4FYBA

Structural and functional characterizations of a thioredoxin-fold protein from helicobacter pylori
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
IDKKSYAGLEDVFSDNKSISPNDKYMLLVFGRNGCSYCERFKKDLKNVKELRDYIKEHFSAYYVNISYSKEHDFKVGDKNNEKEIKMSTEELAQIYAVQSTPTIVLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKDDEDLTKKLKAYIKYKTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein (DsbC)
publication title Structural and functional characterization of HP0377, a thioredoxin-fold protein from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 57
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fybA00
4YQUA 4TW5A 5IMZA 2LNSA 1EGRA 2M72A 5JCGA 1U6TA 4MH2A 2V2GA 9GSSA 4TKYA 1JZDA 3G7JA 1AQWA 4OO5A 3CYNA 16GSA 2YZUA 4WF5A 2FD3A 1QK8A 4OFTA 5ABRA 4HQSA 5CRWA 4EDZA 2I9HA 1EGOA 1MDJA 4I5QA 1ZCPA 2GZPA 3ZREA 1WMJA 1XBSA 4PQIA 2RM6A 2YOIA 1Z7PA 2DJ0A 3HHVA 2GSTA 4IVFA 3S9FA 3CTGA 2JL4A 3KZQA 3TJGA 4MF5A 4ZBDA 3TKQA 3WGDA 3VURA 2P5RA 4N0ZA 3TJKA 4POBA 3IRAA 1FAAA 2K8VA 2C4JA 3UARA 4ECJA 4LLRA 1THOA 2VL2A 2R3XA 5CRGA 3GRXA 2OJLA 5CREA 5DJMA 14GSA 2MMNA 3TJFA 1KEBA 1XOAA 4WEYA 2H6YA 4YH2A 2IMDA 4L0UA 3IHQA 3APSA 1JZWA 4ISDA 5LD0A 3QPMA 1A0FA 2RUEA 3L0HA 3W8JA 2B5XA 2PVQA 3O76A 1SJ6A 3US3A 19GSA 3LQ7A 4MCUA 3KIJA 2BMXA 4DSSA 4JU5A 3BCKA 1IYHA 1BEDA 3A2XA 1MEKA 3ZIVA 1PQNA 1UN2A 3I43A 1KNGA 4OMVA 1Q98A 5HFIA 3FW2A 3LG6A 4XS4B 3L78A 3EINA 3HZ8A 2LJRA 3GA4A 4KGIA 17GSA 2LQOA 1WP0A 2H0IA 3VI5A 5LCZA 3DKSA 1HNCA 2YWMA 4V2MA 4HJ2A 1B9YC 1S3DA 1ZL9A 1U88A 3LXTA 4NXIA 4KNDA 1TRWA 5DALB 5DDLA 2OE0A 5FT3A 1SJZA 1YF0A 2WDUA 1J08A 5ID2A 1GTBA 2EC4A 3HJMA 2OADA 5ENUA 2BJXA 2BTOT 4I2TA 3LJRA 2H0GA 2IL3A 1XWAA 1HNBA 3GUSA 2P5QA 1PKZA 1NW2A 3DMLA 1YQ1A 5IQYA 4GWRA 2OACA 3R2QA 5IOWA 1MTCA 1WPIA 3J7Yk 4MJCA 1TRSA 1Z5YE 1YZXA 1GSFA 4WXTA 2O8VB 4LMWA 4IN0A 4ZB8A 5DQSA 4KX4A 4TXVA 4K7IA 1F3BA 2FLSA 3CSHA 3ERWA 2DJ3A 1S3AA 2OKAA 3UL3A 2F8FA 2RLIA 2WULA 5ECHB 5KEJA 2DJ1A 2H1AA 1F6MC 1K0MA 1FHEA 1BJXA 2YWIA 2PVOC 3GFKA 3TOUA 4EVMA 1ZZYA 3HJPA 4TR1A 1O8WA 2JSZA 2YNXA 2VL3A 5E59A 3WYWA 4PGTA 1R26A 3TKSC 3VWXA 1LBKA 5JWRB 1EEJA 4P3YB 4DEJA 3Q19A 3G7YA 2PN8A 3ZYWA 2VLVA 2FHEA 4JRRA 3QCPA 1K3OA 3MNGA 1G6WA 4L0WA 3D21A 5IMAA 1VF4A 2O85A 2C80A 3ME7A 3BBYA 1T8EB 1AUCA 4EUYA 2H1GA 4Z7XA 5LNKe 4LMVA 2AB6A 1WJKA 4MA9A 5COHA 4MZWA 4ZL8A 4BVYA 1GSEA 5G5FA 1M9AA 2DJ2A 2HFDA 1ERWA 5DBQA 4OWYA 1SK1A 2J9HA 1XWCA 3IC4A 4ZBBA 1XW9A 4E8HA 1K0NA 3FK8A 2REMA 1N8JA 4RI7A 2PUKC 2O87A 3IBHA 2V6OA 1GNWA 4RI6A 1TU8A 1QQ2A 4ZL9A 5ECLB 3J7Yb 1GSSA 4I2UA 4NWYA 1XWGA 5G1LA 1QGVA 5GAND 1Q4JA 1PL2A 2JZTA 4ZXGA 2RUFA 3DGQA 2VLUA 3EMXA 1IYIA 5CO3A 1B48A 1A8LA 2VUPA 3APOA 5GSTA 2V41A 3KMOA 11GSA 4NMUA 2H8LA 1C72A 4FYBA 5AIXA 3C71A 2J23A 2MBSA 2L57A 1RW1A 5FHIA 3EC3A 1OC3A 5E4WA 2FY6A 1GL8A 4Q5NA 4PNFA 4AJ6A 1EOGA 1KBNA 1PA3A 3GH9A 2GTUA 2HE3A 3TRPA 2OBIA 4IHUA 4GSTA 2WGRA 3L9VA 4JE1A 3ZVJD 3TGZA 1OC9B 3CXGA 1BG5A 1X9MB 1BAYA 4JR4A 1PL1A 1FVKA 4ZILA 4F0BA 5F0GA 1OE7A 1EZKA 4F9ZA 5G2ZA 1BYEA 2CX3A 3M9KA 3TDGA 1XXUA 5HR0A 3GTUB 5DALA 4O7HA 2N5BA 2DMLA 4ECCA 5ELGA 2VLTA 3TKSA 3PH9A 1MDIA 5DJLA 1Z6MA 3F4TA 2GGTA 1I9DA 1XVQA 5G5EA 4GLTA 2EIQA 3KEBA 2DIYA 2H70A 3CBUA 5H5QA 1T1VA 4AJ7A 4PNGA 1TI1A 5AISA 2FWEA 1RK4A 2MMAA 1GLQA 3E9JB 1G6YA 2PMTA 5EPFA 5JWOB 4G2EA 4IQAA 1DUGA 3LSZA 5J41A 4EC0A 3RBTA 1M99A 3RHCA 1F9MA 2CA8A 2V1MA 1MD3A 1R5AA 3H8QA 2GT5A 4GSSA 1A24A 4BWSA 5KN2A 4RUVA 2DJJA 1A2JA 3D6IA 1VF1A 2MMZA 2G2QA 2N5AA 5H5RA 3TJBA 4YAVA 4MDCA 4ZL7A 4K7NA 4F82A 4J56E 1USBA 2LQQA 5J3RA 3AY8A 1NM3A 5GAPD 1OC8A 2IFQB 4MJBA 1AC1A 4POLA 1XZOA 3KD0A 2C3TA 2B5YA 4MH3A 4KA0A 4GCIA 2VOCA 4HEA2 2FUG2 1V57A 3DXBA 2VM1A 3P7XA 4K0GA 3F63A 1GSDA 2XBQA 4CHSA 2P0GA 3APQA 4TR1B 2PGTA 4PUFC 5HQPA 2PERA 2R6KA 1WIKA 4V2NA 3ERFA 3PGTA 4QQ7A 1ZYEA 2O7KA 4TVEA 4HDEA 4K9ZA 3FZ9A 2XPDA 2B3SA 1SJIA 4V1Ap 3CMIA 3EYTA 2FWGA 1QFNA 2L6DA 2IMIA 2C3NA 1URMA 5IMFA 2C0FA 3GV1A 1PSQA 2CT6A 3ZMKA 5KN1A 3O6TA 3EMPA 4OFMA 2WFCA 3UBLA 3EURA 2L4QA 4IJIA 4X43A 3FHKA 1MDKA 1SK2A 2VCTA 1TU7A 3KCMA 2ON5A 1YF1A 4MZCA 2CVDA 4HU7A 1OVNA 5FWGA 1WE0A 4EE0A 3ZMLA 3A5WA 2H76A 2C8UA 4O32A 3LYKA 2H1BA 2H01A 3IAS2 2B1KA 1ON4A 4LL1B 4N11A 3JCML 3ZFLA 4QL7A 3NOFA 1TRUA 1K0CA 1SYRA 2KLXA 1OC9A 4MJEA 5D9VA 1SL2B 1ILOA 3UOMA 1YKAA 1WOUA 2LJKA 2VCXA 4KW6A 4OFNA 4EL1A 1K3LA 1ZGNA 5CAXA 5G1KA 1V58A 3DVXA 3GTUA 2A4VA 1E6BA 4OD7A 3P8WA 1HD2A 5IPGA 1A23A 3FZ4A 2AV4A 1XOBA 5ECNB 4TOPA 5IMVA 4LL4B 1WWJA 3GH6A 4ECIA 2ON7A 2KP2A 2R5GA 2YJ7A 2ZNMA 5IPHA 5JWQB 4XHMA 4KCAA 2X64A 3WD6A 5F8BA 4H86A 1U3AA 2OBKA 1B9XC 3GKMA 4CW9A 5B8AA 2LSTA 4F03A 3F4RA 2RM5A 3DD3A 2CZ2A 4ZB9A 1TK0B 3Q74A 2HZFA 1O73A 4KDXA 4G9HA 3QMXA 2PU9C 3F9UA 4GTUA 2VM2A 5AGYA 1H4OA 4POMA 3ZIJA 5D9WA 1T00A 3HA9A 3P90A 3TUEA 3FRCA 4I97A 3UMAA 3F6DA 1T4ZA 2H30A 4WBRD 3IDVA 1I5GA 1SL0B 3ZTLA 2JZRA 1PD21 4FO5A 4ID0A 5J5NA 3KTLA 5DQYA 2IFQA 5B6NA 2HSYA 4HS1A 1XIYA 4YQVA 3ZLPA 3UAPA 1U87A 1ML6A 3D4TA 4YQMA 3H1NA 1OKDA 5J4UA 1ACVA 3GN3A 3HVXA 4IP1A 5A4UA 3SWLA 2WZ9A 2CAIA 2F8AA 4MF6A 2AUVA 4GRFA 1XWKA 5JCUA 22GSA 3GKKA 2IWTA 2I81A 1H75A 4IKHA 4O92A 4EDYA 1T3BA 1PX6A 1FW1A 3NIVA 2OA7A 3IV4A 3GX8A 4Q5RA 2KUCA 3A2VA 4ZB6A 1EOHA 3VWWA 3FEUA 3TKSE 5EVOA 1T4YA 6GSXA 4TRXA 3NZNA 3QD9A 4WBJA 1FVJA 2PWJA 2E2GA 3BCIA 3SBCA 20GSA 3F0IA 1X9SB 2KHPA 2CVKA 4NPBA 4NHWA 2EIOA 2A2RA 4L5OA 4KDYA 1EEMA 3KP8A 3F3QA 5ELAA 2X8GA 2H71A 2AJQB 2LEGA 1M0UA 2L6CA 3KTBA 4MJAA 4MMMA 1GP1A 2ZCTA 3GNJA 1M9BA 2V6KA 1J9BA 1CQGA 1R7HA 3ZL5A 5B6MA 4KSMA 1HYUA 1K0DA 2GDRA 3I6AA 2K8SA 2CAQA 3DRNA 2HT9A 5EY6A 1TXXA 4EXJA 3C7MA 2TRCP 1XW6A 2VD0A 1GTUA 4GXZA 4JBBA 1TK8B 1PGTA 4BPYA 5B8BA 2Z9SA 3QAGA 3HDCA 1UVZA 4IQ1A 2HRFA 2A2SA 3CRUA 3N9JA 3GYKA 1XW5A 1K3YA 2VL9A 3PINA 3RHBA 1G7EA 3EU4A 4IS0A 2GVPA 4TR0A 5ECKB 3QFAC 1V98A 2QC7A 4KAEA 2AHEA 4YAPA 3EWLA 2YCDA 2WCIA 3VFIA 2LV3A 2H66A 3TOTA 3U5RE 5A5KA 3HVVA 1Z7RA 3H4KA 1YEPA 2ES7A 4O5RA 6GSUA 3M0FA 5ECMB 3RAZA 4KSOA 3VLNA 4KCEA 4IBPA 3QFBC 5D9XA 4XRDA 5HFGA 3EVIA 1O81A 2H6XA 4ULXA 2TRXA 3BJ5A 4TR4A 2IPAA 1WRYA 3C8EA 1FB6A 5KN3A 1SKSB 1FO5A 4K6XA 2CZ3A 4ECBA 2I4AA 1F2EA 2F51A 1XVWA 5ECRB 2HLSA 3KH9A 1F37A 4MPGA 1HNAA 2JZSA 2C1YA 5CRHA 3UIWA 4ACSA 5A4VA 1FB0A 2OE1A 4K2DA 3F4SA 3DEXA 1NHYA 1GTAA 2GQLA 4GQCA 3OR5A 1A2LA 5CYYA 2VAFA 2AAWA 13GSA 2F3MA 4XIHA 1EWXA 3ZRDA 3KGKA 4BA7A 6GSTA 2HZEA 1MD4A 2C0DA 2LUSA 1TP9A 1QMVA 4XTSA 1DBYA 4L5LA 1GLPA 1GTIA 3EE2A 3PR8A 4FIWA 4NV2A 1VF2A 2N5FA 4PQHA 5D93A 2VD1A 3Q18A 2GLRA 2LNTA 3RDWA 1BQ7A 2F9SA 2LRNA 5AN1A 1LJRA 2HNLA 5HFKA 2YN1A 3GIXA 2XPEA 4RQRA 2CX4A 4IELA 2NDOA 3HCZA 1O85A 3DWVA 2YP6A 4EF0A 1TRVA 4K0NA 3HYPA 3FR9A 3N5OA 2YANA 2YWNA 2IJYA 4MLYA 4AJ8A 3F8UA 1M2BA 5ECSA 3MSZA 1JLVA 2DIZA 1A0RP 4KE3A 2LTKA 3D22A 1SYXA 1GNEA 3BD2A 4K7OA 3A3TA 3M8NA 6GSVA 5F06A 5EL8A 1QXHA 4FYUA 4DVCA 2L5OA 4N30A 3IAM2 1GSYA 5IMCA 1SL1B 1SD9A 2M80A 6GSYA 3TJJA 1AXDA 2L5LA 4TR3A 4WR5A 1XPVA 3QDNA 1JFUA 3WGXA 5L71A 4HOJA 3GMFA 2XBIA 3E0UA 5C00A 4F2IA 5ECPB 4HQZA 2MMOA 1AAZA 4JZQA 1UA5A 4BL7A 1U3IA 4G19A 4TXOB 7GSSA 2B7KA 5INYA 4GF0A 2K6VA 3KMNA 3VPQA 3HJOA 3D0ZA 2R4VA 2H75A 2K9FA 1GUHA 2CVBA 3GSSA 1A8YA 4IP6A 4BVXA 4ZIJA 4WETA 18GSA 1OE8A 5DAKA 1GH2A 3IA1A 4MPFA 4V2LA 1M7TA 2GSRA 3CSJA 3ED3A 4DSQA 5IIZA 5J9CA 2MYGA 2FA4A 2H73A 1X5CA 2VIMA 3IXRA 2WRTA 3FYGA 1EP8A 3DIEA 1X5EA 6GSSA 4MF7A 4AF2A 3TRQA 3G7IA 4WR4A 1G7OA 3F3RA 3W6GA 1EV4A 3FR3A 1DE1A 2DSAA 3E3EA 2GQMA 5A4WA 1SKWB 1K0AA 5IO0A 3LORA 1YY7A 4J57E 5H5SA 2XHFA 1HQOA 2DLXA 1PRXA 2H19A 2MBTA 3VPTA 4G10A 1S3CA 1ZYQB 4F0CA 1SK0A 4X1UA 4K1FA 4Q5QA 2MZCA 1OYJA 2YV7A 4XS6A 3GHAA 2GQKA 1GSUA 3GKXA 2NBSA 4CDOA 4X0XA 5AIVA 2GZZA 1PKWA 4PUAA 5CRDA 3VK9A 5IO2A 4KB3A 2M46A 3V1WA 3M9JA 2KOKA 1ABAA 2AYTA 3IOSA 4FYCA 3TCOA 4HU9A 2GS3A 3KXOA 4RQXA 3L9SA 2L59A 2YWOA 1X0RA 1B8XA 1VRSD 3QAWA 3GX0A 3D5JA 4XS1A 4ML1A 1Z6NA 1R4WA 1TDIA 1ZMAA 1K0OA 3ISOA 5KN0A 3CTFA 4POKA 3RPNA 5F05A 5DCHA 1A2MA 2LRTA 2YPMA 4Q5FA 8GSSA 2HI7A 2JU5A 4OO4A 4BWQA 2YJHA 4J2FA 3U6VA 1TI3A 1B4PA 1O7UA 4ZBAA 4KUNA 5B7CA 2HSHA 2H6ZA 3GSTA 3F6FA 3FR6A 3CSIA 2WB9A 4TN8A 1YJ6A 3C1SA 1YDKA 2YZHA 2B7JA 2TIRA 2RIIA 1DSBA 1M2AA 1TK5B 2VCZA 3FKFA 4N10A 1E2YA 3MAKA 2E0QA 1W4VA 3HXSA 2C3QA 1XCCA 3LEFA 2R2JA 1W89A 2P31A 3IK9A 3UVHA 3VWUA 3WT2A 2HZEB 3MWHA 3KJYA 3UEMA 2QGVA 2GSSA 3ME8A 2O89A 3MDKA 3UVTA 3KH7A 5G30A 3H79A 2VCWA 4N0VA 2V32A 3ZFBA 1JZRA 3A2WA 2HXKA 2NTOA 1JLWA 5C04A 1TJDA 1Z3EA 2B1LA 2VO4A 2JSYA 3TKRA 2K18A 5IOXA 3GL3A 5J9BA 2IMFA 2L4CA 3O3TA 2IMKA 1YEXA 3FZAA 3RPPA 1J0FA 5GSSA 4MZBA 4NAXA 1PN9A 4EKZA 2DJKA 3IK7A 2X8HA 2JACA 2H0HA 5HR1A 1TTZA 1SU9A 3KP9A 2H74A 4D73B 5ECIB 3QAVA 4LA1A 1QUWA 2ALBA 1GUMA 4MP4A 1AW9A 3IPZA 4TXOA 2PPTA 1VF3A 1ERTA 1Y25A 3K8NA 1G0TA 4KDUA 3IE3A 2PBJA 1V9WA 4WF4A 2VCQA 1V2AA 2JADA 2YV9A 3P2AA 1N2AA 1BX9A 4KH7A 5JCWA 4PX1A 4QL9A 4FH8A 5ECQB 1FG4A 1AIUA 2FCHA 1NSWA 3C1RA 2XC2A 1B4QA 2E2MA 1ERVA 2DMMA 5D96A 3VI7A 3UBKA 3L4NA 4IGJA 3UJ1A 1X9WB 1F3AA 4MABA 3LXZA 4ILFA 2WS2A 3LWAA 5D8IA 2OE3A 3I9V2 2KP1A 1GWCA 5DAKB 2LRCA 1T7PB 1X5DA 3FZ5A 1R5PA 3WGEA 2C0GA 2H72A 1TKDB 1ST9A 12GSA 2GT6A 2HYXA 4V1Ag 4XS4A 3I69A 3L9UA 3M1GA 2IMEA 1PMTA 3VWVA 4PQ1A 3GKNA 2FWFA 1EP7A 2CQ9A 2WJUA 4HUAA 1TOFA 4XRAA 5F07A 1KTEA 5CNWA 3HD5A 3ZZXA 3Q6OA 3IR4A 3LFLA 4DSSB 1JHBA 1Z9HA 1V40A 2QSIA 1JZOA 4IW9A 4E8EA 5GZZB 3H93A 1ZOFA 2D2ZA 3LGCA 2FWHA 2IIYA 3QR6A 4NV5A 1UC7A 1GSQA 6GSWA 4I6XA 4GQFA 1NHOA 2CV4A 2VCVA 4AGSA 2X8CA 5HR2A 2FA8A 5DCGA 1EV9A 2LJAA 4K8MA 3WT1A 1YKCA 2H1DA 3G9BA 1GUKA 1OAZA 2GSQA 3M3MA 4EO3A 4ML6A 1TW9A 1THXA 2VL2C 2R37A 3DYRA 3ZVJA 2GZYA 4HZ4A 3FY7A 1CQHA 3BOAA 4JEDA 4XCSA 3ZITA 4PXOA 1RQMA 5CP1A 1GRXA 1SENA 1AQVA 2G0FA 5ID2B 2E7PA 1AQXA 2I3YA 2ZUPA 3TRXA 1K0BA 1O6JA 1OKTA 3DVWA 4IJ3A 3ERGA 1M2DA 5IMDA 4I8BA 4OCEA 10GSA 3TB2A 4HZ2A 3HVSA 3QOUA 2I1UA 5HR3A 5D9TA 3LYPA 2NPBA 3C73A 4WKWA 3GURA 2IN3A 4HI7A 2DC5A 1Y6EA 2C0EA 3HY2A 1PX7A 3HKRA 4NHZA 1FOVA 4JR6A 2DBCA 2HRNA 1SD8A 5D73A 1LU4A 3EU3A 4MK3A 2B6MA 1GULA 4PURA 3CRTA 2LKUA 3KM6A 5DVBA 2QKEA 3HZ4A 1VGLA 1XWBA 1XFLA 3W8SA 2FNOA 4L8EA 4OCFA 5IM9A 1DE2A 3TKPA 3D4MA 4HJMA 2FGXA 4D73A 2NVLA 3GL5A 1SKRB 4DSRA 2LS5A 4GSNA 5G31A 2X99A 2EIRA 2B5EA 5ECOB 1O8XA 1ERUA
