3CMIA

Crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
Knots found
sequence length
161
structure length
143
Chain Sequence
SEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIGFPCNQFGGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin HYR1
publication title Crystal structure of glutathione-dependent phospholipid peroxidase Hyr1 from the yeast Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 39
structure length 143
sequence length 161
other databases KnotProt 2.0: Artifct K +31
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cmiA00
1TOFA 4WF5A 5B6MA 1FO5A 2H1GA 1TU8A 2FY6A 4MPGA 1F3AA 2PWJA 2IMDA 1KEBA 1WRYA 3W8JA 3EE2A 3KXOA 1G7EA 1ZOFA 2C80A 2WJUA 3WGDA 1TRUA 2YANA 2MMZA 3F6DA 3CTFA 2FWFA 1GTUA 1BJXA 2XPDA 2LQOA 1G6WA 3FZ4A 4ZB8A 4V2LA 1EV9A 1EOGA 2LJAA 2ON7A 5DCGA 4FYUA 2LRNA 1TK5B 1MD4A 2GGTA 1GSQA 5G5FA 2HRFA 2DJJA 4KSOA 4Q5QA 4NPBA 3LYKA 1OKDA 1SJZA 2DSAA 6GSWA 3M3MA 3M9KA 4O5RA 2LRCA 4WR5A 2H72A 2C4JA 1XFLA 2CAIA 2DJKA 3TJGA 4BL7A 2JL4A 4LLRA 4WR4A 4YQVA 3UVTA 1KTEA 3E3EA 1B9XC 1FOVA 1PD21 1YF0A 1H75A 2RUEA 4XHMA 4MA9A 1ERVA 2QGVA 1AQVA 4DVCA 3KM6A 3IHQA 1SENA 3GH6A 3M8NA 4PQ1A 3WYWA 2HT9A 4N0ZA 3GRXA 1LBKA 2KOKA 3CSIA 2DJ1A 5AGYA 1XXUA 1AUCA 4HUAA 3ZLPA 1SD9A 4D73A 4J57E 3GHAA 1OE8A 1VF2A 2MBTA 3RHCA 4HDEA 3C1RA 1ZL9A 5G31A 2YZUA 4KDYA 1T4ZA 2ON5A 4NMUA 4E8EA 1TKDB 5HQPA 3KP8A 3FW2A 1AW9A 2ZCTA 5DQSA 4ECCA 1GWCA 3KD0A 1A2LA 2LEGA 3EU3A 2N5FA 1GTIA 4RUVA 1ILOA 1AIUA 5LNKe 2K8VA 4GRFA 4BVXA 3HZ8A 4MLYA 4E8HA 2K9FA 1PRXA 1BAYA 4MZBA 1USBA 2OE0A 3FR9A 4WKWA 3L9UA 1H4OA 5ECSA 3W6GA 1EP8A 4PX1A 2IFQB 4HJ2A 4KCAA 2LTKA 6GSUA 3F8UA 1PKZA 2HNLA 3IDVA 1B8XA 2VL3A 3FYGA 4OCEA 2O8VB 1V9WA 2FCHA 3GH9A 4JRRA 2BJXA 2YCDA 3ZVJA 1DE1A 2OBIA 3LGCA 4OCFA 1YQ1A 14GSA 3MWHA 1XW6A 3PGTA 4L0WA 4WETA 4PUAA 1LJRA 2ZNMA 3U5RE 2DJ2A 4XTSA 3D4TA 2L6CA 4HEA2 3RPPA 2O85A 5F06A 3QMXA 3ZVJD 2FWEA 4TR1A 4F0CA 3P2AA 4NXIA 2DC5A 2IMIA 3M1GA 3GKXA 4GLTA 3D5JA 1QMVA 4BPYA 4GTUA 3GL3A 5CRHA 4HZ4A 4V2NA 1XWAA 1XWCA 4ECIA 5HFKA 2HZEA 1Y25A 4AGSA 3F4SA 4Q5FA 1SD8A 3QD9A 4DSQA 2DJ3A 4RI7A 3ERFA 1EEJA 1VF3A 2C0DA 2J23A 1XBSA 4YAPA 2RIIA 2H1BA 4FYCA 4TVEA 3HJMA 2Z9SA 3DGQA 4YH2A 6GSTA 1ZYQB 3A2VA 2DLXA 1FG4A 3VPTA 2YJ7A 2YWMA 3WT2A 4JEDA 2GQLA 5J3RA 4G2EA 5ECOB 2H1DA 3H1NA 5C04A 2F8AA 1YF1A 1JZOA 2I4AA 2IPAA 2LNTA 2C1YA 3F4RA 1GNEA 1TK0B 1XW5A 1J0FA 3BCIA 3ZFBA 2RLIA 4CHSA 2XC2A 2L4QA 2LJRA 3ERGA 2WCIA 1TRSA 2WS2A 3IK9A 4H86A 1O81A 4NV5A 2A2SA 4KSMA 3PH9A 2FWHA 1T8EB 5JWRB 1OC9B 4IS0A 2OBKA 4K9ZA 4LMWA 4TXVA 1Z7PA 2TRCP 2K6VA 5F8BA 5G30A 2B7JA 3O6TA 2F8FA 3CSJA 5CRDA 4F82A 3GURA 3IV4A 3FZ9A 2VIMA 4GSSA 3HCZA 3KH9A 3KGKA 4PNFA 4JR4A 4JE1A 10GSA 5ECNB 3I69A 4ZB9A 1AAZA 4KGIA 3DWVA 4V2MA 2MMAA 1TDIA 5HR2A 2PPTA 4EL1A 2XBQA 3GKKA 2C3TA 4POMA 2B3SA 3M0FA 4OO4A 2C3QA 2YPMA 2GSTA 3QOUA 4MF5A 4NWYA 3KMNA 4MP4A 4F0BA 2HE3A 4OD7A 4K8MA 2TRXA 1M9BA 4J56E 5DQYA 3G7JA 4LA1A 4LL1B 2FLSA 1ST9A 1V2AA 3GMFA 2HI7A 5F0GA 2FNOA 2VL9A 1TP9A 1V58A 4BWSA 4KA0A 4G9HA 5H5SA 1RW1A 3VWUA 2C0EA 2KUCA 3DXBA 1XWKA 3SWLA 4ZBBA 2BMXA 2WULA 3ME8A 9GSSA 4IHUA 5ECHB 2REMA 4I97A 3TJKA 1Z6NA 1QXHA 5JCGA 1K0OA 3A3TA 4KDUA 2KP1A 1A8YA 1WP0A 2YP6A 3CRTA 1SJ6A 4PQHA 17GSA 3GL5A 2OACA 1GUHA 3TKSA 3GTUB 3FEUA 1V40A 3TKSE 5JCWA 5INYA 4FYBA 1OVNA 3GA4A 2MMOA 5J5NA 4L8EA 2WZ9A 5ECMB 3RHBA 3GYKA 4EC0A 4EXJA 5KN2A 5AIXA 1JLVA 2GTUA 4J2FA 1KNGA 3D6IA 1T1VA 5ENUA 4I6XA 5AISA 4K1FA 4IJIA 2CQ9A 3DVWA 1XWGA 3ZIVA 3RAZA 1B48A 2JZRA 4XS4B 5A4WA 3QDNA 1SL2B 2GVPA 1PX6A 3G7IA 1GSDA 6GSYA 1M2BA 3TKQA 4RQRA 1KBNA 5ELAA 2CVKA 3GIXA 3BOAA 5EPFA 1VF1A 1I5GA 2F51A 4MZWA 4HJMA 5IMZA 3BBYA 3LXZA 3TRXA 4EF0A 1OC3A 1TU7A 5LD0A 3F6FA 5E4WA 2R2JA 2HZFA 4HS1A 2MBSA 2FUG2 1X9SB 1TXXA 5GAPD 3UL3A 3F0IA 3LFLA 1SYXA 20GSA 4JU5A 2V41A 3IE3A 3H4KA 1QGVA 4MPFA 2C0GA 3MDKA 3NZNA 2I3YA 1T7PB 1TRWA 1G7OA 4GSTA 2IL3A 4AJ8A 1MDKA 3BJ5A 3JCML 3VWVA 1AQXA 2VM2A 4XS1A 1ACVA 2M72A 2AB6A 3V1WA 1GSUA 1PA3A 3L4NA 3C71A 2H70A 3TOUA 4MJBA 4IP1A 5KN0A 4X1UA 5DALA 4PUFC 3HVXA 2L5OA 5CP1A 3WGEA 5IIZA 4L5OA 2C0FA 3HHVA 3UIWA 2N5BA 1K0BA 4F9ZA 2H0HA 2JU5A 2L4CA 2GSQA 4ML1A 3VWXA 1TJDA 1N2AA 3GSTA 3UEMA 2FA8A 3Q74A 5F05A 4G19A 2WGRA 1TK8B 5A4VA 3GKNA 5DJLA 3F63A 3KMOA 5IMFA 3EINA 2J9HA 4IGJA 2AYTA 4NV2A 4HQZA 4YQMA 1YDKA 19GSA 1ZZYA 4DSSB 1GSEA 2HYXA 1HNAA 1EP7A 2L6DA 12GSA 3IBHA 4IN0A 2RM5A 1OYJA 3H8QA 4F03A 5HR0A 1NM3A 2MMNA 1M7TA 3IC4A 5ID2A 3LORA 2B5EA 3HXSA 1ZYEA 4XRDA 1R7HA 1YZXA 3KJYA 1K0CA 2DJ0A 5AIVA 4AF2A 3TJJA 1X5CA 1O8WA 2GT6A 1LU4A 1XVWA 2LQQA 2X64A 6GSSA 4MZCA 1EWXA 1X0RA 1HD2A 3RBTA 1SKRB 2YWNA 4OMVA 1GSYA 2P31A 1O6JA 4ILFA 1ON4A 1SK2A 3ME7A 1O85A 2B5YA 1I9DA 2O87A 3EVIA 1RK4A 4I5QA 4EVMA 3UJ1A 2A4VA 5D96A 4DSRA 4QQ7A 3C8EA 4HU7A 1EOHA 3NIVA 5A4UA 2XPEA 4PXOA 1SK0A 1A0RP 3QFAC 1XIYA 5D9TA 1EGRA 1S3CA 4N10A 1ZCPA 1UN2A 2V2GA 3O76A 3L9VA 5HR1A 3P7XA 1GSFA 3EU4A 5CYYA 4CW9A 5D93A 4ECJA 3TJBA 2C3NA 1K0AA 1MTCA 4EDZA 5D9XA 5J4UA 2X8HA 2IMEA 3LXTA 1THOA 1X5DA 5ECLB 2GS3A 2VAFA 1B4PA 4BWQA 2HSHA 2YN1A 2VCXA 2RUFA 2P5RA 2FD3A 4YAVA 4OFTA 3VWWA 4TR0A 1OC8A 5HFGA 5KN1A 2GDRA 4MDCA 2VCWA 1SL0B 2M80A 1F37A 2B6MA 3G7YA 13GSA 3ZIJA 3E0UA 4HU9A 1GTAA 5B7CA 5IMAA 3UARA 2LUSA 4ML6A 3AY8A 4N30A 4MF6A 2YOIA 3P90A 3QAGA 3N5OA 5G2ZA 1F9MA 4EE0A 2F9SA 2E2MA 3IA1A 2X8GA 2LSTA 3WGXA 1O73A 3KEBA 3GKMA 4MCUA 2NVLA 2IJYA 2VCQA 4D73B 1WPIA 2LKUA 2YJHA 5J41A 1E6BA 5CNWA 4TXOA 3CBUA 1R5PA 5COHA 2EIQA 4MMMA 3KIJA 2R5GA 4OO5A 4HOJA 3TOTA 2JZSA 2CT6A 2H01A 3FZAA 4Z7XA 1U88A 4K2DA 1FAAA 1XPVA 4N0VA 2I1UA 4GSNA 2IMKA 1A2MA 1IYIA 4KCEA 1YEPA 3CTGA 1O8XA 3DKSA 2L5LA 4HI7A 3CSHA 2H6YA 1MD3A 4IW9A 2GSRA 1WIKA 2FWGA 2R37A 2YWIA 1YEXA 3DMLA 5HR3A 1U87A 3FRCA 3OR5A 3KTBA 2OJLA 2BTOT 3APQA 4PNGA 1JZDA 5E59A 2C8UA 3GX8A 3LWAA 1Z5YE 2AAWA 1BYEA 2OA7A 4ULXA 1VF4A 1WOUA 4ZL7A 4XIHA 1MDJA 4Q5NA 1NW2A 2CAQA 2OE3A 3D22A 1X9WB 4Q5RA 2A2RA 2YWOA 1OKTA 1X9MB 2V1MA 4FIWA 1Z9HA 1K0DA 2GT5A 3S9FA 4NHWA 2WDUA 4KW6A 3C1SA 2B5XA 5ECRB 3NOFA 2R4VA 3TB2A 1FB6A 3GSSA 3WT1A 5CAXA 4HZ2A 4IBPA 1VRSD 1UVZA 3HA9A 2IN3A 2O89A 2AV4A 1W4VA 2B1LA 2GZPA 4QL7A 1ERTA 3RPNA 4TR3A 5G5EA 4MK3A 1SU9A 3F4TA 2B7KA 3HJPA 5IMVA 4TR1B 1A23A 4WBRD 2LV3A 5ECKB 3EMPA 1GNWA 1PMTA 4AJ6A 4JZQA 2TIRA 1EEMA 1QK8A 1Q4JA 3MSZA 1BX9A 1W89A 5KN3A 2JZTA 3KP9A 5ABRA 4KH7A 1XOBA 2V6KA 2H19A 5J9BA 3MNGA 1WWJA 1BG5A 5B8BA 2HZEB 4GF0A 5GAND 4P3YB 2PUKC 4GWRA 3TKSC 3QPMA 1J08A 4ZL8A 2GLRA 4K7IA 5GSSA 3CXGA 3N9JA 3QAVA 5DBQA 3TRQA 3LEFA 6GSXA 1QFNA 3VK9A 3HY2A 1ERUA 5IO2A 2KLXA 2H8LA 1ABAA 4IJ3A 1AC1A 1CQHA 1FB0A 1F2EA 22GSA 1PGTA 3GUSA 3IK7A 3GX0A 1FVKA 2GZZA 1ERWA 4DSSA 1HYUA 5IM9A 5CRWA 3F9UA 2VO4A 3HYPA 2CA8A 4OFMA 1URMA 2M46A 3EC3A 1B9YC 3UAPA 2NBSA 3C7MA 4HQSA 1GULA 2H6XA 5D9WA 3ZL5A 4EO3A 1GP1A 3U6VA 4KDXA 1SL1B 5FWGA 3US3A 2IMFA 3Q19A 2WRTA 2H0IA 3R2QA 3VFIA 4K6XA 3TDGA 4LL4B 3P8WA 3FY7A 4ZB6A 2F3MA 3RDWA 3GN3A 4XRAA 5IPGA 1THXA 2CV4A 1PQNA 4ZBDA 5CO3A 4K0GA 2X8CA 2V32A 2P0GA 5AN1A 3HJOA 3TGZA 4V1Ag 3O3TA 5HFIA 4POBA 4MJEA 5ECPB 2JADA 3UOMA 3TKPA 5IPHA 3EWLA 4PGTA 4X0XA 3SBCA 3FZ5A 3W8SA 2VLTA 4O7HA 2QC7A 5FHIA 3L0HA 2QKEA 4NAXA 7GSSA 1DUGA 2IFQA 4YQUA 1EZKA 2DBCA 5JWOB 2YV7A 3TRPA 3LYPA 5CRGA 4POLA 3HVVA 3ZREA 4K7NA 1WJKA 1UA5A 1XW9A 3J7Yk 3KCMA 1T4YA 3DYRA 2PMTA 3D0ZA 3VLNA 5DVBA 1MDIA 1K3OA 1Z3EA 1K0NA 2CX3A 4KNDA 4PURA 1G0TA 4OFNA 5DDLA 4N11A 3ZRDA 2H1AA 2KHPA 4PQIA 5JWQB 1B4QA 2NPBA 1S3DA 2EIOA 1GLPA 1V98A 3IXRA 1DSBA 4O32A 1Y6EA 2MYGA 4TOPA 1ML6A 2CX4A 2JSYA 2PVOC 3HKRA 3VPQA 3CYNA 2PN8A 3FR3A 2OKAA 3LJRA 2AHEA 3F3QA 3DEXA 2WB9A 3G9BA 3KTLA 5D73A 4DEJA 1BQ7A 3A5WA 1GH2A 4ZBAA 1TTZA 2N5AA 5H5QA 1DBYA 5D8IA 1PSQA 2B1KA 3TCOA 5DAKB 1IYHA 3MAKA 2DIYA 3ZYWA 4EKZA 1GTBA 2FGXA 5B6NA 2OE1A 1A0FA 1UC7A 1WE0A 1EGOA 4BVYA 2PBJA 3EYTA 1YJ6A 2VUPA 2CZ3A 2E0QA 5GSTA 1SK1A 2XHFA 1RQMA 2V6OA 2D2ZA 1T00A 2XBIA 8GSSA 4JR6A 1XWBA 2VLVA 2NTOA 2VLUA 3Q18A 1NHOA 3EMXA 4K7OA 3A2XA 18GSA 1SKWB 1TI3A 3TUEA 3KH7A 2GQMA 2HXKA 3KZQA 4X43A 2YV9A 1AQWA 2KP2A 1OC9A 1GSSA 4IQAA 1X5EA 5KEJA 2PU9C 1JZWA 5D9VA 1TRVA 5G1LA 5LCZA 5IOXA 1Z7RA 3ZMKA 4ECBA 1XZOA 3GNJA 4GQCA 1R26A 2G0FA 1G6YA 5A5KA 1HQOA 1PKWA 4BA7A 4ISDA 4WBJA 4IQ1A 2GQKA 5DALB 3ZITA 3HZ4A 1GLQA 2K18A 6GSVA 1VGLA 2P5QA 4F2IA 2VL2C 3E9JB 4MABA 1FW1A 2ALBA 1WMJA 2AJQB 4IVFA 4I2UA 1AXDA 1ZMAA 3FK8A 2NDOA 2VL2A 5ELGA 2HFDA 3QFBC 4FO5A 4XS6A 5H5RA 4KX4A 