VGLA 3FZ9A 4MMMA 5CRGA 4H86A 2A2SA 2VCXA 3RAZA 2GSRA 3F4SA 1EV9A 1GSFA 2LNTA 2RM6A 2WRTA 1V40A 2H30A 1TKDB 2CVKA 1GWCA 4CY8A 3EINA 1TW9A 2RUEA 1V58A 2DC5A 2QC7A 4O32A 2LQOA 1O7UA 1BEDA 2NBSA 3TKRA 2B7JA 1M9BA 4NAXA 3CYNA 3ZIJA 1SYRA 4TW5A 2HRKA 2WDUA 1AUCA 3GHAA 5DAKB 5ECPB 3KM6A 5INYA 1TXXA 2FY6A 3KD0A 4ZL7A 5COHA 2ZNMA 1DBYA 4ID0A 4FYBA 3EE2A 1OKTA 3ZMKA 2YV9A 5ECQB 5ECRB 2KP2A 2MBSA 4F03A 2IJYA 2ON7A 4BL7B 2O7KA 1GSDA 1YEPA 2G2QA 2R0PA 4LL4B 3KEBA 3HA9A 2DJ2A 2E0QA 3QFAC 2KP1A 3VI5A 1GLPA 1B4PA 1ZYPA 2REMA 2DIYA 2H01A 2E2GA 4TR1B 5ECNB 2YJ7A 1GUHA 4PX1A 3GTUB 2B6MA 4JR4A 3DWVA 3GX8A 2B3SA 1XVWA 4RQXA 2K6VA 5IM9A 1PRXA 5CRWA 2C1YA 2H0GA 3D22A 5F07A 4BVYA 4XS4B 4NMUA 3EC3A 2OBKA 5KN2A 3WYWA 3IAM2 5B7CA 1BYEA 2FA8A 4QQ7A 5CYYA 3CRTA 4XS6A 5J9CA 1YF0A 4RI6A 3RDWA 2WB9A 4Q5RA 5IIZA 3CTGA 2DKIA 1GTUA 2H0IA 2XBIA 3ZVJD 2A2PA 2PPTA 3J7Yb 1T4ZA 4J57E 2WGRA 1R26A 1ZYNA 3TJBA 1OE7A 2OA7A 3GX0A 5ECSA 2WJUA 2IMKA 4HU9A 5DJMA 4WETA 3TRQA 2VL2C 4AF2A 3IXRA 4N10A 4CHSA 1UA5A 2LRCA 5F0GA 3VWUA 3C73A 1M2AA 1M0UA 4XCSA 3GL5A 10GSA 3ERFA 1PQNA 3IHQA 3GSSA 5ECMB 4N30A 3N5OA 5KN1A 4EDZA 1THXA 1YY7A 5CAXA 2VOCA 2DJ0A 2AUVA 3P8WA 5KEJA 5BRTA 3C7MA 3V1WA 4X43A 4G10A 2A4HA 3A2VA 3F8UA 4IBPA 4IP1A 4NV2A 4K7IA 4TKYA 1GNWA 4CW9A 4P3YB 1J08A 4G19A 2QGVA 4BVYB 2HNLA 1UN2A 3GURA 1EGRA 3ZITA 4NWYA 1VF1A 2M80A 2X99A 4L0WA 1ERVA 11GSA 2K8VA 4KCAA 1H4OA 1BQ7A 3FR9A 3FZ5A 4TVEA 1YZXA 2OE0A 3F3QA 2UZ8A 1TK0B 1ON4A 4TR4A 2R0GA 4V2LA 3DMLA 4IKHA 3QOUA 2NDOA 3LWAA 4GSSA 2OJLA 4DSQA 6GSYA 2H70A 4NHZA 4K5RA 2J9HA 13GSA 2X8GA 6GSVA 1W89A 4PXOA 1KBNA 3A2XA 2LJKA 1SK0A 3R2QA 3KCMA 1XWGA 2DMMA 5G5FA 1V2AA 6GSSA 1OC3A 3F4RA 2VM2A 1M7TA 3IDVA 1CQGA 3GMFA 1A2MA 4KW6A 2DJJA 3IRAA 4GRFA 1XZOA 2H1BA 1QGVA 4KSOA 2PBJA 1HNBA 4FYCA 2FA4A 3GRXA 2H6ZA 2H0HA 1BJXA 3L4NA 1OVNA 2VL2A 2KUCA 2HSYA 4PTSA 1B9YC 5H5RA 1NSWA 3LQ7A 3RBTA 3P2AA 4GQFA 2H66A 5KOXA 1I5GA 4PQHA 3RPNA 2FWEA 2YJHA 1A2LA 3QDNA 3ZMLA 3ZFBA 1GRXA 1MDKA 3NZNA 4Q5FA 2BMXA 4F0CA 2LJAA 5H5QA 1TU8A 2D2ZA 2LS5A 4MF5A 1KTEA 1AQWA 3G9BA 3ZZXA 4GLTA 16GSA 4K8MA 4MZWA 5DBQA 2G0FA 2FWHA 5FWGA 1JZWA 1V9WA 3UJ1A 2HZFA 1TK8B 2F51A 3LYPA 3TUEA 1O85A 5KOWA 3H4KA 3HHVA 2GZPA 5DQSA 1SJZA 5EVOA 2PVOC 1PN9A 3CMIA 1XW9A 3VWWA 3W6GA 1SD8A 3H93A 2H74A 1J0FA 2H75A 4MH2A 4IJIA 1DE1A 2C3QA 2IN3A 3KH7A 4OFNA 1RK4A 4JR6A 5JCWA 3EWLA 3LSZA 1MD3A 4X0XA 3WD6A 1EEMA 4NHWA 1T1VA 3FR6A 3I6AA 4ECJA 2H71A 4ZBDA 3EURA 4EXJA 2FCHA 4ZILA 6GSTA 3QAGA 3GKMA 3H1NA 4EF0A 3D6IA 4YAPA 4MJEA 4K6XA 5IO2A 1QFNA 3VPQA 3IHGA 4FO5A 2CZ3A 3HJOA 1QMVA 2X4AA 2RIIA 4IVFA 2H1GA 2O89A 3WGXA 2LNSA 5IQYA 5ID2A 3W8JA 1OC9A 2B5XA 4ZL9A 2VAFA 3A5WA 1GTAA 3QFBC 2GZZA 2C0GA 4HZ2A 1DUGA 3HVXA 1ABAA 1VF2A 3TKPA 1PSQA 4XRAA 1R7HA 4MABA 4GF0A 1V98A 12GSA 3F0IA 4ZB9A 5DVBA 1T00A 3TGZA 1F3AA 1PMTA 2HT9A 1EZKA 5HFGA 2V6OA 3TCOA 1XIYA 4OFMA 3UBKA 2XPEA 5D9TA 5H5SA 4HDEA 3W8SA 6GSUA 4F0BA 1G7EA 5D9WA 1XCCA 4JE1A 2HZEA 5AISA 2OKAA 3LYKA 3M9JA 1O73A 3C71A 4O5UA 5EPFA 4PNGA 4LLRA 3D21A 2KHPA 2PN8A 3KP8A 5D9XA 2IFQA 1WRYA 4O5QA 5DALA 3Q74A 4LMWA 5G31A 1IYHA 2CZ2A 2LKUA 2C3NA 1F37A 1NM3A 17GSA 2I3YA 2L4CA 4MDCA 3VWVA 3IE3A 1ST9A 1G7OA 2P5RA 5A4WA 4TR0A 3ZREA 1FAAA 4QL7A 2MMOA 2L57A 5ECLB 3QCPA 5ID2B 2HFDA 1ERWA 1OC9B 2H6XA 3IPZA 4KCEA 4G0LA 3Q19A 2L59A 4KDXA 4IJ3A 1FB0A 2O8VB 5B8AA 1AAZA 2HRNA 4KA0A 1GL8A 4J2FA 4YKGA 2TRXA 1R5PA 3ME7A 1X9SB 3GN3A 1MD4A 1GUMA 1U6TA 1GUKA 3F3RA 3F9UA 4BVXA 1UC7A 1T8EB 4K9ZA 3GV1A 2HSHA 1EOHA 1A24A 4I2UA 4X4JA 1WE0A 1ERTA 4Q5NA 4JEDA 1ZYEA 4FH8A 2DKHA 1M2BA 3CSIA 1XBSA 3PINA 18GSA 2YWIA 3UVHA 4MZBA 2HZEB 3M0FA 1YEXA 3AY8A 1S3DA 4LMVA 1BAYA 5HFIA 4ZBBA 3GFKA 2IFQB 4G0IA 4KNDA 5B6MA 1JZRA 5DALB 4KGIA 1NW2A 2P0GA 3ZFLA 3C8EA 3ME8A 3FHKA 4K0GA 5JWOB 4I97A 2EC4A 3MAKA 1ACVA 2PVQA 2CVDA 5AGYA 3UARA 1F6MC 4PQIA 2VD1A 1PL1A 4GCIA 3BD2A 1F9MA 2AB6A 1KNGA 1S3CA 3GA4A 5ECKB 1U87A 1NHYA 3BCIA 2XBQA 3EMXA 5DCGA 3FMWA 3MDKA 2QSIA 5ELGA 1DE2A 2VD0A 3LFLA 3HYPA 2F3MA 2JZRA 4TN8A 1TOFA 3O3TA 1TI1A 4L5OA 4XIHA 1YDKA 3UIWA 4CY6A 2QA1A 2CAQA 1B48A 4OWYA 5L71A 3LXZA 3TDGA 3VFIA 2IL3A 5D9VA 4PQ1A 5CRHA 3TRPA 1XXUA 4BVXB 4NPBA 3EYTA 4GSNA 3KTBA 4V2MA 5ENUA 3VLNA 4WKWA 2OBIA 4MPFA 4PNFA 2GSTA 2B1KA 1RQMA 2RM5A 5A4VA 2GZYA 2YPMA 4PGTA 4V1Ap 3KMOA 2YWOA 1HQOA 2L5LA 1QK8A 2R5GA 3VPTA 3L9SA 5AIXA 2JL4A 4XS1A 3WGDA 2DJ3A 1EEJA 2VL9A 1XW6A 3ED3A 2F9SA 2C4JA 4AJ7A 3KXOA 2C80A 2E2MA 4OFTA 3IR4A 2DSAA 5J4UA 2MMZA 4WEYA 1X9WB 4ICYA 4BA7A 1X0RA 1TI3A 4L5LA 1SKWB 3H79A 2ZUPA 3HD5A 1OC8A 3HZ8A 4IS0A 4HZ4A 1JLVA 1HNCA 1WJKA 3HZ4A 1Z3EA 4LA1A 4Z7XA 1K0OA 2RLIA 3DXBA 2P31A 2K8SA 3FY7A 1KEBA 2DMLA 2JSZA 5ABRA 1GSSA 3FKFA 1PX6A 3KTLA 2HXKA 1G6WA 2FHEA 4WBRD 1GSUA 2MYGA 1XVQA 1K0MA 5E4WA 3TKSC 2X64A 3VK9A 3GL3A 1FW1A 1T3BA 1XW5A 14GSA 3DVWA 2LEGA 3QR6A 4Z2TA 2PUKC 2H8LA 4FIWA 1A0FA 2QA2A 1XPVA 1B9XC 1W4VA 1ZCPA 1LBKA 4IQ1A 2GQKA 2R6KA 1Z6MA 4BPYA 2VCTA 3DRNA 4KDYA 3Q18A 4MCUA 3TOTA 2FWGA 2XHFA 3DD3A 3F63A 3IC8A 1PKWA 4K1FA 4MA9A 1E2YA 5C04A 4L8EA 4ZB6A 4BWSA 3UMAA 5ECIB 4MJCA 4IP6A 2DJ1A 2L6CA 5D93A 4K2DA 3WT1A 1XWAA 5HR1A 5HR3A 2LRTA 3KP9A 3GH9A 3HDCA 5CREA 5IOWA 1EP7A 2H1AA 1BX9A 6GSWA 2LRNA 3L0HA 3RPPA 2IWTA 1NHOA 5ECHB 1JHBA 5AIVA 4HJMA 2GVPA 4ML1A 2YN1A 1A8YA 2N5FA 5F05A 1SL0B 3HXSA 2MBTA 2PU9C 4O92A 4HQZA 4HEA2 1WPIA 1Q98A 2IMFA 3UOMA 3I43A 1K3LA 4MPGA 1AC1A 2CV4A 3BJ5A 3US3A 2O87A 3K8NA 2V6KA 1ZYQB 4MLYA 2GLRA 4MF6A 8GSSA 2GTUA 3SBCA 3D4MA 3EMPA 1IYIA 4MZCA 1SENA 1M2DA 1QQ2A 5G1KA 4GWRA 2WULA 4AJ6A 3M8NA 3LG6A 3ISOA 4AGSA 1SYXA 3A2WA 3ZTLA 3FEUA 22GSA 3A5IA 2GDRA 2YWMA 4EIQA 4L0UA 4HUAA 4POKA 4IW9A 1PX7A 2V2GA 3H8QA 2HI7A 2FWFA 2I9HA 4ECIA 5GZZB 1LJRA 3TKSA 4ZL8A 2B5EA 4POMA 4F2IA 1GH2A 1Z5YE 2EIQA 2KLXA 1BG5A 3E0UA 4YQVA 5JWQB 2LUSA 4WR5A 5G30A 1YQ1A 5CO3A 2YCDA 3NOFA 2C0DA 2VIMA 4XTSA 1G0TA 1TRSA 4K2XA 4TR3A 3O76A 1K0AA 3D0ZA 2L6DA 2PERA 3FRCA 3DEXA 9GSSA 2YNXA 2QKEA 3GKNA 3O6TA 2MMAA 1ZZYA 3ZVJA 5DDLA 4O5RA 3FR3A 1V57A 1F2EA 2RUFA 2GQLA 3G7JA 2V1MA 1K0DA 3FZAA 2H76A 2KOKA 1I9DA 2GT6A 1XWKA 1SD9A 4O7HA 2YP6A 3S9FA 3TJFA 1Y6EA 1GLQA 1WOUA 1GTIA 2CAIA 3TJJA 4WF4A 2I1UA 1JFUA 5E59A 2A2RA 2FLSA 1TTZA 2WZ9A 1TDIA 3G7IA 3LEFA 1GSQA 1YJ6A 2LQQA 3QAWA 1ZL9A 4WBJA 5DAKA 2TIRA 3F6DA 4KX4A 2XPDA 1E6BA 1TJDA 2E7PA 3HVSA 1SKRB 4KDUA 2C0EA 5LCZA 1PGTA 2L5OA 3MNGA 4KF9A 2DLXA 2R4VA 3TRXA 1SL1B 1PN0A 4MJAA 1Y25A 4MF7A 4ULXA 4Z2UA 3F6FA 4GSTA 5KN0A 1F3BA 2FNOA 2TRCP 4RQRA 1X9MB 1FOVA 3A3TA 1Q4JA 2CX3A 3I9V2 2VUPA 4USSA 1AQXA 3HJMA 2AJQB 5HR2A 4TXVA 3D5JA 3C1SA 1FVJA 1R5AA 4RI7A 5DCHA 4GTUA 3D4TA 4DEJA 3EU3A 4OO4A 1M9AA 4MNNA 