chains in the Genus database with same CATH superfamily
4YQUA 4TW5A 5IMZA 2LNSA 1EGRA 2M72A 5JCGA 1U6TA 4MH2A 2V2GA 9GSSA 4TKYA 1JZDA 3G7JA 1AQWA 4USSA 4OO5A 3CYNA 16GSA 2YZUA 4WF5A 2FD3A 1QK8A 4OFTA 5ABRA 4HQSA 5CRWA 4EDZA 4BVYB 2I9HA 1EGOA 1MDJA 4I5QA 1ZCPA 2GZPA 3ZREA 1WMJA 1XBSA 4PQIA 2RM6A 2YOIA 1Z7PA 2DJ0A 3HHVA 2GSTA 4IVFA 3S9FA 3CTGA 2JL4A 3KZQA 3TJGA 4MF5A 4ZBDA 3TKQA 3WGDA 3VURA 2P5RA 4N0ZA 3TJKA 4POBA 3IRAA 1FAAA 2K8VA 3IC8A 2C4JA 3UARA 4ECJA 4LLRA 1THOA 2VL2A 2R3XA 5CRGA 3GRXA 4G0IA 2OJLA 5CREA 5DJMA 14GSA 2MMNA 3TJFA 1KEBA 1XOAA 4WEYA 2H6YA 4YH2A 2IMDA 4L0UA 3IHQA 3APSA 1JZWA 4ISDA 5LD0A 3QPMA 1A0FA 2RUEA 3L0HA 3W8JA 2B5XA 2PVQA 3O76A 1SJ6A 3US3A 19GSA 3LQ7A 4MCUA 3KIJA 2BMXA 4DSSA 4JU5A 3BCKA 1IYHA 3MIXA 1BEDA 3A2XA 1MEKA 3ZIVA 1PQNA 1UN2A 3I43A 1KNGA 4OMVA 1Q98A 5HFIA 3FW2A 3LG6A 4XS4B 3L78A 3EINA 3HZ8A 2LJRA 3GA4A 4KGIA 17GSA 2LQOA 1WP0A 2H0IA 3VI5A 5LCZA 3DKSA 1HNCA 2YWMA 4V2MA 4HJ2A 1B9YC 1S3DA 1ZL9A 1U88A 3LXTA 4NXIA 4KNDA 1TRWA 5DALB 5DDLA 4O5QA 2OE0A 5FT3A 1SJZA 1YF0A 2WDUA 1J08A 5ID2A 1GTBA 2EC4A 3HJMA 2OADA 5ENUA 2BJXA 2BTOT 4I2TA 3LJRA 2H0GA 2IL3A 1XWAA 1HNBA 3GUSA 2P5QA 1PKZA 1NW2A 3DMLA 1YQ1A 5IQYA 4GWRA 2OACA 3R2QA 5IOWA 1MTCA 1WPIA 3J7Yk 4MJCA 4G0LA 1TRSA 1Z5YE 1YZXA 1GSFA 4WXTA 2O8VB 4LMWA 4IN0A 4ZB8A 5DQSA 4KX4A 4TXVA 4K7IA 1F3BA 2FLSA 3CSHA 3ERWA 2DJ3A 1S3AA 2OKAA 3UL3A 2F8FA 2RLIA 2WULA 5ECHB 5KEJA 2DJ1A 2H1AA 1F6MC 1K0MA 1FHEA 1BJXA 2YWIA 2PVOC 3GFKA 3TOUA 4EVMA 2UZ8A 1ZZYA 3HJPA 4TR1A 1O8WA 2JSZA 2YNXA 2VL3A 5E59A 3WYWA 4PGTA 1R26A 3TKSC 3VWXA 1LBKA 5JWRB 1EEJA 4P3YB 4A5PA 4DEJA 3Q19A 3PPUA 3G7YA 2PN8A 3ZYWA 2VLVA 2FHEA 4JRRA 3QCPA 1K3OA 3MNGA 1G6WA 4L0WA 3D21A 5IMAA 1VF4A 2O85A 4ICYA 2C80A 1FOHA 3ME7A 3BBYA 1T8EB 1AUCA 4EUYA 2H1GA 4Z7XA 5LNKe 4LMVA 2AB6A 1WJKA 4MA9A 5COHA 4MZWA 4ZL8A 4BVYA 1GSEA 5G5FA 1M9AA 2DJ2A 2HFDA 1ERWA 5DBQA 4OWYA 1SK1A 2J9HA 1XWCA 3IC4A 4ZBBA 1XW9A 4E8HA 1K0NA 3FK8A 2REMA 1N8JA 4RI7A 2PUKC 2O87A 3IBHA 2V6OA 3EPTA 1GNWA 4RI6A 1TU8A 1QQ2A 4ZL9A 5ECLB 3HVNA 3J7Yb 1GSSA 4I2UA 4NWYA 1XWGA 5G1LA 1QGVA 5GAND 1Q4JA 1PL2A 2JZTA 4ZXGA 2RUFA 3DGQA 2VLUA 3EMXA 5CO3A 1IYIA 1B48A 1A8LA 2VUPA 3APOA 5GSTA 2V41A 3KMOA 11GSA 4NMUA 2H8LA 1C72A 4FYBA 5AIXA 3C71A 2J23A 2MBSA 2L57A 1RW1A 5FHIA 3EC3A 1OC3A 5E4WA 2FY6A 1GL8A 4Q5NA 4PNFA 4AJ6A 1EOGA 1KBNA 1PA3A 3GH9A 2GTUA 2HE3A 3TRPA 2OBIA 4IHUA 4GSTA 2WGRA 3L9VA 4JE1A 3ZVJD 3TGZA 1OC9B 3CXGA 1BG5A 1X9MB 1BAYA 4JR4A 1PL1A 1FVKA 4ZILA 4F0BA 5F0GA 1OE7A 1EZKA 4F9ZA 4FQUA 5G2ZA 1BYEA 2CX3A 3M9KA 3TDGA 1XXUA 5HR0A 3GTUB 5DALA 4O7HA 2N5BA 2DMLA 4ECCA 5ELGA 2VLTA 3TKSA 3PH9A 1MDIA 5DJLA 1Z6MA 3F4TA 2GGTA 1I9DA 1XVQA 5G5EA 4GLTA 2EIQA 3KEBA 2HRAA 2DIYA 2H70A 3CBUA 5H5QA 1T1VA 4AJ7A 4PNGA 1TI1A 5AISA 2FWEA 1RK4A 4K2XA 3CQFA 2MMAA 1GLQA 3E9JB 1G6YA 2PMTA 5EPFA 5JWOB 4G2EA 4IQAA 1DUGA 3LSZA 5J41A 4EC0A 3RBTA 1M3IA 1M99A 3RHCA 1F9MA 2CA8A 2V1MA 1MD3A 1R5AA 3H8QA 2GT5A 4GSSA 1A24A 4BWSA 5KN2A 4RUVA 2DJJA 1A2JA 3D6IA 1VF1A 2MMZA 2G2QA 2N5AA 5H5RA 3TJBA 4YAVA 4MDCA 4ZL7A 4K7NA 4F82A 4J56E 1USBA 2LQQA 5J3RA 1XG8A 2X4AA 3AY8A 1NM3A 5GAPD 4CY6A 1OC8A 2IFQB 4MJBA 1AC1A 4POLA 1PFOA 1XZOA 3KD0A 2C3TA 2B5YA 4MH3A 4KA0A 4GCIA 2VOCA 4HEA2 2FUG2 1V57A 3DXBA 2VM1A 3P7XA 4K0GA 3F63A 1GSDA 2XBQA 4CHSA 2P0GA 3APQA 4TR1B 2PGTA 4PUFC 5HQPA 2PERA 2R6KA 1WIKA 4V2NA 3ERFA 3PGTA 4QQ7A 1ZYEA 2O7KA 4TVEA 4HDEA 4K9ZA 3FZ9A 2XPDA 2B3SA 1SJIA 4V1Ap 3CMIA 3EYTA 2FWGA 1QFNA 2L6DA 2IMIA 2C3NA 1URMA 5IMFA 2C0FA 3GV1A 1PSQA 2CT6A 3ZMKA 1S3RA 5KN1A 3O6TA 3EMPA 4PTSA 4OFMA 2WFCA 3UBLA 3EURA 2L4QA 4IJIA 4X43A 3FHKA 1MDKA 1SK2A 2VCTA 1TU7A 3KCMA 2ON5A 1YF1A 4MZCA 2CVDA 4HU7A 1OVNA 5FWGA 1WE0A 4EE0A 3ZMLA 3A5WA 2H76A 2C8UA 4O32A 3LYKA 2H1BA 2H01A 3IAS2 2B1KA 1ON4A 4LL1B 4N11A 3JCML 3ZFLA 4QL7A 3NOFA 1TRUA 1K0CA 1SYRA 2KLXA 1OC9A 4MJEA 5D9VA 1SL2B 1ILOA 3UOMA 1YKAA 1WOUA 2LJKA 2VCXA 4KW6A 4OFNA 4EL1A 1K3LA 1ZGNA 5CAXA 5G1KA 1V58A 3DVXA 3GTUA 2A4VA 1E6BA 4OD7A 3P8WA 1HD2A 5IPGA 1A23A 3FZ4A 2AV4A 1XOBA 5ECNB 4TOPA 5IMVA 4LL4B 1WWJA 3GH6A 4ECIA 2ON7A 2KP2A 2R5GA 2YJ7A 2ZNMA 5IPHA 5JWQB 4XHMA 4KCAA 2X64A 3WD6A 5F8BA 4H86A 1U3AA 2OBKA 1B9XC 3GKMA 4CW9A 5B8AA 2LSTA 4F03A 3F4RA 2RM5A 3DD3A 2CZ2A 4ZB9A 1TK0B 3Q74A 2HZFA 1O73A 4KDXA 4G9HA 3QMXA 2PU9C 3F9UA 4GTUA 2VM2A 5AGYA 1H4OA 4POMA 3ZIJA 5D9WA 1T00A 3HA9A 3P90A 3TUEA 3FRCA 4I97A 3UMAA 3F6DA 1T4ZA 2H30A 2DKHA 4WBRD 3IDVA 1I5GA 1SL0B 3ZTLA 2JZRA 1PD21 4FO5A 4ID0A 5J5NA 3KTLA 5DQYA 2HRKA 2IFQA 5B6NA 2HSYA 4HS1A 1XIYA 4YQVA 3ZLPA 3UAPA 1U87A 1ML6A 3D4TA 4YQMA 3H1NA 1OKDA 5J4UA 1ACVA 3GN3A 3HVXA 4IP1A 5A4UA 3MYDA 3SWLA 2WZ9A 2CAIA 2F8AA 4MF6A 2AUVA 4GRFA 1XWKA 5JCUA 22GSA 4BIKA 3GKKA 2IWTA 2I81A 1H75A 4IKHA 4O92A 4EDYA 1T3BA 1PX6A 1FW1A 3NIVA 2OA7A 3IV4A 1PN0A 3GX8A 4Q5RA 2KUCA 3A2VA 4ZB6A 1EOHA 3VWWA 3FEUA 3TKSE 5EVOA 1T4YA 6GSXA 4TRXA 3NZNA 3QD9A 4WBJA 1FVJA 2PWJA 2E2GA 3BCIA 3SBCA 20GSA 3F0IA 1X9SB 2KHPA 2CVKA 4NPBA 4NHWA 2EIOA 2A2RA 5BMUA 4L5OA 4KDYA 1EEMA 3KP8A 3F3QA 5ELAA 2X8GA 2H71A 2AJQB 2LEGA 1ZYNA 1M0UA 2L6CA 3KTBA 4MJAA 4MMMA 1GP1A 2ZCTA 3GNJA 1M9BA 2V6KA 1J9BA 1CQGA 1R7HA 3ZL5A 5B6MA 4KSMA 1HYUA 1K0DA 2GDRA 3I6AA 2K8SA 2CAQA 3DRNA 2HT9A 5EY6A 1TXXA 4EXJA 3C7MA 2TRCP 1XW6A 2VD0A 1GTUA 4GXZA 4JBBA 3A5IA 1TK8B 1PGTA 4BPYA 5B8BA 2Z9SA 4BL7B 3QAGA 3HDCA 1UVZA 4IQ1A 2HRFA 2A2SA 3CRUA 3N9JA 3GYKA 4BVXB 1XW5A 1K3YA 2VL9A 4MNNA 3PINA 3RHBA 1G7EA 3EU4A 4YKGA 4IS0A 2GVPA 4TR0A 4CY8A 5ECKB 3QFAC 1V98A 2QC7A 4KAEA 2AHEA 4YAPA 3EWLA 2YCDA 2WCIA 3VFIA 2LV3A 2H66A 3TOTA 3U5RE 5A5KA 2R0GA 3HVVA 1Z7RA 3H4KA 1YEPA 2ES7A 4O5RA 6GSUA 3M0FA 5ECMB 3RAZA 4KSOA 3VLNA 4KCEA 4IBPA 3QFBC 5D9XA 4XRDA 5HFGA 3EVIA 1O81A 2DKIA 2H6XA 4ULXA 2TRXA 3BJ5A 4TR4A 2IPAA 1WRYA 3C8EA 1FB6A 5KN3A 1SKSB 1FO5A 4K6XA 2CZ3A 4ECBA 2I4AA 1F2EA 2F51A 1XVWA 5ECRB 2HLSA 3KH9A 1F37A 4MPGA 1HNAA 2JZSA 2C1YA 5CRHA 3UIWA 4ACSA 5A4VA 1FB0A 2OE1A 4K2DA 3F4SA 3DEXA 1NHYA 1GTAA 2GQLA 4GQCA 3OR5A 1A2LA 2VAFA 2AAWA 5CYYA 13GSA 2F3MA 4XIHA 1EWXA 3ZRDA 3KGKA 4BA7A 3IHGA 6GSTA 2HZEA 1MD4A 2C0DA 2LUSA 1TP9A 1QMVA 4XTSA 1DBYA 4L5LA 1GLPA 1GTIA 3EE2A 3PR8A 4FIWA 4NV2A 1VF2A 2N5FA 4PQHA 5D93A 2VD1A 3Q18A 2GLRA 2LNTA 3RDWA 1BQ7A 2F9SA 2LRNA 5AN1A 5BRTA 1LJRA 2HNLA 5HFKA 2YN1A 3GIXA 2XPEA 4RQRA 4Z2RA 2CX4A 4IELA 2NDOA 3HCZA 1O85A 3DWVA 2YP6A 4EF0A 1TRVA 4K0NA 3HYPA 3FR9A 3N5OA 2YANA 2YWNA 2IJYA 4MLYA 4AJ8A 3F8UA 1M2BA 5ECSA 3MSZA 1JLVA 2DIZA 1A0RP 4KE3A 2LTKA 3D22A 1SYXA 1GNEA 3BD2A 4K7OA 3A3TA 3M8NA 6GSVA 5F06A 5EL8A 1QXHA 4FYUA 4DVCA 2L5OA 4N30A 3IAM2 1GSYA 5IMCA 1SL1B 1SD9A 2M80A 6GSYA 4X4JA 4K5RA 3TJJA 1AXDA 2L5LA 4TR3A 4WR5A 1XPVA 5KOXA 3QDNA 2QA2A 1JFUA 3WGXA 5L71A 4HOJA 3GMFA 2XBIA 3E0UA 5C00A 4F2IA 5ECPB 4HQZA 2MMOA 1AAZA 1M3JA 4JZQA 1UA5A 2QA1A 4BL7A 1U3IA 4G19A 4TXOB 7GSSA 2B7KA 5INYA 4GF0A 2K6VA 3KMNA 3VPQA 3HJOA 3D0ZA 2R4VA 2H75A 2K9FA 1GUHA 2CVBA 3GSSA 1A8YA 4IP6A 4BVXA 4ZIJA 4WETA 18GSA 1OE8A 5DAKA 4EIQA 1GH2A 3IA1A 4MPFA 4V2LA 1M7TA 2GSRA 3CSJA 3ED3A 4DSQA 5IIZA 5J9CA 2MYGA 2FA4A 2H73A 1X5CA 2VIMA 3IXRA 2WRTA 3FYGA 1EP8A 3DIEA 1X5EA 2A2PA 6GSSA 4MF7A 4AF2A 3TRQA 3G7IA 4WR4A 1G7OA 3F3RA 3W6GA 1EV4A 3FR3A 1DE1A 2DSAA 3E3EA 2GQMA 4Z2UA 5A4WA 1SKWB 1K0AA 5IO0A 3LORA 1YY7A 4J57E 5H5SA 2XHFA 1HQOA 2DLXA 1PRXA 2H19A 2MBTA 3VPTA 4G10A 1S3CA 1ZYQB 4F0CA 1SK0A 4X1UA 4K1FA 4Q5QA 2MZCA 1OYJA 2YV7A 4XS6A 3GHAA 2GQKA 1GSUA 3GKXA 2NBSA 4CDOA 4X0XA 5AIVA 2GZZA 1PKWA 4PUAA 5CRDA 3VK9A 5IO2A 4KB3A 2M46A 3V1WA 3M9JA 2KOKA 1ABAA 2AYTA 3LW9A 3IOSA 4FYCA 3TCOA 4HU9A 2GS3A 3KXOA 4RQXA 3L9SA 2L59A 2YWOA 1X0RA 1B8XA 1VRSD 3QAWA 1ZYPA 3GX0A 3D5JA 4XS1A 4ML1A 1Z6NA 2X49A 1R4WA 1TDIA 1ZMAA 1K0OA 3ISOA 5KN0A 3CTFA 4POKA 3RPNA 5F05A 5DCHA 1A2MA 2LRTA 2YPMA 4Q5FA 8GSSA 2HI7A 2JU5A 4OO4A 4BWQA 2YJHA 4J2FA 3U6VA 1TI3A 1B4PA 1O7UA 4ZBAA 4KUNA 5B7CA 2HSHA 2H6ZA 3GSTA 3F6FA 3FR6A 3CSIA 2WB9A 4TN8A 1YJ6A 3C1SA 1YDKA 2YZHA 2B7JA 2TIRA 2RIIA 1DSBA 1M2AA 1TK5B 2VCZA 3FKFA 4N10A 1E2YA 3MAKA 2E0QA 1W4VA 3HXSA 2C3QA 1XCCA 3LEFA 2R2JA 1W89A 2P31A 3IK9A 3UVHA 3VWUA 3WT2A 2HZEB 3MWHA 3KJYA 3UEMA 2QGVA 2GSSA 3ME8A 2O89A 3MDKA 3UVTA 3KH7A 5G30A 3H79A 2VCWA 4N0VA 2V32A 3ZFBA 1JZRA 3A2WA 2HXKA 2NTOA 1JLWA 5C04A 1TJDA 1Z3EA 2B1LA 2VO4A 2JSYA 3TKRA 2K18A 5IOXA 3GL3A 5J9BA 2IMFA 2L4CA 3O3TA 2IMKA 1YEXA 3FZAA 3RPPA 1J0FA 5GSSA 4MZBA 4NAXA 1PN9A 4EKZA 2DJKA 3IK7A 2X8HA 2JACA 2H0HA 5HR1A 1TTZA 1SU9A 3KP9A 2H74A 4D73B 4O5UA 5ECIB 3QAVA 4LA1A 1QUWA 2ALBA 1GUMA 4MP4A 1AW9A 4EIPA 3IPZA 4TXOA 2PPTA 