5GZZB 1BEDA 3EURA 4ACSA 4TRXA 3TJFA 4FH8A 4KB3A 2L57A 2O7KA 1OE7A 3FKFA 2MZCA 3IPZA 1SJIA 1A2JA 3DRNA 3L78A 4ZXGA 3UVHA 5EL8A 2I9HA 3H79A 2H75A 1S3AA 1OAZA 3DVXA 1NHYA 2LNSA 2WFCA 4L5LA 1GUKA 1PL1A 4WXTA 1F3BA 3D21A 5C00A 3C73A 5FT3A 3PR8A 2R6KA 3APOA 3UBKA 5ID2B 1PN9A 4POKA 5IMDA 3DIEA 3GTUA 3I43A 1XOAA 4XCSA 4WEYA 1EV4A 4ZILA 4GCIA 1ZGNA 2LS5A 3LG6A 1HNBA 3I9V2 4I8BA 3CMIA 3L9SA 1K0MA 2DMMA 4MH3A 2E7PA 2LJKA 5F07A 4TN8A 4WF4A 2HLSA 5EY6A 3A2WA 3FHKA 4ID0A 2RM6A 3GFKA 3ED3A 2GZYA 4TKYA 1YKAA 1XVQA 3IOSA 3BCKA 3J7Yb 1MEKA 4AJ7A 1M9AA 4GXZA 3ZTLA 4NHZA 5IQYA 4XS4A 1A8LA 4MH2A 3PINA 3VI5A 3IRAA 2VD1A 4TR4A 2R3XA 1GL8A 2AUVA 1JZRA 3LQ7A 1YKCA 4JBBA 3QCPA 4EDYA 1TI1A 3FR6A 5DCHA 2CVDA 3APSA 5IMCA 2VCTA 4KUNA 3UBLA 3ZFLA 3ZMLA 1CQGA 1JLWA 4IP6A 2EIRA 1TW9A 3I6AA 3UMAA 1M99A 1M2DA 4TW5A 1K3YA 2LRTA 2VD0A 2I81A 1SKSB 3K8NA 1YY7A 3QAWA 2VCVA 3TKRA 4LMVA 2E2GA 1Q98A 3CRUA 2H71A 4MJAA 2H0GA 4ZIJA 1U3AA 1V57A 2HSYA 1E2YA 3VI7A 1A24A 1M0UA 2H66A 16GSA 1DE2A 5CREA 2H73A 4MJCA 2H6ZA 3ERWA 1O7UA 5ECIB 2VOCA 5G1KA 5ECQB 2CZ2A 2JSZA 4IKHA 3WD6A 4KE3A 1QUWA 5EVOA 1PL2A 1U3IA 3BD2A 1FHEA 3ISOA 3ZZXA 2GSSA 4V1Ap 1JHBA 2ZUPA 4I2TA 4L0UA 1R4WA 3M9JA 1PX7A 3IAM2 2X99A 4RQXA 4G10A 2IWTA 1F6MC 1Z6MA 2IIYA 1FVJA 4GQFA 5DJMA 3IR4A 4TXOB 3DD3A 4RI6A 2EC4A 5B8AA 1QQ2A 3H93A 2YZHA 1GRXA 4O92A 2FHEA 1C72A 1XCCA 2PVQA 1T3BA 4EUYA 3IAS2 4MF7A 2OADA 4IELA 2JACA 1JFUA 1K3LA 2DMLA 4OWYA 3Q6OA 1M2AA 3HD5A 1SYRA 2FA4A 2PGTA 2ES7A 2PERA 2VM1A 1U6TA 5DAKA 5IOWA 2DIZA 2QSIA 1N8JA 3GV1A 4CDOA 3VURA 1R5AA 5L71A 3D4MA 5J9CA 3LSZA 11GSA 5JCUA 1J9BA 1HNCA 2H30A 2G2QA 5IO0A 2L59A 2YNXA 1NSWA 4QL9A 2H74A 3QR6A 2VCZA 2H76A 4K0NA 2HRNA 3F3RA 1GUMA 4ZL9A 2K8SA 3HDCA 2CVBA 3HVSA 4KAEA
chains in the Genus database with same CATH superfamily
1TOFA 4WF5A 5B6MA 4HSCX 1FO5A 2H1GA 1TU8A 2FY6A 4MPGA 1F3AA 2PWJA 2IMDA 1KEBA 1WRYA 3W8JA 3EE2A 3KXOA 1G7EA 1ZOFA 2C80A 2WJUA 3WGDA 1TRUA 2YANA 2MMZA 3F6DA 3CTFA 2FWFA 1GTUA 1BJXA 2XPDA 2LQOA 1G6WA 3FZ4A 3LW9A 4ZB8A 4V2LA 3HVNA 1EV9A 1EOGA 2LJAA 2ON7A 5DCGA 4FYUA 2LRNA 1TK5B 1MD4A 2GGTA 1GSQA 5G5FA 2HRFA 2DJJA 4KSOA 4Q5QA 4NPBA 3LYKA 1OKDA 1SJZA 2DSAA 6GSWA 3M3MA 3M9KA 4O5RA 2LRCA 4WR5A 2H72A 2C4JA 1XFLA 2CAIA 2DJKA 3TJGA 4BL7A 2JL4A 4LLRA 4WR4A 3FMWA 4YQVA 3UVTA 1KTEA 3E3EA 1B9XC 1FOVA 1PD21 1YF0A 1H75A 2RUEA 4XHMA 4MA9A 1ERVA 2QGVA 1AQVA 4DVCA 3KM6A 4O5UA 3IHQA 1SENA 3GH6A 3M8NA 4PQ1A 3WYWA 2HT9A 4N0ZA 3GRXA 1LBKA 2KOKA 3CSIA 2DJ1A 5AGYA 1XXUA 1AUCA 4HUAA 4Z2TA 3ZLPA 1SD9A 4D73A 4J57E 3GHAA 1OE8A 1VF2A 2MBTA 3RHCA 4HDEA 3C1RA 1ZL9A 5G31A 2YZUA 4KDYA 1T4ZA 2ON5A 4NMUA 4E8EA 1TKDB 5HQPA 3KP8A 3FW2A 1AW9A 2ZCTA 5DQSA 4ECCA 2R0PA 1GWCA 3KD0A 1A2LA 2LEGA 3EU3A 2N5FA 1GTIA 4RUVA 1ILOA 1AIUA 5LNKe 2K8VA 4GRFA 4BVXA 3HZ8A 4MLYA 4E8HA 2K9FA 1PRXA 1BAYA 4MZBA 1USBA 2OE0A 3FR9A 4G0LA 4WKWA 3L9UA 3PPUA 1H4OA 5ECSA 3W6GA 1EP8A 4PX1A 2IFQB 4HJ2A 4KCAA 2LTKA 6GSUA 3A5IA 3F8UA 1PKZA 2HNLA 3IDVA 1B8XA 2VL3A 3FYGA 4OCEA 2O8VB 1V9WA 2FCHA 4KF9A 3GH9A 4JRRA 2BJXA 2UZ8A 2YCDA 3ZVJA 1DE1A 2OBIA 3LGCA 4OCFA 1YQ1A 14GSA 3MWHA 1XW6A 3PGTA 4L0WA 4WETA 4PUAA 1LJRA 3MIXA 2ZNMA 3U5RE 2DJ2A 4XTSA 3D4TA 2L6CA 4HEA2 4K2XA 3RPPA 2O85A 5F06A 3QMXA 3ZVJD 2FWEA 4TR1A 4F0CA 3P2AA 4NXIA 2DC5A 2IMIA 3M1GA 3GKXA 4GLTA 3D5JA 1QMVA 4BPYA 4GTUA 3GL3A 5CRHA 4HZ4A 4V2NA 1XWAA 1XWCA 4ECIA 5HFKA 2HZEA 1Y25A 4AGSA 3F4SA 4Q5FA 1SD8A 3QD9A 4DSQA 2DJ3A 4RI7A 3ERFA 1EEJA 1VF3A 2C0DA 2J23A 1XBSA 4YAPA 2RIIA 2H1BA 4FYCA 4TVEA 3HJMA 2Z9SA 3DGQA 4YH2A 6GSTA 1ZYQB 3A2VA 2DLXA 1FG4A 3VPTA 2YJ7A 2YWMA 3WT2A 4JEDA 2GQLA 5J3RA 4G2EA 5ECOB 4BVYB 4YKGA 2H1DA 3H1NA 5C04A 2F8AA 1YF1A 1JZOA 2I4AA 2IPAA 2LNTA 2C1YA 3F4RA 1GNEA 1TK0B 1XW5A 1J0FA 3BCIA 3ZFBA 2RLIA 4CHSA 2XC2A 2L4QA 2LJRA 3ERGA 1PFOA 2WCIA 1TRSA 2WS2A 3IK9A 4H86A 1O81A 4NV5A 2A2SA 4KSMA 3PH9A 2FWHA 1T8EB 5JWRB 1OC9B 4IS0A 2OBKA 4K9ZA 4LMWA 4TXVA 1Z7PA 2TRCP 2K6VA 5F8BA 2R0CA 5G30A 2B7JA 3O6TA 2F8FA 3CSJA 5CRDA 4F82A 3GURA 3IV4A 3FZ9A 2VIMA 4GSSA 3HCZA 3KH9A 3KGKA 4PNFA 4JR4A 4JE1A 10GSA 5ECNB 3I69A 4ZB9A 1AAZA 4KGIA 3DWVA 4V2MA 2MMAA 1TDIA 5HR2A 2PPTA 4EL1A 2XBQA 3GKKA 2C3TA 4POMA 2B3SA 3M0FA 4OO4A 2C3QA 2YPMA 2DKHA 2GSTA 3QOUA 4MF5A 4NWYA 3KMNA 4MP4A 4F0BA 2HE3A 4OD7A 4K8MA 2TRXA 1M9BA 4J56E 5DQYA 3G7JA 4LA1A 4LL1B 2FLSA 1ST9A 1V2AA 3GMFA 2HI7A 5F0GA 2FNOA 1PN0A 2VL9A 1TP9A 1V58A 4BWSA 4KA0A 4G9HA 5H5SA 1RW1A 3VWUA 2C0EA 2KUCA 3DXBA 1XWKA 4FQUA 3SWLA 4ZBBA 2BMXA 2WULA 3ME8A 9GSSA 4IHUA 5ECHB 2REMA 4I97A 3TJKA 1Z6NA 1QXHA 5JCGA 1K0OA 3A3TA 4KDUA 2KP1A 4O5QA 1A8YA 1WP0A 2YP6A 3CRTA 1SJ6A 4PQHA 17GSA 3GL5A 2OACA 1GUHA 3TKSA 3GTUB 3FEUA 2DKIA 1V40A 3TKSE 5JCWA 5INYA 4FYBA 1OVNA 3GA4A 2MMOA 5J5NA 4L8EA 2WZ9A 5ECMB 3RHBA 3GYKA 4EC0A 4EXJA 5KN2A 5AIXA 1JLVA 2GTUA 4J2FA 1KNGA 3D6IA 4YKFA 1T1VA 5ENUA 4I6XA 5AISA 4K1FA 4IJIA 2CQ9A 3DVWA 4ICYA 1XWGA 3ZIVA 3RAZA 1B48A 2JZRA 4XS4B 5A4WA 3QDNA 1SL2B 2GVPA 1PX6A 2HSMA 3G7IA 1GSDA 6GSYA 1M2BA 3TKQA 4RQRA 1KBNA 5ELAA 2CVKA 3GIXA 3BOAA 5EPFA 1VF1A 1I5GA 2F51A 4MZWA 4HJMA 5IMZA 3BBYA 3LXZA 3TRXA 4EF0A 1OC3A 1TU7A 5LD0A 2QA2A 3F6FA 5E4WA 2R2JA 2HZFA 4HS1A 2MBSA 2X4AA 2FUG2 1X9SB 1TXXA 5GAPD 3UL3A 3F0IA 3LFLA 1SYXA 20GSA 4JU5A 2V41A 3IE3A 3H4KA 1QGVA 4MPFA 2C0GA 4CY8A 3MDKA 3NZNA 2I3YA 1T7PB 1TRWA 1G7OA 4GSTA 2IL3A 4AJ8A 1MDKA 3R3EA 3BJ5A 3JCML 3VWVA 1AQXA 2VM2A 4XS1A 1ACVA 2M72A 2AB6A 3V1WA 1GSUA 1PA3A 3L4NA 3C71A 2H70A 3TOUA 4MJBA 4IP1A 5KN0A 4X1UA 5DALA 4PUFC 1M3JA 3HVXA 2L5OA 5CP1A 3WGEA 5IIZA 4L5OA 2C0FA 4K5SA 5KOWA 3HHVA 3UIWA 2N5BA 1K0BA 4F9ZA 2H0HA 2JU5A 2L4CA 2GSQA 4ML1A 3VWXA 1TJDA 1N2AA 3GSTA 3UEMA 2FA8A 3Q74A 5F05A 4G19A 2WGRA 1TK8B 5A4VA 3GKNA 5DJLA 3F63A 4K5RA 3KMOA 5IMFA 3EINA 2J9HA 4IGJA 2AYTA 4NV2A 4HQZA 4YQMA 1YDKA 19GSA 1ZZYA 4DSSB 1GSEA 2HYXA 1HNAA 1EP7A 2L6DA 12GSA 3IBHA 4IN0A 2RM5A 1OYJA 3H8QA 4F03A 5HR0A 1NM3A 2MMNA 1M7TA 3IC4A 5ID2A 3LORA 2B5EA 3HXSA 1ZYEA 4XRDA 1R7HA 1YZXA 4EIQA 4EIPA 3KJYA 1K0CA 2DJ0A 5AIVA 4AF2A 3CQFA 3TJJA 1X5CA 1O8WA 2GT6A 1LU4A 1XVWA 2LQQA 2X64A 6GSSA 4MZCA 1EWXA 1X0RA 1HD2A 3RBTA 1SKRB 2YWNA 4OMVA 1GSYA 2P31A 1O6JA 4ILFA 1ON4A 1SK2A 3ME7A 1O85A 2B5YA 1I9DA 2O87A 3EVIA 1RK4A 4I5QA 4EVMA 3UJ1A 2A4VA 5D96A 4DSRA 4QQ7A 3C8EA 4HU7A 1EOHA 3NIVA 5A4UA 2XPEA 4PXOA 1SK0A 1A0RP 3QFAC 1XIYA 5D9TA 1EGRA 1S3CA 4N10A 1ZCPA 1UN2A 2V2GA 3O76A 3L9VA 5HR1A 3P7XA 1GSFA 3EU4A 5CYYA 4CW9A 5D93A 4ECJA 1M3IA 3TJBA 2QA1A 4Z2RA 2C3NA 1K0AA 1MTCA 4EDZA 5D9XA 5J4UA 2X8HA 2IMEA 3LXTA 1THOA 1X5DA 5ECLB 2GS3A 2VAFA 1B4PA 4BWQA 2HSHA 2YN1A 2VCXA 2RUFA 2P5RA 2FD3A 4YAVA 4OFTA 3VWWA 4TR0A 1OC8A 5HFGA 4A5PA 5KN1A 2GDRA 4MDCA 2VCWA 1SL0B 2M80A 1F37A 2B6MA 3G7YA 13GSA 3ZIJA 1ZYNA 3E0UA 4BL7B 4G0KA 4HU9A 1GTAA 5B7CA 5IMAA 3UARA 2LUSA 4ML6A 3AY8A 4N30A 4MF6A 2YOIA 3P90A 3QAGA 3N5OA 5G2ZA 1F9MA 4EE0A 2F9SA 2E2MA 3IA1A 2X8GA 2LSTA 3WGXA 1O73A 3KEBA 3GKMA 4MCUA 2NVLA 2IJYA 2VCQA 4D73B 1WPIA 2LKUA 2YJHA 5J41A 1E6BA 5CNWA 4TXOA 3CBUA 1R5PA 5COHA 2EIQA 4MMMA 3KIJA 2R5GA 4OO5A 4HOJA 3TOTA 2JZSA 2CT6A 2H01A 3FZAA 4Z7XA 1U88A 4K2DA 1FAAA 1XPVA 4N0VA 2I1UA 4GSNA 2IMKA 1A2MA 1IYIA 4KCEA 1YEPA 3CTGA 1O8XA 3DKSA 2L5LA 4HI7A 3CSHA 2H6YA 1MD3A 4IW9A 2GSRA 1WIKA 2FWGA 2R37A 2YWIA 1YEXA 3DMLA 5HR3A 1U87A 3FRCA 4BVXB 3OR5A 3KTBA 2OJLA 2BTOT 3APQA 4PNGA 1JZDA 5E59A 2C8UA 3GX8A 3LWAA 1Z5YE 2AAWA 1BYEA 2OA7A 4ULXA 1VF4A 1WOUA 2HRAA 4PTSA 4ZL7A 4XIHA 1MDJA 4Q5NA 1NW2A 2CAQA 2OE3A 3D22A 1X9WB 4Q5RA 2A2RA 2YWOA 1OKTA 1X9MB 2V1MA 4FIWA 1Z9HA 1K0DA 2GT5A 3S9FA 4NHWA 2WDUA 4KW6A 3C1SA 2B5XA 5ECRB 3NOFA 3EPTA 2R4VA 3TB2A 1FB6A 3GSSA 3WT1A 5CAXA 4HZ2A 4IBPA 1VRSD 1UVZA 3HA9A 2IN3A 2O89A 2AV4A 1W4VA 2B1LA 2GZPA 4QL7A 1ERTA 3RPNA 4TR3A 4USSA 5G5EA 4MK3A 1SU9A 3F4TA 2B7KA 3HJPA 5BRTA 5IMVA 4TR1B 1A23A 4WBRD 2LV3A 5ECKB 3EMPA 1GNWA 1PMTA 4AJ6A 4JZQA 2TIRA 1EEMA 1QK8A 1Q4JA 3MSZA 1BX9A 1W89A 5KN3A 2JZTA 3KP9A 5ABRA 4KH7A 1XOBA 2V6KA 2H19A 5J9BA 3MNGA 1WWJA 1BG5A 5B8BA 2HZEB 4GF0A 5GAND 4P3YB 2PUKC 4GWRA 3TKSC 3QPMA 1J08A 4ZL8A 2GLRA 4K7IA 5GSSA 3CXGA 3N9JA 3QAVA 5DBQA 3TRQA 3LEFA 6GSXA 1QFNA 3VK9A 3HY2A 1ERUA 2R0GA 5IO2A 2KLXA 2H8LA 1ABAA 4IJ3A 1AC1A 1CQHA 1FB0A 1F2EA 22GSA 1PGTA 3GUSA 3IK7A 3GX0A 1FVKA 2GZZA 1ERWA 4DSSA 1HYUA 5IM9A 5CRWA 3F9UA 2VO4A 3HYPA 2CA8A 4OFMA 1URMA 2M46A 3EC3A 1B9YC 3UAPA 2NBSA 3C7MA 4HQSA 1GULA 2H6XA 2X49A 5D9WA 3ZL5A 4EO3A 1GP1A 3U6VA 4KDXA 1SL1B 5FWGA 3US3A 2IMFA 3Q19A 2WRTA 