1KEBA

Crystal structure of double mutant m37l,p40s e.coli thioredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin 1
publication title Structural Consequences of Replacement of an alpha-helical Pro Residue in E.coli Thioredoxin
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1kebA00
5AGYA 1YJ6A 1AIUA 4HUAA 1YEPA 1DSBA 5ECHB 1R7HA 3FY7A 1TRSA 3C71A 4OCEA 3QD9A 1JZRA 6GSTA 4OFTA 2V1MA 2VCQA 1ERUA 2NDOA 1WIKA 4TKYA 4GSNA 4AJ8A 5HR3A 2AHEA 2ON5A 1F2EA 1SD9A 2HNLA 3UVTA 2DJ3A 1TK0B 4DVCA 3N9JA 5GSTA 2OACA 3IR4A 4KSMA 4TR3A 1G6YA 2YPMA 3TOTA 2B5YA 4WR4A 2VCWA 3VWUA 3WT1A 5J41A 1GTBA 3VPTA 2RUFA 4NAXA 2CT6A 3D5JA 2C8UA 3L0HA 2OADA 1NSWA 1J9BA 1BYEA 3RDWA 1MDJA 2XPEA 3GTUB 3HJMA 5G2ZA 4IVFA 2YZHA 2OA7A 3FHKA 4AF2A 2YJHA 2HSYA 1SYRA 3KXOA 3GKNA 3BJ5A 4IW9A 1XOBA 4POBA 1GRXA 1SKRB 4Q5RA 1PKZA 2YN1A 3UAPA 1J08A 2P31A 1T4YA 1GLQA 5L71A 2OE0A 3BD2A 2RUEA 2HSHA 1LJRA 4MPFA 1T00A 4LMWA 2FLSA 2FY6A 19GSA 2ZNMA 1H75A 2H72A 3GV1A 5EL8A 1ILOA 1OC8A 4PUAA 5D9WA 14GSA 4XHMA 2H1BA 5KN2A 4OFNA 1XIYA 4IN0A 5ELGA 3KM6A 2DMMA 1M9BA 3GKXA 5LCZA 1Z7RA 2CA8A 1TRVA 5DDLA 3WYWA 2XBIA 3DWVA 1MD4A 1QQ2A 5HFGA 5AIXA 5AN1A 3HXSA 1OC3A 3EURA 1VF2A 4XCSA 5DAKA 3VURA 2VM1A 2LKUA 1BX9A 3C8EA 2CVBA 2C3NA 4TW5A 4JEDA 3GH6A 1NHYA 1PD21 2B7KA 3WGDA 3KEBA 1B4PA 2LJRA 3SBCA 2A4VA 1YZXA 1TKDB 3GFKA 3DEXA 5ECMB 3GRXA 3R2QA 1LU4A 5IIZA 5J5NA 2EIQA 2X99A 3TKSA 1OAZA 5H5SA 5JCWA 4KDUA 2B6MA 6GSXA 1FAAA 3C1RA 2H8LA 1F3AA 5G31A 1SL2B 1GTIA 1O85A 3F0IA 3EYTA 4BWSA 2CQ9A 4ZIJA 3ZFBA 3VLNA 3MDKA 2PPTA 5G1KA 4LL4B 4HQSA 3DRNA 4L0UA 1FB6A 1R5PA 2GSTA 3AY8A 3VI5A 1GSFA 5CAXA 2JL4A 2PGTA 6GSVA 3DD3A 3ED3A 1XWAA 1PX7A 3JCML 2WRTA 4XS4B 1HNCA 1JFUA 1QK8A 2P5RA 3N5OA 4G10A 2K9FA 2RIIA 1ABAA 1FVKA 3D21A 4MZCA 2VL2C 3W8SA 1Z7PA 3F8UA 4KH7A 4D73B 4MJCA 5CYYA 4MH2A 5JCUA 1PL1A 3HYPA 2RLIA 3HZ4A 1SL0B 3MNGA 3PR8A 1V58A 1EP8A 3TRXA 1V57A 2KP2A 3KMNA 4EL1A 3GH9A 4KAEA 3M9JA 2HYXA 1WMJA 5IMDA 2WB9A 3P2AA 4AJ7A 4J2FA 1TP9A 5DALA 3E0UA 2H19A 2GTUA 2HI7A 3LQ7A 3M0FA 5C04A 4OFMA 5IQYA 5JWRB 3EINA 1TK8B 3TRQA 4DSSB 2AYTA 4GXZA 2IFQB 3ZYWA 2J9HA 1Q98A 5FT3A 5B8BA 3FR6A 2M72A 1A8LA 5IPGA 1GTUA 4LLRA 4PQ1A 3VWVA 4HI7A 1ZYQB 1PX6A 1DE2A 2OE1A 5HR2A 3W6GA 2FGXA 5KN0A 1A2LA 3EC3A 5FHIA 4PX1A 5EVOA 2OBKA 1SU9A 1IYIA 4I5QA 5KN1A 2IMDA 3GL5A 1JHBA 3TJGA 1S3CA 2QSIA 2TIRA 2EC4A 4KW6A 1XWKA 3IRAA 1A8YA 2LQOA 2DSAA 5E59A 3QOUA 3D4TA 3ZMKA 1A24A 2PU9C 2WULA 2WS2A 1O8XA 3FEUA 4GQCA 2HXKA 1U3IA 3IE3A 4MZBA 1GSSA 3EU4A 3IK7A 2B1KA 2IPAA 1SKWB 5GAND 2L6DA 5H5RA 1GLPA 2O8VB 5IMCA 4MCUA 4EKZA 5COHA 1X5CA 1WE0A 5KN3A 3DXBA 1EEMA 2LRCA 2G0FA 1XVQA 4YAPA 4ZB6A 5HFIA 3OR5A 5CREA 3H4KA 4O7HA 4DEJA 2H6ZA 3D0ZA 4OO4A 1RQMA 4G19A 2VD0A 5IO2A 1GULA 3FR3A 4ZB8A 1C72A 3TJFA 2L4CA 5IMAA 4EE0A 4O92A 4K7IA 3TJJA 1K0CA 4NHWA 3ERGA 7GSSA 1U3AA 2DJ0A 3KMOA 2MMOA 4V2NA 2WFCA 5JWOB 1PQNA 3TB2A 2VCXA 2L6CA 2HRNA 4D73A 1Z5YE 3P8WA 1PGTA 3HJOA 2ES7A 3RAZA 5JWQB 2TRXA 2H71A 2GSQA 4HU7A 3QFBC 2CAQA 5HFKA 2DLXA 2PWJA 4K9ZA 3MWHA 4O5RA 10GSA 4HJ2A 3TGZA 4GQFA 2KOKA 3O6TA 5B7CA 3VPQA 2C1YA 4GLTA 3HDCA 1THXA 2V2GA 3FYGA 3DVXA 1G7EA 2GVPA 5KEJA 2YZUA 3DMLA 4K7OA 1SJ6A 2PUKC 1V40A 2FWEA 1OVNA 2DIYA 2F8AA 1VF3A 2VO4A 3C73A 5D96A 2K6VA 2VL9A 1V2AA 2DMLA 3GHAA 3E9JB 5FWGA 3ZVJD 2GS3A 3BBYA 5ECIB 2LNTA 4X0XA 3GX0A 2DJ2A 4GSTA 1OYJA 4TXOA 2V32A 1XPVA 1SK1A 4TRXA 2C0EA 5CRWA 2V41A 1M7TA 4FO5A 4KB3A 5DVBA 4CW9A 2YCDA 5CRHA 2DIZA 2MMAA 4K1FA 4MLYA 3LWAA 4BA7A 2VCTA 4ECBA 3L9SA 5G5FA 2ON7A 4FYBA 2I81A 4FH8A 5D73A 3L9UA 4E8HA 2WDUA 1AQWA 2LRNA 4KDYA 1AQVA 4HS1A 4YH2A 1AXDA 1GTAA 5DJMA 1GNWA 1KTEA 1GSEA 1GUHA 4KCEA 3HZ8A 1ZL9A 3IXRA 2H70A 4MDCA 1GL8A 5D9VA 3M8NA 1YF0A 4MF5A 2M46A 3UL3A 1F9MA 4OWYA 1Q4JA 1UN2A 4O32A 2C0DA 4HQZA 3CBUA 3TKSE 3FW2A 4JBBA 2P5QA 4PXOA 1PMTA 4E8EA 4WBJA 3ZITA 4EDZA 3EU3A 1Y6EA 3K8NA 5IMZA 2YANA 1YY7A 3TKQA 3F63A 3I69A 3LSZA 1VF1A 2IMFA 2VLTA 1SYXA 1TW9A 4N30A 5DQYA 3ZIVA 4MH3A 3EVIA 3V1WA 2B3SA 5DALB 4F82A 5CRGA 4JU5A 2LUSA 4MJBA 4L5LA 3D22A 4FYCA 3TCOA 1SK0A 3G7JA 1EOHA 1RW1A 2N5FA 3EMXA 5F06A 3TKPA 1OE7A 2H73A 4V1Ag 1UC7A 1JLVA 3KP9A 3GYKA 3HVVA 4OD7A 3QAGA 4XS6A 2GZPA 1FVJA 1K3LA 3BCIA 5DBQA 1XVWA 3VI7A 3DVWA 5ELAA 4BVXA 5D9XA 3PH9A 3ZZXA 3A2VA 3IV4A 1M0UA 2L4QA 4LMVA 3ZREA 3HVSA 3HCZA 1A0FA 5G5EA 5HR1A 2ZCTA 3KIJA 3QFAC 4ZL9A 1QXHA 2LSTA 3IAM2 2LNSA 3CRUA 3E3EA 3TRPA 4LA1A 1IYHA 4PURA 5IOXA 3UOMA 1USBA 2FCHA 5IO0A 2B5EA 1X5DA 1FOVA 4MA9A 4G9HA 1PL2A 2L5LA 3PINA 4JR4A 3LFLA 2XHFA 1TOFA 3F6FA 2CZ3A 3ERFA 3GA4A 1O73A 3H79A 4IBPA 3A3TA 4ZL7A 4KX4A 1X9WB 2GT6A 3HA9A 4OO5A 1O7UA 2C0GA 1OKDA 4IQ1A 3TJBA 5HQPA 1V9WA 3RHCA 3MSZA 3L9VA 4K2DA 3G7YA 4BL7A 2D2ZA 4PNFA 2K8VA 4HDEA 3CRTA 1F37A 3UBKA 1T8EB 5EY6A 1OKTA 2REMA 4POMA 2FA4A 4Q5QA 1HD2A 3EWLA 3WGEA 17GSA 3IA1A 1SD8A 5F05A 4I6XA 3J7Yk 2K8SA 4EF0A 2YWMA 1TTZA 1ACVA 3S9FA 2EIRA 4GTUA 1EV4A 1NHOA 4MMMA 2OKAA 3C7MA 5CRDA 1NM3A 4POKA 2JACA 4YAVA 3EMPA 12GSA 2AB6A 2F51A 4NHZA 5AISA 5CNWA 4F03A 3GIXA 3IC4A 3RBTA 3TDGA 4MABA 3FR9A 1SJZA 1XOAA 3UMAA 3ZTLA 1VGLA 2DJJA 1X5EA 2GSSA 1MD3A 1PSQA 1VRSD 1XWBA 2H1GA 1ZCPA 1R4WA 3QAWA 3UARA 1YEXA 3I6AA 5GZZB 1PN9A 5GSSA 2VAFA 2IL3A 1K0OA 4IKHA 4RI7A 4ZBAA 3DIEA 2CX3A 4TXOB 3A2WA 2F3MA 3WD6A 3M3MA 1B8XA 2KLXA 1JLWA 3FZ4A 3CTFA 1ST9A 3TJKA 2O89A 2B7JA 3D4MA 4GWRA 3CMIA 3GKMA 1G0TA 3NIVA 2R4VA 2E2MA 2H30A 3IBHA 1VF4A 1DE1A 4TR4A 2I9HA 2VD1A 1E6BA 4JZQA 5ECQB 2FWGA 4ECJA 4Z7XA 4JR6A 3IHQA 1EGOA 2VUPA 3FK8A 1UA5A 5B8AA 1S3AA 4HZ2A 5ENUA 1I9DA 3UBLA 2L5OA 1T1VA 3DKSA 2OBIA 5IMFA 4I2UA 1N8JA 2Z9SA 2BJXA 5ECSA 5J4UA 3CSIA 2C3QA 2DJ1A 4HZ4A 4K6XA 2VL3A 4GF0A 1G7OA 2JZTA 4EXJA 5G1LA 4ML6A 3ZLPA 2WCIA 2KHPA 1F6MC 3BCKA 4KGIA 4BWQA 2K18A 3APQA 1AC1A 2JSYA 4N0VA 1WJKA 2H74A 3BOAA 3KGKA 4WBRD 3H93A 4MF7A 2H0GA 2VLVA 2YWOA 4IGJA 4IP1A 2M80A 2H0IA 2N5AA 2CVDA 2R37A 1TI1A 3ERWA 3GURA 4AGSA 2OE3A 5ID2A 4G2EA 4YQMA 5E4WA 1QFNA 16GSA 2HT9A 5GAPD 2PVOC 1R26A 1CQHA 2X8HA 2YOIA 1B9YC 2WJUA 2G2QA 3HY2A 3Q18A 1GSQA 1GSYA 3NZNA 2C80A 5J9CA 1FO5A 4I97A 4X43A 5CP1A 3ME7A 4TR0A 1ERWA 3H1NA 2AV4A 5HR0A 2P0GA 1R5AA 2PBJA 3CXGA 4MJEA 3FKFA 3ZIJA 4KUNA 1XW9A 2NVLA 2PERA 6GSUA 3I43A 4NWYA 2C0FA 1WPIA 3US3A 1GSUA 3P7XA 1S3DA 3GL3A 4HU9A 3G9BA 4H86A 1UVZA 2KUCA 1U87A 4CDOA 1GNEA 4WKWA 3KH9A 2F8FA 3G7IA 4NV2A 2CV4A 1YKAA 2HLSA 3J7Yb 3KH7A 11GSA 3ISOA 3LEFA 2GGTA 4CHSA 3GNJA 1EOGA 5IOWA 1XW5A 2I4AA 1GH2A 4P3YB 3KD0A 2WZ9A 2YP6A 5ECLB 3SWLA 5ECPB 4WXTA 2C3TA 2YV9A 4DSRA 1YKCA 2XBQA 3ZVJA 4WF5A 1TI3A 3HKRA 2F9SA 2FA8A 1N2AA 4J57E 1K3OA 2VOCA 2NPBA 1ZYEA 3IPZA 2H1DA 1ZMAA 1FW1A 2QC7A 1FHEA 3CYNA 3RPPA 1AAZA 1HNAA 4L8EA 3KP8A 3IK9A 2MZCA 2X8CA 1BQ7A 4ML1A 2AAWA 1Y25A 5EPFA 3F3QA 1B4QA 3KTLA 1H4OA 1KEBA 5J9BA 3U5RE 3LXTA 3GUSA 1CQGA 4AJ6A 4ZL8A 18GSA 1X0RA 4EDYA 2FHEA 2VM2A 4IQAA 1MTCA 5A4VA 1SL1B 1A0RP 4TOPA 3QPMA 2GQMA 2BMXA 1TRWA 4Q5FA 4JRRA 4J56E 3ZFLA 2JSZA 3EE2A 3O76A 1WOUA 1OE8A 5LNKe 2A2RA 2GQLA 3GKKA 2HFDA 4EO3A 3IAS2 3C1SA 3VWXA 5IM9A 2NTOA 4NPBA 4POLA 1A2MA 1GP1A 1BG5A 1XXUA 4ULXA 4F0BA 4OCFA 3QMXA 2H6YA 4GRFA 4I8BA 4FIWA 1OC9A 2GLRA 2O7KA 2V6OA 2IMIA 2AJQB 3RPNA 1XFLA 2R6KA 4F0CA 20GSA 2V6KA 1XWGA 4TXVA 1G6WA 2FUG2 4F2IA 2R3XA 2H01A 3APOA 1JZWA 1QMVA 1TDIA 5JCGA 1WP0A 4KCAA 3IOSA 6GSWA 2LV3A 2VCVA 1Z9HA 2YWNA 1K0AA 1HYUA 3ZL5A 5ABRA 3VWWA 3A5WA 3WT2A 4ECCA 1ML6A 2JADA 1O6JA 3PGTA 2R2JA 1TRUA 2QKEA 2YV7A 2IMKA 3M1GA 1NW2A 2E2GA 4K8MA 4TR1A 1SKSB 2KP1A 2MMNA 1TK5B 4WEYA 3M9KA 4K0NA 1BJXA 3WGXA 1ON4A 1K0NA 3LGCA 1EGRA 2ZUPA 2CVKA 2E0QA 2X64A 4IS0A 5A4WA 1BEDA 4KA0A 2TRCP 3GSSA 3TKRA 2RM5A 1ERVA 1A23A 4KNDA 2N5BA 1TXXA 1U88A 2HE3A 1ERTA 2LS5A 4BVYA 4MZWA 1GUKA 3VFIA 5B6MA 3QAVA 3GX8A 4TVEA 3UIWA 3APSA 2DC5A 4PQHA 4WETA 4MK3A 1KBNA 2HZEA 2I3YA 5ID2B 4MPGA 4NV5A 9GSSA 4PGTA 3F4SA 5INYA 5DCGA 1BAYA 1SK2A 1FB0A 3Q74A 4ZBBA 4N11A 13GSA 3HJPA 2PN8A 2PVQA 4XTSA 4IP6A 4ECIA 3LORA 2E7PA 1M9AA 2CZ2A 4N10A 2JU5A 4K0GA 3LYKA 3LYPA 1ZGNA 3RHBA 1XBSA 2H1AA 2LJKA 2H76A 4KE3A 1GUMA 3KJYA 1EWXA 2LEGA 2VCZA 4XRDA 2HZFA 3MAKA 5A4UA 5D93A 2GDRA 4YQVA 2DBCA 1M2BA 3GSTA 2VIMA 1X9MB 4MP4A 2DJKA 3D6IA 1TU7A 3I9V2 4DSQA 1KNGA 4HEA2 1DUGA 4XIHA 1K3YA 3GN3A 3ZMLA 1T4ZA 2LTKA 1W89A 2XC2A 6GSYA 2RM6A 1MDKA 2AUVA 3GTUA 1Z3EA 3DGQA 3UEMA 1M99A 5ECNB 3QDNA 3QCPA 5DCHA 5D8IA 1MEKA 2MYGA 2H0HA 2FD3A 2IMEA 3H8QA 1XWCA 5C00A 1ZOFA 3F6DA 1PA3A 4JE1A 4WF4A 3FZ9A 2VLUA 4IHUA 2R5GA 4KDXA 4IELA 4ZILA 2H6XA 3NOFA 1AUCA 5G30A 4NMUA 3CSHA 4EC0A 3TUEA 2FWFA 2GSRA 4RQRA 4PQIA 8GSSA 1XZOA 3TOUA 5A5KA 2LQQA 1B48A 1URMA 4ZBDA 1PKWA 22GSA 1K0BA 2MMZA 4PUFC 5F07A 2IN3A 2EIOA 1M2DA 3LXZA 5IPHA 2OJLA 4FYUA 1HNBA 5IMVA 2PMTA 4V2LA 3KTBA 1QUWA 1PRXA 4XRAA 1HQOA 2BTOT 4NXIA 1LBKA 1W4VA 4RUVA 2XPDA 4YQUA 1A2JA 2JZSA 4ILFA 3F9UA 1MDIA 4OMVA 1DBYA 5AIVA 3QR6A 1JZOA 1O8WA 4ISDA 4GCIA 4TN8A 4RI6A 1Z6NA 4GSSA 4MF6A 5LD0A 1T7PB 2MBTA 1X9SB 2LJAA 3U6VA 2GZYA 4WR5A 1M2AA 1TU8A 2H75A 4QL7A 4BPYA 4IJ3A 3W8JA 3FRCA 4IJIA 2GT5A 2JZRA 2O87A 1F3BA 4ZXGA 3CSJA 4EUYA 3Q19A 2CAIA 1I5GA 1WRYA 2YWIA 1OC9B 2L59A 4N0ZA 3CTGA 1YF1A 4MJAA 5ECKB 2MBSA 1YDKA 1FG4A 1EP7A 5J3RA 2GZZA 3Q6OA 5B6NA 2HRFA 3ZRDA 1XW6A 2ALBA 3FZAA 1WWJA 4V1Ap 2YNXA 2FNOA 5H5QA 4XS4A 4Q5NA 1AW9A 1U6TA 2NBSA 1RK4A 3KZQA 3HHVA 1TJDA 2VL2A 4HOJA 3F3RA 3FZ5A 4L5OA 2YJ7A 1B9XC 3HVXA 2WGRA 1K0DA 2CX4A 4PNGA 1GSDA 2B1LA 4QQ7A 5ECOB 1AQXA 1YQ1A 3O3TA 3A2XA 2C4JA 2IJYA 2A2SA 2O85A 3GMFA 1SJIA 4TR1B 3LG6A 2B5XA 4F9ZA 2GQKA 1QGVA 2IWTA 5DAKB 3UJ1A 1EEJA 1T3BA 4HJMA 2H66A 4ACSA 4I2TA 5D9TA 4XS1A 3HD5A 1JZDA 2I1UA 2LRTA 1J0FA 1GWCA 4QL9A 1O81A 4EVMA 1Z6MA 1ZZYA 2J23A 1K0MA 1SENA 4DSSA 3DYRA 4RQXA 2IFQA 4LL1B 6GSSA 1E2YA 5F0GA 3TKSC 4KSOA 3L78A 4ZB9A 2IIYA 1XCCA 2QGVA 2L57A 3ME8A 3F4TA 5F8BA 5DJLA 3P90A 3F4RA 2X8GA 3L4NA 4V2MA 3VK9A 1EV9A 5DQSA 3IDVA 3KCMA 3UVHA 1THOA 4K7NA 4L0WA 1EZKA 2HZEB 1V98A 4X1UA 3LJRA 5CO3A 5ECRB 4ID0A 2FWHA
chains in the Genus database with same CATH superfamily
5AGYA 1YJ6A 1AIUA 4HUAA 1YEPA 1DSBA 5ECHB 1R7HA 3FY7A 1TRSA 3C71A 4OCEA 3QD9A 1JZRA 6GSTA 4OFTA 2V1MA 2VCQA 1ERUA 2NDOA 1WIKA 4TKYA 4GSNA 4AJ8A 5HR3A 2AHEA 2ON5A 4YKGA 1F2EA 1SD9A 2HNLA 3UVTA 2DJ3A 1TK0B 4DVCA 3N9JA 5GSTA 2OACA 3IR4A 4KSMA 4TR3A 1G6YA 2YPMA 3TOTA 2B5YA 4WR4A 2VCWA 3VWUA 3WT1A 5J41A 1GTBA 3VPTA 2RUFA 4NAXA 2CT6A 3D5JA 2C8UA 3L0HA 2OADA 1NSWA 1J9BA 1BYEA 3RDWA 1MDJA 2XPEA 3GTUB 3HJMA 5G2ZA 4IVFA 2YZHA 2OA7A 3FHKA 4AF2A 2YJHA 2HSYA 1SYRA 4Z2RA 3KXOA 3GKNA 3BJ5A 4IW9A 1XOBA 4POBA 1GRXA 1SKRB 4Q5RA 1PKZA 2YN1A 3UAPA 1J08A 2P31A 1T4YA 1GLQA 5L71A 2OE0A 4KF9A 3BD2A 2RUEA 2HSHA 1LJRA 4MPFA 1T00A 4LMWA 2FLSA 2FY6A 19GSA 2ZNMA 1H75A 2H72A 3GV1A 5EL8A 1ILOA 1OC8A 4PUAA 5D9WA 14GSA 4XHMA 2H1BA 5KN2A 4OFNA 1XIYA 4IN0A 5ELGA 3KM6A 2DMMA 1M9BA 3GKXA 5LCZA 1Z7RA 2CA8A 1TRVA 5DDLA 3WYWA 2XBIA 3DWVA 1MD4A 1QQ2A 3EPTA 5HFGA 5AIXA 5AN1A 3HXSA 1OC3A 4EIQA 3EURA 1VF2A 2A2PA 4XCSA 5DAKA 4K5SA 3VURA 2VM1A 2LKUA 1BX9A 3C8EA 2CVBA 2C3NA 4TW5A 4JEDA 3GH6A 1NHYA 1PD21 2B7KA 3WGDA 3KEBA 1B4PA 2LJRA 3SBCA 2A4VA 1YZXA 1TKDB 3GFKA 3DEXA 5ECMB 3GRXA 3R2QA 1LU4A 5IIZA 5J5NA 2EIQA 2X99A 3TKSA 1OAZA 5H5SA 5JCWA 4KDUA 2B6MA 6GSXA 1FAAA 3C1RA 2H8LA 1F3AA 5G31A 1SL2B 1GTIA 1O85A 3F0IA 3EYTA 4BWSA 2CQ9A 4ZIJA 3ZFBA 3VLNA 3MDKA 2PPTA 5G1KA 4LL4B 4HQSA 3DRNA 4L0UA 1FB6A 1R5PA 2GSTA 3AY8A 3VI5A 1GSFA 5CAXA 2JL4A 2PGTA 6GSVA 3DD3A 3ED3A 1XWAA 1PX7A 3JCML 2WRTA 4XS4B 1HNCA 1JFUA 1QK8A 2P5RA 3N5OA 4G10A 2K9FA 2RIIA 1ABAA 1FVKA 3D21A 4MZCA 2VL2C 3W8SA 1Z7PA 3F8UA 4KH7A 4D73B 3PPUA 4MJCA 5CYYA 4MH2A 5JCUA 1XG8A 1PL1A 3HYPA 2RLIA 3HZ4A 1SL0B 3MNGA 3PR8A 1V58A 1EP8A 3TRXA 1V57A 2KP2A 3KMNA 4EL1A 3GH9A 4KAEA 3M9JA 2HYXA 1WMJA 4USSA 5IMDA 2WB9A 3P2AA 4AJ7A 4J2FA 1TP9A 3MIXA 5DALA 4K2XA 3E0UA 2H19A 2GTUA 2HI7A 3LQ7A 3M0FA 5C04A 4OFMA 5IQYA 5JWRB 3EINA 1TK8B 3TRQA 4DSSB 2AYTA 4GXZA 2IFQB 3ZYWA 2J9HA 1Q98A 5FT3A 2HSMA 5B8BA 3FR6A 2M72A 1A8LA 5IPGA 1GTUA 4LLRA 4Z2UA 4PQ1A 3VWVA 4HI7A 1ZYQB 1PX6A 1DE2A 2OE1A 5HR2A 3W6GA 2FGXA 5KN0A 1A2LA 3EC3A 5FHIA 4PX1A 5EVOA 2OBKA 1SU9A 1IYIA 4I5QA 5KN1A 2IMDA 3GL5A 1JHBA 3TJGA 1S3CA 2QSIA 2TIRA 2EC4A 4KW6A 1XWKA 3IRAA 1A8YA 2LQOA 2DSAA 5E59A 3QOUA 3D4TA 3ZMKA 1A24A 2PU9C 2WULA 2WS2A 1O8XA 3FEUA 4GQCA 2HXKA 1U3IA 3IE3A 4MZBA 4PTSA 1GSSA 3EU4A 3IK7A 2B1KA 2IPAA 1SKWB 5GAND 2L6DA 5H5RA 1GLPA 2O8VB 5IMCA 2DKHA 4MCUA 4EKZA 5COHA 1X5CA 3HVNA 1WE0A 5KN3A 3DXBA 1EEMA 2LRCA 2G0FA 1XVQA 4YAPA 4ZB6A 4HSCX 5HFIA 3OR5A 5CREA 3H4KA 1ZYNA 4O7HA 4DEJA 2H6ZA 3D0ZA 4OO4A 1RQMA 1M3IA 4G19A 2VD0A 5IO2A 1GULA 3FR3A 4ZB8A 1C72A 3TJFA 2L4CA 5IMAA 4EE0A 4O92A 4K7IA 3TJJA 2R0PA 1K0CA 4NHWA 3ERGA 7GSSA 1U3AA 2DJ0A 2UZ8A 3KMOA 2MMOA 4V2NA 2WFCA 5JWOB 1PQNA 3TB2A 2VCXA 2L6CA 2HRNA 4D73A 1Z5YE 3P8WA 1PGTA 3HJOA 2ES7A 3RAZA 5JWQB 2HRKA 2TRXA 2H71A 4BVXB 2GSQA 4HU7A 3QFBC 4Z2TA 2CAQA 5HFKA 2DLXA 2PWJA 4K9ZA 3MWHA 4O5RA 10GSA 4HJ2A 3TGZA 4GQFA 2KOKA 3O6TA 5B7CA 3VPQA 2C1YA 4GLTA 3HDCA 1THXA 2V2GA 3FYGA 3DVXA 1G7EA 2GVPA 5KEJA 2YZUA 1PFOA 3DMLA 4K7OA 1SJ6A 2PUKC 1V40A 2FWEA 1OVNA 2DIYA 2F8AA 1VF3A 2VO4A 3C73A 5D96A 2K6VA 2VL9A 1V2AA 2DMLA 5KOWA 3GHAA 3E9JB 5FWGA 3ZVJD 2GS3A 3BBYA 5ECIB 2LNTA 4X0XA 3GX0A 2DJ2A 4GSTA 1OYJA 4TXOA 3IC8A 2V32A 1XPVA 1SK1A 4TRXA 2C0EA 5CRWA 2V41A 1M7TA 4FO5A 4KB3A 5DVBA 4CW9A 2YCDA 5CRHA 2DIZA 2MMAA 4K1FA 4MLYA 3LWAA 4BA7A 2VCTA 4ECBA 3L9SA 5G5FA 2ON7A 4FYBA 2I81A 4FH8A 5D73A 3L9UA 4E8HA 2WDUA 1AQWA 2LRNA 4KDYA 1AQVA 4HS1A 3FMWA 4YH2A 1AXDA 1GTAA 5DJMA 1GNWA 1KTEA 1GSEA 1GUHA 4KCEA 3HZ8A 1ZL9A 3IXRA 2X49A 2H70A 4MDCA 1GL8A 5D9VA 3M8NA 1YF0A 4MF5A 2M46A 3UL3A 1F9MA 4OWYA 1Q4JA 1UN2A 4O32A 2C0DA 4HQZA 3CBUA 3TKSE 3FW2A 4JBBA 2P5QA 4PXOA 1PMTA 4E8EA 4WBJA 3ZITA 4EDZA 3EU3A 1Y6EA 3K8NA 5IMZA 2YANA 1YY7A 3TKQA 3F63A 3I69A 3LSZA 1VF1A 2IMFA 2VLTA 1SYXA 1TW9A 4N30A 5DQYA 3ZIVA 4MH3A 3EVIA 3V1WA 2B3SA 5DALB 4F82A 5CRGA 4JU5A 2LUSA 2HRAA 4MJBA 4L5LA 3D22A 4FYCA 3TCOA 1SK0A 3G7JA 1EOHA 1RW1A 2N5FA 4CY8A 3EMXA 5F06A 3TKPA 1OE7A 2H73A 4V1Ag 1UC7A 1JLVA 3KP9A 3GYKA 3HVVA 3LW9A 4OD7A 3QAGA 4XS6A 2GZPA 1FVJA 1K3LA 3BCIA 5DBQA 1XVWA 3VI7A 3DVWA 5ELAA 4BVXA 5D9XA 3PH9A 3ZZXA 3A2VA 3IV4A 1M0UA 2L4QA 4LMVA 3ZREA 3HVSA 3HCZA 1A0FA 5G5EA 5HR1A 2ZCTA 3KIJA 3QFAC 4ZL9A 1QXHA 2LSTA 3IAM2 2LNSA 4CY6A 3CRUA 3E3EA 3TRPA 4LA1A 1IYHA 4PURA 5IOXA 3UOMA 1USBA 2FCHA 5IO0A 2B5EA 1X5DA 1FOVA 4MA9A 3A5IA 1PL2A 2L5LA 4G9HA 3PINA 4JR4A 3LFLA 2XHFA 1TOFA 3F6FA 2CZ3A 3ERFA 3GA4A 1O73A 3H79A 4IBPA 3A3TA 4ZL7A 4KX4A 1X9WB 2GT6A 3HA9A 4OO5A 1O7UA 2C0GA 1OKDA 4IQ1A 3TJBA 5HQPA 4K5RA 1V9WA 3RHCA 3MSZA 3L9VA 4K2DA 3G7YA 4BL7A 3IHGA 2D2ZA 4PNFA 2K8VA 4HDEA 3CRTA 1F37A 3UBKA 1T8EB 5EY6A 1OKTA 2REMA 1M3JA 4POMA 2FA4A 4Q5QA 1HD2A 3EWLA 3WGEA 17GSA 3IA1A 1SD8A 5F05A 4I6XA 3J7Yk 2K8SA 4G0LA 4EF0A 2YWMA 1TTZA 1ACVA 3S9FA 2EIRA 4GTUA 1EV4A 1NHOA 4MMMA 2OKAA 3C7MA 5CRDA 1NM3A 4POKA 2JACA 4YAVA 3EMPA 12GSA 2AB6A 2F51A 4NHZA 5AISA 4O5QA 5CNWA 4F03A 3GIXA 3IC4A 3RBTA 3TDGA 4MABA 3FR9A 1SJZA 1XOAA 3UMAA 3ZTLA 1VGLA 2DJJA 1X5EA 2GSSA 1MD3A 1PSQA 1VRSD 1XWBA 2H1GA 1ZCPA 1R4WA 3QAWA 3UARA 1YEXA 3I6AA 5GZZB 1PN9A 2X4AA 5GSSA 2VAFA 4G0IA 2IL3A 1K0OA 4IKHA 4RI7A 5KOXA 4ZBAA 3DIEA 2CX3A 4TXOB 3A2WA 2F3MA 3WD6A 3M3MA 1B8XA 2KLXA 1JLWA 3FZ4A 3CTFA 1ST9A 3TJKA 2O89A 2B7JA 4ICYA 3D4MA 4GWRA 3CMIA 3GKMA 1G0TA 3NIVA 2R4VA 2E2MA 2H30A 3IBHA 1VF4A 5BRTA 1DE1A 4TR4A 2I9HA 2VD1A 1E6BA 4JZQA 5ECQB 2FWGA 4ECJA 4Z7XA 4JR6A 3IHQA 1EGOA 2VUPA 3FK8A 4BIKA 1UA5A 5B8AA 1S3AA 4HZ2A 5ENUA 1I9DA 3UBLA 2L5OA 1T1VA 3DKSA 2OBIA 5IMFA 4I2UA 1N8JA 2Z9SA 2BJXA 5ECSA 5J4UA 3CSIA 2C3QA 2DJ1A 4HZ4A 4K6XA 2VL3A 4GF0A 1G7OA 2JZTA 4EXJA 5G1LA 4ML6A 3ZLPA 2WCIA 2KHPA 1F6MC 3BCKA 4KGIA 4BWQA 2K18A 3APQA 1AC1A 2JSYA 4N0VA 1WJKA 2H74A 3BOAA 3KGKA 4WBRD 3MYDA 3H93A 4MF7A 2H0GA 2VLVA 2YWOA 4IGJA 4IP1A 2M80A 2H0IA 2N5AA 2CVDA 2R37A 1TI1A 3ERWA 3GURA 4AGSA 2OE3A 5ID2A 4G2EA 2QA1A 4YQMA 1QFNA 5E4WA 16GSA 2HT9A 5GAPD 2PVOC 1R26A 1CQHA 2X8HA 2YOIA 1B9YC 2WJUA 2G2QA 3HY2A 2R0GA 3Q18A 1GSQA 1GSYA 3NZNA 2C80A 5J9CA 1FO5A 4I97A 4X43A 5CP1A 3ME7A 4TR0A 1ERWA 3H1NA 2AV4A 5HR0A 2P0GA 1R5AA 2PBJA 3CXGA 4MJEA 3FKFA 3ZIJA 4KUNA 1XW9A 2NVLA 2PERA 6GSUA 3I43A 4NWYA 2C0FA 1WPIA 3US3A 1GSUA 3P7XA 1S3DA 3GL3A 4HU9A 3G9BA 4H86A 1UVZA 2KUCA 1U87A 1FOHA 4CDOA 1GNEA 4WKWA 3KH9A 2F8FA 3G7IA 4NV2A 2CV4A 1YKAA 2HLSA 3J7Yb 3KH7A 11GSA 3ISOA 3LEFA 2GGTA 4CHSA 3GNJA 1EOGA 5IOWA 1XW5A 2I4AA 1GH2A 4P3YB 3KD0A 2WZ9A 2YP6A 5ECLB 3SWLA 5ECPB 4WXTA 2C3TA 2YV9A 4DSRA 1YKCA 2XBQA 3ZVJA 4WF5A 1TI3A 3HKRA 2F9SA 2FA8A 4BVYB 1N2AA 4J57E 1K3OA 2VOCA 2NPBA 1ZYEA 3IPZA 4BL7B 2H1DA 1ZMAA 1FW1A 2QC7A 1FHEA 3CYNA 3RPPA 1AAZA 1HNAA 4L8EA 3KP8A 3IK9A 2MZCA 2X8CA 1BQ7A 4ML1A 2AAWA 1Y25A 5EPFA 3F3QA 1B4QA 3KTLA 1H4OA 1KEBA 5J9BA 3U5RE 3LXTA 3GUSA 1CQGA 4AJ6A 4ZL8A 18GSA 4FQUA 1X0RA 4EDYA 2FHEA 2VM2A 4IQAA 1MTCA 5A4VA 1SL1B 5BMUA 1A0RP 1PN0A 4TOPA 3QPMA 2GQMA 2BMXA 1TRWA 4Q5FA 4JRRA 4J56E 3ZFLA 2JSZA 3EE2A 3O76A 1WOUA 1OE8A 5LNKe 2A2RA 2GQLA 3GKKA 2HFDA 4EO3A 3IAS2 3C1SA 3VWXA 5IM9A 2NTOA 4NPBA 4POLA 1A2MA 1GP1A 1BG5A 1XXUA 4ULXA 4F0BA 4OCFA 3QMXA 2H6YA 4GRFA 4I8BA 4FIWA 1OC9A 2GLRA 2O7KA 2V6OA 2IMIA 4G0KA 2AJQB 3RPNA 1XFLA 2R6KA 4EIPA 4F0CA 20GSA 2V6KA 1XWGA 4TXVA 1ZYPA 1G6WA 2FUG2 4F2IA 2R3XA 2H01A 3APOA 1JZWA 1QMVA 1TDIA 5JCGA 1WP0A 4KCAA 3IOSA 6GSWA 2LV3A 2VCVA 1Z9HA 2YWNA 1K0AA 1HYUA 3ZL5A 5ABRA 3VWWA 3A5WA 3WT2A 4ECCA 1ML6A 2JADA 1O6JA 3PGTA 2R2JA 1TRUA 2QKEA 2YV7A 2IMKA 3M1GA 1NW2A 2E2GA 4K8MA 4TR1A 1SKSB 2KP1A 2MMNA 1TK5B 4WEYA 3M9KA 4K0NA 1BJXA 3WGXA 1ON4A 2A4HA 1K0NA 3LGCA 1EGRA 2ZUPA 2CVKA 2E0QA 2X64A 4IS0A 5A4WA 1BEDA 4KA0A 2TRCP 3GSSA 3TKRA 2RM5A 1ERVA 1A23A 4KNDA 2N5BA 1TXXA 1U88A 2HE3A 1ERTA 2LS5A 4BVYA 4MZWA 1GUKA 3VFIA 5B6MA 3QAVA 3GX8A 4MNNA 4TVEA 3UIWA 3APSA 2DC5A 4PQHA 4WETA 4MK3A 1KBNA 2HZEA 2I3YA 5ID2B 4MPGA 4NV5A 9GSSA 4PGTA 3F4SA 5INYA 5DCGA 1BAYA 1SK2A 1FB0A 3Q74A 4ZBBA 4N11A 13GSA 3HJPA 2PN8A 2PVQA 4XTSA 4IP6A 4ECIA 3LORA 2E7PA 1M9AA 2CZ2A 4N10A 2JU5A 4K0GA 3LYKA 3LYPA 4A5PA 1ZGNA 3RHBA 1XBSA 2H1AA 2LJKA 2H76A 4KE3A 1GUMA 3KJYA 1EWXA 2LEGA 2VCZA 4XRDA 2HZFA 3MAKA 5A4UA 5D93A 2GDRA 4YQVA 2DBCA 1M2BA 3GSTA 2VIMA 1X9MB 4MP4A 2DJKA 3D6IA 1TU7A 1S3RA 3I9V2 4DSQA 1KNGA 4HEA2 1DUGA 4XIHA 1K3YA 3GN3A 3ZMLA 1T4ZA 2LTKA 1W89A 2XC2A 6GSYA 2RM6A 1MDKA 2AUVA 3GTUA 1Z3EA 3DGQA 3UEMA 1M99A 5ECNB 3QDNA 2DKIA 2R0CA 3QCPA 2QA2A 5DCHA 5D8IA 1MEKA 2MYGA 2H0HA 2FD3A 2IMEA 3H8QA 1XWCA 5C00A 1ZOFA 3F6DA 1PA3A 4JE1A 4WF4A 3FZ9A 2VLUA 4IHUA 2R5GA 4KDXA 4IELA 4ZILA 2H6XA 3NOFA 1AUCA 5G30A 4NMUA 3CSHA 4EC0A 3TUEA 2FWFA 2GSRA 4RQRA 4PQIA 8GSSA 1XZOA 3TOUA 5A5KA 2LQQA 1B48A 1URMA 4ZBDA 1PKWA 3R3EA 22GSA 1K0BA 4YKFA 2MMZA 4PUFC 5F07A 2IN3A 2EIOA 1M2DA 3LXZA 5IPHA 2OJLA 4FYUA 1HNBA 5IMVA 2PMTA 4V2LA 3KTBA 1QUWA 1PRXA 4XRAA 1HQOA 2BTOT 4NXIA 1LBKA 1W4VA 4RUVA 2XPDA 4YQUA 1A2JA 2JZSA 4ILFA 3F9UA 1MDIA 4OMVA 1DBYA 5AIVA 3QR6A 1JZOA 1O8WA 4ISDA 4GCIA 4TN8A 4RI6A 1Z6NA 4GSSA 4MF6A 5LD0A 1T7PB 2MBTA 1X9SB 2LJAA 3U6VA 2GZYA 4WR5A 1M2AA 1TU8A 2H75A 4QL7A 4BPYA 4IJ3A 3W8JA 3FRCA 4IJIA 2GT5A 2JZRA 2O87A 1F3BA 4ZXGA 3CSJA 4EUYA 3Q19A 2CAIA 1I5GA 1WRYA 2YWIA 1OC9B 2L59A 4N0ZA 3CTGA 1YF1A 4MJAA 5ECKB 2MBSA 1YDKA 1FG4A 1EP7A 5J3RA 2GZZA 3Q6OA 5B6NA 2HRFA 3ZRDA 1XW6A 2ALBA 3FZAA 1WWJA 4V1Ap 2YNXA 2FNOA 5H5QA 4XS4A 4Q5NA 1AW9A 1U6TA 2NBSA 1RK4A 3KZQA 3HHVA 1TJDA 2VL2A 4HOJA 3F3RA 3FZ5A 4L5OA 2YJ7A 1B9XC 3HVXA 2WGRA 1K0DA 2CX4A 4PNGA 1GSDA 2B1LA 4QQ7A 5ECOB 1AQXA 1YQ1A 3O3TA 3A2XA 2C4JA 2IJYA 2A2SA 2O85A 4O5UA 3GMFA 1SJIA 4TR1B 3LG6A 2B5XA 4F9ZA 2GQKA 1QGVA 2IWTA 5DAKB 3UJ1A 1EEJA 1T3BA 4HJMA 2H66A 4ACSA 4I2TA 5D9TA 4XS1A 3HD5A 1JZDA 2I1UA 2LRTA 1J0FA 1GWCA 4QL9A 1O81A 4EVMA 1Z6MA 1ZZYA 2J23A 1K0MA 1SENA 4DSSA 3DYRA 4RQXA 2IFQA 4LL1B 6GSSA 1E2YA 3CQFA 5F0GA 3TKSC 4KSOA 3L78A 4ZB9A 2IIYA 1XCCA 2QGVA 2L57A 3ME8A 3F4TA 5F8BA 5DJLA 3P90A 3F4RA 2X8GA 3L4NA 4V2MA 3VK9A 4X4JA 1EV9A 5DQSA 3IDVA 3KCMA 3UVHA 1THOA 4K7NA 4L0WA 1EZKA 2HZEB 1V98A 4X1UA 3LJRA 5CO3A 5ECRB 4ID0A 2FWHA
