3FZAA

Crystal structure of poplar glutaredoxin s12 in complex with glutathione and beta-mercaptoethanol
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
106
structure length
106
Chain Sequence
GSRLEDAVKKTVAENPVVVYSKTWCSYSSEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title Structure-function relationship of the chloroplastic glutaredoxin S12 with an atypical WCSYS active site.
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
total genus 37
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fzaA00
4ZILA 5IOWA 2TRCP 3A2WA 1GUMA 3ME7A 3AY8A 1SJIA 1SD9A 4MP4A 4K7IA 4HDEA 1Y6EA 4MPGA 1OC3A 2MZCA 2YOIA 2G2QA 1FB0A 1LJRA 2VM1A 3JCML 5DAKA 2HNLA 3UMAA 1GRXA 2K6VA 4TR0A 4TOPA 3D22A 4YQMA 3L9SA 2DJ1A 5ELGA 2GLRA 3HDCA 2IPAA 4KDYA 2E7PA 2ON7A 1T00A 3GNJA 2H1BA 2L4QA 1U3AA 2R3XA 1F2EA 1B9XC 5LD0A 1FB6A 1XW6A 2RM6A 2OADA 5CAXA 3KGKA 4BPYA 2FGXA 13GSA 3GKNA 2ZNMA 1M2AA 2DIZA 1ZOFA 3QAVA 2H0IA 1ZMAA 3DWVA 3TKQA 1AQWA 2KP2A 3F4SA 5GZZB 3WT2A 4TN8A 4NXIA 2MMAA 4MH2A 10GSA 4AGSA 3A2VA 1B8XA 3IV4A 3HJPA 4RI7A 2V41A 1YF0A 1ON4A 4XCSA 5G30A 3UJ1A 3FHKA 1C72A 2H6YA 4LLRA 4N0ZA 1Z5YE 1J9BA 4FO5A 1JZWA 3UARA 4MJCA 2WDUA 5CRWA 3GTUA 1SL0B 3C1SA 1U6TA 5D9TA 3H1NA 4TW5A 3TRPA 2L57A 4F0CA 3LYPA 3IHQA 3DMLA 4HJ2A 2CVBA 1K0NA 2YZUA 1GSFA 1SK1A 1LBKA 2RM5A 2BJXA 3UBKA 3I43A 2O7KA 1TRUA 4K1FA 4L5OA 1DSBA 4MPFA 3QFAC 3ZVJA 4J57E 1ZYEA 5AIVA 2CT6A 4F82A 1URMA 1I9DA 3TCOA 4Q5NA 1GNEA 3DVXA 4IBPA 1MD4A 4KUNA 2HRFA 3GX0A 1JLWA 2H76A 4EE0A 4IS0A 3J7Yk 5AGYA 6GSYA 1PKZA 3CMIA 5D93A 1UVZA 2RLIA 3ME8A 3TJBA 5JWRB 1O85A 4IJIA 4XS1A 2VLVA 2YPMA 3RPNA 1YDKA 3ISOA 2V6KA 4ACSA 1XW5A 3FYGA 1WPIA 1O7UA 1TI1A 3G9BA 3QCPA 4ECBA 1ERVA 1DUGA 3IDVA 2VCVA 1V58A 1W89A 2IMFA 5J5NA 4XIHA 3GYKA 4V2NA 1WMJA 1G7EA 2GSRA 5IOXA 5ID2A 4ISDA 4JU5A 1QUWA 2R5GA 2VIMA 4N30A 4PQ1A 2AV4A 5B6NA 8GSSA 2HXKA 3MNGA 2PUKC 4KCEA 2EIOA 3HZ4A 2FD3A 3ZMKA 3GKKA 3TJGA 4LMWA 4PNFA 1K3LA 1TOFA 5CRDA 3HVXA 5A4WA 4I97A 2JU5A 5ECQB 1K0BA 1SD8A 1YF1A 1TW9A 3IK9A 2YJHA 4BA7A 4RQXA 4GWRA 2PN8A 5IIZA 1WP0A 1EGOA 2LRNA 3TJJA 3P8WA 2MMZA 2NTOA 1OE7A 2C0EA 2DJKA 2FA4A 2Z9SA 2DMLA 3BOAA 1TU8A 3QOUA 1H75A 3VWXA 4YQVA 2REMA 4XS4B 2C1YA 2M80A 4MJAA 1XWKA 3F3RA 5D9XA 2PMTA 5IQYA 4TRXA 1V40A 3KJYA 3VPTA 4DSSA 2JSZA 3DKSA 5B8BA 1EV4A 3ERFA 5DQYA 2TRXA 5E59A 3VI7A 3L0HA 3MSZA 1K0CA 3RBTA 4ULXA 3L9VA 3P7XA 5ABRA 2HSYA 3TOTA 1IYIA 2YV9A 3TKPA 3A5WA 1I5GA 1XOAA 2OA7A 3A3TA 4ZBDA 2JZTA 3TKRA 1XZOA 3LG6A 3P2AA 2P5RA 3IC4A 1B4QA 4KSOA 2B3SA 3M9JA 4K7OA 3UVHA 4TXVA 2FA8A 1MD3A 1FVJA 2B5EA 9GSSA 1KBNA 1GLQA 4IP6A 2PU9C 2WFCA 4N11A 1OVNA 3FY7A 3KCMA 3EURA 2IMIA 4G10A 3DD3A 1JZDA 4HQSA 1TI3A 3KZQA 3Q18A 2LRTA 5ENUA 1F9MA 2HRNA 3MWHA 1FOVA 1AIUA 2WULA 2VL3A 2GQKA 5A4VA 5J4UA 1A0FA 2KUCA 4BL7A 3ZYWA 3FZ5A 2XPEA 3FW2A 4JR6A 5IMDA 2A2RA 4KNDA 2EIRA 2MYGA 2YP6A 2XBIA 1HYUA 5KEJA 1K0AA 1JZRA 4G19A 2L59A 17GSA 3C1RA 2V32A 2GZYA 4EDZA 2H72A 2BMXA 4NPBA 1AUCA 5CREA 2DBCA 3APOA 3GHAA 1TJDA 4KSMA 3DGQA 2C3QA 4PQIA 2LJRA 3ZIJA 4HJMA 1N8JA 1SKWB 2IFQA 5AN1A 3CRTA 2GQMA 2X8CA 2CQ9A 2VL2A 2E2GA 4F2IA 1TXXA 1SJ6A 1TP9A 3PINA 1HQOA 3FEUA 1V9WA 5IMVA 1XIYA 18GSA 4WXTA 1GWCA 1TK5B 3LSZA 1Q98A 3FR9A 1PKWA 4GSTA 1J08A 3IOSA 5IPGA 3F8UA 1TDIA 4CW9A 3DIEA 4TR1B 1TRSA 1ERTA 4QQ7A 3N5OA 1EV9A 4PNGA 4I6XA 1O8XA 3I6AA 5F06A 1BX9A 3EINA 4MA9A 2XPDA 4RQRA 4AF2A 2AAWA 1SKRB 4TR4A 2NBSA 1QQ2A 5G2ZA 2B1LA 1TK8B 1MDKA 1TTZA 1KEBA 5IM9A 2I81A 3H79A 5DVBA 1B48A 3EYTA 5HFGA 2HZEA 2D2ZA 2H66A 5ECLB 4YAPA 4PUAA 2I1UA 3F6FA 1X9WB 1R7HA 4KAEA 2QGVA 2H71A 1SKSB 1VF4A 3ZREA 3KM6A 1Z9HA 3VPQA 2DJ3A 4GRFA 1NM3A 2VL9A 1QXHA 3KD0A 5IO2A 3H8QA 3BJ5A 4GQFA 2N5BA 5ECHB 4JE1A 2V2GA 1HD2A 1KTEA 5CP1A 4LL4B 4F03A 3TRQA 3HKRA 1EP7A 3QAGA 4KB3A 5DJMA 1CQHA 1PX7A 1VF3A 4V1Ap 2IMEA 3FKFA 2GT6A 5IO0A 4KA0A 1EEJA 1SYXA 3QD9A 2YNXA 1USBA 2FWEA 4KDUA 2NDOA 1AQXA 3LQ7A 3KIJA 2R4VA 5CO3A 3PR8A 2M46A 4EC0A 2P5QA 5HR0A 3GKMA 3HZ8A 3FZ4A 4GLTA 4MDCA 5DAKB 3EC3A 4JZQA 1O6JA 3FK8A 1ZYQB 1K0DA 1SJZA 2FLSA 1A24A 1T1VA 3GIXA 4MF5A 1TK0B 3G7YA 1DE2A 3ERWA 4FYUA 4PXOA 1JHBA 4ML1A 1X9SB 1R5PA 1M7TA 2O85A 4AJ6A 1FAAA 5ECIB 4EKZA 1XBSA 1THOA 2N5AA 3EU3A 4AJ8A 3GV1A 2RUFA 2YWNA 5F0GA 2J23A 1Z7PA 4L8EA 1YEPA 3TUEA 4LA1A 2PERA 1THXA 2PGTA 4GXZA 5D8IA 2GQLA 1OAZA 2LJAA 3LJRA 5G31A 5DJLA 1FVKA 1XWAA 1X5DA 2L6CA 1A8LA 2KOKA 2X8GA 4GTUA 5JCUA 4XTSA 3GTUB 4BVXA 1GSQA 3UBLA 4F0BA 1M99A 4FH8A 5H5RA 1GL8A 1ZCPA 1UC7A 3IRAA 5DALA 4MH3A 1PL1A 3LGCA 2GGTA 3Q19A 1Z7RA 4L0UA 1Z6MA 2FCHA 4JEDA 2C8UA 3ZITA 1YZXA 1ERUA 4F9ZA 4NAXA 5J9CA 4TXOA 2F8FA 1X5CA 2HZFA 5CNWA 2XC2A 4XS6A 2C0DA 2JACA 4OWYA 5D9WA 3EE2A 3HCZA 4V2LA 2QSIA 5KN2A 3CYNA 5G1LA 3C71A 2FHEA 4OCEA 1OKTA 3O3TA 1HNCA 1VRSD 4WF4A 4RUVA 2X64A 4MF6A 3GL3A 3D21A 2C3TA 5COHA 3SWLA 3VURA 2O8VB 3LEFA 1AXDA 6GSVA 1S3CA 3M1GA 2LQQA 3DYRA 4YQUA 2A4VA 1Z3EA 1XPVA 4K0GA 1WRYA 2VCZA 2ZUPA 3TDGA 1F37A 4XRDA 4HU7A 4Q5RA 4Q5QA 1OKDA 4KDXA 4QL7A 3LWAA 1PGTA 3I69A 1G6YA 4O92A 5ID2B 5JWQB 2WS2A 2YWIA 4BWQA 1SYRA 1G6WA 4LMVA 16GSA 3FZ9A 4WBJA 2L5OA 2VL2C 4WBRD 1FG4A 4POKA 1M9BA 5ECPB 1G0TA 1BEDA 2GDRA 2FWFA 5LCZA 2IMKA 3KH7A 1AAZA 3CTFA 1XVQA 1M2BA 5EL8A 1GUHA 4NV2A 1PRXA 3F3QA 3D4MA 5H5SA 2WJUA 4MCUA 2ZCTA 3WT1A 3QDNA 3H93A 3E9JB 5D9VA 1GSDA 4PUFC 1ZGNA 2AYTA 2RIIA 3KTBA 2FNOA 1F3BA 2LUSA 4BVYA 5JCGA 2OE1A 5FHIA 3TJFA 1FW1A 1WE0A 2F51A 3ED3A 1V57A 4MLYA 3J7Yb 2XBQA 3C8EA 4O7HA 5ECMB 1XOBA 1VF2A 4KX4A 2JL4A 2FY6A 1TRVA 2VCTA 2LEGA 4O5RA 1MDJA 1GSYA 4MF7A 4DSSB 3D4TA 3Q74A 3E0UA 4POMA 1YKCA 3MDKA 3CTGA 4WF5A 3KXOA 3BD2A 1PL2A 4IKHA 4ECJA 3K8NA 3GURA 4J56E 1GTUA 2C80A 3BCKA 4J2FA 2H75A 4ECIA 3US3A 1KNGA 2L6DA 2CZ2A 4EVMA 1Y25A 4LL1B 1AW9A 3BBYA 2LJKA 2YN1A 1K0OA 1VF1A 1Z6NA 3KMOA 4KH7A 4I5QA 4AJ7A 4YH2A 2AHEA 1XW9A 3IAM2 3UEMA 2V1MA 2MMNA 4HZ2A 5F07A 6GSXA 3L9UA 4I8BA 4OFMA 4JRRA 3ZVJD 1X0RA 1BQ7A 1M9AA 1NHYA 4X43A 2FWHA 2LQOA 22GSA 4EXJA 1QFNA 2GZPA 5ECRB 5J3RA 4IVFA 1YEXA 20GSA 3GN3A 3G7JA 5CRHA 3UVTA 1LU4A 2ALBA 4CDOA 4ML6A 1XCCA 5KN1A 3QPMA 1GSSA 1ABAA 1JZOA 2O89A 1YJ6A 2YWOA 5F05A 1ST9A 1EWXA 1B4PA 1WWJA 2B7JA 2WZ9A 4KGIA 5L71A 3WGXA 1U88A 3IAS2 1JLVA 1SL1B 3QAWA 2NPBA 3UOMA 5DCHA 3VWUA 2IFQB 6GSTA 2H73A 3EMPA 3GSSA 4DSQA 4PX1A 2C3NA 2HE3A 4D73A 5IMZA 3GRXA 1XWBA 5F8BA 3VI5A 1QGVA 1YQ1A 4TR1A 2F9SA 2KHPA 5G1KA 4IW9A 4FIWA 4MABA 1ML6A 4E8HA 1EP8A 4GF0A 2OACA 2LRCA 4WR5A 4MZCA 4WETA 4IJ3A 2K18A 4NV5A 2J9HA 3FR6A 3KMNA 3CSIA 4MJBA 5KN0A 4G9HA 1X5EA 4JR4A 5J9BA 4K9ZA 3NIVA 3C73A 1EZKA 4MK3A 2BTOT 2CAIA 3G7IA 2VOCA 3QMXA 1J0FA 1A23A 1DBYA 4HS1A 2N5FA 3W8JA 2QKEA 3U5RE 1BJXA 2B1KA 5B8AA 3VWVA 4HI7A 3APSA 3KEBA 4MMMA 1YY7A 4ZL7A 1E2YA 5J41A 3F9UA 2FWGA 3ZL5A 3EWLA 4K0NA 1XWGA 3TKSE 1WJKA 5GSSA 3ZZXA 1OE8A 2HZEB 4ECCA 1H4OA 3M9KA 1OC8A 2LTKA 2IWTA 5DCGA 2VAFA 5A5KA 5HR2A 1F6MC 5GSTA 4K6XA 3TJKA 1OC9B 3QFBC 4FYCA 1TRWA 3KP8A 5B6MA 3TOUA 4POBA 4GSNA 1ERWA 2DC5A 1EEMA 3HJOA 1GTAA 1SU9A 1R4WA 3RDWA 5HFKA 4HUAA 1F3AA 2CZ3A 3ZLPA 5IMCA 3IE3A 4ZB9A 5ECKB 1PA3A 1E6BA 3LXTA 2AUVA 2WCIA 3M8NA 2ON5A 3DEXA 2DSAA 2VCQA 2GSTA 3KP9A 3O76A 4O32A 2HYXA 3CXGA 3TRXA 4ZBBA 4X1UA 4QL9A 3LYKA 3RHBA 2MMOA 3W6GA 2P31A 5IPHA 1IYHA 2B7KA 4IELA 5G5FA 3F63A 2VCXA 5CRGA 4L0WA 1PMTA 3I9V2 3TKSA 6GSSA 4MZWA 2H74A 1OYJA 5FT3A 2JZRA 2CV4A 2YJ7A 5C00A 4KCAA 4N10A 3ZIVA 2QC7A 2GSSA 1EOGA 4WR4A 1XXUA 3LXZA 4G2EA 2H01A 3C7MA 2WB9A 1EOHA 2E0QA 1PX6A 4ZL8A 3V1WA 1PD21 1BYEA 3FRCA 3DXBA 1TKDB 3HA9A 1R26A 2LKUA 2R37A 1A0RP 2VUPA 5ECNB 2H1DA 6GSWA 2H1AA 1YKAA 2VD0A 4GSSA 2L5LA 3O6TA 2JZSA 1K3OA 19GSA 1GP1A 14GSA 2DJJA 1WIKA 4OFNA 1X9MB 1B9YC 4PGTA 4EDYA 2IL3A 2AB6A 2LV3A 3KTLA 1A2MA 5B7CA 5EPFA 2B6MA 3WD6A 1A8YA 4POLA 1ZZYA 4JBBA 3W8SA 5KN3A 4GQCA 5DALB 2YZHA 3UAPA 1GNWA 1GTBA 4IQAA 3VK9A 5EVOA 1SK0A 1ILOA 5HR1A 5AISA 1CQGA 2GSQA 2X99A 3D6IA 4NWYA 3F4TA 1DE1A 3TGZA 2HT9A 2JADA 4X0XA 3PH9A 2VO4A 3HY2A 1HNBA 3HVSA 3OR5A 5JCWA 2HI7A 1QMVA 2PBJA 2V6OA 3EU4A 1VGLA 4TXOB 4L5LA 2M72A 2PVOC 1NHOA 1M2DA 2H19A 4IP1A 1W4VA 1NW2A 1SK2A 2OJLA 1AQVA 2C0FA 2CVDA 4TR3A 2VCWA 2PPTA 1ZL9A 3A2XA 2CX3A 5IMFA 3L78A 3CBUA 2OBIA 1SENA 1TU7A 1GUKA 4DSRA 3GL5A 2H30A 3GFKA 4IHUA 4I2UA 3ZFLA 3F6DA 5DQSA 3QR6A 1S3DA 1M0UA 1FHEA 4XHMA 4FYBA 3HD5A 1O73A 4NHWA 3VLNA 1NSWA 3HXSA 5GAPD 5H5QA 4EF0A 2YWMA 3N9JA 3U6VA 1U3IA 2H8LA 2GTUA 3NOFA 2HLSA 3D0ZA 3WGEA 4K2DA 5E4WA 2AJQB 4XS4A 2KP1A 2K9FA 2OE0A 5GAND 2VLUA 3E3EA 4OCFA 5IMAA 3D5JA 5LNKe 2R6KA 2LNTA 5DBQA 4V2MA 3GX8A 4RI6A 4NMUA 3RPPA 2OBKA 4HOJA 4OD7A 1GH2A 2I9HA 2OKAA 3EMXA 4ILFA 1HNAA 2L4CA 1T4ZA 5D73A 2GS3A 2DJ2A 2VLTA 2MBTA 2YANA 3APQA 1EGRA 2IJYA 4CHSA 3IR4A 3SBCA 3GMFA 2DMMA 3FZAA 2H6ZA 1WOUA 4DEJA 2IMDA 1RQMA 2H0GA 2C0GA 1SL2B 4OO4A 11GSA 3HYPA 1K0MA 4N0VA 4OMVA 1RW1A 1V98A 3ZTLA 4I2TA 4P3YB 4WKWA 1Q4JA 2EIQA 4EUYA 2H6XA 1XFLA 3F4RA 2O87A 2H0HA 4HEA2 3ZFBA 4TVEA 3WGDA 2HSHA 1K3YA 4K8MA 4EL1A 1RK4A 2YV7A 3EVIA 2LSTA 2H70A 2IN3A 5HFIA 2EC4A 5EY6A 3ZRDA 3BCIA 3M3MA 2IIYA 2I4AA 4Z7XA 3TB2A 1PN9A 3GH6A 3LORA 2DLXA 2G0FA 3ZMLA 6GSUA 4K7NA 4HQZA 2VM2A 1T7PB 5ECOB 1GULA 4IQ1A 1PSQA 2GVPA 2CA8A 5C04A 2K8SA 4PURA 2RUEA 2MBSA 4ZB8A 1A2JA 2DIYA 2C4JA 3R2QA 4ZIJA 2E2MA 5INYA 5JWOB 4OFTA 2K8VA 4IGJA 3GKXA 4TKYA 2CX4A 3NZNA 4XRAA 3FR3A 1ACVA 3GA4A 3HVVA 3DRNA 2XHFA 1UN2A 3CSJA 1BG5A 1MEKA 2PWJA 2B5XA 1GLPA 1UA5A 3PGTA 1JFUA 1XWCA 3DVWA 4KE3A 3VWWA 2GT5A 4ZL9A 4EO3A 3HJMA 3M0FA 3TKSC 4H86A 1T4YA 3MAKA 3WYWA 4MZBA 1MDIA 4YAVA 2F3MA 1PQNA 1O81A 2A2SA 1U87A 4ZXGA 2NVLA 1T3BA 3IA1A 2X8HA 2WGRA 2B5YA 1V2AA 5FWGA 1S3AA 4HZ4A 3L4NA 2I3YA 3S9FA 3UIWA 3F0IA 4HU9A 3GSTA 2FUG2 4IN0A 3RHCA 3GUSA 3LFLA 5HQPA 3KH9A 3ERGA 3RAZA 4NHZA 1AC1A 4OO5A 1GSUA 1MTCA 5CYYA 2ES7A 1GTIA 1FO5A 2VD1A 4GCIA 1G7OA 2R2JA 2LNSA 2OE3A 5ELAA 4D73B 7GSSA 3IK7A 2H1GA 3IXRA 12GSA 2F8AA 5DDLA 1QK8A 2YCDA 1T8EB 2JSYA 2TIRA 4WEYA 5G5EA 2DJ0A 1BAYA 3CRUA 4ZBAA 2GZZA 4V1Ag 4E8EA 3IBHA 2HFDA 2PVQA 3CSHA 3HHVA 3P90A 5ECSA 4Q5FA 3Q6OA 4MJEA 4ID0A 4KW6A 3UL3A 2KLXA 4PQHA 5AIXA 3VFIA 5A4UA 4ZB6A 2WRTA 2CVKA 1GSEA 1R5AA 1OC9A 5D96A 5HR3A 3IPZA 2P0GA 2CAQA 1A2LA 1N2AA 3H4KA 4BWSA 4DVCA 1O8WA 2LS5A 1XVWA 3GH9A