2H0IA 3R2QA 3VFIA 4K6XA 3TDGA 4LL4B 3P8WA 3FY7A 4ZB6A 2F3MA 3RDWA 3GN3A 4XRAA 5IPGA 1THXA 2CV4A 1PQNA 4ZBDA 5CO3A 4K0GA 2X8CA 2V32A 2P0GA 3HJOA 5AN1A 3TGZA 4V1Ag 3O3TA 5HFIA 4POBA 4MJEA 5ECPB 2JADA 3UOMA 3TKPA 5IPHA 3EWLA 4PGTA 4BIKA 4X0XA 3SBCA 3FZ5A 3W8SA 2VLTA 4O7HA 2QC7A 5FHIA 3L0HA 2QKEA 4NAXA 7GSSA 1DUGA 2IFQA 4YQUA 1EZKA 2DBCA 5JWOB 2YV7A 3TRPA 3LYPA 5CRGA 4POLA 3HVVA 3ZREA 4K7NA 1WJKA 3IHGA 1UA5A 1XW9A 3J7Yk 3KCMA 1T4YA 3DYRA 2PMTA 3D0ZA 3VLNA 5DVBA 1MDIA 1K3OA 1Z3EA 1K0NA 2CX3A 4KNDA 4PURA 1G0TA 4OFNA 5DDLA 4N11A 3ZRDA 2H1AA 2KHPA 4PQIA 5JWQB 1B4QA 2NPBA 1S3DA 2EIOA 4O32A 1GLPA 1V98A 1DSBA 3IXRA 1Y6EA 2MYGA 4TOPA 1ML6A 2CX4A 2JSYA 2PVOC 3HKRA 3VPQA 3CYNA 2PN8A 3FR3A 2OKAA 3LJRA 2AHEA 3F3QA 3DEXA 2WB9A 3G9BA 3KTLA 5D73A 4DEJA 1BQ7A 3A5WA 1GH2A 4ZBAA 1TTZA 2N5AA 5H5QA 5KOXA 1DBYA 5D8IA 1PSQA 2B1KA 3TCOA 5DAKB 1IYHA 3MAKA 2DIYA 3ZYWA 4EKZA 1GTBA 2FGXA 5B6NA 2OE1A 1A0FA 1UC7A 1WE0A 1EGOA 4BVYA 2PBJA 1FOHA 3EYTA 1YJ6A 2VUPA 2CZ3A 2E0QA 5GSTA 1SK1A 2XHFA 1RQMA 2V6OA 2D2ZA 1T00A 2XBIA 8GSSA 4JR6A 1XWBA 2VLVA 2NTOA 2VLUA 3Q18A 1NHOA 3EMXA 4K7OA 3A2XA 18GSA 1SKWB 1TI3A 3TUEA 3KH7A 2GQMA 2HXKA 3KZQA 4X43A 2YV9A 1AQWA 2KP2A 1OC9A 1GSSA 4MNNA 4IQAA 1X5EA 5KEJA 2PU9C 1JZWA 5D9VA 1TRVA 5G1LA 5LCZA 5IOXA 1Z7RA 3ZMKA 4ECBA 1XZOA 3GNJA 4GQCA 1R26A 2G0FA 1G6YA 5A5KA 1HQOA 1PKWA 4BA7A 4ISDA 4WBJA 4IQ1A 2GQKA 5DALB 3ZITA 3HZ4A 1GLQA 2K18A 6GSVA 1VGLA 2P5QA 4F2IA 2VL2C 3E9JB 4MABA 1FW1A 2ALBA 1WMJA 2AJQB 4IVFA 4I2UA 1AXDA 1ZMAA 3FK8A 2NDOA 2VL2A 5ELGA 2HFDA 3QFBC 4FO5A 4XS6A 5H5RA 4KX4A 5GZZB 1BEDA 3EURA 4ACSA 4TRXA 3TJFA 4FH8A 4KB3A 2L57A 2O7KA 4G0IA 5BMUA 1OE7A 3FKFA 2MZCA 3IPZA 1SJIA 1A2JA 3DRNA 3L78A 4ZXGA 3UVHA 5EL8A 2I9HA 3H79A 2H75A 1S3AA 1OAZA 3DVXA 1NHYA 2LNSA 2WFCA 4L5LA 1GUKA 4CY6A 1PL1A 4WXTA 1F3BA 3D21A 5C00A 3C73A 5FT3A 3PR8A 2R6KA 3APOA 3UBKA 5ID2B 1PN9A 4POKA 5IMDA 3DIEA 3GTUA 3I43A 1XOAA 4XCSA 4WEYA 1EV4A 4ZILA 4GCIA 1ZGNA 2LS5A 3LG6A 1HNBA 3I9V2 4I8BA 3CMIA 3L9SA 2HRKA 1K0MA 2DMMA 4MH3A 2E7PA 2LJKA 5F07A 4TN8A 4WF4A 2HLSA 5EY6A 3A2WA 3FHKA 4ID0A 2RM6A 3GFKA 3ED3A 2GZYA 4TKYA 1YKAA 1XVQA 3IOSA 3BCKA 3J7Yb 1MEKA 4AJ7A 1M9AA 4GXZA 3ZTLA 4NHZA 5IQYA 4XS4A 1A8LA 4MH2A 3PINA 3VI5A 3IRAA 2VD1A 4TR4A 2R3XA 1GL8A 2AUVA 1JZRA 3LQ7A 1YKCA 4JBBA 3QCPA 4EDYA 1TI1A 3FR6A 5DCHA 2CVDA 3APSA 5IMCA 2VCTA 4KUNA 3UBLA 3ZFLA 3ZMLA 1CQGA 1JLWA 4IP6A 2EIRA 1TW9A 3I6AA 3UMAA 1S3RA 1M99A 1M2DA 4TW5A 1K3YA 2LRTA 2VD0A 2I81A 1SKSB 3K8NA 1YY7A 3QAWA 2VCVA 3TKRA 4LMVA 2E2GA 1Q98A 3CRUA 4X4JA 2H71A 4MJAA 2H0GA 4ZIJA 3IC8A 1U3AA 1V57A 2HSYA 1E2YA 3VI7A 1A24A 1M0UA 2H66A 16GSA 1DE2A 5CREA 2H73A 4MJCA 2H6ZA 3ERWA 1O7UA 5ECIB 2VOCA 5G1KA 5ECQB 2CZ2A 2JSZA 4IKHA 3WD6A 4KE3A 4Z2UA 1QUWA 3MYDA 1ZYPA 5EVOA 1PL2A 1U3IA 3BD2A 1FHEA 3ISOA 3ZZXA 2GSSA 4V1Ap 1JHBA 2ZUPA 4I2TA 4L0UA 1R4WA 3M9JA 1PX7A 3IAM2 2X99A 4RQXA 4G10A 2IWTA 1F6MC 1Z6MA 2IIYA 1FVJA 4GQFA 5DJMA 3IR4A 4TXOB 3DD3A 4RI6A 2EC4A 5B8AA 1QQ2A 3H93A 2YZHA 1GRXA 4O92A 2FHEA 1C72A 1XCCA 2PVQA 1T3BA 4EUYA 3IAS2 4MF7A 2OADA 4IELA 2JACA 1JFUA 1K3LA 2DMLA 4OWYA 3Q6OA 1M2AA 1XG8A 3HD5A 1SYRA 2FA4A 2PGTA 2ES7A 2PERA 2A4HA 2VM1A 1U6TA 5DAKA 5IOWA 2DIZA 2QSIA 1N8JA 3GV1A 4CDOA 3VURA 1R5AA 5L71A 3D4MA 5J9CA 2A2PA 3LSZA 11GSA 5JCUA 1J9BA 1HNCA 2H30A 2G2QA 5IO0A 2L59A 2YNXA 1NSWA 4QL9A 2H74A 3QR6A 2VCZA 2H76A 4K0NA 2HRNA 3F3RA 1GUMA 4ZL9A 2K8SA 3HDCA 2CVBA 3HVSA 4KAEA
chains in the Genus database with same CATH topology
1TOFA 4WF5A 5B6MA 1FO5A 2H1GA 1TU8A 2FY6A 4MPGA 1F3AA 2PWJA 2IMDA 1KEBA 1WRYA 3W8JA 3EE2A 3KXOA 1G7EA 1ZOFA 2C80A 2WJUA 3WGDA 1TRUA 2YANA 2MMZA 3F6DA 3CTFA 2FWFA 1GTUA 1BJXA 2XPDA 2LQOA 1G6WA 3FZ4A 3LW9A 4ZB8A 4V2LA 1EV9A 1EOGA 2LJAA 2ON7A 5DCGA 4FYUA 2LRNA 1TK5B 1MD4A 2GGTA 1GSQA 5G5FA 2HRFA 2DJJA 4KSOA 4Q5QA 4NPBA 3LYKA 1OKDA 1SJZA 2DSAA 6GSWA 3M3MA 3M9KA 4O5RA 2LRCA 4WR5A 2H72A 2C4JA 1XFLA 2CAIA 2DJKA 3TJGA 4BL7A 2JL4A 4LLRA 4WR4A 3FMWA 4YQVA 3UVTA 1KTEA 3E3EA 1B9XC 1FOVA 1PD21 1YF0A 1H75A 2RUEA 4XHMA 4MA9A 1ERVA 2QGVA 1AQVA 4DVCA 3KM6A 4O5UA 3IHQA 1SENA 3GH6A 3M8NA 4PQ1A 3WYWA 2HT9A 4N0ZA 3GRXA 1LBKA 2KOKA 3CSIA 2DJ1A 5AGYA 1XXUA 1AUCA 4HUAA 4Z2TA 3ZLPA 1SD9A 4D73A 4J57E 3GHAA 1OE8A 1VF2A 2MBTA 3RHCA 4HDEA 3C1RA 1ZL9A 5G31A 2YZUA 4KDYA 1T4ZA 2ON5A 4NMUA 4E8EA 1TKDB 5HQPA 3KP8A 3FW2A 1AW9A 2ZCTA 5DQSA 4ECCA 2R0PA 1GWCA 3KD0A 1A2LA 2LEGA 3EU3A 2N5FA 1GTIA 4RUVA 1ILOA 1AIUA 5LNKe 2K8VA 4GRFA 4BVXA 3HZ8A 4MLYA 4E8HA 2K9FA 1PRXA 1BAYA 4MZBA 1USBA 2OE0A 3FR9A 4G0LA 4WKWA 3L9UA 3PPUA 1H4OA 5ECSA 3W6GA 1EP8A 4PX1A 2IFQB 4HJ2A 4KCAA 2LTKA 6GSUA 3A5IA 3F8UA 1PKZA 2HNLA 3IDVA 1B8XA 2VL3A 3FYGA 4OCEA 2O8VB 1V9WA 2FCHA 4KF9A 3GH9A 4JRRA 2BJXA 2UZ8A 2YCDA 3ZVJA 1DE1A 2OBIA 3LGCA 4OCFA 1YQ1A 14GSA 3MWHA 1XW6A 3PGTA 4L0WA 4WETA 4PUAA 1LJRA 3MIXA 2ZNMA 3U5RE 2DJ2A 4XTSA 3D4TA 2L6CA 4HEA2 4K2XA 3RPPA 2O85A 5F06A 3QMXA 3ZVJD 2FWEA 4TR1A 4F0CA 3P2AA 4NXIA 2DC5A 2IMIA 3M1GA 3GKXA 4GLTA 3D5JA 1QMVA 4BPYA 4GTUA 3GL3A 5CRHA 4HZ4A 4V2NA 1XWAA 1XWCA 4ECIA 5HFKA 2HZEA 1Y25A 4AGSA 3F4SA 4Q5FA 1SD8A 3QD9A 4DSQA 2DJ3A 4RI7A 3ERFA 1EEJA 1VF3A 2C0DA 2J23A 1XBSA 4YAPA 2RIIA 2H1BA 4FYCA 4TVEA 3HJMA 2Z9SA 3DGQA 4YH2A 6GSTA 1ZYQB 3A2VA 2DLXA 1FG4A 3VPTA 2YJ7A 2YWMA 3WT2A 4JEDA 2GQLA 5J3RA 4G2EA 5ECOB 4BVYB 4YKGA 2H1DA 3H1NA 5C04A 2F8AA 1YF1A 1JZOA 2I4AA 2IPAA 2LNTA 2C1YA 3F4RA 1GNEA 1TK0B 1XW5A 1J0FA 3BCIA 3ZFBA 2RLIA 4CHSA 2XC2A 2L4QA 2LJRA 3ERGA 2WCIA 1TRSA 2WS2A 3IK9A 4H86A 1O81A 4NV5A 2A2SA 4KSMA 3PH9A 2FWHA 1T8EB 5JWRB 1OC9B 4IS0A 2OBKA 4K9ZA 4LMWA 4TXVA 1Z7PA 2TRCP 2K6VA 5F8BA 2R0CA 5G30A 2B7JA 3O6TA 2F8FA 3CSJA 5CRDA 4F82A 3GURA 3IV4A 3FZ9A 2VIMA 4GSSA 3HCZA 3KH9A 3KGKA 4PNFA 4JR4A 4JE1A 10GSA 5ECNB 3I69A 4ZB9A 1AAZA 4KGIA 3DWVA 4V2MA 2MMAA 1TDIA 5HR2A 2PPTA 4EL1A 2XBQA 3GKKA 2C3TA 4POMA 2B3SA 3M0FA 4OO4A 2C3QA 2YPMA 2DKHA 2GSTA 3QOUA 4MF5A 4NWYA 3KMNA 4MP4A 4F0BA 2HE3A 4OD7A 4K8MA 2TRXA 1M9BA 4J56E 5DQYA 3G7JA 4LA1A 4LL1B 2FLSA 1ST9A 1V2AA 3GMFA 2HI7A 5F0GA 2FNOA 1PN0A 2VL9A 1TP9A 1V58A 4BWSA 4KA0A 4G9HA 5H5SA 1RW1A 3VWUA 2C0EA 2KUCA 3DXBA 1XWKA 4FQUA 3SWLA 4ZBBA 2BMXA 2WULA 3ME8A 9GSSA 4IHUA 5ECHB 2REMA 4I97A 3TJKA 1Z6NA 1QXHA 5JCGA 1K0OA 3A3TA 4KDUA 2KP1A 4O5QA 1A8YA 1WP0A 2YP6A 3CRTA 1SJ6A 4PQHA 17GSA 3GL5A 2OACA 1GUHA 3TKSA 3GTUB 3FEUA 2DKIA 1V40A 3TKSE 5JCWA 5INYA 4FYBA 1OVNA 3GA4A 2MMOA 5J5NA 4L8EA 2WZ9A 5ECMB 3RHBA 3GYKA 4EC0A 4EXJA 5KN2A 5AIXA 1JLVA 2GTUA 4J2FA 1KNGA 3D6IA 4YKFA 1T1VA 5ENUA 4I6XA 5AISA 4K1FA 4IJIA 2CQ9A 3DVWA 4ICYA 1XWGA 3ZIVA 3RAZA 1B48A 2JZRA 4XS4B 5A4WA 3QDNA 1SL2B 2GVPA 1PX6A 2HSMA 3G7IA 1GSDA 6GSYA 1M2BA 3TKQA 4RQRA 1KBNA 5ELAA 2CVKA 3GIXA 3BOAA 5EPFA 1VF1A 1I5GA 2F51A 4MZWA 4HJMA 5IMZA 3BBYA 3LXZA 3TRXA 4EF0A 1OC3A 1TU7A 5LD0A 2QA2A 3F6FA 5E4WA 2R2JA 2HZFA 4HS1A 2MBSA 2X4AA 2FUG2 1X9SB 1TXXA 5GAPD 3UL3A 3F0IA 3LFLA 1SYXA 20GSA 4JU5A 2V41A 3IE3A 3H4KA 1QGVA 4MPFA 2C0GA 4CY8A 3MDKA 3NZNA 2I3YA 1T7PB 1TRWA 1G7OA 4GSTA 2IL3A 4AJ8A 1MDKA 3R3EA 3BJ5A 3JCML 3VWVA 1AQXA 2VM2A 4XS1A 1ACVA 2M72A 2AB6A 3V1WA 1GSUA 1PA3A 3L4NA 3C71A 2H70A 3TOUA 4MJBA 4IP1A 5KN0A 4X1UA 5DALA 4PUFC 3HVXA 2L5OA 5CP1A 3WGEA 5IIZA 4L5OA 2C0FA 4K5SA 5KOWA 3HHVA 3UIWA 2N5BA 1K0BA 4F9ZA 2H0HA 2JU5A 2L4CA 2GSQA 4ML1A 3VWXA 1TJDA 1N2AA 3GSTA 3UEMA 2FA8A 3Q74A 5F05A 4G19A 2WGRA 1TK8B 5A4VA 3GKNA 5DJLA 3F63A 4K5RA 3KMOA 5IMFA 3EINA 2J9HA 4IGJA 2AYTA 4NV2A 4HQZA 4YQMA 1YDKA 19GSA 1ZZYA 4DSSB 1GSEA 2HYXA 1HNAA 1EP7A 2L6DA 12GSA 3IBHA 4IN0A 2RM5A 1OYJA 3H8QA 4F03A 5HR0A 1NM3A 2MMNA 1M7TA 3IC4A 5ID2A 3LORA 2B5EA 3HXSA 1ZYEA 4XRDA 1R7HA 1YZXA 4EIQA 4EIPA 3KJYA 1K0CA 2DJ0A 5AIVA 4AF2A 3TJJA 1X5CA 1O8WA 2GT6A 1LU4A 1XVWA 2LQQA 2X64A 6GSSA 4MZCA 1EWXA 1X0RA 1HD2A 3RBTA 1SKRB 2YWNA 4OMVA 1GSYA 2P31A 1O6JA 4ILFA 1ON4A 1SK2A 3ME7A 1O85A 2B5YA 1I9DA 2O87A 3EVIA 1RK4A 4I5QA 4EVMA 3UJ1A 2A4VA 5D96A 4DSRA 4QQ7A 3C8EA 4HU7A 1EOHA 3NIVA 5A4UA 2XPEA 4PXOA 1SK0A 1A0RP 3QFAC 1XIYA 5D9TA 1EGRA 1S3CA 4N10A 1ZCPA 1UN2A 2V2GA 3O76A 3L9VA 5HR1A 3P7XA 1GSFA 3EU4A 5CYYA 4CW9A 5D93A 4ECJA 3TJBA 2QA1A 4Z2RA 2C3NA 1K0AA 1MTCA 4EDZA 5D9XA 5J4UA 2X8HA 2IMEA 3LXTA 1THOA 1X5DA 5ECLB 2GS3A 2VAFA 1B4PA 4BWQA 2HSHA 2YN1A 2VCXA 2RUFA 2P5RA 2FD3A 4YAVA 4OFTA 3VWWA 4TR0A 1OC8A 5HFGA 4A5PA 5KN1A 2GDRA 4MDCA 2VCWA 1SL0B 2M80A 1F37A 2B6MA 3G7YA 13GSA 3ZIJA 1ZYNA 3E0UA 4BL7B 4G0KA 4HU9A 1GTAA 5B7CA 5IMAA 3UARA 2LUSA 4ML6A 3AY8A 4N30A 4MF6A 