3CMIA

Crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
Knots found
sequence length
161
structure length
143
Chain Sequence
SEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIGFPCNQFGGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin HYR1
publication title Crystal structure of glutathione-dependent phospholipid peroxidase Hyr1 from the yeast Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 143
sequence length 161
other databases KnotProt 2.0: Artifct K +31
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cmiA00
4FH8A 2DMLA 3C1RA 2O85A 4NXIA 3GRXA 4TR4A 3EE2A 2VL9A 1KEBA 3O3TA 4YQUA 2QC7A 4ULXA 2O89A 4HU9A 1AQXA 4RQRA 1V9WA 2HRFA 5CREA 4TW5A 2KHPA 3L4NA 2VCWA 3ZZXA 1VF3A 5F8BA 2H72A 1MDJA 1WP0A 3MSZA 1DE2A 4HI7A 1PMTA 1M7TA 4JZQA 1H75A 2C0EA 4MZWA 5J4UA 3KD0A 6GSYA 2FA8A 1R26A 1TRSA 2CAIA 2IPAA 5HR3A 1J0FA 3GL3A 4Q5RA 4BL7A 1MD3A 2B3SA 2VL2C 3F63A 4KNDA 2OKAA 2NTOA 3UJ1A 3TOTA 4OMVA 3DVXA 3P90A 5HFIA 3EINA 3G7JA 3CSJA 4J2FA 5J5NA 4Q5NA 2DMMA 3RPNA 3HD5A 2YV7A 1SKSB 3TOUA 1TRUA 1T3BA 1SL1B 1VRSD 2N5BA 3RHCA 4HQZA 1RK4A 2F9SA 2ON5A 1YY7A 4PNFA 3FR9A 2L4QA 4TR3A 3L0HA 1T4YA 1XXUA 3FEUA 1M2DA 2DIYA 3UAPA 1X5DA 3I69A 2B7JA 5ECQB 4IBPA 2XC2A 3LYPA 2GSSA 1GNWA 2IMIA 3V1WA 3BCIA 3OR5A 2YN1A 3IBHA 2ALBA 2R4VA 3TRQA 4D73B 1FB6A 4EF0A 1A24A 1O7UA 3PH9A 3EMPA 3ERFA 1F37A 4LLRA 2XBQA 2KP1A 1Y25A 4ML1A 2VCQA 1WOUA 2JZTA 2RUEA 3C73A 6GSVA 3EU4A 5HR2A 2HZEA 4WF5A 2GSRA 1K3LA 3TKSA 2YZHA 4KW6A 2FY6A 2X99A 1GULA 2F3MA 5IM9A 3WGEA 1GSYA 4ZILA 2I4AA 2PERA 5G2ZA 3NZNA 4JR6A 4XHMA 2AJQB 1EOGA 3WGDA 2L6CA 4KDYA 2CX4A 5IO2A 4YAVA 5COHA 4O92A 4ZIJA 2K6VA 2VCVA 2LQOA 4O5RA 2PBJA 3A3TA 5D8IA 2EIOA 1FW1A 1XBSA 5ECHB 2H66A 3GMFA 1K3OA 13GSA 2K8VA 2C4JA 1WMJA 3N9JA 2HFDA 2K18A 3MNGA 3VI5A 2WGRA 4IKHA 3QAVA 2PWJA 2P5QA 2V2GA 5G1KA 17GSA 3VWXA 3TJFA 1I5GA 2GZPA 2R3XA 3W8JA 3F9UA 5CRDA 4X0XA 3RBTA 1XWGA 4OFMA 4DEJA 4V1Ap 2HZFA 5DBQA 1MTCA 4L5LA 4GQFA 4XTSA 4MA9A 4J57E 11GSA 4GSNA 4K0GA 3H79A 2NPBA 5ID2B 3KZQA 5CO3A 5DQYA 2QGVA 1M9BA 1PRXA 1GWCA 1MD4A 2FGXA 5LNKe 5F05A 2N5FA 3LEFA 1F2EA 3I6AA 2BTOT 5A4UA 3HA9A 4G2EA 5AN1A 3DVWA 3NOFA 2OA7A 1KTEA 4EKZA 5F06A 2V41A 4WBRD 1X5EA 3L9UA 3P7XA 3ZFLA 2LJAA 5CP1A 2GT6A 5F07A 5JCWA 4GSSA 2FWEA 4WR5A 2FLSA 2V1MA 4E8HA 5HFKA 1F3BA 3GNJA 5B8BA 4BWSA 4ACSA 1TXXA 2IN3A 3A5WA 3VWWA 3QDNA 1FOVA 8GSSA 2M72A 1K0DA 5DCGA 1PQNA 2L57A 1K0MA 5B6NA 4XRDA 2NVLA 2XPDA 4F9ZA 3VFIA 3VLNA 3HJOA 4AF2A 1EWXA 2EIQA 4KDXA 3EYTA 1B9YC 2XPEA 3FR3A 4BPYA 4K2DA 1TJDA 1OE8A 4IP6A 1UA5A 4NV2A 4PQHA 3HYPA 4HQSA 1TKDB 1GSQA 5KEJA 1JFUA 4EL1A 4KGIA 3FZ5A 1MDIA 2BMXA 1F6MC 5DAKA 4I2UA 4E8EA 4O7HA 5ECSA 5A4VA 3FZAA 2H0HA 4ZL7A 3F4TA 3KMOA 3GKKA 4MF6A 1FO5A 1GUKA 2E2GA 3ME8A 1O85A 5D96A 5IIZA 4FYBA 2JL4A 2X8GA 4FO5A 1A0RP 4WXTA 3DD3A 2IMKA 1ZYEA 3LGCA 3ZIJA 5G31A 4LL1B 1S3DA 6GSXA 4JR4A 5IOWA 3TRPA 2D2ZA 3QD9A 3F6FA 1EV9A 3GYKA 3KP9A 1EV4A 1GLQA 1Z6MA 3G7YA 2FWFA 1VGLA 2H6ZA 5CRGA 2VM2A 3UVHA 4EDZA 1GP1A 3E3EA 3EWLA 2OE3A 1Q4JA 2GQMA 3PR8A 2WZ9A 4NAXA 2IMEA 3QAWA 4V1Ag 2MMAA 4P3YB 4WBJA 2H70A 4L0UA 3CTFA 2CT6A 3M3MA 3MDKA 1TDIA 4ZBBA 4NPBA 4EVMA 5KN2A 3O76A 2DJ3A 3LORA 3EU3A 4KUNA 2AUVA 5B6MA 2C1YA 2DLXA 2VCZA 1GUMA 20GSA 3UARA 1PKZA 2IMFA 2LJKA 3ISOA 3TKRA 4CW9A 4N11A 2GSQA 3EVIA 4POLA 5D9VA 4F82A 2G0FA 4O32A 1W89A 3M9JA 1AAZA 4F0BA 3KH9A 1G7OA 2VOCA 1O6JA 1M99A 3FYGA 5E4WA 1ERVA 1FVJA 4LMWA 4KCAA 3E0UA 4YQVA 1ZYQB 3SWLA 2C3NA 4MF5A 5C00A 3HDCA 3GSSA 3GX0A 3GV1A 1WPIA 1HYUA 5ECMB 5G30A 4Q5QA 3IK7A 2PVQA 1XW6A 1JLVA 3FZ9A 1DBYA 4POBA 4MJAA 3GTUB 5IMZA 5IMFA 3WGXA 4HZ2A 3ZL5A 5EL8A 4ZB8A 1GH2A 1USBA 2TRCP 3IHQA 4RI7A 3KCMA 4MJBA 2H74A 1TOFA 4OO4A 2IL3A 2X8HA 3PINA 4EXJA 3QAGA 3GSTA 3VI7A 2DJ2A 3CMIA 1PX6A 4TN8A 3U5RE 1S3AA 2ZUPA 2IWTA 1ABAA 1PA3A 1MDKA 1SK0A 2VM1A 4NMUA 1FVKA 16GSA 6GSSA 2E0QA 3IDVA 5ECIB 2FUG2 4JU5A 3UBLA 4MP4A 2GQKA 4OD7A 4JRRA 5KN1A 5GAPD 2C0GA 2I1UA 5L71A 2GTUA 4F03A 2HYXA 1XIYA 3TJBA 2C3TA 2HT9A 4EE0A 2LNTA 5D93A 3FKFA 4IN0A 2WS2A 2GVPA 3HY2A 5DJMA 1X9SB 1Z6NA 2WB9A 4FIWA 4I97A 1LBKA 1GSSA 2H30A 5DVBA 5IPHA 2OJLA 1XVWA 5J9BA 4GCIA 5DJLA 1QMVA 1A2JA 1ST9A 1DUGA 2HSHA 2FNOA 4NV5A 1V2AA 3GKMA 1B48A 4OWYA 3I9V2 2HI7A 2IFQB 5D9WA 3FK8A 4PGTA 1K0AA 1K3YA 3ZLPA 2YV9A 4DSSB 2G2QA 1NM3A 2E2MA 1DSBA 1AC1A 1U3AA 4WKWA 3VK9A 4KE3A 4KB3A 5JCGA 3KTBA 1K0BA 4MH2A 3HJMA 4V2MA 1PKWA 1XWCA 4HJMA 2RM5A 2LRTA 4LA1A 3W8SA 3SBCA 2H73A 3Q6OA 1Q98A 1XZOA 4TR0A 2MYGA 4EC0A 1EZKA 1X0RA 2CV4A 3IE3A 4AJ7A 3LQ7A 3K8NA 2A2SA 3HCZA 2JSZA 3O6TA 4EUYA 3FW2A 4OFNA 4N10A 2H1BA 2LJRA 2QKEA 5D9XA 2QSIA 3L9SA 3DIEA 4CDOA 3PGTA 5HR1A 2DJ1A 4GRFA 1V40A 3US3A 3E9JB 3HJPA 1R4WA 2B5YA 2VLTA 4X1UA 3F4SA 2C0DA 1HNCA 3CBUA 1OKTA 1EP8A 3GFKA 5ID2A 1GLPA 4BVYA 2CX3A 1TK0B 1E2YA 3GA4A 3J7Yk 2MMNA 1OE7A 3KP8A 3CYNA 2GT5A 1PL1A 4QL9A 2VUPA 3KM6A 3H8QA 1I9DA 4I6XA 5G5EA 3EMXA 2YP6A 3P8WA 2V6OA 2YANA 3WYWA 4JBBA 3QR6A 3F3RA 2L4CA 4TXOA 1O73A 1YZXA 4ZB9A 5DDLA 1GSFA 5H5QA 4I8BA 1PGTA 3A2VA 4I5QA 4OCEA 2H01A 2XBIA 3RHBA 2J23A 2C8UA 2OBIA 2VO4A 4JEDA 1EP7A 2R2JA 4KSOA 1NHYA 3R2QA 3D0ZA 3WT2A 2MBSA 4WEYA 4N0VA 1BX9A 1BYEA 3D4TA 2YOIA 4LL4B 3S9FA 1O81A 3CRTA 4HJ2A 5KN3A 3TJJA 4TXVA 2R6KA 3DMLA 2H1AA 1SD9A 2H8LA 5FHIA 2H0IA 1GTIA 4XS4B 4TRXA 1GL8A 3KGKA 5AIVA 3LXZA 2B6MA 1XW5A 4POMA 5LD0A 3GURA 4KA0A 1QUWA 4OO5A 1XFLA 3D4MA 2I3YA 3AY8A 3VURA 1V57A 1GSEA 3G9BA 3KXOA 2F8AA 3QFAC 2VCXA 4LMVA 1YEXA 1DE1A 2P31A 1ZGNA 3ME7A 4MDCA 3L9VA 1NSWA 3A2WA 4GTUA 3MWHA 1T4ZA 3D6IA 1AXDA 3H1NA 4PUFC 5GAND 1WIKA 1G0TA 3TKSC 2AB6A 1OC9B 2ZNMA 4IS0A 1G6YA 2VIMA 1LU4A 4IGJA 6GSWA 4PUAA 1YJ6A 5IO0A 2WFCA 3ERWA 4I2TA 3VPQA 2YWOA 1AUCA 5FT3A 4MLYA 1XOBA 1ZL9A 4PQIA 1EOHA 5EPFA 2PMTA 2OE1A 3DXBA 1VF4A 1UVZA 4OCFA 1Y6EA 3BJ5A 4K7OA 2E7PA 1SD8A 5DALB 2GGTA 3Q19A 1EEMA 3TKQA 2XHFA 4FYUA 2PU9C 1JZDA 4IQ1A 4TKYA 1U6TA 2NBSA 4HEA2 1H4OA 2M46A 4PNGA 1PSQA 2LRNA 2ZCTA 4GQCA 4XS6A 1XOAA 5HQPA 4YH2A 2LQQA 2CZ3A 3GN3A 3G7IA 2LKUA 2ES7A 4ISDA 3BBYA 4ZB6A 1F9MA 4RQXA 4Z7XA 3ZTLA 1HNBA 2L5LA 1A8YA 2F8FA 4KH7A 3VWVA 3GH6A 1OC8A 2YPMA 3CTGA 4PQ1A 5LCZA 3UBKA 2K9FA 3DKSA 1AQWA 3TB2A 4RUVA 3TKSE 1N2AA 4ML6A 5CNWA 5IOXA 3UMAA 1U88A 3U6VA 2JSYA 5ECRB 4BA7A 2IIYA 1R5PA 3GTUA 5H5SA 1KBNA 3ZRDA 5AIXA 4L5OA 4IELA 1SKWB 4CHSA 2HRNA 3DGQA 1YEPA 2PUKC 3LYKA 5IPGA 2PPTA 2MMZA 1XWAA 2YJ7A 1V98A 19GSA 5H5RA 4RI6A 3ZMKA 1J08A 1GSDA 1AW9A 5HR0A 1OKDA 2FA4A 5JWRB 2TRXA 1AIUA 2H71A 1PN9A 5JCUA 4MCUA 1A2MA 3ED3A 2OACA 2GZYA 4MF7A 1YDKA 4XS1A 2FWGA 4TR1B 1BEDA 2NDOA 2O7KA 2VD0A 4IJIA 2WDUA 3GKXA 4L0WA 3ZIVA 1RQMA 1T00A 3UIWA 3IXRA 3F6DA 3QFBC 2KP2A 3HKRA 5C04A 3TDGA 2YJHA 4QL7A 2MBTA 3C71A 1M0UA 2YWIA 2O8VB 2H6XA 3BCKA 2DIZA 2CAQA 4BWQA 4EDYA 1RW1A 4OFTA 3VWUA 5ECNB 3WD6A 1CQGA 5E59A 4POKA 3KJYA 2WCIA 4MK3A 2FWHA 1VF2A 12GSA 2IFQA 1GNEA 1ZMAA 3RPPA 1TU7A 2X8CA 3UVTA 1Z7RA 1ZZYA 4NWYA 1AQVA 2FHEA 4DSSA 3ZVJA 5A4WA 4ID0A 5ELAA 3GIXA 4TOPA 2LS5A 2H75A 5B7CA 3GHAA 4K7IA 4MJEA 3D22A 3M1GA 1Z3EA 4L8EA 1ZCPA 1M2BA 4N30A 2YCDA 3C1SA 4BVXA 3EC3A 3D5JA 2L6DA 3GUSA 3QMXA 1B8XA 1JZOA 1ILOA 4D73A 5IQYA 3RDWA 2MZCA 3FRCA 3BOAA 5F0GA 2O87A 2ON7A 4K8MA 1OVNA 1VF1A 3EURA 2LNSA 2J9HA 3HXSA 5JWOB 2CQ9A 1B4QA 3CXGA 1SJZA 4ECJA 1BQ7A 5ECOB 2REMA 4XIHA 4MH3A 3NIVA 3TCOA 1X9WB 3FY7A 3UEMA 2OBKA 2EC4A 2IMDA 1EGRA 1UN2A 1TK8B 1B9XC 1HQOA 3LSZA 2EIRA 3QCPA 3CSIA 3ZYWA 1ACVA 1T1VA 3LWAA 1THXA 2JZSA 4XCSA 2B5EA 1EEJA 5D73A 3W6GA 4F2IA 5IMCA 4MPGA 2RIIA 2VAFA 2X64A 2YZUA 3IRAA 4GF0A 4G19A 1T8EB 1NW2A 2C3QA 2V6KA 2PGTA 2B7KA 3D21A 4K7NA 2CA8A 6GSUA 5G1LA 5AGYA 3QPMA 1K0CA 3FR6A 2N5AA 3MAKA 3DWVA 1TTZA 3ZVJD 2R37A 3F3QA 4IP1A 2MMOA 3TKPA 3ZREA 3ZMLA 1QGVA 1K0OA 2KLXA 5ECPB 4Q5FA 1ERUA 2RLIA 3ZITA 1E6BA 4GXZA 1S3CA 1JZRA 4XS4A 2OE0A 1O8WA 1T7PB 2PN8A 5A5KA 1Z9HA 1YF1A 2C80A 3TGZA 3F8UA 3UOMA 2CVBA 4KSMA 2HNLA 4IQAA 4ECIA 1XCCA 6GSTA 5KN0A 5CRHA 4AJ6A 3GX8A 1OYJA 4H86A 2VCTA 1ML6A 1A0FA 4IW9A 2VLUA 2KOKA 2HZEB 2L59A 4PURA 1ERTA 1K0NA 1TRWA 2RM6A 3CRUA 3JCML 2LV3A 5EY6A 1R7HA 1XWBA 2V32A 4GSTA 1YKCA 4FYCA 3IPZA 4IVFA 5G5FA 3CSHA 1GUHA 3LXTA 4ILFA 1SENA 4HU7A 3P2AA 2DJJA 3HVXA 1OC9A 1QQ2A 2Z9SA 4ECBA 1JLWA 1G7EA 1YF0A 4KX4A 3F0IA 1URMA 1PX7A 2YNXA 4MJCA 1WE0A 1Z5YE 1SL2B 1TI1A 2PVOC 3M0FA 1JZWA 2JADA 2CVDA 1SKRB 1QFNA 4DVCA 2GQLA 1M2AA 4G10A 1M9AA 1FHEA 3HHVA 4MABA 2IJYA 1G6WA 2YWMA 4G9HA 5GSTA 3QOUA 1Z7PA 4TXOB 4XRAA 3KIJA 2LRCA 1OAZA 2BJXA 5IMAA 1PD21 1U3IA 2GS3A 3KTLA 1XW9A 4YQMA 1YKAA 5ELGA 1TRVA 1R5AA 5J41A 1N8JA 3TJGA 5DQSA 5DALA 4KCEA 3HVVA 1W4VA 4F0CA 1SL0B 4IJ3A 2WJUA 3LJRA 3GL5A 2K8SA 3M9KA 3C8EA 7GSSA 2A4VA 1A8LA 1ON4A 3DRNA 5D9TA 5CAXA 2FD3A 4HDEA 3HZ8A 3L78A 2B5XA 3LFLA 1NHOA 1OC3A 4V2LA 1LJRA 5CRWA 2B1LA 2H0GA 1A2LA 18GSA 3FZ4A 3H4KA 4NHWA 4QQ7A 5HFGA 1SU9A 1XWKA 2GLRA 1SK1A 1KNGA 2FCHA 1SJ6A 1TI3A 4KDUA 4ZBAA 2B1KA 1CQHA 1EGOA 3IAM2 2M80A 2HSYA 2GZZA 2JU5A 3TJKA 1TP9A 2KUCA 5ENUA 1U87A 5IMVA 1QK8A 2R5GA 2WULA 4K9ZA 2VD1A 1F3AA 2A2RA 3Q74A 3KEBA 1WRYA 1SYRA 3HVSA 1B4PA 4ECCA 4JE1A 3C7MA 3VPTA 2C0FA 3DEXA 3IOSA 5J9CA 1GTBA 1BJXA 2DJ0A 1C72A 3F4RA 3ZFBA 3KH7A 1WJKA 2H1DA 2OADA 1SYXA 1GRXA 2LUSA 4AJ8A 3UL3A 3Q18A 2AV4A 4N0ZA 2TIRA 4X43A 2I9HA 2AAWA 5AISA 2LTKA 3APQA 2CZ2A 1SK2A 1A23A 2DSAA 5ECKB 1UC7A 4IHUA 5J3RA 4ZL9A 10GSA 2DC5A 1TK5B 3H93A 2VLVA 1GTAA 1TU8A 4TVEA 2HE3A 1ZOFA 3APOA 1BAYA 3GH9A 5IMDA 3I43A 3IK9A 2LEGA 3RAZA 5DAKB 4PX1A 1XPVA 4MZBA 4TR1A 2WRTA 1QXHA 3IC4A 1IYHA 1HD2A 2AYTA 4ZBDA 2F51A 1GTUA 4K0NA 5GSSA 3IV4A 3KMNA 2JACA 1J9BA 4K1FA 4HUAA 4HZ4A 4NHZA 1X5CA 2VL2A 2VL3A 3BD2A 4HOJA 4KAEA 4K6XA 5CYYA 4DSQA 2GDRA 2H1GA 3LG6A 3HZ4A 1JHBA 1PL2A 3IA1A 2CVKA 5INYA 3M8NA 3TRXA 4J56E 2L5OA 5ABRA 4EO3A 14GSA 1YQ1A 3DYRA 4GLTA 5DCHA 2JZRA 4YAPA 3WT1A 2RUFA 5FWGA 4DSRA 2YWNA 5ECLB 1WWJA 4WF4A 1O8XA 4MPFA 2H19A 4MZCA 4WETA 1TW9A 2H76A 2H6YA 1ERWA 3ERGA 1X9MB 4AGSA 3APSA 2P5RA 3TUEA 2LSTA 4V2NA 1XVQA 2HLSA 3A2XA 2HXKA 1V58A 2P0GA 1GSUA 1FB0A 4GWRA 3FHKA 5JWQB 4WR4A 2DJKA 2GSTA 3IR4A 3IAS2 2AHEA 1FG4A 1MEKA 2DBCA 3N5OA 5GZZB 4ZXGA 22GSA 1IYIA 4MMMA 1BG5A 4ZL8A 3GKNA 5EVOA 3J7Yb 9GSSA 5B8AA 4PXOA 1THOA 1HNAA 1SJIA 1FAAA 2I81A 4HS1A