5ECOB 2J23A 1GNEA 1VF3A 1QXHA 1B4QA 4EDYA 2JSYA 5IMDA 2HYXA 3UAPA 4YH2A 1RW1A 5D73A 2CVBA 3RHCA 3J7Yk 2VLUA 4N0VA 5KN3A 3CTFA 1PKZA 4NV5A 1ZMAA 1OYJA 5JCGA 3UEMA 3EU4A 3UVTA 2VCQA 3CXGA 2OACA 1TP9A 1AQVA 4K0NA 2JADA 4JZQA 5BMUA 2A4VA 1WP0A 1GSEA 2K18A 3WGEA 3G7YA 3U6VA 5JCUA 3MIXA 2AAWA 2XC2A 2DIZA 1ZOFA 3NIVA 1HD2A 2R0CA 5EL8A 5CRDA 3I69A 3QAVA 3HVVA 4FYUA 1EV4A 5FHIA 1H75A 5GAPD 2MMNA 2WCIA 2YZUA 2O85A 3IK7A 1OE8A 4TOPA 3FYGA 2GSQA 2CT6A 3PH9A 1THOA 2JZSA 3APSA 4E8HA 1TK5B 1VRSD 1U88A 4JBBA 1A8LA 5G1LA 1XOAA 3ERWA 3KGKA 4RUVA 3JCML 1FVKA 1OAZA 3TKSE 1QUWA 2NVLA 1MTCA 2YWNA 2NTOA 1X5EA 1LU4A 4Q5QA 3GKKA 3VWXA 4D73A 4V2NA 3APOA 3HKRA 1ERUA 4K7OA 2I81A 5HR0A 1A0RP 1YKCA 2ZCTA 4PURA 1EWXA 5D8IA 5JWRB 5IPHA 3TB2A 5B6NA 3GKXA 1K0NA 4ZB8A 3TJKA 3ZYWA 3PR8A 2M72A 2H19A 5IMVA 3GUSA 2IMEA 3IAS2 4HI7A 4POBA 5B8BA 3M3MA 2R3XA 3BBYA 5F06A 5IPGA 2EIOA 2JACA 1SKSB 3E3EA 2V41A 4YKFA 3ZIVA 2DBCA 2P5QA 4HQSA 3BCKA 3QPMA 2LJRA 4EE0A 1VF4A 4V1Ag 4HJ2A 3MSZA 2FUG2 3M1GA 4POLA 3TJGA 4PUAA 5LNKe 5FT3A 4YQMA 3U5RE 3GYKA 2VCWA 3EPTA 1N8JA 2YV7A 2CX4A 3DYRA 3VURA 3RHBA 5HQPA 5G2ZA 1M99A 2B7KA 2IMIA 3KJYA 1SL2B 4I2TA 3CSHA 1JZOA 3IOSA 2M46A 1PD21 5A5KA 4IELA 4PUFC 4I6XA 2H6YA 3KIJA 4KE3A 3KMNA 3N9JA 4D73B 4XHMA 2AYTA 1EGOA 4DSSA 3HCZA 1DSBA 4BWQA 1GTBA 2YOIA 1HYUA 1SJIA 4MH3A 4MJBA 1AIUA 1FB6A 1SK2A 4OCEA 5CP1A 2Z9SA 4G2EA 4IHUA 4OO5A 3P90A 4F9ZA 3VI7A 4N11A 4YQUA 5IMAA 5DJLA 1TRWA 3E9JB 1EP8A 3M9KA 4HS1A 4I8BA 5IO0A 3CRUA 2X49A 2YZHA 1S3AA 7GSSA 4MK3A 1WIKA 1WMJA 5AN1A 3UL3A 3R3EA 4CDOA 4ML6A 3PPUA 2X8HA 1K0CA 2GSSA 4E8EA 2H72A 4ZBAA 1YKAA 1XWCA 4X1UA 4AJ8A 2AV4A 1T7PB 2F8AA 4YAVA 5ELAA 3FK8A 1XWBA 4IQAA 1N2AA 3C1RA 3QMXA 4DSRA 2I4AA 1CQHA 4JRRA 3LORA 3ZLPA 4MP4A 3IV4A 2C3TA 5EY6A 3IC4A 3Q6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJP A;  1AW9 A;  1OKD A;  1JLW A;  1JZD A;  2VO4 A;  1ZGN A;  2C0F A;  1FHE A;  3BOA A;  1SK1 A;  2VCZ A;  3QD9 A;  4HOJ A;  1U3I A;  5C00 A;  2H73 A;  2L4Q A;  5CNW A;  3ZRD A;  3LGC A;  4IGJ A;  4N0Z A;  3DIE A;  4DSS B;  4EL1 A;  4WXT A;  1WWJ A;  1XFL A;  1PL2 A;  2NPB A;  1FG4 A;  2F8F A;  1K3Y A;  1TRV A;  1SU9 A;  3FW2 A;  4G9H A;  4ECB A;  2JU5 A;  2VM1 A;  2N5B A;  4J56 E;  4HU7 A;  2R2J A;  2BTO T;  4TRX A;  3DKS A;  2OE1 A;  4I5Q A;  4EO3 A;  5J41 A;  1SJ6 A;  1USB A;  1A2J A;  5IMF A;  1FO5 A;  4EC0 A;  3KH9 A;  2C8U A;  1K0B A;  3PGT A;  2HE3 A;  5GST A;  3IBH A;  2N5A A;  1X5D A;  2ON5 A;  4ISD A;  3FZ4 A;  2B1L A;  20GS A;  3LXT A;  4F82 A;  4ECC A;  5DQY A;  5LD0 A;  1MDI A;  1Z7R A;  1GP1 A;  3L78 A;  2LTK A;  2ALB A;  4KSM A;  1PA3 A;  2H1D A;  2IMD A;  3ZL5 A;  5IOX A;  5J3R A;  2ES7 A;  3GH6 A;  2IIY A;  1O8X A;  2X8C A;  4TXO A;  2JZT A;  1HNA A;  2PMT A;  3F4T A;  3CBU A;  3APQ A;  3DGQ A;  5J9B A;  2PWJ A;  2FD3 A;  5A4U A;  1B8X A;  1O8W A;  1YF1 A;  1ML6 A;  3GNJ A;  2FGX A;  1G6Y A;  1R4W A;  1Z6N A;  2CA8 A;  2MZC A;  2V32 A;  1Z9H A;  3ERG A;  4DVC A;  2WS2 A;  1AXD A;  3L9U A;  3UBL A;  2VCV A;  4OCF A;  1O6J A;  5J5N A;  3HY2 A;  1A23 A;  1EOG A;  3GIX A;  4LL1 B;  1XOB A;  2GQM A;  2LST A;  5G5E A;  3L9V A;  5IMZ A;  2BJX A;  4ACS A;  2VLV A;  1TU7 A;  2R37 A;  1K3O A;  3GST A;  4KAE A;  4OMV A;  4NXI A;  2YAN A;  4ZIJ A;  3LJR A;  2K9F A;  3SWL A;  2PGT A;  1O81 A;  4EKZ A;  3DVX A;  4XRD A;  1Z7P A;  6GSX A;  4KUN A;  2GT5 A;  3P7X A;  3CSJ A;  1GSY A;  2CQ9 A;  2GGT A;  5HFK A;  5IMC A;  2B5Y A;  5F8B A;  2HLS A;  2WFC A;  4K7N A;  2HRF A;  3WT2 A;  4EVM A;  2GS3 A;  1X5C A;  3KZQ A;  4ZXG A;  4KB3 A;  4TXO B;  4ILF A;  5GAN D;  2LV3 A;  1MEK A;  2VLT A;  4BL7 A;  4KH7 A;  19GS A;  1URM A;  3MWH A;  4QL9 A;  1J9B A;  4GXZ A;  1UVZ A;  4GQC A;  3EVI A;  4OD7 A;  3IK9 A;  2EIR A;  1ILO A;  1TRU A;  4EUY A;  2IPA A;  2OAD A;  4TR1 A;  3GTU A;  4JU5 A;  2OE3 A;  2DJK A;  4WR4 A;  2VL3 A;  1MDJ A;  5GSS A;  3IA1 A;  2AHE A;  4IN0 A;  1U3A A;  3OR5 A;  3TOU A;  1GUL A;  4WF5 A;  1T4Y A;  3TKQ A;  4XS4 A;  1C72 A;  5D96 A;  1VGL A;  3FZ9 A;  4MMM A;  5CRG A;  4H86 A;  2A2S A;  2VCX A;  3RAZ A;  2GSR A;  3F4S A;  1EV9 A;  1GSF A;  2LNT A;  2RM6 A;  2WRT A;  1V40 A;  2H30 A;  1TKD B;  2CVK A;  1GWC A;  3EIN A;  1TW9 A;  2RUE A;  1V58 A;  2DC5 A;  2QC7 A;  4O32 A;  2LQO A;  1O7U A;  1BED A;  2NBS A;  3TKR A;  2B7J A;  1M9B A;  4NAX A;  3CYN A;  3ZIJ A;  1SYR A;  4TW5 A;  2WDU A;  1AUC A;  3GHA A;  5DAK B;  5ECP B;  3KM6 A;  5INY A;  1TXX A;  2FY6 A;  3KD0 A;  4ZL7 A;  5COH A;  2ZNM A;  1DBY A;  4ID0 A;  4FYB A;  3EE2 A;  1OKT A;  3ZMK A;  2YV9 A;  5ECQ B;  5ECR B;  2KP2 A;  2MBS A;  4F03 A;  2IJY A;  2ON7 A;  2O7K A;  1GSD A;  1YEP A;  2G2Q A;  4LL4 B;  3KEB A;  3HA9 A;  2DJ2 A;  2E0Q A;  3QFA C;  2KP1 A;  3VI5 A;  1GLP A;  1B4P A;  2REM A;  2DIY A;  2H01 A;  2E2G A;  4TR1 B;  5ECN B;  2YJ7 A;  1GUH A;  4PX1 A;  3GTU B;  2B6M A;  4JR4 A;  3DWV A;  3GX8 A;  2B3S A;  1XVW A;  4RQX A;  2K6V A;  5IM9 A;  1PRX A;  5CRW A;  2C1Y A;  2H0G A;  3D22 A;  5F07 A;  4BVY A;  4XS4 B;  4NMU A;  3EC3 A;  2OBK A;  5KN2 A;  3WYW A;  3IAM 2;  5B7C A;  1BYE A;  2FA8 A;  4QQ7 A;  5CYY A;  3CRT A;  4XS6 A;  5J9C A;  1YF0 A;  4RI6 A;  3RDW A;  2WB9 A;  4Q5R A;  5IIZ A;  3CTG A;  1GTU A;  2H0I A;  2XBI A;  3ZVJ D;  2PPT A;  3J7Y b;  1T4Z A;  4J57 E;  2WGR A;  1R26 A;  3TJB A;  1OE7 A;  2OA7 A;  3GX0 A;  5ECS A;  2WJU A;  2IMK A;  4HU9 A;  5DJM A;  4WET A;  3TRQ A;  2VL2 C;  4AF2 A;  3IXR A;  4N10 A;  4CHS A;  1UA5 A;  2LRC A;  5F0G A;  3VWU A;  3C73 A;  1M2A A;  1M0U A;  4XCS A;  3GL5 A;  10GS A;  3ERF A;  1PQN A;  3IHQ A;  3GSS A;  5ECM B;  4N30 A;  3N5O A;  5KN1 A;  4EDZ A;  1THX A;  1YY7 A;  5CAX A;  2VOC A;  2DJ0 A;  2AUV A;  3P8W A;  5KEJ A;  3C7M A;  3V1W A;  4X43 A;  4G10 A;  3A2V A;  3F8U A;  4IBP A;  4IP1 A;  4NV2 A;  4K7I A;  4TKY A;  1GNW A;  4CW9 A;  4P3Y B;  1J08 A;  4G19 A;  2QGV A;  2HNL A;  1UN2 A;  3GUR A;  1EGR A;  3ZIT A;  4NWY A;  1VF1 A;  2M80 A;  2X99 A;  4L0W A;  1ERV A;  11GS A;  2K8V A;  4KCA A;  1H4O A;  1BQ7 A;  3FR9 A;  3FZ5 A;  4TVE A;  1YZX A;  2OE0 A;  3F3Q A;  1TK0 B;  1ON4 A;  4TR4 A;  4V2L A;  3DML A;  4IKH A;  3QOU A;  2NDO A;  3LWA A;  4GSS A;  2OJL A;  4DSQ A;  6GSY A;  2H70 A;  4NHZ A;  2J9H A;  13GS A;  2X8G A;  6GSV A;  1W89 A;  4PXO A;  1KBN A;  3A2X A;  2LJK A;  1SK0 A;  3R2Q A;  3KCM A;  1XWG A;  2DMM A;  5G5F A;  1V2A A;  6GSS A;  1OC3 A;  3F4R A;  2VM2 A;  1M7T A;  3IDV A;  1CQG A;  3GMF A;  1A2M A;  4KW6 A;  2DJJ A;  3IRA A;  4GRF A;  1XZO A;  2H1B A;  1QGV A;  4KSO A;  2PBJ A;  