2YOIA 3P90A 3QAGA 3N5OA 5G2ZA 1F9MA 4EE0A 2F9SA 2E2MA 3IA1A 2X8GA 2LSTA 3WGXA 1O73A 3KEBA 3GKMA 4MCUA 2NVLA 2IJYA 2VCQA 4D73B 1WPIA 2LKUA 2YJHA 5J41A 1E6BA 5CNWA 4TXOA 3CBUA 1R5PA 5COHA 2EIQA 4MMMA 3KIJA 2R5GA 4OO5A 4HOJA 3TOTA 2JZSA 2CT6A 2H01A 3FZAA 4Z7XA 1U88A 4K2DA 1FAAA 1XPVA 4N0VA 2I1UA 4GSNA 2IMKA 1A2MA 1IYIA 4KCEA 1YEPA 3CTGA 1O8XA 3DKSA 2L5LA 4HI7A 3CSHA 2H6YA 1MD3A 4IW9A 2GSRA 1WIKA 2FWGA 2R37A 2YWIA 1YEXA 3DMLA 5HR3A 1U87A 3FRCA 4BVXB 3OR5A 3KTBA 2OJLA 2BTOT 3APQA 4PNGA 1JZDA 5E59A 2C8UA 3GX8A 3LWAA 1Z5YE 2AAWA 1BYEA 2OA7A 4ULXA 1VF4A 1WOUA 2HRAA 4PTSA 4ZL7A 4XIHA 1MDJA 4Q5NA 1NW2A 2CAQA 2OE3A 3D22A 1X9WB 4Q5RA 2A2RA 2YWOA 1OKTA 1X9MB 2V1MA 4FIWA 1Z9HA 1K0DA 2GT5A 3S9FA 4NHWA 2WDUA 4KW6A 3C1SA 2B5XA 5ECRB 3NOFA 3EPTA 2R4VA 3TB2A 1FB6A 3GSSA 3WT1A 5CAXA 4HZ2A 4IBPA 1VRSD 1UVZA 3HA9A 2IN3A 2O89A 2AV4A 1W4VA 2B1LA 2GZPA 4QL7A 1ERTA 3RPNA 4TR3A 4USSA 5G5EA 4MK3A 1SU9A 3F4TA 2B7KA 3HJPA 5BRTA 5IMVA 4TR1B 1A23A 4WBRD 2LV3A 5ECKB 3EMPA 1GNWA 1PMTA 4AJ6A 4JZQA 2TIRA 1EEMA 1QK8A 1Q4JA 3MSZA 1BX9A 1W89A 5KN3A 2JZTA 3KP9A 5ABRA 4KH7A 1XOBA 2V6KA 2H19A 5J9BA 3MNGA 1WWJA 1BG5A 5B8BA 2HZEB 4GF0A 5GAND 4P3YB 2PUKC 4GWRA 3TKSC 3QPMA 1J08A 4ZL8A 2GLRA 4K7IA 5GSSA 3CXGA 3N9JA 3QAVA 5DBQA 3TRQA 3LEFA 6GSXA 1QFNA 3VK9A 3HY2A 1ERUA 2R0GA 5IO2A 2KLXA 2H8LA 1ABAA 4IJ3A 1AC1A 1CQHA 1FB0A 1F2EA 22GSA 1PGTA 3GUSA 3IK7A 3GX0A 1FVKA 2GZZA 1ERWA 4DSSA 1HYUA 5IM9A 5CRWA 3F9UA 2VO4A 3HYPA 2CA8A 4OFMA 1URMA 2M46A 3EC3A 1B9YC 3UAPA 2NBSA 3C7MA 4HQSA 1GULA 2H6XA 2X49A 5D9WA 3ZL5A 4EO3A 1GP1A 3U6VA 4KDXA 1SL1B 5FWGA 3US3A 2IMFA 3Q19A 2WRTA 2H0IA 3R2QA 3VFIA 4K6XA 3TDGA 4LL4B 3P8WA 3FY7A 4ZB6A 2F3MA 3RDWA 3GN3A 4XRAA 5IPGA 1THXA 2CV4A 1PQNA 4ZBDA 5CO3A 4K0GA 2X8CA 2V32A 2P0GA 3HJOA 5AN1A 3TGZA 4V1Ag 3O3TA 5HFIA 4POBA 4MJEA 5ECPB 2JADA 3UOMA 3TKPA 5IPHA 3EWLA 4PGTA 4X0XA 3SBCA 3FZ5A 3W8SA 2VLTA 4O7HA 2QC7A 5FHIA 3L0HA 2QKEA 4NAXA 7GSSA 1DUGA 2IFQA 4YQUA 1EZKA 2DBCA 5JWOB 2YV7A 3TRPA 3LYPA 5CRGA 4POLA 3HVVA 3ZREA 4K7NA 1WJKA 3IHGA 1UA5A 1XW9A 3J7Yk 3KCMA 1T4YA 3DYRA 2PMTA 3D0ZA 3VLNA 5DVBA 1MDIA 1K3OA 1Z3EA 1K0NA 2CX3A 4KNDA 4PURA 1G0TA 4OFNA 5DDLA 4N11A 3ZRDA 2H1AA 2KHPA 4PQIA 5JWQB 1B4QA 2NPBA 1S3DA 2EIOA 4O32A 1GLPA 1V98A 1DSBA 3IXRA 1Y6EA 2MYGA 4TOPA 1ML6A 2CX4A 2JSYA 2PVOC 3HKRA 3VPQA 3CYNA 2PN8A 3FR3A 2OKAA 3LJRA 2AHEA 3F3QA 3DEXA 2WB9A 3G9BA 3KTLA 5D73A 4DEJA 1BQ7A 3A5WA 1GH2A 4ZBAA 1TTZA 2N5AA 5H5QA 5KOXA 1DBYA 5D8IA 1PSQA 2B1KA 3TCOA 5DAKB 1IYHA 3MAKA 2DIYA 3ZYWA 4EKZA 1GTBA 2FGXA 5B6NA 2OE1A 1A0FA 1UC7A 1WE0A 1EGOA 4BVYA 2PBJA 1FOHA 3EYTA 1YJ6A 2VUPA 2CZ3A 2E0QA 5GSTA 1SK1A 2XHFA 1RQMA 2V6OA 2D2ZA 1T00A 2XBIA 8GSSA 4JR6A 1XWBA 2VLVA 2NTOA 2VLUA 3Q18A 1NHOA 3EMXA 4K7OA 3A2XA 18GSA 1SKWB 1TI3A 3TUEA 3KH7A 2GQMA 2HXKA 3KZQA 4X43A 2YV9A 1AQWA 2KP2A 1OC9A 1GSSA 4MNNA 4IQAA 1X5EA 5KEJA 2PU9C 1JZWA 5D9VA 1TRVA 5G1LA 5LCZA 5IOXA 1Z7RA 3ZMKA 4ECBA 1XZOA 3GNJA 4GQCA 1R26A 2G0FA 1G6YA 5A5KA 1HQOA 1PKWA 4BA7A 4ISDA 4WBJA 4IQ1A 2GQKA 5DALB 3ZITA 3HZ4A 1GLQA 2K18A 6GSVA 1VGLA 2P5QA 4F2IA 2VL2C 3E9JB 4MABA 1FW1A 2ALBA 1WMJA 2AJQB 4IVFA 4I2UA 1AXDA 1ZMAA 3FK8A 2NDOA 2VL2A 5ELGA 2HFDA 3QFBC 4FO5A 4XS6A 5H5RA 4KX4A 5GZZB 1BEDA 3EURA 4ACSA 4TRXA 3TJFA 4FH8A 4KB3A 2L57A 2O7KA 4G0IA 5BMUA 1OE7A 3FKFA 2MZCA 3IPZA 1SJIA 1A2JA 3DRNA 3L78A 4ZXGA 3UVHA 5EL8A 2I9HA 3H79A 2H75A 1S3AA 1OAZA 3DVXA 1NHYA 2LNSA 2WFCA 4L5LA 1GUKA 4CY6A 1PL1A 4WXTA 1F3BA 3D21A 5C00A 3C73A 5FT3A 3PR8A 2R6KA 3APOA 3UBKA 5ID2B 1PN9A 4POKA 5IMDA 3DIEA 3GTUA 3I43A 1XOAA 4XCSA 4WEYA 1EV4A 4ZILA 4GCIA 1ZGNA 2LS5A 3LG6A 1HNBA 3I9V2 4I8BA 3CMIA 3L9SA 2HRKA 1K0MA 2DMMA 4MH3A 2E7PA 2LJKA 5F07A 4TN8A 4WF4A 2HLSA 5EY6A 3A2WA 3FHKA 4ID0A 2RM6A 3GFKA 3ED3A 2GZYA 4TKYA 1YKAA 1XVQA 3IOSA 3BCKA 3J7Yb 1MEKA 4AJ7A 1M9AA 4GXZA 3ZTLA 4NHZA 5IQYA 4XS4A 1A8LA 4MH2A 3PINA 3VI5A 3IRAA 2VD1A 4TR4A 2R3XA 1GL8A 2AUVA 1JZRA 3LQ7A 1YKCA 4JBBA 3QCPA 4EDYA 1TI1A 3FR6A 5DCHA 2CVDA 3APSA 5IMCA 2VCTA 4KUNA 3UBLA 3ZFLA 3ZMLA 1CQGA 1JLWA 4IP6A 2EIRA 1TW9A 3I6AA 3UMAA 1M99A 1M2DA 4TW5A 1K3YA 2LRTA 2VD0A 2I81A 1SKSB 3K8NA 1YY7A 3QAWA 2VCVA 3TKRA 4LMVA 2E2GA 1Q98A 3CRUA 4X4JA 2H71A 4MJAA 2H0GA 4ZIJA 3IC8A 1U3AA 1V57A 2HSYA 1E2YA 3VI7A 1A24A 1M0UA 2H66A 16GSA 1DE2A 5CREA 2H73A 4MJCA 2H6ZA 3ERWA 1O7UA 5ECIB 2VOCA 5G1KA 5ECQB 2CZ2A 2JSZA 4IKHA 3WD6A 4KE3A 4Z2UA 1QUWA 3MYDA 1ZYPA 5EVOA 1PL2A 1U3IA 3BD2A 1FHEA 3ISOA 3ZZXA 2GSSA 4V1Ap 1JHBA 2ZUPA 4I2TA 4L0UA 1R4WA 3M9JA 1PX7A 3IAM2 2X99A 4RQXA 4G10A 2IWTA 1F6MC 1Z6MA 2IIYA 1FVJA 4GQFA 5DJMA 3IR4A 4TXOB 3DD3A 4RI6A 2EC4A 5B8AA 1QQ2A 3H93A 2YZHA 1GRXA 4O92A 2FHEA 1C72A 1XCCA 2PVQA 1T3BA 4EUYA 3IAS2 4MF7A 2OADA 4IELA 2JACA 1JFUA 1K3LA 2DMLA 4OWYA 3Q6OA 1M2AA 3HD5A 1SYRA 2FA4A 2PGTA 2ES7A 2PERA 2A4HA 2VM1A 1U6TA 5DAKA 5IOWA 2DIZA 2QSIA 1N8JA 3GV1A 4CDOA 3VURA 1R5AA 5L71A 3D4MA 5J9CA 2A2PA 3LSZA 11GSA 5JCUA 1J9BA 1HNCA 2H30A 2G2QA 5IO0A 2L59A 2YNXA 1NSWA 4QL9A 2H74A 3QR6A 2VCZA 2H76A 4K0NA 2HRNA 3F3RA 1GUMA 4ZL9A 2K8SA 3HDCA 2CVBA 3HVSA 4KAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOF A;  4WF5 A;  5B6M A;  1FO5 A;  2H1G A;  1TU8 A;  2FY6 A;  4MPG A;  1F3A A;  2PWJ A;  2IMD A;  1KEB A;  1WRY A;  3W8J A;  3EE2 A;  3KXO A;  1G7E A;  1ZOF A;  2C80 A;  2WJU A;  3WGD A;  1TRU A;  2YAN A;  2MMZ A;  3F6D A;  3CTF A;  2FWF A;  1GTU A;  1BJX A;  2XPD A;  2LQO A;  1G6W A;  3FZ4 A;  4ZB8 A;  4V2L A;  1EV9 A;  1EOG A;  2LJA A;  2ON7 A;  5DCG A;  4FYU A;  2LRN A;  1TK5 B;  1MD4 A;  2GGT A;  1GSQ A;  5G5F A;  2HRF A;  2DJJ A;  4KSO A;  4Q5Q A;  4NPB A;  3LYK A;  1OKD A;  1SJZ A;  2DSA A;  6GSW A;  3M3M A;  3M9K A;  4O5R A;  2LRC A;  4WR5 A;  2H72 A;  2C4J A;  1XFL A;  2CAI A;  2DJK A;  3TJG A;  4BL7 A;  2JL4 A;  4LLR A;  4WR4 A;  4YQV A;  3UVT A;  1KTE A;  3E3E A;  1B9X C;  1FOV A;  1PD2 1;  1YF0 A;  1H75 A;  2RUE A;  4XHM A;  4MA9 A;  1ERV A;  2QGV A;  1AQV A;  4DVC A;  3KM6 A;  3IHQ A;  1SEN A;  3GH6 A;  3M8N A;  4PQ1 A;  3WYW A;  2HT9 A;  4N0Z A;  3GRX A;  1LBK A;  2KOK A;  3CSI A;  2DJ1 A;  5AGY A;  1XXU A;  1AUC A;  4HUA A;  3ZLP A;  1SD9 A;  4D73 A;  4J57 E;  3GHA A;  1OE8 A;  1VF2 A;  2MBT A;  3RHC A;  4HDE A;  3C1R A;  1ZL9 A;  5G31 A;  2YZU A;  4KDY A;  1T4Z A;  2ON5 A;  4NMU A;  4E8E A;  1TKD B;  5HQP A;  3KP8 A;  3FW2 A;  1AW9 A;  2ZCT A;  5DQS A;  4ECC A;  1GWC A;  3KD0 A;  1A2L A;  2LEG A;  3EU3 A;  2N5F A;  1GTI A;  4RUV A;  1ILO A;  1AIU A;  5LNK e;  2K8V A;  4GRF A;  4BVX A;  3HZ8 A;  4MLY A;  4E8H A;  2K9F A;  1PRX A;  1BAY A;  4MZB A;  1USB A;  2OE0 A;  3FR9 A;  4WKW A;  3L9U A;  1H4O A;  5ECS A;  3W6G A;  1EP8 A;  4PX1 A;  2IFQ B;  4HJ2 A;  4KCA A;  2LTK A;  6GSU A;  3F8U A;  1PKZ A;  2HNL A;  3IDV A;  1B8X A;  2VL3 A;  3FYG A;  4OCE A;  2O8V B;  1V9W A;  2FCH A;  3GH9 A;  4JRR A;  2BJX A;  2YCD A;  3ZVJ A;  1DE1 A;  2OBI A;  3LGC A;  4OCF A;  1YQ1 A;  14GS A;  3MWH A;  1XW6 A;  3PGT A;  4L0W A;  4WET A;  4PUA A;  1LJR A;  2ZNM A;  3U5R E;  2DJ2 A;  4XTS A;  3D4T A;  2L6C A;  4HEA 2;  3RPP A;  2O85 A;  5F06 A;  3QMX A;  3ZVJ D;  2FWE A;  4TR1 A;  4F0C A;  3P2A A;  4NXI A;  2DC5 A;  2IMI A;  3M1G A;  3GKX A;  4GLT A;  3D5J A;  1QMV A;  4BPY A;  4GTU A;  3GL3 A;  5CRH A;  4HZ4 A;  4V2N A;  1XWA A;  1XWC A;  4ECI A;  5HFK A;  2HZE A;  1Y25 A;  4AGS A;  3F4S A;  4Q5F A;  1SD8 A;  3QD9 A;  4DSQ A;  2DJ3 A;  4RI7 A;  3ERF A;  1EEJ A;  1VF3 A;  2C0D A;  2J23 A;  1XBS A;  4YAP A;  2RII A;  2H1B A;  4FYC A;  4TVE A;  3HJM A;  2Z9S A;  3DGQ A;  4YH2 A;  6GST A;  1ZYQ B;  3A2V A;  2DLX A;  1FG4 A;  3VPT A;  2YJ7 A;  2YWM A;  3WT2 A;  4JED A;  2GQL A;  5J3R A;  4G2E A;  5ECO B;  2H1D A;  3H1N A;  5C04 A;  2F8A A;  1YF1 A;  1JZO A;  2I4A A;  2IPA A;  2LNT A;  2C1Y A;  3F4R A;  1GNE A;  1TK0 B;  1XW5 A;  1J0F A;  3BCI A;  3ZFB A;  2RLI A;  4CHS A;  2XC2 A;  2L4Q A;  2LJR A;  3ERG A;  2WCI A;  1TRS A;  2WS2 A;  3IK9 A;  4H86 A;  1O81 A;  4NV5 A;  2A2S A;  4KSM A;  3PH9 A;  2FWH A;  1T8E B;  5JWR B;  1OC9 B;  4IS0 A;  2OBK A;  4K9Z A;  4LMW A;  4TXV A;  1Z7P A;  2TRC P;  2K6V A;  5F8B A;  5G30 A;  2B7J A;  3O6T A;  2F8F A;  3CSJ A;  5CRD A;  4F82 A;  3GUR A;  3IV4 A;  3FZ9 A;  2VIM A;  4GSS A;  3HCZ A;  3KH9 A;  3KGK A;  4PNF A;  4JR4 A;  4JE1 A;  10GS A;  5ECN B;  3I69 A;  4ZB9 A;  1AAZ A;  4KGI A;  3DWV A;  4V2M A;  2MMA A;  1TDI A;  5HR2 A;  2PPT A;  4EL1 A;  2XBQ A;  3GKK A;  2C3T A;  4POM A;  2B3S A;  3M0F A;  4OO4 A;  2C3Q A;  2YPM A;  2GST A;  3QOU A;  4MF5 A;  4NWY A;  3KMN A;  4MP4 A;  4F0B A;  2HE3 A;  4OD7 A;  4K8M A;  2TRX A;  1M9B A;  4J56 E;  5DQY A;  3G7J A;  4LA1 A;  4LL1 B;  2FLS A;  1ST9 A;  1V2A A;  3GMF A;  2HI7 A;  5F0G A;  2FNO A;  2VL9 A;  1TP9 A;  1V58 A;  4BWS A;  4KA0 A;  4G9H A;  5H5S A;  1RW1 A;  3VWU A;  2C0E A;  2KUC A;  3DXB A;  1XWK A;  3SWL A;  4ZBB A;  2BMX A;  2WUL A;  3ME8 A;  9GSS A;  4IHU A;  5ECH B;  2REM A;  4I97 A;  3TJK A;  1Z6N A;  1QXH A;  5JCG A;  1K0O A;  3A3T A;  4KDU A;  2KP1 A;  1A8Y A;  1WP0 A;  2YP6 A;  3CRT A;  1SJ6 A;  4PQH A;  17GS A;  3GL5 A;  2OAC A;  1GUH A;  3TKS A;  3GTU B;  3FEU A;  1V40 A;  3TKS E;  5JCW A;  5INY A;  4FYB A;  1OVN A;  3GA4 A;  2MMO A;  5J5N A;  4L8E A;  2WZ9 A;  5ECM B;  3RHB A;  3GYK A;  4EC0 A;  4EXJ A;  5KN2 A;  5AIX A;  1JLV A;  2GTU A;  4J2F A;  1KNG A;  3D6I A;  1T1V A;  5ENU A;  4I6X A;  5AIS A;  4K1F A;  4IJI A;  2CQ9 A;  3DVW A;  1XWG A;  3ZIV A;  3RAZ A;  1B48 A;  2JZR A;  4XS4 B;  5A4W A;  3QDN A;  1SL2 B;  2GVP A;  1PX6 A;  3G7I A;  1GSD A;  6GSY A;  1M2B A;  3TKQ A;  4RQR A;  1KBN A;  5ELA A;  2CVK A;  3GIX A;  3BOA A;  5EPF A;  1VF1 A;  1I5G A;  2F51 A;  4MZW A;  4HJM A;  5IMZ A;  3BBY A;  3LXZ A;  3TRX A;  4EF0 A;  1OC3 A;  1TU7 A;  5LD0 A;  3F6F A;  5E4W A;  2R2J A;  2HZF A;  4HS1 A;  2MBS A;  2FUG 2;  1X9S B;  1TXX A;  5GAP D;  3UL3 A;  3F0I A;  3LFL A;  1SYX A;  20GS A;  4JU5 A;  2V41 A;  3IE3 A;  3H4K A;  1QGV A;  4MPF A;  2C0G A;  3MDK A;  3NZN A;  2I3Y A;  1T7P B;  1TRW A;  1G7O A;  4GST A;  2IL3 A;  4AJ8 A;  1MDK A;  3BJ5 A;  3JCM L;  3VWV A;  1AQX A;  2VM2 A;  4XS1 A;  1ACV A;  2M72 A;  2AB6 A;  3V1W A;  1GSU A;  1PA3 A;  3L4N A;  3C71 A;  2H70 A;  3TOU A;  4MJB A;  4IP1 A;  5KN0 A;  4X1U A;  5DAL A;  4PUF C;  3HVX A;  2L5O A;  5CP1 A;  3WGE A;  5IIZ A;  4L5O A;  2C0F A;  3HHV A;  3UIW A;  2N5B A;  1K0B A;  4F9Z A;  2H0H A;  2JU5 A;  2L4C A;  2GSQ A;  4ML1 A;  3VWX A;  1TJD A;  1N2A A;  3GST A;  3UEM A;  2FA8 A;  3Q74 A;  5F05 A;  4G19 A;  2WGR A;  1TK8 B;  5A4V A;  3GKN A;  5DJL A;  3F63 A;  3KMO A;  5IMF A;  3EIN A;  2J9H A;  4IGJ A;  2AYT A;  4NV2 A;  4HQZ A;  4YQM A;  1YDK A;  19GS A;  1ZZY A;  4DSS B;  1GSE A;  2HYX A;  1HNA A;  1EP7 A;  2L6D A;  12GS A;  3IBH A;  4IN0 A;  2RM5 A;  1OYJ A;  3H8Q A;  4F03 A;  5HR0 A;  1NM3 A;  2MMN A;  1M7T A;  3IC4 A;  5ID2 A;  3LOR A;  2B5E A;  3HXS A;  1ZYE A;  4XRD A;  1R7H A;  1YZX A;  3KJY A;  1K0C A;  2DJ0 A;  5AIV A;  4AF2 A;  3TJJ A;  1X5C A;  1O8W A;  2GT6 A;  1LU4 A;  1XVW A;  2LQQ A;  2X64 A;  6GSS A;  4MZC A;  1EWX A;  1X0R A;  1HD2 A;  3RBT A;  1SKR B;  2YWN A;  4OMV A;  1GSY A;  2P31 A;  1O6J A;  4ILF A;  1ON4 A;  1SK2 A;  3ME7 A;  1O85 A;  2B5Y A;  1I9D A;  2O87 A;  3EVI A;  1RK4 A;  4I5Q A;  4EVM A;  3UJ1 A;  2A4V A;  5D96 A;  4DSR A;  4QQ7 A;  3C8E A;  4HU7 A;  1EOH A;  3NIV A;  5A4U A;  2XPE A;  4PXO A;  1SK0 A;  1A0R P;  3QFA C;  1XIY A;  5D9T A;  1EGR A;  1S3C A;  4N10 A;  1ZCP A;  1UN2 A;  2V2G A;  3O76 A;  3L9V A;  5HR1 A;  3P7X A;  1GSF A;  3EU4 A;  5CYY A;  4CW9 A;  5D93 A;  4ECJ A;  3TJB A;  2C3N A;  1K0A A;  1MTC A;  4EDZ A;  5D9X A;  5J4U A;  2X8H A;  2IME A;  3LXT A;  1THO A;  1X5D A;  5ECL B;  2GS3 A;  2VAF A;  1B4P A;  4BWQ A;  2HSH A;  2YN1 A;  2VCX A;  2RUF A;  2P5R A;  2FD3 A;  4YAV A;  4OFT A;  3VWW A;  4TR0 A;  1OC8 A;  5HFG A;  5KN1 A;  2GDR A;  4MDC A;  2VCW A;  1SL0 B;  2M80 A;  1F37 A;  2B6M A;  3G7Y A;  13GS A;  3ZIJ A;  3E0U A;  4HU9 A;  1GTA A;  5B7C A;  5IMA A;  3UAR A;  2LUS A;  4ML6 A;  3AY8 A;  4N30 A;  4MF6 A;  2YOI A;  3P90 A;  3QAG A;  3N5O A;  5G2Z A;  1F9M A;  4EE0 A;  2F9S A;  2E2M A;  3IA1 A;  2X8G A;  2LST A;  3WGX A;  1O73 A;  3KEB A;  3GKM A;  4MCU A;  2NVL A;  2IJY A;  2VCQ A;  4D73 B;  1WPI A;  2LKU A;  2YJH A;  5J41 A;  1E6B A;  5CNW A;  4TXO A;  3CBU A;  1R5P A;  5COH A;  2EIQ A;  4MMM A;  3KIJ A;  2R5G A;  4OO5 A;  4HOJ A;  3TOT A;  2JZS A;  2CT6 A;  2H01 A;  3FZA A;  4Z7X A;  1U88 A;  4K2D A;  1FAA A;  1XPV A;  4N0V A;  2I1U A;  4GSN A;  2IMK A;  1A2M A;  1IYI A;  4KCE A;  1YEP A;  3CTG A;  1O8X A;  3DKS A;  2L5L A;  4HI7 A;  3CSH A;  2H6Y A;  1MD3 A;  4IW9 A;  2GSR A;  1WIK A;  2FWG A;  2R37 A;  2YWI A;  1YEX A;  3DML A;  5HR3 A;  1U87 A;  3FRC A;  3OR5 A;  3KTB A;  2OJL A;  2BTO T;  3APQ A;  4PNG A;  1JZD A;  5E59 A;  2C8U A;  3GX8 A;  3LWA A;  1Z5Y E;  2AAW A;  1BYE A;  2OA7 A;  4ULX A;  1VF4 A;  1WOU A;  4ZL7 A;  4XIH A;  1MDJ A;  4Q5N A;  1NW2 A;  2CAQ A;  2OE3 A;  3D22 A;  1X9W B;  4Q5R A;  2A2R A;  2YWO A;  1OKT A;  1X9M B;  2V1M A;  4FIW A;  1Z9H A;  1K0D A;  2GT5 A;  3S9F A;  4NHW A;  2WDU A;  4KW6 A;  3C1S A;  2B5X A;  5ECR B;  3NOF A;  2R4V A;  3TB2 A;  1FB6 A;  3GSS A;  3WT1 A;  5CAX A;  4HZ2 A;  4IBP A;  1VRS D;  1UVZ A;  3HA9 A;  2IN3 A;  2O89 A;  2AV4 A;  1W4V A;  2B1L A;  2GZP A;  4QL7 A;  1ERT A;  3RPN A;  4TR3 A;  5G5E A;  4MK3 A;  1SU9 A;  3F4T A;  2B7K A;  3HJP A;  5IMV A;  4TR1 B;  1A23 A;  4WBR D;  2LV3 A;  5ECK B;  3EMP A;  1GNW A;  1PMT A;  4AJ6 A;  4JZQ A;  2TIR A;  1EEM A;  1QK8 A;  1Q4J A;  3MSZ A;  1BX9 A;  1W89 A;  5KN3 A;  2JZT A;  3KP9 A;  5ABR A;  4KH7 A;  1XOB A;  2V6K A;  2H19 A;  5J9B A;  3MNG A;  1WWJ A;  1BG5 A;  5B8B A;  2HZE B;  4GF0 A;  5GAN D;  4P3Y B;  2PUK C;  4GWR A;  3TKS C;  3QPM A;  1J08 A;  4ZL8 A;  2GLR A;  4K7I A;  5GSS A;  3CXG A;  3N9J A;  3QAV A;  5DBQ A;  3TRQ A;  3LEF A;  6GSX A;  1QFN A;  3VK9 A;  3HY2 A;  1ERU A;  5IO2 A;  2KLX A;  2H8L A;  1ABA A;  4IJ3 A;  1AC1 A;  1CQH A;  1FB0 A;  1F2E A;  22GS A;  1PGT A;  3GUS A;  3IK7 A;  3GX0 A;  1FVK A;  2GZZ A;  1ERW A;  4DSS A;  1HYU A;  5IM9 A;  5CRW A;  3F9U A;  2VO4 A;  3HYP A;  2CA8 A;  4OFM A;  1URM A;  2M46 A;  3EC3 A;  1B9Y C;  3UAP A;  2NBS A;  3C7M A;  4HQS A;  1GUL A;  2H6X A;  5D9W A;  3ZL5 A;  4EO3 A;  1GP1 A;  3U6V A;  4KDX A;  1SL1 B;  5FWG A;  3US3 A;  2IMF A;  3Q19 A;  2WRT A;  2H0I A;  3R2Q A;  3VFI A;  4K6X A;  3TDG A;  4LL4 B;  3P8W A;  3FY7 A;  4ZB6 A;  2F3M A;  3RDW A;  3GN3 A;  4XRA A;  5IPG A;  1THX A;  2CV4 A;  1PQN A;  4ZBD A;  5CO3 A;  4K0G A;  2X8C A;  2V32 A;  2P0G A;  5AN1 A;  3HJO A;  3TGZ A;  4V1A g;  3O3T A;  5HFI A;  4POB A;  4MJE A;  5ECP B;  2JAD A;  3UOM A;  3TKP A;  5IPH A;  3EWL A;  4PGT A;  4X0X A;  3SBC A;  3FZ5 A;  3W8S A;  2VLT A;  4O7H A;  2QC7 A;  5FHI A;  3L0H A;  2QKE A;  4NAX A;  7GSS A;  1DUG A;  2IFQ A;  4YQU A;  1EZK A;  2DBC A;  5JWO B;  2YV7 A;  3TRP A;  3LYP A;  5CRG A;  4POL A;  3HVV A;  3ZRE A;  4K7N A;  1WJK A;  1UA5 A;  1XW9 A;  3J7Y k;  3KCM A;  1T4Y A;  3DYR A;  2PMT A;  3D0Z A;  3VLN A;  5DVB A;  1MDI A;  1K3O A;  1Z3E A;  1K0N A;  2CX3 A;  4KND A;  4PUR A;  1G0T A;  4OFN A;  5DDL A;  4N11 A;  3ZRD A;  2H1A A;  2KHP A;  4PQI A;  5JWQ B;  1B4Q A;  2NPB A;  1S3D A;  2EIO A;  1GLP A;  1V98 A;  3IXR A;  1DSB A;  4O32 A;  1Y6E A;  2MYG A;  4TOP A;  1ML6 A;  2CX4 A;  2JSY A;  2PVO C;  3HKR A;  3VPQ A;  3CYN A;  2PN8 A;  3FR3 A;  2OKA A;  3LJR A;  2AHE A;  3F3Q A;  3DEX A;  2WB9 A;  3G9B A;  3KTL A;  5D73 A;  4DEJ A;  1BQ7 A;  3A5W A;  1GH2 A;  4ZBA A;  1TTZ A;  2N5A A;  5H5Q A;  1DBY A;  5D8I A;  1PSQ A;  2B1K A;  3TCO A;  5DAK B;  1IYH A;  3MAK A;  2DIY A;  3ZYW A;  4EKZ A;  1GTB A;  2FGX A;  5B6N A;  2OE1 A;  1A0F A;  1UC7 A;  1WE0 A;  1EGO A;  4BVY A;  2PBJ A;  3EYT A;  1YJ6 A;  2VUP A;  2CZ3 A;  2E0Q A;  5GST A;  1SK1 A;  2XHF A;  1RQM A;  2V6O A;  2D2Z A;  1T00 A;  2XBI A;  8GSS A;  4JR6 A;  1XWB A;  2VLV A;  2NTO A;  2VLU A;  3Q18 A;  1NHO A;  3EMX A;  4K7O A;  3A2X A;  18GS A;  1SKW B;  1TI3 A;  3TUE A;  3KH7 A;  2GQM A;  2HXK A;  3KZQ A;  4X43 A;  2YV9 A;  1AQW A;  2KP2 A;  1OC9 A;  1GSS A;  4IQA A;  1X5E A;  5KEJ A;  2PU9 C;  1JZW A;  5D9V A;  1TRV A;  5G1L A;  5LCZ A;  5IOX A;  1Z7R A;  3ZMK A;  4ECB A;  1XZO A;  3GNJ A;  4GQC A;  1R26 A;  2G0F A;  1G6Y A;  5A5K A;  1HQO A;  1PKW A;  4BA7 A;  4ISD A;  4WBJ A;  4IQ1 A;  2GQK A;  5DAL B;  3ZIT A;  3HZ4 A;  1GLQ A;  2K18 A;  6GSV A;  1VGL A;  2P5Q A;  4F2I A;  2VL2 C;  3E9J B;  4MAB A;  1FW1 A;  2ALB A;  1WMJ A;  2AJQ B;  4IVF A;  4I2U A;  1AXD A;  1ZMA A;  3FK8 A;  2NDO A;  2VL2 A;  5ELG A;  2HFD A;  3QFB C;  4FO5 A;  4XS6 A;  5H5R A;  4KX4 A;  5GZZ B;  1BED A;  3EUR A;  4ACS A;  4TRX A;  3TJF A;  4FH8 A;  4KB3 A;  2L57 A;  2O7K A;  1OE7 A;  3FKF A;  2MZC A;  3IPZ A;  1SJI A;  1A2J A;  3DRN A;  3L78 A;  4ZXG A;  3UVH A;  5EL8 A;  2I9H A;  3H79 A;  2H75 A;  1S3A A;  1OAZ A;  3DVX A;  1NHY A;  2LNS A;  2WFC A;  4L5L A;  1GUK A;  1PL1 A;  4WXT A;  1F3B A;  3D21 A;  5C00 A;  3C73 A;  5FT3 A;  3PR8 A;  2R6K A;  3APO A;  3UBK A;  5ID2 B;  1PN9 A;  4POK A;  5IMD A;  3DIE A;  3GTU A;  3I43 A;  1XOA A;  4XCS A;  4WEY A;  1EV4 A;  4ZIL A;  4GCI A;  1ZGN A;  2LS5 A;  3LG6 A;  1HNB A;  3I9V 2;  4I8B A;  3CMI A;  3L9S A;  1K0M A;  2DMM A;  4MH3 A;  2E7P A;  2LJK A;  5F07 A;  4TN8 A;  4WF4 A;  2HLS A;  5EY6 A;  3A2W A;  3FHK A;  4ID0 A;  2RM6 A;  3GFK A;  3ED3 A;  2GZY A;  4TKY A;  1YKA A;  1XVQ A;  3IOS A;  3BCK A;  3J7Y b;  1MEK A;  4AJ7 A;  1M9A A;  4GXZ A;  3ZTL A;  4NHZ A;  5IQY A;  4XS4 A;  1A8L A;  4MH2 A;  3PIN A;  3VI5 A;  3IRA A;  2VD1 A;  4TR4 A;  2R3X A;  1GL8 A;  2AUV A;  1JZR A;  3LQ7 A;  1YKC A;  4JBB A;  3QCP A;  4EDY A;  1TI1 A;  3FR6 A;  5DCH A;  2CVD A;  3APS A;  5IMC A;  2VCT A;  4KUN A;  3UBL A;  3ZFL A;  3ZML A;  1CQG A;  1JLW A;  4IP6 A;  2EIR A;  1TW9 A;  3I6A A;  3UMA A;  1M99 A;  1M2D A;  4TW5 A;  1K3Y A;  2LRT A;  2VD0 A;  2I81 A;  1SKS B;  3K8N A;  1YY7 A;  3QAW A;  2VCV A;  3TKR A;  4LMV A;  2E2G A;  1Q98 A;  3CRU A;  2H71 A;  4MJA A;  2H0G A;  4ZIJ A;  1U3A A;  1V57 A;  2HSY A;  1E2Y A;  3VI7 A;  1A24 A;  1M0U A;  2H66 A;  16GS A;  1DE2 A;  5CRE A;  2H73 A;  4MJC A;  2H6Z A;  3ERW A;  1O7U A;  5ECI B;  2VOC A;  5G1K A;  5ECQ B;  2CZ2 A;  2JSZ A;  4IKH A;  3WD6 A;  4KE3 A;  1QUW A;  5EVO A;  1PL2 A;  1U3I A;  3BD2 A;  1FHE A;  3ISO A;  3ZZX A;  2GSS A;  4V1A p;  1JHB A;  2ZUP A;  4I2T A;  4L0U A;  1R4W A;  3M9J A;  1PX7 A;  3IAM 2;  2X99 A;  4RQX A;  4G10 A;  2IWT A;  1F6M C;  1Z6M A;  2IIY A;  1FVJ A;  4GQF A;  5DJM A;  3IR4 A;  4TXO B;  3DD3 A;  4RI6 A;  2EC4 A;  5B8A A;  1QQ2 A;  3H93 A;  2YZH A;  1GRX A;  4O92 A;  2FHE A;  1C72 A;  1XCC A;  2PVQ A;  1T3B A;  4EUY A;  3IAS 2;  4MF7 A;  2OAD A;  4IEL A;  2JAC A;  1JFU A;  1K3L A;  2DML A;  4OWY A;  3Q6O A;  1M2A A;  3HD5 A;  1SYR A;  2FA4 A;  2PGT A;  2ES7 A;  2PER A;  2VM1 A;  1U6T A;  5DAK A;  5IOW A;  2DIZ A;  2QSI A;  1N8J A;  3GV1 A;  4CDO A;  3VUR A;  1R5A A;  5L71 A;  3D4M A;  5J9C A;  3LSZ A;  11GS A;  5JCU A;  1J9B A;  1HNC A;  2H30 A;  2G2Q A;  5IO0 A;  2L59 A;  2YNX A;  1NSW A;  4QL9 A;  2H74 A;  3QR6 A;  2VCZ A;  2H76 A;  4K0N A;  2HRN A;  3F3R A;  1GUM A;  4ZL9 A;  2K8S A;  3HDC A;  2CVB A;  3HVS A;  4KAE A; 
#chains in the Genus database with same CATH topology
 1TOF A;  4WF5 A;  5B6M A;  4HSC X;  1FO5 A;  2H1G A;  1TU8 A;  2FY6 A;  4MPG A;  1F3A A;  2PWJ A;  2IMD A;  1KEB A;  1WRY A;  3W8J A;  3EE2 A;  3KXO A;  1G7E A;  1ZOF A;  2C80 A;  2WJU A;  3WGD A;  1TRU A;  2YAN A;  2MMZ A;  3F6D A;  3CTF A;  2FWF A;  1GTU A;  1BJX A;  2XPD A;  2LQO A;  1G6W A;  3FZ4 A;  3LW9 A;  4ZB8 A;  4V2L A;  3HVN A;  1EV9 A;  1EOG A;  2LJA A;  2ON7 A;  5DCG A;  4FYU A;  2LRN A;  1TK5 B;  1MD4 A;  2GGT A;  1GSQ A;  5G5F A;  2HRF A;  2DJJ A;  4KSO A;  4Q5Q A;  4NPB A;  3LYK A;  1OKD A;  1SJZ A;  2DSA A;  6GSW A;  3M3M A;  3M9K A;  4O5R A;  2LRC A;  4WR5 A;  2H72 A;  2C4J A;  1XFL A;  2CAI A;  2DJK A;  3TJG A;  4BL7 A;  2JL4 A;  4LLR A;  4WR4 A;  3FMW A;  4YQV A;  3UVT A;  1KTE A;  3E3E A;  1B9X C;  1FOV A;  1PD2 1;  1YF0 A;  1H75 A;  2RUE A;  4XHM A;  4MA9 A;  1ERV A;  2QGV A;  1AQV A;  4DVC A;  3KM6 A;  4O5U A;  3IHQ A;  1SEN A;  3GH6 A;  3M8N A;  4PQ1 A;  3WYW A;  2HT9 A;  4N0Z A;  3GRX A;  1LBK A;  2KOK A;  3CSI A;  2DJ1 A;  5AGY A;  1XXU A;  1AUC A;  4HUA A;  4Z2T A;  3ZLP A;  1SD9 A;  4D73 A;  4J57 E;  3GHA A;  1OE8 A;  1VF2 A;  2MBT A;  3RHC A;  4HDE A;  3C1R A;  1ZL9 A;  5G31 A;  2YZU A;  4KDY A;  1T4Z A;  2ON5 A;  4NMU A;  4E8E A;  1TKD B;  5HQP A;  3KP8 A;  3FW2 A;  1AW9 A;  2ZCT A;  5DQS A;  4ECC A;  2R0P A;  1GWC A;  3KD0 A;  1A2L A;  2LEG A;  3EU3 A;  2N5F A;  1GTI A;  4RUV A;  1ILO A;  1AIU A;  5LNK e;  2K8V A;  4GRF A;  4BVX A;  3HZ8 A;  4MLY A;  4E8H A;  2K9F A;  1PRX A;  1BAY A;  4MZB A;  1USB A;  2OE0 A;  3FR9 A;  4G0L A;  4WKW A;  3L9U A;  3PPU A;  1H4O A;  5ECS A;  3W6G A;  1EP8 A;  4PX1 A;  2IFQ B;  4HJ2 A;  4KCA A;  2LTK A;  6GSU A;  3A5I A;  3F8U A;  1PKZ A;  2HNL A;  3IDV A;  1B8X A;  2VL3 A;  3FYG A;  4OCE A;  2O8V B;  1V9W A;  2FCH A;  4KF9 A;  3GH9 A;  4JRR A;  2BJX A;  2UZ8 A;  2YCD A;  3ZVJ A;  1DE1 A;  2OBI A;  3LGC A;  4OCF A;  1YQ1 A;  14GS A;  3MWH A;  1XW6 A;  3PGT A;  4L0W A;  4WET A;  4PUA A;  1LJR A;  3MIX A;  2ZNM A;  3U5R E;  2DJ2 A;  4XTS A;  3D4T A;  2L6C A;  4HEA 2;  4K2X A;  3RPP A;  2O85 A;  5F06 A;  3QMX A;  3ZVJ D;  2FWE A;  4TR1 A;  4F0C A;  3P2A A;  4NXI A;  2DC5 A;  2IMI A;  3M1G A;  3GKX A;  4GLT A;  3D5J A;  1QMV A;  4BPY A;  4GTU A;  3GL3 A;  5CRH A;  4HZ4 A;  4V2N A;  1XWA A;  1XWC A;  4ECI A;  5HFK A;  2HZE A;  1Y25 A;  4AGS A;  3F4S A;  4Q5F A;  1SD8 A;  3QD9 A;  4DSQ A;  2DJ3 A;  4RI7 A;  3ERF A;  1EEJ A;  1VF3 A;  2C0D A;  2J23 A;  1XBS A;  4YAP A;  2RII A;  2H1B A;  4FYC A;  4TVE A;  3HJM A;  2Z9S A;  3DGQ A;  4YH2 A;  6GST A;  1ZYQ B;  3A2V A;  2DLX A;  1FG4 A;  3VPT A;  2YJ7 A;  2YWM A;  3WT2 A;  4JED A;  2GQL A;  5J3R A;  4G2E A;  5ECO B;  4BVY B;  4YKG A;  2H1D A;  3H1N A;  5C04 A;  2F8A A;  1YF1 A;  1JZO A;  2I4A A;  2IPA A;  2LNT A;  2C1Y A;  3F4R A;  1GNE A;  1TK0 B;  1XW5 A;  1J0F A;  3BCI A;  3ZFB A;  2RLI A;  4CHS A;  2XC2 A;  2L4Q A;  2LJR A;  3ERG A;  1PFO A;  2WCI A;  1TRS A;  2WS2 A;  3IK9 A;  4H86 A;  1O81 A;  4NV5 A;  2A2S A;  4KSM A;  3PH9 A;  2FWH A;  1T8E B;  5JWR B;  1OC9 B;  4IS0 A;  2OBK A;  4K9Z A;  4LMW A;  4TXV A;  1Z7P A;  2TRC P;  2K6V A;  5F8B A;  2R0C A;  5G30 A;  2B7J A;  3O6T A;  2F8F A;  3CSJ A;  5CRD A;  4F82 A;  3GUR A;  3IV4 A;  3FZ9 A;  2VIM A;  4GSS A;  3HCZ A;  3KH9 A;  3KGK A;  4PNF A;  4JR4 A;  4JE1 A;  10GS A;  5ECN B;  3I69 A;  4ZB9 A;  1AAZ A;  4KGI A;  3DWV A;  4V2M A;  2MMA A;  1TDI A;  5HR2 A;  2PPT A;  4EL1 A;  2XBQ A;  3GKK A;  2C3T A;  4POM A;  2B3S A;  3M0F A;  4OO4 A;  2C3Q A;  2YPM A;  2DKH A;  2GST A;  3QOU A;  4MF5 A;  4NWY A;  3KMN A;  4MP4 A;  4F0B A;  2HE3 A;  4OD7 A;  4K8M A;  2TRX A;  1M9B A;  4J56 E;  5DQY A;  3G7J A;  4LA1 A;  4LL1 B;  2FLS A;  1ST9 A;  1V2A A;  3GMF A;  2HI7 A;  5F0G A;  2FNO A;  1PN0 A;  2VL9 A;  1TP9 A;  1V58 A;  4BWS A;  4KA0 A;  4G9H A;  5H5S A;  1RW1 A;  3VWU A;  2C0E A;  2KUC A;  3DXB A;  1XWK A;  4FQU A;  3SWL A;  4ZBB A;  2BMX A;  2WUL A;  3ME8 A;  9GSS A;  4IHU A;  5ECH B;  2REM A;  4I97 A;  3TJK A;  1Z6N A;  1QXH A;  5JCG A;  1K0O A;  3A3T A;  4KDU A;  2KP1 A;  4O5Q A;  1A8Y A;  1WP0 A;  2YP6 A;  3CRT A;  1SJ6 A;  4PQH A;  17GS A;  3GL5 A;  2OAC A;  1GUH A;  3TKS A;  3GTU B;  3FEU A;  2DKI A;  1V40 A;  3TKS E;  5JCW A;  5INY A;  4FYB A;  1OVN A;  3GA4 A;  2MMO A;  5J5N A;  4L8E A;  2WZ9 A;  5ECM B;  3RHB A;  3GYK A;  4EC0 A;  4EXJ A;  5KN2 A;  5AIX A;  1JLV A;  2GTU A;  4J2F A;  1KNG A;  3D6I A;  4YKF A;  1T1V A;  5ENU A;  4I6X A;  5AIS A;  4K1F A;  4IJI A;  2CQ9 A;  3DVW A;  4ICY A;  1XWG A;  3ZIV A;  3RAZ A;  1B48 A;  2JZR A;  4XS4 B;  5A4W A;  3QDN A;  1SL2 B;  2GVP A;  1PX6 A;  2HSM A;  3G7I A;  1GSD A;  6GSY A;  1M2B A;  3TKQ A;  4RQR A;  1KBN A;  5ELA A;  2CVK A;  3GIX A;  3BOA A;  5EPF A;  1VF1 A;  1I5G A;  2F51 A;  4MZW A;  4HJM A;  5IMZ A;  3BBY A;  3LXZ A;  3TRX A;  4EF0 A;  1OC3 A;  1TU7 A;  5LD0 A;  2QA2 A;  3F6F A;  5E4W A;  2R2J A;  2HZF A;  4HS1 A;  2MBS A;  2X4A A;  2FUG 2;  1X9S B;  1TXX A;  5GAP D;  3UL3 A;  3F0I A;  3LFL A;  1SYX A;  20GS A;  4JU5 A;  2V41 A;  3IE3 A;  3H4K A;  1QGV A;  4MPF A;  2C0G A;  4CY8 A;  3MDK A;  3NZN A;  2I3Y A;  1T7P B;  1TRW A;  1G7O A;  4GST A;  2IL3 A;  4AJ8 A;  1MDK A;  3R3E A;  3BJ5 A;  3JCM L;  3VWV A;  1AQX A;  2VM2 A;  4XS1 A;  1ACV A;  2M72 A;  2AB6 A;  3V1W A;  1GSU A;  1PA3 A;  3L4N A;  3C71 A;  2H70 A;  3TOU A;  4MJB A;  4IP1 A;  5KN0 A;  4X1U A;  5DAL A;  4PUF C;  1M3J A;  3HVX A;  2L5O A;  5CP1 A;  3WGE A;  5IIZ A;  4L5O A;  2C0F A;  4K5S A;  5KOW A;  3HHV A;  3UIW A;  2N5B A;  1K0B A;  4F9Z A;  2H0H A;  2JU5 A;  2L4C A;  2GSQ A;  4ML1 A;  3VWX A;  1TJD A;  1N2A A;  3GST A;  3UEM