chains in the Genus database with same CATH superfamily
4FH8A 2DMLA 3C1RA 2O85A 4NXIA 3GRXA 4TR4A 3EE2A 2VL9A 1KEBA 3O3TA 4YQUA 2QC7A 4ULXA 2O89A 4HU9A 1AQXA 4RQRA 1V9WA 2HRFA 5CREA 4TW5A 2KHPA 3L4NA 2VCWA 3ZZXA 1VF3A 5F8BA 2H72A 1MDJA 1WP0A 3MSZA 1DE2A 4HI7A 1PMTA 1M7TA 4JZQA 1H75A 2C0EA 4MZWA 5J4UA 3KD0A 6GSYA 2FA8A 1R26A 1TRSA 2CAIA 2IPAA 5HR3A 1J0FA 4Z2UA 3GL3A 3IHGA 4Q5RA 4BL7A 1MD3A 2B3SA 2VL2C 3F63A 4KNDA 2OKAA 2NTOA 3UJ1A 4G0LA 3TOTA 4OMVA 3DVXA 3P90A 5HFIA 5KOWA 3EINA 3G7JA 3CSJA 4J2FA 5J5NA 4Q5NA 2DMMA 3RPNA 3HD5A 2YV7A 1SKSB 3HVNA 3TOUA 1TRUA 1T3BA 1SL1B 1VRSD 2N5BA 2R0CA 3RHCA 4HQZA 1RK4A 2F9SA 2ON5A 1YY7A 4PNFA 3FR9A 4X4JA 2L4QA 4TR3A 3L0HA 1T4YA 1XXUA 3FEUA 1M2DA 2DIYA 3UAPA 1X5DA 3I69A 2B7JA 5ECQB 4IBPA 2XC2A 3LYPA 2GSSA 1GNWA 4BVXB 2IMIA 3V1WA 3BCIA 3OR5A 2YN1A 3IBHA 2ALBA 2R4VA 4ICYA 3TRQA 4D73B 1FB6A 4EF0A 1A24A 1O7UA 3PH9A 3EMPA 3ERFA 1F37A 4LLRA 2XBQA 2KP1A 1Y25A 4ML1A 2VCQA 1WOUA 2JZTA 2RUEA 3C73A 6GSVA 3EU4A 5HR2A 2HZEA 4WF5A 2GSRA 1K3LA 3TKSA 2YZHA 4KW6A 2FY6A 2X99A 1GULA 2F3MA 5IM9A 3WGEA 1GSYA 4ZILA 2I4AA 2PERA 5G2ZA 3NZNA 4JR6A 4XHMA 4BIKA 2AJQB 1EOGA 3WGDA 2L6CA 4KDYA 2CX4A 5IO2A 4YAVA 5COHA 4O92A 4ZIJA 2K6VA 2VCVA 2LQOA 4O5RA 2PBJA 3A3TA 5D8IA 2EIOA 1FW1A 1XBSA 5ECHB 2H66A 3GMFA 1K3OA 13GSA 2K8VA 2C4JA 1WMJA 3N9JA 2HFDA 2K18A 3MNGA 3VI5A 2WGRA 4IKHA 1M3IA 2R0PA 3QAVA 2PWJA 2P5QA 2V2GA 5G1KA 17GSA 3VWXA 3TJFA 1I5GA 2GZPA 2R3XA 3W8JA 3F9UA 5CRDA 4X0XA 3RBTA 1XWGA 4OFMA 4DEJA 4V1Ap 2HZFA 5DBQA 2HSMA 1MTCA 4L5LA 4GQFA 4XTSA 4MA9A 4J57E 11GSA 4GSNA 4K0GA 3H79A 2NPBA 5ID2B 3KZQA 4BVYB 5CO3A 5DQYA 2QGVA 1M9BA 1PRXA 1GWCA 1MD4A 2FGXA 5LNKe 5F05A 2N5FA 3LEFA 1F2EA 3I6AA 2BTOT 5A4UA 3HA9A 4G2EA 5AN1A 4PTSA 3DVWA 3NOFA 2OA7A 1KTEA 4EKZA 5F06A 2V41A 4WBRD 1X5EA 3L9UA 3P7XA 3ZFLA 2LJAA 5CP1A 2GT6A 5F07A 5JCWA 4GSSA 2FWEA 4WR5A 2FLSA 2V1MA 4E8HA 5HFKA 1F3BA 2HRKA 3GNJA 5B8BA 4BWSA 4ACSA 1TXXA 2IN3A 3A5WA 3VWWA 3QDNA 1FOVA 8GSSA 2M72A 1K0DA 5DCGA 1PQNA 4K2XA 2L57A 1K0MA 5B6NA 4XRDA 2NVLA 2DKIA 2XPDA 4F9ZA 3VFIA 3VLNA 3HJOA 4AF2A 1EWXA 2EIQA 4KDXA 3EYTA 1B9YC 2XPEA 3FR3A 4BPYA 4K2DA 1TJDA 1OE8A 4IP6A 1UA5A 4NV2A 4PQHA 3HYPA 4HQSA 1TKDB 1GSQA 5KEJA 1JFUA 4EL1A 4KGIA 3FZ5A 1MDIA 2BMXA 1F6MC 5DAKA 4I2UA 4E8EA 4O7HA 5ECSA 5A4VA 3FZAA 2H0HA 4ZL7A 3F4TA 3KMOA 3GKKA 4MF6A 1FO5A 1GUKA 2E2GA 3ME8A 1O85A 5D96A 5IIZA 4FYBA 2JL4A 2X8GA 4FO5A 1A0RP 4WXTA 3DD3A 2X4AA 2IMKA 1ZYEA 3LGCA 3ZIJA 5G31A 4LL1B 1S3DA 6GSXA 4JR4A 5IOWA 3TRPA 2D2ZA 3QD9A 3F6FA 1EV9A 3GYKA 3KP9A 1EV4A 1GLQA 1Z6MA 3G7YA 2FWFA 1VGLA 2H6ZA 5CRGA 2VM2A 3UVHA 4EDZA 1GP1A 3E3EA 3EWLA 2OE3A 1Q4JA 2GQMA 3PR8A 2WZ9A 4NAXA 2IMEA 3QAWA 4V1Ag 2MMAA 4P3YB 4WBJA 2H70A 4L0UA 3CTFA 2CT6A 3M3MA 3MDKA 1TDIA 3FMWA 4ZBBA 4NPBA 4EVMA 5KN2A 3O76A 2DJ3A 3LORA 1XG8A 3EU3A 4KUNA 2AUVA 5B6MA 2C1YA 2DLXA 2VCZA 1GUMA 20GSA 3UARA 1PKZA 2IMFA 2LJKA 3ISOA 3TKRA 4CW9A 4N11A 2GSQA 3EVIA 4POLA 5D9VA 4F82A 2G0FA 4O32A 4YKFA 1W89A 3M9JA 1AAZA 4F0BA 3KH9A 1G7OA 2VOCA 1O6JA 1M99A 3FYGA 5E4WA 1ERVA 1FVJA 4LMWA 4KCAA 3E0UA 4YQVA 1ZYQB 3SWLA 2C3NA 4MF5A 5C00A 3HDCA 3GSSA 3GX0A 3GV1A 1WPIA 1HYUA 5ECMB 5G30A 4Q5QA 3IK7A 2PVQA 1XW6A 1JLVA 3FZ9A 1DBYA 5BRTA 4POBA 4MJAA 3GTUB 5IMZA 5IMFA 3WGXA 4HZ2A 3ZL5A 4FQUA 4G0KA 5EL8A 4ZB8A 1GH2A 1USBA 2TRCP 3IHQA 4RI7A 3KCMA 4MJBA 2H74A 1TOFA 4OO4A 2IL3A 2X8HA 3PINA 4EXJA 3QAGA 3GSTA 3VI7A 2DJ2A 3CMIA 1PX6A 4TN8A 3U5RE 1S3AA 2ZUPA 2IWTA 1ABAA 1PA3A 1MDKA 1SK0A 2VM1A 4NMUA 1FVKA 16GSA 6GSSA 2E0QA 3IDVA 5ECIB 2FUG2 4JU5A 3UBLA 4MP4A 2GQKA 4OD7A 4JRRA 5KN1A 5GAPD 2C0GA 2I1UA 5L71A 2GTUA 4F03A 2HYXA 1XIYA 3TJBA 4CY6A 2C3TA 2HT9A 4EE0A 2LNTA 5D93A 3FKFA 4IN0A 2WS2A 2GVPA 3HY2A 5DJMA 1X9SB 1Z6NA 4Z2TA 2WB9A 4FIWA 4I97A 1LBKA 1GSSA 2H30A 5DVBA 5IPHA 2OJLA 1XVWA 5J9BA 4GCIA 5DJLA 1QMVA 1A2JA 1ST9A 1DUGA 2HSHA 2FNOA 4NV5A 1V2AA 3GKMA 1B48A 4OWYA 3I9V2 2HI7A 2IFQB 5D9WA 3FK8A 4PGTA 1K0AA 1K3YA 3ZLPA 2YV9A 4DSSB 2G2QA 1NM3A 2E2MA 4Z2RA 1DSBA 1AC1A 1U3AA 4WKWA 3VK9A 4KE3A 4KB3A 5JCGA 3KTBA 1K0BA 4MH2A 3HJMA 4V2MA 1PKWA 1XWCA 4HJMA 2RM5A 2LRTA 4LA1A 3W8SA 3SBCA 2H73A 3Q6OA 1Q98A 1XZOA 4TR0A 2MYGA 4EC0A 1EZKA 1X0RA 2CV4A 3IE3A 4AJ7A 3LQ7A 3K8NA 2A2SA 3HCZA 2DKHA 2JSZA 3O6TA 4EUYA 3FW2A 4OFNA 4BL7B 4N10A 2H1BA 2LJRA 2QKEA 5D9XA 2QSIA 3L9SA 3DIEA 4CDOA 3PGTA 5HR1A 2DJ1A 4GRFA 1S3RA 1V40A 3US3A 1ZYPA 3E9JB 3HJPA 1R4WA 2B5YA 2VLTA 4X1UA 3F4SA 5KOXA 2C0DA 1HNCA 4HSCX 3CBUA 1OKTA 1EP8A 3GFKA 5ID2A 1GLPA 4BVYA 2CX3A 1TK0B 1E2YA 3GA4A 3J7Yk 2MMNA 1OE7A 3KP8A 2R0GA 3CYNA 2GT5A 1PL1A 4QL9A 2VUPA 3KM6A 3H8QA 1I9DA 4I6XA 5G5EA 3EMXA 2YP6A 3P8WA 2V6OA 2YANA 3WYWA 4JBBA 3QR6A 3F3RA 2L4CA 4TXOA 1O73A 1YZXA 4ZB9A 5DDLA 1GSFA 5H5QA 2A2PA 4I8BA 1PGTA 3A2VA 4I5QA 4OCEA 2H01A 2XBIA 3RHBA 2J23A 2QA1A 2C8UA 2OBIA 2VO4A 4JEDA 1EP7A 2R2JA 4KSOA 1NHYA 1PN0A 3R2QA 3D0ZA 3WT2A 2MBSA 4WEYA 4N0VA 1BX9A 1BYEA 3D4TA 2YOIA 4LL4B 3S9FA 1O81A 3CRTA 4HJ2A 5KN3A 3TJJA 4O5QA 4TXVA 2R6KA 3DMLA 2H1AA 1SD9A 2H8LA 5FHIA 2H0IA 1GTIA 4XS4B 4TRXA 1GL8A 3KGKA 3IC8A 5AIVA 3LXZA 2B6MA 1XW5A 4POMA 5LD0A 3GURA 4KA0A 1QUWA 4OO5A 1XFLA 3D4MA 2I3YA 3AY8A 3VURA 1V57A 1GSEA 3G9BA 3KXOA 2F8AA 3QFAC 2VCXA 4LMVA 1YEXA 1DE1A 2P31A 1ZGNA 3ME7A 4MDCA 3L9VA 1NSWA 3A2WA 4GTUA 3MWHA 1T4ZA 3D6IA 1AXDA 3H1NA 4PUFC 5GAND 1WIKA 1G0TA 3TKSC 2AB6A 1OC9B 2ZNMA 4IS0A 1G6YA 2VIMA 1LU4A 4IGJA 6GSWA 4PUAA 1YJ6A 5IO0A 2WFCA 3ERWA 4I2TA 3VPQA 2YWOA 1AUCA 5FT3A 4MLYA 1XOBA 1ZL9A 4PQIA 3LW9A 1EOHA 4MNNA 5EPFA 2PMTA 2OE1A 3DXBA 2QA2A 1VF4A 1UVZA 4OCFA 1Y6EA 3BJ5A 4K7OA 2E7PA 1SD8A 5DALB 4O5UA 2GGTA 3Q19A 1EEMA 3TKQA 2XHFA 4FYUA 2PU9C 1JZDA 4IQ1A 4TKYA 1U6TA 2NBSA 4HEA2 1H4OA 2M46A 4PNGA 1PSQA 2LRNA 2ZCTA 4GQCA 4XS6A 1XOAA 5HQPA 4YH2A 2LQQA 2CZ3A 3GN3A 3G7IA 2LKUA 2ES7A 4ISDA 3BBYA 4ZB6A 1F9MA 4RQXA 4Z7XA 3ZTLA 1HNBA 2L5LA 1A8YA 2F8FA 4KH7A 3VWVA 4G0IA 3GH6A 1OC8A 2YPMA 3CTGA 4PQ1A 5LCZA 3UBKA 2K9FA 3DKSA 1AQWA 3TB2A 4RUVA 3TKSE 1N2AA 4ML6A 5CNWA 5IOXA 3UMAA 1U88A 3U6VA 2JSYA 5ECRB 4BA7A 2IIYA 1R5PA 3GTUA 5H5SA 1KBNA 3ZRDA 5AIXA 4L5OA 4IELA 1SKWB 4CHSA 2HRNA 3DGQA 1YEPA 2PUKC 3LYKA 5IPGA 2PPTA 2MMZA 1XWAA 2YJ7A 1V98A 19GSA 5H5RA 4RI6A 3ZMKA 1J08A 1GSDA 1AW9A 5HR0A 1OKDA 2FA4A 4YKGA 5JWRB 2TRXA 1AIUA 2H71A 1PN9A 5JCUA 4MCUA 1A2MA 3ED3A 2OACA 2GZYA 4MF7A 1YDKA 4XS1A 2FWGA 4TR1B 1BEDA 2NDOA 2O7KA 2VD0A 4IJIA 2WDUA 3EPTA 3GKXA 4L0WA 3ZIVA 1RQMA 1T00A 3UIWA 3IXRA 3F6DA 3QFBC 2KP2A 3HKRA 1PFOA 5C04A 3TDGA 2YJHA 4QL7A 2MBTA 3C71A 1M0UA 2YWIA 2O8VB 2H6XA 3BCKA 2DIZA 2CAQA 4BWQA 4EDYA 1RW1A 4OFTA 3VWUA 5ECNB 3WD6A 1CQGA 5E59A 4POKA 3KJYA 2WCIA 4MK3A 2FWHA 1VF2A 12GSA 2IFQA 1GNEA 1ZMAA 3RPPA 1TU7A 2X8CA 3UVTA 1Z7RA 1ZZYA 4NWYA 3R3EA 1AQVA 2FHEA 4DSSA 3ZVJA 5A4WA 4ID0A 5ELAA 3GIXA 4TOPA 2LS5A 2H75A 5B7CA 3GHAA 4CY8A 4K7IA 4MJEA 5BMUA 3D22A 3M1GA 1Z3EA 4L8EA 1ZCPA 1M2BA 4N30A 2YCDA 3C1SA 4BVXA 3EC3A 3D5JA 2L6DA 3GUSA 3QMXA 1B8XA 1JZOA 1ILOA 4D73A 5IQYA 3RDWA 2MZCA 3FRCA 3BOAA 5F0GA 2O87A 2ON7A 4K8MA 1OVNA 1VF1A 3EURA 2LNSA 2J9HA 3HXSA 5JWOB 2CQ9A 2A4HA 1B4QA 3CXGA 1SJZA 4ECJA 1BQ7A 5ECOB 2REMA 4XIHA 4MH3A 3NIVA 3TCOA 1X9WB 3FY7A 3CQFA 3UEMA 2OBKA 2EC4A 2IMDA 1EGRA 1UN2A 1TK8B 1B9XC 1HQOA 3LSZA 2EIRA 3QCPA 3CSIA 3ZYWA 1ACVA 1T1VA 3LWAA 2UZ8A 1THXA 2JZSA 4XCSA 2B5EA 1EEJA 5D73A 3W6GA 4F2IA 5IMCA 4MPGA 2RIIA 2VAFA 2X64A 2YZUA 3IRAA 4GF0A 4G19A 1T8EB 1NW2A 1M3JA 2C3QA 2V6KA 2PGTA 2B7KA 3D21A 4K7NA 2CA8A 6GSUA 5G1LA 3A5IA 5AGYA 3QPMA 2HRAA 1K0CA 3FR6A 2N5AA 3MAKA 3DWVA 1TTZA 3ZVJD 2R37A 3F3QA 4IP1A 2MMOA 3TKPA 3ZREA 3ZMLA 1QGVA 1K0OA 2KLXA 5ECPB 4Q5FA 1ERUA 2RLIA 3ZITA 1E6BA 4GXZA 1S3CA 1JZRA 4XS4A 2OE0A 4USSA 1O8WA 1T7PB 2PN8A 5A5KA 1Z9HA 1YF1A 2C80A 3TGZA 3F8UA 3UOMA 2CVBA 4KSMA 2HNLA 4IQAA 4ECIA 1XCCA 6GSTA 5KN0A 5CRHA 4AJ6A 3GX8A 1OYJA 4H86A 2VCTA 1ML6A 1A0FA 4IW9A 2VLUA 2KOKA 2HZEB 2L59A 4PURA 1ERTA 1K0NA 4EIQA 1TRWA 2RM6A 3CRUA 3JCML 2LV3A 5EY6A 1R7HA 1XWBA 2V32A 4GSTA 1YKCA 4FYCA 3IPZA 4IVFA 5G5FA 3CSHA 1GUHA 3LXTA 4A5PA 4ILFA 1SENA 4HU7A 3PPUA 3P2AA 2DJJA 3HVXA 1OC9A 1QQ2A 2Z9SA 4ECBA 1JLWA 1G7EA 1YF0A 4KX4A 3F0IA 1URMA 1PX7A 2YNXA 4MJCA 1WE0A 1Z5YE 1SL2B 1TI1A 2PVOC 3M0FA 1JZWA 2JADA 2CVDA 1SKRB 1QFNA 4DVCA 2GQLA 1M2AA 4G10A 1M9AA 1FHEA 3HHVA 4MABA 2IJYA 1G6WA 2YWMA 4G9HA 5GSTA 3QOUA 1Z7PA 4TXOB 4XRAA 3KIJA 2LRCA 1OAZA 2BJXA 4EIPA 5IMAA 1PD21 1U3IA 2GS3A 3KTLA 1XW9A 4YQMA 1YKAA 5ELGA 1TRVA 1R5AA 5J41A 1N8JA 3TJGA 5DQSA 5DALA 4KCEA 3HVVA 1W4VA 4F0CA 1SL0B 4IJ3A 2WJUA 3LJRA 3GL5A 2K8SA 3M9KA 3C8EA 7GSSA 2A4VA 1A8LA 1ON4A 3DRNA 5D9TA 5CAXA 2FD3A 4HDEA 3HZ8A 3L78A 