chains in the Genus database with same CATH topology
5AGYA 1YJ6A 1AIUA 4HUAA 1YEPA 1DSBA 5ECHB 1R7HA 3FY7A 1TRSA 3C71A 4OCEA 3QD9A 1JZRA 6GSTA 4OFTA 2V1MA 2VCQA 1ERUA 2NDOA 1WIKA 4TKYA 4GSNA 4AJ8A 5HR3A 2AHEA 2ON5A 4YKGA 1F2EA 1SD9A 2HNLA 3UVTA 2DJ3A 1TK0B 4DVCA 3N9JA 5GSTA 2OACA 3IR4A 4KSMA 4TR3A 1G6YA 2YPMA 3TOTA 2B5YA 4WR4A 2VCWA 3VWUA 3WT1A 5J41A 1GTBA 3VPTA 2RUFA 4NAXA 2CT6A 3D5JA 2C8UA 3L0HA 2OADA 1NSWA 1J9BA 1BYEA 3RDWA 1MDJA 2XPEA 3GTUB 3HJMA 5G2ZA 4IVFA 2YZHA 2OA7A 3FHKA 4AF2A 2YJHA 2HSYA 1SYRA 4Z2RA 3KXOA 3GKNA 3BJ5A 4IW9A 1XOBA 4POBA 1GRXA 1SKRB 4Q5RA 1PKZA 2YN1A 3UAPA 1J08A 2P31A 1T4YA 1GLQA 5L71A 2OE0A 4KF9A 3BD2A 2RUEA 2HSHA 1LJRA 4MPFA 1T00A 4LMWA 2FLSA 2FY6A 19GSA 2ZNMA 1H75A 2H72A 3GV1A 5EL8A 1ILOA 1OC8A 4PUAA 5D9WA 14GSA 4XHMA 2H1BA 5KN2A 4OFNA 1XIYA 4IN0A 5ELGA 3KM6A 2DMMA 1M9BA 3GKXA 5LCZA 1Z7RA 2CA8A 1TRVA 5DDLA 3WYWA 2XBIA 3DWVA 1MD4A 1QQ2A 3EPTA 5HFGA 5AIXA 5AN1A 3HXSA 1OC3A 4EIQA 3EURA 1VF2A 2A2PA 4XCSA 5DAKA 4K5SA 3VURA 2VM1A 2LKUA 1BX9A 3C8EA 2CVBA 2C3NA 4TW5A 4JEDA 3GH6A 1NHYA 1PD21 2B7KA 3WGDA 3KEBA 1B4PA 2LJRA 3SBCA 2A4VA 1YZXA 1TKDB 3GFKA 3DEXA 5ECMB 3GRXA 3R2QA 1LU4A 5IIZA 5J5NA 2EIQA 2X99A 3TKSA 1OAZA 5H5SA 5JCWA 4KDUA 2B6MA 6GSXA 1FAAA 3C1RA 2H8LA 1F3AA 5G31A 1SL2B 1GTIA 1O85A 3F0IA 3EYTA 4BWSA 2CQ9A 4ZIJA 3ZFBA 3VLNA 3MDKA 2PPTA 5G1KA 4LL4B 4HQSA 3DRNA 4L0UA 1FB6A 1R5PA 2GSTA 3AY8A 3VI5A 1GSFA 5CAXA 2JL4A 2PGTA 6GSVA 3DD3A 3ED3A 1XWAA 1PX7A 3JCML 2WRTA 4XS4B 1HNCA 1JFUA 1QK8A 2P5RA 3N5OA 4G10A 2K9FA 2RIIA 1ABAA 1FVKA 3D21A 4MZCA 2VL2C 3W8SA 1Z7PA 3F8UA 4KH7A 4D73B 3PPUA 4MJCA 5CYYA 4MH2A 5JCUA 1PL1A 3HYPA 2RLIA 3HZ4A 1SL0B 3MNGA 3PR8A 1V58A 1EP8A 3TRXA 1V57A 2KP2A 3KMNA 4EL1A 3GH9A 4KAEA 3M9JA 2HYXA 1WMJA 4USSA 5IMDA 2WB9A 3P2AA 4AJ7A 4J2FA 1TP9A 3MIXA 5DALA 4K2XA 3E0UA 2H19A 2GTUA 2HI7A 3LQ7A 3M0FA 5C04A 4OFMA 5IQYA 5JWRB 3EINA 1TK8B 3TRQA 4DSSB 2AYTA 4GXZA 2IFQB 3ZYWA 2J9HA 1Q98A 5FT3A 2HSMA 5B8BA 3FR6A 2M72A 1A8LA 5IPGA 1GTUA 4LLRA 4Z2UA 4PQ1A 3VWVA 4HI7A 1ZYQB 1PX6A 1DE2A 2OE1A 5HR2A 3W6GA 2FGXA 5KN0A 1A2LA 3EC3A 5FHIA 4PX1A 5EVOA 2OBKA 1SU9A 1IYIA 4I5QA 5KN1A 2IMDA 3GL5A 1JHBA 3TJGA 1S3CA 2QSIA 2TIRA 2EC4A 4KW6A 1XWKA 3IRAA 1A8YA 2LQOA 2DSAA 5E59A 3QOUA 3D4TA 3ZMKA 1A24A 2PU9C 2WULA 2WS2A 1O8XA 3FEUA 4GQCA 2HXKA 1U3IA 3IE3A 4MZBA 4PTSA 1GSSA 3EU4A 3IK7A 2B1KA 2IPAA 1SKWB 5GAND 2L6DA 5H5RA 1GLPA 2O8VB 5IMCA 2DKHA 4MCUA 4EKZA 5COHA 1X5CA 1WE0A 5KN3A 3DXBA 1EEMA 2LRCA 2G0FA 1XVQA 4YAPA 4ZB6A 5HFIA 3OR5A 5CREA 3H4KA 1ZYNA 4O7HA 4DEJA 2H6ZA 3D0ZA 4OO4A 1RQMA 4G19A 2VD0A 5IO2A 1GULA 3FR3A 4ZB8A 1C72A 3TJFA 2L4CA 5IMAA 4EE0A 4O92A 4K7IA 3TJJA 2R0PA 1K0CA 4NHWA 3ERGA 7GSSA 1U3AA 2DJ0A 2UZ8A 3KMOA 2MMOA 4V2NA 2WFCA 5JWOB 1PQNA 3TB2A 2VCXA 2L6CA 2HRNA 4D73A 1Z5YE 3P8WA 1PGTA 3HJOA 2ES7A 3RAZA 5JWQB 2HRKA 2TRXA 2H71A 4BVXB 2GSQA 4HU7A 3QFBC 4Z2TA 2CAQA 5HFKA 2DLXA 2PWJA 4K9ZA 3MWHA 4O5RA 10GSA 4HJ2A 3TGZA 4GQFA 2KOKA 3O6TA 5B7CA 3VPQA 2C1YA 4GLTA 3HDCA 1THXA 2V2GA 3FYGA 3DVXA 1G7EA 2GVPA 5KEJA 2YZUA 3DMLA 4K7OA 1SJ6A 2PUKC 1V40A 2FWEA 1OVNA 2DIYA 2F8AA 1VF3A 2VO4A 3C73A 5D96A 2K6VA 2VL9A 1V2AA 2DMLA 5KOWA 3GHAA 3E9JB 5FWGA 3ZVJD 2GS3A 3BBYA 5ECIB 2LNTA 4X0XA 3GX0A 2DJ2A 4GSTA 1OYJA 4TXOA 3IC8A 2V32A 1XPVA 1SK1A 4TRXA 2C0EA 5CRWA 2V41A 1M7TA 4FO5A 4KB3A 5DVBA 4CW9A 2YCDA 5CRHA 2DIZA 2MMAA 4K1FA 4MLYA 3LWAA 4BA7A 2VCTA 4ECBA 3L9SA 5G5FA 2ON7A 4FYBA 2I81A 4FH8A 5D73A 3L9UA 4E8HA 2WDUA 1AQWA 2LRNA 4KDYA 1AQVA 4HS1A 3FMWA 4YH2A 1AXDA 1GTAA 5DJMA 1GNWA 1KTEA 1GSEA 1GUHA 4KCEA 3HZ8A 1ZL9A 3IXRA 2X49A 2H70A 4MDCA 1GL8A 5D9VA 3M8NA 1YF0A 4MF5A 2M46A 3UL3A 1F9MA 4OWYA 1Q4JA 1UN2A 4O32A 2C0DA 4HQZA 3CBUA 3TKSE 3FW2A 4JBBA 2P5QA 4PXOA 1PMTA 4E8EA 4WBJA 3ZITA 4EDZA 3EU3A 1Y6EA 3K8NA 5IMZA 2YANA 1YY7A 3TKQA 3F63A 3I69A 3LSZA 1VF1A 2IMFA 2VLTA 1SYXA 1TW9A 4N30A 5DQYA 3ZIVA 4MH3A 3EVIA 3V1WA 2B3SA 5DALB 4F82A 5CRGA 4JU5A 2LUSA 2HRAA 4MJBA 4L5LA 3D22A 4FYCA 3TCOA 1SK0A 3G7JA 1EOHA 1RW1A 2N5FA 4CY8A 3EMXA 5F06A 3TKPA 1OE7A 2H73A 4V1Ag 1UC7A 1JLVA 3KP9A 3GYKA 3HVVA 3LW9A 4OD7A 3QAGA 4XS6A 2GZPA 1FVJA 1K3LA 3BCIA 5DBQA 1XVWA 3VI7A 3DVWA 5ELAA 4BVXA 5D9XA 3PH9A 3ZZXA 3A2VA 3IV4A 1M0UA 2L4QA 4LMVA 3ZREA 3HVSA 3HCZA 1A0FA 5G5EA 5HR1A 2ZCTA 3KIJA 3QFAC 4ZL9A 1QXHA 2LSTA 3IAM2 2LNSA 4CY6A 3CRUA 3E3EA 3TRPA 4LA1A 1IYHA 4PURA 5IOXA 3UOMA 1USBA 2FCHA 5IO0A 2B5EA 1X5DA 1FOVA 4MA9A 3A5IA 1PL2A 2L5LA 4G9HA 3PINA 4JR4A 3LFLA 2XHFA 1TOFA 3F6FA 2CZ3A 3ERFA 3GA4A 1O73A 3H79A 4IBPA 3A3TA 4ZL7A 4KX4A 1X9WB 2GT6A 3HA9A 4OO5A 1O7UA 2C0GA 1OKDA 4IQ1A 3TJBA 5HQPA 4K5RA 1V9WA 3RHCA 3MSZA 3L9VA 4K2DA 3G7YA 4BL7A 3IHGA 2D2ZA 4PNFA 2K8VA 4HDEA 3CRTA 1F37A 3UBKA 1T8EB 5EY6A 1OKTA 2REMA 4POMA 2FA4A 4Q5QA 1HD2A 3EWLA 3WGEA 17GSA 3IA1A 1SD8A 5F05A 4I6XA 3J7Yk 2K8SA 4G0LA 4EF0A 2YWMA 1TTZA 1ACVA 3S9FA 2EIRA 4GTUA 1EV4A 1NHOA 4MMMA 2OKAA 3C7MA 5CRDA 1NM3A 4POKA 2JACA 4YAVA 3EMPA 12GSA 2AB6A 2F51A 4NHZA 5AISA 4O5QA 5CNWA 4F03A 3GIXA 3IC4A 3RBTA 3TDGA 4MABA 3FR9A 1SJZA 1XOAA 3UMAA 3ZTLA 1VGLA 2DJJA 1X5EA 2GSSA 1MD3A 1PSQA 1VRSD 1XWBA 2H1GA 1ZCPA 1R4WA 3QAWA 3UARA 1YEXA 3I6AA 5GZZB 1PN9A 2X4AA 5GSSA 2VAFA 4G0IA 2IL3A 1K0OA 4IKHA 4RI7A 5KOXA 4ZBAA 3DIEA 2CX3A 4TXOB 3A2WA 2F3MA 3WD6A 3M3MA 1B8XA 2KLXA 1JLWA 3FZ4A 3CTFA 1ST9A 3TJKA 2O89A 2B7JA 4ICYA 3D4MA 4GWRA 3CMIA 3GKMA 1G0TA 3NIVA 2R4VA 2E2MA 2H30A 3IBHA 1VF4A 5BRTA 1DE1A 4TR4A 2I9HA 2VD1A 1E6BA 4JZQA 5ECQB 2FWGA 4ECJA 4Z7XA 4JR6A 3IHQA 1EGOA 2VUPA 3FK8A 1UA5A 5B8AA 1S3AA 4HZ2A 5ENUA 1I9DA 3UBLA 2L5OA 1T1VA 3DKSA 2OBIA 5IMFA 4I2UA 1N8JA 2Z9SA 2BJXA 5ECSA 5J4UA 3CSIA 2C3QA 2DJ1A 4HZ4A 4K6XA 2VL3A 4GF0A 1G7OA 2JZTA 4EXJA 5G1LA 4ML6A 3ZLPA 2WCIA 2KHPA 1F6MC 3BCKA 4KGIA 4BWQA 2K18A 3APQA 1AC1A 2JSYA 4N0VA 1WJKA 2H74A 3BOAA 3KGKA 4WBRD 3MYDA 3H93A 4MF7A 2H0GA 2VLVA 2YWOA 4IGJA 4IP1A 2M80A 2H0IA 2N5AA 2CVDA 2R37A 1TI1A 3ERWA 3GURA 4AGSA 2OE3A 5ID2A 4G2EA 2QA1A 4YQMA 1QFNA 5E4WA 16GSA 2HT9A 5GAPD 2PVOC 1R26A 1CQHA 2X8HA 2YOIA 1B9YC 2WJUA 2G2QA 3HY2A 2R0GA 3Q18A 1GSQA 1GSYA 3NZNA 2C80A 5J9CA 1FO5A 4I97A 4X43A 5CP1A 3ME7A 4TR0A 1ERWA 3H1NA 2AV4A 5HR0A 2P0GA 1R5AA 2PBJA 3CXGA 4MJEA 3FKFA 3ZIJA 4KUNA 1XW9A 2NVLA 2PERA 6GSUA 3I43A 4NWYA 2C0FA 1WPIA 3US3A 1GSUA 3P7XA 1S3DA 3GL3A 4HU9A 3G9BA 4H86A 1UVZA 2KUCA 1U87A 1FOHA 4CDOA 1GNEA 4WKWA 3KH9A 2F8FA 3G7IA 4NV2A 2CV4A 1YKAA 2HLSA 3J7Yb 3KH7A 11GSA 3ISOA 3LEFA 2GGTA 4CHSA 3GNJA 1EOGA 5IOWA 1XW5A 2I4AA 1GH2A 4P3YB 3KD0A 2WZ9A 2YP6A 5ECLB 3SWLA 5ECPB 4WXTA 2C3TA 2YV9A 4DSRA 1YKCA 2XBQA 3ZVJA 4WF5A 1TI3A 3HKRA 2F9SA 2FA8A 4BVYB 1N2AA 4J57E 1K3OA 2VOCA 2NPBA 1ZYEA 3IPZA 4BL7B 2H1DA 1ZMAA 1FW1A 2QC7A 1FHEA 3CYNA 3RPPA 1AAZA 1HNAA 4L8EA 3KP8A 3IK9A 2MZCA 2X8CA 1BQ7A 4ML1A 2AAWA 1Y25A 5EPFA 3F3QA 1B4QA 3KTLA 1H4OA 1KEBA 5J9BA 3U5RE 3LXTA 3GUSA 1CQGA 4AJ6A 4ZL8A 18GSA 4FQUA 1X0RA 4EDYA 2FHEA 2VM2A 4IQAA 1MTCA 5A4VA 1SL1B 5BMUA 1A0RP 1PN0A 4TOPA 3QPMA 2GQMA 2BMXA 1TRWA 4Q5FA 4JRRA 4J56E 3ZFLA 2JSZA 3EE2A 3O76A 1WOUA 1OE8A 5LNKe 2A2RA 2GQLA 3GKKA 2HFDA 4EO3A 3IAS2 3C1SA 3VWXA 5IM9A 2NTOA 4NPBA 4POLA 1A2MA 1GP1A 1BG5A 1XXUA 4ULXA 4F0BA 4OCFA 3QMXA 2H6YA 4GRFA 4I8BA 4FIWA 1OC9A 2GLRA 2O7KA 2V6OA 2IMIA 4G0KA 2AJQB 3RPNA 1XFLA 2R6KA 4EIPA 4F0CA 20GSA 2V6KA 1XWGA 4TXVA 1ZYPA 1G6WA 2FUG2 4F2IA 2R3XA 2H01A 3APOA 1JZWA 1QMVA 1TDIA 5JCGA 1WP0A 4KCAA 3IOSA 6GSWA 2LV3A 2VCVA 1Z9HA 2YWNA 1K0AA 1HYUA 3ZL5A 5ABRA 3VWWA 3A5WA 3WT2A 4ECCA 1ML6A 2JADA 1O6JA 3PGTA 2R2JA 1TRUA 2QKEA 2YV7A 2IMKA 3M1GA 1NW2A 2E2GA 4K8MA 4TR1A 1SKSB 2KP1A 2MMNA 1TK5B 4WEYA 3M9KA 4K0NA 1BJXA 3WGXA 1ON4A 2A4HA 1K0NA 3LGCA 1EGRA 2ZUPA 2CVKA 2E0QA 2X64A 4IS0A 5A4WA 1BEDA 4KA0A 2TRCP 3GSSA 3TKRA 2RM5A 1ERVA 1A23A 4KNDA 2N5BA 1TXXA 1U88A 2HE3A 1ERTA 2LS5A 4BVYA 4MZWA 1GUKA 3VFIA 5B6MA 3QAVA 3GX8A 4MNNA 4TVEA 3UIWA 3APSA 2DC5A 4PQHA 4WETA 4MK3A 1KBNA 2HZEA 2I3YA 5ID2B 4MPGA 4NV5A 9GSSA 4PGTA 3F4SA 5INYA 5DCGA 1BAYA 1SK2A 1FB0A 3Q74A 4ZBBA 4N11A 13GSA 3HJPA 2PN8A 2PVQA 4XTSA 4IP6A 4ECIA 3LORA 2E7PA 