chains in the Genus database with same CATH superfamily
4ZILA 5IOWA 2TRCP 3A2WA 3FMWA 1GUMA 3ME7A 3AY8A 1SJIA 1SD9A 4MP4A 4K7IA 4HDEA 1Y6EA 4MPGA 1OC3A 2MZCA 2YOIA 2G2QA 1FB0A 1LJRA 2VM1A 3JCML 5DAKA 2HNLA 3UMAA 1GRXA 2K6VA 4K5SA 4TR0A 4TOPA 3D22A 4YQMA 3L9SA 2DJ1A 5ELGA 2GLRA 3HDCA 2IPAA 4KDYA 4CY8A 2E7PA 2ON7A 1T00A 3GNJA 4K2XA 5KOXA 2H1BA 2L4QA 1U3AA 2R3XA 1F2EA 1B9XC 5LD0A 1FB6A 1XW6A 2RM6A 2OADA 5CAXA 3KGKA 4BPYA 2FGXA 13GSA 3GKNA 2ZNMA 1M2AA 2DIZA 1ZOFA 3QAVA 2H0IA 1ZMAA 3DWVA 3TKQA 1AQWA 2KP2A 3F4SA 5GZZB 3WT2A 4TN8A 4NXIA 2MMAA 4MH2A 10GSA 4AGSA 3A2VA 1B8XA 3IV4A 3HJPA 4RI7A 2V41A 1YF0A 1ON4A 4XCSA 5G30A 3UJ1A 3FHKA 1C72A 2H6YA 4LLRA 4N0ZA 1Z5YE 1J9BA 4FO5A 1JZWA 3UARA 4MJCA 2WDUA 5CRWA 3GTUA 1SL0B 3C1SA 1U6TA 5D9TA 3H1NA 4TW5A 3TRPA 2L57A 4F0CA 3LYPA 3IHQA 3DMLA 4HJ2A 2CVBA 1K0NA 4Z2UA 2YZUA 1GSFA 1SK1A 1LBKA 2RM5A 2BJXA 3UBKA 3I43A 2O7KA 1TRUA 4K1FA 4L5OA 1DSBA 4MPFA 3QFAC 3ZVJA 4J57E 1ZYEA 5AIVA 2CT6A 4F82A 1URMA 1I9DA 3TCOA 4PTSA 4Q5NA 1GNEA 3DVXA 4IBPA 1MD4A 4KUNA 2HRFA 3GX0A 1JLWA 2H76A 4EE0A 4IS0A 3J7Yk 5AGYA 6GSYA 1PKZA 3CMIA 5D93A 1UVZA 2RLIA 3ME8A 3TJBA 5JWRB 1O85A 4IJIA 4XS1A 2VLVA 2YPMA 3RPNA 1YDKA 3ISOA 2V6KA 4ACSA 1XW5A 3FYGA 1WPIA 1O7UA 1TI1A 3G9BA 3QCPA 4ECBA 1ERVA 1DUGA 3IDVA 5BMUA 2VCVA 1V58A 1W89A 2IMFA 5J5NA 4XIHA 3GYKA 4V2NA 1WMJA 1G7EA 2GSRA 5IOXA 5ID2A 4ISDA 4JU5A 1QUWA 2R5GA 2VIMA 4N30A 4PQ1A 2AV4A 5B6NA 8GSSA 2HXKA 3MNGA 2PUKC 4KCEA 2EIOA 3HZ4A 2FD3A 3ZMKA 2R0PA 3GKKA 3TJGA 4LMWA 4PNFA 1K3LA 1TOFA 5CRDA 2X4AA 3HVXA 5A4WA 4I97A 2JU5A 5ECQB 1K0BA 1SD8A 1YF1A 1TW9A 3IK9A 2YJHA 4BA7A 4RQXA 4GWRA 2PN8A 5IIZA 1WP0A 1EGOA 2LRNA 3TJJA 3P8WA 2MMZA 2NTOA 1OE7A 2C0EA 2DJKA 2FA4A 2Z9SA 2DMLA 3BOAA 1TU8A 3QOUA 1H75A 3VWXA 4YQVA 2REMA 4XS4B 4MJAA 2C1YA 2M80A 4G0KA 1XWKA 3F3RA 5D9XA 2HRAA 2PMTA 5IQYA 4TRXA 1V40A 3KJYA 3VPTA 4DSSA 2JSZA 3DKSA 5B8BA 1EV4A 3ERFA 4G0LA 5DQYA 2TRXA 5E59A 3VI7A 3L0HA 3MSZA 1K0CA 3RBTA 4ULXA 3L9VA 3P7XA 5ABRA 2HSYA 3TOTA 1IYIA 2YV9A 3TKPA 3A5WA 1I5GA 1XOAA 2OA7A 3A3TA 4ZBDA 2JZTA 3TKRA 1XZOA 3LG6A 3P2AA 2P5RA 3IC4A 1B4QA 4KSOA 2B3SA 3M9JA 4K7OA 3UVHA 4TXVA 2FA8A 1MD3A 1FVJA 2B5EA 9GSSA 1KBNA 1GLQA 4IP6A 2PU9C 2WFCA 4N11A 1OVNA 3FY7A 3KCMA 3EURA 2IMIA 4G10A 3DD3A 1JZDA 4HQSA 3A5IA 1PN0A 1TI3A 3KZQA 3Q18A 2LRTA 5ENUA 1F9MA 2HRNA 3MWHA 1FOVA 1AIUA 2WULA 2VL3A 2GQKA 5A4VA 5J4UA 1A0FA 2KUCA 4BL7A 3ZYWA 2UZ8A 3FZ5A 2XPEA 3FW2A 4JR6A 5IMDA 2A2RA 4KNDA 2EIRA 2MYGA 2YP6A 2XBIA 1HYUA 5KEJA 1K0AA 1JZRA 4G19A 2L59A 17GSA 3C1RA 2V32A 2GZYA 4EDZA 2H72A 3EPTA 2BMXA 4NPBA 1AUCA 5CREA 2DBCA 3APOA 3GHAA 1TJDA 4KSMA 3DGQA 2C3QA 4PQIA 2LJRA 3ZIJA 4ICYA 4HJMA 1N8JA 1SKWB 2IFQA 5AN1A 3IC8A 3CRTA 2GQMA 2X8CA 2CQ9A 2VL2A 2E2GA 4F2IA 1TXXA 1SJ6A 1TP9A 3PINA 1HQOA 3FEUA 1V9WA 5IMVA 1XIYA 18GSA 4WXTA 1GWCA 1TK5B 3LSZA 1Q98A 3FR9A 1PKWA 4GSTA 1J08A 3IOSA 5IPGA 3F8UA 1TDIA 4CW9A 3DIEA 4TR1B 1TRSA 1ERTA 4QQ7A 3N5OA 1EV9A 4PNGA 4I6XA 1O8XA 3I6AA 5F06A 1BX9A 3EINA 4MA9A 2XPDA 4RQRA 4AF2A 2AAWA 1SKRB 4TR4A 2NBSA 1QQ2A 5G2ZA 2B1LA 1TK8B 1MDKA 1TTZA 1KEBA 5IM9A 2I81A 3H79A 5DVBA 1B48A 3EYTA 5HFGA 2HZEA 2D2ZA 2H66A 5ECLB 4YAPA 4PUAA 2I1UA 3F6FA 1X9WB 1R7HA 4KAEA 2QGVA 2H71A 1SKSB 1VF4A 3ZREA 3KM6A 1Z9HA 3VPQA 2DJ3A 4GRFA 1NM3A 2X49A 2VL9A 1QXHA 3KD0A 5IO2A 3H8QA 3BJ5A 4GQFA 2N5BA 5ECHB 4JE1A 2V2GA 1HD2A 1KTEA 5CP1A 4LL4B 4F03A 3TRQA 3HKRA 1EP7A 3QAGA 4KB3A 5DJMA 1CQHA 1PX7A 1VF3A 4KF9A 2DKHA 4V1Ap 2IMEA 3FKFA 2GT6A 5IO0A 4KA0A 1EEJA 1SYXA 3QD9A 2YNXA 1USBA 2FWEA 4KDUA 2NDOA 1AQXA 3LQ7A 3KIJA 2R4VA 5CO3A 3PR8A 2M46A 4EC0A 2P5QA 5HR0A 3GKMA 3HZ8A 3FZ4A 4GLTA 4MDCA 5DAKB 3EC3A 4JZQA 1O6JA 3FK8A 1ZYQB 1K0DA 1SJZA 2FLSA 1A24A 1T1VA 3GIXA 4MF5A 1TK0B 3G7YA 1DE2A 3ERWA 4FYUA 4PXOA 1JHBA 4ML1A 1X9SB 5BRTA 1R5PA 1M7TA 2O85A 4AJ6A 1FAAA 5ECIB 4EKZA 1XBSA 1THOA 2N5AA 3EU3A 4AJ8A 3GV1A 2RUFA 2YWNA 5F0GA 2J23A 1Z7PA 4L8EA 1YEPA 3TUEA 4LA1A 4G0IA 2PERA 1S3RA 1THXA 2PGTA 4GXZA 5D8IA 2GQLA 1OAZA 2LJAA 3LJRA 5G31A 5DJLA 1FVKA 1XWAA 1X5DA 2L6CA 1A8LA 2KOKA 2X8GA 4GTUA 5JCUA 4XTSA 3GTUB 4BVXA 1GSQA 3UBLA 2HSMA 4F0BA 1M99A 4FH8A 5H5RA 1GL8A 1ZCPA 1UC7A 3IRAA 5DALA 4MH3A 1PL1A 3LGCA 2GGTA 3Q19A 1Z7RA 4L0UA 1Z6MA 2FCHA 4JEDA 2C8UA 3ZITA 1YZXA 1ERUA 4F9ZA 4NAXA 5J9CA 4TXOA 2F8FA 1X5CA 2HZFA 5CNWA 2XC2A 4XS6A 2C0DA 2JACA 4OWYA 5D9WA 3EE2A 3HCZA 4V2LA 2QSIA 5KN2A 3CYNA 5G1LA 3C71A 2FHEA 4OCEA 1OKTA 3O3TA 1HNCA 1VRSD 4WF4A 4RUVA 2X64A 4MF6A 3GL3A 3D21A 2C3TA 5COHA 3SWLA 3VURA 2O8VB 3LEFA 1AXDA 6GSVA 1S3CA 3M1GA 2LQQA 3DYRA 4YQUA 2A4VA 1Z3EA 1XPVA 4K0GA 1WRYA 2VCZA 2ZUPA 3TDGA 1F37A 4XRDA 4HU7A 4Q5RA 4Q5QA 1OKDA 4KDXA 4QL7A 1ZYNA 3LWAA 1PGTA 3I69A 1G6YA 4O92A 5ID2B 5JWQB 2WS2A 2YWIA 4BWQA 1SYRA 1G6WA 4LMVA 16GSA 3FZ9A 4WBJA 2L5OA 2VL2C 4WBRD 1FG4A 4POKA 1M9BA 5ECPB 1G0TA 1BEDA 2GDRA 2FWFA 5LCZA 2IMKA 3KH7A 1AAZA 3CTFA 1XVQA 1M2BA 5EL8A 1GUHA 4NV2A 1PRXA 3F3QA 3D4MA 5H5SA 2WJUA 4MCUA 2ZCTA 3WT1A 3QDNA 3PPUA 3H93A 3E9JB 5D9VA 1GSDA 4PUFC 1ZGNA 2AYTA 2RIIA 3KTBA 2FNOA 1F3BA 2LUSA 4BVYA 5JCGA 2OE1A 5FHIA 3TJFA 1FW1A 4A5PA 1WE0A 2F51A 3ED3A 1V57A 4MLYA 3J7Yb 2XBQA 3C8EA 3LW9A 4O7HA 5ECMB 1XOBA 1VF2A 4KX4A 2JL4A 2FY6A 1TRVA 2VCTA 2LEGA 4O5RA 1MDJA 1GSYA 4MF7A 4DSSB 3D4TA 3Q74A 2A4HA 3E0UA 4POMA 4Z2TA 1YKCA 3MDKA 3CTGA 4WF5A 3KXOA 3BD2A 1PL2A 4IKHA 4ECJA 3K8NA 3GURA 4J56E 1GTUA 2C80A 3BCKA 4J2FA 2H75A 4ECIA 3US3A 1KNGA 2L6DA 2CZ2A 4EVMA 1Y25A 4LL1B 1AW9A 3BBYA 2LJKA 2YN1A 1K0OA 1VF1A 1Z6NA 3KMOA 4KH7A 4I5QA 4AJ7A 4YH2A 2AHEA 1XW9A 3IAM2 3UEMA 2V1MA 2MMNA 4HZ2A 5F07A 6GSXA 3L9UA 4I8BA 4OFMA 4JRRA 3ZVJD 1X0RA 1BQ7A 1M9AA 1NHYA 4X43A 2FWHA 2LQOA 22GSA 4EXJA 1QFNA 2GZPA 5ECRB 5J3RA 4IVFA 1YEXA 20GSA 3GN3A 3G7JA 5CRHA 3UVTA 1LU4A 2ALBA 4CDOA 4ML6A 1XCCA 5KN1A 3QPMA 1GSSA 1ABAA 1JZOA 2O89A 1YJ6A 2YWOA 5F05A 1ST9A 1EWXA 1B4PA 1WWJA 2B7JA 2WZ9A 4KGIA 5L71A 3WGXA 1U88A 3IAS2 1JLVA 1SL1B 3QAWA 2NPBA 3UOMA 5DCHA 2QA2A 3VWUA 2IFQB 6GSTA 2H73A 3EMPA 3GSSA 4DSQA 4PX1A 2C3NA 2HE3A 4D73A 5IMZA 3GRXA 1XWBA 5F8BA 3VI5A 1QGVA 2R0GA 1YQ1A 4TR1A 2F9SA 2KHPA 5G1KA 4IW9A 4FIWA 4MABA 1ML6A 4E8HA 1EP8A 4GF0A 2OACA 2LRCA 4WR5A 4MZCA 4WETA 4IJ3A 2K18A 4NV5A 2J9HA 3FR6A 3KMNA 3CSIA 4MJBA 5KN0A 4G9HA 1X5EA 4JR4A 5J9BA 4K9ZA 3NIVA 3C73A 1EZKA 4MK3A 2BTOT 4USSA 2CAIA 3G7IA 2VOCA 3QMXA 1J0FA 1A23A 1DBYA 4HS1A 2N5FA 3W8JA 2QKEA 3U5RE 1BJXA 2B1KA 5B8AA 3VWVA 4HI7A 3APSA 3KEBA 4MMMA 1YY7A 4ZL7A 1E2YA 3R3EA 5J41A 3F9UA 2FWGA 3ZL5A 3EWLA 4K0NA 1XWGA 3TKSE 1WJKA 5GSSA 3ZZXA 2DKIA 1OE8A 2HZEB 4ECCA 1H4OA 3M9KA 1OC8A 2LTKA 2IWTA 5DCGA 2VAFA 5A5KA 5HR2A 1F6MC 5GSTA 4K6XA 3TJKA 1OC9B 3QFBC 4FYCA 1TRWA 3KP8A 5B6MA 3TOUA 4POBA 4GSNA 1ERWA 2DC5A 1EEMA 3HJOA 1GTAA 1SU9A 1R4WA 3RDWA 5HFKA 4HUAA 1F3AA 2CZ3A 3ZLPA 5IMCA 4YKFA 3IE3A 4ZB9A 5ECKB 1PA3A 1E6BA 3LXTA 2AUVA 2WCIA 3M8NA 2ON5A 3DEXA 2DSAA 2VCQA 2GSTA 3KP9A 3O76A 4O32A 2HYXA 3CXGA 3TRXA 4ZBBA 4X1UA 4QL9A 3LYKA 3RHBA 2MMOA 3W6GA 2P31A 5IPHA 1IYHA 2B7KA 4IELA 5G5FA 3F63A 2VCXA 5CRGA 4L0WA 1PMTA 3I9V2 3TKSA 6GSSA 4MZWA 2H74A 1OYJA 5FT3A 1FOHA 2JZRA 2CV4A 2YJ7A 5C00A 4KCAA 4N10A 3ZIVA 2QC7A 2GSSA 1EOGA 4WR4A 1XXUA 3LXZA 4G2EA 2H01A 3C7MA 2WB9A 1EOHA 2E0QA 1PX6A 4ZL8A 3V1WA 4YKGA 2QA1A 1PD21 1BYEA 3FRCA 3DXBA 1TKDB 3HA9A 1R26A 4Z2RA 2LKUA 2R37A 1A0RP 2VUPA 5ECNB 2H1DA 6GSWA 2H1AA 1YKAA 2VD0A 3HVNA 4GSSA 2L5LA 3O6TA 2JZSA 1K3OA 19GSA 1GP1A 2A2PA 4EIQA 14GSA 2DJJA 1WIKA 4OFNA 1X9MB 1B9YC 4PGTA 4EDYA 2IL3A 2AB6A 2LV3A 3KTLA 1A2MA 5B7CA 5EPFA 2B6MA 3WD6A 1A8YA 4BVXB 4POLA 1ZZYA 4JBBA 3W8SA 5KN3A 4GQCA 5DALB 2YZHA 3UAPA 1GNWA 1GTBA 4IQAA 3VK9A 5EVOA 1SK0A 1ILOA 5HR1A 5AISA 1CQGA 2GSQA 2X99A 3D6IA 4NWYA 3F4TA 1DE1A 3TGZA 2HT9A 2JADA 4X0XA 3PH9A 2VO4A 3HY2A 1HNBA 3HVSA 3OR5A 3IHGA 5JCWA 2HI7A 1QMVA 2PBJA 2V6OA 3EU4A 1VGLA 2HRKA 4TXOB 4L5LA 2M72A 4FQUA 2PVOC 4EIPA 1NHOA 1M2DA 2H19A 4IP1A 1W4VA 1NW2A 1SK2A 2OJLA 1AQVA 2C0FA 2CVDA 4O5UA 4TR3A 2VCWA 2PPTA 1ZL9A 3A2XA 2CX3A 5IMFA 3L78A 3CBUA 2OBIA 1SENA 1TU7A 1GUKA 4DSRA 3GL5A 3CQFA 2H30A 4HSCX 3GFKA 4IHUA 4I2UA 3ZFLA 1XG8A 3F6DA 5DQSA 3QR6A 1S3DA 1M0UA 1FHEA 4XHMA 4FYBA 3HD5A 4X4JA 1O73A 4NHWA 3VLNA 1NSWA 3HXSA 5GAPD 5H5QA 4BIKA 4EF0A 2YWMA 3N9JA 3U6VA 1U3IA 2H8LA 2GTUA 3NOFA 2HLSA 3D0ZA 3WGEA 2R0CA 4K2DA 5E4WA 2AJQB 4XS4A 2KP1A 2K9FA 1PFOA 2OE0A 5GAND 2VLUA 3E3EA 4OCFA 5IMAA 3D5JA 5LNKe 2R6KA 2LNTA 5DBQA 4V2MA 3GX8A 4RI6A 4NMUA 3RPPA 2OBKA 4HOJA 4OD7A 1GH2A 2I9HA 2OKAA 3EMXA 4ILFA 1HNAA 2L4CA 1T4ZA 5D73A 2GS3A 2DJ2A 2VLTA 2MBTA 2YANA 3APQA 1EGRA 2IJYA 4CHSA 3IR4A 3SBCA 3GMFA 2DMMA 3FZAA 2H6ZA 1WOUA 4DEJA 2IMDA 1RQMA 4BVYB 