1HNB A;  4FYC A;  2FA4 A;  3GRX A;  2H6Z A;  2H0H A;  1BJX A;  3L4N A;  1OVN A;  2VL2 A;  2KUC A;  2HSY A;  1B9Y C;  5H5R A;  1NSW A;  3LQ7 A;  3RBT A;  3P2A A;  4GQF A;  2H66 A;  1I5G A;  4PQH A;  3RPN A;  2FWE A;  2YJH A;  1A2L A;  3QDN A;  3ZML A;  3ZFB A;  1GRX A;  1MDK A;  3NZN A;  4Q5F A;  2BMX A;  4F0C A;  2LJA A;  5H5Q A;  1TU8 A;  2D2Z A;  2LS5 A;  4MF5 A;  1KTE A;  1AQW A;  3G9B A;  3ZZX A;  4GLT A;  16GS A;  4K8M A;  4MZW A;  5DBQ A;  2G0F A;  2FWH A;  5FWG A;  1JZW A;  1V9W A;  3UJ1 A;  2HZF A;  1TK8 B;  2F51 A;  3LYP A;  3TUE A;  1O85 A;  3H4K A;  3HHV A;  2GZP A;  5DQS A;  1SJZ A;  5EVO A;  2PVO C;  1PN9 A;  3CMI A;  1XW9 A;  3VWW A;  3W6G A;  1SD8 A;  3H93 A;  2H74 A;  1J0F A;  2H75 A;  4MH2 A;  4IJI A;  1DE1 A;  2C3Q A;  2IN3 A;  3KH7 A;  4OFN A;  1RK4 A;  4JR6 A;  5JCW A;  3EWL A;  3LSZ A;  1MD3 A;  4X0X A;  3WD6 A;  1EEM A;  4NHW A;  1T1V A;  3FR6 A;  3I6A A;  4ECJ A;  2H71 A;  4ZBD A;  3EUR A;  4EXJ A;  2FCH A;  4ZIL A;  6GST A;  3QAG A;  3GKM A;  3H1N A;  4EF0 A;  3D6I A;  4YAP A;  4MJE A;  4K6X A;  5IO2 A;  1QFN A;  3VPQ A;  4FO5 A;  2CZ3 A;  3HJO A;  1QMV A;  2RII A;  4IVF A;  2H1G A;  2O89 A;  3WGX A;  2LNS A;  5IQY A;  5ID2 A;  3W8J A;  1OC9 A;  2B5X A;  4ZL9 A;  2VAF A;  3A5W A;  1GTA A;  3QFB C;  2GZZ A;  2C0G A;  4HZ2 A;  1DUG A;  3HVX A;  1ABA A;  1VF2 A;  3TKP A;  1PSQ A;  4XRA A;  1R7H A;  4MAB A;  4GF0 A;  1V98 A;  12GS A;  3F0I A;  4ZB9 A;  5DVB A;  1T00 A;  3TGZ A;  1F3A A;  1PMT A;  2HT9 A;  1EZK A;  5HFG A;  2V6O A;  3TCO A;  1XIY A;  4OFM A;  3UBK A;  2XPE A;  5D9T A;  5H5S A;  4HDE A;  3W8S A;  6GSU A;  4F0B A;  1G7E A;  5D9W A;  1XCC A;  4JE1 A;  2HZE A;  5AIS A;  2OKA A;  3LYK A;  3M9J A;  1O73 A;  3C71 A;  5EPF A;  4PNG A;  4LLR A;  3D21 A;  2KHP A;  2PN8 A;  3KP8 A;  5D9X A;  2IFQ A;  1WRY A;  5DAL A;  3Q74 A;  4LMW A;  5G31 A;  1IYH A;  2CZ2 A;  2LKU A;  2C3N A;  1F37 A;  1NM3 A;  17GS A;  2I3Y A;  2L4C A;  4MDC A;  3VWV A;  3IE3 A;  1ST9 A;  1G7O A;  2P5R A;  5A4W A;  4TR0 A;  3ZRE A;  1FAA A;  4QL7 A;  2MMO A;  2L57 A;  5ECL B;  3QCP A;  5ID2 B;  2HFD A;  1ERW A;  1OC9 B;  2H6X A;  3IPZ A;  4KCE A;  3Q19 A;  2L59 A;  4KDX A;  4IJ3 A;  1FB0 A;  2O8V B;  5B8A A;  1AAZ A;  2HRN A;  4KA0 A;  1GL8 A;  4J2F A;  2TRX A;  1R5P A;  3ME7 A;  1X9S B;  3GN3 A;  1MD4 A;  1GUM A;  1U6T A;  1GUK A;  3F3R A;  3F9U A;  4BVX A;  1UC7 A;  1T8E B;  4K9Z A;  3GV1 A;  2HSH A;  1EOH A;  1A24 A;  4I2U A;  1WE0 A;  1ERT A;  4Q5N A;  4JED A;  1ZYE A;  4FH8 A;  1M2B A;  3CSI A;  1XBS A;  3PIN A;  18GS A;  2YWI A;  3UVH A;  4MZB A;  2HZE B;  3M0F A;  1YEX A;  3AY8 A;  1S3D A;  4LMV A;  1BAY A;  5HFI A;  4ZBB A;  3GFK A;  2IFQ B;  4KND A;  5B6M A;  1JZR A;  5DAL B;  4KGI A;  1NW2 A;  2P0G A;  3ZFL A;  3C8E A;  3ME8 A;  3FHK A;  4K0G A;  5JWO B;  4I97 A;  2EC4 A;  3MAK A;  1ACV A;  2PVQ A;  2CVD A;  5AGY A;  3UAR A;  1F6M C;  4PQI A;  2VD1 A;  1PL1 A;  4GCI A;  3BD2 A;  1F9M A;  2AB6 A;  1KNG A;  1S3C A;  3GA4 A;  5ECK B;  1U87 A;  1NHY A;  3BCI A;  2XBQ A;  3EMX A;  5DCG A;  3MDK A;  2QSI A;  5ELG A;  1DE2 A;  2VD0 A;  3LFL A;  3HYP A;  2F3M A;  2JZR A;  4TN8 A;  1TOF A;  3O3T A;  1TI1 A;  4L5O A;  4XIH A;  1YDK A;  3UIW A;  2CAQ A;  1B48 A;  4OWY A;  5L71 A;  3LXZ A;  3TDG A;  3VFI A;  2IL3 A;  5D9V A;  4PQ1 A;  5CRH A;  3TRP A;  1XXU A;  4NPB A;  3EYT A;  4GSN A;  3KTB A;  4V2M A;  5ENU A;  3VLN A;  4WKW A;  2OBI A;  4MPF A;  4PNF A;  2GST A;  2B1K A;  1RQM A;  2RM5 A;  5A4V A;  2GZY A;  2YPM A;  4PGT A;  4V1A p;  3KMO A;  2YWO A;  1HQO A;  2L5L A;  1QK8 A;  2R5G A;  3VPT A;  3L9S A;  5AIX A;  2JL4 A;  4XS1 A;  3WGD A;  2DJ3 A;  1EEJ A;  2VL9 A;  1XW6 A;  3ED3 A;  2F9S A;  2C4J A;  4AJ7 A;  3KXO A;  2C80 A;  2E2M A;  4OFT A;  3IR4 A;  2DSA A;  5J4U A;  2MMZ A;  4WEY A;  1X9W B;  4BA7 A;  1X0R A;  1TI3 A;  4L5L A;  1SKW B;  3H79 A;  2ZUP A;  3HD5 A;  1OC8 A;  3HZ8 A;  4IS0 A;  4HZ4 A;  1JLV A;  1HNC A;  1WJK A;  3HZ4 A;  1Z3E A;  4LA1 A;  4Z7X A;  1K0O A;  2RLI A;  3DXB A;  2P31 A;  2K8S A;  3FY7 A;  1KEB A;  2DML A;  2JSZ A;  5ABR A;  1GSS A;  3FKF A;  1PX6 A;  3KTL A;  2HXK A;  1G6W A;  2FHE A;  4WBR D;  1GSU A;  2MYG A;  1XVQ A;  1K0M A;  5E4W A;  3TKS C;  2X64 A;  3VK9 A;  3GL3 A;  1FW1 A;  1T3B A;  1XW5 A;  14GS A;  3DVW A;  2LEG A;  3QR6 A;  2PUK C;  2H8L A;  4FIW A;  1A0F A;  1XPV A;  1B9X C;  1W4V A;  1ZCP A;  1LBK A;  4IQ1 A;  2GQK A;  2R6K A;  1Z6M A;  4BPY A;  2VCT A;  3DRN A;  4KDY A;  3Q18 A;  4MCU A;  3TOT A;  2FWG A;  2XHF A;  3DD3 A;  3F63 A;  1PKW A;  4K1F A;  4MA9 A;  1E2Y A;  5C04 A;  4L8E A;  4ZB6 A;  4BWS A;  3UMA A;  5ECI B;  4MJC A;  4IP6 A;  2DJ1 A;  2L6C A;  5D93 A;  4K2D A;  3WT1 A;  1XWA A;  5HR1 A;  5HR3 A;  2LRT A;  3KP9 A;  3GH9 A;  3HDC A;  5CRE A;  5IOW A;  1EP7 A;  2H1A A;  1BX9 A;  6GSW A;  2LRN A;  3L0H A;  3RPP A;  2IWT A;  1NHO A;  5ECH B;  1JHB A;  5AIV A;  4HJM A;  2GVP A;  4ML1 A;  2YN1 A;  1A8Y A;  2N5F A;  5F05 A;  1SL0 B;  3HXS A;  2MBT A;  2PU9 C;  4O92 A;  4HQZ A;  4HEA 2;  1WPI A;  1Q98 A;  2IMF A;  3UOM A;  3I43 A;  1K3L A;  4MPG A;  1AC1 A;  2CV4 A;  3BJ5 A;  3US3 A;  2O87 A;  3K8N A;  2V6K A;  1ZYQ B;  4MLY A;  2GLR A;  4MF6 A;  8GSS A;  2GTU A;  3SBC A;  3D4M A;  3EMP A;  1IYI A;  4MZC A;  1SEN A;  1M2D A;  1QQ2 A;  5G1K A;  4GWR A;  2WUL A;  4AJ6 A;  3M8N A;  3LG6 A;  3ISO A;  4AGS A;  1SYX A;  3A2W A;  3ZTL A;  3FEU A;  22GS A;  2GDR A;  2YWM A;  4L0U A;  4HUA A;  4POK A;  4IW9 A;  1PX7 A;  2V2G A;  3H8Q A;  2HI7 A;  2FWF A;  2I9H A;  4ECI A;  5GZZ B;  1LJR A;  3TKS A;  4ZL8 A;  2B5E A;  4POM A;  4F2I A;  1GH2 A;  1Z5Y E;  2EIQ A;  2KLX A;  1BG5 A;  3E0U A;  4YQV A;  5JWQ B;  2LUS A;  4WR5 A;  5G30 A;  1YQ1 A;  5CO3 A;  2YCD A;  3NOF A;  2C0D A;  2VIM A;  4XTS A;  1G0T A;  1TRS A;  1K0A A;  4TR3 A;  3O76 A;  3D0Z A;  2L6D A;  2PER A;  3FRC A;  3DEX A;  9GSS A;  2YNX A;  2QKE A;  3GKN A;  3O6T A;  2MMA A;  1ZZY A;  3ZVJ A;  5DDL A;  4O5R A;  3FR3 A;  1V57 A;  1F2E A;  2RUF A;  2GQL A;  3G7J A;  2V1M A;  1K0D A;  3FZA A;  2H76 A;  2KOK A;  1I9D A;  2GT6 A;  1XWK A;  1SD9 A;  4O7H A;  2YP6 A;  3S9F A;  3TJF A;  1Y6E A;  1GLQ A;  1WOU A;  1GTI A;  2CAI A;  3TJJ A;  4WF4 A;  2I1U A;  1JFU A;  5E59 A;  2A2R A;  2FLS A;  1TTZ A;  2WZ9 A;  1TDI A;  3G7I A;  3LEF A;  1GSQ A;  1YJ6 A;  2LQQ A;  3QAW A;  1ZL9 A;  4WBJ A;  5DAK A;  2TIR A;  3F6D A;  4KX4 A;  2XPD A;  1E6B A;  1TJD A;  2E7P A;  3HVS A;  1SKR B;  4KDU A;  2C0E A;  5LCZ A;  1PGT A;  2L5O A;  3MNG A;  2DLX A;  2R4V A;  3TRX