2B5XA 3LFLA 1NHOA 1OC3A 4V2LA 1ZYNA 1LJRA 5CRWA 2B1LA 2H0GA 1A2LA 18GSA 3FZ4A 3H4KA 4NHWA 4QQ7A 5HFGA 1SU9A 1XWKA 2GLRA 1SK1A 1KNGA 2FCHA 1SJ6A 1TI3A 4KDUA 4ZBAA 2B1KA 1CQHA 1EGOA 3IAM2 2M80A 2HSYA 2GZZA 2JU5A 3TJKA 1TP9A 2KUCA 5ENUA 1U87A 5IMVA 1QK8A 2R5GA 2WULA 4K9ZA 2VD1A 1F3AA 2A2RA 3Q74A 3KEBA 1WRYA 1SYRA 3HVSA 1B4PA 4ECCA 4JE1A 2X49A 3C7MA 3VPTA 3MYDA 2C0FA 3DEXA 3IOSA 5J9CA 1GTBA 1BJXA 2DJ0A 1C72A 3F4RA 3ZFBA 3KH7A 1WJKA 2H1DA 2OADA 1SYXA 1GRXA 2LUSA 4AJ8A 3UL3A 3Q18A 2AV4A 4N0ZA 2TIRA 4X43A 2I9HA 2AAWA 5AISA 2LTKA 3APQA 2CZ2A 1SK2A 1A23A 2DSAA 5ECKB 1UC7A 4IHUA 5J3RA 4ZL9A 10GSA 2DC5A 1TK5B 3H93A 2VLVA 1GTAA 1TU8A 4TVEA 2HE3A 1ZOFA 3APOA 1BAYA 3GH9A 5IMDA 3I43A 3IK9A 2LEGA 3RAZA 5DAKB 4PX1A 1XPVA 4MZBA 4TR1A 2WRTA 1QXHA 4KF9A 3IC4A 1IYHA 1HD2A 2AYTA 4ZBDA 2F51A 1GTUA 4K0NA 5GSSA 3IV4A 3KMNA 2JACA 1J9BA 4K1FA 4HUAA 1FOHA 4HZ4A 4NHZA 1X5CA 2VL2A 2VL3A 3BD2A 4HOJA 4KAEA 4K6XA 5CYYA 4DSQA 2GDRA 2H1GA 4K5SA 3LG6A 3HZ4A 1JHBA 1PL2A 3IA1A 2CVKA 5INYA 3M8NA 3TRXA 4J56E 4K5RA 2L5OA 5ABRA 4EO3A 14GSA 1YQ1A 3DYRA 4GLTA 5DCHA 2JZRA 4YAPA 3WT1A 2RUFA 5FWGA 4DSRA 2YWNA 5ECLB 1WWJA 4WF4A 1O8XA 4MPFA 2H19A 4MZCA 3MIXA 4WETA 1TW9A 2H76A 2H6YA 1ERWA 3ERGA 1X9MB 4AGSA 3APSA 2P5RA 3TUEA 2LSTA 4V2NA 1XVQA 2HLSA 3A2XA 2HXKA 1V58A 2P0GA 1GSUA 1FB0A 4GWRA 3FHKA 5JWQB 4WR4A 2DJKA 2GSTA 3IR4A 3IAS2 2AHEA 1FG4A 1MEKA 2DBCA 3N5OA 5GZZB 4ZXGA 22GSA 1IYIA 4MMMA 1BG5A 4ZL8A 3GKNA 5EVOA 3J7Yb 9GSSA 5B8AA 4PXOA 1THOA 1HNAA 1SJIA 1FAAA 2I81A 4HS1A
chains in the Genus database with same CATH topology
4FH8A 2DMLA 3C1RA 2O85A 4NXIA 3GRXA 4TR4A 3EE2A 2VL9A 1KEBA 3O3TA 4YQUA 2QC7A 4ULXA 2O89A 4HU9A 1AQXA 4RQRA 1V9WA 2HRFA 5CREA 4TW5A 2KHPA 3L4NA 2VCWA 3ZZXA 1VF3A 5F8BA 2H72A 1MDJA 1WP0A 3MSZA 1DE2A 4HI7A 1PMTA 1M7TA 4JZQA 1H75A 2C0EA 4MZWA 5J4UA 3KD0A 6GSYA 2FA8A 1R26A 1TRSA 2CAIA 2IPAA 5HR3A 1J0FA 4Z2UA 3GL3A 3IHGA 4Q5RA 4BL7A 1MD3A 2B3SA 2VL2C 3F63A 4KNDA 2OKAA 2NTOA 3UJ1A 4G0LA 3TOTA 4OMVA 3DVXA 3P90A 5HFIA 5KOWA 3EINA 3G7JA 3CSJA 4J2FA 5J5NA 4Q5NA 2DMMA 3RPNA 3HD5A 2YV7A 1SKSB 3TOUA 1TRUA 1T3BA 1SL1B 1VRSD 2N5BA 2R0CA 3RHCA 4HQZA 1RK4A 2F9SA 2ON5A 1YY7A 4PNFA 3FR9A 4X4JA 2L4QA 4TR3A 3L0HA 1T4YA 1XXUA 3FEUA 1M2DA 2DIYA 3UAPA 1X5DA 3I69A 2B7JA 5ECQB 4IBPA 2XC2A 3LYPA 2GSSA 1GNWA 4BVXB 2IMIA 3V1WA 3BCIA 3OR5A 2YN1A 3IBHA 2ALBA 2R4VA 4ICYA 3TRQA 4D73B 1FB6A 4EF0A 1A24A 1O7UA 3PH9A 3EMPA 3ERFA 1F37A 4LLRA 2XBQA 2KP1A 1Y25A 4ML1A 2VCQA 1WOUA 2JZTA 2RUEA 3C73A 6GSVA 3EU4A 5HR2A 2HZEA 4WF5A 2GSRA 1K3LA 3TKSA 2YZHA 4KW6A 2FY6A 2X99A 1GULA 2F3MA 5IM9A 3WGEA 1GSYA 4ZILA 2I4AA 2PERA 5G2ZA 3NZNA 4JR6A 4XHMA 2AJQB 1EOGA 3WGDA 2L6CA 4KDYA 2CX4A 5IO2A 4YAVA 5COHA 4O92A 4ZIJA 2K6VA 2VCVA 2LQOA 4O5RA 2PBJA 3A3TA 5D8IA 2EIOA 1FW1A 1XBSA 5ECHB 2H66A 3GMFA 1K3OA 13GSA 2K8VA 2C4JA 1WMJA 3N9JA 2HFDA 2K18A 3MNGA 3VI5A 2WGRA 4IKHA 2R0PA 3QAVA 2PWJA 2P5QA 2V2GA 5G1KA 17GSA 3VWXA 3TJFA 1I5GA 2GZPA 2R3XA 3W8JA 3F9UA 5CRDA 4X0XA 3RBTA 1XWGA 4OFMA 4DEJA 4V1Ap 2HZFA 5DBQA 2HSMA 1MTCA 4L5LA 4GQFA 4XTSA 4MA9A 4J57E 11GSA 4GSNA 4K0GA 3H79A 2NPBA 5ID2B 3KZQA 4BVYB 5CO3A 5DQYA 2QGVA 1M9BA 1PRXA 1GWCA 1MD4A 2FGXA 5LNKe 5F05A 2N5FA 3LEFA 1F2EA 3I6AA 2BTOT 5A4UA 3HA9A 4G2EA 5AN1A 4PTSA 3DVWA 3NOFA 2OA7A 1KTEA 4EKZA 5F06A 2V41A 4WBRD 1X5EA 3L9UA 3P7XA 3ZFLA 2LJAA 5CP1A 2GT6A 5F07A 5JCWA 4GSSA 2FWEA 4WR5A 2FLSA 2V1MA 4E8HA 5HFKA 1F3BA 2HRKA 3GNJA 5B8BA 4BWSA 4ACSA 1TXXA 2IN3A 3A5WA 3VWWA 3QDNA 1FOVA 8GSSA 2M72A 1K0DA 5DCGA 1PQNA 4K2XA 2L57A 1K0MA 5B6NA 4XRDA 2NVLA 2DKIA 2XPDA 4F9ZA 3VFIA 3VLNA 3HJOA 4AF2A 1EWXA 2EIQA 4KDXA 3EYTA 1B9YC 2XPEA 3FR3A 4BPYA 4K2DA 1TJDA 1OE8A 4IP6A 1UA5A 4NV2A 4PQHA 3HYPA 4HQSA 1TKDB 1GSQA 5KEJA 1JFUA 4EL1A 4KGIA 3FZ5A 1MDIA 2BMXA 1F6MC 5DAKA 4I2UA 4E8EA 4O7HA 5ECSA 5A4VA 3FZAA 2H0HA 4ZL7A 3F4TA 3KMOA 3GKKA 4MF6A 1FO5A 1GUKA 2E2GA 3ME8A 1O85A 5D96A 5IIZA 4FYBA 2JL4A 2X8GA 4FO5A 1A0RP 4WXTA 3DD3A 2X4AA 2IMKA 1ZYEA 3LGCA 3ZIJA 5G31A 4LL1B 1S3DA 6GSXA 4JR4A 5IOWA 3TRPA 2D2ZA 3QD9A 3F6FA 1EV9A 3GYKA 3KP9A 1EV4A 1GLQA 1Z6MA 3G7YA 2FWFA 1VGLA 2H6ZA 5CRGA 2VM2A 3UVHA 4EDZA 1GP1A 3E3EA 3EWLA 2OE3A 1Q4JA 2GQMA 3PR8A 2WZ9A 4NAXA 2IMEA 3QAWA 4V1Ag 2MMAA 4P3YB 4WBJA 2H70A 4L0UA 3CTFA 2CT6A 3M3MA 3MDKA 1TDIA 3FMWA 4ZBBA 4NPBA 4EVMA 5KN2A 3O76A 2DJ3A 3LORA 3EU3A 4KUNA 2AUVA 5B6MA 2C1YA 2DLXA 2VCZA 1GUMA 20GSA 3UARA 1PKZA 2IMFA 2LJKA 3ISOA 3TKRA 4CW9A 4N11A 2GSQA 3EVIA 4POLA 5D9VA 4F82A 2G0FA 4O32A 4YKFA 1W89A 3M9JA 1AAZA 4F0BA 3KH9A 1G7OA 2VOCA 1O6JA 1M99A 3FYGA 5E4WA 1ERVA 1FVJA 4LMWA 4KCAA 3E0UA 4YQVA 1ZYQB 3SWLA 2C3NA 4MF5A 5C00A 3HDCA 3GSSA 3GX0A 3GV1A 1WPIA 1HYUA 5ECMB 5G30A 4Q5QA 3IK7A 2PVQA 1XW6A 1JLVA 3FZ9A 1DBYA 5BRTA 4POBA 4MJAA 3GTUB 5IMZA 5IMFA 3WGXA 4HZ2A 3ZL5A 4FQUA 4G0KA 5EL8A 4ZB8A 1GH2A 1USBA 2TRCP 3IHQA 4RI7A 3KCMA 4MJBA 2H74A 1TOFA 4OO4A 2IL3A 2X8HA 3PINA 4EXJA 3QAGA 3GSTA 3VI7A 2DJ2A 3CMIA 1PX6A 4TN8A 3U5RE 1S3AA 2ZUPA 2IWTA 1ABAA 1PA3A 1MDKA 1SK0A 2VM1A 4NMUA 1FVKA 16GSA 6GSSA 2E0QA 3IDVA 5ECIB 2FUG2 4JU5A 3UBLA 4MP4A 2GQKA 4OD7A 4JRRA 5KN1A 5GAPD 2C0GA 2I1UA 5L71A 2GTUA 4F03A 2HYXA 1XIYA 3TJBA 4CY6A 2C3TA 2HT9A 4EE0A 2LNTA 5D93A 3FKFA 4IN0A 2WS2A 2GVPA 3HY2A 5DJMA 1X9SB 1Z6NA 4Z2TA 2WB9A 4FIWA 4I97A 1LBKA 1GSSA 2H30A 5DVBA 5IPHA 2OJLA 1XVWA 5J9BA 4GCIA 5DJLA 1QMVA 1A2JA 1ST9A 1DUGA 2HSHA 2FNOA 4NV5A 1V2AA 3GKMA 1B48A 4OWYA 3I9V2 2HI7A 2IFQB 5D9WA 3FK8A 4PGTA 1K0AA 1K3YA 3ZLPA 2YV9A 4DSSB 2G2QA 1NM3A 2E2MA 4Z2RA 1DSBA 1AC1A 1U3AA 4WKWA 3VK9A 4KE3A 4KB3A 5JCGA 3KTBA 1K0BA 4MH2A 3HJMA 4V2MA 1PKWA 1XWCA 4HJMA 2RM5A 2LRTA 4LA1A 3W8SA 3SBCA 2H73A 3Q6OA 1Q98A 1XZOA 4TR0A 2MYGA 4EC0A 1EZKA 1X0RA 2CV4A 3IE3A 4AJ7A 3LQ7A 3K8NA 2A2SA 3HCZA 2DKHA 2JSZA 3O6TA 4EUYA 3FW2A 4OFNA 4BL7B 4N10A 2H1BA 2LJRA 2QKEA 5D9XA 2QSIA 3L9SA 3DIEA 4CDOA 3PGTA 5HR1A 2DJ1A 4GRFA 1V40A 3US3A 1ZYPA 3E9JB 3HJPA 1R4WA 2B5YA 2VLTA 4X1UA 3F4SA 5KOXA 2C0DA 1HNCA 3CBUA 1OKTA 1EP8A 3GFKA 5ID2A 1GLPA 4BVYA 2CX3A 1TK0B 1E2YA 3GA4A 3J7Yk 2MMNA 1OE7A 3KP8A 2R0GA 3CYNA 2GT5A 1PL1A 4QL9A 2VUPA 3KM6A 3H8QA 1I9DA 4I6XA 5G5EA 3EMXA 2YP6A 3P8WA 2V6OA 2YANA 3WYWA 4JBBA 3QR6A 3F3RA 2L4CA 4TXOA 1O73A 1YZXA 4ZB9A 5DDLA 1GSFA 5H5QA 2A2PA 4I8BA 1PGTA 3A2VA 4I5QA 4OCEA 2H01A 2XBIA 3RHBA 2J23A 2QA1A 2C8UA 2OBIA 2VO4A 4JEDA 1EP7A 2R2JA 4KSOA 1NHYA 1PN0A 3R2QA 3D0ZA 3WT2A 2MBSA 4WEYA 4N0VA 1BX9A 1BYEA 3D4TA 2YOIA 4LL4B 3S9FA 1O81A 3CRTA 4HJ2A 5KN3A 3TJJA 4O5QA 4TXVA 2R6KA 3DMLA 2H1AA 1SD9A 2H8LA 5FHIA 2H0IA 1GTIA 4XS4B 4TRXA 1GL8A 3KGKA 3IC8A 5AIVA 3LXZA 2B6MA 1XW5A 4POMA 5LD0A 3GURA 4KA0A 1QUWA 4OO5A 1XFLA 3D4MA 2I3YA 3AY8A 3VURA 1V57A 1GSEA 3G9BA 3KXOA 2F8AA 3QFAC 2VCXA 4LMVA 1YEXA 1DE1A 2P31A 1ZGNA 3ME7A 4MDCA 3L9VA 1NSWA 3A2WA 4GTUA 3MWHA 1T4ZA 3D6IA 1AXDA 3H1NA 4PUFC 5GAND 1WIKA 1G0TA 3TKSC 2AB6A 1OC9B 2ZNMA 4IS0A 1G6YA 2VIMA 1LU4A 4IGJA 6GSWA 4PUAA 1YJ6A 5IO0A 2WFCA 3ERWA 4I2TA 3VPQA 2YWOA 1AUCA 5FT3A 4MLYA 1XOBA 1ZL9A 4PQIA 3LW9A 1EOHA 4MNNA 5EPFA 2PMTA 2OE1A 3DXBA 2QA2A 1VF4A 1UVZA 4OCFA 1Y6EA 3BJ5A 4K7OA 2E7PA 1SD8A 5DALB 4O5UA 2GGTA 3Q19A 1EEMA 3TKQA 2XHFA 4FYUA 2PU9C 1JZDA 4IQ1A 4TKYA 1U6TA 2NBSA 4HEA2 1H4OA 2M46A 4PNGA 1PSQA 2LRNA 2ZCTA 4GQCA 4XS6A 1XOAA 5HQPA 4YH2A 2LQQA 2CZ3A 3GN3A 3G7IA 2LKUA 2ES7A 4ISDA 3BBYA 4ZB6A 1F9MA 4RQXA 4Z7XA 3ZTLA 1HNBA 2L5LA 1A8YA 2F8FA 4KH7A 3VWVA 4G0IA 3GH6A 1OC8A 2YPMA 3CTGA 4PQ1A 5LCZA 3UBKA 2K9FA 3DKSA 1AQWA 3TB2A 4RUVA 3TKSE 1N2AA 4ML6A 5CNWA 5IOXA 3UMAA 1U88A 3U6VA 2JSYA 5ECRB 4BA7A 2IIYA 1R5PA 3GTUA 5H5SA 1KBNA 3ZRDA 5AIXA 4L5OA 4IELA 1SKWB 4CHSA 2HRNA 3DGQA 1YEPA 2PUKC 3LYKA 5IPGA 2PPTA 2MMZA 1XWAA 2YJ7A 1V98A 19GSA 5H5RA 4RI6A 3ZMKA 1J08A 1GSDA 1AW9A 5HR0A 1OKDA 2FA4A 4YKGA 5JWRB 2TRXA 1AIUA 2H71A 1PN9A 5JCUA 4MCUA 1A2MA 3ED3A 2OACA 2GZYA 4MF7A 1YDKA 4XS1A 2FWGA 4TR1B 1BEDA 2NDOA 2O7KA 2VD0A 4IJIA 2WDUA 3EPTA 3GKXA 4L0WA 3ZIVA 1RQMA 1T00A 3UIWA 3IXRA 3F6DA 3QFBC 2KP2A 3HKRA 5C04A 3TDGA 2YJHA 4QL7A 2MBTA 3C71A 1M0UA 2YWIA 2O8VB 2H6XA 3BCKA 2DIZA 2CAQA 4BWQA 4EDYA 1RW1A 4OFTA 3VWUA 5ECNB 3WD6A 1CQGA 5E59A 4POKA 3KJYA 2WCIA 4MK3A 2FWHA 1VF2A 12GSA 2IFQA 1GNEA 1ZMAA 3RPPA 1TU7A 2X8CA 3UVTA 1Z7RA 1ZZYA 4NWYA 3R3EA 1AQVA 2FHEA 4DSSA 3ZVJA 5A4WA 4ID0A 5ELAA 3GIXA 4TOPA 2LS5A 2H75A 5B7CA 3GHAA 4CY8A 4K7IA 4MJEA 5BMUA 3D22A 3M1GA 1Z3EA 4L8EA 1ZCPA 1M2BA 4N30A 2YCDA 3C1SA 4BVXA 3EC3A 3D5JA 2L6DA 3GUSA 3QMXA 1B8XA 1JZOA 1ILOA 4D73A 5IQYA 3RDWA 2MZCA 3FRCA 3BOAA 5F0GA 2O87A 2ON7A 4K8MA 1OVNA 1VF1A 3EURA 2LNSA 2J9HA 3HXSA 5JWOB 2CQ9A 2A4HA 1B4QA 3CXGA 1SJZA 4ECJA 1BQ7A 5ECOB 2REMA 4XIHA 4MH3A 3NIVA 3TCOA 1X9WB 3FY7A 3UEMA 2OBKA 2EC4A 2IMDA 1EGRA 1UN2A 1TK8B 1B9XC 1HQOA 3LSZA 2EIRA 3QCPA 3CSIA 3ZYWA 1ACVA 1T1VA 3LWAA 2UZ8A 1THXA 2JZSA 4XCSA 2B5EA 1EEJA 5D73A 3W6GA 4F2IA 5IMCA 4MPGA 2RIIA 2VAFA 2X64A 2YZUA 3IRAA 4GF0A 4G19A 1T8EB 1NW2A 2C3QA 2V6KA 2PGTA 2B7KA 3D21A 4K7NA 2CA8A 6GSUA 5G1LA 3A5IA 5AGYA 3QPMA 2HRAA 1K0CA 3FR6A 2N5AA 3MAKA 3DWVA 1TTZA 3ZVJD 2R37A 3F3QA 4IP1A 2MMOA 3TKPA 3ZREA 3ZMLA 1QGVA 1K0OA 2KLXA 5ECPB 4Q5FA 1ERUA 2RLIA 3ZITA 1E6BA 4GXZA 1S3CA 1JZRA 4XS4A 2OE0A 4USSA 1O8WA 1T7PB 2PN8A 5A5KA 1Z9HA 1YF1A 2C80A 3TGZA 3F8UA 3UOMA 2CVBA 4KSMA 2HNLA 4IQAA 4ECIA 1XCCA 6GSTA 5KN0A 5CRHA 4AJ6A 3GX8A 1OYJA 4H86A 2VCTA 1ML6A 1A0FA 4IW9A 2VLUA 2KOKA 2HZEB 2L59A 4PURA 1ERTA 1K0NA 4EIQA 1TRWA 2RM6A 3CRUA 3JCML 2LV3A 5EY6A 