A;  2FA8 A;  3Q74 A;  5F05 A;  4G19 A;  2WGR A;  1TK8 B;  5A4V A;  3GKN A;  5DJL A;  3F63 A;  4K5R A;  3KMO A;  5IMF A;  3EIN A;  2J9H A;  4IGJ A;  2AYT A;  4NV2 A;  4HQZ A;  4YQM A;  1YDK A;  19GS A;  1ZZY A;  4DSS B;  1GSE A;  2HYX A;  1HNA A;  1EP7 A;  2L6D A;  12GS A;  3IBH A;  4IN0 A;  2RM5 A;  1OYJ A;  3H8Q A;  4F03 A;  5HR0 A;  1NM3 A;  2MMN A;  1M7T A;  3IC4 A;  5ID2 A;  3LOR A;  2B5E A;  3HXS A;  1ZYE A;  4XRD A;  1R7H A;  1YZX A;  4EIQ A;  4EIP A;  3KJY A;  1K0C A;  2DJ0 A;  5AIV A;  4AF2 A;  3CQF A;  3TJJ A;  1X5C A;  1O8W A;  2GT6 A;  1LU4 A;  1XVW A;  2LQQ A;  2X64 A;  6GSS A;  4MZC A;  1EWX A;  1X0R A;  1HD2 A;  3RBT A;  1SKR B;  2YWN A;  4OMV A;  1GSY A;  2P31 A;  1O6J A;  4ILF A;  1ON4 A;  1SK2 A;  3ME7 A;  1O85 A;  2B5Y A;  1I9D A;  2O87 A;  3EVI A;  1RK4 A;  4I5Q A;  4EVM A;  3UJ1 A;  2A4V A;  5D96 A;  4DSR A;  4QQ7 A;  3C8E A;  4HU7 A;  1EOH A;  3NIV A;  5A4U A;  2XPE A;  4PXO A;  1SK0 A;  1A0R P;  3QFA C;  1XIY A;  5D9T A;  1EGR A;  1S3C A;  4N10 A;  1ZCP A;  1UN2 A;  2V2G A;  3O76 A;  3L9V A;  5HR1 A;  3P7X A;  1GSF A;  3EU4 A;  5CYY A;  4CW9 A;  5D93 A;  4ECJ A;  1M3I A;  3TJB A;  2QA1 A;  4Z2R A;  2C3N A;  1K0A A;  1MTC A;  4EDZ A;  5D9X A;  5J4U A;  2X8H A;  2IME A;  3LXT A;  1THO A;  1X5D A;  5ECL B;  2GS3 A;  2VAF A;  1B4P A;  4BWQ A;  2HSH A;  2YN1 A;  2VCX A;  2RUF A;  2P5R A;  2FD3 A;  4YAV A;  4OFT A;  3VWW A;  4TR0 A;  1OC8 A;  5HFG A;  4A5P A;  5KN1 A;  2GDR A;  4MDC A;  2VCW A;  1SL0 B;  2M80 A;  1F37 A;  2B6M A;  3G7Y A;  13GS A;  3ZIJ A;  1ZYN A;  3E0U A;  4BL7 B;  4G0K A;  4HU9 A;  1GTA A;  5B7C A;  5IMA A;  3UAR A;  2LUS A;  4ML6 A;  3AY8 A;  4N30 A;  4MF6 A;  2YOI A;  3P90 A;  3QAG A;  3N5O A;  5G2Z A;  1F9M A;  4EE0 A;  2F9S A;  2E2M A;  3IA1 A;  2X8G A;  2LST A;  3WGX A;  1O73 A;  3KEB A;  3GKM A;  4MCU A;  2NVL A;  2IJY A;  2VCQ A;  4D73 B;  1WPI A;  2LKU A;  2YJH A;  5J41 A;  1E6B A;  5CNW A;  4TXO A;  3CBU A;  1R5P A;  5COH A;  2EIQ A;  4MMM A;  3KIJ A;  2R5G A;  4OO5 A;  4HOJ A;  3TOT A;  2JZS A;  2CT6 A;  2H01 A;  3FZA A;  4Z7X A;  1U88 A;  4K2D A;  1FAA A;  1XPV A;  4N0V A;  2I1U A;  4GSN A;  2IMK A;  1A2M A;  1IYI A;  4KCE A;  1YEP A;  3CTG A;  1O8X A;  3DKS A;  2L5L A;  4HI7 A;  3CSH A;  2H6Y A;  1MD3 A;  4IW9 A;  2GSR A;  1WIK A;  2FWG A;  2R37 A;  2YWI A;  1YEX A;  3DML A;  5HR3 A;  1U87 A;  3FRC A;  4BVX B;  3OR5 A;  3KTB A;  2OJL A;  2BTO T;  3APQ A;  4PNG A;  1JZD A;  5E59 A;  2C8U A;  3GX8 A;  3LWA A;  1Z5Y E;  2AAW A;  1BYE A;  2OA7 A;  4ULX A;  1VF4 A;  1WOU A;  2HRA A;  4PTS A;  4ZL7 A;  4XIH A;  1MDJ A;  4Q5N A;  1NW2 A;  2CAQ A;  2OE3 A;  3D22 A;  1X9W B;  4Q5R A;  2A2R A;  2YWO A;  1OKT A;  1X9M B;  2V1M A;  4FIW A;  1Z9H A;  1K0D A;  2GT5 A;  3S9F A;  4NHW A;  2WDU A;  4KW6 A;  3C1S A;  2B5X A;  5ECR B;  3NOF A;  3EPT A;  2R4V A;  3TB2 A;  1FB6 A;  3GSS A;  3WT1 A;  5CAX A;  4HZ2 A;  4IBP A;  1VRS D;  1UVZ A;  3HA9 A;  2IN3 A;  2O89 A;  2AV4 A;  1W4V A;  2B1L A;  2GZP A;  4QL7 A;  1ERT A;  3RPN A;  4TR3 A;  4USS A;  5G5E A;  4MK3 A;  1SU9 A;  3F4T A;  2B7K A;  3HJP A;  5BRT A;  5IMV A;  4TR1 B;  1A23 A;  4WBR D;  2LV3 A;  5ECK B;  3EMP A;  1GNW A;  1PMT A;  4AJ6 A;  4JZQ A;  2TIR A;  1EEM A;  1QK8 A;  1Q4J A;  3MSZ A;  1BX9 A;  1W89 A;  5KN3 A;  2JZT A;  3KP9 A;  5ABR A;  4KH7 A;  1XOB A;  2V6K A;  2H19 A;  5J9B A;  3MNG A;  1WWJ A;  1BG5 A;  5B8B A;  2HZE B;  4GF0 A;  5GAN D;  4P3Y B;  2PUK C;  4GWR A;  3TKS C;  3QPM A;  1J08 A;  4ZL8 A;  2GLR A;  4K7I A;  5GSS A;  3CXG A;  3N9J A;  3QAV A;  5DBQ A;  3TRQ A;  3LEF A;  6GSX A;  1QFN A;  3VK9 A;  3HY2 A;  1ERU A;  2R0G A;  5IO2 A;  2KLX A;  2H8L A;  1ABA A;  4IJ3 A;  1AC1 A;  1CQH A;  1FB0 A;  1F2E A;  22GS A;  1PGT A;  3GUS A;  3IK7 A;  3GX0 A;  1FVK A;  2GZZ A;  1ERW A;  4DSS A;  1HYU A;  5IM9 A;  5CRW A;  3F9U A;  2VO4 A;  3HYP A;  2CA8 A;  4OFM A;  1URM A;  2M46 A;  3EC3 A;  1B9Y C;  3UAP A;  2NBS A;  3C7M A;  4HQS A;  1GUL A;  2H6X A;  2X49 A;  5D9W A;  3ZL5 A;  4EO3 A;  1GP1 A;  3U6V A;  4KDX A;  1SL1 B;  5FWG A;  3US3 A;  2IMF A;  3Q19 A;  2WRT A;  2H0I A;  3R2Q A;  3VFI A;  4K6X A;  3TDG A;  4LL4 B;  3P8W A;  3FY7 A;  4ZB6 A;  2F3M A;  3RDW A;  3GN3 A;  4XRA A;  5IPG A;  1THX A;  2CV4 A;  1PQN A;  4ZBD A;  5CO3 A;  4K0G A;  2X8C A;  2V32 A;  2P0G A;  3HJO A;  5AN1 A;  3TGZ A;  4V1A g;  3O3T A;  5HFI A;  4POB A;  4MJE A;  5ECP B;  2JAD A;  3UOM A;  3TKP A;  5IPH A;  3EWL A;  4PGT A;  4BIK A;  4X0X A;  3SBC A;  3FZ5 A;  3W8S A;  2VLT A;  4O7H A;  2QC7 A;  5FHI A;  3L0H A;  2QKE A;  4NAX A;  7GSS A;  1DUG A;  2IFQ A;  4YQU A;  1EZK A;  2DBC A;  5JWO B;  2YV7 A;  3TRP A;  3LYP A;  5CRG A;  4POL A;  3HVV A;  3ZRE A;  4K7N A;  1WJK A;  3IHG A;  1UA5 A;  1XW9 A;  3J7Y k;  3KCM A;  1T4Y A;  3DYR A;  2PMT A;  3D0Z A;  3VLN A;  5DVB A;  1MDI A;  1K3O A;  1Z3E A;  1K0N A;  2CX3 A;  4KND A;  4PUR A;  1G0T A;  4OFN A;  5DDL A;  4N11 A;  3ZRD A;  2H1A A;  2KHP A;  4PQI A;  5JWQ B;  1B4Q A;  2NPB A;  1S3D A;  2EIO A;  4O32 A;  1GLP A;  1V98 A;  1DSB A;  3IXR A;  1Y6E A;  2MYG A;  4TOP A;  1ML6 A;  2CX4 A;  2JSY A;  2PVO C;  3HKR A;  3VPQ A;  3CYN A;  2PN8 A;  3FR3 A;  2OKA A;  3LJR A;  2AHE A;  3F3Q A;  3DEX A;  2WB9 A;  3G9B A;  3KTL A;  5D73 A;  4DEJ A;  1BQ7 A;  3A5W A;  1GH2 A;  4ZBA A;  1TTZ A;  2N5A A;  5H5Q A;  5KOX A;  1DBY A;  5D8I A;  1PSQ A;  2B1K A;  3TCO A;  5DAK B;  1IYH A;  3MAK A;  2DIY A;  3ZYW A;  4EKZ A;  1GTB A;  2FGX A;  5B6N A;  2OE1 A;  1A0F A;  1UC7 A;  1WE0 A;  1EGO A;  4BVY A;  2PBJ A;  1FOH A;  3EYT A;  1YJ6 A;  2VUP A;  2CZ3 A;  2E0Q A;  5GST A;  1SK1 A;  2XHF A;  1RQM A;  2V6O A;  2D2Z A;  1T00 A;  2XBI A;  8GSS A;  4JR6 A;  1XWB A;  2VLV A;  2NTO A;  2VLU A;  3Q18 A;  1NHO A;  3EMX A;  4K7O A;  3A2X A;  18GS A;  1SKW B;  1TI3 A;  3TUE A;  3KH7 A;  2GQM A;  2HXK A;  3KZQ A;  4X43 A;  2YV9 A;  1AQW A;  2KP2 A;  1OC9 A;  1GSS A;  4MNN A;  4IQA A;  1X5E A;  5KEJ A;  2PU9 C;  1JZW A;  5D9V A;  1TRV A;  5G1L A;  5LCZ A;  5IOX A;  1Z7R A;  3ZMK A;  4ECB A;  1XZO A;  3GNJ A;  4GQC A;  1R26 A;  2G0F A;  1G6Y A;  5A5K A;  1HQO A;  1PKW A;  4BA7 A;  4ISD A;  4WBJ A;  4IQ1 A;  2GQK A;  5DAL B;  3ZIT A;  3HZ4 A;  1GLQ A;  2K18 A;  6GSV A;  1VGL A;  2P5Q A;  4F2I A;  2VL2 C;  3E9J B;  4MAB A;  1FW1 A;  2ALB A;  1WMJ A;  2AJQ B;  4IVF A;  4I2U A;  1AXD A;  1ZMA A;  3FK8 A;  2NDO A;  2VL2 A;  5ELG A;  2HFD A;  3QFB C;  4FO5 A;  4XS6 A;  5H5R A;  4KX4 A;  5GZZ B;  1BED A;  3EUR A;  4ACS A;  4TRX A;  3TJF A;  4FH8 A;  4KB3 A;  2L57 A;  2O7K A;  4G0I A;  5BMU A;  1OE7 A;  3FKF A;  2MZC A;  3IPZ A;  1SJI A;  1A2J A;  3DRN A;  3L78 A;  4ZXG A;  3UVH A;  5EL8 A;  2I9H A;  3H79 A;  2H75 A;  1S3A A;  1OAZ A;  3DVX A;  1NHY A;  2LNS A;  2WFC A;  4L5L A;  1GUK A;  4CY6 A;  1PL1 A;  4WXT A;  1F3B A;  3D21 A;  5C00 A;  3C73 A;  5FT3 A;  3PR8 A;  2R6K A;  3APO A;  3UBK A;  5ID2 B;  1PN9 A;  4POK A;  5IMD A;  3DIE A;  3GTU A;  3I43 A;  1XOA A;  4XCS A;  4WEY A;  1EV4 A;  4ZIL A;  4GCI A;  1ZGN A;  2LS5 A;  3LG6 A;  1HNB A;  3I9V 2;  4I8B A;  3CMI A;  3L9S A;  2HRK A;  1K0M A;  2DMM A;  4MH3 A;  2E7P A;  2LJK A;  5F07 A;  4TN8 A;  4WF4 A;  2HLS A;  5EY6 A;  3A2W A;  3FHK A;  4ID0 A;  2RM6 A;  3GFK A;  3ED3 A;  2GZY A;  4TKY A;  1YKA A;  1XVQ A;  3IOS A;  3BCK A;  3J7Y b;  1MEK A;  4AJ7 A;  1M9A A;  4GXZ A;  3ZTL A;  4NHZ A;  5IQY A;  4XS4 A;  1A8L A;  4MH2 A;  3PIN A;  3VI5 A;  3IRA A;  2VD1 A;  4TR4 A;  2R3X A;  1GL8 A;  2AUV A;  1JZR A;  3LQ7 A;  1YKC A;  4JBB A;  3QCP A;  4EDY A;  1TI1 A;  3FR6 A;  5DCH A;  2CVD A;  3APS A;  5IMC A;  2VCT A;  4KUN A;  3UBL A;  3ZFL A;  3ZML A;  1CQG A;  1JLW A;  4IP6 A;  2EIR A;  1TW9 A;  3I6A A;  3UMA A;  1S3R A;  1M99 A;  1M2D A;  4TW5 A;  1K3Y A;  2LRT A;  2VD0 A;  2I81 A;  1SKS B;  3K8N A;  1YY7 A;  3QAW A;  2VCV A;  3TKR A;  4LMV A;  2E2G A;  1Q98 A;  3CRU A;  4X4J A;  2H71 A;  4MJA A;  2H0G A;  4ZIJ A;  3IC8 A;  1U3A A;  1V57 A;  2HSY A;  1E2Y A;  3VI7 A;  1A24 A;  1M0U A;  2H66 A;  16GS A;  1DE2 A;  5CRE A;  2H73 A;  4MJC A;  2H6Z A;  3ERW A;  1O7U A;  5ECI B;  2VOC A;  5G1K A;  5ECQ B;  2CZ2 A;  2JSZ A;  4IKH A;  3WD6 A;  4KE3 A;  4Z2U A;  1QUW A;  3MYD A;  1ZYP A;  5EVO A;  1PL2 A;  1U3I A;  3BD2 A;  1FHE A;  3ISO A;  3ZZX A;  2GSS A;  4V1A p;  1JHB A;  2ZUP A;  4I2T A;  4L0U A;  1R4W A;  3M9J A;  1PX7 A;  3IAM 2;  2X99 A;  4RQX A;  4G10 A;  2IWT A;  1F6M C;  1Z6M A;  2IIY A;  1FVJ A;  4GQF A;  5DJM A;  3IR4 A;  4TXO B;  3DD3 A;  4RI6 A;  2EC4 A;  5B8A A;  1QQ2 A;  3H93 A;  2YZH A;  1GRX A;  4O92 A;  2FHE A;  1C72 A;  1XCC A;  2PVQ A;  1T3B A;  4EUY A;  3IAS 2;  4MF7 A;  2OAD A;  4IEL A;  2JAC A;  1JFU A;  1K3L A;  2DML A;  4OWY A;  3Q6O A;  1M2A A;  1XG8 A;  3HD5 A;  1SYR A;  2FA4 A;  2PGT A;  2ES7 A;  2PER A;  2A4H A;  2VM1 A;  1U6T A;  5DAK A;  5IOW A;  2DIZ A;  2QSI A;  1N8J A;  3GV1 A;  4CDO A;  3VUR A;  1R5A A;  5L71 A;  3D4M A;  5J9C A;  2A2P A;  3LSZ A;  11GS A;  5JCU A;  1J9B A;  1HNC A;  2H30 A;  2G2Q A;  5IO0 A;  2L59 A;  2YNX A;  1NSW A;  4QL9 A;  2H74 A;  3QR6 A;  2VCZ A;  2H76 A;  4K0N A;  2HRN A;  3F3R A;  1GUM A;  4ZL9 A;  2K8S A;  3HDC A;  2CVB A;  3HVS A;  4KAE A; 