A;  1SL1 B;  4MJA A;  1Y25 A;  4MF7 A;  4ULX A;  3F6F A;  4GST A;  5KN0 A;  1F3B A;  2FNO A;  2TRC P;  4RQR A;  1X9M B;  1FOV A;  3A3T A;  1Q4J A;  2CX3 A;  3I9V 2;  2VUP A;  1AQX A;  3HJM A;  2AJQ B;  5HR2 A;  4TXV A;  3D5J A;  3C1S A;  1FVJ A;  1R5A A;  4RI7 A;  5DCH A;  4GTU A;  3D4T A;  4DEJ A;  3EU3 A;  4OO4 A;  1M9A A;  5ECO B;  2J23 A;  1GNE A;  1VF3 A;  1QXH A;  1B4Q A;  4EDY A;  2JSY A;  5IMD A;  2HYX A;  3UAP A;  4YH2 A;  1RW1 A;  5D73 A;  2CVB A;  3RHC A;  3J7Y k;  2VLU A;  4N0V A;  5KN3 A;  3CTF A;  1PKZ A;  4NV5 A;  1ZMA A;  1OYJ A;  5JCG A;  3UEM A;  3EU4 A;  3UVT A;  2VCQ A;  3CXG A;  2OAC A;  1TP9 A;  1AQV A;  4K0N A;  2JAD A;  4JZQ A;  2A4V A;  1WP0 A;  1GSE A;  2K18 A;  3WGE A;  3G7Y A;  3U6V A;  5JCU A;  2AAW A;  2XC2 A;  2DIZ A;  1ZOF A;  3NIV A;  1HD2 A;  5EL8 A;  5CRD A;  3I69 A;  3QAV A;  3HVV A;  4FYU A;  1EV4 A;  5FHI A;  1H75 A;  5GAP D;  2MMN A;  2WCI A;  2YZU A;  2O85 A;  3IK7 A;  1OE8 A;  4TOP A;  3FYG A;  2GSQ A;  2CT6 A;  3PH9 A;  1THO A;  2JZS A;  3APS A;  4E8H A;  1TK5 B;  1VRS D;  1U88 A;  4JBB A;  1A8L A;  5G1L A;  1XOA A;  3ERW A;  3KGK A;  4RUV A;  3JCM L;  1FVK A;  1OAZ A;  3TKS E;  1QUW A;  2NVL A;  1MTC A;  2YWN A;  2NTO A;  1X5E A;  1LU4 A;  4Q5Q A;  3GKK A;  3VWX A;  4D73 A;  4V2N A;  3APO A;  3HKR A;  1ERU A;  4K7O A;  2I81 A;  5HR0 A;  1A0R P;  1YKC A;  2ZCT A;  4PUR A;  1EWX A;  5D8I A;  5JWR B;  5IPH A;  3TB2 A;  5B6N A;  3GKX A;  1K0N A;  4ZB8 A;  3TJK A;  3ZYW A;  3PR8 A;  2M72 A;  2H19 A;  5IMV A;  3GUS A;  2IME A;  3IAS 2;  4HI7 A;  4POB A;  5B8B A;  3M3M A;  2R3X A;  3BBY A;  5F06 A;  5IPG A;  2EIO A;  2JAC A;  1SKS B;  3E3E A;  2V41 A;  3ZIV A;  2DBC A;  2P5Q A;  4HQS A;  3BCK A;  3QPM A;  2LJR A;  4EE0 A;  1VF4 A;  4V1A g;  4HJ2 A;  3MSZ A;  2FUG 2;  3M1G A;  4POL A;  3TJG A;  4PUA A;  5LNK e;  5FT3 A;  4YQM A;  3U5R E;  3GYK A;  2VCW A;  1N8J A;  2YV7 A;  2CX4 A;  3DYR A;  3VUR A;  3RHB A;  5HQP A;  5G2Z A;  1M99 A;  2B7K A;  2IMI A;  3KJY A;  1SL2 B;  4I2T A;  3CSH A;  1JZO A;  3IOS A;  2M46 A;  1PD2 1;  5A5K A;  4IEL A;  4PUF C;  4I6X A;  2H6Y A;  3KIJ A;  4KE3 A;  3KMN A;  3N9J A;  4D73 B;  4XHM A;  2AYT A;  1EGO A;  4DSS A;  3HCZ A;  1DSB A;  4BWQ A;  1GTB A;  2YOI A;  1HYU A;  1SJI A;  4MH3 A;  4MJB A;  1AIU A;  1FB6 A;  1SK2 A;  4OCE A;  5CP1 A;  2Z9S A;  4G2E A;  4IHU A;  4OO5 A;  3P90 A;  4F9Z A;  3VI7 A;  4N11 A;  4YQU A;  5IMA A;  5DJL A;  1TRW A;  3E9J B;  1EP8 A;  3M9K A;  4HS1 A;  4I8B A;  5IO0 A;  3CRU A;  2YZH A;  1S3A A;  7GSS A;  4MK3 A;  1WIK A;  1WMJ A;  5AN1 A;  3UL3 A;  4CDO A;  4ML6 A;  2X8H A;  1K0C A;  2GSS A;  4E8E A;  2H72 A;  4ZBA A;  1YKA A;  1XWC A;  4X1U A;  4AJ8 A;  2AV4 A;  1T7P B;  2F8A A;  4YAV A;  5ELA A;  3FK8 A;  1XWB A;  4IQA A;  1N2A A;  3C1R A;  3QMX A;  4DSR A;  2I4A A;  1CQH A;  4JRR A;  3LOR A;  3ZLP A;  4MP4 A;  3IV4 A;  2C3T A;  5EY6 A;  3IC4 A;  3Q6O A; 
#chains in the Genus database with same CATH topology
 3HJP A;  1AW9 A;  1OKD A;  1JLW A;  1JZD A;  2VO4 A;  1ZGN A;  2C0F A;  1FHE A;  3BOA A;  1SK1 A;  2VCZ A;  3QD9 A;  4HOJ A;  1U3I A;  5C00 A;  1FOH A;  2H73 A;  2L4Q A;  5CNW A;  3ZRD A;  3LGC A;  4IGJ A;  4N0Z A;  3DIE A;  4DSS B;  4EL1 A;  4WXT A;  1WWJ A;  1XFL A;  1PL2 A;  2NPB A;  1FG4 A;  2F8F A;  4G0K A;  1K3Y A;  1TRV A;  1SU9 A;  3FW2 A;  4G9H A;  4ECB A;  2JU5 A;  2VM1 A;  2N5B A;  4J56 E;  4HU7 A;  2R2J A;  2BTO T;  4TRX A;  3DKS A;  2OE1 A;  4I5Q A;  4A5P A;  4EO3 A;  5J41 A;  1SJ6 A;  1USB A;  1A2J A;  5IMF A;  1FO5 A;  4EC0 A;  3KH9 A;  2C8U A;  1K0B A;  3PGT A;  2HE3 A;  5GST A;  3IBH A;  2N5A A;  1X5D A;  2ON5 A;  4ISD A;  4FQU A;  3FZ4 A;  2B1L A;  20GS A;  3LXT A;  4F82 A;  4ECC A;  5DQY A;  5LD0 A;  1MDI A;  1Z7R A;  1GP1 A;  3L78 A;  2LTK A;  2ALB A;  4KSM A;  1PA3 A;  2H1D A;  2IMD A;  3ZL5 A;  5IOX A;  5J3R A;  2ES7 A;  3GH6 A;  2HRA A;  2IIY A;  1O8X A;  2X8C A;  4TXO A;  2JZT A;  1HNA A;  2PMT A;  3F4T A;  3CBU A;  3APQ A;  3DGQ A;  5J9B A;  2PWJ A;  2FD3 A;  5A4U A;  1B8X A;  1O8W A;  1YF1 A;  1ML6 A;  3GNJ A;  2FGX A;  1G6Y A;  1R4W A;  1Z6N A;  2CA8 A;  2MZC A;  2V32 A;  1Z9H A;  3ERG A;  4DVC A;  2WS2 A;  1AXD A;  3L9U A;  3UBL A;  2VCV A;  4OCF A;  1O6J A;  3LW9 A;  5J5N A;  3HY2 A;  1A23 A;  1EOG A;  3GIX A;  4LL1 B;  1XOB A;  2GQM A;  2LST A;  5G5E A;  3L9V A;  5IMZ A;  2BJX A;  4ACS A;  2VLV A;  1TU7 A;  2R37 A;  1K3O A;  3GST A;  4KAE A;  4OMV A;  4NXI A;  2YAN A;  4ZIJ A;  3LJR A;  2K9F A;  3SWL A;  2PGT A;  1O81 A;  4EKZ A;  3DVX A;  4XRD A;  1Z7P A;  3MYD A;  6GSX A;  4KUN A;  2GT5 A;  3P7X A;  3CSJ A;  1GSY A;  2CQ9 A;  2GGT A;  5HFK A;  5IMC A;  2B5Y A;  2HLS A;  5F8B A;  2WFC A;  1S3R A;  4K7N A;  2HRF A;  3WT2 A;  4EVM A;  2GS3 A;  1X5C A;  3KZQ A;  4ZXG A;  4KB3 A;  4TXO B;  4ILF A;  5GAN D;  2LV3 A;  1MEK A;  2VLT A;  4BL7 A;  4KH7 A;  19GS A;  1URM A;  3MWH A;  4QL9 A;  1J9B A;  4GXZ A;  1UVZ A;  4GQC A;  3EVI A;  4OD7 A;  3IK9 A;  2EIR A;  1ILO A;  1TRU A;  4EUY A;  2IPA A;  2OAD A;  4TR1 A;  3GTU A;  4JU5 A;  2OE3 A;  2DJK A;  4WR4 A;  2VL3 A;  1MDJ A;  5GSS A;  2HSM A;  3IA1 A;  2AHE A;  4IN0 A;  1U3A A;  3OR5 A;  3TOU A;  1GUL A;  4WF5 A;  4K5S A;  1T4Y A;  3TKQ A;  4XS4 A;  4EIP A;  3CQF A;  4Z2R A;  1C72 A;  5D96 A;  1VGL A;  3FZ9 A;  4MMM A;  5CRG A;  1M3J A;  4H86 A;  2A2S A;  2VCX A;  3RAZ A;  2GSR A;  3F4S A;  1EV9 A;  1GSF A;  2LNT A;  2RM6 A;  2WRT A;  1V40 A;  2H30 A;  1TKD B;  2CVK A;  1GWC A;  4CY8 A;  3EIN A;  1TW9 A;  2RUE A;  1V58 A;  2DC5 A;  2QC7 A;  4O32 A;  2LQO A;  1O7U A;  1BED A;  2NBS A;  3TKR A;  2B7J A;  1M9B A;  4NAX A;  3CYN A;  3ZIJ A;  1SYR A;  4TW5 A;  2HRK A;  2WDU A;  1AUC A;  3GHA A;  5DAK B;  5ECP B;  3KM6 A;  5INY A;  1TXX A;  2FY6 A;  3KD0 A;  4ZL7 A;  5COH A;  2ZNM A;  1DBY A;  4ID0 A;  4FYB A;  3EE2 A;  1OKT A;  3ZMK A;  2YV9 A;  5ECQ B;  5ECR B;  2KP2 A;  2MBS A;  4F03 A;  2IJY A;  2ON7 A;  4BL7 B;  2O7K A;  1GSD A;  1YEP A;  2G2Q A;  2R0P A;  4LL4 B;  3KEB A;  3HA9 A;  2DJ2 A;  2E0Q A;  3QFA C;  2KP1 A;  3VI5 A;  1GLP A;  1B4P A;  1ZYP A;  2REM A;  2DIY A;  2H01 A;  2E2G A;  4TR1 B;  5ECN B;  2YJ7 A;  1GUH A;  4PX1 A;  3GTU B;  2B6M A;  4JR4 A;  3DWV A;  3GX8 A;  2B3S A;  1XVW A;  4RQX A;  2K6V A;  5IM9 A;  1PRX A;  5CRW A;  2C1Y A;  2H0G A;  3D22 A;  5F07 A;  4BVY A;  4XS4 B;  4NMU A;  3EC3 A;  2OBK A;  5KN2 A;  3WYW A;  3IAM 2;  5B7C A;  1BYE A;  2FA8 A;  4QQ7 A;  5CYY A;  3CRT A;  4XS6 A;  5J9C A;  1YF0 A;  4RI6 A;  3RDW A;  2WB9 A;  4Q5R A;  5IIZ A;  3CTG A;  2DKI A;  1GTU A;  2H0I A;  2XBI A;  3ZVJ D;  2A2P A;  2PPT A;  3J7Y b;  1T4Z A;  4J57 E;  2WGR A;  1R26 A;  1ZYN A;  3TJB A;  1OE7 A;  2OA7 A;  3GX0 A;  5ECS A;  2WJU A;  2IMK A;  4HU9 A;  5DJM A;  4WET A;  3TRQ A;  2VL2 C;  4AF2 A;  3IXR A;  4N10 A;  4CHS A;  1UA5 A;  2LRC A;  5F0G A;  3VWU A;  3C73 A;  1M2A A;  1M0U A;  4XCS A;  3GL5 A;  10GS A;  3ERF A;  1PQN A;  3IHQ A;  3GSS A;  5ECM B;  4N30 A;  3N5O A;  5KN1 A;  4EDZ A;  1THX A;  1YY7 A;  5CAX A;  2VOC A;  2DJ0 A;  2AUV A;  3P8W A;  5KEJ A;  5BRT A;  3C7M A;  3V1W A;  4X43 A;  4G10 A;  2A4H A;  3A2V A;  3F8U A;  4IBP A;  4IP1 A;  4NV2 A;  4K7I A;  4TKY A;  1GNW A;  4CW9 A;  4P3Y B;  1J08 A;  4G19 A;  2QGV A;  4BVY B;  2HNL A;  1UN2 A;  3GUR A;  1EGR A;  3ZIT A;  4NWY A;  1VF1 A;  2M80 A;  2X99 A;  4L0W A;  1ERV A;  11GS A;  2K8V A;  4KCA A;  1H4O A;  1BQ7 A;  3FR9 A;  3FZ5 A;  4TVE A;  1YZX A;  2OE0 A;  3F3Q A;  2UZ8 A;  1TK0 B;  1ON4 A;  4TR4 A;  2R0G A;  4V2L A;  3DML A;  4IKH A;  3QOU A;  2NDO A;  3LWA A;  4GSS A;  2OJL A;  4DSQ A;  6GSY A;  2H70 A;  4NHZ A;  4K5R A;  2J9H A;  13GS A;  2X8G A;  6GSV A;  1W89 A;  4PXO A;  1KBN A;  3A2X A;  2LJK A;  1SK0 A;  3R2Q A;  3KCM A;  1XWG A;  2DMM A;  5G5F A;  1V2A A;  6GSS A;  1OC3 A;  3F4R A;  2VM2 A;  1M7T A;  3IDV A;  1CQG A;  3GMF A;  1A2M A;  4KW6 A;  2DJJ A;  3IRA A;  4GRF A;  1XZO A;  2H1B A;  1QGV A;  4KSO A;  2PBJ A;  1HNB A;  4FYC A;  2FA4 A;  3GRX A;  2H6Z A;  2H0H A;  1BJX A;  3L4N A;  1OVN A;  2VL2 A;  2KUC A;  2HSY A;  4PTS A;  1B9Y C;  5H5R A;  1NSW A;  3LQ7 A;  3RBT A;  3P2A A;  4GQF A;  2H66 A;  5KOX A;  1I5G A;  4PQH A;  3RPN A;  2FWE A;  2YJH A;  1A2L A;  3QDN A;  3ZML A;  3ZFB A;  1GRX A;  1MDK A;  3NZN A;  4Q5F A;  2BMX A;  4F0C A;  2LJA A;  5H5Q A;  1TU8 A;  2D2Z A;  2LS5 A;  4MF5 A;  1KTE A;  1AQW A;  3G9B A;  3ZZX A;  4GLT A;  16GS A;  4K8M A;  4MZW A;  5DBQ A;  2G0F A;  2FWH A;  5FWG A;  1JZW A;  1V9W A;  3UJ1 A;  2HZF A;  1TK8 B;  2F51 A;  3LYP A;  3TUE A;  1O85 A;  5KOW A;  3H4K A;  3HHV A;  2GZP A;  5DQS A;  1SJZ A;  5EVO A;  2PVO C;  1PN9 A;  3CMI A;  1XW9 A;  3VWW A;  3W6G A;  1SD8 A;  3H93 A;  2H74 A;  1J0F A;  2H75 A;  4MH2 A;  4IJI A;  1DE1 A;  2C3Q A;  2IN3 A;  3KH7 A;  4OFN A;  1RK4 A;  4JR6 A;  5JCW A;  3EWL A;  3LSZ A;  1MD3 A;  4X0X A;  3WD6 A;  1EEM A;  4NHW A;  1T1V A;  3FR6 A;  3I6A A;  4ECJ A;  2H71 A;  4ZBD A;  3EUR A;  4EXJ A;  2FCH A;  4ZIL A;  6GST A;  3QAG A;  3GKM A;  3H1N A;  4EF0 A;  3D6I A;  4YAP A;  4MJE A;  4K6X A;  5IO2 A;  1QFN A;  3VPQ A;  3IHG A;  4FO5 A;  2CZ3 A;  3HJO A;  1QMV A;  2X4A A;  2RII A;  4IVF A;  2H1G A;  2O89 A;  3WGX A;  2LNS A;  1M3I A;  5IQY A;  5ID2 A;  3W8J A;  1OC9 A;  2B5X A;  4ZL9 A;  2VAF A;  3A5W A;  1GTA A;  3QFB C;  2GZZ A;  2C0G A;  4HZ2 A;  1DUG A;  3HVX A;  1ABA A;  1VF2 A;  3TKP A;  1PSQ A;  4XRA A;  1R7H A;  4MAB A;  4GF0 A;  1V98 A;  12GS A;  3F0I A;  4ZB9 A;  5DVB A;  1T00 A;  3TGZ A;  1F3A A;  1PMT A;  2HT9 A;  1EZK A;  5HFG A;  2V6O A;  3TCO A;  1XIY A;  4OFM A;  3UBK A;  2XPE A;  5D9T A;  5H5S A;  4HDE A;  3W8S A;  6GSU A;  4F0B A;  1G7E A;  5D9W A;  1XCC A;  4JE1 A;  2HZE A;  5AIS A;  2OKA A;  3LYK A;  3M9J A;  1O73 A;  3C71 A;  4O5U A;  5EPF A;  4PNG A;  4LLR A;  3D21 A;  2KHP A;  2PN8 A;  3KP8 A;  5D9X A;  2IFQ A;  1WRY A;  4O5Q A;  5DAL A;  3Q74 A;  4LMW A;  5G31 A;  1IYH A;  2CZ2 A;  2LKU A;  2C3N A;  1F37 A;  1NM3 A;  17GS A;  2I3Y A;  2L4C A;  4MDC A;  3VWV A;  3IE3 A;  1ST9 A;  1G7O A;  2P5R A;  5A4W A;  4TR0 A;  3ZRE A;  3HVN A;  1FAA A;  4QL7 A;  2MMO A;  2L57 A;  5ECL B;  3QCP A;  5ID2 B;  2HFD A;  1ERW A;  1OC9 B;  2H6X A;  3IPZ A;  4KCE A;  4G0L A;  3Q19 A;  2L59 A;  4KDX A;  4IJ3 A;  1FB0 A;  2O8V B;  5B8A A;  1AAZ A;  2HRN A;  4KA0 A;  1GL8 A;  4J2F A;  4YKG A;  2TRX A;  1R5P A;  3ME7 A;  1X9S B;  3GN3 A;  1MD4 A;  1GUM A;  1U6T A;  1GUK A;  3F3R A;  3F9U A;  4BVX A;  1UC7 A;  1T8E B;  4K9Z A;  3GV1 A;  2HSH A;  1EOH A;  1A24 A;  4I2U A;  4X4J A;  1WE0 A;  1ERT A;  4Q5N A;  4JED A;  1ZYE A;  4FH8 A;  2DKH A;  1M2B A;  3CSI A;  1XBS A;  3PIN A;  18GS A;  2YWI A;  3UVH A;  4MZB A;  2HZE B;  3M0F A;  1YEX A;  3AY8 A;  1S3D A;  4LMV A;  1BAY A;  5HFI A;  4ZBB A;  3GFK A;  2IFQ B;  4G0I A;  4KND A;  5B6M A;  1JZR A;  5DAL B;  4KGI A;  1NW2 A;  2P0G A;  3ZFL A;  3C8E A;  3ME8 A;  3FHK A;  4K0G A;  5JWO B;  4I97 A;  2EC4 A;  3MAK A;  1ACV A;  2PVQ A;  2CVD A;  5AGY A;  3UAR A;  1F6M C;  4PQI A;  2VD1 A;  1PL1 A;  4GCI A;  3BD2 A;  1F9M A;  2AB6 A;  1KNG A;  1S3C A;  3GA4 A;  5ECK B;  1U87 A;  1NHY A;  3BCI A;  2XBQ A;  3EMX A;  5DCG A;  3FMW A;  3MDK A;  2QSI A;  5ELG A;  1DE2 A;  2VD0 A;  3LFL A;  3HYP A;  2F3M A;  2JZR A;  4TN8 A;  1TOF A;  3O3T A;  1TI1 A;  4L5O A;  4XIH A;  1YDK A;  3UIW A;  4CY6 A;  2QA1 A;  2CAQ A;  1B48 A;  4OWY A;  5L71 A;  3LXZ A;  3TDG A;  3VFI A;  2IL3 A;  5D9V A;  4PQ1 A;  5CRH A;  3TRP A;  1XXU A;  4BVX B;  4NPB A;  3EYT A;  4GSN A;  3KTB A;  4V2M A;  5ENU A;  3VLN A;  4WKW A;  2OBI A;  4MPF A;  4PNF A;  2GST A;  2B1K A;  1RQM A;  2RM5 A;  5A4V A;  2GZY A;  2YPM A;  4PGT A;  4V1A p;  3KMO A;  2YWO A;  1HQO A;  2L5L A;  1QK8 A;  2R5G A;  3VPT A;  3L9S A;  5AIX A;  2JL4 A;  4XS1 A;  3WGD A;  2DJ3 A;  1EEJ A;  2VL9 A;  1XW6 A;  3ED3 A;  2F9S A;  2C4J A;  4AJ7 A;  3KXO A;  2C80 A;  2E2M A;  4OFT A;  3IR4 A;  2DSA A;  5J4U A;  2MMZ A;  4WEY A;  1X9W B;  4ICY A;  4BA7 A;  1X0R A;  1TI3 A;  4L5L A;  1SKW B;  3H79 A;  2ZUP A;  3HD5 A;  1OC8 A;  3HZ8 A;  4IS0 A;  4HZ4 A;  1JLV A;  1HNC A;  1WJK A;  3HZ4 A;  1Z3E A;  4LA1 A;  4Z7X A;  1K0O A;  2RLI A;  3DXB A;  2P31 A;  2K8S A;  3FY7 A;  1KEB A;  2DML A;  2JSZ A;  5ABR A;  1GSS A;  3FKF A;  1PX6 A;  3KTL A;  2HXK A;  1G6W A;  2FHE A;  4WBR D;  1GSU A;  2MYG A;  1XVQ A;  1K0M A;  5E4W A;  3TKS C;  2X64 A;  3VK9 A;  3GL3 A;  1FW1 A;  1T3B A;  1XW5 A;  14GS A;  3DVW A;  2LEG A;  3QR6 A;  4Z2T A;  2PUK C;  2H8L A;  4FIW A;  1A0F A;  2QA2 A;  1XPV A;  1B9X C;  1W4V A;  1ZCP A;  1LBK A;  4IQ1 A;  2GQK A;  2R6K A;  1Z6M A;  4BPY A;  2VCT A;  3DRN A;  4KDY A;  3Q18 A;  4MCU A;  3TOT A;  2FWG A;  2XHF A;  3DD3 A;  3F63 A;  3IC8 A;  1PKW A;  4K1F A;  4MA9 A;  1E2Y A;  5C04 A;  4L8E A;  4ZB6 A;  4BWS A;  3UMA A;  5ECI B;  4MJC A;  4IP6 A;  2DJ1 A;  2L6C A;  5D93 A;  4K2D A;  3WT1 A;  1XWA A;  5HR1 A;  5HR3 A;  2LRT A;  3KP9 A;  3GH9 A;  3HDC A;  5CRE A;  5IOW A;  1EP7 A;  2H1A A;  1BX9 A;  6GSW A;  2LRN A;  3L0H A;  3RPP A;  2IWT A;  1NHO A;  5ECH B;  1JHB A;  5AIV A;  