1R7HA 1XWBA 2V32A 4GSTA 1YKCA 4FYCA 3IPZA 4IVFA 5G5FA 3CSHA 1GUHA 3LXTA 4A5PA 4ILFA 1SENA 4HU7A 3PPUA 3P2AA 2DJJA 3HVXA 1OC9A 1QQ2A 2Z9SA 4ECBA 1JLWA 1G7EA 1YF0A 4KX4A 3F0IA 1URMA 1PX7A 2YNXA 4MJCA 1WE0A 1Z5YE 1SL2B 1TI1A 2PVOC 3M0FA 1JZWA 2JADA 2CVDA 1SKRB 1QFNA 4DVCA 2GQLA 1M2AA 4G10A 1M9AA 1FHEA 3HHVA 4MABA 2IJYA 1G6WA 2YWMA 4G9HA 5GSTA 3QOUA 1Z7PA 4TXOB 4XRAA 3KIJA 2LRCA 1OAZA 2BJXA 4EIPA 5IMAA 1PD21 1U3IA 2GS3A 3KTLA 1XW9A 4YQMA 1YKAA 5ELGA 1TRVA 1R5AA 5J41A 1N8JA 3TJGA 5DQSA 5DALA 4KCEA 3HVVA 1W4VA 4F0CA 1SL0B 4IJ3A 2WJUA 3LJRA 3GL5A 2K8SA 3M9KA 3C8EA 7GSSA 2A4VA 1A8LA 1ON4A 3DRNA 5D9TA 5CAXA 2FD3A 4HDEA 3HZ8A 3L78A 2B5XA 3LFLA 1NHOA 1OC3A 4V2LA 1ZYNA 1LJRA 5CRWA 2B1LA 2H0GA 1A2LA 18GSA 3FZ4A 3H4KA 4NHWA 4QQ7A 5HFGA 1SU9A 1XWKA 2GLRA 1SK1A 1KNGA 2FCHA 1SJ6A 1TI3A 4KDUA 4ZBAA 2B1KA 1CQHA 1EGOA 3IAM2 2M80A 2HSYA 2GZZA 2JU5A 3TJKA 1TP9A 2KUCA 5ENUA 1U87A 5IMVA 1QK8A 2R5GA 2WULA 4K9ZA 2VD1A 1F3AA 2A2RA 3Q74A 3KEBA 1WRYA 1SYRA 3HVSA 1B4PA 4ECCA 4JE1A 2X49A 3C7MA 3VPTA 3MYDA 2C0FA 3DEXA 3IOSA 5J9CA 1GTBA 1BJXA 2DJ0A 1C72A 3F4RA 3ZFBA 3KH7A 1WJKA 2H1DA 2OADA 1SYXA 1GRXA 2LUSA 4AJ8A 3UL3A 3Q18A 2AV4A 4N0ZA 2TIRA 4X43A 2I9HA 2AAWA 5AISA 2LTKA 3APQA 2CZ2A 1SK2A 1A23A 2DSAA 5ECKB 1UC7A 4IHUA 5J3RA 4ZL9A 10GSA 2DC5A 1TK5B 3H93A 2VLVA 1GTAA 1TU8A 4TVEA 2HE3A 1ZOFA 3APOA 1BAYA 3GH9A 5IMDA 3I43A 3IK9A 2LEGA 3RAZA 5DAKB 4PX1A 1XPVA 4MZBA 4TR1A 2WRTA 1QXHA 4KF9A 3IC4A 1IYHA 1HD2A 2AYTA 4ZBDA 2F51A 1GTUA 4K0NA 5GSSA 3IV4A 3KMNA 2JACA 1J9BA 4K1FA 4HUAA 1FOHA 4HZ4A 4NHZA 1X5CA 2VL2A 2VL3A 3BD2A 4HOJA 4KAEA 4K6XA 5CYYA 4DSQA 2GDRA 2H1GA 4K5SA 3LG6A 3HZ4A 1JHBA 1PL2A 3IA1A 2CVKA 5INYA 3M8NA 3TRXA 4J56E 4K5RA 2L5OA 5ABRA 4EO3A 14GSA 1YQ1A 3DYRA 4GLTA 5DCHA 2JZRA 4YAPA 3WT1A 2RUFA 5FWGA 4DSRA 2YWNA 5ECLB 1WWJA 4WF4A 1O8XA 4MPFA 2H19A 4MZCA 3MIXA 4WETA 1TW9A 2H76A 2H6YA 1ERWA 3ERGA 1X9MB 4AGSA 3APSA 2P5RA 3TUEA 2LSTA 4V2NA 1XVQA 2HLSA 3A2XA 2HXKA 1V58A 2P0GA 1GSUA 1FB0A 4GWRA 3FHKA 5JWQB 4WR4A 2DJKA 2GSTA 3IR4A 3IAS2 2AHEA 1FG4A 1MEKA 2DBCA 3N5OA 5GZZB 4ZXGA 22GSA 1IYIA 4MMMA 1BG5A 4ZL8A 3GKNA 5EVOA 3J7Yb 9GSSA 5B8AA 4PXOA 1THOA 1HNAA 1SJIA 1FAAA 2I81A 4HS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FH8 A;  2DML A;  3C1R A;  2O85 A;  4NXI A;  3GRX A;  4TR4 A;  3EE2 A;  2VL9 A;  1KEB A;  3O3T A;  4YQU A;  2QC7 A;  4ULX A;  2O89 A;  4HU9 A;  1AQX A;  4RQR A;  1V9W A;  2HRF A;  5CRE A;  4TW5 A;  2KHP A;  3L4N A;  2VCW A;  3ZZX A;  1VF3 A;  5F8B A;  2H72 A;  1MDJ A;  1WP0 A;  3MSZ A;  1DE2 A;  4HI7 A;  1PMT A;  1M7T A;  4JZQ A;  1H75 A;  2C0E A;  4MZW A;  5J4U A;  3KD0 A;  6GSY A;  2FA8 A;  1R26 A;  1TRS A;  2CAI A;  2IPA A;  5HR3 A;  1J0F A;  3GL3 A;  4Q5R A;  4BL7 A;  1MD3 A;  2B3S A;  2VL2 C;  3F63 A;  4KND A;  2OKA A;  2NTO A;  3UJ1 A;  3TOT A;  4OMV A;  3DVX A;  3P90 A;  5HFI A;  3EIN A;  3G7J A;  3CSJ A;  4J2F A;  5J5N A;  4Q5N A;  2DMM A;  3RPN A;  3HD5 A;  2YV7 A;  1SKS B;  3TOU A;  1TRU A;  1T3B A;  1SL1 B;  1VRS D;  2N5B A;  3RHC A;  4HQZ A;  1RK4 A;  2F9S A;  2ON5 A;  1YY7 A;  4PNF A;  3FR9 A;  2L4Q A;  4TR3 A;  3L0H A;  1T4Y A;  1XXU A;  3FEU A;  1M2D A;  2DIY A;  3UAP A;  1X5D A;  3I69 A;  2B7J A;  5ECQ B;  4IBP A;  2XC2 A;  3LYP A;  2GSS A;  1GNW A;  2IMI A;  3V1W A;  3BCI A;  3OR5 A;  2YN1 A;  3IBH A;  2ALB A;  2R4V A;  3TRQ A;  4D73 B;  1FB6 A;  4EF0 A;  1A24 A;  1O7U A;  3PH9 A;  3EMP A;  3ERF A;  1F37 A;  4LLR A;  2XBQ A;  2KP1 A;  1Y25 A;  4ML1 A;  2VCQ A;  1WOU A;  2JZT A;  2RUE A;  3C73 A;  6GSV A;  3EU4 A;  5HR2 A;  2HZE A;  4WF5 A;  2GSR A;  1K3L A;  3TKS A;  2YZH A;  4KW6 A;  2FY6 A;  2X99 A;  1GUL A;  2F3M A;  5IM9 A;  3WGE A;  1GSY A;  4ZIL A;  2I4A A;  2PER A;  5G2Z A;  3NZN A;  4JR6 A;  4XHM A;  2AJQ B;  1EOG A;  3WGD A;  2L6C A;  4KDY A;  2CX4 A;  5IO2 A;  4YAV A;  5COH A;  4O92 A;  4ZIJ A;  2K6V A;  2VCV A;  2LQO A;  4O5R A;  2PBJ A;  3A3T A;  5D8I A;  2EIO A;  1FW1 A;  1XBS A;  5ECH B;  2H66 A;  3GMF A;  1K3O A;  13GS A;  2K8V A;  2C4J A;  1WMJ A;  3N9J A;  2HFD A;  2K18 A;  3MNG A;  3VI5 A;  2WGR A;  4IKH A;  3QAV A;  2PWJ A;  2P5Q A;  2V2G A;  5G1K A;  17GS A;  3VWX A;  3TJF A;  1I5G A;  2GZP A;  2R3X A;  3W8J A;  3F9U A;  5CRD A;  4X0X A;  3RBT A;  1XWG A;  4OFM A;  4DEJ A;  4V1A p;  2HZF A;  5DBQ A;  1MTC A;  4L5L A;  4GQF A;  4XTS A;  4MA9 A;  4J57 E;  11GS A;  4GSN A;  4K0G A;  3H79 A;  2NPB A;  5ID2 B;  3KZQ A;  5CO3 A;  5DQY A;  2QGV A;  1M9B A;  1PRX A;  1GWC A;  1MD4 A;  2FGX A;  5LNK e;  5F05 A;  2N5F A;  3LEF A;  1F2E A;  3I6A A;  2BTO T;  5A4U A;  3HA9 A;  4G2E A;  5AN1 A;  3DVW A;  3NOF A;  2OA7 A;  1KTE A;  4EKZ A;  5F06 A;  2V41 A;  4WBR D;  1X5E A;  3L9U A;  3P7X A;  3ZFL A;  2LJA A;  5CP1 A;  2GT6 A;  5F07 A;  5JCW A;  4GSS A;  2FWE A;  4WR5 A;  2FLS A;  2V1M A;  4E8H A;  5HFK A;  1F3B A;  3GNJ A;  5B8B A;  4BWS A;  4ACS A;  1TXX A;  2IN3 A;  3A5W A;  3VWW A;  3QDN A;  1FOV A;  8GSS A;  2M72 A;  1K0D A;  5DCG A;  1PQN A;  2L57 A;  1K0M A;  5B6N A;  4XRD A;  2NVL A;  2XPD A;  4F9Z A;  3VFI A;  3VLN A;  3HJO A;  4AF2 A;  1EWX A;  2EIQ A;  4KDX A;  3EYT A;  1B9Y C;  2XPE A;  3FR3 A;  4BPY A;  4K2D A;  1TJD A;  1OE8 A;  4IP6 A;  1UA5 A;  4NV2 A;  4PQH A;  3HYP A;  4HQS A;  1TKD B;  1GSQ A;  5KEJ A;  1JFU A;  4EL1 A;  4KGI A;  3FZ5 A;  1MDI A;  2BMX A;  1F6M C;  5DAK A;  4I2U A;  4E8E A;  4O7H A;  5ECS A;  5A4V A;  3FZA A;  2H0H A;  4ZL7 A;  3F4T A;  3KMO A;  3GKK A;  4MF6 A;  1FO5 A;  1GUK A;  2E2G A;  3ME8 A;  1O85 A;  5D96 A;  5IIZ A;  4FYB A;  2JL4 A;  2X8G A;  4FO5 A;  1A0R P;  4WXT A;  3DD3 A;  2IMK A;  1ZYE A;  3LGC A;  3ZIJ A;  5G31 A;  4LL1 B;  1S3D A;  6GSX A;  4JR4 A;  5IOW A;  3TRP A;  2D2Z A;  3QD9 A;  3F6F A;  1EV9 A;  3GYK A;  3KP9 A;  1EV4 A;  1GLQ A;  1Z6M A;  3G7Y A;  2FWF A;  1VGL A;  2H6Z A;  5CRG A;  2VM2 A;  3UVH A;  4EDZ A;  1GP1 A;  3E3E A;  3EWL A;  2OE3 A;  1Q4J A;  2GQM A;  3PR8 A;  2WZ9 A;  4NAX A;  2IME A;  3QAW A;  4V1A g;  2MMA A;  4P3Y B;  4WBJ A;  2H70 A;  4L0U A;  3CTF A;  2CT6 A;  3M3M A;  3MDK A;  1TDI A;  4ZBB A;  4NPB A;  4EVM A;  5KN2 A;  3O76 A;  2DJ3 A;  3LOR A;  3EU3 A;  4KUN A;  2AUV A;  5B6M A;  2C1Y A;  2DLX A;  2VCZ A;  1GUM A;  20GS A;  3UAR A;  1PKZ A;  2IMF A;  2LJK A;  3ISO A;  3TKR A;  4CW9 A;  4N11 A;  2GSQ A;  3EVI A;  4POL A;  5D9V A;  4F82 A;  2G0F A;  4O32 A;  1W89 A;  3M9J A;  1AAZ A;  4F0B A;  3KH9 A;  1G7O A;  2VOC A;  1O6J A;  1M99 A;  3FYG A;  5E4W A;  1ERV A;  1FVJ A;  4LMW A;  4KCA A;  3E0U A;  4YQV A;  1ZYQ B;  3SWL A;  2C3N A;  4MF5 A;  5C00 A;  3HDC A;  3GSS A;  3GX0 A;  3GV1 A;  1WPI A;  1HYU A;  5ECM B;  5G30 A;  4Q5Q A;  3IK7 A;  2PVQ A;  1XW6 A;  1JLV A;  3FZ9 A;  1DBY A;  4POB A;  4MJA A;  3GTU B;  5IMZ A;  5IMF A;  3WGX A;  4HZ2 A;  3ZL5 A;  5EL8 A;  4ZB8 A;  1GH2 A;  1USB A;  2TRC P;  3IHQ A;  4RI7 A;  3KCM A;  4MJB A;  2H74 A;  1TOF A;  4OO4 A;  2IL3 A;  2X8H A;  3PIN A;  4EXJ A;  3QAG A;  3GST A;  3VI7 A;  2DJ2 A;  3CMI A;  1PX6 A;  4TN8 A;  3U5R E;  1S3A A;  2ZUP A;  2IWT A;  1ABA A;  1PA3 A;  1MDK A;  1SK0 A;  2VM1 A;  4NMU A;  1FVK A;  16GS A;  6GSS A;  2E0Q A;  3IDV A;  5ECI B;  2FUG 2;  4JU5 A;  3UBL A;  4MP4 A;  2GQK A;  4OD7 A;  4JRR A;  5KN1 A;  5GAP D;  2C0G A;  2I1U A;  5L71 A;  2GTU A;  4F03 A;  2HYX A;  1XIY A;  3TJB A;  2C3T A;  2HT9 A;  4EE0 A;  2LNT A;  5D93 A;  3FKF A;  4IN0 A;  2WS2 A;  2GVP A;  3HY2 A;  5DJM A;  1X9S B;  1Z6N A;  2WB9 A;  4FIW A;  4I97 A;  1LBK A;  1GSS A;  2H30 A;  5DVB A;  5IPH A;  2OJL A;  1XVW A;  5J9B A;  4GCI A;  5DJL A;  1QMV A;  1A2J A;  1ST9 A;  1DUG A;  2HSH A;  2FNO A;  4NV5 A;  1V2A A;  3GKM A;  1B48 A;  4OWY A;  3I9V 2;  2HI7 A;  2IFQ B;  5D9W A;  3FK8 A;  4PGT A;  1K0A A;  1K3Y A;  3ZLP A;  2YV9 A;  4DSS B;  2G2Q A;  1NM3 A;  2E2M A;  1DSB A;  1AC1 A;  1U3A A;  4WKW A;  3VK9 A;  4KE3 A;  4KB3 A;  5JCG A;  3KTB A;  1K0B A;  4MH2 A;  3HJM A;  4V2M A;  1PKW A;  1XWC A;  4HJM A;  2RM5 A;  2LRT A;  4LA1 A;  3W8S A;  3SBC A;  2H73 A;  3Q6O A;  1Q98 A;  1XZO A;  4TR0 A;  2MYG A;  4EC0 A;  1EZK A;  1X0R A;  2CV4 A;  3IE3 A;  4AJ7 A;  3LQ7 A;  3K8N A;  2A2S A;  3HCZ A;  2JSZ A;  3O6T A;  4EUY A;  3FW2 A;  4OFN A;  4N10 A;  2H1B A;  2LJR A;  2QKE A;  5D9X A;  2QSI A;  3L9S A;  3DIE A;  4CDO A;  3PGT A;  5HR1 A;  2DJ1 A;  4GRF A;  1V40 A;  3US3 A;  3E9J B;  3HJP A;  1R4W A;  2B5Y A;  2VLT A;  4X1U A;  3F4S A;  2C0D A;  1HNC A;  3CBU A;  1OKT A;  1EP8 A;  3GFK A;  5ID2 A;  1GLP A;  4BVY A;  2CX3 A;  1TK0 B;  1E2Y A;  3GA4 A;  3J7Y k;  2MMN A;  1OE7 A;  3KP8 A;  3CYN A;  2GT5 A;  1PL1 A;  4QL9 A;  2VUP A;  3KM6 A;  3H8Q A;  1I9D A;  4I6X A;  5G5E A;  3EMX A;  2YP6 A;  3P8W A;  2V6O A;  2YAN A;  3WYW A;  4JBB A;  3QR6 A;  3F3R A;  2L4C A;  4TXO A;  1O73 A;  1YZX A;  4ZB9 A;  5DDL A;  1GSF A;  5H5Q A;  4I8B A;  1PGT A;  3A2V A;  4I5Q A;  4OCE A;  2H01 A;  2XBI A;  3RHB A;  2J23 A;  2C8U A;  2OBI A;  2VO4 A;  4JED A;  1EP7 A;  2R2J A;  4KSO A;  1NHY A;  3R2Q A;  3D0Z A;  3WT2 A;  2MBS A;  4WEY A;  4N0V A;  1BX9 A;  1BYE A;  3D4T A;  2YOI A;  4LL4 B;  3S9F A;  1O81 A;  3CRT A;  4HJ2 A;  5KN3 A;  3TJJ A;  4TXV A;  2R6K A;  3DML A;  2H1A A;  1SD9 A;  2H8L A;  5FHI A;  2H0I A;  1GTI A;  4XS4 B;  4TRX A;  1GL8 A;  3KGK A;  5AIV A;  3LXZ A;  2B6M A;  1XW5 A;  4POM A;  5LD0 A;  3GUR A;  4KA0 A;  1QUW A;  4OO5 A;  1XFL A;  3D4M A;  2I3Y A;  3AY8 A;  3VUR A;  1V57 A;  1GSE A;  3G9B A;  3KXO A;  2F8A A;  3QFA C;  2VCX A;  4LMV A;  1YEX A;  1DE1 A;  2P31 A;  1ZGN A;  3ME7 A;  4MDC A;  3L9V A;  1NSW A;  3A2W A;  4GTU A;  3MWH A;  1T4Z A;  3D6I A;  1AXD A;  3H1N A;  4PUF C;  5GAN D;  1WIK A;  1G0T A;  3TKS C;  2AB6 A;  1OC9 B;  2ZNM A;  4IS0 A;  1G6Y A;  2VIM A;  1LU4 A;  4IGJ A;  6GSW A;  4PUA A;  1YJ6 A;  5IO0 A;  2WFC A;  3ERW A;  4I2T A;  3VPQ A;  2YWO A;  1AUC A;  5FT3 A;  4MLY A;  1XOB A;  1ZL9 A;  4PQI A;  1EOH A;  5EPF A;  2PMT A;  2OE1 A;  3DXB A;  1VF4 A;  1UVZ A;  4OCF A;  1Y6E A;  3BJ5 A;  4K7O A;  2E7P A;  1SD8 A;  5DAL B;  2GGT A;  3Q19 A;  1EEM A;  3TKQ A;  2XHF A;  4FYU A;  2PU9 C;  1JZD A;  4IQ1 A;  4TKY A;  1U6T A;  2NBS A;  4HEA 2;  1H4O A;  2M46 A;  4PNG A;  1PSQ A;  2LRN A;  2ZCT A;  4GQC A;  4XS6 A;  1XOA A;  5HQP A;  4YH2 A;  2LQQ A;  2CZ3 A;  3GN3 A;  3G7I A;  2LKU A;  2ES7 A;  4ISD A;  3BBY A;  4ZB6 A;  1F9M A;  4RQX A;  4Z7X A;  3ZTL A;  1HNB A;  2L5L A;  1A8Y A;  2F8F A;  4KH7 A;  3VWV A;  3GH6 A;  1OC8 A;  2YPM A;  3CTG A;  4PQ1 A;  5LCZ A;  3UBK A;  2K9F A;  3DKS A;  1AQW A;  3TB2 A;  4RUV A;  3TKS E;  1N2A A;  4ML6 A;  5CNW A;  5IOX A;  3UMA A;  1U88 A;  3U6V A;  2JSY A;  5ECR B;  4BA7 A;  2IIY A;  1R5P A;  3GTU A;  5H5S A;  1KBN A;  3ZRD A;  5AIX A;  4L5O A;  4IEL A;  1SKW B;  4CHS A;  2HRN A;  3DGQ A;  1YEP A;  2PUK C;  3LYK A;  5IPG A;  2PPT A;  2MMZ A;  1XWA A;  2YJ7 A;  1V98 A;  19GS A;  5H5R A;  4RI6 A;  3ZMK A;  1J08 A;  1GSD A;  1AW9 A;  5HR0 A;  1OKD A;  2FA4 A;  5JWR B;  2TRX A;  1AIU A;  2H71 A;  1PN9 A;  5JCU A;  4MCU A;  1A2M A;  3ED3 A;  2OAC A;  2GZY A;  4MF7 A;  1YDK A;  4XS1 A;  2FWG A;  4TR1 B;  1BED A;  2NDO A;  2O7K A;  2VD0 A;  4IJI A;  2WDU A;  3GKX A;  4L0W A;  3ZIV A;  1RQM A;  1T00 A;  3UIW A;  3IXR A;  3F6D A;  3QFB C;  2KP2 A;  3HKR A;  5C04 A;  3TDG A;  2YJH A;  4QL7 A;  2MBT A;  3C71 A;  1M0U A;  2YWI A;  2O8V B;  2H6X A;  3BCK A;  2DIZ A;  2CAQ A;  4BWQ A;  4EDY A;  1RW1 A;  4OFT A;  3VWU A;  5ECN B;  3WD6 A;  1CQG A;  5E59 A;  4POK A;  3KJY A;  2WCI A;  4MK3 A;  2FWH A;  1VF2 A;  12GS A;  2IFQ A;  1GNE A;  1ZMA A;  3RPP A;  1TU7 A;  2X8C A;  3UVT A;  1Z7R A;  1ZZY A;  4NWY A;  1AQV A;  2FHE A;  4DSS A;  3ZVJ A;  5A4W A;  4ID0 A;  5ELA A;  3GIX A;  4TOP A;  2LS5 A;  2H75 A;  5B7C A;  3GHA A;  4K7I A;  4MJE A;  3D22 A;  3M1G A;  1Z3E A;  4L8E A;  1ZCP A;  1M2B A;  4N30 A;  2YCD A;  3C1S A;  4BVX A;  3EC3 A;  3D5J A;  2L6D A;  3GUS A;  3QMX A;  1B8X A;  1JZO A;  1ILO A;  4D73 A;  5IQY A;  3RDW A;  2MZC A;  3FRC A;  3BOA A;  5F0G A;  2O87 A;  2ON7 A;  4K8M A;  1OVN A;  1VF1 A;  3EUR A;  2LNS A;  2J9H A;  3HXS A;  5JWO B;  2CQ9 A;  1B4Q A;  3CXG A;  1SJZ A;  4ECJ A;  1BQ7 A;  5ECO B;  2REM A;  4XIH A;  4MH3 A;  3NIV A;  3TCO A;  1X9W B;  3FY7 A;  3UEM A;  2OBK A;  2EC4 A;  2IMD A;  1EGR A;  1UN2 A;  1TK8 B;  1B9X C;  1HQO A;  3LSZ A;  2EIR A;  3QCP A;  3CSI A;  3ZYW A;  1ACV A;  1T1V A;  3LWA A;  1THX A;  2JZS A;  4XCS A;  2B5E A;  1EEJ A;  5D73 A;  3W6G A;  4F2I A;  5IMC A;  4MPG A;  2RII A;  2VAF A;  2X64 A;  2YZU A;  3IRA A;  4GF0 A;  4G19 A;  1T8E B;  1NW2 A;  2C3Q A;  2V6K A;  2PGT A;  2B7K A;  3D21 A;  4K7N A;  2CA8 A;  6GSU A;  5G1L A;  5AGY A;  3QPM A;  1K0C A;  3FR6 A;  2N5A A;  3MAK A;  3DWV A;  1TTZ A;  3ZVJ D;  2R37 A;  3F3Q A;  4IP1 A;  2MMO A;  3TKP A;  3ZRE A;  3ZML A;  1QGV A;  1K0O A;  2KLX A;  5ECP B;  4Q5F A;  1ERU A;  2RLI A;  3ZIT A;  1E6B A;  4GXZ A;  1S3C A;  1JZR A;  4XS4 A;  2OE0 A;  1O8W A;  1T7P B;  2PN8 A;  5A5K A;  1Z9H A;  1YF1 A;  2C80 A;  3TGZ A;  3F8U A;  3UOM A;  2CVB A;  4KSM A;  2HNL A;  4IQA A;  4ECI A;  1XCC A;  6GST A;  5KN0 A;  5CRH A;  4AJ6 A;  3GX8 A;  1OYJ A;  4H86 A;  2VCT A;  1ML6 A;  1A0F A;  4IW9 A;  2VLU A;  2KOK A;  2HZE B;  2L59 A;  4PUR A;  1ERT A;  1K0N A;  1TRW A;  2RM6 A;  3CRU A;  3JCM L;  2LV3 A;  5EY6 A;  1R7H A;  1XWB A;  2V32 A;  4GST A;  1YKC A;  4FYC A;  3IPZ A;  4IVF A;  5G5F A;  3CSH A;  1GUH A;  3LXT A;  4ILF A;  1SEN A;  4HU7 A;  3P2A A;  2DJJ A;  3HVX A;  1OC9 A;  1QQ2 A;  2Z9S A;  4ECB A;  1JLW A;  1G7E A;  1YF0 A;  4KX4 A;  3F0I A;  1URM A;  1PX7 A;  2YNX A;  4MJC A;  1WE0 A;  1Z5Y E;  1SL2 B;  1TI1 A;  2PVO C;  3M0F A;  1JZW A;  2JAD A;  2CVD A;  1SKR B;  1QFN A;  4DVC A;  2GQL A;  1M2A A;  4G10 A;  1M9A A;  1FHE A;  3HHV A;  4MAB A;  2IJY A;  1G6W A;  2YWM A;  4G9H A;  5GST A;  3QOU A;  1Z7P A;  4TXO B;  4XRA A;  3KIJ A;  2LRC A;  1OAZ A;  2BJX A;  5IMA A;  1PD2 1;  1U3I A;  2GS3 A;  3KTL A;  1XW9 A;  4YQM A;  1YKA A;  5ELG A;  1TRV A;  1R5A A;  5J41 A;  1N8J A;  3TJG A;  5DQS A;  5DAL A;  4KCE A;  3HVV A;  1W4V A;  4F0C A;  1SL0 B;  4IJ3 A;  2WJU A;  3LJR A;  3GL5 A;  2K8S A;  3M9K A;  3C8E A;  7GSS A;  2A4V A;  1A8L A;  1ON4 A;  3DRN A;  5D9T A;  5CAX A;  2FD3 A;  4HDE A;  3HZ8 A;  3L78 A;  2B5X A;  3LFL A;  1NHO A;  1OC3 A;  4V2L A;  1LJR A;  5CRW A;  2B1L A;  2H0G A;  1A2L A;  18GS A;  3FZ4 A;  3H4K A;  4NHW A;  4QQ7 A;  5HFG A;  1SU9 A;  1XWK A;  2GLR A;  1SK1 A;  1KNG A;  2FCH A;  1SJ6 A;  1TI3 A;  4KDU A;  4ZBA A;  2B1K A;  1CQH A;  1EGO A;  3IAM 2;  2M80 A;  2HSY A;  2GZZ A;  2JU5 A;  3TJK A;  1TP9 A;  2KUC A;  5ENU A;  1U87 A;  5IMV A;  1QK8 A;  2R5G A;  2WUL A;  4K9Z A;  2VD1 A;  1F3A A;  2A2R A;  3Q74 A;  3KEB A;  1WRY A;  1SYR A;  3HVS A;  1B4P A;  4ECC A;  4JE1 A;  3C7M A;  3VPT A;  2C0F A;  3DEX A;  3IOS A;  5J9C A;  1GTB A;  1BJX A;  2DJ0 A;  1C72 A;  3F4R A;  3ZFB A;  3KH7 A;  1WJK A;  2H1D A;  2OAD A;  1SYX A;  1GRX A;  2LUS A;  4AJ8 A;  3UL3 A;  3Q18 A;  2AV4 A;  4N0Z A;  2TIR A;  4X43 A;  2I9H A;  2AAW A;  5AIS A;  2LTK A;  3APQ A;  2CZ2 A;  1SK2 A;  1A23 A;  2DSA A;  5ECK B;  1UC7 A;  4IHU A;  5J3R A;  4ZL9 A;  10GS A;  2DC5 A;  1TK5 B;  3H93 A;  2VLV A;  1GTA A;  1TU8 A;  4TVE A;  2HE3 A;  1ZOF A;  3APO A;  1BAY A;  3GH9 A;  5IMD A;  3I43 A;  3IK9 A;  2LEG A;  3RAZ A;  5DAK B;  4PX1 A;  1XPV A;  4MZB A;  4TR1 A;  2WRT A;  1QXH A;  3IC4 A;  1IYH A;  1HD2 A;  2AYT A;  4ZBD A;  2F51 A;  1GTU A;  4K0N A;  5GSS A;  3IV4 A;  3KMN A;  2JAC A;  1J9B A;  4K1F A;  4HUA A;  4HZ4 A;  4NHZ A;  1X5C A;  2VL2 A;  2VL3 A;  3BD2 A;  4HOJ A;  4KAE A;  4K6X A;  5CYY A;  4DSQ A;  2GDR A;  2H1G A;  3LG6 A;  3HZ4 A;  1JHB A;  1PL2 A;  3IA1 A;  2CVK A;  5INY A;  3M8N A;  3TRX A;  4J56 E;  2L5O A;  5ABR A;  4EO3 A;  14GS A;  1YQ1 A;  3DYR A;  4GLT A;  5DCH A;  2JZR A;  4YAP A;  3WT1 A;  2RUF A;  5FWG A;  4DSR A;  2YWN A;  5ECL B;  1WWJ A;  4WF4 A;  1O8X A;  4MPF A;  2H19 A;  4MZC A;  4WET A;  1TW9 A;  2H76 A;  2H6Y A;  1ERW A;  3ERG A;  1X9M B;  4AGS A;  3APS A;  2P5R A;  3TUE A;  2LST A;  4V2N A;  1XVQ A;  2HLS A;  3A2X A;  2HXK A;  1V58 A;  2P0G A;  1GSU A;  1FB0 A;  4GWR A;  3FHK A;  5JWQ B;  4WR4 A;  2DJK A;  2GST A;  3IR4 A;  3IAS 2;  2AHE A;  1FG4 A;  1MEK A;  2DBC A;  3N5O A;  5GZZ B;  4ZXG A;  22GS A;  1IYI A;  4MMM A;  1BG5 A;  4ZL8 A;  3GKN A;  5EVO A;  3J7Y b;  9GSS A;  5B8A A;  4PXO A;  1THO A;  1HNA A;  1SJI A;  1FAA A;  2I81 A;  4HS1 A; 
#chains in the Genus database with same CATH topology
 4FH8 A;  2DML A;  3C1R A;  2O85 A;  4NXI A;  3GRX A;  4TR4 A;  3EE2 A;  2VL9 A;  1KEB A;  3O3T A;  4YQU A;  2QC7 A;  4ULX A;  2O89 A;  4HU9 A;  1AQX A;  4RQR A;  1V9W A;  2HRF A;  5CRE A;  4TW5 A;  2KHP A;  3L4N A;  2VCW A;  3ZZX A;  1VF3 A;  5F8B A;  2H72 A;  1MDJ A;  1WP0 A;  3MSZ A;  1DE2 A;  4HI7 A;  1PMT A;  1M7T A;  4JZQ A;  1H75 A;  2C0E A;  4MZW A;  5J4U A;  3KD0 A;  6GSY A;  2FA8 A;  1R26 A;  1TRS A;  2CAI A;  2IPA A;  5HR3 A;  1J0F A;  4Z2U A;  3GL3 A;  3IHG A;  4Q5R A;  4BL7 A;  1MD3 A;  2B3S A;  2VL2 C;  3F63 A;  4KND A;  2OKA A;  2NTO A;  3UJ1 A;  4G0L A;  3TOT A;  4OMV A;  3DVX A;  3P90 A;  5HFI A;  5KOW A;  3EIN A;  3G7J A;  3CSJ A;  4J2F A;  5J5N A;  4Q5N A;  2DMM A;  3RPN A;  3HD5 A;  2YV7 A;  1SKS B;  3HVN A;  3TOU A;  1TRU A;  1T3B A;  1SL1 B;  1VRS D;  2N5B A;  2R0C A;  3RHC A;  4HQZ A;  1RK4 A;  2F9S A;  2ON5 A;  1YY7 A;  4PNF A;  3FR9 A;  4X4J A;  2L4Q A;  4TR3 A;  3L0H A;  1T4Y A;  1XXU A;  3FEU A;  1M2D A;  2DIY A;  3UAP A;  1X5D A;  3I69 A;  2B7J A;  5ECQ B;  4IBP A;  2XC2 A;  3LYP A;  2GSS A;  1GNW A;  4BVX B;  2IMI A;  3V1W A;  3BCI A;  3OR5 A;  2YN1 A;  3IBH A;  2ALB A;  2R4V A;  4ICY A;  3TRQ A;  4D73 B;  1FB6 A;  4EF0 A;  1A24 A;  1O7U A;  3PH9 A;  3EMP A;  3ERF A;  1F37 A;  4LLR A;  2XBQ A;  2KP1 A;  1Y25 A;  4ML1 A;  2VCQ A;  1WOU A;  2JZT A;  2RUE A;  3C73 A;  6GSV A;  3EU4 A;  5HR2 A;  2HZE A;  4WF5 A;  2GSR A;  1K3L A;  3TKS A;  2YZH A;  4KW6 A;  2FY6 A;  2X99 A;  1GUL A;  2F3M A;  5IM9 A;  3WGE A;  1GSY A;  4ZIL A;  2I4A A;  2PER A;  5G2Z A;  3NZN A;  4JR6 A;  4XHM A;  4BIK A;  2AJQ B;  1EOG A;  3WGD A;  2L6C A;  4KDY A;  2CX4 A;  5IO2 A;  4YAV A;  5COH A;  4O92 A;  4ZIJ A;  2K6V A;  2VCV A;  2LQO A;  4O5R A;  2PBJ A;  3A3T A;  5D8I A;  2EIO A;  1FW1 A;  1XBS A;  5ECH B;  2H66 A;  3GMF A;  1K3O A;  13GS A;  2K8V A;  2C4J A;  1WMJ A;  3N9J A;  2HFD A;  2K18 A;  3MNG A;  3VI5 A;  2WGR A;  4IKH A;  1M3I A;  2R0P A;  3QAV A;  2PWJ A;  2P5Q A;  2V2G A;  5G1K