1M9AA 2CZ2A 4N10A 2JU5A 4K0GA 3LYKA 3LYPA 4A5PA 1ZGNA 3RHBA 1XBSA 2H1AA 2LJKA 2H76A 4KE3A 1GUMA 3KJYA 1EWXA 2LEGA 2VCZA 4XRDA 2HZFA 3MAKA 5A4UA 5D93A 2GDRA 4YQVA 2DBCA 1M2BA 3GSTA 2VIMA 1X9MB 4MP4A 2DJKA 3D6IA 1TU7A 3I9V2 4DSQA 1KNGA 4HEA2 1DUGA 4XIHA 1K3YA 3GN3A 3ZMLA 1T4ZA 2LTKA 1W89A 2XC2A 6GSYA 2RM6A 1MDKA 2AUVA 3GTUA 1Z3EA 3DGQA 3UEMA 1M99A 5ECNB 3QDNA 2DKIA 2R0CA 3QCPA 2QA2A 5DCHA 5D8IA 1MEKA 2MYGA 2H0HA 2FD3A 2IMEA 3H8QA 1XWCA 5C00A 1ZOFA 3F6DA 1PA3A 4JE1A 4WF4A 3FZ9A 2VLUA 4IHUA 2R5GA 4KDXA 4IELA 4ZILA 2H6XA 3NOFA 1AUCA 5G30A 4NMUA 3CSHA 4EC0A 3TUEA 2FWFA 2GSRA 4RQRA 4PQIA 8GSSA 1XZOA 3TOUA 5A5KA 2LQQA 1B48A 1URMA 4ZBDA 1PKWA 3R3EA 22GSA 1K0BA 4YKFA 2MMZA 4PUFC 5F07A 2IN3A 2EIOA 1M2DA 3LXZA 5IPHA 2OJLA 4FYUA 1HNBA 5IMVA 2PMTA 4V2LA 3KTBA 1QUWA 1PRXA 4XRAA 1HQOA 2BTOT 4NXIA 1LBKA 1W4VA 4RUVA 2XPDA 4YQUA 1A2JA 2JZSA 4ILFA 3F9UA 1MDIA 4OMVA 1DBYA 5AIVA 3QR6A 1JZOA 1O8WA 4ISDA 4GCIA 4TN8A 4RI6A 1Z6NA 4GSSA 4MF6A 5LD0A 1T7PB 2MBTA 1X9SB 2LJAA 3U6VA 2GZYA 4WR5A 1M2AA 1TU8A 2H75A 4QL7A 4BPYA 4IJ3A 3W8JA 3FRCA 4IJIA 2GT5A 2JZRA 2O87A 1F3BA 4ZXGA 3CSJA 4EUYA 3Q19A 2CAIA 1I5GA 1WRYA 2YWIA 1OC9B 2L59A 4N0ZA 3CTGA 1YF1A 4MJAA 5ECKB 2MBSA 1YDKA 1FG4A 1EP7A 5J3RA 2GZZA 3Q6OA 5B6NA 2HRFA 3ZRDA 1XW6A 2ALBA 3FZAA 1WWJA 4V1Ap 2YNXA 2FNOA 5H5QA 4XS4A 4Q5NA 1AW9A 1U6TA 2NBSA 1RK4A 3KZQA 3HHVA 1TJDA 2VL2A 4HOJA 3F3RA 3FZ5A 4L5OA 2YJ7A 1B9XC 3HVXA 2WGRA 1K0DA 2CX4A 4PNGA 1GSDA 2B1LA 4QQ7A 5ECOB 1AQXA 1YQ1A 3O3TA 3A2XA 2C4JA 2IJYA 2A2SA 2O85A 4O5UA 3GMFA 1SJIA 4TR1B 3LG6A 2B5XA 4F9ZA 2GQKA 1QGVA 2IWTA 5DAKB 3UJ1A 1EEJA 1T3BA 4HJMA 2H66A 4ACSA 4I2TA 5D9TA 4XS1A 3HD5A 1JZDA 2I1UA 2LRTA 1J0FA 1GWCA 4QL9A 1O81A 4EVMA 1Z6MA 1ZZYA 2J23A 1K0MA 1SENA 4DSSA 3DYRA 4RQXA 2IFQA 4LL1B 6GSSA 1E2YA 5F0GA 3TKSC 4KSOA 3L78A 4ZB9A 2IIYA 1XCCA 2QGVA 2L57A 3ME8A 3F4TA 5F8BA 5DJLA 3P90A 3F4RA 2X8GA 3L4NA 4V2MA 3VK9A 4X4JA 1EV9A 5DQSA 3IDVA 3KCMA 3UVHA 1THOA 4K7NA 4L0WA 1EZKA 2HZEB 1V98A 4X1UA 3LJRA 5CO3A 5ECRB 4ID0A 2FWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGY A;  1YJ6 A;  1AIU A;  4HUA A;  1YEP A;  1DSB A;  5ECH B;  1R7H A;  3FY7 A;  1TRS A;  3C71 A;  4OCE A;  3QD9 A;  1JZR A;  6GST A;  4OFT A;  2V1M A;  2VCQ A;  1ERU A;  2NDO A;  1WIK A;  4TKY A;  4GSN A;  4AJ8 A;  5HR3 A;  2AHE A;  2ON5 A;  1F2E A;  1SD9 A;  2HNL A;  3UVT A;  2DJ3 A;  1TK0 B;  4DVC A;  3N9J A;  5GST A;  2OAC A;  3IR4 A;  4KSM A;  4TR3 A;  1G6Y A;  2YPM A;  3TOT A;  2B5Y A;  4WR4 A;  2VCW A;  3VWU A;  3WT1 A;  5J41 A;  1GTB A;  3VPT A;  2RUF A;  4NAX A;  2CT6 A;  3D5J A;  2C8U A;  3L0H A;  2OAD A;  1NSW A;  1J9B A;  1BYE A;  3RDW A;  1MDJ A;  2XPE A;  3GTU B;  3HJM A;  5G2Z A;  4IVF A;  2YZH A;  2OA7 A;  3FHK A;  4AF2 A;  2YJH A;  2HSY A;  1SYR A;  3KXO A;  3GKN A;  3BJ5 A;  4IW9 A;  1XOB A;  4POB A;  1GRX A;  1SKR B;  4Q5R A;  1PKZ A;  2YN1 A;  3UAP A;  1J08 A;  2P31 A;  1T4Y A;  1GLQ A;  5L71 A;  2OE0 A;  3BD2 A;  2RUE A;  2HSH A;  1LJR A;  4MPF A;  1T00 A;  4LMW A;  2FLS A;  2FY6 A;  19GS A;  2ZNM A;  1H75 A;  2H72 A;  3GV1 A;  5EL8 A;  1ILO A;  1OC8 A;  4PUA A;  5D9W A;  14GS A;  4XHM A;  2H1B A;  5KN2 A;  4OFN A;  1XIY A;  4IN0 A;  5ELG A;  3KM6 A;  2DMM A;  1M9B A;  3GKX A;  5LCZ A;  1Z7R A;  2CA8 A;  1TRV A;  5DDL A;  3WYW A;  2XBI A;  3DWV A;  1MD4 A;  1QQ2 A;  5HFG A;  5AIX A;  5AN1 A;  3HXS A;  1OC3 A;  3EUR A;  1VF2 A;  4XCS A;  5DAK A;  3VUR A;  2VM1 A;  2LKU A;  1BX9 A;  3C8E A;  2CVB A;  2C3N A;  4TW5 A;  4JED A;  3GH6 A;  1NHY A;  1PD2 1;  2B7K A;  3WGD A;  3KEB A;  1B4P A;  2LJR A;  3SBC A;  2A4V A;  1YZX A;  1TKD B;  3GFK A;  3DEX A;  5ECM B;  3GRX A;  3R2Q A;  1LU4 A;  5IIZ A;  5J5N A;  2EIQ A;  2X99 A;  3TKS A;  1OAZ A;  5H5S A;  5JCW A;  4KDU A;  2B6M A;  6GSX A;  1FAA A;  3C1R A;  2H8L A;  1F3A A;  5G31 A;  1SL2 B;  1GTI A;  1O85 A;  3F0I A;  3EYT A;  4BWS A;  2CQ9 A;  4ZIJ A;  3ZFB A;  3VLN A;  3MDK A;  2PPT A;  5G1K A;  4LL4 B;  4HQS A;  3DRN A;  4L0U A;  1FB6 A;  1R5P A;  2GST A;  3AY8 A;  3VI5 A;  1GSF A;  5CAX A;  2JL4 A;  2PGT A;  6GSV A;  3DD3 A;  3ED3 A;  1XWA A;  1PX7 A;  3JCM L;  2WRT A;  4XS4 B;  1HNC A;  1JFU A;  1QK8 A;  2P5R A;  3N5O A;  4G10 A;  2K9F A;  2RII A;  1ABA A;  1FVK A;  3D21 A;  4MZC A;  2VL2 C;  3W8S A;  1Z7P A;  3F8U A;  4KH7 A;  4D73 B;  4MJC A;  5CYY A;  4MH2 A;  5JCU A;  1PL1 A;  3HYP A;  2RLI A;  3HZ4 A;  1SL0 B;  3MNG A;  3PR8 A;  1V58 A;  1EP8 A;  3TRX A;  1V57 A;  2KP2 A;  3KMN A;  4EL1 A;  3GH9 A;  4KAE A;  3M9J A;  2HYX A;  1WMJ A;  5IMD A;  2WB9 A;  3P2A A;  4AJ7 A;  4J2F A;  1TP9 A;  5DAL A;  3E0U A;  2H19 A;  2GTU A;  2HI7 A;  3LQ7 A;  3M0F A;  5C04 A;  4OFM A;  5IQY A;  5JWR B;  3EIN A;  1TK8 B;  3TRQ A;  4DSS B;  2AYT A;  4GXZ A;  2IFQ B;  3ZYW A;  2J9H A;  1Q98 A;  5FT3 A;  5B8B A;  3FR6 A;  2M72 A;  1A8L A;  5IPG A;  1GTU A;  4LLR A;  4PQ1 A;  3VWV A;  4HI7 A;  1ZYQ B;  1PX6 A;  1DE2 A;  2OE1 A;  5HR2 A;  3W6G A;  2FGX A;  5KN0 A;  1A2L A;  3EC3 A;  5FHI A;  4PX1 A;  5EVO A;  2OBK A;  1SU9 A;  1IYI A;  4I5Q A;  5KN1 A;  2IMD A;  3GL5 A;  1JHB A;  3TJG A;  1S3C A;  2QSI A;  2TIR A;  2EC4 A;  4KW6 A;  1XWK A;  3IRA A;  1A8Y A;  2LQO A;  2DSA A;  5E59 A;  3QOU A;  3D4T A;  3ZMK A;  1A24 A;  2PU9 C;  2WUL A;  2WS2 A;  1O8X A;  3FEU A;  4GQC A;  2HXK A;  1U3I A;  3IE3 A;  4MZB A;  1GSS A;  3EU4 A;  3IK7 A;  2B1K A;  2IPA A;  1SKW B;  5GAN D;  2L6D A;  5H5R A;  1GLP A;  2O8V B;  5IMC A;  4MCU A;  4EKZ A;  5COH A;  1X5C A;  1WE0 A;  5KN3 A;  3DXB A;  1EEM A;  2LRC A;  2G0F A;  1XVQ A;  4YAP A;  4ZB6 A;  5HFI A;  3OR5 A;  5CRE A;  3H4K A;  4O7H A;  4DEJ A;  2H6Z A;  3D0Z A;  4OO4 A;  1RQM A;  4G19 A;  2VD0 A;  5IO2 A;  1GUL A;  3FR3 A;  4ZB8 A;  1C72 A;  3TJF A;  2L4C A;  5IMA A;  4EE0 A;  4O92 A;  4K7I A;  3TJJ A;  1K0C A;  4NHW A;  3ERG A;  7GSS A;  1U3A A;  2DJ0 A;  3KMO A;  2MMO A;  4V2N A;  2WFC A;  5JWO B;  1PQN A;  3TB2 A;  2VCX A;  2L6C A;  2HRN A;  4D73 A;  1Z5Y E;  3P8W A;  1PGT A;  3HJO A;  2ES7 A;  3RAZ A;  5JWQ B;  2TRX A;  2H71 A;  2GSQ A;  4HU7 A;  3QFB C;  2CAQ A;  5HFK A;  2DLX A;  2PWJ A;  4K9Z A;  3MWH A;  4O5R A;  10GS A;  4HJ2 A;  3TGZ A;  4GQF A;  2KOK A;  3O6T A;  5B7C A;  3VPQ A;  2C1Y A;  4GLT A;  3HDC A;  1THX A;  2V2G A;  3FYG A;  3DVX A;  1G7E A;  2GVP A;  5KEJ A;  2YZU A;  3DML A;  4K7O A;  1SJ6 A;  2PUK C;  1V40 A;  2FWE A;  1OVN A;  2DIY A;  2F8A A;  1VF3 A;  2VO4 A;  3C73 A;  5D96 A;  2K6V A;  2VL9 A;  1V2A A;  2DML A;  3GHA A;  3E9J B;  5FWG A;  3ZVJ D;  2GS3 A;  3BBY A;  5ECI B;  2LNT A;  4X0X A;  3GX0 A;  2DJ2 A;  4GST A;  1OYJ A;  4TXO A;  2V32 A;  1XPV A;  1SK1 A;  4TRX A;  2C0E A;  5CRW A;  2V41 A;  1M7T A;  4FO5 A;  4KB3 A;  5DVB A;  4CW9 A;  2YCD A;  5CRH A;  2DIZ A;  2MMA A;  4K1F A;  4MLY A;  3LWA A;  4BA7 A;  2VCT A;  4ECB A;  3L9S A;  5G5F A;  2ON7 A;  4FYB A;  2I81 A;  4FH8 A;  5D73 A;  3L9U A;  4E8H A;  2WDU A;  1AQW A;  2LRN A;  4KDY A;  1AQV A;  4HS1 A;  4YH2 A;  1AXD A;  1GTA A;  5DJM A;  1GNW A;  1KTE A;  1GSE A;  1GUH A;  4KCE A;  3HZ8 A;  1ZL9 A;  3IXR A;  2H70 A;  4MDC A;  1GL8 A;  5D9V A;  3M8N A;  1YF0 A;  4MF5 A;  2M46 A;  3UL3 A;  1F9M A;  4OWY A;  1Q4J A;  1UN2 A;  4O32 A;  2C0D A;  4HQZ A;  3CBU A;  3TKS E;  3FW2 A;  4JBB A;  2P5Q A;  4PXO A;  1PMT A;  4E8E A;  4WBJ A;  3ZIT A;  4EDZ A;  3EU3 A;  1Y6E A;  3K8N A;  5IMZ A;  2YAN A;  1YY7 A;  3TKQ A;  3F63 A;  3I69 A;  3LSZ A;  1VF1 A;  2IMF A;  2VLT A;  1SYX A;  1TW9 A;  4N30 A;  5DQY A;  3ZIV A;  4MH3 A;  3EVI A;  3V1W A;  2B3S A;  5DAL B;  4F82 A;  5CRG A;  4JU5 A;  2LUS A;  4MJB A;  4L5L A;  3D22 A;  4FYC A;  3TCO A;  1SK0 A;  3G7J A;  1EOH A;  1RW1 A;  2N5F A;  3EMX A;  5F06 A;  3TKP A;  1OE7 A;  2H73 A;  4V1A g;  1UC7 A;  1JLV A;  3KP9 A;  3GYK A;  3HVV A;  4OD7 A;  3QAG A;  4XS6 A;  2GZP A;  1FVJ A;  1K3L A;  3BCI A;  5DBQ A;  1XVW A;  3VI7 A;  3DVW A;  5ELA A;  4BVX A;  5D9X A;  3PH9 A;  3ZZX A;  3A2V A;  3IV4 A;  1M0U A;  2L4Q A;  4LMV A;  3ZRE A;  3HVS A;  3HCZ A;  1A0F A;  5G5E A;  5HR1 A;  2ZCT A;  3KIJ A;  3QFA C;  4ZL9 A;  1QXH A;  2LST A;  3IAM 2;  2LNS A;  3CRU A;  3E3E A;  3TRP A;  4LA1 A;  1IYH A;  4PUR A;  5IOX A;  3UOM A;  1USB A;  2FCH A;  5IO0 A;  2B5E A;  1X5D A;  1FOV A;  4MA9 A;  4G9H A;  1PL2 A;  2L5L A;  3PIN A;  4JR4 A;  3LFL A;  2XHF A;  1TOF A;  3F6F A;  2CZ3 A;  3ERF A;  3GA4 A;  1O73 A;  3H79 A;  4IBP A;  3A3T A;  4ZL7 A;  4KX4 A;  1X9W B;  2GT6 A;  3HA9 A;  4OO5 A;  1O7U A;  2C0G A;  1OKD A;  4IQ1 A;  3TJB A;  5HQP A;  1V9W A;  3RHC A;  3MSZ A;  3L9V A;  4K2D A;  3G7Y A;  4BL7 A;  2D2Z A;  4PNF A;  2K8V A;  4HDE A;  3CRT A;  1F37 A;  3UBK A;  1T8E B;  5EY6 A;  1OKT A;  2REM A;  4POM A;  2FA4 A;  4Q5Q A;  1HD2 A;  3EWL A;  3WGE A;  17GS A;  3IA1 A;  1SD8 A;  5F05 A;  4I6X A;  3J7Y k;  2K8S A;  4EF0 A;  2YWM A;  1TTZ A;  1ACV A;  3S9F A;  2EIR A;  4GTU A;  1EV4 A;  1NHO A;  4MMM A;  2OKA A;  3C7M A;  5CRD A;  1NM3 A;  4POK A;  2JAC A;  4YAV A;  3EMP A;  12GS A;  2AB6 A;  2F51 A;  4NHZ A;  5AIS A;  5CNW A;  4F03 A;  3GIX A;  3IC4 A;  3RBT A;  3TDG A;  4MAB A;  3FR9 A;  1SJZ A;  1XOA A;  3UMA A;  3ZTL A;  1VGL A;  2DJJ A;  1X5E A;  2GSS A;  1MD3 A;  1PSQ A;  1VRS D;  1XWB A;  2H1G A;  1ZCP A;  1R4W