4MNNA 4K5RA 2H0GA 2C0GA 1SL2B 1M3IA 4OO4A 11GSA 3HYPA 1K0MA 4N0VA 4OMVA 1RW1A 1V98A 3ZTLA 4I2TA 4P3YB 4WKWA 1Q4JA 2EIQA 4EUYA 2H6XA 1XFLA 3F4RA 2O87A 2H0HA 4HEA2 3ZFBA 4TVEA 3WGDA 2HSHA 1K3YA 4K8MA 4EL1A 1RK4A 2YV7A 3EVIA 2LSTA 2H70A 2IN3A 5HFIA 2EC4A 5EY6A 3ZRDA 3BCIA 3M3MA 2IIYA 2I4AA 4Z7XA 3TB2A 1PN9A 3GH6A 3LORA 2DLXA 2G0FA 3ZMLA 6GSUA 4K7NA 4HQZA 2VM2A 1T7PB 5ECOB 1GULA 4IQ1A 1PSQA 2GVPA 2CA8A 5C04A 2K8SA 4PURA 2RUEA 2MBSA 4ZB8A 1A2JA 2DIYA 2C4JA 3R2QA 4ZIJA 2E2MA 5INYA 4BL7B 5JWOB 4OFTA 3MIXA 2K8VA 4IGJA 3GKXA 4TKYA 2CX4A 3NZNA 4XRAA 1M3JA 3FR3A 1ACVA 3GA4A 3HVVA 3DRNA 2XHFA 1UN2A 3CSJA 4CY6A 1BG5A 1MEKA 2PWJA 2B5XA 1GLPA 1UA5A 3PGTA 1JFUA 1XWCA 3DVWA 4KE3A 3VWWA 2GT5A 4ZL9A 4EO3A 3HJMA 3M0FA 3TKSC 4H86A 1T4YA 3MAKA 3WYWA 4MZBA 1MDIA 4YAVA 2F3MA 1PQNA 1O81A 2A2SA 1U87A 4ZXGA 2NVLA 1T3BA 3IA1A 2X8HA 2WGRA 2B5YA 1V2AA 5FWGA 1S3AA 4HZ4A 3L4NA 2I3YA 3S9FA 3UIWA 3F0IA 4HU9A 3GSTA 2FUG2 4IN0A 3RHCA 1ZYPA 3GUSA 3LFLA 5HQPA 3KH9A 3ERGA 3RAZA 4NHZA 1AC1A 4OO5A 1GSUA 1MTCA 5CYYA 2ES7A 1GTIA 1FO5A 2VD1A 4GCIA 1G7OA 2R2JA 2LNSA 2OE3A 5ELAA 4D73B 7GSSA 4O5QA 3IK7A 2H1GA 3IXRA 12GSA 2F8AA 5DDLA 1QK8A 2YCDA 1T8EB 2JSYA 2TIRA 4WEYA 5G5EA 2DJ0A 1BAYA 3CRUA 4ZBAA 5KOWA 2GZZA 4V1Ag 4E8EA 3IBHA 2HFDA 2PVQA 3MYDA 3CSHA 3HHVA 3P90A 5ECSA 4Q5FA 3Q6OA 4MJEA 4ID0A 4KW6A 3UL3A 2KLXA 4PQHA 5AIXA 3VFIA 5A4UA 4ZB6A 2WRTA 2CVKA 1GSEA 1R5AA 1OC9A 5D96A 5HR3A 3IPZA 2P0GA 2CAQA 1A2LA 1N2AA 3H4KA 4BWSA 4DVCA 1O8WA 2LS5A 1XVWA 3GH9A
chains in the Genus database with same CATH topology
4ZILA 5IOWA 2TRCP 3A2WA 3FMWA 1GUMA 3ME7A 3AY8A 1SJIA 1SD9A 4MP4A 4K7IA 4HDEA 1Y6EA 4MPGA 1OC3A 2MZCA 2YOIA 2G2QA 1FB0A 1LJRA 2VM1A 3JCML 5DAKA 2HNLA 3UMAA 1GRXA 2K6VA 4K5SA 4TR0A 4TOPA 3D22A 4YQMA 3L9SA 2DJ1A 5ELGA 2GLRA 3HDCA 2IPAA 4KDYA 4CY8A 2E7PA 2ON7A 1T00A 3GNJA 4K2XA 5KOXA 2H1BA 2L4QA 1U3AA 2R3XA 1F2EA 1B9XC 5LD0A 1FB6A 1XW6A 2RM6A 2OADA 5CAXA 3KGKA 4BPYA 2FGXA 13GSA 3GKNA 2ZNMA 1M2AA 2DIZA 1ZOFA 3QAVA 2H0IA 1ZMAA 3DWVA 3TKQA 1AQWA 2KP2A 3F4SA 5GZZB 3WT2A 4TN8A 4NXIA 2MMAA 4MH2A 10GSA 4AGSA 3A2VA 1B8XA 3IV4A 3HJPA 4RI7A 2V41A 1YF0A 1ON4A 4XCSA 5G30A 3UJ1A 3FHKA 1C72A 2H6YA 4LLRA 4N0ZA 1Z5YE 1J9BA 4FO5A 1JZWA 3UARA 4MJCA 2WDUA 5CRWA 3GTUA 1SL0B 3C1SA 1U6TA 5D9TA 3H1NA 4TW5A 3TRPA 2L57A 4F0CA 3LYPA 3IHQA 3DMLA 4HJ2A 2CVBA 1K0NA 4Z2UA 2YZUA 1GSFA 1SK1A 1LBKA 2RM5A 2BJXA 3UBKA 3I43A 2O7KA 1TRUA 4K1FA 4L5OA 1DSBA 4MPFA 3QFAC 3ZVJA 4J57E 1ZYEA 5AIVA 2CT6A 4F82A 1URMA 1I9DA 3TCOA 4PTSA 4Q5NA 1GNEA 3DVXA 4IBPA 1MD4A 4KUNA 2HRFA 3GX0A 1JLWA 2H76A 4EE0A 4IS0A 3J7Yk 5AGYA 6GSYA 1PKZA 3CMIA 5D93A 1UVZA 2RLIA 3ME8A 3TJBA 5JWRB 1O85A 4IJIA 4XS1A 2VLVA 2YPMA 3RPNA 1YDKA 3ISOA 2V6KA 4ACSA 1XW5A 3FYGA 1WPIA 1O7UA 1TI1A 3G9BA 3QCPA 4ECBA 1ERVA 1DUGA 3IDVA 5BMUA 2VCVA 1V58A 1W89A 2IMFA 5J5NA 4XIHA 3GYKA 4V2NA 1WMJA 1G7EA 2GSRA 5IOXA 5ID2A 4ISDA 4JU5A 1QUWA 2R5GA 2VIMA 4N30A 4PQ1A 2AV4A 5B6NA 8GSSA 2HXKA 3MNGA 2PUKC 4KCEA 2EIOA 3HZ4A 2FD3A 3ZMKA 2R0PA 3GKKA 3TJGA 4LMWA 4PNFA 1K3LA 1TOFA 5CRDA 2X4AA 3HVXA 5A4WA 4I97A 2JU5A 5ECQB 1K0BA 1SD8A 1YF1A 1TW9A 3IK9A 2YJHA 4BA7A 4RQXA 4GWRA 2PN8A 5IIZA 1WP0A 1EGOA 2LRNA 3TJJA 3P8WA 2MMZA 2NTOA 1OE7A 2C0EA 2DJKA 2FA4A 2Z9SA 2DMLA 3BOAA 1TU8A 3QOUA 1H75A 3VWXA 4YQVA 2REMA 4XS4B 4MJAA 2C1YA 2M80A 4G0KA 1XWKA 3F3RA 5D9XA 2HRAA 2PMTA 5IQYA 4TRXA 1V40A 3KJYA 3VPTA 4DSSA 2JSZA 3DKSA 5B8BA 1EV4A 3ERFA 4G0LA 5DQYA 2TRXA 5E59A 3VI7A 3L0HA 3MSZA 1K0CA 3RBTA 4ULXA 3L9VA 3P7XA 5ABRA 2HSYA 3TOTA 1IYIA 2YV9A 3TKPA 3A5WA 1I5GA 1XOAA 2OA7A 3A3TA 4ZBDA 2JZTA 3TKRA 1XZOA 3LG6A 3P2AA 2P5RA 3IC4A 1B4QA 4KSOA 2B3SA 3M9JA 4K7OA 3UVHA 4TXVA 2FA8A 1MD3A 1FVJA 2B5EA 9GSSA 1KBNA 1GLQA 4IP6A 2PU9C 2WFCA 4N11A 1OVNA 3FY7A 3KCMA 3EURA 2IMIA 4G10A 3DD3A 1JZDA 4HQSA 3A5IA 1PN0A 1TI3A 3KZQA 3Q18A 2LRTA 5ENUA 1F9MA 2HRNA 3MWHA 1FOVA 1AIUA 2WULA 2VL3A 2GQKA 5A4VA 5J4UA 1A0FA 2KUCA 4BL7A 3ZYWA 2UZ8A 3FZ5A 2XPEA 3FW2A 4JR6A 5IMDA 2A2RA 4KNDA 2EIRA 2MYGA 2YP6A 2XBIA 1HYUA 5KEJA 1K0AA 1JZRA 4G19A 2L59A 17GSA 3C1RA 2V32A 2GZYA 4EDZA 2H72A 3EPTA 2BMXA 4NPBA 1AUCA 5CREA 2DBCA 3APOA 3GHAA 1TJDA 4KSMA 3DGQA 2C3QA 4PQIA 2LJRA 3ZIJA 4ICYA 4HJMA 1N8JA 1SKWB 2IFQA 5AN1A 3IC8A 3CRTA 2GQMA 2X8CA 2CQ9A 2VL2A 2E2GA 4F2IA 1TXXA 1SJ6A 1TP9A 3PINA 1HQOA 3FEUA 1V9WA 5IMVA 1XIYA 18GSA 4WXTA 1GWCA 1TK5B 3LSZA 1Q98A 3FR9A 1PKWA 4GSTA 1J08A 3IOSA 5IPGA 3F8UA 1TDIA 4CW9A 3DIEA 4TR1B 1TRSA 1ERTA 4QQ7A 3N5OA 1EV9A 4PNGA 4I6XA 1O8XA 3I6AA 5F06A 1BX9A 3EINA 4MA9A 2XPDA 4RQRA 4AF2A 2AAWA 1SKRB 4TR4A 2NBSA 1QQ2A 5G2ZA 2B1LA 1TK8B 1MDKA 1TTZA 1KEBA 5IM9A 2I81A 3H79A 5DVBA 1B48A 3EYTA 5HFGA 2HZEA 2D2ZA 2H66A 5ECLB 4YAPA 4PUAA 2I1UA 3F6FA 1X9WB 1R7HA 4KAEA 2QGVA 2H71A 1SKSB 1VF4A 3ZREA 3KM6A 1Z9HA 3VPQA 2DJ3A 4GRFA 1NM3A 2X49A 2VL9A 1QXHA 3KD0A 5IO2A 3H8QA 3BJ5A 4GQFA 2N5BA 5ECHB 4JE1A 2V2GA 1HD2A 1KTEA 5CP1A 4LL4B 4F03A 3TRQA 3HKRA 1EP7A 3QAGA 4KB3A 5DJMA 1CQHA 1PX7A 1VF3A 4KF9A 2DKHA 4V1Ap 2IMEA 3FKFA 2GT6A 5IO0A 4KA0A 1EEJA 1SYXA 3QD9A 2YNXA 1USBA 2FWEA 4KDUA 2NDOA 1AQXA 3LQ7A 3KIJA 2R4VA 5CO3A 3PR8A 2M46A 4EC0A 2P5QA 5HR0A 3GKMA 3HZ8A 3FZ4A 4GLTA 4MDCA 5DAKB 3EC3A 4JZQA 1O6JA 3FK8A 1ZYQB 1K0DA 1SJZA 2FLSA 1A24A 1T1VA 3GIXA 4MF5A 1TK0B 3G7YA 1DE2A 3ERWA 4FYUA 4PXOA 1JHBA 4ML1A 1X9SB 5BRTA 1R5PA 1M7TA 2O85A 4AJ6A 1FAAA 5ECIB 4EKZA 1XBSA 1THOA 2N5AA 3EU3A 4AJ8A 3GV1A 2RUFA 2YWNA 5F0GA 2J23A 1Z7PA 4L8EA 1YEPA 3TUEA 4LA1A 4G0IA 2PERA 1THXA 2PGTA 4GXZA 5D8IA 2GQLA 1OAZA 2LJAA 3LJRA 5G31A 5DJLA 1FVKA 1XWAA 1X5DA 2L6CA 1A8LA 2KOKA 2X8GA 4GTUA 5JCUA 4XTSA 3GTUB 4BVXA 1GSQA 3UBLA 2HSMA 4F0BA 1M99A 4FH8A 5H5RA 1GL8A 1ZCPA 1UC7A 3IRAA 5DALA 4MH3A 1PL1A 3LGCA 2GGTA 3Q19A 1Z7RA 4L0UA 1Z6MA 2FCHA 4JEDA 2C8UA 3ZITA 1YZXA 1ERUA 4F9ZA 4NAXA 5J9CA 4TXOA 2F8FA 1X5CA 2HZFA 5CNWA 2XC2A 4XS6A 2C0DA 2JACA 4OWYA 5D9WA 3EE2A 3HCZA 4V2LA 2QSIA 5KN2A 3CYNA 5G1LA 3C71A 2FHEA 4OCEA 1OKTA 3O3TA 1HNCA 1VRSD 4WF4A 4RUVA 2X64A 4MF6A 3GL3A 3D21A 2C3TA 5COHA 3SWLA 3VURA 2O8VB 3LEFA 1AXDA 6GSVA 1S3CA 3M1GA 2LQQA 3DYRA 4YQUA 2A4VA 1Z3EA 1XPVA 4K0GA 1WRYA 2VCZA 2ZUPA 3TDGA 1F37A 4XRDA 4HU7A 4Q5RA 4Q5QA 1OKDA 4KDXA 4QL7A 1ZYNA 3LWAA 1PGTA 3I69A 1G6YA 4O92A 5ID2B 5JWQB 2WS2A 2YWIA 4BWQA 1SYRA 1G6WA 4LMVA 16GSA 3FZ9A 4WBJA 2L5OA 2VL2C 4WBRD 1FG4A 4POKA 1M9BA 5ECPB 1G0TA 1BEDA 2GDRA 2FWFA 5LCZA 2IMKA 3KH7A 1AAZA 3CTFA 1XVQA 1M2BA 5EL8A 1GUHA 4NV2A 1PRXA 3F3QA 3D4MA 5H5SA 2WJUA 4MCUA 2ZCTA 3WT1A 3QDNA 3PPUA 3H93A 3E9JB 5D9VA 1GSDA 4PUFC 1ZGNA 2AYTA 2RIIA 3KTBA 2FNOA 1F3BA 2LUSA 4BVYA 5JCGA 2OE1A 5FHIA 3TJFA 1FW1A 4A5PA 1WE0A 2F51A 3ED3A 1V57A 4MLYA 3J7Yb 2XBQA 3C8EA 3LW9A 4O7HA 5ECMB 1XOBA 1VF2A 4KX4A 2JL4A 2FY6A 1TRVA 2VCTA 2LEGA 4O5RA 1MDJA 1GSYA 4MF7A 4DSSB 3D4TA 3Q74A 2A4HA 3E0UA 4POMA 4Z2TA 1YKCA 3MDKA 3CTGA 4WF5A 3KXOA 3BD2A 1PL2A 4IKHA 4ECJA 3K8NA 3GURA 4J56E 1GTUA 2C80A 3BCKA 4J2FA 2H75A 4ECIA 3US3A 1KNGA 2L6DA 2CZ2A 4EVMA 1Y25A 4LL1B 1AW9A 3BBYA 2LJKA 2YN1A 1K0OA 1VF1A 1Z6NA 3KMOA 4KH7A 4I5QA 4AJ7A 4YH2A 2AHEA 1XW9A 3IAM2 3UEMA 2V1MA 2MMNA 4HZ2A 5F07A 6GSXA 3L9UA 4I8BA 4OFMA 4JRRA 3ZVJD 1X0RA 1BQ7A 1M9AA 1NHYA 4X43A 2FWHA 2LQOA 22GSA 4EXJA 1QFNA 2GZPA 5ECRB 5J3RA 4IVFA 1YEXA 20GSA 3GN3A 3G7JA 5CRHA 3UVTA 1LU4A 2ALBA 4CDOA 4ML6A 1XCCA 5KN1A 3QPMA 1GSSA 1ABAA 1JZOA 2O89A 1YJ6A 2YWOA 5F05A 1ST9A 1EWXA 1B4PA 1WWJA 2B7JA 2WZ9A 4KGIA 5L71A 3WGXA 1U88A 3IAS2 1JLVA 1SL1B 3QAWA 2NPBA 3UOMA 5DCHA 2QA2A 3VWUA 2IFQB 6GSTA 2H73A 3EMPA 3GSSA 4DSQA 4PX1A 2C3NA 2HE3A 4D73A 5IMZA 3GRXA 1XWBA 5F8BA 3VI5A 1QGVA 2R0GA 1YQ1A 4TR1A 2F9SA 2KHPA 5G1KA 4IW9A 4FIWA 4MABA 1ML6A 4E8HA 1EP8A 4GF0A 2OACA 2LRCA 4WR5A 4MZCA 4WETA 4IJ3A 2K18A 4NV5A 2J9HA 3FR6A 3KMNA 3CSIA 4MJBA 5KN0A 4G9HA 1X5EA 4JR4A 5J9BA 4K9ZA 3NIVA 3C73A 1EZKA 4MK3A 2BTOT 4USSA 2CAIA 3G7IA 2VOCA 3QMXA 1J0FA 1A23A 1DBYA 4HS1A 2N5FA 3W8JA 2QKEA 3U5RE 1BJXA 2B1KA 5B8AA 3VWVA 4HI7A 3APSA 3KEBA 4MMMA 1YY7A 4ZL7A 1E2YA 3R3EA 5J41A 3F9UA 2FWGA 3ZL5A 3EWLA 4K0NA 1XWGA 3TKSE 1WJKA 5GSSA 3ZZXA 2DKIA 1OE8A 2HZEB 4ECCA 1H4OA 3M9KA 1OC8A 2LTKA 2IWTA 5DCGA 2VAFA 5A5KA 5HR2A 1F6MC 5GSTA 4K6XA 3TJKA 1OC9B 3QFBC 4FYCA 1TRWA 3KP8A 5B6MA 3TOUA 4POBA 4GSNA 1ERWA 2DC5A 1EEMA 3HJOA 1GTAA 1SU9A 1R4WA 3RDWA 5HFKA 4HUAA 1F3AA 2CZ3A 3ZLPA 5IMCA 4YKFA 3IE3A 4ZB9A 5ECKB 1PA3A 1E6BA 3LXTA 2AUVA 2WCIA 3M8NA 2ON5A 3DEXA 2DSAA 2VCQA 2GSTA 3KP9A 3O76A 4O32A 2HYXA 3CXGA 3TRXA 4ZBBA 4X1UA 4QL9A 3LYKA 3RHBA 2MMOA 3W6GA 2P31A 5IPHA 1IYHA 2B7KA 4IELA 5G5FA 3F63A 2VCXA 5CRGA 4L0WA 1PMTA 3I9V2 3TKSA 6GSSA 4MZWA 2H74A 1OYJA 5FT3A 1FOHA 2JZRA 2CV4A 2YJ7A 5C00A 4KCAA 4N10A 3ZIVA 2QC7A 2GSSA 1EOGA 4WR4A 1XXUA 3LXZA 4G2EA 2H01A 3C7MA 2WB9A 1EOHA 2E0QA 1PX6A 4ZL8A 3V1WA 4YKGA 2QA1A 1PD21 1BYEA 3FRCA 3DXBA 1TKDB 3HA9A 1R26A 4Z2RA 2LKUA 2R37A 1A0RP 2VUPA 5ECNB 2H1DA 6GSWA 2H1AA 1YKAA 2VD0A 4GSSA 2L5LA 3O6TA 2JZSA 1K3OA 19GSA 1GP1A 2A2PA 4EIQA 14GSA 2DJJA 1WIKA 4OFNA 1X9MB 1B9YC 4PGTA 4EDYA 2IL3A 2AB6A 2LV3A 3KTLA 1A2MA 5B7CA 5EPFA 2B6MA 3WD6A 1A8YA 4BVXB 4POLA 1ZZYA 4JBBA 3W8SA 5KN3A 4GQCA 5DALB 2YZHA 3UAPA 1GNWA 1GTBA 4IQAA 3VK9A 5EVOA 1SK0A 1ILOA 5HR1A 5AISA 1CQGA 2GSQA 2X99A 3D6IA 4NWYA 3F4TA 1DE1A 3TGZA 2HT9A 2JADA 4X0XA 3PH9A 2VO4A 3HY2A 1HNBA 3HVSA 3OR5A 3IHGA 5JCWA 2HI7A 1QMVA 2PBJA 2V6OA 3EU4A 1VGLA 2HRKA 4TXOB 4L5LA 2M72A 4FQUA 2PVOC 4EIPA 1NHOA 1M2DA 2H19A 4IP1A 1W4VA 1NW2A 1SK2A 2OJLA 1AQVA 2C0FA 2CVDA 4O5UA 4TR3A 2VCWA 2PPTA 1ZL9A 3A2XA 2CX3A 5IMFA 3L78A 3CBUA 2OBIA 1SENA 1TU7A 1GUKA 4DSRA 3GL5A 2H30A 3GFKA 4IHUA 4I2UA 3ZFLA 3F6DA 5DQSA 3QR6A 1S3DA 1M0UA 1FHEA 4XHMA 4FYBA 3HD5A 4X4JA 1O73A 4NHWA 3VLNA 1NSWA 3HXSA 5GAPD 5H5QA 4EF0A 2YWMA 3N9JA 3U6VA 1U3IA 2H8LA 2GTUA 3NOFA 2HLSA 3D0ZA 3WGEA 2R0CA 4K2DA 5E4WA 2AJQB 4XS4A 2KP1A 2K9FA 2OE0A 5GAND 2VLUA 3E3EA 4OCFA 5IMAA 3D5JA 5LNKe 2R6KA 2LNTA 5DBQA 4V2MA 3GX8A 4RI6A 4NMUA 3RPPA 2OBKA 4HOJA 4OD7A 1GH2A 2I9HA 2OKAA 3EMXA 4ILFA 1HNAA 2L4CA 1T4ZA 5D73A 2GS3A 2DJ2A 2VLTA 2MBTA 2YANA 3APQA 1EGRA 2IJYA 4CHSA 3IR4A 3SBCA 3GMFA 2DMMA 3FZAA 2H6ZA 1WOUA 4DEJA 2IMDA 1RQMA 4BVYB 4MNNA 4K5RA 2H0GA 2C0GA 1SL2B 4OO4A 11GSA 3HYPA 1K0MA 4N0VA 4OMVA 1RW1A 1V98A 3ZTLA 4I2TA 4P3YB 4WKWA 1Q4JA 2EIQA 4EUYA 2H6XA 1XFLA 3F4RA 2O87A 2H0HA 4HEA2 3ZFBA 4TVEA 3WGDA 2HSHA 1K3YA 4K8MA 4EL1A 1RK4A 2YV7A 3EVIA 2LSTA 2H70A 2IN3A 5HFIA 2EC4A 5EY6A 3ZRDA 3BCIA 3M3MA 2IIYA 2I4AA 4Z7XA 3TB2A 1PN9A 3GH6A 3LORA 2DLXA 2G0FA 3ZMLA 6GSUA 4K7NA 4HQZA 2VM2A 1T7PB 5ECOB 1GULA 4IQ1A 1PSQA 2GVPA 2CA8A 5C04A 2K8SA 4PURA 2RUEA 2MBSA 4ZB8A 1A2JA 2DIYA 2C4JA 3R2QA 4ZIJA 2E2MA 5INYA 4BL7B 5JWOB 4OFTA 3MIXA 2K8VA 4IGJA 3GKXA 4TKYA 2CX4A 3NZNA 4XRAA 3FR3A 1ACVA 3GA4A 3HVVA 3DRNA 2XHFA 1UN2A 3CSJA 4CY6A 1BG5A 1MEKA 2PWJA 2B5XA 1GLPA 1UA5A 3PGTA 1JFUA 1XWCA 3DVWA 4KE3A 3VWWA 2GT5A 4ZL9A 4EO3A 3HJMA 3M0FA 3TKSC 4H86A 1T4YA 3MAKA 3WYWA 4MZBA 1MDIA 4YAVA 2F3MA 1PQNA 1O81A 2A2SA 1U87A 4ZXGA 2NVLA 1T3BA 3IA1A 2X8HA 2WGRA 2B5YA 1V2AA 5FWGA 1S3AA 4HZ4A 3L4NA 2I3YA 3S9FA 3UIWA 3F0IA 4HU9A 3GSTA 2FUG2 4IN0A 3RHCA 1ZYPA 3GUSA 3LFLA 5HQPA 3KH9A 3ERGA 3RAZA 4NHZA 1AC1A 4OO5A 1GSUA 1MTCA 5CYYA 2ES7A 1GTIA 1FO5A 2VD1A 4GCIA 1G7OA 2R2JA 2LNSA 2OE3A 5ELAA 4D73B 7GSSA 4O5QA 3IK7A 2H1GA 3IXRA 12GSA 2F8AA 5DDLA 1QK8A 2YCDA 1T8EB 2JSYA 2TIRA 4WEYA 5G5EA 2DJ0A 1BAYA 3CRUA 4ZBAA 5KOWA 2GZZA 4V1Ag 4E8EA 3IBHA 2HFDA 2PVQA 3MYDA 3CSHA 3HHVA 3P90A 5ECSA 4Q5FA 3Q6OA 4MJEA 4ID0A 4KW6A 3UL3A 2KLXA 4PQHA 5AIXA 3VFIA 5A4UA 4ZB6A 2WRTA 2CVKA 1GSEA 1R5AA 1OC9A 5D96A 5HR3A 3IPZA 2P0GA 2CAQA 1A2LA 1N2AA 3H4KA 4BWSA 4DVCA 1O8WA 2LS5A 1XVWA 3GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIL A;  5IOW A;  2TRC P;  3A2W A;  1GUM A;  3ME7 A;  3AY8 A;  1SJI A;  1SD9 A;  4MP4 A;  4K7I A;  4HDE A;  1Y6E A;  4MPG A;  1OC3 A;  2MZC A;  2YOI A;  2G2Q A;  1FB0 A;  1LJR A;  2VM1 A;  3JCM L;  5DAK A;  2HNL A;  3UMA A;  1GRX A;  2K6V A;  4TR0 A;  4TOP A;  3D22 A;  4YQM A;  3L9S A;  2DJ1 A;  5ELG A;  2GLR A;  3HDC A;  2IPA A;  4KDY A;  2E7P A;  2ON7 A;  1T00 A;  3GNJ A;  2H1B A;  2L4Q A;  1U3A A;  2R3X A;  1F2E A;  1B9X C;  5LD0 A;  1FB6 A;  1XW6 A;  2RM6 A;  2OAD A;  5CAX A;  3KGK A;  4BPY A;  2FGX A;  13GS A;  3GKN A;  2ZNM A;  1M2A A;  2DIZ A;  1ZOF A;  3QAV A;  2H0I A;  1ZMA A;  3DWV A;  3TKQ A;  1AQW A;  2KP2 A;  3F4S A;  5GZZ B;  3WT2 A;  4TN8 A;  4NXI A;  2MMA A;  4MH2 A;  10GS A;  4AGS A;  3A2V A;  1B8X A;  3IV4 A;  3HJP A;  4RI7 A;  2V41 A;  1YF0 A;  1ON4 A;  4XCS A;  5G30 A;  3UJ1 A;  3FHK A;  1C72 A;  2H6Y A;  4LLR A;  4N0Z A;  1Z5Y E;  1J9B A;  4FO5 A;  1JZW A;  3UAR A;  4MJC A;  2WDU A;  5CRW A;  3GTU A;  1SL0 B;  3C1S A;  1U6T A;  5D9T A;  3H1N A;  4TW5 A;  3TRP A;  2L57 A;  4F0C A;  3LYP A;  3IHQ A;  3DML A;  4HJ2 A;  2CVB A;  1K0N A;  2YZU A;  1GSF A;  1SK1 A;  1LBK A;  2RM5 A;  2BJX A;  3UBK A;  3I43 A;  2O7K A;  1TRU A;  4K1F A;  4L5O A;  1DSB A;  4MPF A;  3QFA C;  3ZVJ A;  4J57 E;  1ZYE A;  5AIV A;  2CT6 A;  4F82 A;  1URM A;  1I9D A;  3TCO A;  4Q5N A;  1GNE A;  3DVX A;  4IBP A;  1MD4 A;  4KUN A;  2HRF A;  3GX0 A;  1JLW A;  2H76 A;  4EE0 A;  4IS0 A;  3J7Y k;  5AGY A;  6GSY A;  1PKZ A;  3CMI A;  5D93 A;  1UVZ A;  2RLI A;  3ME8 A;  3TJB A;  5JWR B;  1O85 A;  4IJI A;  4XS1 A;  2VLV A;  2YPM A;  3RPN A;  1YDK A;  3ISO A;  2V6K A;  4ACS A;  1XW5 A;  3FYG A;  1WPI A;  1O7U A;  1TI1 A;  3G9B A;  3QCP A;  4ECB A;  1ERV A;  1DUG A;  3IDV A;  2VCV A;  1V58 A;  1W89 A;  2IMF A;  5J5N A;  4XIH A;  3GYK A;  4V2N A;  1WMJ A;  1G7E A;  2GSR A;  5IOX A;  5ID2 A;  4ISD A;  4JU5 A;  1QUW A;  2R5G A;  2VIM A;  4N30 A;  4PQ1 A;  2AV4 A;  5B6N A;  8GSS A;  2HXK A;  3MNG A;  2PUK C;  4KCE A;  2EIO A;  3HZ4 A;  2FD3 A;  3ZMK A;  3GKK A;  3TJG A;  4LMW A;  4PNF A;  1K3L A;  1TOF A;  5CRD A;  3HVX A;  5A4W A;  4I97 A;  2JU5 A;  5ECQ B;  1K0B A;  1SD8 A;  1YF1 A;  1TW9 A;  3IK9 A;  2YJH A;  4BA7 A;  4RQX A;  4GWR A;  2PN8 A;  5IIZ A;  1WP0 A;  1EGO A;  2LRN A;  3TJJ A;  3P8W A;  2MMZ A;  2NTO A;  1OE7 A;  2C0E A;  2DJK A;  2FA4 A;  2Z9S A;  2DML A;  3BOA A;  1TU8 A;  3QOU A;  1H75 A;  3VWX A;  4YQV A;  2REM A;  4XS4 B;  2C1Y A;  2M80 A;  4MJA A;  1XWK A;  3F3R A;  5D9X A;  2PMT A;  5IQY A;  4TRX A;  1V40 A;  3KJY A;  3VPT A;  4DSS A;  2JSZ A;  3DKS A;  5B8B A;  1EV4 A;  3ERF A;  5DQY A;  2TRX A;  5E59 A;  3VI7 A;  3L0H A;  3MSZ A;  1K0C A;  3RBT A;  4ULX A;  3L9V A;  3P7X A;  5ABR A;  2HSY A;  3TOT A;  1IYI A;  2YV9 A;  3TKP A;  3A5W A;  1I5G A;  1XOA A;  2OA7 A;  3A3T A;  4ZBD A;  2JZT A;  3TKR A;  1XZO A;  3LG6 A;  3P2A A;  2P5R A;  3IC4 A;  1B4Q A;  4KSO A;  2B3S A;  3M9J A;  4K7O A;  3UVH A;  4TXV A;  2FA8 A;  1MD3 A;  1FVJ A;  2B5E A;  9GSS A;  1KBN A;  1GLQ A;  4IP6 A;  2PU9 C;  2WFC A;  4N11 A;  1OVN A;  3FY7 A;  3KCM A;  3EUR A;  2IMI A;  4G10 A;  3DD3 A;  1JZD A;  4HQS A;  1TI3 A;  3KZQ A;  3Q18 A;  2LRT A;  5ENU A;  1F9M A;  2HRN A;  3MWH A;  1FOV A;  1AIU A;  2WUL A;  2VL3 A;  2GQK A;  5A4V A;  5J4U A;  1A0F A;  2KUC A;  4BL7 A;  3ZYW A;  3FZ5 A;  2XPE A;  3FW2 A;  4JR6 A;  5IMD A;  2A2R A;  4KND A;  2EIR A;  2MYG A;  2YP6 A;  2XBI A;  1HYU A;  5KEJ A;  1K0A A;  1JZR A;  4G19 A;  2L59 A;  17GS A;  3C1R A;  2V32 A;  2GZY A;  4EDZ A;  2H72 A;  2BMX A;  4NPB A;  1AUC A;  5CRE A;  2DBC A;  3APO A;  3GHA A;  1TJD A;  4KSM A;  3DGQ A;  2C3Q A;  4PQI A;  2LJR A;  3ZIJ A;  4HJM A;  1N8J A;  1SKW B;  2IFQ A;  5AN1 A;  3CRT A;  2GQM A;  2X8C A;  2CQ9 A;  2VL2 A;  2E2G A;  4F2I A;  1TXX A;  1SJ6 A;  1TP9 A;  3PIN A;  1HQO A;  3FEU A;  1V9W A;  5IMV A;  1XIY A;  18GS A;  4WXT A;  1GWC A;  1TK5 B;  3LSZ A;  1Q98 A;  3FR9 A;  1PKW A;  4GST A;  1J08 A;  3IOS A;  5IPG A;  3F8U A;  1TDI A;  4CW9 A;  3DIE A;  4TR1 B;  1TRS A;  1ERT A;  4QQ7 A;  3N5O A;  1EV9 A;  4PNG A;  4I6X A;  1O8X A;  3I6A A;  5F06 A;  1BX9 A;  3EIN A;  4MA9 A;  2XPD A;  4RQR A;  4AF2 A;  2AAW A;  1SKR B;  4TR4 A;  2NBS A;  1QQ2 A;  5G2Z A;  2B1L A;  1TK8 B;  1MDK A;  1TTZ A;  1KEB A;  5IM9 A;  2I81 A;  3H79 A;  5DVB A;  1B48 A;  3EYT A;  5HFG A;  2HZE A;  2D2Z A;  2H66 A;  5ECL B;  4YAP A;  4PUA A;  2I1U A;  3F6F A;  1X9W B;  1R7H A;  4KAE A;  2QGV A;  2H71 A;  1SKS B;  1VF4 A;  3ZRE A;  3KM6 A;  1Z9H A;  3VPQ A;  2DJ3 A;  4GRF A;  1NM3 A;  2VL9 A;  1QXH A;  3KD0 A;  5IO2 A;  3H8Q A;  3BJ5 A;  4GQF A;  2N5B A;  5ECH B;  4JE1 A;  2V2G A;  1HD2 A;  1KTE A;  5CP1 A;  4LL4 B;  4F03 A;  3TRQ A;  3HKR A;  1EP7 A;  3QAG A;  4KB3 A;  5DJM A;  1CQH A;  1PX7 A;  1VF3 A;  4V1A p;  2IME A;  3FKF A;  2GT6 A;  5IO0 A;  4KA0 A;  1EEJ A;  1SYX A;  3QD9 A;  2YNX A;  1USB A;  2FWE A;  4KDU A;  2NDO A;  1AQX A;  3LQ7 A;  3KIJ A;  2R4V A;  5CO3 A;  3PR8 A;  2M46 A;  4EC0 A;  2P5Q A;  5HR0 A;  3GKM A;  3HZ8 A;  3FZ4 A;  4GLT A;  4MDC A;  5DAK B;  3EC3 A;  4JZQ A;  1O6J A;  3FK8 A;  1ZYQ B;  1K0D A;  1SJZ A;  2FLS A;  1A24 A;  1T1V A;  3GIX A;  4MF5 A;  1TK0 B;  3G7Y A;  1DE2 A;  3ERW A;  4FYU A;  4PXO A;  1JHB A;  4ML1 A;  1X9S B;  1R5P A;  1M7T A;  2O85 A;  4AJ6 A;  1FAA A;  5ECI B;  4EKZ A;  1XBS A;  1THO A;  2N5A A;  3EU3 A;  4AJ8 A;  3GV1 A;  2RUF A;  2YWN A;  5F0G A;  2J23 A;  1Z7P A;  4L8E A;  1YEP A;  3TUE A;  4LA1 A;  2PER A;  1THX A;  2PGT A;  4GXZ A;  5D8I A;  2GQL A;  1OAZ A;  2LJA A;  3LJR A;  5G31 A;  5DJL A;  1FVK A;  1XWA A;  1X5D A;  2L6C A;  1A8L A;  2KOK A;  2X8G A;  4GTU A;  5JCU A;  4XTS A;  3GTU B;  4BVX A;  1GSQ A;  3UBL A;  4F0B A;  1M99 A;  4FH8 A;  5H5R A;  1GL8 A;  1ZCP A;  1UC7 A;  3IRA A;  5DAL A;  4MH3 A;  1PL1 A;  3LGC A;  2GGT A;  3Q19 A;  1Z7R A;  4L0U A;  1Z6M A;  2FCH A;  4JED A;  2C8U A;  3ZIT A;  1YZX A;  1ERU A;  4F9Z A;  4NAX A;  5J9C A;  4TXO A;  2F8F A;  1X5C A;  2HZF A;  5CNW A;  2XC2 A;  4XS6 A;  2C0D A;  2JAC A;  4OWY A;  5D9W A;  3EE2 A;  3HCZ A;  4V2L A;  2QSI A;  5KN2 A;  3CYN A;  5G1L A;  3C71 A;  2FHE A;  4OCE A;  1OKT A;  3O3T A;  1HNC A;  1VRS D;  4WF4 A;  4RUV A;  2X64 A;  4MF6 A;  3GL3 A;  3D21 A;  2C3T A;  5COH A;  3SWL A;  3VUR A;  2O8V B;  3LEF A;  1AXD A;  6GSV A;  1S3C A;  3M1G A;  2LQQ A;  3DYR A;  4YQU A;  2A4V A;  1Z3E A;  1XPV A;  4K0G A;  1WRY A;  2VCZ A;  2ZUP A;  3TDG A;  1F37 A;  4XRD A;  4HU7 A;  4Q5R A;  4Q5Q A;  1OKD A;  4KDX A;  4QL7 A;  3LWA A;  1PGT A;  3I69 A;  1G6Y A;  4O92 A;  5ID2 B;  5JWQ B;  2WS2 A;  2YWI A;  4BWQ A;  1SYR A;  1G6W A;  4LMV A;  16GS A;  3FZ9 A;  4WBJ A;  2L5O A;  2VL2 C;  4WBR D;  1FG4 A;  4POK A;  1M9B A;  5ECP B;  1G0T A;  1BED A;  2GDR A;  2FWF A;  5LCZ A;  2IMK A;  3KH7 A;  1AAZ A;  3CTF A;  1XVQ A;  1M2B A;  5EL8 A;  1GUH A;  4NV2 A;  1PRX A;  3F3Q A;  3D4M A;  5H5S A;  2WJU A;  4MCU A;  2ZCT A;  3WT1 A;  3QDN A;  3H93 A;  3E9J B;  5D9V A;  1GSD A;  4PUF C;  