4HJM A;  2GVP A;  4ML1 A;  2YN1 A;  1A8Y A;  2N5F A;  5F05 A;  1SL0 B;  3HXS A;  2MBT A;  2PU9 C;  4O92 A;  4HQZ A;  4HEA 2;  1WPI A;  1Q98 A;  2IMF A;  3UOM A;  3I43 A;  1K3L A;  4MPG A;  1AC1 A;  2CV4 A;  3BJ5 A;  3US3 A;  2O87 A;  3K8N A;  2V6K A;  1ZYQ B;  4MLY A;  2GLR A;  4MF6 A;  8GSS A;  2GTU A;  3SBC A;  3D4M A;  3EMP A;  1IYI A;  4MZC A;  1SEN A;  1M2D A;  1QQ2 A;  5G1K A;  4GWR A;  2WUL A;  4AJ6 A;  3M8N A;  3LG6 A;  3ISO A;  4AGS A;  1SYX A;  3A2W A;  3ZTL A;  3FEU A;  1PFO A;  22GS A;  3A5I A;  2GDR A;  2YWM A;  4EIQ A;  4L0U A;  4HUA A;  4POK A;  4IW9 A;  1PX7 A;  2V2G A;  3H8Q A;  2HI7 A;  2FWF A;  2I9H A;  4ECI A;  5GZZ B;  1LJR A;  3TKS A;  4ZL8 A;  2B5E A;  4POM A;  4F2I A;  1GH2 A;  1Z5Y E;  2EIQ A;  2KLX A;  1BG5 A;  3E0U A;  4YQV A;  5JWQ B;  2LUS A;  4WR5 A;  5G30 A;  1YQ1 A;  5CO3 A;  2YCD A;  3NOF A;  2C0D A;  2VIM A;  4XTS A;  1G0T A;  1TRS A;  4K2X A;  4TR3 A;  3O76 A;  1K0A A;  3D0Z A;  2L6D A;  2PER A;  3FRC A;  3DEX A;  9GSS A;  2YNX A;  2QKE A;  3GKN A;  3O6T A;  2MMA A;  1ZZY A;  3ZVJ A;  5DDL A;  4O5R A;  3FR3 A;  1V57 A;  1F2E A;  2RUF A;  2GQL A;  3G7J A;  2V1M A;  1K0D A;  3FZA A;  2H76 A;  2KOK A;  1I9D A;  2GT6 A;  1XWK A;  1SD9 A;  4O7H A;  2YP6 A;  3S9F A;  3TJF A;  1Y6E A;  1GLQ A;  1WOU A;  1GTI A;  2CAI A;  3TJJ A;  4WF4 A;  2I1U A;  1JFU A;  5E59 A;  2A2R A;  2FLS A;  1TTZ A;  2WZ9 A;  1TDI A;  3G7I A;  3LEF A;  1GSQ A;  1YJ6 A;  2LQQ A;  3QAW A;  1ZL9 A;  4WBJ A;  5DAK A;  2TIR A;  3F6D A;  4KX4 A;  2XPD A;  1E6B A;  1TJD A;  2E7P A;  3HVS A;  1SKR B;  4KDU A;  2C0E A;  5LCZ A;  1PGT A;  2L5O A;  3MNG A;  4KF9 A;  2DLX A;  2R4V A;  3TRX A;  1SL1 B;  1PN0 A;  4MJA A;  1Y25 A;  4MF7 A;  4ULX A;  4Z2U A;  3F6F A;  4GST A;  5KN0 A;  1F3B A;  2FNO A;  2TRC P;  4RQR A;  1X9M B;  1FOV A;  3A3T A;  1Q4J A;  2CX3 A;  3I9V 2;  2VUP A;  4USS A;  1AQX A;  3HJM A;  2AJQ B;  5HR2 A;  4TXV A;  3D5J A;  3C1S A;  1FVJ A;  1R5A A;  4RI7 A;  5DCH A;  4GTU A;  3D4T A;  4DEJ A;  3EU3 A;  4OO4 A;  1M9A A;  4MNN A;  5ECO B;  2J23 A;  1GNE A;  1VF3 A;  1QXH A;  1B4Q A;  4EDY A;  2JSY A;  5IMD A;  2HYX A;  3UAP A;  4YH2 A;  1RW1 A;  5D73 A;  2CVB A;  3RHC A;  3J7Y k;  2VLU A;  4N0V A;  5KN3 A;  3CTF A;  1PKZ A;  4NV5 A;  1ZMA A;  1OYJ A;  5JCG A;  3UEM A;  3EU4 A;  3UVT A;  2VCQ A;  3CXG A;  2OAC A;  1TP9 A;  1AQV A;  4K0N A;  2JAD A;  4JZQ A;  5BMU A;  2A4V A;  1WP0 A;  1GSE A;  2K18 A;  3WGE A;  3G7Y A;  3U6V A;  5JCU A;  3MIX A;  2AAW A;  2XC2 A;  2DIZ A;  1ZOF A;  3NIV A;  1HD2 A;  2R0C A;  5EL8 A;  5CRD A;  3I69 A;  3QAV A;  3HVV A;  4FYU A;  1EV4 A;  5FHI A;  1H75 A;  5GAP D;  2MMN A;  2WCI A;  2YZU A;  2O85 A;  3IK7 A;  1OE8 A;  4TOP A;  3FYG A;  2GSQ A;  2CT6 A;  3PH9 A;  1THO A;  2JZS A;  3APS A;  4E8H A;  1TK5 B;  1VRS D;  1U88 A;  4JBB A;  1A8L A;  5G1L A;  1XOA A;  3ERW A;  3KGK A;  4RUV A;  3JCM L;  1FVK A;  1OAZ A;  3TKS E;  1QUW A;  2NVL A;  1MTC A;  2YWN A;  2NTO A;  1X5E A;  1LU4 A;  4Q5Q A;  3GKK A;  3VWX A;  4D73 A;  4V2N A;  3APO A;  3HKR A;  1ERU A;  4K7O A;  2I81 A;  5HR0 A;  1A0R P;  1YKC A;  2ZCT A;  4PUR A;  1EWX A;  4BIK A;  5D8I A;  5JWR B;  5IPH A;  3TB2 A;  5B6N A;  3GKX A;  1K0N A;  4ZB8 A;  3TJK A;  3ZYW A;  3PR8 A;  2M72 A;  2H19 A;  5IMV A;  3GUS A;  2IME A;  3IAS 2;  4HI7 A;  4POB A;  5B8B A;  3M3M A;  2R3X A;  3BBY A;  5F06 A;  5IPG A;  2EIO A;  2JAC A;  1SKS B;  3E3E A;  2V41 A;  4YKF A;  3ZIV A;  2DBC A;  2P5Q A;  4HQS A;  3BCK A;  3QPM A;  2LJR A;  4EE0 A;  1VF4 A;  4V1A g;  4HJ2 A;  3MSZ A;  2FUG 2;  3M1G A;  4POL A;  3TJG A;  4PUA A;  5LNK e;  5FT3 A;  4YQM A;  3U5R E;  3GYK A;  2VCW A;  3EPT A;  1XG8 A;  1N8J A;  2YV7 A;  2CX4 A;  3DYR A;  3VUR A;  3RHB A;  5HQP A;  5G2Z A;  1M99 A;  2B7K A;  2IMI A;  3KJY A;  1SL2 B;  4I2T A;  3CSH A;  1JZO A;  3IOS A;  2M46 A;  1PD2 1;  5A5K A;  4IEL A;  4PUF C;  4I6X A;  2H6Y A;  3KIJ A;  4KE3 A;  3KMN A;  3N9J A;  4D73 B;  4XHM A;  2AYT A;  1EGO A;  4DSS A;  3HCZ A;  1DSB A;  4BWQ A;  1GTB A;  2YOI A;  1HYU A;  1SJI A;  4MH3 A;  4MJB A;  1AIU A;  1FB6 A;  1SK2 A;  4OCE A;  5CP1 A;  2Z9S A;  4G2E A;  4IHU A;  4OO5 A;  3P90 A;  4F9Z A;  3VI7 A;  4N11 A;  4YQU A;  5IMA A;  5DJL A;  1TRW A;  3E9J B;  1EP8 A;  3M9K A;  4HS1 A;  4I8B A;  5IO0 A;  3CRU A;  2X49 A;  2YZH A;  1S3A A;  7GSS A;  4MK3 A;  1WIK A;  1WMJ A;  5AN1 A;  3UL3 A;  3R3E A;  4CDO A;  4ML6 A;  3PPU A;  2X8H A;  1K0C A;  2GSS A;  4E8E A;  2H72 A;  4ZBA A;  1YKA A;  1XWC A;  4X1U A;  4AJ8 A;  2AV4 A;  1T7P B;  2F8A A;  4YAV A;  5ELA A;  3FK8 A;  1XWB A;  4IQA A;  1N2A A;  3C1R A;  4HSC X;  3QMX A;  4DSR A;  2I4A A;  1CQH A;  4JRR A;  3LOR A;  3ZLP A;  4MP4 A;  3IV4 A;  2C3T A;  5EY6 A;  3IC4 A;  3Q6O A; 
#chains in the Genus database with same CATH homology
 3HJP A;  1AW9 A;  1OKD A;  1JLW A;  1JZD A;  2VO4 A;  1ZGN A;  2C0F A;  1FHE A;  3BOA A;  1SK1 A;  2VCZ A;  3QD9 A;  4HOJ A;  1U3I A;  5C00 A;  1FOH A;  2H73 A;  2L4Q A;  5CNW A;  3ZRD A;  3LGC A;  4IGJ A;  4N0Z A;  3DIE A;  4DSS B;  4EL1 A;  4WXT A;  1WWJ A;  1XFL A;  1PL2 A;  2NPB A;  1FG4 A;  2F8F A;  4G0K A;  1K3Y A;  1TRV A;  1SU9 A;  3FW2 A;  4G9H A;  4ECB A;  2JU5 A;  2VM1 A;  2N5B A;  4J56 E;  4HU7 A;  2R2J A;  2BTO T;  4TRX A;  3DKS A;  2OE1 A;  4I5Q A;  4A5P A;  4EO3 A;  5J41 A;  1SJ6 A;  1USB A;  1A2J A;  5IMF A;  1FO5 A;  4EC0 A;  3KH9 A;  2C8U A;  1K0B A;  3PGT A;  2HE3 A;  5GST A;  3IBH A;  2N5A A;  1X5D A;  2ON5 A;  4ISD A;  4FQU A;  3FZ4 A;  2B1L A;  20GS A;  3LXT A;  4F82 A;  4ECC A;  5DQY A;  5LD0 A;  1MDI A;  1Z7R A;  1GP1 A;  3L78 A;  2LTK A;  2ALB A;  4KSM A;  1PA3 A;  2H1D A;  2IMD A;  3ZL5 A;  5IOX A;  5J3R A;  2ES7 A;  3GH6 A;  2HRA A;  2IIY A;  1O8X A;  2X8C A;  4TXO A;  2JZT A;  1HNA A;  2PMT A;  3F4T A;  3CBU A;  3APQ A;  3DGQ A;  5J9B A;  2PWJ A;  2FD3 A;  5A4U A;  1B8X A;  1O8W A;  1YF1 A;  1ML6 A;  3GNJ A;  2FGX A;  1G6Y A;  1R4W A;  1Z6N A;  2CA8 A;  2MZC A;  2V32 A;  1Z9H A;  3ERG A;  4DVC A;  2WS2 A;  1AXD A;  3L9U A;  3UBL A;  2VCV A;  4OCF A;  1O6J A;  3LW9 A;  5J5N A;  3HY2 A;  1A23 A;  1EOG A;  3GIX A;  4LL1 B;  1XOB A;  2GQM A;  2LST A;  5G5E A;  3L9V A;  5IMZ A;  2BJX A;  4ACS A;  2VLV A;  1TU7 A;  2R37 A;  1K3O A;  3GST A;  4KAE A;  4OMV A;  4NXI A;  2YAN A;  4ZIJ A;  3LJR A;  2K9F A;  3SWL A;  2PGT A;  1O81 A;  4EKZ A;  3DVX A;  4XRD A;  1Z7P A;  3MYD A;  6GSX A;  4KUN A;  2GT5 A;  3P7X A;  3CSJ A;  1GSY A;  2CQ9 A;  2GGT A;  5HFK A;  5IMC A;  2B5Y A;  2HLS A;  5F8B A;  2WFC A;  4K7N A;  