A;  3QAW A;  3UAR A;  1YEX A;  3I6A A;  5GZZ B;  1PN9 A;  5GSS A;  2VAF A;  2IL3 A;  1K0O A;  4IKH A;  4RI7 A;  4ZBA A;  3DIE A;  2CX3 A;  4TXO B;  3A2W A;  2F3M A;  3WD6 A;  3M3M A;  1B8X A;  2KLX A;  1JLW A;  3FZ4 A;  3CTF A;  1ST9 A;  3TJK A;  2O89 A;  2B7J A;  3D4M A;  4GWR A;  3CMI A;  3GKM A;  1G0T A;  3NIV A;  2R4V A;  2E2M A;  2H30 A;  3IBH A;  1VF4 A;  1DE1 A;  4TR4 A;  2I9H A;  2VD1 A;  1E6B A;  4JZQ A;  5ECQ B;  2FWG A;  4ECJ A;  4Z7X A;  4JR6 A;  3IHQ A;  1EGO A;  2VUP A;  3FK8 A;  1UA5 A;  5B8A A;  1S3A A;  4HZ2 A;  5ENU A;  1I9D A;  3UBL A;  2L5O A;  1T1V A;  3DKS A;  2OBI A;  5IMF A;  4I2U A;  1N8J A;  2Z9S A;  2BJX A;  5ECS A;  5J4U A;  3CSI A;  2C3Q A;  2DJ1 A;  4HZ4 A;  4K6X A;  2VL3 A;  4GF0 A;  1G7O A;  2JZT A;  4EXJ A;  5G1L A;  4ML6 A;  3ZLP A;  2WCI A;  2KHP A;  1F6M C;  3BCK A;  4KGI A;  4BWQ A;  2K18 A;  3APQ A;  1AC1 A;  2JSY A;  4N0V A;  1WJK A;  2H74 A;  3BOA A;  3KGK A;  4WBR D;  3H93 A;  4MF7 A;  2H0G A;  2VLV A;  2YWO A;  4IGJ A;  4IP1 A;  2M80 A;  2H0I A;  2N5A A;  2CVD A;  2R37 A;  1TI1 A;  3ERW A;  3GUR A;  4AGS A;  2OE3 A;  5ID2 A;  4G2E A;  4YQM A;  5E4W A;  1QFN A;  16GS A;  2HT9 A;  5GAP D;  2PVO C;  1R26 A;  1CQH A;  2X8H A;  2YOI A;  1B9Y C;  2WJU A;  2G2Q A;  3HY2 A;  3Q18 A;  1GSQ A;  1GSY A;  3NZN A;  2C80 A;  5J9C A;  1FO5 A;  4I97 A;  4X43 A;  5CP1 A;  3ME7 A;  4TR0 A;  1ERW A;  3H1N A;  2AV4 A;  5HR0 A;  2P0G A;  1R5A A;  2PBJ A;  3CXG A;  4MJE A;  3FKF A;  3ZIJ A;  4KUN A;  1XW9 A;  2NVL A;  2PER A;  6GSU A;  3I43 A;  4NWY A;  2C0F A;  1WPI A;  3US3 A;  1GSU A;  3P7X A;  1S3D A;  3GL3 A;  4HU9 A;  3G9B A;  4H86 A;  1UVZ A;  2KUC A;  1U87 A;  4CDO A;  1GNE A;  4WKW A;  3KH9 A;  2F8F A;  3G7I A;  4NV2 A;  2CV4 A;  1YKA A;  2HLS A;  3J7Y b;  3KH7 A;  11GS A;  3ISO A;  3LEF A;  2GGT A;  4CHS A;  3GNJ A;  1EOG A;  5IOW A;  1XW5 A;  2I4A A;  1GH2 A;  4P3Y B;  3KD0 A;  2WZ9 A;  2YP6 A;  5ECL B;  3SWL A;  5ECP B;  4WXT A;  2C3T A;  2YV9 A;  4DSR A;  1YKC A;  2XBQ A;  3ZVJ A;  4WF5 A;  1TI3 A;  3HKR A;  2F9S A;  2FA8 A;  1N2A A;  4J57 E;  1K3O A;  2VOC A;  2NPB A;  1ZYE A;  3IPZ A;  2H1D A;  1ZMA A;  1FW1 A;  2QC7 A;  1FHE A;  3CYN A;  3RPP A;  1AAZ A;  1HNA A;  4L8E A;  3KP8 A;  3IK9 A;  2MZC A;  2X8C A;  1BQ7 A;  4ML1 A;  2AAW A;  1Y25 A;  5EPF A;  3F3Q A;  1B4Q A;  3KTL A;  1H4O A;  1KEB A;  5J9B A;  3U5R E;  3LXT A;  3GUS A;  1CQG A;  4AJ6 A;  4ZL8 A;  18GS A;  1X0R A;  4EDY A;  2FHE A;  2VM2 A;  4IQA A;  1MTC A;  5A4V A;  1SL1 B;  1A0R P;  4TOP A;  3QPM A;  2GQM A;  2BMX A;  1TRW A;  4Q5F A;  4JRR A;  4J56 E;  3ZFL A;  2JSZ A;  3EE2 A;  3O76 A;  1WOU A;  1OE8 A;  5LNK e;  2A2R A;  2GQL A;  3GKK A;  2HFD A;  4EO3 A;  3IAS 2;  3C1S A;  3VWX A;  5IM9 A;  2NTO A;  4NPB A;  4POL A;  1A2M A;  1GP1 A;  1BG5 A;  1XXU A;  4ULX A;  4F0B A;  4OCF A;  3QMX A;  2H6Y A;  4GRF A;  4I8B A;  4FIW A;  1OC9 A;  2GLR A;  2O7K A;  2V6O A;  2IMI A;  2AJQ B;  3RPN A;  1XFL A;  2R6K A;  4F0C A;  20GS A;  2V6K A;  1XWG A;  4TXV A;  1G6W A;  2FUG 2;  4F2I A;  2R3X A;  2H01 A;  3APO A;  1JZW A;  1QMV A;  1TDI A;  5JCG A;  1WP0 A;  4KCA A;  3IOS A;  6GSW A;  2LV3 A;  2VCV A;  1Z9H A;  2YWN A;  1K0A A;  1HYU A;  3ZL5 A;  5ABR A;  3VWW A;  3A5W A;  3WT2 A;  4ECC A;  1ML6 A;  2JAD A;  1O6J A;  3PGT A;  2R2J A;  1TRU A;  2QKE A;  2YV7 A;  2IMK A;  3M1G A;  1NW2 A;  2E2G A;  4K8M A;  4TR1 A;  1SKS B;  2KP1 A;  2MMN A;  1TK5 B;  4WEY A;  3M9K A;  4K0N A;  1BJX A;  3WGX A;  1ON4 A;  1K0N A;  3LGC A;  1EGR A;  2ZUP A;  2CVK A;  2E0Q A;  2X64 A;  4IS0 A;  5A4W A;  1BED A;  4KA0 A;  2TRC P;  3GSS A;  3TKR A;  2RM5 A;  1ERV A;  1A23 A;  4KND A;  2N5B A;  1TXX A;  1U88 A;  2HE3 A;  1ERT A;  2LS5 A;  4BVY A;  4MZW A;  1GUK A;  3VFI A;  5B6M A;  3QAV A;  3GX8 A;  4TVE A;  3UIW A;  3APS A;  2DC5 A;  4PQH A;  4WET A;  4MK3 A;  1KBN A;  2HZE A;  2I3Y A;  5ID2 B;  4MPG A;  4NV5 A;  9GSS A;  4PGT A;  3F4S A;  5INY A;  5DCG A;  1BAY A;  1SK2 A;  1FB0 A;  3Q74 A;  4ZBB A;  4N11 A;  13GS A;  3HJP A;  2PN8 A;  2PVQ A;  4XTS A;  4IP6 A;  4ECI A;  3LOR A;  2E7P A;  1M9A A;  2CZ2 A;  4N10 A;  2JU5 A;  4K0G A;  3LYK A;  3LYP A;  1ZGN A;  3RHB A;  1XBS A;  2H1A A;  2LJK A;  2H76 A;  4KE3 A;  1GUM A;  3KJY A;  1EWX A;  2LEG A;  2VCZ A;  4XRD A;  2HZF A;  3MAK A;  5A4U A;  5D93 A;  2GDR A;  4YQV A;  2DBC A;  1M2B A;  3GST A;  2VIM A;  1X9M B;  4MP4 A;  2DJK A;  3D6I A;  1TU7 A;  3I9V 2;  4DSQ A;  1KNG A;  4HEA 2;  1DUG A;  4XIH A;  1K3Y A;  3GN3 A;  3ZML A;  1T4Z A;  2LTK A;  1W89 A;  2XC2 A;  6GSY A;  2RM6 A;  1MDK A;  2AUV A;  3GTU A;  1Z3E A;  3DGQ A;  3UEM A;  1M99 A;  5ECN B;  3QDN A;  3QCP A;  5DCH A;  5D8I A;  1MEK A;  2MYG A;  2H0H A;  2FD3 A;  2IME A;  3H8Q A;  1XWC A;  5C00 A;  1ZOF A;  3F6D A;  1PA3 A;  4JE1 A;  4WF4 A;  3FZ9 A;  2VLU A;  4IHU A;  2R5G A;  4KDX A;  4IEL A;  4ZIL A;  2H6X A;  3NOF A;  1AUC A;  5G30 A;  4NMU A;  3CSH A;  4EC0 A;  3TUE A;  2FWF A;  2GSR A;  4RQR A;  4PQI A;  8GSS A;  1XZO A;  3TOU A;  5A5K A;  2LQQ A;  1B48 A;  1URM A;  4ZBD A;  1PKW A;  22GS A;  1K0B A;  2MMZ A;  4PUF C;  5F07 A;  2IN3 A;  2EIO A;  1M2D A;  3LXZ A;  5IPH A;  2OJL A;  4FYU A;  1HNB A;  5IMV A;  2PMT A;  4V2L A;  3KTB A;  1QUW A;  1PRX A;  4XRA A;  1HQO A;  2BTO T;  4NXI A;  1LBK A;  1W4V A;  4RUV A;  2XPD A;  4YQU A;  1A2J A;  2JZS A;  4ILF A;  3F9U A;  1MDI A;  4OMV A;  1DBY A;  5AIV A;  3QR6 A;  1JZO A;  1O8W A;  4ISD A;  4GCI A;  4TN8 A;  4RI6 A;  1Z6N A;  4GSS A;  4MF6 A;  5LD0 A;  1T7P B;  2MBT A;  1X9S B;  2LJA A;  3U6V A;  2GZY A;  4WR5 A;  1M2A A;  1TU8 A;  2H75 A;  4QL7 A;  4BPY A;  4IJ3 A;  3W8J A;  3FRC A;  4IJI A;  2GT5 A;  2JZR A;  2O87 A;  1F3B A;  4ZXG A;  3CSJ A;  4EUY A;  3Q19 A;  2CAI A;  1I5G A;  1WRY A;  2YWI A;  1OC9 B;  2L59 A;  4N0Z A;  3CTG A;  1YF1 A;  4MJA A;  5ECK B;  2MBS A;  1YDK A;  1FG4 A;  1EP7 A;  5J3R A;  2GZZ A;  3Q6O A;  5B6N A;  2HRF A;  3ZRD A;  1XW6 A;  2ALB A;  3FZA A;  1WWJ A;  4V1A p;  2YNX A;  2FNO A;  5H5Q A;  4XS4 A;  4Q5N A;  1AW9 A;  1U6T A;  2NBS A;  1RK4 A;  3KZQ A;  3HHV A;  1TJD A;  2VL2 A;  4HOJ A;  3F3R A;  3FZ5 A;  4L5O A;  2YJ7 A;  1B9X C;  3HVX A;  2WGR A;  1K0D A;  2CX4 A;  4PNG A;  1GSD A;  2B1L A;  4QQ7 A;  5ECO B;  1AQX A;  1YQ1 A;  3O3T A;  3A2X A;  2C4J A;  2IJY A;  2A2S A;  2O85 A;  3GMF A;  1SJI A;  4TR1 B;  3LG6 A;  2B5X A;  4F9Z A;  2GQK A;  1QGV A;  2IWT A;  5DAK B;  3UJ1 A;  1EEJ A;  1T3B A;  4HJM A;  2H66 A;  4ACS A;  4I2T A;  5D9T A;  4XS1 A;  3HD5 A;  1JZD A;  2I1U A;  2LRT A;  1J0F A;  1GWC A;  4QL9 A;  1O81 A;  4EVM A;  1Z6M A;  1ZZY A;  2J23 A;  1K0M A;  1SEN A;  4DSS A;  3DYR A;  4RQX A;  2IFQ A;  4LL1 B;  6GSS A;  1E2Y A;  5F0G A;  3TKS C;  4KSO A;  3L78 A;  4ZB9 A;  2IIY A;  1XCC A;  2QGV A;  2L57 A;  3ME8 A;  3F4T A;  5F8B A;  5DJL A;  3P90 A;  3F4R A;  2X8G A;  3L4N A;  4V2M A;  3VK9 A;  1EV9 A;  5DQS A;  3IDV A;  3KCM A;  3UVH A;  1THO A;  4K7N A;  4L0W A;  1EZK A;  2HZE B;  1V98 A;  4X1U A;  3LJR A;  5CO3 A;  5ECR B;  4ID0 A;  2FWH A; 
#chains in the Genus database with same CATH topology
 5AGY A;  1YJ6 A;  1AIU A;  4HUA A;  1YEP A;  1DSB A;  5ECH B;  1R7H A;  3FY7 A;  1TRS A;  3C71 A;  4OCE A;  3QD9 A;  1JZR A;  6GST A;  4OFT A;  2V1M A;  2VCQ A;  1ERU A;  2NDO A;  1WIK A;  4TKY A;  4GSN A;  4AJ8 A;  5HR3 A;  2AHE A;  2ON5 A;  4YKG A;  1F2E A;  1SD9 A;  2HNL A;  3UVT A;  2DJ3 A;  1TK0 B;  4DVC A;  3N9J A;  5GST A;  2OAC A;  3IR4 A;  4KSM A;  4TR3 A;  1G6Y A;  2YPM A;  3TOT A;  2B5Y A;  4WR4 A;  2VCW A;  3VWU A;  3WT1 A;  5J41 A;  1GTB A;  3VPT A;  2RUF A;  4NAX A;  2CT6 A;  3D5J A;  2C8U A;  3L0H A;  2OAD A;  1NSW A;  1J9B A;  1BYE A;  3RDW A;  1MDJ A;  2XPE A;  3GTU B;  3HJM A;  5G2Z A;  4IVF A;  2YZH A;  2OA7 A;  3FHK A;  4AF2 A;  2YJH A;  2HSY A;  1SYR A;  4Z2R A;  3KXO A;  3GKN A;  3BJ5 A;  4IW9 A;  1XOB A;  4POB A;  1GRX A;  1SKR B;  4Q5R A;  1PKZ A;  2YN1 A;  3UAP A;  1J08 A;  2P31 A;  1T4Y A;  1GLQ A;  5L71 A;  2OE0 A;  4KF9 A;  3BD2 A;  2RUE A;  2HSH A;  1LJR A;  4MPF A;  1T00 A;  4LMW A;  2FLS A;  2FY6 A;  19GS A;  2ZNM A;  1H75 A;  2H72 A;  3GV1 A;  5EL8 A;  1ILO A;  1OC8 A;  4PUA A;  5D9W A;  14GS A;  4XHM A;  2H1B A;  5KN2 A;  4OFN A;  1XIY A;  4IN0 A;  5ELG A;  3KM6 A;  2DMM A;  1M9B A;  3GKX A;  5LCZ A;  1Z7R A;  2CA8 A;  1TRV A;  5DDL A;  3WYW A;  2XBI A;  3DWV A;  1MD4 A;  1QQ2 A;  3EPT A;  5HFG A;  5AIX A;  5AN1 A;  3HXS A;  1OC3 A;  4EIQ A;  3EUR A;  1VF2 A;  2A2P A;  4XCS A;  5DAK A;  4K5S A;  3VUR A;  2VM1 A;  2LKU A;  1BX9 A;  3C8E A;  2CVB A;  2C3N A;  4TW5 A;  4JED A;  3GH6 A;  1NHY A;  1PD2 1;  2B7K A;  3WGD A;  3KEB A;  1B4P A;  2LJR A;  3SBC A;  2A4V A;  1YZX A;  1TKD B;  3GFK A;  3DEX A;  5ECM B;  3GRX A;  3R2Q A;  1LU4 A;  5IIZ A;  5J5N A;  2EIQ A;  2X99 A;  3TKS A;  1OAZ A;  5H5S A;  5JCW A;  4KDU A;  2B6M A;  6GSX A;  1FAA A;  3C1R A;  2H8L A;  1F3A A;  5G31 A;  1SL2 B;  1GTI A;  1O85 A;  3F0I A;  3EYT A;  4BWS A;  2CQ9 A;  4ZIJ A;  3ZFB A;  3VLN A;  3MDK A;  2PPT A;  5G1K A;  4LL4 B;  4HQS A;  3DRN A;  4L0U A;  1FB6 A;  1R5P A;  2GST A;  3AY8 A;  3VI5 A;  1GSF A;  5CAX A;  2JL4 A;  2PGT A;  6GSV A;  3DD3 A;  3ED3 A;  1XWA A;  1PX7 