1VF3A 1ERTA 1Y25A 3K8NA 2R0CA 1G0TA 4KDUA 4YKFA 3IE3A 2PBJA 1V9WA 4WF4A 2VCQA 1V2AA 2JADA 2YV9A 3P2AA 1N2AA 1BX9A 4KH7A 3R3EA 5JCWA 4PX1A 4QL9A 4FH8A 5ECQB 1FG4A 1AIUA 2FCHA 1NSWA 3C1RA 2XC2A 1B4QA 2E2MA 1ERVA 4KF9A 5KOWA 2DMMA 5D96A 3VI7A 3UBKA 3L4NA 4IGJA 3UJ1A 1X9WB 1F3AA 4MABA 3LXZA 4ILFA 2WS2A 3LWAA 5D8IA 2OE3A 3I9V2 2KP1A 1GWCA 5DAKB 2LRCA 1T7PB 1X5DA 3FZ5A 1R5PA 3WGEA 2C0GA 2H72A 1TKDB 1ST9A 12GSA 2GT6A 2HYXA 4V1Ag 4XS4A 3I69A 3L9UA 3M1GA 2IMEA 1PMTA 3VWVA 4PQ1A 3GKNA 2FWFA 1EP7A 2CQ9A 2WJUA 4HUAA 1TOFA 4XRAA 5F07A 1KTEA 5CNWA 3HD5A 3ZZXA 2R0PA 3Q6OA 3IR4A 3LFLA 4DSSB 1JHBA 1Z9HA 1V40A 2QSIA 1JZOA 4IW9A 4E8EA 5GZZB 3H93A 1ZOFA 2D2ZA 3LGCA 2FWHA 2IIYA 3QR6A 4NV5A 1UC7A 1GSQA 4G0KA 6GSWA 4I6XA 4GQFA 1NHOA 2CV4A 2VCVA 4AGSA 2X8CA 2A4HA 5HR2A 2FA8A 5DCGA 1EV9A 2LJAA 4K8MA 3WT1A 1YKCA 2H1DA 3G9BA 1GUKA 1OAZA 2GSQA 4HSCX 3M3MA 4EO3A 4ML6A 4K5SA 1TW9A 1THXA 2VL2C 2R37A 3DYRA 3ZVJA 2GZYA 4HZ4A 3FY7A 1CQHA 3BOAA 4JEDA 4XCSA 3ZITA 4PXOA 1RQMA 5CP1A 1GRXA 1SENA 1AQVA 2G0FA 5ID2B 2E7PA 1AQXA 2I3YA 2ZUPA 3TRXA 1K0BA 1O6JA 1OKTA 3DVWA 4IJ3A 3ERGA 1M2DA 5IMDA 4I8BA 4OCEA 10GSA 3TB2A 4HZ2A 3HVSA 3QOUA 2I1UA 5HR3A 5D9TA 3LYPA 2NPBA 3C73A 4WKWA 3GURA 2IN3A 4HI7A 2DC5A 1Y6EA 2C0EA 3HY2A 2HSMA 1PX7A 3HKRA 4NHZA 1FOVA 4JR6A 2DBCA 2HRNA 1SD8A 5D73A 1LU4A 3EU3A 4MK3A 2B6MA 4Z2TA 1GULA 4PURA 3CRTA 2LKUA 3KM6A 5DVBA 2QKEA 3HZ4A 1VGLA 1XWBA 1XFLA 3W8SA 2FNOA 4L8EA 4OCFA 5IM9A 1DE2A 3TKPA 3D4MA 4HJMA 2FGXA 4D73A 2NVLA 3GL5A 1SKRB 3FMWA 4DSRA 2LS5A 4GSNA 5G31A 2X99A 2EIRA 2B5EA 5ECOB 1O8XA 1ERUA
chains in the Genus database with same CATH topology
4YQUA 4TW5A 5IMZA 2LNSA 1EGRA 2M72A 5JCGA 1U6TA 4MH2A 2V2GA 9GSSA 4TKYA 1JZDA 3G7JA 1AQWA 4USSA 4OO5A 3CYNA 16GSA 2YZUA 4WF5A 2FD3A 1QK8A 4OFTA 5ABRA 4HQSA 5CRWA 4EDZA 4BVYB 2I9HA 1EGOA 1MDJA 4I5QA 1ZCPA 2GZPA 3ZREA 1WMJA 1XBSA 4PQIA 2RM6A 2YOIA 1Z7PA 2DJ0A 3HHVA 2GSTA 4IVFA 3S9FA 3CTGA 2JL4A 3KZQA 3TJGA 4MF5A 4ZBDA 3TKQA 3WGDA 3VURA 2P5RA 4N0ZA 3TJKA 4POBA 3IRAA 1FAAA 2K8VA 3IC8A 2C4JA 3UARA 4ECJA 4LLRA 1THOA 2VL2A 2R3XA 5CRGA 3GRXA 4G0IA 2OJLA 5CREA 5DJMA 14GSA 2MMNA 3TJFA 1KEBA 1XOAA 4WEYA 2H6YA 4YH2A 2IMDA 4L0UA 3IHQA 3APSA 1JZWA 4ISDA 5LD0A 3QPMA 1A0FA 2RUEA 3L0HA 3W8JA 2B5XA 2PVQA 3O76A 1SJ6A 3US3A 19GSA 3LQ7A 4MCUA 3KIJA 2BMXA 4DSSA 4JU5A 3BCKA 1IYHA 3MIXA 1BEDA 3A2XA 1MEKA 3ZIVA 1PQNA 1UN2A 3I43A 1KNGA 4OMVA 1Q98A 5HFIA 3FW2A 3LG6A 4XS4B 3L78A 3EINA 3HZ8A 2LJRA 3GA4A 4KGIA 17GSA 2LQOA 1WP0A 2H0IA 3VI5A 5LCZA 3DKSA 1HNCA 2YWMA 4V2MA 4HJ2A 1B9YC 1S3DA 1ZL9A 1U88A 3LXTA 4NXIA 4KNDA 1TRWA 5DALB 5DDLA 4O5QA 2OE0A 5FT3A 1SJZA 1YF0A 2WDUA 1J08A 5ID2A 1GTBA 2EC4A 3HJMA 2OADA 5ENUA 2BJXA 2BTOT 4I2TA 3LJRA 2H0GA 2IL3A 1XWAA 1HNBA 3GUSA 2P5QA 1PKZA 1NW2A 3DMLA 1YQ1A 5IQYA 4GWRA 2OACA 3R2QA 5IOWA 1MTCA 1WPIA 3J7Yk 4MJCA 4G0LA 1TRSA 1Z5YE 1YZXA 1GSFA 4WXTA 2O8VB 4LMWA 4IN0A 4ZB8A 5DQSA 4KX4A 4TXVA 4K7IA 1F3BA 2FLSA 3CSHA 3ERWA 2DJ3A 1S3AA 2OKAA 3UL3A 2F8FA 2RLIA 2WULA 5ECHB 5KEJA 2DJ1A 2H1AA 1F6MC 1K0MA 1FHEA 1BJXA 2YWIA 2PVOC 3GFKA 3TOUA 4EVMA 2UZ8A 1ZZYA 3HJPA 4TR1A 1O8WA 2JSZA 2YNXA 2VL3A 5E59A 3WYWA 4PGTA 1R26A 3TKSC 3VWXA 1LBKA 5JWRB 1EEJA 4P3YB 4A5PA 4DEJA 3Q19A 3PPUA 3G7YA 2PN8A 3ZYWA 2VLVA 2FHEA 4JRRA 3QCPA 1K3OA 3MNGA 1G6WA 4L0WA 3D21A 5IMAA 1VF4A 2O85A 4ICYA 2C80A 1FOHA 3ME7A 3BBYA 1T8EB 1AUCA 4EUYA 2H1GA 4Z7XA 5LNKe 4LMVA 2AB6A 1WJKA 4MA9A 5COHA 4MZWA 4ZL8A 4BVYA 1GSEA 5G5FA 1M9AA 2DJ2A 2HFDA 1ERWA 5DBQA 4OWYA 1SK1A 2J9HA 1XWCA 3IC4A 4ZBBA 1XW9A 4E8HA 1K0NA 3FK8A 2REMA 1N8JA 4RI7A 2PUKC 2O87A 3IBHA 2V6OA 3EPTA 1GNWA 4RI6A 1TU8A 1QQ2A 4ZL9A 5ECLB 3J7Yb 1GSSA 4I2UA 4NWYA 1XWGA 5G1LA 1QGVA 5GAND 1Q4JA 1PL2A 2JZTA 4ZXGA 2RUFA 3DGQA 2VLUA 3EMXA 5CO3A 1IYIA 1B48A 1A8LA 2VUPA 3APOA 5GSTA 2V41A 3KMOA 11GSA 4NMUA 2H8LA 1C72A 4FYBA 5AIXA 3C71A 2J23A 2MBSA 2L57A 1RW1A 5FHIA 3EC3A 1OC3A 5E4WA 2FY6A 1GL8A 4Q5NA 4PNFA 4AJ6A 1EOGA 1KBNA 1PA3A 3GH9A 2GTUA 2HE3A 3TRPA 2OBIA 4IHUA 4GSTA 2WGRA 3L9VA 4JE1A 3ZVJD 3TGZA 1OC9B 3CXGA 1BG5A 1X9MB 1BAYA 4JR4A 1PL1A 1FVKA 4ZILA 4F0BA 5F0GA 1OE7A 1EZKA 4F9ZA 4FQUA 5G2ZA 1BYEA 2CX3A 3M9KA 3TDGA 1XXUA 5HR0A 3GTUB 5DALA 4O7HA 2N5BA 2DMLA 4ECCA 5ELGA 2VLTA 3TKSA 3PH9A 1MDIA 5DJLA 1Z6MA 3F4TA 2GGTA 1I9DA 1XVQA 5G5EA 4GLTA 2EIQA 3KEBA 2HRAA 2DIYA 2H70A 3CBUA 5H5QA 1T1VA 4AJ7A 4PNGA 1TI1A 5AISA 2FWEA 1RK4A 4K2XA 2MMAA 1GLQA 3E9JB 1G6YA 2PMTA 5EPFA 5JWOB 4G2EA 4IQAA 1DUGA 3LSZA 5J41A 4EC0A 3RBTA 1M99A 3RHCA 1F9MA 2CA8A 2V1MA 1MD3A 1R5AA 3H8QA 2GT5A 4GSSA 1A24A 4BWSA 5KN2A 4RUVA 2DJJA 1A2JA 3D6IA 1VF1A 2MMZA 2G2QA 2N5AA 5H5RA 3TJBA 4YAVA 4MDCA 4ZL7A 4K7NA 4F82A 4J56E 1USBA 2LQQA 5J3RA 2X4AA 3AY8A 1NM3A 5GAPD 4CY6A 1OC8A 2IFQB 4MJBA 1AC1A 4POLA 1XZOA 3KD0A 2C3TA 2B5YA 4MH3A 4KA0A 4GCIA 2VOCA 4HEA2 2FUG2 1V57A 3DXBA 2VM1A 3P7XA 4K0GA 3F63A 1GSDA 2XBQA 4CHSA 2P0GA 3APQA 4TR1B 2PGTA 4PUFC 5HQPA 2PERA 2R6KA 1WIKA 4V2NA 3ERFA 3PGTA 4QQ7A 1ZYEA 2O7KA 4TVEA 4HDEA 4K9ZA 3FZ9A 2XPDA 2B3SA 1SJIA 4V1Ap 3CMIA 3EYTA 2FWGA 1QFNA 2L6DA 2IMIA 2C3NA 1URMA 5IMFA 2C0FA 3GV1A 1PSQA 2CT6A 3ZMKA 5KN1A 3O6TA 3EMPA 4PTSA 4OFMA 2WFCA 3UBLA 3EURA 2L4QA 4IJIA 4X43A 3FHKA 1MDKA 1SK2A 2VCTA 1TU7A 3KCMA 2ON5A 1YF1A 4MZCA 2CVDA 4HU7A 1OVNA 5FWGA 1WE0A 4EE0A 3ZMLA 3A5WA 2H76A 2C8UA 4O32A 3LYKA 2H1BA 2H01A 3IAS2 2B1KA 1ON4A 4LL1B 4N11A 3JCML 3ZFLA 4QL7A 3NOFA 1TRUA 1K0CA 1SYRA 2KLXA 1OC9A 4MJEA 5D9VA 1SL2B 1ILOA 3UOMA 1YKAA 1WOUA 2LJKA 2VCXA 4KW6A 4OFNA 4EL1A 1K3LA 1ZGNA 5CAXA 5G1KA 1V58A 3DVXA 3GTUA 2A4VA 1E6BA 4OD7A 3P8WA 1HD2A 5IPGA 1A23A 3FZ4A 2AV4A 1XOBA 5ECNB 4TOPA 5IMVA 4LL4B 1WWJA 3GH6A 4ECIA 2ON7A 2KP2A 2R5GA 2YJ7A 2ZNMA 5IPHA 5JWQB 4XHMA 4KCAA 2X64A 3WD6A 5F8BA 4H86A 1U3AA 2OBKA 1B9XC 3GKMA 4CW9A 5B8AA 2LSTA 4F03A 3F4RA 2RM5A 3DD3A 2CZ2A 4ZB9A 1TK0B 3Q74A 2HZFA 1O73A 4KDXA 4G9HA 3QMXA 2PU9C 3F9UA 4GTUA 2VM2A 5AGYA 1H4OA 4POMA 3ZIJA 5D9WA 1T00A 3HA9A 3P90A 3TUEA 3FRCA 4I97A 3UMAA 3F6DA 1T4ZA 2H30A 2DKHA 4WBRD 3IDVA 1I5GA 1SL0B 3ZTLA 2JZRA 1PD21 4FO5A 4ID0A 5J5NA 3KTLA 5DQYA 2HRKA 2IFQA 5B6NA 2HSYA 4HS1A 1XIYA 4YQVA 3ZLPA 3UAPA 1U87A 1ML6A 3D4TA 4YQMA 3H1NA 1OKDA 5J4UA 1ACVA 3GN3A 3HVXA 4IP1A 5A4UA 3MYDA 3SWLA 2WZ9A 2CAIA 2F8AA 4MF6A 2AUVA 4GRFA 1XWKA 5JCUA 22GSA 3GKKA 2IWTA 2I81A 1H75A 4IKHA 4O92A 4EDYA 1T3BA 1PX6A 1FW1A 3NIVA 2OA7A 3IV4A 1PN0A 3GX8A 4Q5RA 2KUCA 3A2VA 4ZB6A 1EOHA 3VWWA 3FEUA 3TKSE 5EVOA 1T4YA 6GSXA 4TRXA 3NZNA 3QD9A 4WBJA 1FVJA 2PWJA 2E2GA 3BCIA 3SBCA 20GSA 3F0IA 1X9SB 2KHPA 2CVKA 4NPBA 4NHWA 2EIOA 2A2RA 5BMUA 4L5OA 4KDYA 1EEMA 3KP8A 3F3QA 5ELAA 2X8GA 2H71A 2AJQB 2LEGA 1ZYNA 1M0UA 2L6CA 3KTBA 4MJAA 4MMMA 1GP1A 2ZCTA 3GNJA 1M9BA 2V6KA 1J9BA 1CQGA 1R7HA 3ZL5A 5B6MA 4KSMA 1HYUA 1K0DA 2GDRA 3I6AA 2K8SA 2CAQA 3DRNA 2HT9A 5EY6A 1TXXA 4EXJA 3C7MA 2TRCP 1XW6A 2VD0A 1GTUA 4GXZA 4JBBA 3A5IA 1TK8B 1PGTA 4BPYA 5B8BA 2Z9SA 4BL7B 3QAGA 3HDCA 1UVZA 4IQ1A 2HRFA 2A2SA 3CRUA 3N9JA 3GYKA 4BVXB 1XW5A 1K3YA 2VL9A 4MNNA 3PINA 3RHBA 1G7EA 3EU4A 4YKGA 4IS0A 2GVPA 4TR0A 4CY8A 5ECKB 3QFAC 1V98A 2QC7A 4KAEA 2AHEA 4YAPA 3EWLA 2YCDA 2WCIA 3VFIA 2LV3A 2H66A 3TOTA 3U5RE 5A5KA 2R0GA 3HVVA 1Z7RA 3H4KA 1YEPA 2ES7A 4O5RA 6GSUA 3M0FA 5ECMB 3RAZA 4KSOA 3VLNA 4KCEA 4IBPA 3QFBC 5D9XA 4XRDA 5HFGA 3EVIA 1O81A 2DKIA 2H6XA 4ULXA 2TRXA 3BJ5A 4TR4A 2IPAA 1WRYA 3C8EA 1FB6A 5KN3A 1SKSB 1FO5A 4K6XA 2CZ3A 4ECBA 2I4AA 1F2EA 2F51A 1XVWA 5ECRB 2HLSA 3KH9A 1F37A 4MPGA 1HNAA 2JZSA 2C1YA 5CRHA 3UIWA 4ACSA 5A4VA 1FB0A 2OE1A 4K2DA 3F4SA 3DEXA 1NHYA 1GTAA 2GQLA 4GQCA 3OR5A 1A2LA 5CYYA 2VAFA 2AAWA 13GSA 2F3MA 4XIHA 1EWXA 3ZRDA 3KGKA 4BA7A 3IHGA 6GSTA 2HZEA 1MD4A 2C0DA 2LUSA 1TP9A 1QMVA 4XTSA 1DBYA 4L5LA 1GLPA 1GTIA 3EE2A 3PR8A 4FIWA 4NV2A 1VF2A 2N5FA 4PQHA 5D93A 2VD1A 3Q18A 2GLRA 2LNTA 3RDWA 1BQ7A 2F9SA 2LRNA 5AN1A 5BRTA 1LJRA 2HNLA 5HFKA 2YN1A 3GIXA 2XPEA 4RQRA 4Z2RA 2CX4A 4IELA 2NDOA 3HCZA 1O85A 3DWVA 2YP6A 4EF0A 1TRVA 4K0NA 3HYPA 3FR9A 3N5OA 2YANA 2YWNA 2IJYA 4MLYA 4AJ8A 3F8UA 1M2BA 5ECSA 3MSZA 1JLVA 2DIZA 1A0RP 4KE3A 2LTKA 3D22A 1SYXA 1GNEA 3BD2A 4K7OA 3A3TA 3M8NA 6GSVA 5F06A 5EL8A 1QXHA 4FYUA 4DVCA 2L5OA 4N30A 3IAM2 1GSYA 5IMCA 1SL1B 1SD9A 2M80A 6GSYA 4X4JA 4K5RA 3TJJA 1AXDA 2L5LA 4TR3A 4WR5A 1XPVA 5KOXA 3QDNA 2QA2A 1JFUA 3WGXA 5L71A 4HOJA 3GMFA 2XBIA 3E0UA 5C00A 4F2IA 5ECPB 4HQZA 2MMOA 1AAZA 4JZQA 1UA5A 2QA1A 4BL7A 1U3IA 4G19A 4TXOB 7GSSA 2B7KA 5INYA 4GF0A 2K6VA 3KMNA 3VPQA 3HJOA 3D0ZA 2R4VA 2H75A 2K9FA 1GUHA 2CVBA 3GSSA 1A8YA 4IP6A 4BVXA 4ZIJA 4WETA 18GSA 1OE8A 5DAKA 4EIQA 1GH2A 3IA1A 4MPFA 4V2LA 1M7TA 2GSRA 3CSJA 3ED3A 4DSQA 5IIZA 5J9CA 2MYGA 2FA4A 2H73A 1X5CA 2VIMA 3IXRA 2WRTA 3FYGA 1EP8A 3DIEA 1X5EA 2A2PA 6GSSA 4MF7A 4AF2A 3TRQA 3G7IA 4WR4A 1G7OA 3F3RA 3W6GA 1EV4A 3FR3A 1DE1A 2DSAA 3E3EA 2GQMA 4Z2UA 5A4WA 1SKWB 1K0AA 5IO0A 3LORA 1YY7A 4J57E 5H5SA 2XHFA 1HQOA 2DLXA 1PRXA 2H19A 2MBTA 3VPTA 4G10A 1S3CA 1ZYQB 4F0CA 1SK0A 4X1UA 4K1FA 4Q5QA 2MZCA 1OYJA 2YV7A 4XS6A 3GHAA 2GQKA 1GSUA 3GKXA 2NBSA 4CDOA 4X0XA 5AIVA 2GZZA 1PKWA 4PUAA 5CRDA 3VK9A 5IO2A 4KB3A 2M46A 3V1WA 3M9JA 2KOKA 1ABAA 2AYTA 3LW9A 3IOSA 4FYCA 3TCOA 4HU9A 2GS3A 3KXOA 4RQXA 3L9SA 2L59A 2YWOA 1X0RA 1B8XA 1VRSD 3QAWA 1ZYPA 3GX0A 3D5JA 4XS1A 4ML1A 1Z6NA 2X49A 1R4WA 1TDIA 1ZMAA 1K0OA 3ISOA 5KN0A 3CTFA 4POKA 3RPNA 5F05A 5DCHA 1A2MA 2LRTA 2YPMA 4Q5FA 8GSSA 2HI7A 2JU5A 4OO4A 4BWQA 2YJHA 4J2FA 3U6VA 1TI3A 1B4PA 1O7UA 4ZBAA 4KUNA 5B7CA 2HSHA 2H6ZA 3GSTA 3F6FA 3FR6A 3CSIA 2WB9A 4TN8A 1YJ6A 3C1SA 1YDKA 2YZHA 2B7JA 2TIRA 2RIIA 1DSBA 1M2AA 1TK5B 2VCZA 3FKFA 4N10A 1E2YA 3MAKA 2E0QA 1W4VA 3HXSA 2C3QA 1XCCA 3LEFA 2R2JA 1W89A 2P31A 3IK9A 3UVHA 3VWUA 3WT2A 2HZEB 3MWHA 3KJYA 3UEMA 2QGVA 2GSSA 3ME8A 2O89A 3MDKA 3UVTA 3KH7A 5G30A 3H79A 2VCWA 4N0VA 2V32A 3ZFBA 1JZRA 3A2WA 2HXKA 2NTOA 1JLWA 5C04A 1TJDA 1Z3EA 2B1LA 2VO4A 2JSYA 3TKRA 2K18A 5IOXA 3GL3A 5J9BA 2IMFA 2L4CA 3O3TA 2IMKA 1YEXA 3FZAA 3RPPA 1J0FA 5GSSA 4MZBA 4NAXA 1PN9A 4EKZA 2DJKA 3IK7A 2X8HA 2JACA 2H0HA 5HR1A 1TTZA 1SU9A 3KP9A 2H74A 4D73B 4O5UA 5ECIB 3QAVA 4LA1A 1QUWA 2ALBA 1GUMA 4MP4A 1AW9A 4EIPA 3IPZA 4TXOA 2PPTA 1VF3A 1ERTA 1Y25A 3K8NA 2R0CA 1G0TA 4KDUA 4YKFA 3IE3A 2PBJA 1V9WA 4WF4A 2VCQA 1V2AA 2JADA 2YV9A 3P2AA 1N2AA 1BX9A 4KH7A 3R3EA 5JCWA 4PX1A 4QL9A 4FH8A 5ECQB 1FG4A 1AIUA 2FCHA 1NSWA 3C1RA 2XC2A 1B4QA 2E2MA 1ERVA 4KF9A 5KOWA 2DMMA 5D96A 3VI7A 3UBKA 3L4NA 4IGJA 3UJ1A 1X9WB 1F3AA 4MABA 3LXZA 4ILFA 2WS2A 3LWAA 5D8IA 2OE3A 3I9V2 2KP1A 1GWCA 5DAKB 2LRCA 1T7PB 1X5DA 3FZ5A 1R5PA 3WGEA 2C0GA 2H72A 1TKDB 1ST9A 12GSA 2GT6A 2HYXA 4V1Ag 4XS4A 3I69A 3L9UA 3M1GA 2IMEA 1PMTA 3VWVA 4PQ1A 3GKNA 2FWFA 1EP7A 2CQ9A 2WJUA 4HUAA 1TOFA 4XRAA 5F07A 1KTEA 5CNWA 3HD5A 3ZZXA 2R0PA 3Q6OA 3IR4A 3LFLA 4DSSB 1JHBA 1Z9HA 1V40A 2QSIA 1JZOA 4IW9A 4E8EA 5GZZB 3H93A 1ZOFA 2D2ZA 3LGCA 2FWHA 2IIYA 3QR6A 4NV5A 1UC7A 1GSQA 4G0KA 6GSWA 4I6XA 4GQFA 1NHOA 2CV4A 2VCVA 4AGSA 2X8CA 2A4HA 5HR2A 2FA8A 5DCGA 1EV9A 2LJAA 4K8MA 3WT1A 1YKCA 2H1DA 3G9BA 1GUKA 1OAZA 2GSQA 3M3MA 4EO3A 4ML6A 4K5SA 1TW9A 1THXA 2VL2C 2R37A 3DYRA 3ZVJA 2GZYA 4HZ4A 3FY7A 1CQHA 3BOAA 4JEDA 4XCSA 3ZITA 4PXOA 1RQMA 5CP1A 1GRXA 1SENA 1AQVA 2G0FA 5ID2B 2E7PA 1AQXA 2I3YA 2ZUPA 3TRXA 1K0BA 1O6JA 1OKTA 3DVWA 4IJ3A 3ERGA 1M2DA 5IMDA 4I8BA 4OCEA 10GSA 3TB2A 4HZ2A 3HVSA 3QOUA 2I1UA 5HR3A 5D9TA 3LYPA 2NPBA 3C73A 4WKWA 3GURA 2IN3A 4HI7A 2DC5A 1Y6EA 2C0EA 3HY2A 2HSMA 1PX7A 3HKRA 4NHZA 1FOVA 4JR6A 2DBCA 2HRNA 1SD8A 5D73A 1LU4A 3EU3A 4MK3A 2B6MA 4Z2TA 1GULA 4PURA 3CRTA 2LKUA 3KM6A 5DVBA 2QKEA 3HZ4A 1VGLA 1XWBA 1XFLA 3W8SA 2FNOA 4L8EA 4OCFA 5IM9A 1DE2A 3TKPA 3D4MA 4HJMA 2FGXA 4D73A 2NVLA 3GL5A 1SKRB 3FMWA 4DSRA 2LS5A 4GSNA 5G31A 2X99A 2EIRA 2B5EA 5ECOB 1O8XA 1ERUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQU A;  4TW5 A;  5IMZ A;  2LNS A;  1EGR A;  2M72 A;  5JCG A;  1U6T A;  4MH2 A;  2V2G A;  9GSS A;  4TKY A;  1JZD A;  3G7J A;  1AQW A;  4OO5 A;  3CYN A;  16GS A;  2YZU A;  4WF5 A;  2FD3 A;  1QK8 A;  4OFT A;  5ABR A;  4HQS A;  5CRW A;  4EDZ A;  2I9H A;  1EGO A;  1MDJ A;  4I5Q A;  1ZCP A;  2GZP A;  3ZRE A;  1WMJ A;  1XBS A;  4PQI A;  2RM6 A;  2YOI A;  1Z7P A;  2DJ0 A;  3HHV A;  2GST A;  4IVF A;  3S9F A;  3CTG A;  2JL4 A;  3KZQ A;  3TJG A;  4MF5 A;  4ZBD A;  3TKQ A;  3WGD A;  3VUR A;  2P5R A;  4N0Z A;  3TJK A;  4POB A;  3IRA A;  1FAA A;  2K8V A;  2C4J A;  3UAR A;  4ECJ A;  4LLR A;  1THO A;  2VL2 A;  2R3X A;  5CRG A;  3GRX A;  2OJL A;  5CRE A;  5DJM A;  14GS A;  2MMN A;  3TJF A;  1KEB A;  1XOA A;  4WEY A;  2H6Y A;  4YH2 A;  2IMD A;  4L0U A;  3IHQ A;  3APS A;  1JZW A;  4ISD A;  5LD0 A;  3QPM A;  1A0F A;  2RUE A;  3L0H A;  3W8J A;  2B5X A;  2PVQ A;  3O76 A;  1SJ6 A;  3US3 A;  19GS A;  3LQ7 A;  4MCU A;  3KIJ A;  2BMX A;  4DSS A;  4JU5 A;  3BCK A;  1IYH A;  1BED A;  3A2X A;  1MEK A;  3ZIV A;  1PQN A;  1UN2 A;  3I43 A;  1KNG A;  4OMV A;  1Q98 A;  5HFI A;  3FW2 A;  3LG6 A;  4XS4 B;  3L78 A;  3EIN A;  3HZ8 A;  2LJR A;  3GA4 A;  4KGI A;  17GS A;  2LQO A;  1WP0 A;  2H0I A;  3VI5 A;  5LCZ A;  3DKS A;  1HNC A;  2YWM A;  4V2M A;  4HJ2 A;  1B9Y C;  1S3D A;  1ZL9 A;  1U88 A;  3LXT A;  4NXI A;  4KND A;  1TRW A;  5DAL B;  5DDL A;  2OE0 A;  5FT3 A;  1SJZ A;  1YF0 A;  2WDU A;  1J08 A;  5ID2 A;  1GTB A;  2EC4 A;  3HJM A;  2OAD A;  5ENU A;  2BJX A;  2BTO T;  4I2T A;  3LJR A;  2H0G A;  2IL3 A;  1XWA A;  1HNB A;  3GUS A;  2P5Q A;  1PKZ A;  1NW2 A;  3DML A;  1YQ1 A;  5IQY A;  4GWR A;  2OAC A;  3R2Q A;  5IOW A;  1MTC A;  1WPI A;  3J7Y k;  4MJC A;  1TRS A;  1Z5Y E;  1YZX A;  1GSF A;  4WXT A;  2O8V B;  4LMW A;  4IN0 A;  4ZB8 A;  5DQS A;  4KX4 A;  4TXV A;  4K7I A;  1F3B A;  2FLS A;  3CSH A;  3ERW A;  2DJ3 A;  1S3A A;  2OKA A;  3UL3 A;  2F8F A;  2RLI A;  2WUL A;  5ECH B;  5KEJ A;  2DJ1 A;  2H1A A;  1F6M C;  1K0M A;  1FHE A;  1BJX A;  2YWI A;  2PVO C;  3GFK A;  3TOU A;  4EVM A;  1ZZY A;  3HJP A;  4TR1 A;  1O8W A;  2JSZ A;  2YNX A;  2VL3 A;  5E59 A;  3WYW A;  4PGT A;  1R26 A;  3TKS C;  3VWX A;  1LBK A;  5JWR B;  1EEJ A;  4P3Y B;  4DEJ A;  3Q19 A;  3G7Y A;  2PN8 A;  3ZYW A;  2VLV A;  2FHE A;  4JRR A;  3QCP A;  1K3O A;  3MNG A;  1G6W A;  4L0W A;  3D21 A;  5IMA A;  1VF4 A;  2O85 A;  2C80 A;  3ME7 A;  3BBY A;  1T8E B;  1AUC A;  4EUY A;  2H1G A;  4Z7X A;  5LNK e;  4LMV A;  2AB6 A;  1WJK A;  4MA9 A;  5COH A;  4MZW A;  4ZL8 A;  4BVY A;  1GSE A;  5G5F A;  1M9A A;  2DJ2 A;  2HFD A;  1ERW A;  5DBQ A;  4OWY A;  1SK1 A;  2J9H A;  1XWC A;  3IC4 A;  4ZBB A;  1XW9 A;  4E8H A;  1K0N A;  3FK8 A;  2REM A;  1N8J A;  4RI7 A;  2PUK C;  2O87 A;  3IBH A;  2V6O A;  1GNW A;  4RI6 A;  1TU8 A;  1QQ2 A;  4ZL9 A;  5ECL B;  3J7Y b;  1GSS A;  4I2U A;  4NWY A;  1XWG A;  5G1L A;  1QGV A;  5GAN D;  1Q4J A;  1PL2 A;  2JZT A;  4ZXG A;  2RUF A;  3DGQ A;  2VLU A;  3EMX A;  1IYI A;  5CO3 A;  1B48 A;  1A8L A;  2VUP A;  3APO A;  5GST A;  2V41 A;  3KMO A;  11GS A;  4NMU A;  2H8L A;  1C72 A;  4FYB A;  5AIX A;  3C71 A;  2J23 A;  2MBS A;  2L57 A;  1RW1 A;  5FHI A;  3EC3 A;  1OC3 A;  5E4W A;  2FY6 A;  1GL8 A;  4Q5N A;  4PNF A;  4AJ6 A;  1EOG A;  1KBN A;  1PA3 A;  3GH9 A;  2GTU A;  2HE3 A;  3TRP A;  2OBI A;  4IHU A;  4GST A;  2WGR A;  3L9V A;  4JE1 A;  3ZVJ D;  3TGZ A;  1OC9 B;  3CXG A;  1BG5 A;  1X9M B;  1BAY A;  4JR4 A;  1PL1 A;  1FVK A;  4ZIL A;  4F0B A;  5F0G A;  1OE7 A;  1EZK A;  4F9Z A;  5G2Z A;  1BYE A;  2CX3 A;  3M9K A;  3TDG A;  1XXU A;  5HR0 A;  3GTU B;  5DAL A;  4O7H A;  2N5B A;  2DML A;  4ECC A;  5ELG A;  2VLT A;  3TKS A;  3PH9 A;  1MDI A;  5DJL A;  1Z6M A;  3F4T A;  2GGT A;  1I9D A;  1XVQ A;  5G5E A;  4GLT A;  2EIQ A;  3KEB A;  2DIY A;  2H70 A;  3CBU A;  5H5Q A;  1T1V A;  4AJ7 A;  4PNG A;  1TI1 A;  5AIS A;  2FWE A;  1RK4 A;  2MMA A;  1GLQ A;  3E9J B;  1G6Y A;  2PMT A;  5EPF A;  5JWO B;  4G2E A;  4IQA A;  1DUG A;  3LSZ A;  5J41 A;  4EC0 A;  3RBT A;  1M99 A;  3RHC A;  1F9M A;  2CA8 A;  2V1M A;  1MD3 A;  1R5A A;  3H8Q A;  2GT5 A;  4GSS A;  1A24 A;  4BWS A;  5KN2 A;  4RUV A;  2DJJ A;  1A2J A;  3D6I A;  1VF1 A;  2MMZ A;  2G2Q A;  2N5A A;  5H5R A;  3TJB A;  4YAV A;  4MDC A;  4ZL7 A;  4K7N A;  4F82 A;  4J56 E;  1USB A;  2LQQ A;  5J3R A;  3AY8 A;  1NM3 A;  5GAP D;  1OC8 A;  2IFQ B;  4MJB A;  1AC1 A;  4POL A;  1XZO A;  3KD0 A;  2C3T A;  2B5Y A;  4MH3 A;  4KA0 A;  4GCI A;  2VOC A;  4HEA 2;  2FUG 2;  1V57 A;  3DXB A;  2VM1 A;  3P7X A;  4K0G A;  3F63 A;  1GSD A;  2XBQ A;  4CHS A;  2P0G A;  3APQ A;  4TR1 B;  2PGT A;  4PUF C;  5HQP A;  2PER A;  2R6K A;  1WIK A;  4V2N A;  3ERF A;  3PGT A;  4QQ7 A;  1ZYE A;  2O7K A;  4TVE A;  4HDE A;  4K9Z A;  3FZ9 A;  2XPD A;  2B3S A;  1SJI A;  4V1A p;  3CMI A;  3EYT A;  2FWG A;  1QFN A;  2L6D A;  2IMI A;  2C3N A;  1URM A;  5IMF A;  2C0F A;  3GV1 A;  1PSQ A;  2CT6 A;  3ZMK A;  5KN1 A;  3O6T A;  3EMP A;  4OFM A;  2WFC A;  3UBL A;  3EUR A;  2L4Q A;  4IJI A;  4X43 A;  3FHK A;  1MDK A;  1SK2 A;  2VCT A;  1TU7 A;  3KCM A;  2ON5 A;  1YF1 A;  4MZC A;  2CVD A;  4HU7 A;  1OVN A;  5FWG A;  1WE0 A;  4EE0 A;  3ZML A;  3A5W A;  2H76 A;  2C8U A;  4O32 A;  3LYK A;  2H1B A;  2H01 A;  3IAS 2;  2B1K A;  1ON4 A;  4LL1 B;  4N11 A;  3JCM L;  3ZFL A;  4QL7 A;  3NOF A;  1TRU A;  1K0C A;  1SYR A;  2KLX A;  1OC9 A;  4MJE A;  5D9V A;  1SL2 B;  1ILO A;  3UOM A;  1YKA A;  1WOU A;  2LJK A;  2VCX A;  4KW6 A;  4OFN A;  4EL1 A;  1K3L A;  1ZGN A;  5CAX A;  5G1K A;  1V58 A;  3DVX A;  3GTU A;  2A4V A;  1E6B A;  4OD7 A;  3P8W A;  1HD2 A;  5IPG A;  1A23 A;  3FZ4 A;  2AV4 A;  1XOB A;  5ECN B;  4TOP A;  5IMV A;  4LL4 B;  1WWJ A;  3GH6 A;  4ECI A;  2ON7 A;  2KP2 A;  2R5G A;  2YJ7 A;  2ZNM A;  5IPH A;  5JWQ B;  4XHM A;  4KCA A;  2X64 A;  3WD6 A;  5F8B A;  4H86 A;  1U3A A;  2OBK A;  1B9X C;  3GKM A;  4CW9 A;  5B8A A;  2LST A;  4F03 A;  3F4R A;  2RM5 A;  3DD3 A;  2CZ2 A;  4ZB9 A;  1TK0 B;  3Q74 A;  2HZF A;  1O73 A;  4KDX A;  4G9H A;  3QMX A;  2PU9 C;  3F9U A;  4GTU A;  2VM2 A;  5AGY A;  1H4O A;  4POM A;  3ZIJ A;  5D9W A;  1T00 A;  3HA9 A;  3P90 A;  3TUE A;  3FRC A;  4I97 A;  3UMA A;  3F6D A;  1T4Z A;  2H30 A;  4WBR D;  3IDV A;  1I5G A;  1SL0 B;  3ZTL A;  2JZR A;  1PD2 1;  4FO5 A;  4ID0 A;  5J5N A;  3KTL A;  5DQY A;  2IFQ A;  5B6N A;  2HSY A;  4HS1 A;  1XIY A;  4YQV A;  3ZLP A;  3UAP A;  1U87 A;  1ML6 A;  3D4T A;  4YQM A;  3H1N A;  1OKD A;  5J4U A;  1ACV A;  3GN3 A;  3HVX A;  4IP1 A;  5A4U A;  3SWL A;  2WZ9 A;  2CAI A;  2F8A A;  4MF6 A;  2AUV A;  4GRF A;  1XWK A;  5JCU A;  22GS A;  3GKK A;  2IWT A;  2I81 A;  1H75 A;  4IKH A;  4O92 A;  4EDY A;  1T3B A;  1PX6 A;  1FW1 A;  3NIV A;  2OA7 A;  3IV4 A;  3GX8 A;  4Q5R A;  2KUC A;  3A2V A;  4ZB6 A;  1EOH A;  3VWW A;  3FEU A;  3TKS E;  5EVO A;  1T4Y A;  6GSX A;  4TRX A;  3NZN A;  3QD9 A;  4WBJ A;  1FVJ A;  2PWJ A;  2E2G A;  3BCI A;  3SBC A;  20GS A;  3F0I A;  1X9S B;  2KHP A;  2CVK A;  4NPB A;  4NHW