1ZGN A;  2AYT A;  2RII A;  3KTB A;  2FNO A;  1F3B A;  2LUS A;  4BVY A;  5JCG A;  2OE1 A;  5FHI A;  3TJF A;  1FW1 A;  1WE0 A;  2F51 A;  3ED3 A;  1V57 A;  4MLY A;  3J7Y b;  2XBQ A;  3C8E A;  4O7H A;  5ECM B;  1XOB A;  1VF2 A;  4KX4 A;  2JL4 A;  2FY6 A;  1TRV A;  2VCT A;  2LEG A;  4O5R A;  1MDJ A;  1GSY A;  4MF7 A;  4DSS B;  3D4T A;  3Q74 A;  3E0U A;  4POM A;  1YKC A;  3MDK A;  3CTG A;  4WF5 A;  3KXO A;  3BD2 A;  1PL2 A;  4IKH A;  4ECJ A;  3K8N A;  3GUR A;  4J56 E;  1GTU A;  2C80 A;  3BCK A;  4J2F A;  2H75 A;  4ECI A;  3US3 A;  1KNG A;  2L6D A;  2CZ2 A;  4EVM A;  1Y25 A;  4LL1 B;  1AW9 A;  3BBY A;  2LJK A;  2YN1 A;  1K0O A;  1VF1 A;  1Z6N A;  3KMO A;  4KH7 A;  4I5Q A;  4AJ7 A;  4YH2 A;  2AHE A;  1XW9 A;  3IAM 2;  3UEM A;  2V1M A;  2MMN A;  4HZ2 A;  5F07 A;  6GSX A;  3L9U A;  4I8B A;  4OFM A;  4JRR A;  3ZVJ D;  1X0R A;  1BQ7 A;  1M9A A;  1NHY A;  4X43 A;  2FWH A;  2LQO A;  22GS A;  4EXJ A;  1QFN A;  2GZP A;  5ECR B;  5J3R A;  4IVF A;  1YEX A;  20GS A;  3GN3 A;  3G7J A;  5CRH A;  3UVT A;  1LU4 A;  2ALB A;  4CDO A;  4ML6 A;  1XCC A;  5KN1 A;  3QPM A;  1GSS A;  1ABA A;  1JZO A;  2O89 A;  1YJ6 A;  2YWO A;  5F05 A;  1ST9 A;  1EWX A;  1B4P A;  1WWJ A;  2B7J A;  2WZ9 A;  4KGI A;  5L71 A;  3WGX A;  1U88 A;  3IAS 2;  1JLV A;  1SL1 B;  3QAW A;  2NPB A;  3UOM A;  5DCH A;  3VWU A;  2IFQ B;  6GST A;  2H73 A;  3EMP A;  3GSS A;  4DSQ A;  4PX1 A;  2C3N A;  2HE3 A;  4D73 A;  5IMZ A;  3GRX A;  1XWB A;  5F8B A;  3VI5 A;  1QGV A;  1YQ1 A;  4TR1 A;  2F9S A;  2KHP A;  5G1K A;  4IW9 A;  4FIW A;  4MAB A;  1ML6 A;  4E8H A;  1EP8 A;  4GF0 A;  2OAC A;  2LRC A;  4WR5 A;  4MZC A;  4WET A;  4IJ3 A;  2K18 A;  4NV5 A;  2J9H A;  3FR6 A;  3KMN A;  3CSI A;  4MJB A;  5KN0 A;  4G9H A;  1X5E A;  4JR4 A;  5J9B A;  4K9Z A;  3NIV A;  3C73 A;  1EZK A;  4MK3 A;  2BTO T;  2CAI A;  3G7I A;  2VOC A;  3QMX A;  1J0F A;  1A23 A;  1DBY A;  4HS1 A;  2N5F A;  3W8J A;  2QKE A;  3U5R E;  1BJX A;  2B1K A;  5B8A A;  3VWV A;  4HI7 A;  3APS A;  3KEB A;  4MMM A;  1YY7 A;  4ZL7 A;  1E2Y A;  5J41 A;  3F9U A;  2FWG A;  3ZL5 A;  3EWL A;  4K0N A;  1XWG A;  3TKS E;  1WJK A;  5GSS A;  3ZZX A;  1OE8 A;  2HZE B;  4ECC A;  1H4O A;  3M9K A;  1OC8 A;  2LTK A;  2IWT A;  5DCG A;  2VAF A;  5A5K A;  5HR2 A;  1F6M C;  5GST A;  4K6X A;  3TJK A;  1OC9 B;  3QFB C;  4FYC A;  1TRW A;  3KP8 A;  5B6M A;  3TOU A;  4POB A;  4GSN A;  1ERW A;  2DC5 A;  1EEM A;  3HJO A;  1GTA A;  1SU9 A;  1R4W A;  3RDW A;  5HFK A;  4HUA A;  1F3A A;  2CZ3 A;  3ZLP A;  5IMC A;  3IE3 A;  4ZB9 A;  5ECK B;  1PA3 A;  1E6B A;  3LXT A;  2AUV A;  2WCI A;  3M8N A;  2ON5 A;  3DEX A;  2DSA A;  2VCQ A;  2GST A;  3KP9 A;  3O76 A;  4O32 A;  2HYX A;  3CXG A;  3TRX A;  4ZBB A;  4X1U A;  4QL9 A;  3LYK A;  3RHB A;  2MMO A;  3W6G A;  2P31 A;  5IPH A;  1IYH A;  2B7K A;  4IEL A;  5G5F A;  3F63 A;  2VCX A;  5CRG A;  4L0W A;  1PMT A;  3I9V 2;  3TKS A;  6GSS A;  4MZW A;  2H74 A;  1OYJ A;  5FT3 A;  2JZR A;  2CV4 A;  2YJ7 A;  5C00 A;  4KCA A;  4N10 A;  3ZIV A;  2QC7 A;  2GSS A;  1EOG A;  4WR4 A;  1XXU A;  3LXZ A;  4G2E A;  2H01 A;  3C7M A;  2WB9 A;  1EOH A;  2E0Q A;  1PX6 A;  4ZL8 A;  3V1W A;  1PD2 1;  1BYE A;  3FRC A;  3DXB A;  1TKD B;  3HA9 A;  1R26 A;  2LKU A;  2R37 A;  1A0R P;  2VUP A;  5ECN B;  2H1D A;  6GSW A;  2H1A A;  1YKA A;  2VD0 A;  4GSS A;  2L5L A;  3O6T A;  2JZS A;  1K3O A;  19GS A;  1GP1 A;  14GS A;  2DJJ A;  1WIK A;  4OFN A;  1X9M B;  1B9Y C;  4PGT A;  4EDY A;  2IL3 A;  2AB6 A;  2LV3 A;  3KTL A;  1A2M A;  5B7C A;  5EPF A;  2B6M A;  3WD6 A;  1A8Y A;  4POL A;  1ZZY A;  4JBB A;  3W8S A;  5KN3 A;  4GQC A;  5DAL B;  2YZH A;  3UAP A;  1GNW A;  1GTB A;  4IQA A;  3VK9 A;  5EVO A;  1SK0 A;  1ILO A;  5HR1 A;  5AIS A;  1CQG A;  2GSQ A;  2X99 A;  3D6I A;  4NWY A;  3F4T A;  1DE1 A;  3TGZ A;  2HT9 A;  2JAD A;  4X0X A;  3PH9 A;  2VO4 A;  3HY2 A;  1HNB A;  3HVS A;  3OR5 A;  5JCW A;  2HI7 A;  1QMV A;  2PBJ A;  2V6O A;  3EU4 A;  1VGL A;  4TXO B;  4L5L A;  2M72 A;  2PVO C;  1NHO A;  1M2D A;  2H19 A;  4IP1 A;  1W4V A;  1NW2 A;  1SK2 A;  2OJL A;  1AQV A;  2C0F A;  2CVD A;  4TR3 A;  2VCW A;  2PPT A;  1ZL9 A;  3A2X A;  2CX3 A;  5IMF A;  3L78 A;  3CBU A;  2OBI A;  1SEN A;  1TU7 A;  1GUK A;  4DSR A;  3GL5 A;  2H30 A;  3GFK A;  4IHU A;  4I2U A;  3ZFL A;  3F6D A;  5DQS A;  3QR6 A;  1S3D A;  1M0U A;  1FHE A;  4XHM A;  4FYB A;  3HD5 A;  1O73 A;  4NHW A;  3VLN A;  1NSW A;  3HXS A;  5GAP D;  5H5Q A;  4EF0 A;  2YWM A;  3N9J A;  3U6V A;  1U3I A;  2H8L A;  2GTU A;  3NOF A;  2HLS A;  3D0Z A;  3WGE A;  4K2D A;  5E4W A;  2AJQ B;  4XS4 A;  2KP1 A;  2K9F A;  2OE0 A;  5GAN D;  2VLU A;  3E3E A;  4OCF A;  5IMA A;  3D5J A;  5LNK e;  2R6K A;  2LNT A;  5DBQ A;  4V2M A;  3GX8 A;  4RI6 A;  4NMU A;  3RPP A;  2OBK A;  4HOJ A;  4OD7 A;  1GH2 A;  2I9H A;  2OKA A;  3EMX A;  4ILF A;  1HNA A;  2L4C A;  1T4Z A;  5D73 A;  2GS3 A;  2DJ2 A;  2VLT A;  2MBT A;  2YAN A;  3APQ A;  1EGR A;  2IJY A;  4CHS A;  3IR4 A;  3SBC A;  3GMF A;  2DMM A;  3FZA A;  2H6Z A;  1WOU A;  4DEJ A;  2IMD A;  1RQM A;  2H0G A;  2C0G A;  1SL2 B;  4OO4 A;  11GS A;  3HYP A;  1K0M A;  4N0V A;  4OMV A;  1RW1 A;  1V98 A;  3ZTL A;  4I2T A;  4P3Y B;  4WKW A;  1Q4J A;  2EIQ A;  4EUY A;  2H6X A;  1XFL A;  3F4R A;  2O87 A;  2H0H A;  4HEA 2;  3ZFB A;  4TVE A;  3WGD A;  2HSH A;  1K3Y A;  4K8M A;  4EL1 A;  1RK4 A;  2YV7 A;  3EVI A;  2LST A;  2H70 A;  2IN3 A;  5HFI A;  2EC4 A;  5EY6 A;  3ZRD A;  3BCI A;  3M3M A;  2IIY A;  2I4A A;  4Z7X A;  3TB2 A;  1PN9 A;  3GH6 A;  3LOR A;  2DLX A;  2G0F A;  3ZML A;  6GSU A;  4K7N A;  4HQZ A;  2VM2 A;  1T7P B;  5ECO B;  1GUL A;  4IQ1 A;  1PSQ A;  2GVP A;  2CA8 A;  5C04 A;  2K8S A;  4PUR A;  2RUE A;  2MBS A;  4ZB8 A;  1A2J A;  2DIY A;  2C4J A;  3R2Q A;  4ZIJ A;  2E2M A;  5INY A;  5JWO B;  4OFT A;  2K8V A;  4IGJ A;  3GKX A;  4TKY A;  2CX4 A;  3NZN A;  4XRA A;  3FR3 A;  1ACV A;  3GA4 A;  3HVV A;  3DRN A;  2XHF A;  1UN2 A;  3CSJ A;  1BG5 A;  1MEK A;  2PWJ A;  2B5X A;  1GLP A;  1UA5 A;  3PGT A;  1JFU A;  1XWC A;  3DVW A;  4KE3 A;  3VWW A;  2GT5 A;  4ZL9 A;  4EO3 A;  3HJM A;  3M0F A;  3TKS C;  4H86 A;  1T4Y A;  3MAK A;  3WYW A;  4MZB A;  1MDI A;  4YAV A;  2F3M A;  1PQN A;  1O81 A;  2A2S A;  1U87 A;  4ZXG A;  2NVL A;  1T3B A;  3IA1 A;  2X8H A;  2WGR A;  2B5Y A;  1V2A A;  5FWG A;  1S3A A;  4HZ4 A;  3L4N A;  2I3Y A;  3S9F A;  3UIW A;  3F0I A;  4HU9 A;  3GST A;  2FUG 2;  4IN0 A;  3RHC A;  3GUS A;  3LFL A;  5HQP A;  3KH9 A;  3ERG A;  3RAZ A;  4NHZ A;  1AC1 A;  4OO5 A;  1GSU A;  1MTC A;  5CYY A;  2ES7 A;  1GTI A;  1FO5 A;  2VD1 A;  4GCI A;  1G7O A;  2R2J A;  2LNS A;  2OE3 A;  5ELA A;  4D73 B;  7GSS A;  3IK7 A;  2H1G A;  3IXR A;  12GS A;  2F8A A;  5DDL A;  1QK8 A;  2YCD A;  1T8E B;  2JSY A;  2TIR A;  4WEY A;  5G5E A;  2DJ0 A;  1BAY A;  3CRU A;  4ZBA A;  2GZZ A;  4V1A g;  4E8E A;  3IBH A;  2HFD A;  2PVQ A;  3CSH A;  3HHV A;  3P90 A;  5ECS A;  4Q5F A;  3Q6O A;  4MJE A;  4ID0 A;  4KW6 A;  3UL3 A;  2KLX A;  4PQH A;  5AIX A;  3VFI A;  5A4U A;  4ZB6 A;  2WRT A;  2CVK A;  1GSE A;  1R5A A;  1OC9 A;  5D96 A;  5HR3 A;  3IPZ A;  2P0G A;  2CAQ A;  1A2L A;  1N2A A;  3H4K A;  4BWS A;  4DVC A;  1O8W A;  2LS5 A;  1XVW A;  3GH9 A; 
#chains in the Genus database with same CATH topology
 4ZIL A;  5IOW A;  2TRC P;  3A2W A;  3FMW A;  1GUM A;  3ME7 A;  3AY8 A;  1SJI A;  1SD9 A;  4MP4 A;  4K7I A;  4HDE A;  1Y6E A;  4MPG A;  1OC3 A;  2MZC A;  2YOI A;  2G2Q A;  1FB0 A;  1LJR A;  2VM1 A;  3JCM L;  5DAK A;  2HNL A;  3UMA A;  1GRX A;  2K6V A;  4K5S A;  4TR0 A;  4TOP A;  3D22 A;  4YQM A;  3L9S A;  2DJ1 A;  5ELG A;  2GLR A;  3HDC A;  2IPA A;  4KDY A;  4CY8 A;  2E7P A;  2ON7 A;  1T00 A;  3GNJ A;  4K2X A;  5KOX A;  2H1B A;  2L4Q A;  1U3A A;  2R3X A;  1F2E A;  1B9X C;  5LD0 A;  1FB6 A;  1XW6 A;  2RM6 A;  2OAD A;  5CAX A;  3KGK A;  4BPY A;  2FGX A;  13GS A;  3GKN A;  2ZNM A;  1M2A A;  2DIZ A;  1ZOF A;  3QAV A;  2H0I A;  1ZMA A;  3DWV A;  3TKQ A;  1AQW A;  2KP2 A;  3F4S A;  5GZZ B;  3WT2 A;  4TN8 A;  4NXI A;  2MMA A;  4MH2 A;  10GS A;  4AGS A;  3A2V A;  1B8X A;  3IV4 A;  3HJP A;  4RI7 A;  2V41 A;  1YF0 A;  1ON4 A;  4XCS A;  5G30 A;  3UJ1 A;  3FHK A;  1C72 A;  2H6Y A;  4LLR A;  4N0Z A;  1Z5Y E;  1J9B A;  4FO5 A;  1JZW A;  3UAR A;  4MJC A;  2WDU A;  5CRW A;  3GTU A;  1SL0 B;  3C1S A;  1U6T A;  5D9T A;  3H1N A;  4TW5 A;  3TRP A;  2L57 A;  4F0C A;  3LYP A;  3IHQ A;  3DML A;  4HJ2 A;  2CVB A;  1K0N A;  4Z2U A;  2YZU A;  1GSF A;  1SK1 A;  1LBK A;  2RM5 A;  2BJX A;  3UBK A;  3I43 A;  2O7K A;  1TRU A;  4K1F A;  4L5O A;  1DSB A;  4MPF A;  3QFA C;  3ZVJ A;  4J57 E;  1ZYE A;  5AIV A;  2CT6 A;  4F82 A;  1URM A;  1I9D A;  3TCO A;  4PTS A;  4Q5N A;  1GNE A;  3DVX A;  4IBP A;  1MD4 A;  4KUN A;  2HRF A;  3GX0 A;  1JLW A;  2H76 A;  4EE0 A;  4IS0 A;  3J7Y k;  5AGY A;  6GSY A;  1PKZ A;  3CMI A;  5D93 A;  1UVZ A;  2RLI A;  3ME8 A;  3TJB A;  5JWR B;  1O85 A;  4IJI A;  4XS1 A;  2VLV A;  2YPM A;  3RPN A;  1YDK A;  3ISO A;  2V6K A;  4ACS A;  1XW5 A;  3FYG A;  1WPI A;  1O7U A;  1TI1 A;  3G9B A;  3QCP A;  4ECB A;  1ERV A;  1DUG A;  3IDV A;  5BMU A;  2VCV A;  1V58 A;  1W89 A;  2IMF A;  5J5N A;  4XIH A;  3GYK A;  4V2N A;  1WMJ A;  1G7E A;  2GSR A;  5IOX A;  5ID2 A;  4ISD A;  4JU5 A;  1QUW A;  2R5G A;  2VIM A;  4N30 A;  