2HRF A;  3WT2 A;  4EVM A;  2GS3 A;  1X5C A;  3KZQ A;  4ZXG A;  4KB3 A;  4TXO B;  4ILF A;  5GAN D;  2LV3 A;  1MEK A;  2VLT A;  4BL7 A;  4KH7 A;  19GS A;  1URM A;  3MWH A;  4QL9 A;  1J9B A;  4GXZ A;  1UVZ A;  4GQC A;  3EVI A;  4OD7 A;  3IK9 A;  2EIR A;  1ILO A;  1TRU A;  4EUY A;  2IPA A;  2OAD A;  4TR1 A;  3GTU A;  4JU5 A;  2OE3 A;  2DJK A;  4WR4 A;  2VL3 A;  1MDJ A;  5GSS A;  2HSM A;  3IA1 A;  2AHE A;  4IN0 A;  1U3A A;  3OR5 A;  3TOU A;  1GUL A;  4WF5 A;  4K5S A;  1T4Y A;  3TKQ A;  4XS4 A;  4EIP A;  4Z2R A;  1C72 A;  5D96 A;  1VGL A;  3FZ9 A;  4MMM A;  5CRG A;  4H86 A;  2A2S A;  2VCX A;  3RAZ A;  2GSR A;  3F4S A;  1EV9 A;  1GSF A;  2LNT A;  2RM6 A;  2WRT A;  1V40 A;  2H30 A;  1TKD B;  2CVK A;  1GWC A;  4CY8 A;  3EIN A;  1TW9 A;  2RUE A;  1V58 A;  2DC5 A;  2QC7 A;  4O32 A;  2LQO A;  1O7U A;  1BED A;  2NBS A;  3TKR A;  2B7J A;  1M9B A;  4NAX A;  3CYN A;  3ZIJ A;  1SYR A;  4TW5 A;  2HRK A;  2WDU A;  1AUC A;  3GHA A;  5DAK B;  5ECP B;  3KM6 A;  5INY A;  1TXX A;  2FY6 A;  3KD0 A;  4ZL7 A;  5COH A;  2ZNM A;  1DBY A;  4ID0 A;  4FYB A;  3EE2 A;  1OKT A;  3ZMK A;  2YV9 A;  5ECQ B;  5ECR B;  2KP2 A;  2MBS A;  4F03 A;  2IJY A;  2ON7 A;  4BL7 B;  2O7K A;  1GSD A;  1YEP A;  2G2Q A;  2R0P A;  4LL4 B;  3KEB A;  3HA9 A;  2DJ2 A;  2E0Q A;  3QFA C;  2KP1 A;  3VI5 A;  1GLP A;  1B4P A;  1ZYP A;  2REM A;  2DIY A;  2H01 A;  2E2G A;  4TR1 B;  5ECN B;  2YJ7 A;  1GUH A;  4PX1 A;  3GTU B;  2B6M A;  4JR4 A;  3DWV A;  3GX8 A;  2B3S A;  1XVW A;  4RQX A;  2K6V A;  5IM9 A;  1PRX A;  5CRW A;  2C1Y A;  2H0G A;  3D22 A;  5F07 A;  4BVY A;  4XS4 B;  4NMU A;  3EC3 A;  2OBK A;  5KN2 A;  3WYW A;  3IAM 2;  5B7C A;  1BYE A;  2FA8 A;  4QQ7 A;  5CYY A;  3CRT A;  4XS6 A;  5J9C A;  1YF0 A;  4RI6 A;  3RDW A;  2WB9 A;  4Q5R A;  5IIZ A;  3CTG A;  2DKI A;  1GTU A;  2H0I A;  2XBI A;  3ZVJ D;  2A2P A;  2PPT A;  3J7Y b;  1T4Z A;  4J57 E;  2WGR A;  1R26 A;  1ZYN A;  3TJB A;  1OE7 A;  2OA7 A;  3GX0 A;  5ECS A;  2WJU A;  2IMK A;  4HU9 A;  5DJM A;  4WET A;  3TRQ A;  2VL2 C;  4AF2 A;  3IXR A;  4N10 A;  4CHS A;  1UA5 A;  2LRC A;  5F0G A;  3VWU A;  3C73 A;  1M2A A;  1M0U A;  4XCS A;  3GL5 A;  10GS A;  3ERF A;  1PQN A;  3IHQ A;  3GSS A;  5ECM B;  4N30 A;  3N5O A;  5KN1 A;  4EDZ A;  1THX A;  1YY7 A;  5CAX A;  2VOC A;  2DJ0 A;  2AUV A;  3P8W A;  5KEJ A;  5BRT A;  3C7M A;  3V1W A;  4X43 A;  4G10 A;  2A4H A;  3A2V A;  3F8U A;  4IBP A;  4IP1 A;  4NV2 A;  4K7I A;  4TKY A;  1GNW A;  4CW9 A;  4P3Y B;  1J08 A;  4G19 A;  2QGV A;  4BVY B;  2HNL A;  1UN2 A;  3GUR A;  1EGR A;  3ZIT A;  4NWY A;  1VF1 A;  2M80 A;  2X99 A;  4L0W A;  1ERV A;  11GS A;  2K8V A;  4KCA A;  1H4O A;  1BQ7 A;  3FR9 A;  3FZ5 A;  4TVE A;  1YZX A;  2OE0 A;  3F3Q A;  2UZ8 A;  1TK0 B;  1ON4 A;  4TR4 A;  2R0G A;  4V2L A;  3DML A;  4IKH A;  3QOU A;  2NDO A;  3LWA A;  4GSS A;  2OJL A;  4DSQ A;  6GSY A;  2H70 A;  4NHZ A;  4K5R A;  2J9H A;  13GS A;  2X8G A;  6GSV A;  1W89 A;  4PXO A;  1KBN A;  3A2X A;  2LJK A;  1SK0 A;  3R2Q A;  3KCM A;  1XWG A;  2DMM A;  5G5F A;  1V2A A;  6GSS A;  1OC3 A;  3F4R A;  2VM2 A;  1M7T A;  3IDV A;  1CQG A;  3GMF A;  1A2M A;  4KW6 A;  2DJJ A;  3IRA A;  4GRF A;  1XZO A;  2H1B A;  1QGV A;  4KSO A;  2PBJ A;  1HNB A;  4FYC A;  2FA4 A;  3GRX A;  2H6Z A;  2H0H A;  1BJX A;  3L4N A;  1OVN A;  2VL2 A;  2KUC A;  2HSY A;  4PTS A;  1B9Y C;  5H5R A;  1NSW A;  3LQ7 A;  3RBT A;  3P2A A;  4GQF A;  2H66 A;  5KOX A;  1I5G A;  4PQH A;  3RPN A;  2FWE A;  2YJH A;  1A2L A;  3QDN A;  3ZML A;  3ZFB A;  1GRX A;  1MDK A;  3NZN A;  4Q5F A;  2BMX A;  4F0C A;  2LJA A;  5H5Q A;  1TU8 A;  2D2Z A;  2LS5 A;  4MF5 A;  1KTE A;  1AQW A;  3G9B A;  3ZZX A;  4GLT A;  16GS A;  4K8M A;  4MZW A;  5DBQ A;  2G0F A;  2FWH A;  5FWG A;  1JZW A;  1V9W A;  3UJ1 A;  2HZF A;  1TK8 B;  2F51 A;  3LYP A;  3TUE A;  1O85 A;  5KOW A;  3H4K A;  3HHV A;  2GZP A;  5DQS A;  1SJZ A;  5EVO A;  2PVO C;  1PN9 A;  3CMI A;  1XW9 A;  3VWW A;  3W6G A;  1SD8 A;  3H93 A;  2H74 A;  1J0F A;  2H75 A;  4MH2 A;  4IJI A;  1DE1 A;  2C3Q A;  2IN3 A;  3KH7 A;  4OFN A;  1RK4 A;  4JR6 A;  5JCW A;  3EWL A;  3LSZ A;  1MD3 A;  4X0X A;  3WD6 A;  1EEM A;  4NHW A;  1T1V A;  3FR6 A;  3I6A A;  4ECJ A;  2H71 A;  4ZBD A;  3EUR A;  4EXJ A;  2FCH A;  4ZIL A;  6GST A;  3QAG A;  3GKM A;  3H1N A;  4EF0 A;  3D6I A;  4YAP A;  4MJE A;  4K6X A;  5IO2 A;  1QFN A;  3VPQ A;  3IHG A;  4FO5 A;  2CZ3 A;  3HJO A;  1QMV A;  2X4A A;  2RII A;  4IVF A;  2H1G A;  2O89 A;  3WGX A;  2LNS A;  5IQY A;  5ID2 A;  3W8J A;  1OC9 A;  2B5X A;  4ZL9 A;  2VAF A;  3A5W A;  1GTA A;  3QFB C;  2GZZ A;  2C0G A;  4HZ2 A;  1DUG A;  3HVX A;  1ABA A;  1VF2 A;  3TKP A;  1PSQ A;  4XRA A;  1R7H A;  4MAB A;  4GF0 A;  1V98 A;  12GS A;  3F0I A;  4ZB9 A;  5DVB A;  1T00 A;  3TGZ A;  1F3A A;  1PMT A;  2HT9 A;  1EZK A;  5HFG A;  2V6O A;  3TCO A;  1XIY A;  4OFM A;  3UBK A;  2XPE A;  5D9T A;  5H5S A;  4HDE A;  3W8S A;  6GSU A;  4F0B A;  1G7E A;  5D9W A;  1XCC A;  4JE1 A;  2HZE A;  5AIS A;  2OKA A;  3LYK A;  3M9J A;  1O73 A;  3C71 A;  4O5U A;  5EPF A;  4PNG A;  4LLR A;  3D21 A;  2KHP A;  2PN8 A;  3KP8 A;  5D9X A;  2IFQ A;  1WRY A;  4O5Q A;  5DAL A;  3Q74 A;  4LMW A;  5G31 A;  1IYH A;  2CZ2 A;  2LKU A;  2C3N A;  1F37 A;  1NM3 A;  17GS A;  2I3Y A;  2L4C A;  4MDC A;  3VWV A;  3IE3 A;  1ST9 A;  1G7O A;  2P5R A;  5A4W A;  4TR0 A;  3ZRE A;  1FAA A;  4QL7 A;  2MMO A;  2L57 A;  5ECL B;  3QCP A;  5ID2 B;  2HFD A;  1ERW A;  1OC9 B;  2H6X A;  3IPZ A;  4KCE A;  4G0L A;  3Q19 A;  2L59 A;  4KDX A;  4IJ3 A;  1FB0 A;  2O8V B;  5B8A A;  1AAZ A;  2HRN A;  4KA0 A;  1GL8 A;  4J2F A;  4YKG A;  2TRX A;  1R5P A;  3ME7 A;  1X9S B;  3GN3 A;  1MD4 A;  1GUM A;  1U6T A;  1GUK A;  3F3R A;  3F9U A;  4BVX A;  1UC7 A;  1T8E B;  4K9Z A;  3GV1 A;  2HSH A;  1EOH A;  1A24 A;  4I2U A;  4X4J A;  1WE0 A;  1ERT A;  4Q5N A;  4JED A;  1ZYE A;  4FH8 A;  2DKH A;  1M2B A;  3CSI A;  1XBS A;  3PIN A;  18GS A;  2YWI A;  3UVH A;  4MZB A;  2HZE B;  3M0F A;  1YEX A;  3AY8 A;  1S3D A;  4LMV A;  1BAY A;  5HFI A;  4ZBB A;  3GFK A;  2IFQ B;  4G0I A;  4KND A;  5B6M A;  1JZR A;  5DAL B;  4KGI A;  1NW2 A;  2P0G A;  3ZFL A;  3C8E A;  3ME8 A;  3FHK A;  4K0G A;  5JWO B;  4I97 A;  2EC4 A;  3MAK A;  1ACV A;  2PVQ A;  2CVD A;  5AGY A;  3UAR A;  1F6M C;  4PQI A;  2VD1 A;  1PL1 A;  4GCI A;  3BD2 A;  1F9M A;  2AB6 A;  1KNG A;  1S3C A;  3GA4 A;  5ECK B;  1U87 A;  1NHY A;  3BCI A;  2XBQ A;  3EMX A;  5DCG A;  3FMW A;  3MDK A;  2QSI A;  5ELG A;  1DE2 A;  2VD0 A;  3LFL A;  3HYP A;  2F3M A;  2JZR A;  4TN8 A;  1TOF A;  3O3T A;  1TI1 A;  4L5O