A;  17GS A;  3VWX A;  3TJF A;  1I5G A;  2GZP A;  2R3X A;  3W8J A;  3F9U A;  5CRD A;  4X0X A;  3RBT A;  1XWG A;  4OFM A;  4DEJ A;  4V1A p;  2HZF A;  5DBQ A;  2HSM A;  1MTC A;  4L5L A;  4GQF A;  4XTS A;  4MA9 A;  4J57 E;  11GS A;  4GSN A;  4K0G A;  3H79 A;  2NPB A;  5ID2 B;  3KZQ A;  4BVY B;  5CO3 A;  5DQY A;  2QGV A;  1M9B A;  1PRX A;  1GWC A;  1MD4 A;  2FGX A;  5LNK e;  5F05 A;  2N5F A;  3LEF A;  1F2E A;  3I6A A;  2BTO T;  5A4U A;  3HA9 A;  4G2E A;  5AN1 A;  4PTS A;  3DVW A;  3NOF A;  2OA7 A;  1KTE A;  4EKZ A;  5F06 A;  2V41 A;  4WBR D;  1X5E A;  3L9U A;  3P7X A;  3ZFL A;  2LJA A;  5CP1 A;  2GT6 A;  5F07 A;  5JCW A;  4GSS A;  2FWE A;  4WR5 A;  2FLS A;  2V1M A;  4E8H A;  5HFK A;  1F3B A;  2HRK A;  3GNJ A;  5B8B A;  4BWS A;  4ACS A;  1TXX A;  2IN3 A;  3A5W A;  3VWW A;  3QDN A;  1FOV A;  8GSS A;  2M72 A;  1K0D A;  5DCG A;  1PQN A;  4K2X A;  2L57 A;  1K0M A;  5B6N A;  4XRD A;  2NVL A;  2DKI A;  2XPD A;  4F9Z A;  3VFI A;  3VLN A;  3HJO A;  4AF2 A;  1EWX A;  2EIQ A;  4KDX A;  3EYT A;  1B9Y C;  2XPE A;  3FR3 A;  4BPY A;  4K2D A;  1TJD A;  1OE8 A;  4IP6 A;  1UA5 A;  4NV2 A;  4PQH A;  3HYP A;  4HQS A;  1TKD B;  1GSQ A;  5KEJ A;  1JFU A;  4EL1 A;  4KGI A;  3FZ5 A;  1MDI A;  2BMX A;  1F6M C;  5DAK A;  4I2U A;  4E8E A;  4O7H A;  5ECS A;  5A4V A;  3FZA A;  2H0H A;  4ZL7 A;  3F4T A;  3KMO A;  3GKK A;  4MF6 A;  1FO5 A;  1GUK A;  2E2G A;  3ME8 A;  1O85 A;  5D96 A;  5IIZ A;  4FYB A;  2JL4 A;  2X8G A;  4FO5 A;  1A0R P;  4WXT A;  3DD3 A;  2X4A A;  2IMK A;  1ZYE A;  3LGC A;  3ZIJ A;  5G31 A;  4LL1 B;  1S3D A;  6GSX A;  4JR4 A;  5IOW A;  3TRP A;  2D2Z A;  3QD9 A;  3F6F A;  1EV9 A;  3GYK A;  3KP9 A;  1EV4 A;  1GLQ A;  1Z6M A;  3G7Y A;  2FWF A;  1VGL A;  2H6Z A;  5CRG A;  2VM2 A;  3UVH A;  4EDZ A;  1GP1 A;  3E3E A;  3EWL A;  2OE3 A;  1Q4J A;  2GQM A;  3PR8 A;  2WZ9 A;  4NAX A;  2IME A;  3QAW A;  4V1A g;  2MMA A;  4P3Y B;  4WBJ A;  2H70 A;  4L0U A;  3CTF A;  2CT6 A;  3M3M A;  3MDK A;  1TDI A;  3FMW A;  4ZBB A;  4NPB A;  4EVM A;  5KN2 A;  3O76 A;  2DJ3 A;  3LOR A;  1XG8 A;  3EU3 A;  4KUN A;  2AUV A;  5B6M A;  2C1Y A;  2DLX A;  2VCZ A;  1GUM A;  20GS A;  3UAR A;  1PKZ A;  2IMF A;  2LJK A;  3ISO A;  3TKR A;  4CW9 A;  4N11 A;  2GSQ A;  3EVI A;  4POL A;  5D9V A;  4F82 A;  2G0F A;  4O32 A;  4YKF A;  1W89 A;  3M9J A;  1AAZ A;  4F0B A;  3KH9 A;  1G7O A;  2VOC A;  1O6J A;  1M99 A;  3FYG A;  5E4W A;  1ERV A;  1FVJ A;  4LMW A;  4KCA A;  3E0U A;  4YQV A;  1ZYQ B;  3SWL A;  2C3N A;  4MF5 A;  5C00 A;  3HDC A;  3GSS A;  3GX0 A;  3GV1 A;  1WPI A;  1HYU A;  5ECM B;  5G30 A;  4Q5Q A;  3IK7 A;  2PVQ A;  1XW6 A;  1JLV A;  3FZ9 A;  1DBY A;  5BRT A;  4POB A;  4MJA A;  3GTU B;  5IMZ A;  5IMF A;  3WGX A;  4HZ2 A;  3ZL5 A;  4FQU A;  4G0K A;  5EL8 A;  4ZB8 A;  1GH2 A;  1USB A;  2TRC P;  3IHQ A;  4RI7 A;  3KCM A;  4MJB A;  2H74 A;  1TOF A;  4OO4 A;  2IL3 A;  2X8H A;  3PIN A;  4EXJ A;  3QAG A;  3GST A;  3VI7 A;  2DJ2 A;  3CMI A;  1PX6 A;  4TN8 A;  3U5R E;  1S3A A;  2ZUP A;  2IWT A;  1ABA A;  1PA3 A;  1MDK A;  1SK0 A;  2VM1 A;  4NMU A;  1FVK A;  16GS A;  6GSS A;  2E0Q A;  3IDV A;  5ECI B;  2FUG 2;  4JU5 A;  3UBL A;  4MP4 A;  2GQK A;  4OD7 A;  4JRR A;  5KN1 A;  5GAP D;  2C0G A;  2I1U A;  5L71 A;  2GTU A;  4F03 A;  2HYX A;  1XIY A;  3TJB A;  4CY6 A;  2C3T A;  2HT9 A;  4EE0 A;  2LNT A;  5D93 A;  3FKF A;  4IN0 A;  2WS2 A;  2GVP A;  3HY2 A;  5DJM A;  1X9S B;  1Z6N A;  4Z2T A;  2WB9 A;  4FIW A;  4I97 A;  1LBK A;  1GSS A;  2H30 A;  5DVB A;  5IPH A;  2OJL A;  1XVW A;  5J9B A;  4GCI A;  5DJL A;  1QMV A;  1A2J A;  1ST9 A;  1DUG A;  2HSH A;  2FNO A;  4NV5 A;  1V2A A;  3GKM A;  1B48 A;  4OWY A;  3I9V 2;  2HI7 A;  2IFQ B;  5D9W A;  3FK8 A;  4PGT A;  1K0A A;  1K3Y A;  3ZLP A;  2YV9 A;  4DSS B;  2G2Q A;  1NM3 A;  2E2M A;  4Z2R A;  1DSB A;  1AC1 A;  1U3A A;  4WKW A;  3VK9 A;  4KE3 A;  4KB3 A;  5JCG A;  3KTB A;  1K0B A;  4MH2 A;  3HJM A;  4V2M A;  1PKW A;  1XWC A;  4HJM A;  2RM5 A;  2LRT A;  4LA1 A;  3W8S A;  3SBC A;  2H73 A;  3Q6O A;  1Q98 A;  1XZO A;  4TR0 A;  2MYG A;  4EC0 A;  1EZK A;  1X0R A;  2CV4 A;  3IE3 A;  4AJ7 A;  3LQ7 A;  3K8N A;  2A2S A;  3HCZ A;  2DKH A;  2JSZ A;  3O6T A;  4EUY A;  3FW2 A;  4OFN A;  4BL7 B;  4N10 A;  2H1B A;  2LJR A;  2QKE A;  5D9X A;  2QSI A;  3L9S A;  3DIE A;  4CDO A;  3PGT A;  5HR1 A;  2DJ1 A;  4GRF A;  1S3R A;  1V40 A;  3US3 A;  1ZYP A;  3E9J B;  3HJP A;  1R4W A;  2B5Y A;  2VLT A;  4X1U A;  3F4S A;  5KOX A;  2C0D A;  1HNC A;  4HSC X;  3CBU A;  1OKT A;  1EP8 A;  3GFK A;  5ID2 A;  1GLP A;  4BVY A;  2CX3 A;  1TK0 B;  1E2Y A;  3GA4 A;  3J7Y k;  2MMN A;  1OE7 A;  3KP8 A;  2R0G A;  3CYN A;  2GT5 A;  1PL1 A;  4QL9 A;  2VUP A;  3KM6 A;  3H8Q A;  1I9D A;  4I6X A;  5G5E A;  3EMX A;  2YP6 A;  3P8W A;  2V6O A;  2YAN A;  3WYW A;  4JBB A;  3QR6 A;  3F3R A;  2L4C A;  4TXO A;  1O73 A;  1YZX A;  4ZB9 A;  5DDL A;  1GSF A;  5H5Q A;  2A2P A;  4I8B A;  1PGT A;  3A2V A;  4I5Q A;  4OCE A;  2H01 A;  2XBI A;  3RHB A;  2J23 A;  2QA1 A;  2C8U A;  2OBI A;  2VO4 A;  4JED A;  1EP7 A;  2R2J A;  4KSO A;  1NHY A;  1PN0 A;  3R2Q A;  3D0Z A;  3WT2 A;  2MBS A;  4WEY A;  4N0V A;  1BX9 A;  1BYE A;  3D4T A;  2YOI A;  4LL4 B;  3S9F A;  1O81 A;  3CRT A;  4HJ2 A;  5KN3 A;  3TJJ A;  4O5Q A;  4TXV A;  2R6K A;  3DML A;  2H1A A;  1SD9 A;  2H8L A;  5FHI A;  2H0I A;  1GTI A;  4XS4 B;  4TRX A;  1GL8 A;  3KGK A;  3IC8 A;  5AIV A;  3LXZ A;  2B6M A;  1XW5 A;  4POM A;  5LD0 A;  3GUR A;  4KA0 A;  1QUW A;  4OO5 A;  1XFL A;  3D4M A;  2I3Y A;  3AY8 A;  3VUR A;  1V57 A;  1GSE A;  3G9B A;  3KXO A;  2F8A A;  3QFA C;  2VCX A;  4LMV A;  1YEX A;  1DE1 A;  2P31 A;  1ZGN A;  3ME7 A;  4MDC A;  3L9V A;  1NSW A;  3A2W A;  4GTU A;  3MWH A;  1T4Z A;  3D6I A;  1AXD A;  3H1N A;  4PUF C;  5GAN D;  1WIK A;  1G0T A;  3TKS C;  2AB6 A;  1OC9 B;  2ZNM A;  4IS0 A;  1G6Y A;  2VIM A;  1LU4 A;  4IGJ A;  6GSW A;  4PUA A;  1YJ6 A;  5IO0 A;  2WFC A;  3ERW A;  4I2T A;  3VPQ A;  2YWO A;  1AUC A;  5FT3 A;  4MLY A;  1XOB A;  1ZL9 A;  4PQI A;  3LW9 A;  1EOH A;  4MNN A;  5EPF A;  2PMT A;  2OE1 A;  3DXB A;  2QA2 A;  1VF4 A;  1UVZ A;  4OCF A;  1Y6E A;  3BJ5 A;  4K7O A;  2E7P A;  1SD8 A;  5DAL B;  4O5U A;  2GGT A;  3Q19 A;  1EEM A;  3TKQ A;  2XHF A;  4FYU A;  2PU9 C;  1JZD A;  4IQ1 A;  4TKY A;  1U6T A;  2NBS A;  4HEA 2;  1H4O A;  2M46 A;  4PNG A;  1PSQ A;  2LRN A;  2ZCT A;  4GQC A;  4XS6 A;  1XOA A;  5HQP A;  4YH2 A;  2LQQ A;  2CZ3 A;  3GN3 A;  3G7I A;  2LKU A;  2ES7 A;  4ISD A;  3BBY A;  4ZB6 A;  1F9M A;  4RQX A;  4Z7X A;  3ZTL A;  1HNB A;  2L5L A;  1A8Y A;  2F8F A;  4KH7 A;  3VWV A;  4G0I A;  3GH6 A;  1OC8 A;  2YPM A;  3CTG A;  4PQ1 A;  5LCZ A;  3UBK A;  2K9F A;  3DKS A;  1AQW A;  3TB2 A;  4RUV A;  3TKS E;  1N2A A;  4ML6 A;  5CNW A;  5IOX A;  3UMA A;  1U88 A;  3U6V A;  2JSY A;  5ECR B;  4BA7 A;  2IIY A;  1R5P A;  3GTU A;  5H5S A;  1KBN A;  3ZRD A;  5AIX A;  4L5O A;  4IEL A;  1SKW B;  4CHS A;  2HRN A;  3DGQ A;  1YEP A;  2PUK C;  3LYK A;  5IPG A;  2PPT A;  2MMZ A;  1XWA A;  2YJ7 A;  1V98 A;  19GS A;  5H5R A;  4RI6 A;  3ZMK A;  1J08 A;  1GSD A;  1AW9 A;  5HR0 A;  1OKD A;  2FA4 A;  4YKG A;  5JWR B;  2TRX A;  1AIU A;  2H71 A;  1PN9 A;  5JCU A;  4MCU A;  1A2M A;  3ED3 A;  2OAC A;  2GZY A;  4MF7 A;  1YDK A;  4XS1 A;  2FWG A;  4TR1 B;  1BED A;  2NDO A;  2O7K A;  2VD0 A;  4IJI A;  2WDU A;  3EPT A;  3GKX A;  4L0W A;  3ZIV A;  1RQM A;  1T00 A;  3UIW A;  3IXR A;  3F6D A;  3QFB C;  2KP2 A;  3HKR A;  1PFO A;  5C04 A;  3TDG A;  2YJH A;  4QL7 A;  2MBT A;  3C71 A;  1M0U A;  2YWI A;  2O8V B;  2H6X A;  3BCK A;  2DIZ A;  2CAQ A;  4BWQ A;  4EDY A;  1RW1 A;  4OFT A;  3VWU A;  5ECN B;  3WD6 A;  1CQG A;  5E59 A;  4POK A;  3KJY A;  2WCI A;  4MK3 A;  2FWH A;  1VF2 A;  12GS A;  2IFQ A;  1GNE A;  1ZMA A;  3RPP A;  1TU7 A;  2X8C A;  3UVT A;  1Z7R A;  1ZZY A;  4NWY A;  3R3E A;  1AQV A;  2FHE A;  4DSS A;  3ZVJ A;  5A4W A;  4ID0 A;  5ELA A;  3GIX A;  4TOP A;  2LS5 A;  2H75 A;  5B7C A;  3GHA A;  4CY8 A;  4K7I A;  4MJE A;  5BMU A;  3D22 A;  3M1G A;  1Z3E A;  4L8E A;  1ZCP A;  1M2B A;  4N30 A;  2YCD A;  3C1S A;  4BVX A;  3EC3 A;  3D5J A;  2L6D A;  3GUS A;  3QMX A;  1B8X A;  1JZO A;  1ILO A;  4D73 A;  5IQY A;  3RDW A;  2MZC A;  3FRC A;  3BOA A;  5F0G A;  2O87 A;  2ON7 A;  4K8M A;  1OVN A;  1VF1 A;  3EUR A;  2LNS A;  2J9H A;  3HXS A;  5JWO B;  2CQ9 A;  2A4H A;  1B4Q A;  3CXG A;  1SJZ A;  4ECJ A;  1BQ7 A;  5ECO B;  2REM A;  4XIH A;  4MH3 A;  3NIV A;  3TCO A;  1X9W B;  3FY7 A;  3CQF A;  3UEM A;  2OBK A;  2EC4 A;  2IMD A;  1EGR A;  1UN2 A;  1TK8 B;  1B9X C;  1HQO A;  3LSZ A;  2EIR A;  3QCP A;  3CSI A;  3ZYW A;  1ACV A;  1T1V A;  3LWA A;  2UZ8 A;  1THX A;  2JZS A;  4XCS A;  2B5E A;  1EEJ A;  5D73 A;  3W6G A;  4F2I A;  5IMC A;  4MPG A;  2RII A;  2VAF A;  2X64 A;  2YZU A;  3IRA A;  4GF0 A;  4G19 A;  1T8E B;  1NW2 A;  1M3J A;  2C3Q A;  2V6K A;  2PGT A;  2B7K A;  3D21 A;  4K7N A;  2CA8 A;  6GSU A;  5G1L A;  3A5I A;  5AGY A;  3QPM A;  2HRA A;  1K0C A;  3FR6 A;  2N5A A;  3MAK A;  3DWV A;  1TTZ A;  3ZVJ D;  2R37 A;  3F3Q A;  4IP1 A;  2MMO A;  3TKP A;  3ZRE A;  3ZML A;  1QGV A;  1K0O A;  2KLX A;  5ECP B;  4Q5F A;  1ERU A;  2RLI A;  3ZIT A;  1E6B A;  4GXZ A;  1S3C A;  1JZR A;  4XS4 A;  2OE0 A;  4USS A;  1O8W A;  1T7P B;  2PN8 A;  5A5K A;  