A;  2EIO A;  2A2R A;  4L5O A;  4KDY A;  1EEM A;  3KP8 A;  3F3Q A;  5ELA A;  2X8G A;  2H71 A;  2AJQ B;  2LEG A;  1M0U A;  2L6C A;  3KTB A;  4MJA A;  4MMM A;  1GP1 A;  2ZCT A;  3GNJ A;  1M9B A;  2V6K A;  1J9B A;  1CQG A;  1R7H A;  3ZL5 A;  5B6M A;  4KSM A;  1HYU A;  1K0D A;  2GDR A;  3I6A A;  2K8S A;  2CAQ A;  3DRN A;  2HT9 A;  5EY6 A;  1TXX A;  4EXJ A;  3C7M A;  2TRC P;  1XW6 A;  2VD0 A;  1GTU A;  4GXZ A;  4JBB A;  1TK8 B;  1PGT A;  4BPY A;  5B8B A;  2Z9S A;  3QAG A;  3HDC A;  1UVZ A;  4IQ1 A;  2HRF A;  2A2S A;  3CRU A;  3N9J A;  3GYK A;  1XW5 A;  1K3Y A;  2VL9 A;  3PIN A;  3RHB A;  1G7E A;  3EU4 A;  4IS0 A;  2GVP A;  4TR0 A;  5ECK B;  3QFA C;  1V98 A;  2QC7 A;  4KAE A;  2AHE A;  4YAP A;  3EWL A;  2YCD A;  2WCI A;  3VFI A;  2LV3 A;  2H66 A;  3TOT A;  3U5R E;  5A5K A;  3HVV A;  1Z7R A;  3H4K A;  1YEP A;  2ES7 A;  4O5R A;  6GSU A;  3M0F A;  5ECM B;  3RAZ A;  4KSO A;  3VLN A;  4KCE A;  4IBP A;  3QFB C;  5D9X A;  4XRD A;  5HFG A;  3EVI A;  1O81 A;  2H6X A;  4ULX A;  2TRX A;  3BJ5 A;  4TR4 A;  2IPA A;  1WRY A;  3C8E A;  1FB6 A;  5KN3 A;  1SKS B;  1FO5 A;  4K6X A;  2CZ3 A;  4ECB A;  2I4A A;  1F2E A;  2F51 A;  1XVW A;  5ECR B;  2HLS A;  3KH9 A;  1F37 A;  4MPG A;  1HNA A;  2JZS A;  2C1Y A;  5CRH A;  3UIW A;  4ACS A;  5A4V A;  1FB0 A;  2OE1 A;  4K2D A;  3F4S A;  3DEX A;  1NHY A;  1GTA A;  2GQL A;  4GQC A;  3OR5 A;  1A2L A;  5CYY A;  2VAF A;  2AAW A;  13GS A;  2F3M A;  4XIH A;  1EWX A;  3ZRD A;  3KGK A;  4BA7 A;  6GST A;  2HZE A;  1MD4 A;  2C0D A;  2LUS A;  1TP9 A;  1QMV A;  4XTS A;  1DBY A;  4L5L A;  1GLP A;  1GTI A;  3EE2 A;  3PR8 A;  4FIW A;  4NV2 A;  1VF2 A;  2N5F A;  4PQH A;  5D93 A;  2VD1 A;  3Q18 A;  2GLR A;  2LNT A;  3RDW A;  1BQ7 A;  2F9S A;  2LRN A;  5AN1 A;  1LJR A;  2HNL A;  5HFK A;  2YN1 A;  3GIX A;  2XPE A;  4RQR A;  2CX4 A;  4IEL A;  2NDO A;  3HCZ A;  1O85 A;  3DWV A;  2YP6 A;  4EF0 A;  1TRV A;  4K0N A;  3HYP A;  3FR9 A;  3N5O A;  2YAN A;  2YWN A;  2IJY A;  4MLY A;  4AJ8 A;  3F8U A;  1M2B A;  5ECS A;  3MSZ A;  1JLV A;  2DIZ A;  1A0R P;  4KE3 A;  2LTK A;  3D22 A;  1SYX A;  1GNE A;  3BD2 A;  4K7O A;  3A3T A;  3M8N A;  6GSV A;  5F06 A;  5EL8 A;  1QXH A;  4FYU A;  4DVC A;  2L5O A;  4N30 A;  3IAM 2;  1GSY A;  5IMC A;  1SL1 B;  1SD9 A;  2M80 A;  6GSY A;  3TJJ A;  1AXD A;  2L5L A;  4TR3 A;  4WR5 A;  1XPV A;  3QDN A;  1JFU A;  3WGX A;  5L71 A;  4HOJ A;  3GMF A;  2XBI A;  3E0U A;  5C00 A;  4F2I A;  5ECP B;  4HQZ A;  2MMO A;  1AAZ A;  4JZQ A;  1UA5 A;  4BL7 A;  1U3I A;  4G19 A;  4TXO B;  7GSS A;  2B7K A;  5INY A;  4GF0 A;  2K6V A;  3KMN A;  3VPQ A;  3HJO A;  3D0Z A;  2R4V A;  2H75 A;  2K9F A;  1GUH A;  2CVB A;  3GSS A;  1A8Y A;  4IP6 A;  4BVX A;  4ZIJ A;  4WET A;  18GS A;  1OE8 A;  5DAK A;  1GH2 A;  3IA1 A;  4MPF A;  4V2L A;  1M7T A;  2GSR A;  3CSJ A;  3ED3 A;  4DSQ A;  5IIZ A;  5J9C A;  2MYG A;  2FA4 A;  2H73 A;  1X5C A;  2VIM A;  3IXR A;  2WRT A;  3FYG A;  1EP8 A;  3DIE A;  1X5E A;  6GSS A;  4MF7 A;  4AF2 A;  3TRQ A;  3G7I A;  4WR4 A;  1G7O A;  3F3R A;  3W6G A;  1EV4 A;  3FR3 A;  1DE1 A;  2DSA A;  3E3E A;  2GQM A;  5A4W A;  1SKW B;  1K0A A;  5IO0 A;  3LOR A;  1YY7 A;  4J57 E;  5H5S A;  2XHF A;  1HQO A;  2DLX A;  1PRX A;  2H19 A;  2MBT A;  3VPT A;  4G10 A;  1S3C A;  1ZYQ B;  4F0C A;  1SK0 A;  4X1U A;  4K1F A;  4Q5Q A;  2MZC A;  1OYJ A;  2YV7 A;  4XS6 A;  3GHA A;  2GQK A;  1GSU A;  3GKX A;  2NBS A;  4CDO A;  4X0X A;  5AIV A;  2GZZ A;  1PKW A;  4PUA A;  5CRD A;  3VK9 A;  5IO2 A;  4KB3 A;  2M46 A;  3V1W A;  3M9J A;  2KOK A;  1ABA A;  2AYT A;  3IOS A;  4FYC A;  3TCO A;  4HU9 A;  2GS3 A;  3KXO A;  4RQX A;  3L9S A;  2L59 A;  2YWO A;  1X0R A;  1B8X A;  1VRS D;  3QAW A;  3GX0 A;  3D5J A;  4XS1 A;  4ML1 A;  1Z6N A;  1R4W A;  1TDI A;  1ZMA A;  1K0O A;  3ISO A;  5KN0 A;  3CTF A;  4POK A;  3RPN A;  5F05 A;  5DCH A;  1A2M A;  2LRT A;  2YPM A;  4Q5F A;  8GSS A;  2HI7 A;  2JU5 A;  4OO4 A;  4BWQ A;  2YJH A;  4J2F A;  3U6V A;  1TI3 A;  1B4P A;  1O7U A;  4ZBA A;  4KUN A;  5B7C A;  2HSH A;  2H6Z A;  3GST A;  3F6F A;  3FR6 A;  3CSI A;  2WB9 A;  4TN8 A;  1YJ6 A;  3C1S A;  1YDK A;  2YZH A;  2B7J A;  2TIR A;  2RII A;  1DSB A;  1M2A A;  1TK5 B;  2VCZ A;  3FKF A;  4N10 A;  1E2Y A;  3MAK A;  2E0Q A;  1W4V A;  3HXS A;  2C3Q A;  1XCC A;  3LEF A;  2R2J A;  1W89 A;  2P31 A;  3IK9 A;  3UVH A;  3VWU A;  3WT2 A;  2HZE B;  3MWH A;  3KJY A;  3UEM A;  2QGV A;  2GSS A;  3ME8 A;  2O89 A;  3MDK A;  3UVT A;  3KH7 A;  5G30 A;  3H79 A;  2VCW A;  4N0V A;  2V32 A;  3ZFB A;  1JZR A;  3A2W A;  2HXK A;  2NTO A;  1JLW A;  5C04 A;  1TJD A;  1Z3E A;  2B1L A;  2VO4 A;  2JSY A;  3TKR A;  2K18 A;  5IOX A;  3GL3 A;  5J9B A;  2IMF A;  2L4C A;  3O3T A;  2IMK A;  1YEX A;  3FZA A;  3RPP A;  1J0F A;  5GSS A;  4MZB A;  4NAX A;  1PN9 A;  4EKZ A;  2DJK A;  3IK7 A;  2X8H A;  2JAC A;  2H0H A;  5HR1 A;  1TTZ A;  1SU9 A;  3KP9 A;  2H74 A;  4D73 B;  5ECI B;  3QAV A;  4LA1 A;  1QUW A;  2ALB A;  1GUM A;  4MP4 A;  1AW9 A;  3IPZ A;  4TXO A;  2PPT A;  1VF3 A;  1ERT A;  1Y25 A;  3K8N A;  1G0T A;  4KDU A;  3IE3 A;  2PBJ A;  1V9W A;  4WF4 A;  2VCQ A;  1V2A A;  2JAD A;  2YV9 A;  3P2A A;  1N2A A;  1BX9 A;  4KH7 A;  5JCW A;  4PX1 A;  4QL9 A;  4FH8 A;  5ECQ B;  1FG4 A;  1AIU A;  2FCH A;  1NSW A;  3C1R A;  2XC2 A;  1B4Q A;  2E2M A;  1ERV A;  2DMM A;  5D96 A;  3VI7 A;  3UBK A;  3L4N A;  4IGJ A;  3UJ1 A;  1X9W B;  1F3A A;  4MAB A;  3LXZ A;  4ILF A;  2WS2 A;  3LWA A;  5D8I A;  2OE3 A;  3I9V 2;  2KP1 A;  1GWC A;  5DAK B;  2LRC A;  1T7P B;  1X5D A;  3FZ5 A;  1R5P A;  3WGE A;  2C0G A;  2H72 A;  1TKD B;  1ST9 A;  12GS A;  2GT6 A;  2HYX A;  4V1A g;  4XS4 A;  3I69 A;  3L9U A;  3M1G A;  2IME A;  1PMT A;  3VWV A;  4PQ1 A;  3GKN A;  2FWF A;  1EP7 A;  2CQ9 A;  2WJU A;  4HUA A;  1TOF A;  4XRA A;  5F07 A;  1KTE A;  5CNW A;  3HD5 A;  3ZZX A;  3Q6O A;  3IR4 A;  3LFL A;  4DSS B;  1JHB A;  1Z9H A;  1V40 A;  2QSI A;  1JZO A;  4IW9 A;  4E8E A;  5GZZ B;  3H93 A;  1ZOF A;  2D2Z A;  3LGC A;  2FWH A;  2IIY A;  3QR6 A;  4NV5 A;  1UC7 A;  1GSQ A;  6GSW A;  4I6X A;  4GQF A;  1NHO A;  2CV4 A;  2VCV A;  4AGS A;  2X8C A;  5HR2 A;  2FA8 A;  5DCG A;  1EV9 A;  2LJA A;  4K8M A;  3WT1 A;  1YKC A;  2H1D A;  3G9B A;  1GUK A;  1OAZ A;  2GSQ A;  3M3M A;  4EO3 A;  4ML6 A;  1TW9 A;  1THX A;  2VL2 C;  2R37 A;  3DYR A;  3ZVJ A;  2GZY A;  4HZ4 A;  3FY7 A;  1CQH A;  3BOA A;  4JED A;  4XCS A;  3ZIT A;  4PXO A;  1RQM A;  5CP1 A;  1GRX A;  1SEN A;  1AQV A;  2G0F A;  5ID2 B;  2E7P A;  1AQX A;  2I3Y A;  2ZUP A;  3TRX A;  1K0B A;  1O6J A;  1OKT A;  3DVW A;  4IJ3 A;  3ERG A;  1M2D A;  5IMD A;  4I8B A;  4OCE A;  10GS A;  3TB2 A;  4HZ2 A;  3HVS A;  3QOU A;  2I1U A;  5HR3 A;  5D9T A;  3LYP A;  2NPB A;  3C73 A;  4WKW A;  3GUR A;  2IN3 A;  4HI7 A;  2DC5 A;  1Y6E A;  2C0E A;  3HY2 A;  1PX7 A;  3HKR A;  4NHZ A;  1FOV A;  4JR6 A;  2DBC A;  2HRN A;  1SD8 A;  5D73 A;  1LU4 A;  3EU3 A;  4MK3 A;  2B6M A;  1GUL A;  4PUR A;  3CRT A;  2LKU A;  3KM6 A;  5DVB A;  2QKE A;  3HZ4 A;  1VGL A;  1XWB A;  1XFL A;  3W8S A;  2FNO A;  4L8E A;  4OCF A;  5IM9 A;  1DE2 A;  3TKP A;  3D4M A;  4HJM A;  2FGX A;  4D73 A;  2NVL A;  3GL5 A;  1SKR B;  4DSR A;  2LS5 A;  4GSN A;  5G31 A;  2X99 A;  2EIR A;  2B5E A;  5ECO B;  1O8X A;  1ERU A; 
#chains in the Genus database with same CATH topology
 4YQU A;  4TW5 A;  5IMZ A;  2LNS A;  1EGR A;  2M72 A;  5JCG A;  1U6T A;  4MH2 A;  2V2G A;  9GSS A;  4TKY A;  1JZD A;  3G7J A;  1AQW A;  4USS A;  4OO5 A;  3CYN A;  16GS A;  2YZU A;  4WF5 A;  2FD3 A;  1QK8 A;  4OFT A;  5ABR A;  4HQS A;  5CRW A;  4EDZ A;  4BVY B;  2I9H A;  1EGO A;  1MDJ A;  4I5Q A;  1ZCP A;  2GZP A;  3ZRE A;  1WMJ A;  1XBS A;  4PQI A;  2RM6 A;  2YOI A;  1Z7P A;  2DJ0 A;  3HHV A;  2GST A;  4IVF A;  3S9F A;  3CTG A;  2JL4 A;  3KZQ A;  3TJG A;  4MF5 A;  4ZBD A;  3TKQ A;  3WGD A;  3VUR A;  2P5R A;  4N0Z A;  3TJK A;  4POB A;  3IRA A;  1FAA A;  2K8V A;  3IC8 A;  2C4J A;  3UAR A;  4ECJ A;  4LLR A;  1THO A;  2VL2 A;  2R3X A;  5CRG A;  3GRX A;  4G0I A;  2OJL A;  5CRE A;  5DJM A;  14GS A;  2MMN A;  3TJF A;  1KEB A;  1XOA A;  4WEY A;  2H6Y A;  4YH2 A;  2IMD A;  4L0U A;  3IHQ A;  3APS A;  1JZW A;  4ISD A;  5LD0 A;  3QPM A;  1A0F A;  2RUE A;  3L0H A;  3W8J A;  2B5X A;  2PVQ A;  3O76 A;  1SJ6 A;  3US3 A;  19GS A;  3LQ7 A;  4MCU A;  3KIJ A;  2BMX A;  4DSS A;  4JU5 A;  3BCK A;  1IYH A;  3MIX A;  1BED A;  3A2X A;  1MEK A;  3ZIV A;  1PQN A;  1UN2 A;  3I43 A;  1KNG A;  4OMV A;  1Q98 A;  5HFI A;  3FW2 A;  3LG6 A;  4XS4 B;  3L78 A;  3EIN A;  3HZ8 A;  2LJR A;  3GA4 A;  4KGI A;  17GS A;  2LQO A;  1WP0 A;  2H0I A;  3VI5 A;  5LCZ A;  3DKS A;  1HNC A;  2YWM A;  4V2M A;  4HJ2 A;  1B9Y C;  1S3D A;  1ZL9 A;  1U88 A;  3LXT A;  4NXI A;  4KND A;  1TRW A;  5DAL B;  5DDL A;  4O5Q A;  2OE0 A;  5FT3 A;  1SJZ A;  1YF0 A;  2WDU A;  1J08 A;  5ID2 A;  1GTB A;  2EC4 A;  3HJM A;  2OAD A;  5ENU A;  2BJX A;  2BTO T;  4I2T A;  3LJR A;  2H0G A;  2IL3 A;  1XWA A;  1HNB A;  3GUS A;  2P5Q A;  1PKZ A;  1NW2 A;  3DML A;  1YQ1 A;  5IQY A;  4GWR A;  2OAC A;  3R2Q A;  5IOW A;  1MTC A;  1WPI A;  3J7Y k;  4MJC A;  4G0L A;  1TRS A;  1Z5Y E;  1YZX A;  1GSF A;  4WXT A;  2O8V B;  4LMW A;  4IN0 A;  4ZB8 A;  5DQS A;  4KX4 A;  4TXV A;  4K7I A;  1F3B A;  2FLS A;  3CSH A;  3ERW A;  2DJ3 A;  1S3A A;  2OKA A;  