A;  4XIH A;  1YDK A;  3UIW A;  4CY6 A;  2QA1 A;  2CAQ A;  1B48 A;  4OWY A;  5L71 A;  3LXZ A;  3TDG A;  3VFI A;  2IL3 A;  5D9V A;  4PQ1 A;  5CRH A;  3TRP A;  1XXU A;  4BVX B;  4NPB A;  3EYT A;  4GSN A;  3KTB A;  4V2M A;  5ENU A;  3VLN A;  4WKW A;  2OBI A;  4MPF A;  4PNF A;  2GST A;  2B1K A;  1RQM A;  2RM5 A;  5A4V A;  2GZY A;  2YPM A;  4PGT A;  4V1A p;  3KMO A;  2YWO A;  1HQO A;  2L5L A;  1QK8 A;  2R5G A;  3VPT A;  3L9S A;  5AIX A;  2JL4 A;  4XS1 A;  3WGD A;  2DJ3 A;  1EEJ A;  2VL9 A;  1XW6 A;  3ED3 A;  2F9S A;  2C4J A;  4AJ7 A;  3KXO A;  2C80 A;  2E2M A;  4OFT A;  3IR4 A;  2DSA A;  5J4U A;  2MMZ A;  4WEY A;  1X9W B;  4ICY A;  4BA7 A;  1X0R A;  1TI3 A;  4L5L A;  1SKW B;  3H79 A;  2ZUP A;  3HD5 A;  1OC8 A;  3HZ8 A;  4IS0 A;  4HZ4 A;  1JLV A;  1HNC A;  1WJK A;  3HZ4 A;  1Z3E A;  4LA1 A;  4Z7X A;  1K0O A;  2RLI A;  3DXB A;  2P31 A;  2K8S A;  3FY7 A;  1KEB A;  2DML A;  2JSZ A;  5ABR A;  1GSS A;  3FKF A;  1PX6 A;  3KTL A;  2HXK A;  1G6W A;  2FHE A;  4WBR D;  1GSU A;  2MYG A;  1XVQ A;  1K0M A;  5E4W A;  3TKS C;  2X64 A;  3VK9 A;  3GL3 A;  1FW1 A;  1T3B A;  1XW5 A;  14GS A;  3DVW A;  2LEG A;  3QR6 A;  4Z2T A;  2PUK C;  2H8L A;  4FIW A;  1A0F A;  2QA2 A;  1XPV A;  1B9X C;  1W4V A;  1ZCP A;  1LBK A;  4IQ1 A;  2GQK A;  2R6K A;  1Z6M A;  4BPY A;  2VCT A;  3DRN A;  4KDY A;  3Q18 A;  4MCU A;  3TOT A;  2FWG A;  2XHF A;  3DD3 A;  3F63 A;  3IC8 A;  1PKW A;  4K1F A;  4MA9 A;  1E2Y A;  5C04 A;  4L8E A;  4ZB6 A;  4BWS A;  3UMA A;  5ECI B;  4MJC A;  4IP6 A;  2DJ1 A;  2L6C A;  5D93 A;  4K2D A;  3WT1 A;  1XWA A;  5HR1 A;  5HR3 A;  2LRT A;  3KP9 A;  3GH9 A;  3HDC A;  5CRE A;  5IOW A;  1EP7 A;  2H1A A;  1BX9 A;  6GSW A;  2LRN A;  3L0H A;  3RPP A;  2IWT A;  1NHO A;  5ECH B;  1JHB A;  5AIV A;  4HJM A;  2GVP A;  4ML1 A;  2YN1 A;  1A8Y A;  2N5F A;  5F05 A;  1SL0 B;  3HXS A;  2MBT A;  2PU9 C;  4O92 A;  4HQZ A;  4HEA 2;  1WPI A;  1Q98 A;  2IMF A;  3UOM A;  3I43 A;  1K3L A;  4MPG A;  1AC1 A;  2CV4 A;  3BJ5 A;  3US3 A;  2O87 A;  3K8N A;  2V6K A;  1ZYQ B;  4MLY A;  2GLR A;  4MF6 A;  8GSS A;  2GTU A;  3SBC A;  3D4M A;  3EMP A;  1IYI A;  4MZC A;  1SEN A;  1M2D A;  1QQ2 A;  5G1K A;  4GWR A;  2WUL A;  4AJ6 A;  3M8N A;  3LG6 A;  3ISO A;  4AGS A;  1SYX A;  3A2W A;  3ZTL A;  3FEU A;  22GS A;  3A5I A;  2GDR A;  2YWM A;  4EIQ A;  4L0U A;  4HUA A;  4POK A;  4IW9 A;  1PX7 A;  2V2G A;  3H8Q A;  2HI7 A;  2FWF A;  2I9H A;  4ECI A;  5GZZ B;  1LJR A;  3TKS A;  4ZL8 A;  2B5E A;  4POM A;  4F2I A;  1GH2 A;  1Z5Y E;  2EIQ A;  2KLX A;  1BG5 A;  3E0U A;  4YQV A;  5JWQ B;  2LUS A;  4WR5 A;  5G30 A;  1YQ1 A;  5CO3 A;  2YCD A;  3NOF A;  2C0D A;  2VIM A;  4XTS A;  1G0T A;  1TRS A;  4K2X A;  4TR3 A;  3O76 A;  1K0A A;  3D0Z A;  2L6D A;  2PER A;  3FRC A;  3DEX A;  9GSS A;  2YNX A;  2QKE A;  3GKN A;  3O6T A;  2MMA A;  1ZZY A;  3ZVJ A;  5DDL A;  4O5R A;  3FR3 A;  1V57 A;  1F2E A;  2RUF A;  2GQL A;  3G7J A;  2V1M A;  1K0D A;  3FZA A;  2H76 A;  2KOK A;  1I9D A;  2GT6 A;  1XWK A;  1SD9 A;  4O7H A;  2YP6 A;  3S9F A;  3TJF A;  1Y6E A;  1GLQ A;  1WOU A;  1GTI A;  2CAI A;  3TJJ A;  4WF4 A;  2I1U A;  1JFU A;  5E59 A;  2A2R A;  2FLS A;  1TTZ A;  2WZ9 A;  1TDI A;  3G7I A;  3LEF A;  1GSQ A;  1YJ6 A;  2LQQ A;  3QAW A;  1ZL9 A;  4WBJ A;  5DAK A;  2TIR A;  3F6D A;  4KX4 A;  2XPD A;  1E6B A;  1TJD A;  2E7P A;  3HVS A;  1SKR B;  4KDU A;  2C0E A;  5LCZ A;  1PGT A;  2L5O A;  3MNG A;  4KF9 A;  2DLX A;  2R4V A;  3TRX A;  1SL1 B;  1PN0 A;  4MJA A;  1Y25 A;  4MF7 A;  4ULX A;  4Z2U A;  3F6F A;  4GST A;  5KN0 A;  1F3B A;  2FNO A;  2TRC P;  4RQR A;  1X9M B;  1FOV A;  3A3T A;  1Q4J A;  2CX3 A;  3I9V 2;  2VUP A;  4USS A;  1AQX A;  3HJM A;  2AJQ B;  5HR2 A;  4TXV A;  3D5J A;  3C1S A;  1FVJ A;  1R5A A;  4RI7 A;  5DCH A;  4GTU A;  3D4T A;  4DEJ A;  3EU3 A;  4OO4 A;  1M9A A;  4MNN A;  5ECO B;  2J23 A;  1GNE A;  1VF3 A;  1QXH A;  1B4Q A;  4EDY A;  2JSY A;  5IMD A;  2HYX A;  3UAP A;  4YH2 A;  1RW1 A;  5D73 A;  2CVB A;  3RHC A;  3J7Y k;  2VLU A;  4N0V A;  5KN3 A;  3CTF A;  1PKZ A;  4NV5 A;  1ZMA A;  1OYJ A;  5JCG A;  3UEM A;  3EU4 A;  3UVT A;  2VCQ A;  3CXG A;  2OAC A;  1TP9 A;  1AQV A;  4K0N A;  2JAD A;  4JZQ A;  5BMU A;  2A4V A;  1WP0 A;  1GSE A;  2K18 A;  3WGE A;  3G7Y A;  3U6V A;  5JCU A;  3MIX A;  2AAW A;  2XC2 A;  2DIZ A;  1ZOF A;  3NIV A;  1HD2 A;  2R0C A;  5EL8 A;  5CRD A;  3I69 A;  3QAV A;  3HVV A;  4FYU A;  1EV4 A;  5FHI A;  1H75 A;  5GAP D;  2MMN A;  2WCI A;  2YZU A;  2O85 A;  3IK7 A;  1OE8 A;  4TOP A;  3FYG A;  2GSQ A;  2CT6 A;  3PH9 A;  1THO A;  2JZS A;  3APS A;  4E8H A;  1TK5 B;  1VRS D;  1U88 A;  4JBB A;  1A8L A;  5G1L A;  1XOA A;  3ERW A;  3KGK A;  4RUV A;  3JCM L;  1FVK A;  1OAZ A;  3TKS E;  1QUW A;  2NVL A;  1MTC A;  2YWN A;  2NTO A;  1X5E A;  1LU4 A;  4Q5Q A;  3GKK A;  3VWX A;  4D73 A;  4V2N A;  3APO A;  3HKR A;  1ERU A;  4K7O A;  2I81 A;  5HR0 A;  1A0R P;  1YKC A;  2ZCT A;  4PUR A;  1EWX A;  5D8I A;  5JWR B;  5IPH A;  3TB2 A;  5B6N A;  3GKX A;  1K0N A;  4ZB8 A;  3TJK A;  3ZYW A;  3PR8 A;  2M72 A;  2H19 A;  5IMV A;  3GUS A;  2IME A;  3IAS 2;  4HI7 A;  4POB A;  5B8B A;  3M3M A;  2R3X A;  3BBY A;  5F06 A;  5IPG A;  2EIO A;  2JAC A;  1SKS B;  3E3E A;  2V41 A;  4YKF A;  3ZIV A;  2DBC A;  2P5Q A;  4HQS A;  3BCK A;  3QPM A;  2LJR A;  4EE0 A;  1VF4 A;  4V1A g;  4HJ2 A;  3MSZ A;  2FUG 2;  3M1G A;  4POL A;  3TJG A;  4PUA A;  5LNK e;  5FT3 A;  4YQM A;  3U5R E;  3GYK A;  2VCW A;  3EPT A;  1N8J A;  2YV7 A;  2CX4 A;  3DYR A;  3VUR A;  3RHB A;  5HQP A;  5G2Z A;  1M99 A;  2B7K A;  2IMI A;  3KJY A;  1SL2 B;  4I2T A;  3CSH A;  1JZO A;  3IOS A;  2M46 A;  1PD2 1;  5A5K A;  4IEL A;  4PUF C;  4I6X A;  2H6Y A;  3KIJ A;  4KE3 A;  3KMN A;  3N9J A;  4D73 B;  4XHM A;  2AYT A;  1EGO A;  4DSS A;  3HCZ A;  1DSB A;  4BWQ A;  1GTB A;  2YOI A;  1HYU A;  1SJI A;  4MH3 A;  4MJB A;  1AIU A;  1FB6 A;  1SK2 A;  4OCE A;  5CP1 A;  2Z9S A;  4G2E A;  4IHU A;  4OO5 A;  3P90 A;  4F9Z A;  3VI7 A;  4N11 A;  4YQU A;  5IMA A;  5DJL A;  1TRW A;  3E9J B;  1EP8 A;  3M9K A;  4HS1 A;  4I8B A;  5IO0 A;  3CRU A;  2X49 A;  2YZH A;  1S3A A;  7GSS A;  4MK3 A;  1WIK A;  1WMJ A;  5AN1 A;  3UL3 A;  3R3E A;  4CDO A;  4ML6 A;  3PPU A;  2X8H A;  1K0C A;  2GSS A;  4E8E A;  2H72 A;  4ZBA A;  1YKA A;  1XWC A;  4X1U A;  4AJ8 A;  2AV4 A;  1T7P B;  2F8A A;  4YAV A;  5ELA A;  3FK8 A;  1XWB A;  4IQA A;  1N2A A;  3C1R A;  3QMX A;  4DSR A;  2I4A A;  1CQH A;  4JRR A;  3LOR A;  3ZLP A;  4MP4 A;  3IV4 A;  2C3T A;  5EY6 A;  3IC4 A;  3Q6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...