A;  3JCM L;  2WRT A;  4XS4 B;  1HNC A;  1JFU A;  1QK8 A;  2P5R A;  3N5O A;  4G10 A;  2K9F A;  2RII A;  1ABA A;  1FVK A;  3D21 A;  4MZC A;  2VL2 C;  3W8S A;  1Z7P A;  3F8U A;  4KH7 A;  4D73 B;  3PPU A;  4MJC A;  5CYY A;  4MH2 A;  5JCU A;  1XG8 A;  1PL1 A;  3HYP A;  2RLI A;  3HZ4 A;  1SL0 B;  3MNG A;  3PR8 A;  1V58 A;  1EP8 A;  3TRX A;  1V57 A;  2KP2 A;  3KMN A;  4EL1 A;  3GH9 A;  4KAE A;  3M9J A;  2HYX A;  1WMJ A;  4USS A;  5IMD A;  2WB9 A;  3P2A A;  4AJ7 A;  4J2F A;  1TP9 A;  3MIX A;  5DAL A;  4K2X A;  3E0U A;  2H19 A;  2GTU A;  2HI7 A;  3LQ7 A;  3M0F A;  5C04 A;  4OFM A;  5IQY A;  5JWR B;  3EIN A;  1TK8 B;  3TRQ A;  4DSS B;  2AYT A;  4GXZ A;  2IFQ B;  3ZYW A;  2J9H A;  1Q98 A;  5FT3 A;  2HSM A;  5B8B A;  3FR6 A;  2M72 A;  1A8L A;  5IPG A;  1GTU A;  4LLR A;  4Z2U A;  4PQ1 A;  3VWV A;  4HI7 A;  1ZYQ B;  1PX6 A;  1DE2 A;  2OE1 A;  5HR2 A;  3W6G A;  2FGX A;  5KN0 A;  1A2L A;  3EC3 A;  5FHI A;  4PX1 A;  5EVO A;  2OBK A;  1SU9 A;  1IYI A;  4I5Q A;  5KN1 A;  2IMD A;  3GL5 A;  1JHB A;  3TJG A;  1S3C A;  2QSI A;  2TIR A;  2EC4 A;  4KW6 A;  1XWK A;  3IRA A;  1A8Y A;  2LQO A;  2DSA A;  5E59 A;  3QOU A;  3D4T A;  3ZMK A;  1A24 A;  2PU9 C;  2WUL A;  2WS2 A;  1O8X A;  3FEU A;  4GQC A;  2HXK A;  1U3I A;  3IE3 A;  4MZB A;  4PTS A;  1GSS A;  3EU4 A;  3IK7 A;  2B1K A;  2IPA A;  1SKW B;  5GAN D;  2L6D A;  5H5R A;  1GLP A;  2O8V B;  5IMC A;  2DKH A;  4MCU A;  4EKZ A;  5COH A;  1X5C A;  3HVN A;  1WE0 A;  5KN3 A;  3DXB A;  1EEM A;  2LRC A;  2G0F A;  1XVQ A;  4YAP A;  4ZB6 A;  4HSC X;  5HFI A;  3OR5 A;  5CRE A;  3H4K A;  1ZYN A;  4O7H A;  4DEJ A;  2H6Z A;  3D0Z A;  4OO4 A;  1RQM A;  1M3I A;  4G19 A;  2VD0 A;  5IO2 A;  1GUL A;  3FR3 A;  4ZB8 A;  1C72 A;  3TJF A;  2L4C A;  5IMA A;  4EE0 A;  4O92 A;  4K7I A;  3TJJ A;  2R0P A;  1K0C A;  4NHW A;  3ERG A;  7GSS A;  1U3A A;  2DJ0 A;  2UZ8 A;  3KMO A;  2MMO A;  4V2N A;  2WFC A;  5JWO B;  1PQN A;  3TB2 A;  2VCX A;  2L6C A;  2HRN A;  4D73 A;  1Z5Y E;  3P8W A;  1PGT A;  3HJO A;  2ES7 A;  3RAZ A;  5JWQ B;  2HRK A;  2TRX A;  2H71 A;  4BVX B;  2GSQ A;  4HU7 A;  3QFB C;  4Z2T A;  2CAQ A;  5HFK A;  2DLX A;  2PWJ A;  4K9Z A;  3MWH A;  4O5R A;  10GS A;  4HJ2 A;  3TGZ A;  4GQF A;  2KOK A;  3O6T A;  5B7C A;  3VPQ A;  2C1Y A;  4GLT A;  3HDC A;  1THX A;  2V2G A;  3FYG A;  3DVX A;  1G7E A;  2GVP A;  5KEJ A;  2YZU A;  1PFO A;  3DML A;  4K7O A;  1SJ6 A;  2PUK C;  1V40 A;  2FWE A;  1OVN A;  2DIY A;  2F8A A;  1VF3 A;  2VO4 A;  3C73 A;  5D96 A;  2K6V A;  2VL9 A;  1V2A A;  2DML A;  5KOW A;  3GHA A;  3E9J B;  5FWG A;  3ZVJ D;  2GS3 A;  3BBY A;  5ECI B;  2LNT A;  4X0X A;  3GX0 A;  2DJ2 A;  4GST A;  1OYJ A;  4TXO A;  3IC8 A;  2V32 A;  1XPV A;  1SK1 A;  4TRX A;  2C0E A;  5CRW A;  2V41 A;  1M7T A;  4FO5 A;  4KB3 A;  5DVB A;  4CW9 A;  2YCD A;  5CRH A;  2DIZ A;  2MMA A;  4K1F A;  4MLY A;  3LWA A;  4BA7 A;  2VCT A;  4ECB A;  3L9S A;  5G5F A;  2ON7 A;  4FYB A;  2I81 A;  4FH8 A;  5D73 A;  3L9U A;  4E8H A;  2WDU A;  1AQW A;  2LRN A;  4KDY A;  1AQV A;  4HS1 A;  3FMW A;  4YH2 A;  1AXD A;  1GTA A;  5DJM A;  1GNW A;  1KTE A;  1GSE A;  1GUH A;  4KCE A;  3HZ8 A;  1ZL9 A;  3IXR A;  2X49 A;  2H70 A;  4MDC A;  1GL8 A;  5D9V A;  3M8N A;  1YF0 A;  4MF5 A;  2M46 A;  3UL3 A;  1F9M A;  4OWY A;  1Q4J A;  1UN2 A;  4O32 A;  2C0D A;  4HQZ A;  3CBU A;  3TKS E;  3FW2 A;  4JBB A;  2P5Q A;  4PXO A;  1PMT A;  4E8E A;  4WBJ A;  3ZIT A;  4EDZ A;  3EU3 A;  1Y6E A;  3K8N A;  5IMZ A;  2YAN A;  1YY7 A;  3TKQ A;  3F63 A;  3I69 A;  3LSZ A;  1VF1 A;  2IMF A;  2VLT A;  1SYX A;  1TW9 A;  4N30 A;  5DQY A;  3ZIV A;  4MH3 A;  3EVI A;  3V1W A;  2B3S A;  5DAL B;  4F82 A;  5CRG A;  4JU5 A;  2LUS A;  2HRA A;  4MJB A;  4L5L A;  3D22 A;  4FYC A;  3TCO A;  1SK0 A;  3G7J A;  1EOH A;  1RW1 A;  2N5F A;  4CY8 A;  3EMX A;  5F06 A;  3TKP A;  1OE7 A;  2H73 A;  4V1A g;  1UC7 A;  1JLV A;  3KP9 A;  3GYK A;  3HVV A;  3LW9 A;  4OD7 A;  3QAG A;  4XS6 A;  2GZP A;  1FVJ A;  1K3L A;  3BCI A;  5DBQ A;  1XVW A;  3VI7 A;  3DVW A;  5ELA A;  4BVX A;  5D9X A;  3PH9 A;  3ZZX A;  3A2V A;  3IV4 A;  1M0U A;  2L4Q A;  4LMV A;  3ZRE A;  3HVS A;  3HCZ A;  1A0F A;  5G5E A;  5HR1 A;  2ZCT A;  3KIJ A;  3QFA C;  4ZL9 A;  1QXH A;  2LST A;  3IAM 2;  2LNS A;  4CY6 A;  3CRU A;  3E3E A;  3TRP A;  4LA1 A;  1IYH A;  4PUR A;  5IOX A;  3UOM A;  1USB A;  2FCH A;  5IO0 A;  2B5E A;  1X5D A;  1FOV A;  4MA9 A;  3A5I A;  1PL2 A;  2L5L A;  4G9H A;  3PIN A;  4JR4 A;  3LFL A;  2XHF A;  1TOF A;  3F6F A;  2CZ3 A;  3ERF A;  3GA4 A;  1O73 A;  3H79 A;  4IBP A;  3A3T A;  4ZL7 A;  4KX4 A;  1X9W B;  2GT6 A;  3HA9 A;  4OO5 A;  1O7U A;  2C0G A;  1OKD A;  4IQ1 A;  3TJB A;  5HQP A;  4K5R A;  1V9W A;  3RHC A;  3MSZ A;  3L9V A;  4K2D A;  3G7Y A;  4BL7 A;  3IHG A;  2D2Z A;  4PNF A;  2K8V A;  4HDE A;  3CRT A;  1F37 A;  3UBK A;  1T8E B;  5EY6 A;  1OKT A;  2REM A;  1M3J A;  4POM A;  2FA4 A;  4Q5Q A;  1HD2 A;  3EWL A;  3WGE A;  17GS A;  3IA1 A;  1SD8 A;  5F05 A;  4I6X A;  3J7Y k;  2K8S A;  4G0L A;  4EF0 A;  2YWM A;  1TTZ A;  1ACV A;  3S9F A;  2EIR A;  4GTU A;  1EV4 A;  1NHO A;  4MMM A;  2OKA A;  3C7M A;  5CRD A;  1NM3 A;  4POK A;  2JAC A;  4YAV A;  3EMP A;  12GS A;  2AB6 A;  2F51 A;  4NHZ A;  5AIS A;  4O5Q A;  5CNW A;  4F03 A;  3GIX A;  3IC4 A;  3RBT A;  3TDG A;  4MAB A;  3FR9 A;  1SJZ A;  1XOA A;  3UMA A;  3ZTL A;  1VGL A;  2DJJ A;  1X5E A;  2GSS A;  1MD3 A;  1PSQ A;  1VRS D;  1XWB A;  2H1G A;  1ZCP A;  1R4W A;  3QAW A;  3UAR A;  1YEX A;  3I6A A;  5GZZ B;  1PN9 A;  2X4A A;  5GSS A;  2VAF A;  4G0I A;  2IL3 A;  1K0O A;  4IKH A;  4RI7 A;  5KOX A;  4ZBA A;  3DIE A;  2CX3 A;  4TXO B;  3A2W A;  2F3M A;  3WD6 A;  3M3M A;  1B8X A;  2KLX A;  1JLW A;  3FZ4 A;  3CTF A;  1ST9 A;  3TJK A;  2O89 A;  2B7J A;  4ICY A;  3D4M A;  4GWR A;  3CMI A;  3GKM A;  1G0T A;  3NIV A;  2R4V A;  2E2M A;  2H30 A;  3IBH A;  1VF4 A;  5BRT A;  1DE1 A;  4TR4 A;  2I9H A;  2VD1 A;  1E6B A;  4JZQ A;  5ECQ B;  2FWG A;  4ECJ A;  4Z7X A;  4JR6 A;  3IHQ A;  1EGO A;  2VUP A;  3FK8 A;  4BIK A;  1UA5 A;  5B8A A;  1S3A A;  4HZ2 A;  5ENU A;  1I9D A;  3UBL A;  2L5O A;  1T1V A;  3DKS A;  2OBI A;  5IMF A;  4I2U A;  1N8J A;  2Z9S A;  2BJX A;  5ECS A;  5J4U A;  3CSI A;  2C3Q A;  2DJ1 A;  4HZ4 A;  4K6X A;  2VL3 A;  4GF0 A;  1G7O A;  2JZT A;  4EXJ A;  5G1L A;  4ML6 A;  3ZLP A;  2WCI A;  2KHP A;  1F6M C;  3BCK A;  4KGI A;  4BWQ A;  2K18 A;  3APQ A;  1AC1 A;  2JSY A;  4N0V A;  1WJK A;  2H74 A;  3BOA A;  3KGK A;  4WBR D;  3MYD A;  3H93 A;  4MF7 A;  2H0G A;  2VLV A;  2YWO A;  4IGJ A;  4IP1 A;  2M80 A;  2H0I A;  2N5A A;  2CVD A;  2R37 A;  1TI1 A;  3ERW A;  3GUR A;  4AGS A;  2OE3 A;  5ID2 A;  4G2E A;  2QA1 A;  4YQM A;  1QFN A;  5E4W A;  16GS A;  2HT9 A;  5GAP D;  2PVO C;  1R26 A;  1CQH A;  2X8H A;  2YOI A;  1B9Y C;  2WJU A;  2G2Q A;  3HY2 A;  2R0G A;  3Q18 A;  1GSQ A;  1GSY A;  3NZN A;  2C80 A;  5J9C A;  1FO5 A;  4I97 A;  4X43 A;  5CP1 A;  3ME7 A;  4TR0 A;  1ERW A;  3H1N A;  2AV4 A;  5HR0 A;  2P0G A;  1R5A A;  2PBJ A;  3CXG A;  4MJE A;  3FKF A;  3ZIJ A;  4KUN A;  1XW9 A;  2NVL A;  2PER A;  6GSU A;  3I43 A;  4NWY A;  2C0F A;  1WPI A;  3US3 A;  1GSU A;  3P7X A;  1S3D A;  3GL3 A;  4HU9 A;  3G9B A;  4H86 A;  1UVZ A;  2KUC A;  1U87 A;  1FOH A;  4CDO A;  1GNE A;  4WKW A;  3KH9 A;  2F8F A;  3G7I A;  4NV2 A;  2CV4 A;  1YKA A;  2HLS A;  3J7Y b;  3KH7 A;  11GS A;  3ISO A;  3LEF A;  2GGT A;  4CHS A;  3GNJ A;  1EOG A;  5IOW A;  1XW5 A;  2I4A A;  1GH2 A;  4P3Y B;  3KD0 A;  2WZ9 A;  2YP6 A;  5ECL B;  3SWL A;  5ECP B;  4WXT A;  2C3T A;  2YV9 A;  4DSR A;  1YKC A;  2XBQ A;  3ZVJ A;  4WF5 A;  1TI3 A;  3HKR A;  2F9S A;  2FA8 A;  4BVY B;  1N2A A;  4J57 E;  1K3O A;  2VOC A;  2NPB A;  1ZYE A;  3IPZ A;  4BL7 B;  2H1D A;  1ZMA A;  1FW1 A;  2QC7 A;  1FHE A;  3CYN A;  3RPP A;  1AAZ A;  1HNA A;  4L8E A;  3KP8 A;  3IK9 A;  2MZC A;  2X8C A;  1BQ7 A;  4ML1 A;  2AAW A;  1Y25 A;  5EPF A;  3F3Q A;  1B4Q A;  3KTL A;  1H4O A;  1KEB A;  5J9B A;  3U5R E;  3LXT A;  3GUS A;  1CQG A;  4AJ6 A;  4ZL8 A;  18GS A;  4FQU A;  1X0R A;  4EDY A;  2FHE A;  2VM2 A;  4IQA A;  1MTC A;  5A4V A;  1SL1 B;  5BMU A;  1A0R P;  1PN0 A;  4TOP A;  3QPM A;  2GQM A;  2BMX A;  1TRW A;  4Q5F A;  4JRR A;  4J56 E;  3ZFL A;  2JSZ A;  3EE2 A;  3O76 A;  1WOU A;  1OE8 A;  5LNK e;  2A2R A;  2GQL A;  3GKK A;  2HFD A;  4EO3 A;  3IAS 2;  3C1S A;  3VWX A;  5IM9 A;  2NTO A;  4NPB A;  4POL A;  1A2M A;  1GP1 A;  1BG5 A;  1XXU A;  4ULX A;  4F0B A;  4OCF A;  3QMX A;  2H6Y A;  4GRF A;  4I8B A;  4FIW A;  1OC9 A;  2GLR A;  2O7K A;  2V6O A;  2IMI A;  4G0K A;  2AJQ B;  3RPN A;  1XFL A;  2R6K A;  4EIP A;  4F0C A;  20GS A;  2V6K A;  1XWG A;  4TXV A;  1ZYP A;  1G6W A;  2FUG 2;  4F2I A;  2R3X A;  2H01 A;  3APO A;  1JZW A;  1QMV A;  1TDI A;  5JCG A;  1WP0 A;  4KCA A;  3IOS A;  6GSW A;  2LV3 A;  2VCV A;  1Z9H A;  2YWN A;  1K0A A;  1HYU A;  3ZL5 A;  5ABR A;  3VWW A;  3A5W A;  3WT2 A;  4ECC A;  1ML6 A;  2JAD A;  1O6J A;  3PGT A;  2R2J A;  1TRU A;  2QKE A;  2YV7 A;  2IMK A;  3M1G A;  1NW2 A;  2E2G A;  4K8M A;  4TR1 A;  1SKS B;  2KP1 A;  2MMN A;  1TK5 B;  4WEY A;  3M9K A;  4K0N A;  1BJX A;  3WGX A;  1ON4 A;  2A4H A;  1K0N A;  3LGC A;  1EGR A;  2ZUP A;  2CVK A;  2E0Q A;  2X64 A;  4IS0 A;  5A4W A;  1BED A;  4KA0 A;  2TRC P;  3GSS A;  3TKR A;  2RM5 A;  1ERV A;  1A23 A;  4KND A;  2N5B A;  1TXX A;  1U88 A;  2HE3 A;  1ERT A;  2LS5 A;  4BVY A;  4MZW A;  1GUK A;  3VFI A;  5B6M A;  3QAV A;  3GX8 A;  4MNN A;  4TVE A;  3UIW A;  3APS A;  2DC5 A;  4PQH A;  4WET A;  4MK3 A;  1KBN A;  2HZE A;  2I3Y A;  5ID2 B;  4MPG A;  4NV5 A;  9GSS A;  4PGT A;  3F4S A;  5INY A;  5DCG A;  1BAY A;  1SK2 A;  1FB0 A;  3Q74 A;  4ZBB A;  4N11 A;  13GS A;  3HJP A;  2PN8 A;  2PVQ A;  4XTS A;  4IP6 A;  4ECI A;  3LOR A;  2E7P A;  1M9A A;  2CZ2 A;  4N10 A;  2JU5 A;  4K0G A;  3LYK A;  3LYP A;  4A5P A;  1ZGN A;  3RHB A;  1XBS A;  2H1A A;  2LJK A;  2H76 A;  4KE3 A;  1GUM A;  3KJY A;  1EWX A;  2LEG A;  2VCZ A;  4XRD A;  2HZF A;  3MAK A;  5A4U A;  5D93 A;  2GDR A;  4YQV A;  2DBC A;  1M2B A;  3GST A;  2VIM A;  1X9M B;  4MP4 A;  2DJK A;  3D6I A;  1TU7 A;  1S3R A;  3I9V 2;  4DSQ A;  1KNG A;  4HEA 2;  1DUG A;  4XIH A;  1K3Y A;  3GN3 A;  3ZML A;  1T4Z A;  2LTK A;  1W89 A;  2XC2 A;  6GSY A;  2RM6 A;  1MDK A;  2AUV A;  3GTU A;  1Z3E A;  3DGQ A;  3UEM A;  1M99 A;  5ECN B;  3QDN A;  2DKI A;  2R0C A;  3QCP A;  2QA2 A;  5DCH A;  5D8I A;  1MEK A;  2MYG A;  2H0H A;  2FD3 A;  2IME A;  3H8Q A;  1XWC A;  5C00 A;  1ZOF A;  3F6D A;  1PA3 A;  4JE1 A;  4WF4 A;  3FZ9 A;  2VLU A;  4IHU A;  2R5G A;  4KDX A;  4IEL A;  4ZIL A;  2H6X A;  3NOF A;  1AUC A;  5G30 A;  4NMU A;  3CSH A;  4EC0 A;  3TUE A;  2FWF A;  2GSR A;  4RQR A;  4PQI A;  8GSS A;  1XZO A;  3TOU A;  5A5K A;  2LQQ A;  1B48 A;  1URM A;  4ZBD A;  1PKW A;  3R3E A;  22GS A;  1K0B A;  4YKF A;  2MMZ A;  4PUF C;  5F07 A;  2IN3 A;  2EIO A;  1M2D A;  3LXZ A;  5IPH A;  2OJL A;  4FYU A;  1HNB A;  5IMV A;  2PMT A;  4V2L A;  3KTB A;  1QUW A;  1PRX A;  4XRA A;  1HQO A;  2BTO T;  4NXI A;  1LBK A;  1W4V A;  4RUV A;  2XPD A;  4YQU A;  1A2J A;  2JZS A;  4ILF A;  3F9U A;  1MDI A;  4OMV A;  1DBY A;  5AIV A;  3QR6 A;  1JZO A;  1O8W A;  4ISD A;  4GCI A;  4TN8 A;  4RI6 A;  1Z6N A;  4GSS A;  4MF6 A;  5LD0 A;  1T7P B;  2MBT A;  1X9S B;  2LJA A;  3U6V A;  2GZY A;  4WR5 A;  1M2A A;  1TU8 A;  2H75 A;  4QL7 A;  4BPY A;  4IJ3 A;  3W8J A;  3FRC A;  4IJI A;  2GT5 A;  2JZR A;  2O87 A;  1F3B A;  4ZXG A;  3CSJ A;  4EUY A;  3Q19 A;  2CAI A;  1I5G A;  1WRY A;  2YWI A;  1OC9 B;  2L59 A;  4N0Z A;  3CTG A;  1YF1 A;  4MJA A;  5ECK B;  2MBS A;  1YDK A;  1FG4 A;  1EP7 A;  5J3R A;  2GZZ A;  3Q6O A;  5B6N A;  2HRF A;  3ZRD A;  1XW6 A;  2ALB A;  3FZA A;  1WWJ A;  4V1A p;  2YNX A;  2FNO A;  5H5Q A;  4XS4 A;  4Q5N A;  1AW9 A;  1U6T A;  2NBS A;  1RK4 A;  3KZQ A;  3HHV A;  1TJD A;  2VL2 A;  4HOJ A;  3F3R A;  3FZ5 A;  4L5O A;  2YJ7 A;  1B9X C;  3HVX A;  2WGR A;  1K0D A;  2CX4 A;  4PNG A;  1GSD A;  2B1L A;  4QQ7 A;  5ECO B;  1AQX A;  1YQ1 A;  3O3T A;  3A2X A;  2C4J A;  2IJY A;  2A2S A;  2O85 A;  4O5U A;  3GMF A;  1SJI A;  4TR1 B;  3LG6 A;  2B5X A;  4F9Z A;  2GQK A;  1QGV A;  2IWT A;  5DAK B;  3UJ1 A;  1EEJ A;  1T3B A;  4HJM A;  2H66 A;  4ACS A;  4I2T A;  5D9T A;  4XS1 A;  3HD5 A;  1JZD A;  2I1U A;  2LRT A;  1J0F A;  1GWC A;  4QL9 A;  1O81 A;  4EVM A;  1Z6M A;  1ZZY A;  2J23 A;  1K0M A;  1SEN A;  4DSS A;  3DYR A;  4RQX A;  2IFQ A;  4LL1 B;  6GSS A;  1E2Y A;  3CQF A;  5F0G A;  3TKS C;  4KSO A;  3L78 A;  4ZB9 A;  2IIY A;  1XCC A;  2QGV A;  2L57 A;  3ME8 A;  3F4T A;  5F8B A;  5DJL A;  3P90 A;  3F4R A;  2X8G A;  3L4N A;  4V2M A;  3VK9 A;  4X4J A;  1EV9 A;  5DQS A;  3IDV A;  3KCM A;  3UVH A;  1THO A;  4K7N A;  4L0W A;  1EZK A;  2HZE B;  1V98 A;  4X1U A;  3LJR A;  5CO3 A;  5ECR B;  4ID0 A;  2FWH A; 
#chains in the Genus database with same CATH homology
 5AGY A;  1YJ6 A;  1AIU A;  4HUA A;  1YEP A;  1DSB A;  5ECH B;  1R7H A;  3FY7 A;  1TRS A;  3C71 A;  4OCE A;  3QD9 A;  1JZR A;  6GST A;  4OFT A;  2V1M A;  2VCQ A;  1ERU A;  2NDO A;  1WIK A;  4TKY A;  4GSN A;  4AJ8 A;  5HR3 A;  2AHE A;  2ON5 A;  4YKG A;  1F2E A;  1SD9 A;  2HNL A;  3UVT A;  2DJ3 A;  1TK0 B;  4DVC A;  3N9J A;  5GST A;  2OAC A;  3IR4 A;  4KSM A;  4TR3 A;  1G6Y A;  2YPM A;  3TOT A;  2B5Y A;  4WR4 A;  2VCW A;  3VWU A;  3WT1 A;  5J41 A;  1GTB A;  3VPT A;  2RUF A;  4NAX A;  2CT6 A;  3D5J A;  2C8U A;  3L0H A;  2OAD A;  1NSW A;  1J9B A;  1BYE A;  3RDW A;  1MDJ A;  2XPE A;  3GTU B;  3HJM A;  5G2Z A;  4IVF A;  2YZH A;  2OA7 A;  3FHK A;  4AF2 A;  2YJH A;  2HSY A;  1SYR A;  4Z2R A;  3KXO A;  3GKN A;  3BJ5 A;  4IW9 A;  1XOB A;  4POB A;  1GRX A;  1SKR B;  4Q5R A;  1PKZ A;  2YN1 A;  3UAP A;  1J08 A;  2P31 A;  1T4Y A;  1GLQ A;  5L71 A;  2OE0 A;  4KF9 A;  3BD2 A;  2RUE A;  2HSH A;  1LJR A;  4MPF A;  1T00 A;  4LMW A;  2FLS A;  2FY6 A;  19GS A;  2ZNM A;  1H75 A;  2H72 A;  3GV1 A;  5EL8 A;  1ILO A;  1OC8 A;  4PUA A;  5D9W A;  14GS A;  4XHM A;  2H1B A;  5KN2 A;  4OFN A;  1XIY A;  4IN0 A;  5ELG A;  3KM6 A;  2DMM A;  1M9B A;  3GKX A;  5LCZ A;  1Z7R A;  2CA8 A;  1TRV A;  5DDL A;  3WYW A;  2XBI A;  3DWV A;  1MD4 A;  1QQ2 A;  3EPT A;  5HFG A;  5AIX A;  5AN1 A;  3HXS A;  1OC3 A;  4EIQ A;  3EUR A;  1VF2 A;  2A2P A;  4XCS A;  5DAK A;  4K5S A;  3VUR A;  2VM1 A;  2LKU A;  1BX9 A;  3C8E A;  2CVB A;  2C3N A;  4TW5 A;  4JED A;  3GH6 A;  1NHY A;  1PD2 1;  2B7K A;  3WGD A;  3KEB A;  1B4P A;  2LJR A;  3SBC A;  2A4V A;  1YZX A;  1TKD B;  3GFK A;  3DEX A;  5ECM B;  3GRX A;  3R2Q A;  1LU4 A;  5IIZ A;  5J5N A;  2EIQ A;  2X99 A;  3TKS A;  1OAZ A;  5H5S A;  5JCW A;  4KDU A;  2B6M A;  6GSX A;  1FAA A;  3C1R A;  2H8L A;  1F3A A;  5G31 A;  1SL2 B;  1GTI A;  1O85 A;  3F0I A;  3EYT A;  4BWS A;  2CQ9 A;  4ZIJ A;  3ZFB A;  3VLN A;  3MDK A;  2PPT A;  5G1K A;  4LL4 B;  4HQS A;  3DRN A;  4L0U A;  1FB6 A;  1R5P A;  2GST A;  3AY8 A;  3VI5 A;  1GSF A;  5CAX A;  2JL4 A;  2PGT A;  6GSV A;  3DD3 A;  3ED3 A;  1XWA A;  1PX7 A;  3JCM L;  2WRT A;  4XS4 B;  1HNC A;  1JFU A;  1QK8 A;  2P5R A;  3N5O A;  4G10 A;  2K9F A;  2RII A;  1ABA A;  1FVK A;  3D21 A;  4MZC A;  2VL2 C;  3W8S A;  1Z7P A;  3F8U A;  4KH7 A;  4D73 B;  3PPU A;  4MJC A;  5CYY A;  4MH2 A;  5JCU A;  1PL1 A;  3HYP A;  2RLI A;  3HZ4 A;  1SL0 B;  3MNG A;  3PR8 A;  1V58 A;  1EP8 A;  3TRX A;  1V57 A;  2KP2 A;  3KMN A;  4EL1 A;  3GH9 A;  4KAE A;  3M9J A;  2HYX A;  1WMJ A;  4USS A;  5IMD A;  2WB9 A;  3P2A A;  4AJ7 A;  4J2F A;  1TP9 A;  3MIX A;  5DAL A;  4K2X A;  3E0U A;  2H19 A;  2GTU A;  2HI7 A;  3LQ7 A;  3M0F A;  5C04 A;  4OFM A;  5IQY A;  5JWR B;  3EIN A;  1TK8 B;  3TRQ A;  4DSS B;  2AYT A;  4GXZ A;  2IFQ B;  3ZYW A;  2J9H A;  1Q98 A;  5FT3 A;  2HSM A;  5B8B A;  3FR6 A;  2M72 A;  1A8L A;  5IPG A;  1GTU A;  4LLR A;  4Z2U A;  4PQ1 A;  3VWV A;  4HI7 A;  1ZYQ B;  1PX6 A;  1DE2 A;  2OE1 A;  5HR2 A;  3W6G A;  2FGX A;  5KN0 A;  1A2L A;  3EC3 A;  5FHI A;  4PX1 A;  5EVO A;  2OBK A;  1SU9 A;  1IYI A;  4I5Q A;  5KN1 A;  2IMD A;  3GL5 A;  1JHB A;  3TJG A;  1S3C A;  2QSI A;  2TIR A;  2EC4 A;  4KW6 A;  1XWK A;  3IRA A;  1A8Y A;  2LQO A;  2DSA A;  5E59 A;  3QOU A;  3D4T A;  3ZMK A;  1A24 A;  2PU9 C;  2WUL A;  2WS2 A;  1O8X A;  3FEU A;  4GQC A;  2HXK A;  1U3I A;  3IE3 A;  4MZB A;  4PTS A;  1GSS A;  3EU4 A;  3IK7 A;  2B1K A;  2IPA A;  1SKW B;  5GAN D;  2L6D A;  5H5R A;  1GLP A;  2O8V B;  5IMC A;  2DKH A;  4MCU A;  4EKZ A;  5COH A;  1X5C A;  1WE0 A;  5KN3 A;  3DXB A;  1EEM A;  2LRC A;  2G0F A;  1XVQ A;  4YAP A;  4ZB6 A;  5HFI A;  3OR5 A;  5CRE A;  3H4K A;  1ZYN A;  4O7H A;  4DEJ A;  2H6Z A;  3D0Z A;  4OO4 A;  1RQM A;  4G19 A;  2VD0 A;  5IO2 A;  1GUL A;  3FR3 A;  4ZB8 A;  1C72 A;  3TJF A;  2L4C A;  5IMA A;  4EE0 A;  4O92 A;  4K7I A;  3TJJ A;  2R0P A;  1K0C A;  4NHW A;  3ERG A;  7GSS A;  1U3A A;  2DJ0 A;  2UZ8 A;  3KMO A;  2MMO A;  4V2N A;  2WFC A;  5JWO B;  1PQN A;  3TB2 A;  2VCX A;  2L6C A;  2HRN A;  4D73 A;  1Z5Y E;  3P8W A;  1PGT A;  3HJO A;  2ES7 A;  3RAZ A;  5JWQ B;  2HRK A;  2TRX A;  2H71 A;  4BVX B;  2GSQ A;  4HU7 A;  3QFB C;  4Z2T A;  2CAQ A;  5HFK A;  2DLX A;  2PWJ A;  4K9Z A;  3MWH A;  4O5R A;  10GS A;  4HJ2 A;  3TGZ A;  4GQF A;  2KOK A;  3O6T A;  5B7C A;  3VPQ A;  2C1Y A;  4GLT A;  3HDC A;  1THX A;  2V2G A;  3FYG A;  3DVX A;  1G7E A;  2GVP A;  5KEJ A;  2YZU A;  3DML A;  4K7O A;  1SJ6 A;  2PUK C;  1V40 A;  2FWE A;  1OVN A;  2DIY A;  2F8A A;  1VF3 A;  2VO4 A;  3C73 A;  5D96 A;  2K6V A;  2VL9 A;  1V2A A;  2DML A;  5KOW A;  3GHA A;  3E9J B;  5FWG A;  3ZVJ D;  2GS3 A;  3BBY A;  5ECI B;  2LNT A;  4X0X A;  3GX0 A;  2DJ2 A;  4GST A;  1OYJ A;  4TXO A;  3IC8 A;  2V32 A;  1XPV A;  1SK1 A;  4TRX A;  2C0E A;  5CRW A;  2V41 A;  1M7T A;  4FO5 A;  4KB3 A;  5DVB A;  4CW9 A;  2YCD A;  5CRH A;  2DIZ A;  2MMA A;  4K1F A;  4MLY A;  3LWA A;  4BA7 A;  2VCT A;  4ECB A;  3L9S A;  5G5F A;  2ON7 A;  4FYB A;  2I81 A;  4FH8 A;  5D73 A;  3L9U A;  4E8H A;  2WDU A;  1AQW A;  2LRN A;  4KDY A;  1AQV A;  4HS1 A;  3FMW A;  4YH2 A;  1AXD A;  1GTA A;  5DJM A;  1GNW A;  1KTE A;  1GSE A;  1GUH A;  4KCE A;  3HZ8 A;  1ZL9 A;  3IXR A;  2X49 A;  2H70 A;  4MDC A;  1GL8 A;  5D9V A;  3M8N A;  1YF0 A;  4MF5 A;  2M46 A;  3UL3 A;  1F9M A;  4OWY A;  1Q4J A;  1UN2 A;  4O32 A;  2C0D A;  4HQZ A;  3CBU A;  3TKS E;  3FW2 A;  4JBB A;  2P5Q A;  4PXO A;  1PMT A;  4E8E A;  4WBJ A;  3ZIT A;  4EDZ A;  3EU3 A;  1Y6E A;  3K8N A;  5IMZ A;  2YAN A;  1YY7 A;  3TKQ A;  3F63 A;  3I69 A;  3LSZ A;  1VF1 A;  2IMF A;  2VLT A;  1SYX A;  