3UL3 A;  2F8F A;  2RLI A;  2WUL A;  5ECH B;  5KEJ A;  2DJ1 A;  2H1A A;  1F6M C;  1K0M A;  1FHE A;  1BJX A;  2YWI A;  2PVO C;  3GFK A;  3TOU A;  4EVM A;  2UZ8 A;  1ZZY A;  3HJP A;  4TR1 A;  1O8W A;  2JSZ A;  2YNX A;  2VL3 A;  5E59 A;  3WYW A;  4PGT A;  1R26 A;  3TKS C;  3VWX A;  1LBK A;  5JWR B;  1EEJ A;  4P3Y B;  4A5P A;  4DEJ A;  3Q19 A;  3PPU A;  3G7Y A;  2PN8 A;  3ZYW A;  2VLV A;  2FHE A;  4JRR A;  3QCP A;  1K3O A;  3MNG A;  1G6W A;  4L0W A;  3D21 A;  5IMA A;  1VF4 A;  2O85 A;  4ICY A;  2C80 A;  1FOH A;  3ME7 A;  3BBY A;  1T8E B;  1AUC A;  4EUY A;  2H1G A;  4Z7X A;  5LNK e;  4LMV A;  2AB6 A;  1WJK A;  4MA9 A;  5COH A;  4MZW A;  4ZL8 A;  4BVY A;  1GSE A;  5G5F A;  1M9A A;  2DJ2 A;  2HFD A;  1ERW A;  5DBQ A;  4OWY A;  1SK1 A;  2J9H A;  1XWC A;  3IC4 A;  4ZBB A;  1XW9 A;  4E8H A;  1K0N A;  3FK8 A;  2REM A;  1N8J A;  4RI7 A;  2PUK C;  2O87 A;  3IBH A;  2V6O A;  3EPT A;  1GNW A;  4RI6 A;  1TU8 A;  1QQ2 A;  4ZL9 A;  5ECL B;  3HVN A;  3J7Y b;  1GSS A;  4I2U A;  4NWY A;  1XWG A;  5G1L A;  1QGV A;  5GAN D;  1Q4J A;  1PL2 A;  2JZT A;  4ZXG A;  2RUF A;  3DGQ A;  2VLU A;  3EMX A;  5CO3 A;  1IYI A;  1B48 A;  1A8L A;  2VUP A;  3APO A;  5GST A;  2V41 A;  3KMO A;  11GS A;  4NMU A;  2H8L A;  1C72 A;  4FYB A;  5AIX A;  3C71 A;  2J23 A;  2MBS A;  2L57 A;  1RW1 A;  5FHI A;  3EC3 A;  1OC3 A;  5E4W A;  2FY6 A;  1GL8 A;  4Q5N A;  4PNF A;  4AJ6 A;  1EOG A;  1KBN A;  1PA3 A;  3GH9 A;  2GTU A;  2HE3 A;  3TRP A;  2OBI A;  4IHU A;  4GST A;  2WGR A;  3L9V A;  4JE1 A;  3ZVJ D;  3TGZ A;  1OC9 B;  3CXG A;  1BG5 A;  1X9M B;  1BAY A;  4JR4 A;  1PL1 A;  1FVK A;  4ZIL A;  4F0B A;  5F0G A;  1OE7 A;  1EZK A;  4F9Z A;  4FQU A;  5G2Z A;  1BYE A;  2CX3 A;  3M9K A;  3TDG A;  1XXU A;  5HR0 A;  3GTU B;  5DAL A;  4O7H A;  2N5B A;  2DML A;  4ECC A;  5ELG A;  2VLT A;  3TKS A;  3PH9 A;  1MDI A;  5DJL A;  1Z6M A;  3F4T A;  2GGT A;  1I9D A;  1XVQ A;  5G5E A;  4GLT A;  2EIQ A;  3KEB A;  2HRA A;  2DIY A;  2H70 A;  3CBU A;  5H5Q A;  1T1V A;  4AJ7 A;  4PNG A;  1TI1 A;  5AIS A;  2FWE A;  1RK4 A;  4K2X A;  3CQF A;  2MMA A;  1GLQ A;  3E9J B;  1G6Y A;  2PMT A;  5EPF A;  5JWO B;  4G2E A;  4IQA A;  1DUG A;  3LSZ A;  5J41 A;  4EC0 A;  3RBT A;  1M3I A;  1M99 A;  3RHC A;  1F9M A;  2CA8 A;  2V1M A;  1MD3 A;  1R5A A;  3H8Q A;  2GT5 A;  4GSS A;  1A24 A;  4BWS A;  5KN2 A;  4RUV A;  2DJJ A;  1A2J A;  3D6I A;  1VF1 A;  2MMZ A;  2G2Q A;  2N5A A;  5H5R A;  3TJB A;  4YAV A;  4MDC A;  4ZL7 A;  4K7N A;  4F82 A;  4J56 E;  1USB A;  2LQQ A;  5J3R A;  1XG8 A;  2X4A A;  3AY8 A;  1NM3 A;  5GAP D;  4CY6 A;  1OC8 A;  2IFQ B;  4MJB A;  1AC1 A;  4POL A;  1PFO A;  1XZO A;  3KD0 A;  2C3T A;  2B5Y A;  4MH3 A;  4KA0 A;  4GCI A;  2VOC A;  4HEA 2;  2FUG 2;  1V57 A;  3DXB A;  2VM1 A;  3P7X A;  4K0G A;  3F63 A;  1GSD A;  2XBQ A;  4CHS A;  2P0G A;  3APQ A;  4TR1 B;  2PGT A;  4PUF C;  5HQP A;  2PER A;  2R6K A;  1WIK A;  4V2N A;  3ERF A;  3PGT A;  4QQ7 A;  1ZYE A;  2O7K A;  4TVE A;  4HDE A;  4K9Z A;  3FZ9 A;  2XPD A;  2B3S A;  1SJI A;  4V1A p;  3CMI A;  3EYT A;  2FWG A;  1QFN A;  2L6D A;  2IMI A;  2C3N A;  1URM A;  5IMF A;  2C0F A;  3GV1 A;  1PSQ A;  2CT6 A;  3ZMK A;  1S3R A;  5KN1 A;  3O6T A;  3EMP A;  4PTS A;  4OFM A;  2WFC A;  3UBL A;  3EUR A;  2L4Q A;  4IJI A;  4X43 A;  3FHK A;  1MDK A;  1SK2 A;  2VCT A;  1TU7 A;  3KCM A;  2ON5 A;  1YF1 A;  4MZC A;  2CVD A;  4HU7 A;  1OVN A;  5FWG A;  1WE0 A;  4EE0 A;  3ZML A;  3A5W A;  2H76 A;  2C8U A;  4O32 A;  3LYK A;  2H1B A;  2H01 A;  3IAS 2;  2B1K A;  1ON4 A;  4LL1 B;  4N11 A;  3JCM L;  3ZFL A;  4QL7 A;  3NOF A;  1TRU A;  1K0C A;  1SYR A;  2KLX A;  1OC9 A;  4MJE A;  5D9V A;  1SL2 B;  1ILO A;  3UOM A;  1YKA A;  1WOU A;  2LJK A;  2VCX A;  4KW6 A;  4OFN A;  4EL1 A;  1K3L A;  1ZGN A;  5CAX A;  5G1K A;  1V58 A;  3DVX A;  3GTU A;  2A4V A;  1E6B A;  4OD7 A;  3P8W A;  1HD2 A;  5IPG A;  1A23 A;  3FZ4 A;  2AV4 A;  1XOB A;  5ECN B;  4TOP A;  5IMV A;  4LL4 B;  1WWJ A;  3GH6 A;  4ECI A;  2ON7 A;  2KP2 A;  2R5G A;  2YJ7 A;  2ZNM A;  5IPH A;  5JWQ B;  4XHM A;  4KCA A;  2X64 A;  3WD6 A;  5F8B A;  4H86 A;  1U3A A;  2OBK A;  1B9X C;  3GKM A;  4CW9 A;  5B8A A;  2LST A;  4F03 A;  3F4R A;  2RM5 A;  3DD3 A;  2CZ2 A;  4ZB9 A;  1TK0 B;  3Q74 A;  2HZF A;  1O73 A;  4KDX A;  4G9H A;  3QMX A;  2PU9 C;  3F9U A;  4GTU A;  2VM2 A;  5AGY A;  1H4O A;  4POM A;  3ZIJ A;  5D9W A;  1T00 A;  3HA9 A;  3P90 A;  3TUE A;  3FRC A;  4I97 A;  3UMA A;  3F6D A;  1T4Z A;  2H30 A;  2DKH A;  4WBR D;  3IDV A;  1I5G A;  1SL0 B;  3ZTL A;  2JZR A;  1PD2 1;  4FO5 A;  4ID0 A;  5J5N A;  3KTL A;  5DQY A;  2HRK A;  2IFQ A;  5B6N A;  2HSY A;  4HS1 A;  1XIY A;  4YQV A;  3ZLP A;  3UAP A;  1U87 A;  1ML6 A;  3D4T A;  4YQM A;  3H1N A;  1OKD A;  5J4U A;  1ACV A;  3GN3 A;  3HVX A;  4IP1 A;  5A4U A;  3MYD A;  3SWL A;  2WZ9 A;  2CAI A;  2F8A A;  4MF6 A;  2AUV A;  4GRF A;  1XWK A;  5JCU A;  22GS A;  4BIK A;  3GKK A;  2IWT A;  2I81 A;  1H75 A;  4IKH A;  4O92 A;  4EDY A;  1T3B A;  1PX6 A;  1FW1 A;  3NIV A;  2OA7 A;  3IV4 A;  1PN0 A;  3GX8 A;  4Q5R A;  2KUC A;  3A2V A;  4ZB6 A;  1EOH A;  3VWW A;  3FEU A;  3TKS E;  5EVO A;  1T4Y A;  6GSX A;  4TRX A;  3NZN A;  3QD9 A;  4WBJ A;  1FVJ A;  2PWJ A;  2E2G A;  3BCI A;  3SBC A;  20GS A;  3F0I A;  1X9S B;  2KHP A;  2CVK A;  4NPB A;  4NHW A;  2EIO A;  2A2R A;  5BMU A;  4L5O A;  4KDY A;  1EEM A;  3KP8 A;  3F3Q A;  5ELA A;  2X8G A;  2H71 A;  2AJQ B;  2LEG A;  1ZYN A;  1M0U A;  2L6C A;  3KTB A;  4MJA A;  4MMM A;  1GP1 A;  2ZCT A;  3GNJ A;  1M9B A;  2V6K A;  1J9B A;  1CQG A;  1R7H A;  3ZL5 A;  5B6M A;  4KSM A;  1HYU A;  1K0D A;  2GDR A;  3I6A A;  2K8S A;  2CAQ A;  3DRN A;  2HT9 A;  5EY6 A;  1TXX A;  4EXJ A;  3C7M A;  2TRC P;  1XW6 A;  2VD0 A;  1GTU A;  4GXZ A;  4JBB A;  3A5I A;  1TK8 B;  1PGT A;  4BPY A;  5B8B A;  2Z9S A;  4BL7 B;  3QAG A;  3HDC A;  1UVZ A;  4IQ1 A;  2HRF A;  2A2S A;  3CRU A;  3N9J A;  3GYK A;  4BVX B;  1XW5 A;  1K3Y A;  2VL9 A;  4MNN A;  3PIN A;  3RHB A;  1G7E A;  3EU4 A;  4YKG A;  4IS0 A;  2GVP A;  4TR0 A;  4CY8 A;  5ECK B;  3QFA C;  1V98 A;  2QC7 A;  4KAE A;  2AHE A;  4YAP A;  3EWL A;  2YCD A;  2WCI A;  3VFI A;  2LV3 A;  2H66 A;  3TOT A;  3U5R E;  5A5K A;  2R0G A;  3HVV A;  1Z7R A;  3H4K A;  1YEP A;  2ES7 A;  4O5R A;  6GSU A;  3M0F A;  5ECM B;  3RAZ A;  4KSO A;  3VLN A;  4KCE A;  4IBP A;  3QFB C;  5D9X A;  4XRD A;  5HFG A;  3EVI A;  1O81 A;  2DKI A;  2H6X A;  4ULX A;  2TRX A;  3BJ5 A;  4TR4 A;  2IPA A;  1WRY A;  3C8E A;  1FB6 A;  5KN3 A;  1SKS B;  1FO5 A;  4K6X A;  2CZ3 A;  4ECB A;  2I4A A;  1F2E A;  2F51 A;  1XVW A;  5ECR B;  2HLS A;  3KH9 A;  1F37 A;  4MPG A;  1HNA A;  2JZS A;  2C1Y A;  5CRH A;  3UIW A;  4ACS A;  5A4V A;  1FB0 A;  2OE1 A;  4K2D A;  3F4S A;  3DEX A;  1NHY A;  1GTA A;  2GQL A;  4GQC A;  3OR5 A;  1A2L A;  2VAF A;  2AAW A;  5CYY A;  13GS A;  2F3M A;  4XIH A;  1EWX A;  3ZRD A;  3KGK A;  4BA7 A;  3IHG A;  6GST A;  2HZE A;  1MD4 A;  2C0D A;  2LUS A;  1TP9 A;  1QMV A;  4XTS A;  1DBY A;  4L5L A;  1GLP A;  1GTI A;  3EE2 A;  3PR8 A;  4FIW A;  4NV2 A;  1VF2 A;  2N5F A;  4PQH A;  5D93 A;  2VD1 A;  3Q18 A;  2GLR A;  2LNT A;  3RDW A;  1BQ7 A;  2F9S A;  2LRN A;  5AN1 A;  5BRT A;  1LJR A;  2HNL A;  5HFK A;  2YN1 A;  3GIX A;  2XPE A;  4RQR A;  4Z2R A;  2CX4 A;  4IEL A;  2NDO A;  3HCZ A;  1O85 A;  3DWV A;  2YP6 A;  4EF0 A;  1TRV A;  4K0N A;  3HYP A;  3FR9 A;  3N5O A;  2YAN A;  2YWN A;  2IJY A;  4MLY A;  4AJ8 A;  3F8U A;  1M2B A;  5ECS A;  3MSZ A;  1JLV A;  2DIZ A;  1A0R P;  4KE3 A;  2LTK A;  3D22 A;  1SYX A;  1GNE A;  3BD2 A;  4K7O A;  3A3T A;  3M8N A;  6GSV A;  5F06 A;  5EL8 A;  1QXH A;  4FYU A;  4DVC A;  2L5O A;  4N30 A;  3IAM 2;  1GSY A;  5IMC A;  1SL1 B;  1SD9 A;  2M80 A;  6GSY A;  4X4J A;  4K5R A;  3TJJ A;  1AXD A;  2L5L A;  4TR3 A;  4WR5 A;  1XPV A;  5KOX A;  3QDN A;  2QA2 A;  1JFU A;  3WGX A;  5L71 A;  4HOJ A;  3GMF A;  2XBI A;  3E0U A;  5C00 A;  4F2I A;  5ECP B;  4HQZ A;  2MMO A;  1AAZ A;  1M3J A;  4JZQ A;  1UA5 A;  2QA1 A;  4BL7 A;  1U3I A;  4G19 A;  4TXO B;  7GSS A;  2B7K A;  5INY A;  4GF0 A;  2K6V A;  3KMN A;  3VPQ A;  3HJO A;  3D0Z A;  2R4V A;  2H75 A;  2K9F A;  1GUH A;  2CVB A;  3GSS A;  1A8Y A;  4IP6 A;  4BVX A;  4ZIJ A;  4WET A;  18GS A;  1OE8 A;  5DAK A;  4EIQ A;  1GH2 A;  3IA1 A;  4MPF A;  4V2L A;  1M7T A;  2GSR A;  3CSJ A;  3ED3 A;  4DSQ A;  5IIZ A;  5J9C A;  2MYG A;  2FA4 A;  2H73 A;  1X5C A;  2VIM A;  3IXR A;  2WRT A;  3FYG A;  1EP8 A;  3DIE A;  1X5E A;  2A2P A;  6GSS A;  4MF7 A;  4AF2 A;  3TRQ A;  3G7I A;  4WR4 A;  1G7O A;  3F3R A;  3W6G A;  1EV4 A;  3FR3 A;  1DE1 A;  2DSA A;  3E3E A;  2GQM A;  4Z2U A;  5A4W A;  1SKW B;  1K0A A;  5IO0 A;  3LOR A;  1YY7 A;  4J57 E;  5H5S A;  2XHF A;  1HQO A;  2DLX A;  1PRX A;  2H19 A;  2MBT A;  3VPT A;  4G10 A;  1S3C A;  1ZYQ B;  4F0C A;  1SK0 A;  4X1U A;  4K1F A;  4Q5Q A;  2MZC A;  1OYJ A;  2YV7 A;  4XS6 A;  3GHA A;  2GQK A;  1GSU A;  3GKX A;  2NBS A;  4CDO A;  4X0X A;  5AIV A;  2GZZ A;  1PKW A;  4PUA A;  5CRD A;  3VK9 A;  5IO2 A;  4KB3 A;  2M46 A;  3V1W A;  3M9J A;  2KOK A;  1ABA A;  2AYT A;  3LW9 A;  3IOS A;  4FYC A;  3TCO A;  4HU9 A;  2GS3 A;  3KXO A;  4RQX A;  3L9S A;  2L59 A;  2YWO A;  1X0R A;  1B8X A;  1VRS D;  3QAW A;  1ZYP A;  3GX0 A;  3D5J A;  4XS1 A;  4ML1 A;  1Z6N A;  2X49 A;  