4PQ1 A;  2AV4 A;  5B6N A;  8GSS A;  2HXK A;  3MNG A;  2PUK C;  4KCE A;  2EIO A;  3HZ4 A;  2FD3 A;  3ZMK A;  2R0P A;  3GKK A;  3TJG A;  4LMW A;  4PNF A;  1K3L A;  1TOF A;  5CRD A;  2X4A A;  3HVX A;  5A4W A;  4I97 A;  2JU5 A;  5ECQ B;  1K0B A;  1SD8 A;  1YF1 A;  1TW9 A;  3IK9 A;  2YJH A;  4BA7 A;  4RQX A;  4GWR A;  2PN8 A;  5IIZ A;  1WP0 A;  1EGO A;  2LRN A;  3TJJ A;  3P8W A;  2MMZ A;  2NTO A;  1OE7 A;  2C0E A;  2DJK A;  2FA4 A;  2Z9S A;  2DML A;  3BOA A;  1TU8 A;  3QOU A;  1H75 A;  3VWX A;  4YQV A;  2REM A;  4XS4 B;  4MJA A;  2C1Y A;  2M80 A;  4G0K A;  1XWK A;  3F3R A;  5D9X A;  2HRA A;  2PMT A;  5IQY A;  4TRX A;  1V40 A;  3KJY A;  3VPT A;  4DSS A;  2JSZ A;  3DKS A;  5B8B A;  1EV4 A;  3ERF A;  4G0L A;  5DQY A;  2TRX A;  5E59 A;  3VI7 A;  3L0H A;  3MSZ A;  1K0C A;  3RBT A;  4ULX A;  3L9V A;  3P7X A;  5ABR A;  2HSY A;  3TOT A;  1IYI A;  2YV9 A;  3TKP A;  3A5W A;  1I5G A;  1XOA A;  2OA7 A;  3A3T A;  4ZBD A;  2JZT A;  3TKR A;  1XZO A;  3LG6 A;  3P2A A;  2P5R A;  3IC4 A;  1B4Q A;  4KSO A;  2B3S A;  3M9J A;  4K7O A;  3UVH A;  4TXV A;  2FA8 A;  1MD3 A;  1FVJ A;  2B5E A;  9GSS A;  1KBN A;  1GLQ A;  4IP6 A;  2PU9 C;  2WFC A;  4N11 A;  1OVN A;  3FY7 A;  3KCM A;  3EUR A;  2IMI A;  4G10 A;  3DD3 A;  1JZD A;  4HQS A;  3A5I A;  1PN0 A;  1TI3 A;  3KZQ A;  3Q18 A;  2LRT A;  5ENU A;  1F9M A;  2HRN A;  3MWH A;  1FOV A;  1AIU A;  2WUL A;  2VL3 A;  2GQK A;  5A4V A;  5J4U A;  1A0F A;  2KUC A;  4BL7 A;  3ZYW A;  2UZ8 A;  3FZ5 A;  2XPE A;  3FW2 A;  4JR6 A;  5IMD A;  2A2R A;  4KND A;  2EIR A;  2MYG A;  2YP6 A;  2XBI A;  1HYU A;  5KEJ A;  1K0A A;  1JZR A;  4G19 A;  2L59 A;  17GS A;  3C1R A;  2V32 A;  2GZY A;  4EDZ A;  2H72 A;  3EPT A;  2BMX A;  4NPB A;  1AUC A;  5CRE A;  2DBC A;  3APO A;  3GHA A;  1TJD A;  4KSM A;  3DGQ A;  2C3Q A;  4PQI A;  2LJR A;  3ZIJ A;  4ICY A;  4HJM A;  1N8J A;  1SKW B;  2IFQ A;  5AN1 A;  3IC8 A;  3CRT A;  2GQM A;  2X8C A;  2CQ9 A;  2VL2 A;  2E2G A;  4F2I A;  1TXX A;  1SJ6 A;  1TP9 A;  3PIN A;  1HQO A;  3FEU A;  1V9W A;  5IMV A;  1XIY A;  18GS A;  4WXT A;  1GWC A;  1TK5 B;  3LSZ A;  1Q98 A;  3FR9 A;  1PKW A;  4GST A;  1J08 A;  3IOS A;  5IPG A;  3F8U A;  1TDI A;  4CW9 A;  3DIE A;  4TR1 B;  1TRS A;  1ERT A;  4QQ7 A;  3N5O A;  1EV9 A;  4PNG A;  4I6X A;  1O8X A;  3I6A A;  5F06 A;  1BX9 A;  3EIN A;  4MA9 A;  2XPD A;  4RQR A;  4AF2 A;  2AAW A;  1SKR B;  4TR4 A;  2NBS A;  1QQ2 A;  5G2Z A;  2B1L A;  1TK8 B;  1MDK A;  1TTZ A;  1KEB A;  5IM9 A;  2I81 A;  3H79 A;  5DVB A;  1B48 A;  3EYT A;  5HFG A;  2HZE A;  2D2Z A;  2H66 A;  5ECL B;  4YAP A;  4PUA A;  2I1U A;  3F6F A;  1X9W B;  1R7H A;  4KAE A;  2QGV A;  2H71 A;  1SKS B;  1VF4 A;  3ZRE A;  3KM6 A;  1Z9H A;  3VPQ A;  2DJ3 A;  4GRF A;  1NM3 A;  2X49 A;  2VL9 A;  1QXH A;  3KD0 A;  5IO2 A;  3H8Q A;  3BJ5 A;  4GQF A;  2N5B A;  5ECH B;  4JE1 A;  2V2G A;  1HD2 A;  1KTE A;  5CP1 A;  4LL4 B;  4F03 A;  3TRQ A;  3HKR A;  1EP7 A;  3QAG A;  4KB3 A;  5DJM A;  1CQH A;  1PX7 A;  1VF3 A;  4KF9 A;  2DKH A;  4V1A p;  2IME A;  3FKF A;  2GT6 A;  5IO0 A;  4KA0 A;  1EEJ A;  1SYX A;  3QD9 A;  2YNX A;  1USB A;  2FWE A;  4KDU A;  2NDO A;  1AQX A;  3LQ7 A;  3KIJ A;  2R4V A;  5CO3 A;  3PR8 A;  2M46 A;  4EC0 A;  2P5Q A;  5HR0 A;  3GKM A;  3HZ8 A;  3FZ4 A;  4GLT A;  4MDC A;  5DAK B;  3EC3 A;  4JZQ A;  1O6J A;  3FK8 A;  1ZYQ B;  1K0D A;  1SJZ A;  2FLS A;  1A24 A;  1T1V A;  3GIX A;  4MF5 A;  1TK0 B;  3G7Y A;  1DE2 A;  3ERW A;  4FYU A;  4PXO A;  1JHB A;  4ML1 A;  1X9S B;  5BRT A;  1R5P A;  1M7T A;  2O85 A;  4AJ6 A;  1FAA A;  5ECI B;  4EKZ A;  1XBS A;  1THO A;  2N5A A;  3EU3 A;  4AJ8 A;  3GV1 A;  2RUF A;  2YWN A;  5F0G A;  2J23 A;  1Z7P A;  4L8E A;  1YEP A;  3TUE A;  4LA1 A;  4G0I A;  2PER A;  1S3R A;  1THX A;  2PGT A;  4GXZ A;  5D8I A;  2GQL A;  1OAZ A;  2LJA A;  3LJR A;  5G31 A;  5DJL A;  1FVK A;  1XWA A;  1X5D A;  2L6C A;  1A8L A;  2KOK A;  2X8G A;  4GTU A;  5JCU A;  4XTS A;  3GTU B;  4BVX A;  1GSQ A;  3UBL A;  2HSM A;  4F0B A;  1M99 A;  4FH8 A;  5H5R A;  1GL8 A;  1ZCP A;  1UC7 A;  3IRA A;  5DAL A;  4MH3 A;  1PL1 A;  3LGC A;  2GGT A;  3Q19 A;  1Z7R A;  4L0U A;  1Z6M A;  2FCH A;  4JED A;  2C8U A;  3ZIT A;  1YZX A;  1ERU A;  4F9Z A;  4NAX A;  5J9C A;  4TXO A;  2F8F A;  1X5C A;  2HZF A;  5CNW A;  2XC2 A;  4XS6 A;  2C0D A;  2JAC A;  4OWY A;  5D9W A;  3EE2 A;  3HCZ A;  4V2L A;  2QSI A;  5KN2 A;  3CYN A;  5G1L A;  3C71 A;  2FHE A;  4OCE A;  1OKT A;  3O3T A;  1HNC A;  1VRS D;  4WF4 A;  4RUV A;  2X64 A;  4MF6 A;  3GL3 A;  3D21 A;  2C3T A;  5COH A;  3SWL A;  3VUR A;  2O8V B;  3LEF A;  1AXD A;  6GSV A;  1S3C A;  3M1G A;  2LQQ A;  3DYR A;  4YQU A;  2A4V A;  1Z3E A;  1XPV A;  4K0G A;  1WRY A;  2VCZ A;  2ZUP A;  3TDG A;  1F37 A;  4XRD A;  4HU7 A;  4Q5R A;  4Q5Q A;  1OKD A;  4KDX A;  4QL7 A;  1ZYN A;  3LWA A;  1PGT A;  3I69 A;  1G6Y A;  4O92 A;  5ID2 B;  5JWQ B;  2WS2 A;  2YWI A;  4BWQ A;  1SYR A;  1G6W A;  4LMV A;  16GS A;  3FZ9 A;  4WBJ A;  2L5O A;  2VL2 C;  4WBR D;  1FG4 A;  4POK A;  1M9B A;  5ECP B;  1G0T A;  1BED A;  2GDR A;  2FWF A;  5LCZ A;  2IMK A;  3KH7 A;  1AAZ A;  3CTF A;  1XVQ A;  1M2B A;  5EL8 A;  1GUH A;  4NV2 A;  1PRX A;  3F3Q A;  3D4M A;  5H5S A;  2WJU A;  4MCU A;  2ZCT A;  3WT1 A;  3QDN A;  3PPU A;  3H93 A;  3E9J B;  5D9V A;  1GSD A;  4PUF C;  1ZGN A;  2AYT A;  2RII A;  3KTB A;  2FNO A;  1F3B A;  2LUS A;  4BVY A;  5JCG A;  2OE1 A;  5FHI A;  3TJF A;  1FW1 A;  4A5P A;  1WE0 A;  2F51 A;  3ED3 A;  1V57 A;  4MLY A;  3J7Y b;  2XBQ A;  3C8E A;  3LW9 A;  4O7H A;  5ECM B;  1XOB A;  1VF2 A;  4KX4 A;  2JL4 A;  2FY6 A;  1TRV A;  2VCT A;  2LEG A;  4O5R A;  1MDJ A;  1GSY A;  4MF7 A;  4DSS B;  3D4T A;  3Q74 A;  2A4H A;  3E0U A;  4POM A;  4Z2T A;  1YKC A;  3MDK A;  3CTG A;  4WF5 A;  3KXO A;  3BD2 A;  1PL2 A;  4IKH A;  4ECJ A;  3K8N A;  3GUR A;  4J56 E;  1GTU A;  2C80 A;  3BCK A;  4J2F A;  2H75 A;  4ECI A;  3US3 A;  1KNG A;  2L6D A;  2CZ2 A;  4EVM A;  1Y25 A;  4LL1 B;  1AW9 A;  3BBY A;  2LJK A;  2YN1 A;  1K0O A;  1VF1 A;  1Z6N A;  3KMO A;  4KH7 A;  4I5Q A;  4AJ7 A;  4YH2 A;  2AHE A;  1XW9 A;  3IAM 2;  3UEM A;  2V1M A;  2MMN A;  4HZ2 A;  5F07 A;  6GSX A;  3L9U A;  4I8B A;  4OFM A;  4JRR A;  3ZVJ D;  1X0R A;  1BQ7 A;  1M9A A;  1NHY A;  4X43 A;  2FWH A;  2LQO A;  22GS A;  4EXJ A;  1QFN A;  2GZP A;  5ECR B;  5J3R A;  4IVF A;  1YEX A;  20GS A;  3GN3 A;  3G7J A;  5CRH A;  3UVT A;  1LU4 A;  2ALB A;  4CDO A;  4ML6 A;  1XCC A;  5KN1 A;  3QPM A;  1GSS A;  1ABA A;  1JZO A;  2O89 A;  1YJ6 A;  2YWO A;  5F05 A;  1ST9 A;  1EWX A;  1B4P A;  1WWJ A;  2B7J A;  2WZ9 A;  4KGI A;  5L71 A;  3WGX A;  1U88 A;  3IAS 2;  1JLV A;  1SL1 B;  3QAW A;  2NPB A;  3UOM A;  5DCH A;  2QA2 A;  3VWU A;  2IFQ B;  6GST A;  2H73 A;  3EMP A;  3GSS A;  4DSQ A;  4PX1 A;  2C3N A;  2HE3 A;  4D73 A;  5IMZ A;  3GRX A;  1XWB A;  5F8B A;  3VI5 A;  1QGV A;  2R0G A;  1YQ1 A;  4TR1 A;  2F9S A;  2KHP A;  5G1K A;  4IW9 A;  4FIW A;  4MAB A;  1ML6 A;  4E8H A;  1EP8 A;  4GF0 A;  2OAC A;  2LRC A;  4WR5 A;  4MZC A;  4WET A;  4IJ3 A;  2K18 A;  4NV5 A;  2J9H A;  3FR6 A;  3KMN A;  3CSI A;  4MJB A;  5KN0 A;  4G9H A;  1X5E A;  4JR4 A;  5J9B A;  4K9Z A;  3NIV A;  3C73 A;  1EZK A;  4MK3 A;  2BTO T;  4USS A;  2CAI A;  3G7I A;  2VOC A;  3QMX A;  1J0F A;  1A23 A;  1DBY A;  4HS1 A;  2N5F A;  3W8J A;  2QKE A;  3U5R E;  1BJX A;  2B1K A;  5B8A A;  3VWV A;  4HI7 A;  3APS A;  3KEB A;  4MMM A;  1YY7 A;  4ZL7 A;  1E2Y A;  3R3E A;  5J41 A;  3F9U A;  2FWG A;  3ZL5 A;  3EWL A;  4K0N A;  1XWG A;  3TKS E;  1WJK A;  5GSS A;  3ZZX A;  2DKI A;  1OE8 A;  2HZE B;  4ECC A;  1H4O A;  3M9K A;  1OC8 A;  2LTK A;  2IWT A;  5DCG A;  2VAF A;  5A5K A;  5HR2 A;  1F6M C;  5GST A;  4K6X A;  3TJK A;  1OC9 B;  3QFB C;  4FYC A;  1TRW A;  3KP8 A;  5B6M A;  3TOU A;  4POB A;  4GSN A;  1ERW A;  2DC5 A;  1EEM A;  3HJO A;  1GTA A;  1SU9 A;  1R4W A;  3RDW A;  5HFK A;  4HUA A;  1F3A A;  2CZ3 A;  3ZLP A;  5IMC A;  4YKF A;  3IE3 A;  4ZB9 A;  5ECK B;  1PA3 A;  1E6B A;  3LXT A;  2AUV A;  2WCI A;  3M8N A;  2ON5 A;  3DEX A;  2DSA A;  2VCQ A;  2GST A;  3KP9 A;  3O76 A;  4O32 A;  2HYX A;  3CXG A;  3TRX A;  4ZBB A;  4X1U A;  4QL9 A;  3LYK A;  3RHB A;  2MMO A;  3W6G A;  2P31 A;  5IPH A;  1IYH A;  2B7K A;  4IEL A;  5G5F A;  3F63 A;  2VCX A;  5CRG A;  4L0W A;  1PMT A;  3I9V 2;  3TKS A;  6GSS A;  4MZW A;  2H74 A;  1OYJ A;  5FT3 A;  1FOH A;  2JZR A;  2CV4 A;  2YJ7 A;  5C00 A;  4KCA A;  4N10 A;  3ZIV A;  2QC7 A;  2GSS A;  1EOG A;  4WR4 A;  1XXU A;  3LXZ A;  4G2E A;  2H01 A;  3C7M A;  2WB9 A;  1EOH A;  2E0Q A;  1PX6 A;  4ZL8 A;  3V1W A;  4YKG A;  2QA1 A;  1PD2 1;  1BYE A;  3FRC A;  3DXB A;  1TKD B;  3HA9 A;  1R26 A;  4Z2R A;  2LKU A;  2R37 A;  1A0R P;  2VUP A;  5ECN B;  2H1D A;  6GSW A;  2H1A A;  1YKA A;  2VD0 A;  3HVN A;  4GSS A;  2L5L A;  3O6T A;  2JZS A;  1K3O A;  19GS A;  1GP1 A;  2A2P A;  4EIQ A;  14GS A;  2DJJ A;  1WIK A;  4OFN A;  1X9M B;  1B9Y C;  4PGT A;  4EDY A;  2IL3 A;  2AB6 A;  2LV3 A;  3KTL A;  1A2M A;  5B7C A;  5EPF A;  2B6M A;  3WD6 A;  1A8Y A;  4BVX B;  4POL A;  1ZZY A;  4JBB A;  3W8S A;  5KN3 A;  4GQC A;  5DAL B;  2YZH A;  3UAP A;  1GNW A;  1GTB A;  4IQA A;  3VK9 A;  5EVO A;  1SK0 A;  1ILO A;  5HR1 A;  5AIS A;  1CQG A;  2GSQ A;  2X99 A;  3D6I A;  4NWY A;  3F4T A;  1DE1 A;  3TGZ A;  2HT9 A;  2JAD A;  4X0X A;  3PH9 A;  2VO4 A;  3HY2 A;  1HNB A;  3HVS A;  3OR5 A;  3IHG A;  5JCW A;  2HI7 A;  1QMV A;  2PBJ A;  2V6O A;  3EU4 A;  1VGL A;  2HRK A;  4TXO B;  4L5L A;  2M72 A;  4FQU A;  2PVO C;  4EIP A;  1NHO A;  1M2D A;  2H19 A;  4IP1 A;  1W4V A;  1NW2 A;  1SK2 A;  2OJL A;  1AQV A;  2C0F A;  2CVD A;  4O5U A;  4TR3 A;  2VCW A;  2PPT A;  1ZL9 A;  3A2X A;  2CX3 A;  5IMF A;  3L78 A;  3CBU A;  2OBI A;  1SEN A;  1TU7 A;  1GUK A;  4DSR A;  3GL5 A;  3CQF A;  2H30 A;  4HSC X;  3GFK A;  4IHU A;  4I2U A;  3ZFL A;  1XG8 A;  3F6D A;  5DQS A;  3QR6 A;  1S3D A;  1M0U A;  1FHE A;  4XHM A;  4FYB A;  3HD5 A;  4X4J A;  1O73 A;  4NHW A;  3VLN A;  1NSW A;  3HXS A;  5GAP D;  5H5Q A;  4BIK A;  4EF0 A;  2YWM A;  3N9J A;  3U6V A;  1U3I A;  2H8L A;  2GTU A;  3NOF A;  2HLS A;  3D0Z A;  3WGE A;  2R0C A;  4K2D A;  5E4W A;  2AJQ B;  4XS4 A;  2KP1 A;  2K9F A;  1PFO A;  2OE0 A;  5GAN D;  2VLU A;  3E3E A;  4OCF A;  5IMA A;  3D5J A;  5LNK e;  2R6K A;  2LNT A;  5DBQ A;  4V2M A;  3GX8 A;  4RI6 A;  4NMU A;  3RPP A;  2OBK A;  4HOJ A;  4OD7 A;  1GH2 A;  2I9H A;  2OKA A;  3EMX A;  4ILF A;  1HNA A;  2L4C A;  1T4Z A;  5D73 A;  2GS3 A;  2DJ2 A;  2VLT A;  2MBT A;  2YAN A;  3APQ A;  1EGR A;  2IJY A;  4CHS A;  3IR4 A;  3SBC A;  3GMF A;  2DMM A;  3FZA A;  2H6Z A;  1WOU A;  4DEJ A;  2IMD A;  1RQM A;  4BVY B;  4MNN A;  4K5R A;  2H0G A;  2C0G A;  1SL2 B;  1M3I A;  4OO4 A;  11GS A;  3HYP A;  1K0M A;  4N0V A;  4OMV A;  1RW1 A;  1V98 A;  3ZTL A;  4I2T A;  4P3Y B;  4WKW A;  1Q4J A;  2EIQ A;  4EUY A;  2H6X A;  1XFL A;  3F4R A;  2O87 A;  2H0H A;  4HEA 2;  3ZFB A;  4TVE A;  3WGD A;  2HSH A;  1K3Y A;  4K8M A;  4EL1 A;  1RK4 A;  2YV7 A;  3EVI A;  2LST A;  2H70 A;  2IN3 A;  5HFI A;  2EC4 A;  5EY6 A;  3ZRD A;  3BCI A;  3M3M A;  2IIY A;  2I4A A;  4Z7X A;  3TB2 A;  1PN9 A;  3GH6 A;  3LOR A;  2DLX A;  2G0F A;  3ZML A;  6GSU A;  4K7N A;  4HQZ A;  2VM2 A;  1T7P B;  5ECO B;  1GUL A;  4IQ1 A;  1PSQ A;  2GVP A;  2CA8 A;  5C04 A;  2K8S A;  4PUR A;  2RUE A;  2MBS A;  4ZB8 A;  1A2J A;  2DIY A;  2C4J A;  3R2Q A;  4ZIJ A;  2E2M A;  5INY A;  4BL7 B;  5JWO B;  4OFT A;  3MIX A;  2K8V A;  4IGJ A;  3GKX A;  4TKY A;  2CX4 A;  3NZN A;  4XRA A;  1M3J A;  3FR3 A;  1ACV A;  3GA4 A;  3HVV A;  3DRN A;  2XHF A;  1UN2 A;  3CSJ A;  4CY6 A;  1BG5 A;  1MEK A;  2PWJ A;  2B5X A;  1GLP A;  1UA5 A;  3PGT A;  1JFU A;  1XWC A;  3DVW A;  4KE3 A;  3VWW A;  2GT5 A;  4ZL9 A;  4EO3 A;  3HJM A;  3M0F A;  3TKS C;  4H86 A;  1T4Y A;  3MAK A;  3WYW A;  4MZB A;  1MDI A;  4YAV A;  2F3M A;  1PQN A;  1O81 A;  2A2S A;  1U87 A;  4ZXG A;  2NVL A;  1T3B A;  3IA1 A;  2X8H A;  2WGR A;  2B5Y A;  1V2A A;  5FWG A;  1S3A A;  4HZ4 A;  3L4N A;  2I3Y A;  3S9F A;  3UIW A;  3F0I A;  4HU9 A;  3GST A;  2FUG 2;  4IN0 A;  3RHC A;  1ZYP A;  3GUS A;  3LFL A;  5HQP A;  3KH9 A;  3ERG A;  3RAZ A;  4NHZ A;  1AC1 A;  4OO5 A;  1GSU A;  1MTC A;  5CYY A;  2ES7 A;  1GTI A;  1FO5 A;  2VD1 A;  4GCI A;  1G7O A;  2R2J A;  2LNS A;  2OE3 A;  5ELA A;  4D73 B;  7GSS A;  4O5Q A;  3IK7 A;  2H1G A;  3IXR A;  12GS A;  2F8A A;  5DDL A;  1QK8 A;  2YCD A;  1T8E B;  2JSY A;  2TIR A;  4WEY A;  5G5E A;  2DJ0 A;  1BAY A;  3CRU A;  4ZBA A;  5KOW A;  2GZZ A;  4V1A g;  4E8E A;  3IBH A;  2HFD A;  2PVQ A;  3MYD A;  3CSH A;  3HHV A;  3P90 A;  5ECS A;  4Q5F A;  3Q6O A;  4MJE A;  4ID0 A;  4KW6 A;  3UL3 A;  2KLX A;  4PQH A;  5AIX A;  3VFI A;  5A4U A;  4ZB6 A;  2WRT A;  2CVK A;  1GSE A;  1R5A A;  1OC9 A;  5D96 A;  5HR3 A;  3IPZ A;  2P0G A;  2CAQ A;  1A2L A;  1N2A A;  3H4K A;  4BWS A;  4DVC A;  1O8W A;  2LS5 A;  1XVW A;  3GH9 A; 
#chains in the Genus database with same CATH homology
 4ZIL A;  5IOW A;  2TRC P;  3A2W A;  3FMW A;  1GUM A;  3ME7 A;  3AY8 A;  1SJI A;  1SD9 A;  4MP4 A;  4K7I A;  4HDE A;  1Y6E A;  4MPG A;  1OC3 A;  2MZC A;  2YOI A;  2G2Q A;  1FB0 A;  1LJR A;  2VM1 A;  3JCM L;  5DAK A;  2HNL A;  3UMA A;  1GRX A;  2K6V A;  4K5S A;  4TR0 A;  4TOP A;  3D22 A;  4YQM A;  3L9S A;  2DJ1 A;  5ELG A;  2GLR A;  3HDC A;  2IPA A;  4KDY A;  4CY8 A;  2E7P A;  2ON7 A;  1T00 A;  3GNJ A;  4K2X A;  5KOX A;  2H1B A;  2L4Q A;  1U3A A;  2R3X A;  1F2E A;  1B9X C;  5LD0 A;  1FB6 A;  1XW6 A;  2RM6 A;  2OAD A;  5CAX A;  3KGK A;  4BPY A;  2FGX A;  13GS A;  3GKN A;  2ZNM A;  1M2A A;  2DIZ A;  1ZOF A;  3QAV A;  2H0I A;  1ZMA A;  3DWV A;  3TKQ A;  1AQW A;  2KP2 A;  3F4S A;  5GZZ B;  3WT2 A;  4TN8 A;  4NXI A;  2MMA A;  4MH2 A;  10GS A;  4AGS A;  3A2V A;  1B8X A;  3IV4 A;  3HJP A;  4RI7 A;  2V41 A;  1YF0 A;  1ON4 A;  4XCS A;  5G30 A;  3UJ1 A;  3FHK A;  1C72 A;  2H6Y A;  4LLR A;  4N0Z A;  1Z5Y E;  1J9B A;  4FO5 A;  1JZW A;  3UAR A;  4MJC A;  2WDU A;  5CRW A;  3GTU A;  1SL0 B;  3C1S A;  1U6T A;  5D9T A;  3H1N A;  4TW5 A;  3TRP A;  2L57 A;  4F0C A;  3LYP A;  3IHQ A;  3DML A;  4HJ2 A;  2CVB A;  1K0N A;  4Z2U A;  2YZU A;  1GSF A;  1SK1 A;  1LBK A;  2RM5 A;  2BJX A;  3UBK A;  3I43 A;  2O7K A;  1TRU A;  4K1F A;  4L5O A;  1DSB A;  4MPF A;  3QFA C;  3ZVJ A;  4J57 E;  1ZYE A;  5AIV A;  2CT6 A;  4F82 A;  1URM A;  1I9D A;  3TCO A;  4PTS A;  4Q5N A;  1GNE A;  3DVX A;  4IBP A;  1MD4 A;  4KUN A;  2HRF A;  3GX0 A;  1JLW A;  2H76 A;  4EE0 A;  4IS0 A;  3J7Y k;  5AGY A;  6GSY A;  1PKZ A;  3CMI A;  5D93 A;  1UVZ A;  2RLI A;  3ME8 A;  3TJB A;  5JWR B;  1O85 A;  4IJI A;  4XS1 A;  2VLV A;  2YPM A;  3RPN A;  1YDK A;  3ISO A;  2V6K A;  4ACS A;  1XW5 A;  3FYG A;  1WPI A;  1O7U A;  1TI1 A;  3G9B A;  3QCP A;  4ECB A;  1ERV A;  1DUG A;  3IDV A;  5BMU A;  2VCV A;  1V58 A;  1W89 A;  2IMF A;  5J5N A;  4XIH A;  3GYK A;  4V2N A;  1WMJ A;  1G7E A;  2GSR A;  5IOX A;  5ID2 A;  4ISD A;  4JU5 A;  1QUW A;  2R5G A;  2VIM A;  4N30 A;  4PQ1 A;  2AV4 A;  5B6N A;  8GSS A;  2HXK A;  3MNG A;  2PUK C;  4KCE A;  2EIO A;  3HZ4 A;  2FD3 A;  3ZMK A;  2R0P A;  3GKK A;  3TJG A;  4LMW A;  4PNF A;  1K3L A;  1TOF A;  5CRD A;  2X4A A;  3HVX A;  5A4W A;  4I97 A;  2JU5 A;  5ECQ B;  1K0B A;  1SD8 A;  1YF1 A;  1TW9 A;  3IK9 A;  2YJH A;  4BA7 A;  4RQX A;  4GWR A;  2PN8 A;  5IIZ A;  1WP0 A;  1EGO A;  2LRN A;  3TJJ A;  3P8W A;  2MMZ A;  2NTO A;  1OE7 A;  2C0E A;  2DJK A;  2FA4 A;  2Z9S A;  2DML A;  3BOA A;  1TU8 A;  3QOU A;  1H75 A;  3VWX A;  4YQV A;  2REM A;  4XS4 B;  4MJA A;  2C1Y A;  2M80 A;  4G0K A;  1XWK A;  3F3R A;  5D9X A;  2HRA A;  2PMT A;  5IQY A;  4TRX A;  1V40 A;  3KJY A;  3VPT A;  4DSS A;  2JSZ A;  3DKS A;  5B8B A;  1EV4 A;  3ERF A;  4G0L A;  5DQY A;  2TRX A;  5E59 A;  3VI7 A;  3L0H A;  3MSZ A;  1K0C A;  3RBT A;  4ULX A;  3L9V A;  3P7X A;  5ABR A;  2HSY A;  3TOT A;  1IYI A;  2YV9 A;  3TKP A;  3A5W A;  1I5G A;  1XOA A;  2OA7 A;  3A3T A;  4ZBD A;  2JZT A;  3TKR A;  1XZO A;  3LG6 A;  3P2A A;  2P5R A;  3IC4 A;  1B4Q A;  4KSO A;  2B3S A;  3M9J A;  4K7O A;  3UVH A;  4TXV A;  2FA8 A;  1MD3 A;  1FVJ A;  2B5E A;  9GSS A;  1KBN A;  1GLQ A;  4IP6 A;  2PU9 C;  2WFC A;  4N11 A;  1OVN A;  3FY7 A;  3KCM A;  3EUR A;  2IMI A;  4G10 A;  3DD3 A;  1JZD A;  4HQS A;  3A5I A;  1PN0 A;  1TI3 A;  3KZQ A;  3Q18 A;  2LRT A;  5ENU A;  1F9M A;  2HRN A;  3MWH A;  1FOV A;  1AIU A;  2WUL A;  2VL3 A;  2GQK A;  5A4V A;  5J4U A;  1A0F A;  2KUC A;  4BL7 A;  3ZYW A;  2UZ8 A;  3FZ5 A;  2XPE A;  3FW2 A;  4JR6 A;  5IMD A;  2A2R A;  4KND A;  2EIR A;  2MYG A;  2YP6 A;  2XBI A;  1HYU A;  5KEJ A;  1K0A A;  1JZR A;  4G19 A;  2L59 A;  17GS A;  3C1R A;  2V32 A;  2GZY A;  4EDZ A;  2H72 A;  3EPT A;  2BMX A;  4NPB A;  1AUC A;  5CRE A;  2DBC A;  3APO A;  3GHA A;  1TJD A;  4KSM A;  3DGQ A;  2C3Q A;  4PQI A;  2LJR A;  3ZIJ A;  4ICY A;  4HJM A;  1N8J A;  1SKW B;  2IFQ A;  5AN1 A;  3IC8 A;  3CRT A;  2GQM A;  2X8C A;  2CQ9 A;  2VL2 A;  2E2G A;  4F2I A;  1TXX A;  1SJ6 A;  1TP9 A;  3PIN A;  1HQO A;  3FEU A;  1V9W A;  5IMV A;  1XIY A;  18GS A;  4WXT A;  1GWC A;  1TK5 B;  3LSZ A;  1Q98 A;  3FR9 A;  1PKW A;  4GST A;  1J08 A;  3IOS A;  5IPG A;  3F8U A;  1TDI A;  4CW9 A;  3DIE A;  4TR1 B;  1TRS A;  1ERT A;  4QQ7 A;  3N5O A;  1EV9 A;  4PNG A;  4I6X A;  1O8X A;  3I6A A;  5F06 A;  1BX9 A;  3EIN A;  4MA9 A;  2XPD A;  4RQR A;  4AF2 A;  2AAW A;  1SKR B;  4TR4 A;  2NBS A;  1QQ2 A;  5G2Z A;  2B1L A;  1TK8 B;  1MDK A;  1TTZ A;  1KEB A;  5IM9 A;  2I81 A;  3H79 A;  5DVB A;  1B48 A;  3EYT A;  5HFG A;  2HZE A;  2D2Z A;  2H66 A;  5ECL B;  4YAP A;  4PUA A;  2I1U A;  3F6F A;  1X9W B;  1R7H A;  4KAE A;  2QGV A;  2H71 A;  1SKS B;  1VF4 A;  3ZRE A;  3KM6 A;  1Z9H A;  3VPQ A;  2DJ3 A;  4GRF A;  1NM3 A;  2X49 A;  2VL9 A;  1QXH A;  3KD0 A;  5IO2 A;  3H8Q A;  3BJ5 A;  4GQF A;  2N5B A;  5ECH B;  4JE1 A;  2V2G A;  1HD2 A;  1KTE A;  5CP1 A;  4LL4 B;  4F03 A;  3TRQ A;  3HKR A;  1EP7 A;  3QAG A;  4KB3 A;  5DJM A;  1CQH A;  1PX7 A;  1VF3 A;  4KF9 A;  2DKH A;  4V1A p;  2IME A;  3FKF A;  2GT6 A;  5IO0 A;  4KA0 A;  1EEJ A;  1SYX A;  3QD9 A;  2YNX A;  1USB A;  2FWE A;  4KDU A;  2NDO A;  1AQX A;  3LQ7 A;  3KIJ A;  2R4V A;  5CO3 A;  3PR8 A;  2M46 A;  4EC0 A;  2P5Q A;  5HR0 A;  3GKM A;  3HZ8 A;  3FZ4 A;  4GLT A;  4MDC A;  5DAK B;  3EC3 A;  4JZQ A;  1O6J A;  3FK8 A;  1ZYQ B;  1K0D A;  1SJZ A;  2FLS A;  1A24 A;  1T1V A;  3GIX A;  4MF5 A;  1TK0 B;  3G7Y A;  1DE2 A;  3ERW A;  4FYU A;  4PXO A;  1JHB A;  4ML1 A;  1X9S B;  5BRT A;  1R5P A;  1M7T A;  2O85 A;  4AJ6 A;  1FAA A;  5ECI B;  4EKZ A;  