1TW9 A;  4N30 A;  5DQY A;  3ZIV A;  4MH3 A;  3EVI A;  3V1W A;  2B3S A;  5DAL B;  4F82 A;  5CRG A;  4JU5 A;  2LUS A;  2HRA A;  4MJB A;  4L5L A;  3D22 A;  4FYC A;  3TCO A;  1SK0 A;  3G7J A;  1EOH A;  1RW1 A;  2N5F A;  4CY8 A;  3EMX A;  5F06 A;  3TKP A;  1OE7 A;  2H73 A;  4V1A g;  1UC7 A;  1JLV A;  3KP9 A;  3GYK A;  3HVV A;  3LW9 A;  4OD7 A;  3QAG A;  4XS6 A;  2GZP A;  1FVJ A;  1K3L A;  3BCI A;  5DBQ A;  1XVW A;  3VI7 A;  3DVW A;  5ELA A;  4BVX A;  5D9X A;  3PH9 A;  3ZZX A;  3A2V A;  3IV4 A;  1M0U A;  2L4Q A;  4LMV A;  3ZRE A;  3HVS A;  3HCZ A;  1A0F A;  5G5E A;  5HR1 A;  2ZCT A;  3KIJ A;  3QFA C;  4ZL9 A;  1QXH A;  2LST A;  3IAM 2;  2LNS A;  4CY6 A;  3CRU A;  3E3E A;  3TRP A;  4LA1 A;  1IYH A;  4PUR A;  5IOX A;  3UOM A;  1USB A;  2FCH A;  5IO0 A;  2B5E A;  1X5D A;  1FOV A;  4MA9 A;  3A5I A;  1PL2 A;  2L5L A;  4G9H A;  3PIN A;  4JR4 A;  3LFL A;  2XHF A;  1TOF A;  3F6F A;  2CZ3 A;  3ERF A;  3GA4 A;  1O73 A;  3H79 A;  4IBP A;  3A3T A;  4ZL7 A;  4KX4 A;  1X9W B;  2GT6 A;  3HA9 A;  4OO5 A;  1O7U A;  2C0G A;  1OKD A;  4IQ1 A;  3TJB A;  5HQP A;  4K5R A;  1V9W A;  3RHC A;  3MSZ A;  3L9V A;  4K2D A;  3G7Y A;  4BL7 A;  3IHG A;  2D2Z A;  4PNF A;  2K8V A;  4HDE A;  3CRT A;  1F37 A;  3UBK A;  1T8E B;  5EY6 A;  1OKT A;  2REM A;  4POM A;  2FA4 A;  4Q5Q A;  1HD2 A;  3EWL A;  3WGE A;  17GS A;  3IA1 A;  1SD8 A;  5F05 A;  4I6X A;  3J7Y k;  2K8S A;  4G0L A;  4EF0 A;  2YWM A;  1TTZ A;  1ACV A;  3S9F A;  2EIR A;  4GTU A;  1EV4 A;  1NHO A;  4MMM A;  2OKA A;  3C7M A;  5CRD A;  1NM3 A;  4POK A;  2JAC A;  4YAV A;  3EMP A;  12GS A;  2AB6 A;  2F51 A;  4NHZ A;  5AIS A;  4O5Q A;  5CNW A;  4F03 A;  3GIX A;  3IC4 A;  3RBT A;  3TDG A;  4MAB A;  3FR9 A;  1SJZ A;  1XOA A;  3UMA A;  3ZTL A;  1VGL A;  2DJJ A;  1X5E A;  2GSS A;  1MD3 A;  1PSQ A;  1VRS D;  1XWB A;  2H1G A;  1ZCP A;  1R4W A;  3QAW A;  3UAR A;  1YEX A;  3I6A A;  5GZZ B;  1PN9 A;  2X4A A;  5GSS A;  2VAF A;  4G0I A;  2IL3 A;  1K0O A;  4IKH A;  4RI7 A;  5KOX A;  4ZBA A;  3DIE A;  2CX3 A;  4TXO B;  3A2W A;  2F3M A;  3WD6 A;  3M3M A;  1B8X A;  2KLX A;  1JLW A;  3FZ4 A;  3CTF A;  1ST9 A;  3TJK A;  2O89 A;  2B7J A;  4ICY A;  3D4M A;  4GWR A;  3CMI A;  3GKM A;  1G0T A;  3NIV A;  2R4V A;  2E2M A;  2H30 A;  3IBH A;  1VF4 A;  5BRT A;  1DE1 A;  4TR4 A;  2I9H A;  2VD1 A;  1E6B A;  4JZQ A;  5ECQ B;  2FWG A;  4ECJ A;  4Z7X A;  4JR6 A;  3IHQ A;  1EGO A;  2VUP A;  3FK8 A;  1UA5 A;  5B8A A;  1S3A A;  4HZ2 A;  5ENU A;  1I9D A;  3UBL A;  2L5O A;  1T1V A;  3DKS A;  2OBI A;  5IMF A;  4I2U A;  1N8J A;  2Z9S A;  2BJX A;  5ECS A;  5J4U A;  3CSI A;  2C3Q A;  2DJ1 A;  4HZ4 A;  4K6X A;  2VL3 A;  4GF0 A;  1G7O A;  2JZT A;  4EXJ A;  5G1L A;  4ML6 A;  3ZLP A;  2WCI A;  2KHP A;  1F6M C;  3BCK A;  4KGI A;  4BWQ A;  2K18 A;  3APQ A;  1AC1 A;  2JSY A;  4N0V A;  1WJK A;  2H74 A;  3BOA A;  3KGK A;  4WBR D;  3MYD A;  3H93 A;  4MF7 A;  2H0G A;  2VLV A;  2YWO A;  4IGJ A;  4IP1 A;  2M80 A;  2H0I A;  2N5A A;  2CVD A;  2R37 A;  1TI1 A;  3ERW A;  3GUR A;  4AGS A;  2OE3 A;  5ID2 A;  4G2E A;  2QA1 A;  4YQM A;  1QFN A;  5E4W A;  16GS A;  2HT9 A;  5GAP D;  2PVO C;  1R26 A;  1CQH A;  2X8H A;  2YOI A;  1B9Y C;  2WJU A;  2G2Q A;  3HY2 A;  2R0G A;  3Q18 A;  1GSQ A;  1GSY A;  3NZN A;  2C80 A;  5J9C A;  1FO5 A;  4I97 A;  4X43 A;  5CP1 A;  3ME7 A;  4TR0 A;  1ERW A;  3H1N A;  2AV4 A;  5HR0 A;  2P0G A;  1R5A A;  2PBJ A;  3CXG A;  4MJE A;  3FKF A;  3ZIJ A;  4KUN A;  1XW9 A;  2NVL A;  2PER A;  6GSU A;  3I43 A;  4NWY A;  2C0F A;  1WPI A;  3US3 A;  1GSU A;  3P7X A;  1S3D A;  3GL3 A;  4HU9 A;  3G9B A;  4H86 A;  1UVZ A;  2KUC A;  1U87 A;  1FOH A;  4CDO A;  1GNE A;  4WKW A;  3KH9 A;  2F8F A;  3G7I A;  4NV2 A;  2CV4 A;  1YKA A;  2HLS A;  3J7Y b;  3KH7 A;  11GS A;  3ISO A;  3LEF A;  2GGT A;  4CHS A;  3GNJ A;  1EOG A;  5IOW A;  1XW5 A;  2I4A A;  1GH2 A;  4P3Y B;  3KD0 A;  2WZ9 A;  2YP6 A;  5ECL B;  3SWL A;  5ECP B;  4WXT A;  2C3T A;  2YV9 A;  4DSR A;  1YKC A;  2XBQ A;  3ZVJ A;  4WF5 A;  1TI3 A;  3HKR A;  2F9S A;  2FA8 A;  4BVY B;  1N2A A;  4J57 E;  1K3O A;  2VOC A;  2NPB A;  1ZYE A;  3IPZ A;  4BL7 B;  2H1D A;  1ZMA A;  1FW1 A;  2QC7 A;  1FHE A;  3CYN A;  3RPP A;  1AAZ A;  1HNA A;  4L8E A;  3KP8 A;  3IK9 A;  2MZC A;  2X8C A;  1BQ7 A;  4ML1 A;  2AAW A;  1Y25 A;  5EPF A;  3F3Q A;  1B4Q A;  3KTL A;  1H4O A;  1KEB A;  5J9B A;  3U5R E;  3LXT A;  3GUS A;  1CQG A;  4AJ6 A;  4ZL8 A;  18GS A;  4FQU A;  1X0R A;  4EDY A;  2FHE A;  2VM2 A;  4IQA A;  1MTC A;  5A4V A;  1SL1 B;  5BMU A;  1A0R P;  1PN0 A;  4TOP A;  3QPM A;  2GQM A;  2BMX A;  1TRW A;  4Q5F A;  4JRR A;  4J56 E;  3ZFL A;  2JSZ A;  3EE2 A;  3O76 A;  1WOU A;  1OE8 A;  5LNK e;  2A2R A;  2GQL A;  3GKK A;  2HFD A;  4EO3 A;  3IAS 2;  3C1S A;  3VWX A;  5IM9 A;  2NTO A;  4NPB A;  4POL A;  1A2M A;  1GP1 A;  1BG5 A;  1XXU A;  4ULX A;  4F0B A;  4OCF A;  3QMX A;  2H6Y A;  4GRF A;  4I8B A;  4FIW A;  1OC9 A;  2GLR A;  2O7K A;  2V6O A;  2IMI A;  4G0K A;  2AJQ B;  3RPN A;  1XFL A;  2R6K A;  4EIP A;  4F0C A;  20GS A;  2V6K A;  1XWG A;  4TXV A;  1ZYP A;  1G6W A;  2FUG 2;  4F2I A;  2R3X A;  2H01 A;  3APO A;  1JZW A;  1QMV A;  1TDI A;  5JCG A;  1WP0 A;  4KCA A;  3IOS A;  6GSW A;  2LV3 A;  2VCV A;  1Z9H A;  2YWN A;  1K0A A;  1HYU A;  3ZL5 A;  5ABR A;  3VWW A;  3A5W A;  3WT2 A;  4ECC A;  1ML6 A;  2JAD A;  1O6J A;  3PGT A;  2R2J A;  1TRU A;  2QKE A;  2YV7 A;  2IMK A;  3M1G A;  1NW2 A;  2E2G A;  4K8M A;  4TR1 A;  1SKS B;  2KP1 A;  2MMN A;  1TK5 B;  4WEY A;  3M9K A;  4K0N A;  1BJX A;  3WGX A;  1ON4 A;  2A4H A;  1K0N A;  3LGC A;  1EGR A;  2ZUP A;  2CVK A;  2E0Q A;  2X64 A;  4IS0 A;  5A4W A;  1BED A;  4KA0 A;  2TRC P;  3GSS A;  3TKR A;  2RM5 A;  1ERV A;  1A23 A;  4KND A;  2N5B A;  1TXX A;  1U88 A;  2HE3 A;  1ERT A;  2LS5 A;  4BVY A;  4MZW A;  1GUK A;  3VFI A;  5B6M A;  3QAV A;  3GX8 A;  4MNN A;  4TVE A;  3UIW A;  3APS A;  2DC5 A;  4PQH A;  4WET A;  4MK3 A;  1KBN A;  2HZE A;  2I3Y A;  5ID2 B;  4MPG A;  4NV5 A;  9GSS A;  4PGT A;  3F4S A;  5INY A;  5DCG A;  1BAY A;  1SK2 A;  1FB0 A;  3Q74 A;  4ZBB A;  4N11 A;  13GS A;  3HJP A;  2PN8 A;  2PVQ A;  4XTS A;  4IP6 A;  4ECI A;  3LOR A;  2E7P A;  1M9A A;  2CZ2 A;  4N10 A;  2JU5 A;  4K0G A;  3LYK A;  3LYP A;  4A5P A;  1ZGN A;  3RHB A;  1XBS A;  2H1A A;  2LJK A;  2H76 A;  4KE3 A;  1GUM A;  3KJY A;  1EWX A;  2LEG A;  2VCZ A;  4XRD A;  2HZF A;  3MAK A;  5A4U A;  5D93 A;  2GDR A;  4YQV A;  2DBC A;  1M2B A;  3GST A;  2VIM A;  1X9M B;  4MP4 A;  2DJK A;  3D6I A;  1TU7 A;  3I9V 2;  4DSQ A;  1KNG A;  4HEA 2;  1DUG A;  4XIH A;  1K3Y A;  3GN3 A;  3ZML A;  1T4Z A;  2LTK A;  1W89 A;  2XC2 A;  6GSY A;  2RM6 A;  1MDK A;  2AUV A;  3GTU A;  1Z3E A;  3DGQ A;  3UEM A;  1M99 A;  5ECN B;  3QDN A;  2DKI A;  2R0C A;  3QCP A;  2QA2 A;  5DCH A;  5D8I A;  1MEK A;  2MYG A;  2H0H A;  2FD3 A;  2IME A;  3H8Q A;  1XWC A;  5C00 A;  1ZOF A;  3F6D A;  1PA3 A;  4JE1 A;  4WF4 A;  3FZ9 A;  2VLU A;  4IHU A;  2R5G A;  4KDX A;  4IEL A;  4ZIL A;  2H6X A;  3NOF A;  1AUC A;  5G30 A;  4NMU A;  3CSH A;  4EC0 A;  3TUE A;  2FWF A;  2GSR A;  4RQR A;  4PQI A;  8GSS A;  1XZO A;  3TOU A;  5A5K A;  2LQQ A;  1B48 A;  1URM A;  4ZBD A;  1PKW A;  3R3E A;  22GS A;  1K0B A;  4YKF A;  2MMZ A;  4PUF C;  5F07 A;  2IN3 A;  2EIO A;  1M2D A;  3LXZ A;  5IPH A;  2OJL A;  4FYU A;  1HNB A;  5IMV A;  2PMT A;  4V2L A;  3KTB A;  1QUW A;  1PRX A;  4XRA A;  1HQO A;  2BTO T;  4NXI A;  1LBK A;  1W4V A;  4RUV A;  2XPD A;  4YQU A;  1A2J A;  2JZS A;  4ILF A;  3F9U A;  1MDI A;  4OMV A;  1DBY A;  5AIV A;  3QR6 A;  1JZO A;  1O8W A;  4ISD A;  4GCI A;  4TN8 A;  4RI6 A;  1Z6N A;  4GSS A;  4MF6 A;  5LD0 A;  1T7P B;  2MBT A;  1X9S B;  2LJA A;  3U6V A;  2GZY A;  4WR5 A;  1M2A A;  1TU8 A;  2H75 A;  4QL7 A;  4BPY A;  4IJ3 A;  3W8J A;  3FRC A;  4IJI A;  2GT5 A;  2JZR A;  2O87 A;  1F3B A;  4ZXG A;  3CSJ A;  4EUY A;  3Q19 A;  2CAI A;  1I5G A;  1WRY A;  2YWI A;  1OC9 B;  2L59 A;  4N0Z A;  3CTG A;  1YF1 A;  4MJA A;  5ECK B;  2MBS A;  1YDK A;  1FG4 A;  1EP7 A;  5J3R A;  2GZZ A;  3Q6O A;  5B6N A;  2HRF A;  3ZRD A;  1XW6 A;  2ALB A;  3FZA A;  1WWJ A;  4V1A p;  2YNX A;  2FNO A;  5H5Q A;  4XS4 A;  4Q5N A;  1AW9 A;  1U6T A;  2NBS A;  1RK4 A;  3KZQ A;  3HHV A;  1TJD A;  2VL2 A;  4HOJ A;  3F3R A;  3FZ5 A;  4L5O A;  2YJ7 A;  1B9X C;  3HVX A;  2WGR A;  1K0D A;  2CX4 A;  4PNG A;  1GSD A;  2B1L A;  4QQ7 A;  5ECO B;  1AQX A;  1YQ1 A;  3O3T A;  3A2X A;  2C4J A;  2IJY A;  2A2S A;  2O85 A;  4O5U A;  3GMF A;  1SJI A;  4TR1 B;  3LG6 A;  2B5X A;  4F9Z A;  2GQK A;  1QGV A;  2IWT A;  5DAK B;  3UJ1 A;  1EEJ A;  1T3B A;  4HJM A;  2H66 A;  4ACS A;  4I2T A;  5D9T A;  4XS1 A;  3HD5 A;  1JZD A;  2I1U A;  2LRT A;  1J0F A;  1GWC A;  4QL9 A;  1O81 A;  4EVM A;  1Z6M A;  1ZZY A;  2J23 A;  1K0M A;  1SEN A;  4DSS A;  3DYR A;  4RQX A;  2IFQ A;  4LL1 B;  6GSS A;  1E2Y A;  5F0G A;  3TKS C;  4KSO A;  3L78 A;  4ZB9 A;  2IIY A;  1XCC A;  2QGV A;  2L57 A;  3ME8 A;  3F4T A;  5F8B A;  5DJL A;  3P90 A;  3F4R A;  2X8G A;  3L4N A;  4V2M A;  3VK9 A;  4X4J A;  1EV9 A;  5DQS A;  3IDV A;  3KCM A;  3UVH A;  1THO A;  4K7N A;  4L0W A;  1EZK A;  2HZE B;  1V98 A;  4X1U A;  3LJR A;  5CO3 A;  5ECR B;  4ID0 A;  2FWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...