1Z9H A;  1YF1 A;  2C80 A;  3TGZ A;  3F8U A;  3UOM A;  2CVB A;  4KSM A;  2HNL A;  4IQA A;  4ECI A;  1XCC A;  6GST A;  5KN0 A;  5CRH A;  4AJ6 A;  3GX8 A;  1OYJ A;  4H86 A;  2VCT A;  1ML6 A;  1A0F A;  4IW9 A;  2VLU A;  2KOK A;  2HZE B;  2L59 A;  4PUR A;  1ERT A;  1K0N A;  4EIQ A;  1TRW A;  2RM6 A;  3CRU A;  3JCM L;  2LV3 A;  5EY6 A;  1R7H A;  1XWB A;  2V32 A;  4GST A;  1YKC A;  4FYC A;  3IPZ A;  4IVF A;  5G5F A;  3CSH A;  1GUH A;  3LXT A;  4A5P A;  4ILF A;  1SEN A;  4HU7 A;  3PPU A;  3P2A A;  2DJJ A;  3HVX A;  1OC9 A;  1QQ2 A;  2Z9S A;  4ECB A;  1JLW A;  1G7E A;  1YF0 A;  4KX4 A;  3F0I A;  1URM A;  1PX7 A;  2YNX A;  4MJC A;  1WE0 A;  1Z5Y E;  1SL2 B;  1TI1 A;  2PVO C;  3M0F A;  1JZW A;  2JAD A;  2CVD A;  1SKR B;  1QFN A;  4DVC A;  2GQL A;  1M2A A;  4G10 A;  1M9A A;  1FHE A;  3HHV A;  4MAB A;  2IJY A;  1G6W A;  2YWM A;  4G9H A;  5GST A;  3QOU A;  1Z7P A;  4TXO B;  4XRA A;  3KIJ A;  2LRC A;  1OAZ A;  2BJX A;  4EIP A;  5IMA A;  1PD2 1;  1U3I A;  2GS3 A;  3KTL A;  1XW9 A;  4YQM A;  1YKA A;  5ELG A;  1TRV A;  1R5A A;  5J41 A;  1N8J A;  3TJG A;  5DQS A;  5DAL A;  4KCE A;  3HVV A;  1W4V A;  4F0C A;  1SL0 B;  4IJ3 A;  2WJU A;  3LJR A;  3GL5 A;  2K8S A;  3M9K A;  3C8E A;  7GSS A;  2A4V A;  1A8L A;  1ON4 A;  3DRN A;  5D9T A;  5CAX A;  2FD3 A;  4HDE A;  3HZ8 A;  3L78 A;  2B5X A;  3LFL A;  1NHO A;  1OC3 A;  4V2L A;  1ZYN A;  1LJR A;  5CRW A;  2B1L A;  2H0G A;  1A2L A;  18GS A;  3FZ4 A;  3H4K A;  4NHW A;  4QQ7 A;  5HFG A;  1SU9 A;  1XWK A;  2GLR A;  1SK1 A;  1KNG A;  2FCH A;  1SJ6 A;  1TI3 A;  4KDU A;  4ZBA A;  2B1K A;  1CQH A;  1EGO A;  3IAM 2;  2M80 A;  2HSY A;  2GZZ A;  2JU5 A;  3TJK A;  1TP9 A;  2KUC A;  5ENU A;  1U87 A;  5IMV A;  1QK8 A;  2R5G A;  2WUL A;  4K9Z A;  2VD1 A;  1F3A A;  2A2R A;  3Q74 A;  3KEB A;  1WRY A;  1SYR A;  3HVS A;  1B4P A;  4ECC A;  4JE1 A;  2X49 A;  3C7M A;  3VPT A;  3MYD A;  2C0F A;  3DEX A;  3IOS A;  5J9C A;  1GTB A;  1BJX A;  2DJ0 A;  1C72 A;  3F4R A;  3ZFB A;  3KH7 A;  1WJK A;  2H1D A;  2OAD A;  1SYX A;  1GRX A;  2LUS A;  4AJ8 A;  3UL3 A;  3Q18 A;  2AV4 A;  4N0Z A;  2TIR A;  4X43 A;  2I9H A;  2AAW A;  5AIS A;  2LTK A;  3APQ A;  2CZ2 A;  1SK2 A;  1A23 A;  2DSA A;  5ECK B;  1UC7 A;  4IHU A;  5J3R A;  4ZL9 A;  10GS A;  2DC5 A;  1TK5 B;  3H93 A;  2VLV A;  1GTA A;  1TU8 A;  4TVE A;  2HE3 A;  1ZOF A;  3APO A;  1BAY A;  3GH9 A;  5IMD A;  3I43 A;  3IK9 A;  2LEG A;  3RAZ A;  5DAK B;  4PX1 A;  1XPV A;  4MZB A;  4TR1 A;  2WRT A;  1QXH A;  4KF9 A;  3IC4 A;  1IYH A;  1HD2 A;  2AYT A;  4ZBD A;  2F51 A;  1GTU A;  4K0N A;  5GSS A;  3IV4 A;  3KMN A;  2JAC A;  1J9B A;  4K1F A;  4HUA A;  1FOH A;  4HZ4 A;  4NHZ A;  1X5C A;  2VL2 A;  2VL3 A;  3BD2 A;  4HOJ A;  4KAE A;  4K6X A;  5CYY A;  4DSQ A;  2GDR A;  2H1G A;  4K5S A;  3LG6 A;  3HZ4 A;  1JHB A;  1PL2 A;  3IA1 A;  2CVK A;  5INY A;  3M8N A;  3TRX A;  4J56 E;  4K5R A;  2L5O A;  5ABR A;  4EO3 A;  14GS A;  1YQ1 A;  3DYR A;  4GLT A;  5DCH A;  2JZR A;  4YAP A;  3WT1 A;  2RUF A;  5FWG A;  4DSR A;  2YWN A;  5ECL B;  1WWJ A;  4WF4 A;  1O8X A;  4MPF A;  2H19 A;  4MZC A;  3MIX A;  4WET A;  1TW9 A;  2H76 A;  2H6Y A;  1ERW A;  3ERG A;  1X9M B;  4AGS A;  3APS A;  2P5R A;  3TUE A;  2LST A;  4V2N A;  1XVQ A;  2HLS A;  3A2X A;  2HXK A;  1V58 A;  2P0G A;  1GSU A;  1FB0 A;  4GWR A;  3FHK A;  5JWQ B;  4WR4 A;  2DJK A;  2GST A;  3IR4 A;  3IAS 2;  2AHE A;  1FG4 A;  1MEK A;  2DBC A;  3N5O A;  5GZZ B;  4ZXG A;  22GS A;  1IYI A;  4MMM A;  1BG5 A;  4ZL8 A;  3GKN A;  5EVO A;  3J7Y b;  9GSS A;  5B8A A;  4PXO A;  1THO A;  1HNA A;  1SJI A;  1FAA A;  2I81 A;  4HS1 A; 
#chains in the Genus database with same CATH homology
 4FH8 A;  2DML A;  3C1R A;  2O85 A;  4NXI A;  3GRX A;  4TR4 A;  3EE2 A;  2VL9 A;  1KEB A;  3O3T A;  4YQU A;  2QC7 A;  4ULX A;  2O89 A;  4HU9 A;  1AQX A;  4RQR A;  1V9W A;  2HRF A;  5CRE A;  4TW5 A;  2KHP A;  3L4N A;  2VCW A;  3ZZX A;  1VF3 A;  5F8B A;  2H72 A;  1MDJ A;  1WP0 A;  3MSZ A;  1DE2 A;  4HI7 A;  1PMT A;  1M7T A;  4JZQ A;  1H75 A;  2C0E A;  4MZW A;  5J4U A;  3KD0 A;  6GSY A;  2FA8 A;  1R26 A;  1TRS A;  2CAI A;  2IPA A;  5HR3 A;  1J0F A;  4Z2U A;  3GL3 A;  3IHG A;  4Q5R A;  4BL7 A;  1MD3 A;  2B3S A;  2VL2 C;  3F63 A;  4KND A;  2OKA A;  2NTO A;  3UJ1 A;  4G0L A;  3TOT A;  4OMV A;  3DVX A;  3P90 A;  5HFI A;  5KOW A;  3EIN A;  3G7J A;  3CSJ A;  4J2F A;  5J5N A;  4Q5N A;  2DMM A;  3RPN A;  3HD5 A;  2YV7 A;  1SKS B;  3TOU A;  1TRU A;  1T3B A;  1SL1 B;  1VRS D;  2N5B A;  2R0C A;  3RHC A;  4HQZ A;  1RK4 A;  2F9S A;  2ON5 A;  1YY7 A;  4PNF A;  3FR9 A;  4X4J A;  2L4Q A;  4TR3 A;  3L0H A;  1T4Y A;  1XXU A;  3FEU A;  1M2D A;  2DIY A;  3UAP A;  1X5D A;  3I69 A;  2B7J A;  5ECQ B;  4IBP A;  2XC2 A;  3LYP A;  2GSS A;  1GNW A;  4BVX B;  2IMI A;  3V1W A;  3BCI A;  3OR5 A;  2YN1 A;  3IBH A;  2ALB A;  2R4V A;  4ICY A;  3TRQ A;  4D73 B;  1FB6 A;  4EF0 A;  1A24 A;  1O7U A;  3PH9 A;  3EMP A;  3ERF A;  1F37 A;  4LLR A;  2XBQ A;  2KP1 A;  1Y25 A;  4ML1 A;  2VCQ A;  1WOU A;  2JZT A;  2RUE A;  3C73 A;  6GSV A;  3EU4 A;  5HR2 A;  2HZE A;  4WF5 A;  2GSR A;  1K3L A;  3TKS A;  2YZH A;  4KW6 A;  2FY6 A;  2X99 A;  1GUL A;  2F3M A;  5IM9 A;  3WGE A;  1GSY A;  4ZIL A;  2I4A A;  2PER A;  5G2Z A;  3NZN A;  4JR6 A;  4XHM A;  2AJQ B;  1EOG A;  3WGD A;  2L6C A;  4KDY A;  2CX4 A;  5IO2 A;  4YAV A;  5COH A;  4O92 A;  4ZIJ A;  2K6V A;  2VCV A;  2LQO A;  4O5R A;  2PBJ A;  3A3T A;  5D8I A;  2EIO A;  1FW1 A;  1XBS A;  5ECH B;  2H66 A;  3GMF A;  1K3O A;  13GS A;  2K8V A;  2C4J A;  1WMJ A;  3N9J A;  2HFD A;  2K18 A;  3MNG A;  3VI5 A;  2WGR A;  4IKH A;  2R0P A;  3QAV A;  2PWJ A;  2P5Q A;  2V2G A;  5G1K A;  17GS A;  3VWX A;  3TJF A;  1I5G A;  2GZP A;  2R3X A;  3W8J A;  3F9U A;  5CRD A;  4X0X A;  3RBT A;  1XWG A;  4OFM A;  4DEJ A;  4V1A p;  2HZF A;  5DBQ A;  2HSM A;  1MTC A;  4L5L A;  4GQF A;  4XTS A;  4MA9 A;  4J57 E;  11GS A;  4GSN A;  4K0G A;  3H79 A;  2NPB A;  5ID2 B;  3KZQ A;  4BVY B;  5CO3 A;  5DQY A;  2QGV A;  1M9B A;  1PRX A;  1GWC A;  1MD4 A;  2FGX A;  5LNK e;  5F05 A;  2N5F A;  3LEF A;  1F2E A;  3I6A A;  2BTO T;  5A4U A;  3HA9 A;  4G2E A;  5AN1 A;  4PTS A;  3DVW A;  3NOF A;  2OA7 A;  1KTE A;  4EKZ A;  5F06 A;  2V41 A;  4WBR D;  1X5E A;  3L9U A;  3P7X A;  3ZFL A;  2LJA A;  5CP1 A;  2GT6 A;  5F07 A;  5JCW A;  4GSS A;  2FWE A;  4WR5 A;  2FLS A;  2V1M A;  4E8H A;  5HFK A;  1F3B A;  2HRK A;  3GNJ A;  5B8B A;  4BWS A;  4ACS A;  1TXX A;  2IN3 A;  3A5W A;  3VWW A;  3QDN A;  1FOV A;  8GSS A;  2M72 A;  1K0D A;  5DCG A;  1PQN A;  4K2X A;  2L57 A;  1K0M A;  5B6N A;  4XRD A;  2NVL A;  2DKI A;  2XPD A;  4F9Z A;  3VFI A;  3VLN A;  3HJO A;  4AF2 A;  1EWX A;  2EIQ A;  4KDX A;  3EYT A;  1B9Y C;  2XPE A;  3FR3 A;  4BPY A;  4K2D A;  1TJD A;  1OE8 A;  4IP6 A;  1UA5 A;  4NV2 A;  4PQH A;  3HYP A;  4HQS A;  1TKD B;  1GSQ A;  5KEJ A;  1JFU A;  4EL1 A;  4KGI A;  3FZ5 A;  1MDI A;  2BMX A;  1F6M C;  5DAK A;  4I2U A;  4E8E A;  4O7H A;  5ECS A;  5A4V A;  3FZA A;  2H0H A;  4ZL7 A;  3F4T A;  3KMO A;  3GKK A;  4MF6 A;  1FO5 A;  1GUK A;  2E2G A;  3ME8 A;  1O85 A;  5D96 A;  5IIZ A;  4FYB A;  2JL4 A;  2X8G A;  4FO5 A;  1A0R P;  4WXT A;  3DD3 A;  2X4A A;  2IMK A;  1ZYE A;  3LGC A;  3ZIJ A;  5G31 A;  4LL1 B;  1S3D A;  6GSX A;  4JR4 A;  5IOW A;  3TRP A;  2D2Z A;  3QD9 A;  3F6F A;  1EV9 A;  3GYK A;  3KP9 A;  1EV4 A;  1GLQ A;  1Z6M A;  3G7Y A;  2FWF A;  1VGL A;  2H6Z A;  5CRG A;  2VM2 A;  3UVH A;  4EDZ A;  1GP1 A;  3E3E A;  3EWL A;  2OE3 A;  1Q4J A;  2GQM A;  3PR8 A;  2WZ9 A;  4NAX A;  2IME A;  3QAW A;  4V1A g;  2MMA A;  4P3Y B;  4WBJ A;  2H70 A;  4L0U A;  3CTF A;  2CT6 A;  3M3M A;  3MDK A;  1TDI A;  3FMW A;  4ZBB A;  4NPB A;  4EVM A;  5KN2 A;  3O76 A;  2DJ3 A;  3LOR A;  3EU3 A;  4KUN A;  2AUV A;  5B6M A;  2C1Y A;  2DLX A;  2VCZ A;  1GUM A;  20GS A;  3UAR A;  1PKZ A;  2IMF A;  2LJK A;  3ISO A;  3TKR A;  4CW9 A;  4N11 A;  2GSQ A;  3EVI A;  4POL A;  5D9V A;  4F82 A;  2G0F A;  4O32 A;  4YKF A;  1W89 A;  3M9J A;  1AAZ A;  4F0B A;  3KH9 A;  1G7O A;  2VOC A;  1O6J A;  1M99 A;  3FYG A;  5E4W A;  1ERV A;  1FVJ A;  4LMW A;  4KCA A;  3E0U A;  4YQV A;  1ZYQ B;  3SWL A;  2C3N A;  4MF5 A;  5C00 A;  3HDC A;  3GSS A;  3GX0 A;  3GV1 A;  1WPI A;  1HYU A;  5ECM B;  5G30 A;  4Q5Q A;  3IK7 A;  2PVQ A;  1XW6 A;  1JLV A;  3FZ9 A;  1DBY A;  5BRT A;  4POB A;  4MJA A;  3GTU B;  5IMZ A;  5IMF A;  3WGX A;  4HZ2 A;  3ZL5 A;  4FQU A;  4G0K A;  5EL8 A;  4ZB8 A;  1GH2 A;  1USB A;  2TRC P;  3IHQ A;  4RI7 A;  3KCM A;  4MJB A;  2H74 A;  1TOF A;  4OO4 A;  2IL3 A;  2X8H A;  3PIN A;  4EXJ A;  3QAG A;  3GST A;  3VI7 A;  2DJ2 A;  3CMI A;  1PX6 A;  4TN8 A;  3U5R E;  1S3A A;  2ZUP A;  2IWT A;  1ABA A;  1PA3 A;  1MDK A;  1SK0 A;  2VM1 A;  4NMU A;  1FVK A;  16GS A;  6GSS A;  2E0Q A;  3IDV A;  5ECI B;  2FUG 2;  4JU5 A;  3UBL A;  4MP4 A;  2GQK A;  4OD7 A;  4JRR A;  5KN1 A;  5GAP D;  2C0G A;  2I1U A;  5L71 A;  2GTU A;  4F03 A;  2HYX A;  1XIY A;  3TJB A;  4CY6 A;  2C3T A;  2HT9 A;  4EE0 A;  2LNT A;  5D93 A;  3FKF A;  4IN0 A;  2WS2 A;  2GVP A;  3HY2 A;  5DJM A;  1X9S B;  1Z6N A;  4Z2T A;  2WB9 A;  4FIW A;  4I97 A;  1LBK A;  1GSS A;  2H30 A;  5DVB A;  5IPH A;  2OJL A;  1XVW A;  5J9B A;  4GCI A;  5DJL A;  1QMV A;  1A2J A;  1ST9 A;  1DUG A;  2HSH A;  2FNO A;  