1XBS A;  1THO A;  2N5A A;  3EU3 A;  4AJ8 A;  3GV1 A;  2RUF A;  2YWN A;  5F0G A;  2J23 A;  1Z7P A;  4L8E A;  1YEP A;  3TUE A;  4LA1 A;  4G0I A;  2PER A;  1THX A;  2PGT A;  4GXZ A;  5D8I A;  2GQL A;  1OAZ A;  2LJA A;  3LJR A;  5G31 A;  5DJL A;  1FVK A;  1XWA A;  1X5D A;  2L6C A;  1A8L A;  2KOK A;  2X8G A;  4GTU A;  5JCU A;  4XTS A;  3GTU B;  4BVX A;  1GSQ A;  3UBL A;  2HSM A;  4F0B A;  1M99 A;  4FH8 A;  5H5R A;  1GL8 A;  1ZCP A;  1UC7 A;  3IRA A;  5DAL A;  4MH3 A;  1PL1 A;  3LGC A;  2GGT A;  3Q19 A;  1Z7R A;  4L0U A;  1Z6M A;  2FCH A;  4JED A;  2C8U A;  3ZIT A;  1YZX A;  1ERU A;  4F9Z A;  4NAX A;  5J9C A;  4TXO A;  2F8F A;  1X5C A;  2HZF A;  5CNW A;  2XC2 A;  4XS6 A;  2C0D A;  2JAC A;  4OWY A;  5D9W A;  3EE2 A;  3HCZ A;  4V2L A;  2QSI A;  5KN2 A;  3CYN A;  5G1L A;  3C71 A;  2FHE A;  4OCE A;  1OKT A;  3O3T A;  1HNC A;  1VRS D;  4WF4 A;  4RUV A;  2X64 A;  4MF6 A;  3GL3 A;  3D21 A;  2C3T A;  5COH A;  3SWL A;  3VUR A;  2O8V B;  3LEF A;  1AXD A;  6GSV A;  1S3C A;  3M1G A;  2LQQ A;  3DYR A;  4YQU A;  2A4V A;  1Z3E A;  1XPV A;  4K0G A;  1WRY A;  2VCZ A;  2ZUP A;  3TDG A;  1F37 A;  4XRD A;  4HU7 A;  4Q5R A;  4Q5Q A;  1OKD A;  4KDX A;  4QL7 A;  1ZYN A;  3LWA A;  1PGT A;  3I69 A;  1G6Y A;  4O92 A;  5ID2 B;  5JWQ B;  2WS2 A;  2YWI A;  4BWQ A;  1SYR A;  1G6W A;  4LMV A;  16GS A;  3FZ9 A;  4WBJ A;  2L5O A;  2VL2 C;  4WBR D;  1FG4 A;  4POK A;  1M9B A;  5ECP B;  1G0T A;  1BED A;  2GDR A;  2FWF A;  5LCZ A;  2IMK A;  3KH7 A;  1AAZ A;  3CTF A;  1XVQ A;  1M2B A;  5EL8 A;  1GUH A;  4NV2 A;  1PRX A;  3F3Q A;  3D4M A;  5H5S A;  2WJU A;  4MCU A;  2ZCT A;  3WT1 A;  3QDN A;  3PPU A;  3H93 A;  3E9J B;  5D9V A;  1GSD A;  4PUF C;  1ZGN A;  2AYT A;  2RII A;  3KTB A;  2FNO A;  1F3B A;  2LUS A;  4BVY A;  5JCG A;  2OE1 A;  5FHI A;  3TJF A;  1FW1 A;  4A5P A;  1WE0 A;  2F51 A;  3ED3 A;  1V57 A;  4MLY A;  3J7Y b;  2XBQ A;  3C8E A;  3LW9 A;  4O7H A;  5ECM B;  1XOB A;  1VF2 A;  4KX4 A;  2JL4 A;  2FY6 A;  1TRV A;  2VCT A;  2LEG A;  4O5R A;  1MDJ A;  1GSY A;  4MF7 A;  4DSS B;  3D4T A;  3Q74 A;  2A4H A;  3E0U A;  4POM A;  4Z2T A;  1YKC A;  3MDK A;  3CTG A;  4WF5 A;  3KXO A;  3BD2 A;  1PL2 A;  4IKH A;  4ECJ A;  3K8N A;  3GUR A;  4J56 E;  1GTU A;  2C80 A;  3BCK A;  4J2F A;  2H75 A;  4ECI A;  3US3 A;  1KNG A;  2L6D A;  2CZ2 A;  4EVM A;  1Y25 A;  4LL1 B;  1AW9 A;  3BBY A;  2LJK A;  2YN1 A;  1K0O A;  1VF1 A;  1Z6N A;  3KMO A;  4KH7 A;  4I5Q A;  4AJ7 A;  4YH2 A;  2AHE A;  1XW9 A;  3IAM 2;  3UEM A;  2V1M A;  2MMN A;  4HZ2 A;  5F07 A;  6GSX A;  3L9U A;  4I8B A;  4OFM A;  4JRR A;  3ZVJ D;  1X0R A;  1BQ7 A;  1M9A A;  1NHY A;  4X43 A;  2FWH A;  2LQO A;  22GS A;  4EXJ A;  1QFN A;  2GZP A;  5ECR B;  5J3R A;  4IVF A;  1YEX A;  20GS A;  3GN3 A;  3G7J A;  5CRH A;  3UVT A;  1LU4 A;  2ALB A;  4CDO A;  4ML6 A;  1XCC A;  5KN1 A;  3QPM A;  1GSS A;  1ABA A;  1JZO A;  2O89 A;  1YJ6 A;  2YWO A;  5F05 A;  1ST9 A;  1EWX A;  1B4P A;  1WWJ A;  2B7J A;  2WZ9 A;  4KGI A;  5L71 A;  3WGX A;  1U88 A;  3IAS 2;  1JLV A;  1SL1 B;  3QAW A;  2NPB A;  3UOM A;  5DCH A;  2QA2 A;  3VWU A;  2IFQ B;  6GST A;  2H73 A;  3EMP A;  3GSS A;  4DSQ A;  4PX1 A;  2C3N A;  2HE3 A;  4D73 A;  5IMZ A;  3GRX A;  1XWB A;  5F8B A;  3VI5 A;  1QGV A;  2R0G A;  1YQ1 A;  4TR1 A;  2F9S A;  2KHP A;  5G1K A;  4IW9 A;  4FIW A;  4MAB A;  1ML6 A;  4E8H A;  1EP8 A;  4GF0 A;  2OAC A;  2LRC A;  4WR5 A;  4MZC A;  4WET A;  4IJ3 A;  2K18 A;  4NV5 A;  2J9H A;  3FR6 A;  3KMN A;  3CSI A;  4MJB A;  5KN0 A;  4G9H A;  1X5E A;  4JR4 A;  5J9B A;  4K9Z A;  3NIV A;  3C73 A;  1EZK A;  4MK3 A;  2BTO T;  4USS A;  2CAI A;  3G7I A;  2VOC A;  3QMX A;  1J0F A;  1A23 A;  1DBY A;  4HS1 A;  2N5F A;  3W8J A;  2QKE A;  3U5R E;  1BJX A;  2B1K A;  5B8A A;  3VWV A;  4HI7 A;  3APS A;  3KEB A;  4MMM A;  1YY7 A;  4ZL7 A;  1E2Y A;  3R3E A;  5J41 A;  3F9U A;  2FWG A;  3ZL5 A;  3EWL A;  4K0N A;  1XWG A;  3TKS E;  1WJK A;  5GSS A;  3ZZX A;  2DKI A;  1OE8 A;  2HZE B;  4ECC A;  1H4O A;  3M9K A;  1OC8 A;  2LTK A;  2IWT A;  5DCG A;  2VAF A;  5A5K A;  5HR2 A;  1F6M C;  5GST A;  4K6X A;  3TJK A;  1OC9 B;  3QFB C;  4FYC A;  1TRW A;  3KP8 A;  5B6M A;  3TOU A;  4POB A;  4GSN A;  1ERW A;  2DC5 A;  1EEM A;  3HJO A;  1GTA A;  1SU9 A;  1R4W A;  3RDW A;  5HFK A;  4HUA A;  1F3A A;  2CZ3 A;  3ZLP A;  5IMC A;  4YKF A;  3IE3 A;  4ZB9 A;  5ECK B;  1PA3 A;  1E6B A;  3LXT A;  2AUV A;  2WCI A;  3M8N A;  2ON5 A;  3DEX A;  2DSA A;  2VCQ A;  2GST A;  3KP9 A;  3O76 A;  4O32 A;  2HYX A;  3CXG A;  3TRX A;  4ZBB A;  4X1U A;  4QL9 A;  3LYK A;  3RHB A;  2MMO A;  3W6G A;  2P31 A;  5IPH A;  1IYH A;  2B7K A;  4IEL A;  5G5F A;  3F63 A;  2VCX A;  5CRG A;  4L0W A;  1PMT A;  3I9V 2;  3TKS A;  6GSS A;  4MZW A;  2H74 A;  1OYJ A;  5FT3 A;  1FOH A;  2JZR A;  2CV4 A;  2YJ7 A;  5C00 A;  4KCA A;  4N10 A;  3ZIV A;  2QC7 A;  2GSS A;  1EOG A;  4WR4 A;  1XXU A;  3LXZ A;  4G2E A;  2H01 A;  3C7M A;  2WB9 A;  1EOH A;  2E0Q A;  1PX6 A;  4ZL8 A;  3V1W A;  4YKG A;  2QA1 A;  1PD2 1;  1BYE A;  3FRC A;  3DXB A;  1TKD B;  3HA9 A;  1R26 A;  4Z2R A;  2LKU A;  2R37 A;  1A0R P;  2VUP A;  5ECN B;  2H1D A;  6GSW A;  2H1A A;  1YKA A;  2VD0 A;  4GSS A;  2L5L A;  3O6T A;  2JZS A;  1K3O A;  19GS A;  1GP1 A;  2A2P A;  4EIQ A;  14GS A;  2DJJ A;  1WIK A;  4OFN A;  1X9M B;  1B9Y C;  4PGT A;  4EDY A;  2IL3 A;  2AB6 A;  2LV3 A;  3KTL A;  1A2M A;  5B7C A;  5EPF A;  2B6M A;  3WD6 A;  1A8Y A;  4BVX B;  4POL A;  1ZZY A;  4JBB A;  3W8S A;  5KN3 A;  4GQC A;  5DAL B;  2YZH A;  3UAP A;  1GNW A;  1GTB A;  4IQA A;  3VK9 A;  5EVO A;  1SK0 A;  1ILO A;  5HR1 A;  5AIS A;  1CQG A;  2GSQ A;  2X99 A;  3D6I A;  4NWY A;  3F4T A;  1DE1 A;  3TGZ A;  2HT9 A;  2JAD A;  4X0X A;  3PH9 A;  2VO4 A;  3HY2 A;  1HNB A;  3HVS A;  3OR5 A;  3IHG A;  5JCW A;  2HI7 A;  1QMV A;  2PBJ A;  2V6O A;  3EU4 A;  1VGL A;  2HRK A;  4TXO B;  4L5L A;  2M72 A;  4FQU A;  2PVO C;  4EIP A;  1NHO A;  1M2D A;  2H19 A;  4IP1 A;  1W4V A;  1NW2 A;  1SK2 A;  2OJL A;  1AQV A;  2C0F A;  2CVD A;  4O5U A;  4TR3 A;  2VCW A;  2PPT A;  1ZL9 A;  3A2X A;  2CX3 A;  5IMF A;  3L78 A;  3CBU A;  2OBI A;  1SEN A;  1TU7 A;  1GUK A;  4DSR A;  3GL5 A;  2H30 A;  3GFK A;  4IHU A;  4I2U A;  3ZFL A;  3F6D A;  5DQS A;  3QR6 A;  1S3D A;  1M0U A;  1FHE A;  4XHM A;  4FYB A;  3HD5 A;  4X4J A;  1O73 A;  4NHW A;  3VLN A;  1NSW A;  3HXS A;  5GAP D;  5H5Q A;  4EF0 A;  2YWM A;  3N9J A;  3U6V A;  1U3I A;  2H8L A;  2GTU A;  3NOF A;  2HLS A;  3D0Z A;  3WGE A;  2R0C A;  4K2D A;  5E4W A;  2AJQ B;  4XS4 A;  2KP1 A;  2K9F A;  2OE0 A;  5GAN D;  2VLU A;  3E3E A;  4OCF A;  5IMA A;  3D5J A;  5LNK e;  2R6K A;  2LNT A;  5DBQ A;  4V2M A;  3GX8 A;  4RI6 A;  4NMU A;  3RPP A;  2OBK A;  4HOJ A;  4OD7 A;  1GH2 A;  2I9H A;  2OKA A;  3EMX A;  4ILF A;  1HNA A;  2L4C A;  1T4Z A;  5D73 A;  2GS3 A;  2DJ2 A;  2VLT A;  2MBT A;  2YAN A;  3APQ A;  1EGR A;  2IJY A;  4CHS A;  3IR4 A;  3SBC A;  3GMF A;  2DMM A;  3FZA A;  2H6Z A;  1WOU A;  4DEJ A;  2IMD A;  1RQM A;  4BVY B;  4MNN A;  4K5R A;  2H0G A;  2C0G A;  1SL2 B;  4OO4 A;  11GS A;  3HYP A;  1K0M A;  4N0V A;  4OMV A;  1RW1 A;  1V98 A;  3ZTL A;  4I2T A;  4P3Y B;  4WKW A;  1Q4J A;  2EIQ A;  4EUY A;  2H6X A;  1XFL A;  3F4R A;  2O87 A;  2H0H A;  4HEA 2;  3ZFB A;  4TVE A;  3WGD A;  2HSH A;  1K3Y A;  4K8M A;  4EL1 A;  1RK4 A;  2YV7 A;  3EVI A;  2LST A;  2H70 A;  2IN3 A;  5HFI A;  2EC4 A;  5EY6 A;  3ZRD A;  3BCI A;  3M3M A;  2IIY A;  2I4A A;  4Z7X A;  3TB2 A;  1PN9 A;  3GH6 A;  3LOR A;  2DLX A;  2G0F A;  3ZML A;  6GSU A;  4K7N A;  4HQZ A;  2VM2 A;  1T7P B;  5ECO B;  1GUL A;  4IQ1 A;  1PSQ A;  2GVP A;  2CA8 A;  5C04 A;  2K8S A;  4PUR A;  2RUE A;  2MBS A;  4ZB8 A;  1A2J A;  2DIY A;  2C4J A;  3R2Q A;  4ZIJ A;  2E2M A;  5INY A;  4BL7 B;  5JWO B;  4OFT A;  3MIX A;  2K8V A;  4IGJ A;  3GKX A;  4TKY A;  2CX4 A;  3NZN A;  4XRA A;  3FR3 A;  1ACV A;  3GA4 A;  3HVV A;  3DRN A;  2XHF A;  1UN2 A;  3CSJ A;  4CY6 A;  1BG5 A;  1MEK A;  2PWJ A;  2B5X A;  1GLP A;  1UA5 A;  3PGT A;  1JFU A;  1XWC A;  3DVW A;  4KE3 A;  3VWW A;  2GT5 A;  4ZL9 A;  4EO3 A;  3HJM A;  3M0F A;  3TKS C;  4H86 A;  1T4Y A;  3MAK A;  3WYW A;  4MZB A;  1MDI A;  4YAV A;  2F3M A;  1PQN A;  1O81 A;  2A2S A;  1U87 A;  4ZXG A;  2NVL A;  1T3B A;  3IA1 A;  2X8H A;  2WGR A;  2B5Y A;  1V2A A;  5FWG A;  1S3A A;  4HZ4 A;  3L4N A;  2I3Y A;  3S9F A;  3UIW A;  3F0I A;  4HU9 A;  3GST A;  2FUG 2;  4IN0 A;  3RHC A;  1ZYP A;  3GUS A;  3LFL A;  5HQP A;  3KH9 A;  3ERG A;  3RAZ A;  4NHZ A;  1AC1 A;  4OO5 A;  1GSU A;  1MTC A;  5CYY A;  2ES7 A;  1GTI A;  1FO5 A;  2VD1 A;  4GCI A;  1G7O A;  2R2J A;  2LNS A;  2OE3 A;  5ELA A;  4D73 B;  7GSS A;  4O5Q A;  3IK7 A;  2H1G A;  3IXR A;  12GS A;  2F8A A;  5DDL A;  1QK8 A;  2YCD A;  1T8E B;  2JSY A;  2TIR A;  4WEY A;  5G5E A;  2DJ0 A;  1BAY A;  3CRU A;  4ZBA A;  5KOW A;  2GZZ A;  4V1A g;  4E8E A;  3IBH A;  2HFD A;  2PVQ A;  3MYD A;  3CSH A;  3HHV A;  3P90 A;  5ECS A;  4Q5F A;  3Q6O A;  4MJE A;  4ID0 A;  4KW6 A;  3UL3 A;  2KLX A;  4PQH A;  5AIX A;  3VFI A;  5A4U A;  4ZB6 A;  2WRT A;  2CVK A;  1GSE A;  1R5A A;  1OC9 A;  5D96 A;  5HR3 A;  3IPZ A;  2P0G A;  2CAQ A;  1A2L A;  1N2A A;  3H4K A;  4BWS A;  4DVC A;  1O8W A;  2LS5 A;  1XVW A;  3GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...