1R4W A;  1TDI A;  1ZMA A;  1K0O A;  3ISO A;  5KN0 A;  3CTF A;  4POK A;  3RPN A;  5F05 A;  5DCH A;  1A2M A;  2LRT A;  2YPM A;  4Q5F A;  8GSS A;  2HI7 A;  2JU5 A;  4OO4 A;  4BWQ A;  2YJH A;  4J2F A;  3U6V A;  1TI3 A;  1B4P A;  1O7U A;  4ZBA A;  4KUN A;  5B7C A;  2HSH A;  2H6Z A;  3GST A;  3F6F A;  3FR6 A;  3CSI A;  2WB9 A;  4TN8 A;  1YJ6 A;  3C1S A;  1YDK A;  2YZH A;  2B7J A;  2TIR A;  2RII A;  1DSB A;  1M2A A;  1TK5 B;  2VCZ A;  3FKF A;  4N10 A;  1E2Y A;  3MAK A;  2E0Q A;  1W4V A;  3HXS A;  2C3Q A;  1XCC A;  3LEF A;  2R2J A;  1W89 A;  2P31 A;  3IK9 A;  3UVH A;  3VWU A;  3WT2 A;  2HZE B;  3MWH A;  3KJY A;  3UEM A;  2QGV A;  2GSS A;  3ME8 A;  2O89 A;  3MDK A;  3UVT A;  3KH7 A;  5G30 A;  3H79 A;  2VCW A;  4N0V A;  2V32 A;  3ZFB A;  1JZR A;  3A2W A;  2HXK A;  2NTO A;  1JLW A;  5C04 A;  1TJD A;  1Z3E A;  2B1L A;  2VO4 A;  2JSY A;  3TKR A;  2K18 A;  5IOX A;  3GL3 A;  5J9B A;  2IMF A;  2L4C A;  3O3T A;  2IMK A;  1YEX A;  3FZA A;  3RPP A;  1J0F A;  5GSS A;  4MZB A;  4NAX A;  1PN9 A;  4EKZ A;  2DJK A;  3IK7 A;  2X8H A;  2JAC A;  2H0H A;  5HR1 A;  1TTZ A;  1SU9 A;  3KP9 A;  2H74 A;  4D73 B;  4O5U A;  5ECI B;  3QAV A;  4LA1 A;  1QUW A;  2ALB A;  1GUM A;  4MP4 A;  1AW9 A;  4EIP A;  3IPZ A;  4TXO A;  2PPT A;  1VF3 A;  1ERT A;  1Y25 A;  3K8N A;  2R0C A;  1G0T A;  4KDU A;  4YKF A;  3IE3 A;  2PBJ A;  1V9W A;  4WF4 A;  2VCQ A;  1V2A A;  2JAD A;  2YV9 A;  3P2A A;  1N2A A;  1BX9 A;  4KH7 A;  3R3E A;  5JCW A;  4PX1 A;  4QL9 A;  4FH8 A;  5ECQ B;  1FG4 A;  1AIU A;  2FCH A;  1NSW A;  3C1R A;  2XC2 A;  1B4Q A;  2E2M A;  1ERV A;  4KF9 A;  5KOW A;  2DMM A;  5D96 A;  3VI7 A;  3UBK A;  3L4N A;  4IGJ A;  3UJ1 A;  1X9W B;  1F3A A;  4MAB A;  3LXZ A;  4ILF A;  2WS2 A;  3LWA A;  5D8I A;  2OE3 A;  3I9V 2;  2KP1 A;  1GWC A;  5DAK B;  2LRC A;  1T7P B;  1X5D A;  3FZ5 A;  1R5P A;  3WGE A;  2C0G A;  2H72 A;  1TKD B;  1ST9 A;  12GS A;  2GT6 A;  2HYX A;  4V1A g;  4XS4 A;  3I69 A;  3L9U A;  3M1G A;  2IME A;  1PMT A;  3VWV A;  4PQ1 A;  3GKN A;  2FWF A;  1EP7 A;  2CQ9 A;  2WJU A;  4HUA A;  1TOF A;  4XRA A;  5F07 A;  1KTE A;  5CNW A;  3HD5 A;  3ZZX A;  2R0P A;  3Q6O A;  3IR4 A;  3LFL A;  4DSS B;  1JHB A;  1Z9H A;  1V40 A;  2QSI A;  1JZO A;  4IW9 A;  4E8E A;  5GZZ B;  3H93 A;  1ZOF A;  2D2Z A;  3LGC A;  2FWH A;  2IIY A;  3QR6 A;  4NV5 A;  1UC7 A;  1GSQ A;  4G0K A;  6GSW A;  4I6X A;  4GQF A;  1NHO A;  2CV4 A;  2VCV A;  4AGS A;  2X8C A;  2A4H A;  5HR2 A;  2FA8 A;  5DCG A;  1EV9 A;  2LJA A;  4K8M A;  3WT1 A;  1YKC A;  2H1D A;  3G9B A;  1GUK A;  1OAZ A;  2GSQ A;  4HSC X;  3M3M A;  4EO3 A;  4ML6 A;  4K5S A;  1TW9 A;  1THX A;  2VL2 C;  2R37 A;  3DYR A;  3ZVJ A;  2GZY A;  4HZ4 A;  3FY7 A;  1CQH A;  3BOA A;  4JED A;  4XCS A;  3ZIT A;  4PXO A;  1RQM A;  5CP1 A;  1GRX A;  1SEN A;  1AQV A;  2G0F A;  5ID2 B;  2E7P A;  1AQX A;  2I3Y A;  2ZUP A;  3TRX A;  1K0B A;  1O6J A;  1OKT A;  3DVW A;  4IJ3 A;  3ERG A;  1M2D A;  5IMD A;  4I8B A;  4OCE A;  10GS A;  3TB2 A;  4HZ2 A;  3HVS A;  3QOU A;  2I1U A;  5HR3 A;  5D9T A;  3LYP A;  2NPB A;  3C73 A;  4WKW A;  3GUR A;  2IN3 A;  4HI7 A;  2DC5 A;  1Y6E A;  2C0E A;  3HY2 A;  2HSM A;  1PX7 A;  3HKR A;  4NHZ A;  1FOV A;  4JR6 A;  2DBC A;  2HRN A;  1SD8 A;  5D73 A;  1LU4 A;  3EU3 A;  4MK3 A;  2B6M A;  4Z2T A;  1GUL A;  4PUR A;  3CRT A;  2LKU A;  3KM6 A;  5DVB A;  2QKE A;  3HZ4 A;  1VGL A;  1XWB A;  1XFL A;  3W8S A;  2FNO A;  4L8E A;  4OCF A;  5IM9 A;  1DE2 A;  3TKP A;  3D4M A;  4HJM A;  2FGX A;  4D73 A;  2NVL A;  3GL5 A;  1SKR B;  3FMW A;  4DSR A;  2LS5 A;  4GSN A;  5G31 A;  2X99 A;  2EIR A;  2B5E A;  5ECO B;  1O8X A;  1ERU A; 
#chains in the Genus database with same CATH homology
 4YQU A;  4TW5 A;  5IMZ A;  2LNS A;  1EGR A;  2M72 A;  5JCG A;  1U6T A;  4MH2 A;  2V2G A;  9GSS A;  4TKY A;  1JZD A;  3G7J A;  1AQW A;  4USS A;  4OO5 A;  3CYN A;  16GS A;  2YZU A;  4WF5 A;  2FD3 A;  1QK8 A;  4OFT A;  5ABR A;  4HQS A;  5CRW A;  4EDZ A;  4BVY B;  2I9H A;  1EGO A;  1MDJ A;  4I5Q A;  1ZCP A;  2GZP A;  3ZRE A;  1WMJ A;  1XBS A;  4PQI A;  2RM6 A;  2YOI A;  1Z7P A;  2DJ0 A;  3HHV A;  2GST A;  4IVF A;  3S9F A;  3CTG A;  2JL4 A;  3KZQ A;  3TJG A;  4MF5 A;  4ZBD A;  3TKQ A;  3WGD A;  3VUR A;  2P5R A;  4N0Z A;  3TJK A;  4POB A;  3IRA A;  1FAA A;  2K8V A;  3IC8 A;  2C4J A;  3UAR A;  4ECJ A;  4LLR A;  1THO A;  2VL2 A;  2R3X A;  5CRG A;  3GRX A;  4G0I A;  2OJL A;  5CRE A;  5DJM A;  14GS A;  2MMN A;  3TJF A;  1KEB A;  1XOA A;  4WEY A;  2H6Y A;  4YH2 A;  2IMD A;  4L0U A;  3IHQ A;  3APS A;  1JZW A;  4ISD A;  5LD0 A;  3QPM A;  1A0F A;  2RUE A;  3L0H A;  3W8J A;  2B5X A;  2PVQ A;  3O76 A;  1SJ6 A;  3US3 A;  19GS A;  3LQ7 A;  4MCU A;  3KIJ A;  2BMX A;  4DSS A;  4JU5 A;  3BCK A;  1IYH A;  3MIX A;  1BED A;  3A2X A;  1MEK A;  3ZIV A;  1PQN A;  1UN2 A;  3I43 A;  1KNG A;  4OMV A;  1Q98 A;  5HFI A;  3FW2 A;  3LG6 A;  4XS4 B;  3L78 A;  3EIN A;  3HZ8 A;  2LJR A;  3GA4 A;  4KGI A;  17GS A;  2LQO A;  1WP0 A;  2H0I A;  3VI5 A;  5LCZ A;  3DKS A;  1HNC A;  2YWM A;  4V2M A;  4HJ2 A;  1B9Y C;  1S3D A;  1ZL9 A;  1U88 A;  3LXT A;  4NXI A;  4KND A;  1TRW A;  5DAL B;  5DDL A;  4O5Q A;  2OE0 A;  5FT3 A;  1SJZ A;  1YF0 A;  2WDU A;  1J08 A;  5ID2 A;  1GTB A;  2EC4 A;  3HJM A;  2OAD A;  5ENU A;  2BJX A;  2BTO T;  4I2T A;  3LJR A;  2H0G A;  2IL3 A;  1XWA A;  1HNB A;  3GUS A;  2P5Q A;  1PKZ A;  1NW2 A;  3DML A;  1YQ1 A;  5IQY A;  4GWR A;  2OAC A;  3R2Q A;  5IOW A;  1MTC A;  1WPI A;  3J7Y k;  4MJC A;  4G0L A;  1TRS A;  1Z5Y E;  1YZX A;  1GSF A;  4WXT A;  2O8V B;  4LMW A;  4IN0 A;  4ZB8 A;  5DQS A;  4KX4 A;  4TXV A;  4K7I A;  1F3B A;  2FLS A;  3CSH A;  3ERW A;  2DJ3 A;  1S3A A;  2OKA A;  3UL3 A;  2F8F A;  2RLI A;  2WUL A;  5ECH B;  5KEJ A;  2DJ1 A;  2H1A A;  1F6M C;  1K0M A;  1FHE A;  1BJX A;  2YWI A;  2PVO C;  3GFK A;  3TOU A;  4EVM A;  2UZ8 A;  1ZZY A;  3HJP A;  4TR1 A;  1O8W A;  2JSZ A;  2YNX A;  2VL3 A;  5E59 A;  3WYW A;  4PGT A;  1R26 A;  3TKS C;  3VWX A;  1LBK A;  5JWR B;  1EEJ A;  4P3Y B;  4A5P A;  4DEJ A;  3Q19 A;  3PPU A;  3G7Y A;  2PN8 A;  3ZYW A;  2VLV A;  2FHE A;  4JRR A;  3QCP A;  1K3O A;  3MNG A;  1G6W A;  4L0W A;  3D21 A;  5IMA A;  1VF4 A;  2O85 A;  4ICY A;  2C80 A;  1FOH A;  3ME7 A;  3BBY A;  1T8E B;  1AUC A;  4EUY A;  2H1G A;  4Z7X A;  5LNK e;  4LMV A;  2AB6 A;  1WJK A;  4MA9 A;  5COH A;  4MZW A;  4ZL8 A;  4BVY A;  1GSE A;  5G5F A;  1M9A A;  2DJ2 A;  2HFD A;  1ERW A;  5DBQ A;  4OWY A;  1SK1 A;  2J9H A;  1XWC A;  3IC4 A;  4ZBB A;  1XW9 A;  4E8H A;  1K0N A;  3FK8 A;  2REM A;  1N8J A;  4RI7 A;  2PUK C;  2O87 A;  3IBH A;  2V6O A;  3EPT A;  1GNW A;  4RI6 A;  1TU8 A;  1QQ2 A;  4ZL9 A;  5ECL B;  3J7Y b;  1GSS A;  4I2U A;  4NWY A;  1XWG A;  5G1L A;  1QGV A;  5GAN D;  1Q4J A;  1PL2 A;  2JZT A;  4ZXG A;  2RUF A;  3DGQ A;  2VLU A;  3EMX A;  5CO3 A;  1IYI A;  1B48 A;  1A8L A;  2VUP A;  3APO A;  5GST A;  2V41 A;  3KMO A;  11GS A;  4NMU A;  2H8L A;  1C72 A;  4FYB A;  5AIX A;  3C71 A;  2J23 A;  2MBS A;  2L57 A;  1RW1 A;  5FHI A;  3EC3 A;  1OC3 A;  5E4W A;  2FY6 A;  1GL8 A;  4Q5N A;  4PNF A;  4AJ6 A;  1EOG A;  1KBN A;  1PA3 A;  3GH9 A;  2GTU A;  2HE3 A;  3TRP A;  2OBI A;  4IHU A;  4GST A;  2WGR A;  3L9V A;  4JE1 A;  3ZVJ D;  3TGZ A;  1OC9 B;  3CXG A;  1BG5 A;  1X9M B;  1BAY A;  4JR4 A;  1PL1 A;  1FVK A;  4ZIL A;  4F0B A;  5F0G A;  1OE7 A;  1EZK A;  4F9Z A;  4FQU A;  5G2Z A;  1BYE A;  2CX3 A;  3M9K A;  3TDG A;  1XXU A;  5HR0 A;  3GTU B;  5DAL A;  4O7H A;  2N5B A;  2DML A;  4ECC A;  5ELG A;  2VLT A;  3TKS A;  3PH9 A;  1MDI A;  5DJL A;  1Z6M A;  3F4T A;  2GGT A;  1I9D A;  1XVQ A;  5G5E A;  4GLT A;  2EIQ A;  3KEB A;  2HRA A;  2DIY A;  2H70 A;  3CBU A;  5H5Q A;  1T1V A;  4AJ7 A;  4PNG A;  1TI1 A;  5AIS A;  2FWE A;  1RK4 A;  4K2X A;  2MMA A;  1GLQ A;  3E9J B;  1G6Y A;  2PMT A;  5EPF A;  5JWO B;  4G2E A;  4IQA A;  1DUG A;  3LSZ A;  5J41 A;  4EC0 A;  3RBT A;  1M99 A;  3RHC A;  1F9M A;  2CA8 A;  2V1M A;  1MD3 A;  1R5A A;  3H8Q A;  2GT5 A;  4GSS A;  1A24 A;  4BWS A;  5KN2 A;  4RUV A;  2DJJ A;  1A2J A;  3D6I A;  1VF1 A;  2MMZ A;  2G2Q A;  2N5A A;  5H5R A;  3TJB A;  4YAV A;  4MDC A;  4ZL7 A;  4K7N A;  4F82 A;  4J56 E;  1USB A;  2LQQ A;  5J3R A;  2X4A A;  3AY8 A;  1NM3 A;  5GAP D;  4CY6 A;  1OC8 A;  2IFQ B;  4MJB A;  1AC1 A;  4POL A;  1XZO A;  3KD0 A;  2C3T A;  2B5Y A;  4MH3 A;  4KA0 A;  4GCI A;  2VOC A;  4HEA 2;  2FUG 2;  1V57 A;  3DXB A;  2VM1 A;  3P7X A;  4K0G A;  3F63 A;  1GSD A;  2XBQ A;  4CHS A;  2P0G A;  3APQ A;  4TR1 B;  2PGT A;  4PUF C;  5HQP A;  2PER A;  2R6K A;  1WIK A;  4V2N A;  3ERF A;  3PGT A;  4QQ7 A;  1ZYE A;  2O7K A;  4TVE A;  4HDE A;  4K9Z A;  3FZ9 A;  2XPD A;  2B3S A;  1SJI A;  4V1A p;  3CMI A;  3EYT A;  2FWG A;  1QFN A;  2L6D A;  2IMI A;  2C3N A;  1URM A;  5IMF A;  2C0F A;  3GV1 A;  1PSQ A;  2CT6 A;  3ZMK A;  5KN1 A;  3O6T A;  3EMP A;  4PTS A;  4OFM A;  2WFC A;  3UBL A;  3EUR A;  2L4Q A;  4IJI A;  4X43 A;  3FHK A;  1MDK A;  1SK2 A;  2VCT A;  1TU7 A;  3KCM A;  2ON5 A;  1YF1 A;  4MZC A;  2CVD A;  4HU7 A;  1OVN A;  5FWG A;  1WE0 A;  4EE0 A;  3ZML A;  3A5W A;  2H76 A;  2C8U A;  4O32 A;  3LYK A;  2H1B A;  2H01 A;  3IAS 2;  2B1K A;  1ON4 A;  4LL1 B;  4N11 A;  3JCM L;  3ZFL A;  4QL7 A;  3NOF A;  1TRU A;  1K0C A;  1SYR A;  2KLX A;  1OC9 A;  4MJE A;  5D9V A;  