4NV5 A;  1V2A A;  3GKM A;  1B48 A;  4OWY A;  3I9V 2;  2HI7 A;  2IFQ B;  5D9W A;  3FK8 A;  4PGT A;  1K0A A;  1K3Y A;  3ZLP A;  2YV9 A;  4DSS B;  2G2Q A;  1NM3 A;  2E2M A;  4Z2R A;  1DSB A;  1AC1 A;  1U3A A;  4WKW A;  3VK9 A;  4KE3 A;  4KB3 A;  5JCG A;  3KTB A;  1K0B A;  4MH2 A;  3HJM A;  4V2M A;  1PKW A;  1XWC A;  4HJM A;  2RM5 A;  2LRT A;  4LA1 A;  3W8S A;  3SBC A;  2H73 A;  3Q6O A;  1Q98 A;  1XZO A;  4TR0 A;  2MYG A;  4EC0 A;  1EZK A;  1X0R A;  2CV4 A;  3IE3 A;  4AJ7 A;  3LQ7 A;  3K8N A;  2A2S A;  3HCZ A;  2DKH A;  2JSZ A;  3O6T A;  4EUY A;  3FW2 A;  4OFN A;  4BL7 B;  4N10 A;  2H1B A;  2LJR A;  2QKE A;  5D9X A;  2QSI A;  3L9S A;  3DIE A;  4CDO A;  3PGT A;  5HR1 A;  2DJ1 A;  4GRF A;  1V40 A;  3US3 A;  1ZYP A;  3E9J B;  3HJP A;  1R4W A;  2B5Y A;  2VLT A;  4X1U A;  3F4S A;  5KOX A;  2C0D A;  1HNC A;  3CBU A;  1OKT A;  1EP8 A;  3GFK A;  5ID2 A;  1GLP A;  4BVY A;  2CX3 A;  1TK0 B;  1E2Y A;  3GA4 A;  3J7Y k;  2MMN A;  1OE7 A;  3KP8 A;  2R0G A;  3CYN A;  2GT5 A;  1PL1 A;  4QL9 A;  2VUP A;  3KM6 A;  3H8Q A;  1I9D A;  4I6X A;  5G5E A;  3EMX A;  2YP6 A;  3P8W A;  2V6O A;  2YAN A;  3WYW A;  4JBB A;  3QR6 A;  3F3R A;  2L4C A;  4TXO A;  1O73 A;  1YZX A;  4ZB9 A;  5DDL A;  1GSF A;  5H5Q A;  2A2P A;  4I8B A;  1PGT A;  3A2V A;  4I5Q A;  4OCE A;  2H01 A;  2XBI A;  3RHB A;  2J23 A;  2QA1 A;  2C8U A;  2OBI A;  2VO4 A;  4JED A;  1EP7 A;  2R2J A;  4KSO A;  1NHY A;  1PN0 A;  3R2Q A;  3D0Z A;  3WT2 A;  2MBS A;  4WEY A;  4N0V A;  1BX9 A;  1BYE A;  3D4T A;  2YOI A;  4LL4 B;  3S9F A;  1O81 A;  3CRT A;  4HJ2 A;  5KN3 A;  3TJJ A;  4O5Q A;  4TXV A;  2R6K A;  3DML A;  2H1A A;  1SD9 A;  2H8L A;  5FHI A;  2H0I A;  1GTI A;  4XS4 B;  4TRX A;  1GL8 A;  3KGK A;  3IC8 A;  5AIV A;  3LXZ A;  2B6M A;  1XW5 A;  4POM A;  5LD0 A;  3GUR A;  4KA0 A;  1QUW A;  4OO5 A;  1XFL A;  3D4M A;  2I3Y A;  3AY8 A;  3VUR A;  1V57 A;  1GSE A;  3G9B A;  3KXO A;  2F8A A;  3QFA C;  2VCX A;  4LMV A;  1YEX A;  1DE1 A;  2P31 A;  1ZGN A;  3ME7 A;  4MDC A;  3L9V A;  1NSW A;  3A2W A;  4GTU A;  3MWH A;  1T4Z A;  3D6I A;  1AXD A;  3H1N A;  4PUF C;  5GAN D;  1WIK A;  1G0T A;  3TKS C;  2AB6 A;  1OC9 B;  2ZNM A;  4IS0 A;  1G6Y A;  2VIM A;  1LU4 A;  4IGJ A;  6GSW A;  4PUA A;  1YJ6 A;  5IO0 A;  2WFC A;  3ERW A;  4I2T A;  3VPQ A;  2YWO A;  1AUC A;  5FT3 A;  4MLY A;  1XOB A;  1ZL9 A;  4PQI A;  3LW9 A;  1EOH A;  4MNN A;  5EPF A;  2PMT A;  2OE1 A;  3DXB A;  2QA2 A;  1VF4 A;  1UVZ A;  4OCF A;  1Y6E A;  3BJ5 A;  4K7O A;  2E7P A;  1SD8 A;  5DAL B;  4O5U A;  2GGT A;  3Q19 A;  1EEM A;  3TKQ A;  2XHF A;  4FYU A;  2PU9 C;  1JZD A;  4IQ1 A;  4TKY A;  1U6T A;  2NBS A;  4HEA 2;  1H4O A;  2M46 A;  4PNG A;  1PSQ A;  2LRN A;  2ZCT A;  4GQC A;  4XS6 A;  1XOA A;  5HQP A;  4YH2 A;  2LQQ A;  2CZ3 A;  3GN3 A;  3G7I A;  2LKU A;  2ES7 A;  4ISD A;  3BBY A;  4ZB6 A;  1F9M A;  4RQX A;  4Z7X A;  3ZTL A;  1HNB A;  2L5L A;  1A8Y A;  2F8F A;  4KH7 A;  3VWV A;  4G0I A;  3GH6 A;  1OC8 A;  2YPM A;  3CTG A;  4PQ1 A;  5LCZ A;  3UBK A;  2K9F A;  3DKS A;  1AQW A;  3TB2 A;  4RUV A;  3TKS E;  1N2A A;  4ML6 A;  5CNW A;  5IOX A;  3UMA A;  1U88 A;  3U6V A;  2JSY A;  5ECR B;  4BA7 A;  2IIY A;  1R5P A;  3GTU A;  5H5S A;  1KBN A;  3ZRD A;  5AIX A;  4L5O A;  4IEL A;  1SKW B;  4CHS A;  2HRN A;  3DGQ A;  1YEP A;  2PUK C;  3LYK A;  5IPG A;  2PPT A;  2MMZ A;  1XWA A;  2YJ7 A;  1V98 A;  19GS A;  5H5R A;  4RI6 A;  3ZMK A;  1J08 A;  1GSD A;  1AW9 A;  5HR0 A;  1OKD A;  2FA4 A;  4YKG A;  5JWR B;  2TRX A;  1AIU A;  2H71 A;  1PN9 A;  5JCU A;  4MCU A;  1A2M A;  3ED3 A;  2OAC A;  2GZY A;  4MF7 A;  1YDK A;  4XS1 A;  2FWG A;  4TR1 B;  1BED A;  2NDO A;  2O7K A;  2VD0 A;  4IJI A;  2WDU A;  3EPT A;  3GKX A;  4L0W A;  3ZIV A;  1RQM A;  1T00 A;  3UIW A;  3IXR A;  3F6D A;  3QFB C;  2KP2 A;  3HKR A;  5C04 A;  3TDG A;  2YJH A;  4QL7 A;  2MBT A;  3C71 A;  1M0U A;  2YWI A;  2O8V B;  2H6X A;  3BCK A;  2DIZ A;  2CAQ A;  4BWQ A;  4EDY A;  1RW1 A;  4OFT A;  3VWU A;  5ECN B;  3WD6 A;  1CQG A;  5E59 A;  4POK A;  3KJY A;  2WCI A;  4MK3 A;  2FWH A;  1VF2 A;  12GS A;  2IFQ A;  1GNE A;  1ZMA A;  3RPP A;  1TU7 A;  2X8C A;  3UVT A;  1Z7R A;  1ZZY A;  4NWY A;  3R3E A;  1AQV A;  2FHE A;  4DSS A;  3ZVJ A;  5A4W A;  4ID0 A;  5ELA A;  3GIX A;  4TOP A;  2LS5 A;  2H75 A;  5B7C A;  3GHA A;  4CY8 A;  4K7I A;  4MJE A;  5BMU A;  3D22 A;  3M1G A;  1Z3E A;  4L8E A;  1ZCP A;  1M2B A;  4N30 A;  2YCD A;  3C1S A;  4BVX A;  3EC3 A;  3D5J A;  2L6D A;  3GUS A;  3QMX A;  1B8X A;  1JZO A;  1ILO A;  4D73 A;  5IQY A;  3RDW A;  2MZC A;  3FRC A;  3BOA A;  5F0G A;  2O87 A;  2ON7 A;  4K8M A;  1OVN A;  1VF1 A;  3EUR A;  2LNS A;  2J9H A;  3HXS A;  5JWO B;  2CQ9 A;  2A4H A;  1B4Q A;  3CXG A;  1SJZ A;  4ECJ A;  1BQ7 A;  5ECO B;  2REM A;  4XIH A;  4MH3 A;  3NIV A;  3TCO A;  1X9W B;  3FY7 A;  3UEM A;  2OBK A;  2EC4 A;  2IMD A;  1EGR A;  1UN2 A;  1TK8 B;  1B9X C;  1HQO A;  3LSZ A;  2EIR A;  3QCP A;  3CSI A;  3ZYW A;  1ACV A;  1T1V A;  3LWA A;  2UZ8 A;  1THX A;  2JZS A;  4XCS A;  2B5E A;  1EEJ A;  5D73 A;  3W6G A;  4F2I A;  5IMC A;  4MPG A;  2RII A;  2VAF A;  2X64 A;  2YZU A;  3IRA A;  4GF0 A;  4G19 A;  1T8E B;  1NW2 A;  2C3Q A;  2V6K A;  2PGT A;  2B7K A;  3D21 A;  4K7N A;  2CA8 A;  6GSU A;  5G1L A;  3A5I A;  5AGY A;  3QPM A;  2HRA A;  1K0C A;  3FR6 A;  2N5A A;  3MAK A;  3DWV A;  1TTZ A;  3ZVJ D;  2R37 A;  3F3Q A;  4IP1 A;  2MMO A;  3TKP A;  3ZRE A;  3ZML A;  1QGV A;  1K0O A;  2KLX A;  5ECP B;  4Q5F A;  1ERU A;  2RLI A;  3ZIT A;  1E6B A;  4GXZ A;  1S3C A;  1JZR A;  4XS4 A;  2OE0 A;  4USS A;  1O8W A;  1T7P B;  2PN8 A;  5A5K A;  1Z9H A;  1YF1 A;  2C80 A;  3TGZ A;  3F8U A;  3UOM A;  2CVB A;  4KSM A;  2HNL A;  4IQA A;  4ECI A;  1XCC A;  6GST A;  5KN0 A;  5CRH A;  4AJ6 A;  3GX8 A;  1OYJ A;  4H86 A;  2VCT A;  1ML6 A;  1A0F A;  4IW9 A;  2VLU A;  2KOK A;  2HZE B;  2L59 A;  4PUR A;  1ERT A;  1K0N A;  4EIQ A;  1TRW A;  2RM6 A;  3CRU A;  3JCM L;  2LV3 A;  5EY6 A;  1R7H A;  1XWB A;  2V32 A;  4GST A;  1YKC A;  4FYC A;  3IPZ A;  4IVF A;  5G5F A;  3CSH A;  1GUH A;  3LXT A;  4A5P A;  4ILF A;  1SEN A;  4HU7 A;  3PPU A;  3P2A A;  2DJJ A;  3HVX A;  1OC9 A;  1QQ2 A;  2Z9S A;  4ECB A;  1JLW A;  1G7E A;  1YF0 A;  4KX4 A;  3F0I A;  1URM A;  1PX7 A;  2YNX A;  4MJC A;  1WE0 A;  1Z5Y E;  1SL2 B;  1TI1 A;  2PVO C;  3M0F A;  1JZW A;  2JAD A;  2CVD A;  1SKR B;  1QFN A;  4DVC A;  2GQL A;  1M2A A;  4G10 A;  1M9A A;  1FHE A;  3HHV A;  4MAB A;  2IJY A;  1G6W A;  2YWM A;  4G9H A;  5GST A;  3QOU A;  1Z7P A;  4TXO B;  4XRA A;  3KIJ A;  2LRC A;  1OAZ A;  2BJX A;  4EIP A;  5IMA A;  1PD2 1;  1U3I A;  2GS3 A;  3KTL A;  1XW9 A;  4YQM A;  1YKA A;  5ELG A;  1TRV A;  1R5A A;  5J41 A;  1N8J A;  3TJG A;  5DQS A;  5DAL A;  4KCE A;  3HVV A;  1W4V A;  4F0C A;  1SL0 B;  4IJ3 A;  2WJU A;  3LJR A;  3GL5 A;  2K8S A;  3M9K A;  3C8E A;  7GSS A;  2A4V A;  1A8L A;  1ON4 A;  3DRN A;  5D9T A;  5CAX A;  2FD3 A;  4HDE A;  3HZ8 A;  3L78 A;  2B5X A;  3LFL A;  1NHO A;  1OC3 A;  4V2L A;  1ZYN A;  1LJR A;  5CRW A;  2B1L A;  2H0G A;  1A2L A;  18GS A;  3FZ4 A;  3H4K A;  4NHW A;  4QQ7 A;  5HFG A;  1SU9 A;  1XWK A;  2GLR A;  1SK1 A;  1KNG A;  2FCH A;  1SJ6 A;  1TI3 A;  4KDU A;  4ZBA A;  2B1K A;  1CQH A;  1EGO A;  3IAM 2;  2M80 A;  2HSY A;  2GZZ A;  2JU5 A;  3TJK A;  1TP9 A;  2KUC A;  5ENU A;  1U87 A;  5IMV A;  1QK8 A;  2R5G A;  2WUL A;  4K9Z A;  2VD1 A;  1F3A A;  2A2R A;  3Q74 A;  3KEB A;  1WRY A;  1SYR A;  3HVS A;  1B4P A;  4ECC A;  4JE1 A;  2X49 A;  3C7M A;  3VPT A;  3MYD A;  2C0F A;  3DEX A;  3IOS A;  5J9C A;  1GTB A;  1BJX A;  2DJ0 A;  1C72 A;  3F4R A;  3ZFB A;  3KH7 A;  1WJK A;  2H1D A;  2OAD A;  1SYX A;  1GRX A;  2LUS A;  4AJ8 A;  3UL3 A;  3Q18 A;  2AV4 A;  4N0Z A;  2TIR A;  4X43 A;  2I9H A;  2AAW A;  5AIS A;  2LTK A;  3APQ A;  2CZ2 A;  1SK2 A;  1A23 A;  2DSA A;  5ECK B;  1UC7 A;  4IHU A;  5J3R A;  4ZL9 A;  10GS A;  2DC5 A;  1TK5 B;  3H93 A;  2VLV A;  1GTA A;  1TU8 A;  4TVE A;  2HE3 A;  1ZOF A;  3APO A;  1BAY A;  3GH9 A;  5IMD A;  3I43 A;  3IK9 A;  2LEG A;  3RAZ A;  5DAK B;  4PX1 A;  1XPV A;  4MZB A;  4TR1 A;  2WRT A;  1QXH A;  4KF9 A;  3IC4 A;  1IYH A;  1HD2 A;  2AYT A;  4ZBD A;  2F51 A;  1GTU A;  4K0N A;  5GSS A;  3IV4 A;  3KMN A;  2JAC A;  1J9B A;  4K1F A;  4HUA A;  1FOH A;  4HZ4 A;  4NHZ A;  1X5C A;  2VL2 A;  2VL3 A;  3BD2 A;  4HOJ A;  4KAE A;  4K6X A;  5CYY A;  4DSQ A;  2GDR A;  2H1G A;  4K5S A;  3LG6 A;  3HZ4 A;  1JHB A;  1PL2 A;  3IA1 A;  2CVK A;  5INY A;  3M8N A;  3TRX A;  4J56 E;  4K5R A;  2L5O A;  5ABR A;  4EO3 A;  14GS A;  1YQ1 A;  3DYR A;  4GLT A;  5DCH A;  2JZR A;  4YAP A;  3WT1 A;  2RUF A;  5FWG A;  4DSR A;  2YWN A;  5ECL B;  1WWJ A;  4WF4 A;  1O8X A;  4MPF A;  2H19 A;  4MZC A;  3MIX A;  4WET A;  1TW9 A;  2H76 A;  2H6Y A;  1ERW A;  3ERG A;  1X9M B;  4AGS A;  3APS A;  2P5R A;  3TUE A;  2LST A;  4V2N A;  1XVQ A;  2HLS A;  3A2X A;  2HXK A;  1V58 A;  2P0G A;  1GSU A;  1FB0 A;  4GWR A;  3FHK A;  5JWQ B;  4WR4 A;  2DJK A;  2GST A;  3IR4 A;  3IAS 2;  2AHE A;  1FG4 A;  1MEK A;  2DBC A;  3N5O A;  5GZZ B;  4ZXG A;  22GS A;  1IYI A;  4MMM A;  1BG5 A;  4ZL8 A;  3GKN A;  5EVO A;  3J7Y b;  9GSS A;  5B8A A;  4PXO A;  1THO A;  1HNA A;  1SJI A;  1FAA A;  2I81 A;  4HS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...