1SL2 B;  1ILO A;  3UOM A;  1YKA A;  1WOU A;  2LJK A;  2VCX A;  4KW6 A;  4OFN A;  4EL1 A;  1K3L A;  1ZGN A;  5CAX A;  5G1K A;  1V58 A;  3DVX A;  3GTU A;  2A4V A;  1E6B A;  4OD7 A;  3P8W A;  1HD2 A;  5IPG A;  1A23 A;  3FZ4 A;  2AV4 A;  1XOB A;  5ECN B;  4TOP A;  5IMV A;  4LL4 B;  1WWJ A;  3GH6 A;  4ECI A;  2ON7 A;  2KP2 A;  2R5G A;  2YJ7 A;  2ZNM A;  5IPH A;  5JWQ B;  4XHM A;  4KCA A;  2X64 A;  3WD6 A;  5F8B A;  4H86 A;  1U3A A;  2OBK A;  1B9X C;  3GKM A;  4CW9 A;  5B8A A;  2LST A;  4F03 A;  3F4R A;  2RM5 A;  3DD3 A;  2CZ2 A;  4ZB9 A;  1TK0 B;  3Q74 A;  2HZF A;  1O73 A;  4KDX A;  4G9H A;  3QMX A;  2PU9 C;  3F9U A;  4GTU A;  2VM2 A;  5AGY A;  1H4O A;  4POM A;  3ZIJ A;  5D9W A;  1T00 A;  3HA9 A;  3P90 A;  3TUE A;  3FRC A;  4I97 A;  3UMA A;  3F6D A;  1T4Z A;  2H30 A;  2DKH A;  4WBR D;  3IDV A;  1I5G A;  1SL0 B;  3ZTL A;  2JZR A;  1PD2 1;  4FO5 A;  4ID0 A;  5J5N A;  3KTL A;  5DQY A;  2HRK A;  2IFQ A;  5B6N A;  2HSY A;  4HS1 A;  1XIY A;  4YQV A;  3ZLP A;  3UAP A;  1U87 A;  1ML6 A;  3D4T A;  4YQM A;  3H1N A;  1OKD A;  5J4U A;  1ACV A;  3GN3 A;  3HVX A;  4IP1 A;  5A4U A;  3MYD A;  3SWL A;  2WZ9 A;  2CAI A;  2F8A A;  4MF6 A;  2AUV A;  4GRF A;  1XWK A;  5JCU A;  22GS A;  3GKK A;  2IWT A;  2I81 A;  1H75 A;  4IKH A;  4O92 A;  4EDY A;  1T3B A;  1PX6 A;  1FW1 A;  3NIV A;  2OA7 A;  3IV4 A;  1PN0 A;  3GX8 A;  4Q5R A;  2KUC A;  3A2V A;  4ZB6 A;  1EOH A;  3VWW A;  3FEU A;  3TKS E;  5EVO A;  1T4Y A;  6GSX A;  4TRX A;  3NZN A;  3QD9 A;  4WBJ A;  1FVJ A;  2PWJ A;  2E2G A;  3BCI A;  3SBC A;  20GS A;  3F0I A;  1X9S B;  2KHP A;  2CVK A;  4NPB A;  4NHW A;  2EIO A;  2A2R A;  5BMU A;  4L5O A;  4KDY A;  1EEM A;  3KP8 A;  3F3Q A;  5ELA A;  2X8G A;  2H71 A;  2AJQ B;  2LEG A;  1ZYN A;  1M0U A;  2L6C A;  3KTB A;  4MJA A;  4MMM A;  1GP1 A;  2ZCT A;  3GNJ A;  1M9B A;  2V6K A;  1J9B A;  1CQG A;  1R7H A;  3ZL5 A;  5B6M A;  4KSM A;  1HYU A;  1K0D A;  2GDR A;  3I6A A;  2K8S A;  2CAQ A;  3DRN A;  2HT9 A;  5EY6 A;  1TXX A;  4EXJ A;  3C7M A;  2TRC P;  1XW6 A;  2VD0 A;  1GTU A;  4GXZ A;  4JBB A;  3A5I A;  1TK8 B;  1PGT A;  4BPY A;  5B8B A;  2Z9S A;  4BL7 B;  3QAG A;  3HDC A;  1UVZ A;  4IQ1 A;  2HRF A;  2A2S A;  3CRU A;  3N9J A;  3GYK A;  4BVX B;  1XW5 A;  1K3Y A;  2VL9 A;  4MNN A;  3PIN A;  3RHB A;  1G7E A;  3EU4 A;  4YKG A;  4IS0 A;  2GVP A;  4TR0 A;  4CY8 A;  5ECK B;  3QFA C;  1V98 A;  2QC7 A;  4KAE A;  2AHE A;  4YAP A;  3EWL A;  2YCD A;  2WCI A;  3VFI A;  2LV3 A;  2H66 A;  3TOT A;  3U5R E;  5A5K A;  2R0G A;  3HVV A;  1Z7R A;  3H4K A;  1YEP A;  2ES7 A;  4O5R A;  6GSU A;  3M0F A;  5ECM B;  3RAZ A;  4KSO A;  3VLN A;  4KCE A;  4IBP A;  3QFB C;  5D9X A;  4XRD A;  5HFG A;  3EVI A;  1O81 A;  2DKI A;  2H6X A;  4ULX A;  2TRX A;  3BJ5 A;  4TR4 A;  2IPA A;  1WRY A;  3C8E A;  1FB6 A;  5KN3 A;  1SKS B;  1FO5 A;  4K6X A;  2CZ3 A;  4ECB A;  2I4A A;  1F2E A;  2F51 A;  1XVW A;  5ECR B;  2HLS A;  3KH9 A;  1F37 A;  4MPG A;  1HNA A;  2JZS A;  2C1Y A;  5CRH A;  3UIW A;  4ACS A;  5A4V A;  1FB0 A;  2OE1 A;  4K2D A;  3F4S A;  3DEX A;  1NHY A;  1GTA A;  2GQL A;  4GQC A;  3OR5 A;  1A2L A;  5CYY A;  2VAF A;  2AAW A;  13GS A;  2F3M A;  4XIH A;  1EWX A;  3ZRD A;  3KGK A;  4BA7 A;  3IHG A;  6GST A;  2HZE A;  1MD4 A;  2C0D A;  2LUS A;  1TP9 A;  1QMV A;  4XTS A;  1DBY A;  4L5L A;  1GLP A;  1GTI A;  3EE2 A;  3PR8 A;  4FIW A;  4NV2 A;  1VF2 A;  2N5F A;  4PQH A;  5D93 A;  2VD1 A;  3Q18 A;  2GLR A;  2LNT A;  3RDW A;  1BQ7 A;  2F9S A;  2LRN A;  5AN1 A;  5BRT A;  1LJR A;  2HNL A;  5HFK A;  2YN1 A;  3GIX A;  2XPE A;  4RQR A;  4Z2R A;  2CX4 A;  4IEL A;  2NDO A;  3HCZ A;  1O85 A;  3DWV A;  2YP6 A;  4EF0 A;  1TRV A;  4K0N A;  3HYP A;  3FR9 A;  3N5O A;  2YAN A;  2YWN A;  2IJY A;  4MLY A;  4AJ8 A;  3F8U A;  1M2B A;  5ECS A;  3MSZ A;  1JLV A;  2DIZ A;  1A0R P;  4KE3 A;  2LTK A;  3D22 A;  1SYX A;  1GNE A;  3BD2 A;  4K7O A;  3A3T A;  3M8N A;  6GSV A;  5F06 A;  5EL8 A;  1QXH A;  4FYU A;  4DVC A;  2L5O A;  4N30 A;  3IAM 2;  1GSY A;  5IMC A;  1SL1 B;  1SD9 A;  2M80 A;  6GSY A;  4X4J A;  4K5R A;  3TJJ A;  1AXD A;  2L5L A;  4TR3 A;  4WR5 A;  1XPV A;  5KOX A;  3QDN A;  2QA2 A;  1JFU A;  3WGX A;  5L71 A;  4HOJ A;  3GMF A;  2XBI A;  3E0U A;  5C00 A;  4F2I A;  5ECP B;  4HQZ A;  2MMO A;  1AAZ A;  4JZQ A;  1UA5 A;  2QA1 A;  4BL7 A;  1U3I A;  4G19 A;  4TXO B;  7GSS A;  2B7K A;  5INY A;  4GF0 A;  2K6V A;  3KMN A;  3VPQ A;  3HJO A;  3D0Z A;  2R4V A;  2H75 A;  2K9F A;  1GUH A;  2CVB A;  3GSS A;  1A8Y A;  4IP6 A;  4BVX A;  4ZIJ A;  4WET A;  18GS A;  1OE8 A;  5DAK A;  4EIQ A;  1GH2 A;  3IA1 A;  4MPF A;  4V2L A;  1M7T A;  2GSR A;  3CSJ A;  3ED3 A;  4DSQ A;  5IIZ A;  5J9C A;  2MYG A;  2FA4 A;  2H73 A;  1X5C A;  2VIM A;  3IXR A;  2WRT A;  3FYG A;  1EP8 A;  3DIE A;  1X5E A;  2A2P A;  6GSS A;  4MF7 A;  4AF2 A;  3TRQ A;  3G7I A;  4WR4 A;  1G7O A;  3F3R A;  3W6G A;  1EV4 A;  3FR3 A;  1DE1 A;  2DSA A;  3E3E A;  2GQM A;  4Z2U A;  5A4W A;  1SKW B;  1K0A A;  5IO0 A;  3LOR A;  1YY7 A;  4J57 E;  5H5S A;  2XHF A;  1HQO A;  2DLX A;  1PRX A;  2H19 A;  2MBT A;  3VPT A;  4G10 A;  1S3C A;  1ZYQ B;  4F0C A;  1SK0 A;  4X1U A;  4K1F A;  4Q5Q A;  2MZC A;  1OYJ A;  2YV7 A;  4XS6 A;  3GHA A;  2GQK A;  1GSU A;  3GKX A;  2NBS A;  4CDO A;  4X0X A;  5AIV A;  2GZZ A;  1PKW A;  4PUA A;  5CRD A;  3VK9 A;  5IO2 A;  4KB3 A;  2M46 A;  3V1W A;  3M9J A;  2KOK A;  1ABA A;  2AYT A;  3LW9 A;  3IOS A;  4FYC A;  3TCO A;  4HU9 A;  2GS3 A;  3KXO A;  4RQX A;  3L9S A;  2L59 A;  2YWO A;  1X0R A;  1B8X A;  1VRS D;  3QAW A;  1ZYP A;  3GX0 A;  3D5J A;  4XS1 A;  4ML1 A;  1Z6N A;  2X49 A;  1R4W A;  1TDI A;  1ZMA A;  1K0O A;  3ISO A;  5KN0 A;  3CTF A;  4POK A;  3RPN A;  5F05 A;  5DCH A;  1A2M A;  2LRT A;  2YPM A;  4Q5F A;  8GSS A;  2HI7 A;  2JU5 A;  4OO4 A;  4BWQ A;  2YJH A;  4J2F A;  3U6V A;  1TI3 A;  1B4P A;  1O7U A;  4ZBA A;  4KUN A;  5B7C A;  2HSH A;  2H6Z A;  3GST A;  3F6F A;  3FR6 A;  3CSI A;  2WB9 A;  4TN8 A;  1YJ6 A;  3C1S A;  1YDK A;  2YZH A;  2B7J A;  2TIR A;  2RII A;  1DSB A;  1M2A A;  1TK5 B;  2VCZ A;  3FKF A;  4N10 A;  1E2Y A;  3MAK A;  2E0Q A;  1W4V A;  3HXS A;  2C3Q A;  1XCC A;  3LEF A;  2R2J A;  1W89 A;  2P31 A;  3IK9 A;  3UVH A;  3VWU A;  3WT2 A;  2HZE B;  3MWH A;  3KJY A;  3UEM A;  2QGV A;  2GSS A;  3ME8 A;  2O89 A;  3MDK A;  3UVT A;  3KH7 A;  5G30 A;  3H79 A;  2VCW A;  4N0V A;  2V32 A;  3ZFB A;  1JZR A;  3A2W A;  2HXK A;  2NTO A;  1JLW A;  5C04 A;  1TJD A;  1Z3E A;  2B1L A;  2VO4 A;  2JSY A;  3TKR A;  2K18 A;  5IOX A;  3GL3 A;  5J9B A;  2IMF A;  2L4C A;  3O3T A;  2IMK A;  1YEX A;  3FZA A;  3RPP A;  1J0F A;  5GSS A;  4MZB A;  4NAX A;  1PN9 A;  4EKZ A;  2DJK A;  3IK7 A;  2X8H A;  2JAC A;  2H0H A;  5HR1 A;  1TTZ A;  1SU9 A;  3KP9 A;  2H74 A;  4D73 B;  4O5U A;  5ECI B;  3QAV A;  4LA1 A;  1QUW A;  2ALB A;  1GUM A;  4MP4 A;  1AW9 A;  4EIP A;  3IPZ A;  4TXO A;  2PPT A;  1VF3 A;  1ERT A;  1Y25 A;  3K8N A;  2R0C A;  1G0T A;  4KDU A;  4YKF A;  3IE3 A;  2PBJ A;  1V9W A;  4WF4 A;  2VCQ A;  1V2A A;  2JAD A;  2YV9 A;  3P2A A;  1N2A A;  1BX9 A;  4KH7 A;  3R3E A;  5JCW A;  4PX1 A;  4QL9 A;  4FH8 A;  5ECQ B;  1FG4 A;  1AIU A;  2FCH A;  1NSW A;  3C1R A;  2XC2 A;  1B4Q A;  2E2M A;  1ERV A;  4KF9 A;  5KOW A;  2DMM A;  5D96 A;  3VI7 A;  3UBK A;  3L4N A;  4IGJ A;  3UJ1 A;  1X9W B;  1F3A A;  4MAB A;  3LXZ A;  4ILF A;  2WS2 A;  3LWA A;  5D8I A;  2OE3 A;  3I9V 2;  2KP1 A;  1GWC A;  5DAK B;  2LRC A;  1T7P B;  1X5D A;  3FZ5 A;  1R5P A;  3WGE A;  2C0G A;  2H72 A;  1TKD B;  1ST9 A;  12GS A;  2GT6 A;  2HYX A;  4V1A g;  4XS4 A;  3I69 A;  3L9U A;  3M1G A;  2IME A;  1PMT A;  3VWV A;  4PQ1 A;  3GKN A;  2FWF A;  1EP7 A;  2CQ9 A;  2WJU A;  4HUA A;  1TOF A;  4XRA A;  5F07 A;  1KTE A;  5CNW A;  3HD5 A;  3ZZX A;  2R0P A;  3Q6O A;  3IR4 A;  3LFL A;  4DSS B;  1JHB A;  1Z9H A;  1V40 A;  2QSI A;  1JZO A;  4IW9 A;  4E8E A;  5GZZ B;  3H93 A;  1ZOF A;  2D2Z A;  3LGC A;  2FWH A;  2IIY A;  3QR6 A;  4NV5 A;  1UC7 A;  1GSQ A;  4G0K A;  6GSW A;  4I6X A;  4GQF A;  1NHO A;  2CV4 A;  2VCV A;  4AGS A;  2X8C A;  2A4H A;  5HR2 A;  2FA8 A;  5DCG A;  1EV9 A;  2LJA A;  4K8M A;  3WT1 A;  1YKC A;  2H1D A;  3G9B A;  1GUK A;  1OAZ A;  2GSQ A;  3M3M A;  4EO3 A;  4ML6 A;  4K5S A;  1TW9 A;  1THX A;  2VL2 C;  2R37 A;  3DYR A;  3ZVJ A;  2GZY A;  4HZ4 A;  3FY7 A;  1CQH A;  3BOA A;  4JED A;  4XCS A;  3ZIT A;  4PXO A;  1RQM A;  5CP1 A;  1GRX A;  1SEN A;  1AQV A;  2G0F A;  5ID2 B;  2E7P A;  1AQX A;  2I3Y A;  2ZUP A;  3TRX A;  1K0B A;  1O6J A;  1OKT A;  3DVW A;  4IJ3 A;  3ERG A;  1M2D A;  5IMD A;  4I8B A;  4OCE A;  10GS A;  3TB2 A;  4HZ2 A;  3HVS A;  3QOU A;  2I1U A;  5HR3 A;  5D9T A;  3LYP A;  2NPB A;  3C73 A;  4WKW A;  3GUR A;  2IN3 A;  4HI7 A;  2DC5 A;  1Y6E A;  2C0E A;  3HY2 A;  2HSM A;  1PX7 A;  3HKR A;  4NHZ A;  1FOV A;  4JR6 A;  2DBC A;  2HRN A;  1SD8 A;  5D73 A;  1LU4 A;  3EU3 A;  4MK3 A;  2B6M A;  4Z2T A;  1GUL A;  4PUR A;  3CRT A;  2LKU A;  3KM6 A;  5DVB A;  2QKE A;  3HZ4 A;  1VGL A;  1XWB A;  1XFL A;  3W8S A;  2FNO A;  4L8E A;  4OCF A;  5IM9 A;  1DE2 A;  3TKP A;  3D4M A;  4HJM A;  2FGX A;  4D73 A;  2NVL A;  3GL5 A;  1SKR B;  3FMW A;  4DSR A;  2LS5 A;  4GSN A;  5G31 A;  2X99 A;  2EIR A;  2B5E A;  5ECO B;  1O8X A;  1ERU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...