#chains in the Genus database with same CATH homology
 1TOF A;  4WF5 A;  5B6M A;  1FO5 A;  2H1G A;  1TU8 A;  2FY6 A;  4MPG A;  1F3A A;  2PWJ A;  2IMD A;  1KEB A;  1WRY A;  3W8J A;  3EE2 A;  3KXO A;  1G7E A;  1ZOF A;  2C80 A;  2WJU A;  3WGD A;  1TRU A;  2YAN A;  2MMZ A;  3F6D A;  3CTF A;  2FWF A;  1GTU A;  1BJX A;  2XPD A;  2LQO A;  1G6W A;  3FZ4 A;  3LW9 A;  4ZB8 A;  4V2L A;  1EV9 A;  1EOG A;  2LJA A;  2ON7 A;  5DCG A;  4FYU A;  2LRN A;  1TK5 B;  1MD4 A;  2GGT A;  1GSQ A;  5G5F A;  2HRF A;  2DJJ A;  4KSO A;  4Q5Q A;  4NPB A;  3LYK A;  1OKD A;  1SJZ A;  2DSA A;  6GSW A;  3M3M A;  3M9K A;  4O5R A;  2LRC A;  4WR5 A;  2H72 A;  2C4J A;  1XFL A;  2CAI A;  2DJK A;  3TJG A;  4BL7 A;  2JL4 A;  4LLR A;  4WR4 A;  3FMW A;  4YQV A;  3UVT A;  1KTE A;  3E3E A;  1B9X C;  1FOV A;  1PD2 1;  1YF0 A;  1H75 A;  2RUE A;  4XHM A;  4MA9 A;  1ERV A;  2QGV A;  1AQV A;  4DVC A;  3KM6 A;  4O5U A;  3IHQ A;  1SEN A;  3GH6 A;  3M8N A;  4PQ1 A;  3WYW A;  2HT9 A;  4N0Z A;  3GRX A;  1LBK A;  2KOK A;  3CSI A;  2DJ1 A;  5AGY A;  1XXU A;  1AUC A;  4HUA A;  4Z2T A;  3ZLP A;  1SD9 A;  4D73 A;  4J57 E;  3GHA A;  1OE8 A;  1VF2 A;  2MBT A;  3RHC A;  4HDE A;  3C1R A;  1ZL9 A;  5G31 A;  2YZU A;  4KDY A;  1T4Z A;  2ON5 A;  4NMU A;  4E8E A;  1TKD B;  5HQP A;  3KP8 A;  3FW2 A;  1AW9 A;  2ZCT A;  5DQS A;  4ECC A;  2R0P A;  1GWC A;  3KD0 A;  1A2L A;  2LEG A;  3EU3 A;  2N5F A;  1GTI A;  4RUV A;  1ILO A;  1AIU A;  5LNK e;  2K8V A;  4GRF A;  4BVX A;  3HZ8 A;  4MLY A;  4E8H A;  2K9F A;  1PRX A;  1BAY A;  4MZB A;  1USB A;  2OE0 A;  3FR9 A;  4G0L A;  4WKW A;  3L9U A;  3PPU A;  1H4O A;  5ECS A;  3W6G A;  1EP8 A;  4PX1 A;  2IFQ B;  4HJ2 A;  4KCA A;  2LTK A;  6GSU A;  3A5I A;  3F8U A;  1PKZ A;  2HNL A;  3IDV A;  1B8X A;  2VL3 A;  3FYG A;  4OCE A;  2O8V B;  1V9W A;  2FCH A;  4KF9 A;  3GH9 A;  4JRR A;  2BJX A;  2UZ8 A;  2YCD A;  3ZVJ A;  1DE1 A;  2OBI A;  3LGC A;  4OCF A;  1YQ1 A;  14GS A;  3MWH A;  1XW6 A;  3PGT A;  4L0W A;  4WET A;  4PUA A;  1LJR A;  3MIX A;  2ZNM A;  3U5R E;  2DJ2 A;  4XTS A;  3D4T A;  2L6C A;  4HEA 2;  4K2X A;  3RPP A;  2O85 A;  5F06 A;  3QMX A;  3ZVJ D;  2FWE A;  4TR1 A;  4F0C A;  3P2A A;  4NXI A;  2DC5 A;  2IMI A;  3M1G A;  3GKX A;  4GLT A;  3D5J A;  1QMV A;  4BPY A;  4GTU A;  3GL3 A;  5CRH A;  4HZ4 A;  4V2N A;  1XWA A;  1XWC A;  4ECI A;  5HFK A;  2HZE A;  1Y25 A;  4AGS A;  3F4S A;  4Q5F A;  1SD8 A;  3QD9 A;  4DSQ A;  2DJ3 A;  4RI7 A;  3ERF A;  1EEJ A;  1VF3 A;  2C0D A;  2J23 A;  1XBS A;  4YAP A;  2RII A;  2H1B A;  4FYC A;  4TVE A;  3HJM A;  2Z9S A;  3DGQ A;  4YH2 A;  6GST A;  1ZYQ B;  3A2V A;  2DLX A;  1FG4 A;  3VPT A;  2YJ7 A;  2YWM A;  3WT2 A;  4JED A;  2GQL A;  5J3R A;  4G2E A;  5ECO B;  4BVY B;  4YKG A;  2H1D A;  3H1N A;  5C04 A;  2F8A A;  1YF1 A;  1JZO A;  2I4A A;  2IPA A;  2LNT A;  2C1Y A;  3F4R A;  1GNE A;  1TK0 B;  1XW5 A;  1J0F A;  3BCI A;  3ZFB A;  2RLI A;  4CHS A;  2XC2 A;  2L4Q A;  2LJR A;  3ERG A;  2WCI A;  1TRS A;  2WS2 A;  3IK9 A;  4H86 A;  1O81 A;  4NV5 A;  2A2S A;  4KSM A;  3PH9 A;  2FWH A;  1T8E B;  5JWR B;  1OC9 B;  4IS0 A;  2OBK A;  4K9Z A;  4LMW A;  4TXV A;  1Z7P A;  2TRC P;  2K6V A;  5F8B A;  2R0C A;  5G30 A;  2B7J A;  3O6T A;  2F8F A;  3CSJ A;  5CRD A;  4F82 A;  3GUR A;  3IV4 A;  3FZ9 A;  2VIM A;  4GSS A;  3HCZ A;  3KH9 A;  3KGK A;  4PNF A;  4JR4 A;  4JE1 A;  10GS A;  5ECN B;  3I69 A;  4ZB9 A;  1AAZ A;  4KGI A;  3DWV A;  4V2M A;  2MMA A;  1TDI A;  5HR2 A;  2PPT A;  4EL1 A;  2XBQ A;  3GKK A;  2C3T A;  4POM A;  2B3S A;  3M0F A;  4OO4 A;  2C3Q A;  2YPM A;  2DKH A;  2GST A;  3QOU A;  4MF5 A;  4NWY A;  3KMN A;  4MP4 A;  4F0B A;  2HE3 A;  4OD7 A;  4K8M A;  2TRX A;  1M9B A;  4J56 E;  5DQY A;  3G7J A;  4LA1 A;  4LL1 B;  2FLS A;  1ST9 A;  1V2A A;  3GMF A;  2HI7 A;  5F0G A;  2FNO A;  1PN0 A;  2VL9 A;  1TP9 A;  1V58 A;  4BWS A;  4KA0 A;  4G9H A;  5H5S A;  1RW1 A;  3VWU A;  2C0E A;  2KUC A;  3DXB A;  1XWK A;  4FQU A;  3SWL A;  4ZBB A;  2BMX A;  2WUL A;  3ME8 A;  9GSS A;  4IHU A;  5ECH B;  2REM A;  4I97 A;  3TJK A;  1Z6N A;  1QXH A;  5JCG A;  1K0O A;  3A3T A;  4KDU A;  2KP1 A;  4O5Q A;  1A8Y A;  1WP0 A;  2YP6 A;  3CRT A;  1SJ6 A;  4PQH A;  17GS A;  3GL5 A;  2OAC A;  1GUH A;  3TKS A;  3GTU B;  3FEU A;  2DKI A;  1V40 A;  3TKS E;  5JCW A;  5INY A;  4FYB A;  1OVN A;  3GA4 A;  2MMO A;  5J5N A;  4L8E A;  2WZ9 A;  5ECM B;  3RHB A;  3GYK A;  4EC0 A;  4EXJ A;  5KN2 A;  5AIX A;  1JLV A;  2GTU A;  4J2F A;  1KNG A;  3D6I A;  4YKF A;  1T1V A;  5ENU A;  4I6X A;  5AIS A;  4K1F A;  4IJI A;  2CQ9 A;  3DVW A;  4ICY A;  1XWG A;  3ZIV A;  3RAZ A;  1B48 A;  2JZR A;  4XS4 B;  5A4W A;  3QDN A;  1SL2 B;  2GVP A;  1PX6 A;  2HSM A;  3G7I A;  1GSD A;  6GSY A;  1M2B A;  3TKQ A;  4RQR A;  1KBN A;  5ELA A;  2CVK A;  3GIX A;  3BOA A;  5EPF A;  1VF1 A;  1I5G A;  2F51 A;  4MZW A;  4HJM A;  5IMZ A;  3BBY A;  3LXZ A;  3TRX A;  4EF0 A;  1OC3 A;  1TU7 A;  5LD0 A;  2QA2 A;  3F6F A;  5E4W A;  2R2J A;  2HZF A;  4HS1 A;  2MBS A;  2X4A A;  2FUG 2;  1X9S B;  1TXX A;  5GAP D;  3UL3 A;  3F0I A;  3LFL A;  1SYX A;  20GS A;  4JU5 A;  2V41 A;  3IE3 A;  3H4K A;  1QGV A;  4MPF A;  2C0G A;  4CY8 A;  3MDK A;  3NZN A;  2I3Y A;  1T7P B;  1TRW A;  1G7O A;  4GST A;  2IL3 A;  4AJ8 A;  1MDK A;  3R3E A;  3BJ5 A;  3JCM L;  3VWV A;  1AQX A;  2VM2 A;  4XS1 A;  1ACV A;  2M72 A;  2AB6 A;  3V1W A;  1GSU A;  1PA3 A;  3L4N A;  3C71 A;  2H70 A;  3TOU A;  4MJB A;  4IP1 A;  5KN0 A;  4X1U A;  5DAL A;  4PUF C;  3HVX A;  2L5O A;  5CP1 A;  3WGE A;  5IIZ A;  4L5O A;  2C0F A;  4K5S A;  5KOW A;  3HHV A;  3UIW A;  2N5B A;  1K0B A;  4F9Z A;  2H0H A;  2JU5 A;  2L4C A;  2GSQ A;  4ML1 A;  3VWX A;  1TJD A;  1N2A A;  3GST A;  3UEM A;  2FA8 A;  3Q74 A;  5F05 A;  4G19 A;  2WGR A;  1TK8 B;  5A4V A;  3GKN A;  5DJL A;  3F63 A;  4K5R A;  3KMO A;  5IMF A;  3EIN A;  2J9H A;  4IGJ A;  2AYT A;  4NV2 A;  4HQZ A;  4YQM A;  1YDK A;  19GS A;  1ZZY A;  4DSS B;  1GSE A;  2HYX A;  1HNA A;  1EP7 A;  2L6D A;  12GS A;  3IBH A;  4IN0 A;  2RM5 A;  1OYJ A;  3H8Q A;  4F03 A;  5HR0 A;  1NM3 A;  2MMN A;  1M7T A;  3IC4 A;  5ID2 A;  3LOR A;  2B5E A;  3HXS A;  1ZYE A;  4XRD A;  1R7H A;  1YZX A;  4EIQ A;  4EIP A;  3KJY A;  1K0C A;  2DJ0 A;  5AIV A;  4AF2 A;  3TJJ A;  1X5C A;  1O8W A;  2GT6 A;  1LU4 A;  1XVW A;  2LQQ A;  2X64 A;  6GSS A;  4MZC A;  1EWX A;  1X0R A;  1HD2 A;  3RBT A;  1SKR B;  2YWN A;  4OMV A;  1GSY A;  2P31 A;  1O6J A;  4ILF A;  1ON4 A;  1SK2 A;  3ME7 A;  1O85 A;  2B5Y A;  1I9D A;  2O87 A;  3EVI A;  1RK4 A;  4I5Q A;  4EVM A;  3UJ1 A;  2A4V A;  5D96 A;  4DSR A;  4QQ7 A;  3C8E A;  4HU7 A;  1EOH A;  3NIV A;  5A4U A;  2XPE A;  4PXO A;  1SK0 A;  1A0R P;  3QFA C;  1XIY A;  5D9T A;  1EGR A;  1S3C A;  4N10 A;  1ZCP A;  1UN2 A;  2V2G A;  3O76 A;  3L9V A;  5HR1 A;  3P7X A;  1GSF A;  3EU4 A;  5CYY A;  4CW9 A;  5D93 A;  4ECJ A;  3TJB A;  2QA1 A;  4Z2R A;  2C3N A;  1K0A A;  1MTC A;  4EDZ A;  5D9X A;  5J4U A;  2X8H A;  2IME A;  3LXT A;  1THO A;  1X5D A;  5ECL B;  2GS3 A;  2VAF A;  1B4P A;  4BWQ A;  2HSH A;  2YN1 A;  2VCX A;  2RUF A;  2P5R A;  2FD3 A;  4YAV A;  4OFT A;  3VWW A;  4TR0 A;  1OC8 A;  5HFG A;  4A5P A;  5KN1 A;  2GDR A;  4MDC A;  2VCW A;  1SL0 B;  2M80 A;  1F37 A;  2B6M A;  3G7Y A;  13GS A;  3ZIJ A;  1ZYN A;  3E0U A;  4BL7 B;  4G0K A;  4HU9 A;  1GTA A;  5B7C A;  5IMA A;  3UAR A;  2LUS A;  4ML6 A;  3AY8 A;  4N30 A;  4MF6 A;  2YOI A;  3P90 A;  3QAG A;  3N5O A;  5G2Z A;  1F9M A;  4EE0 A;  2F9S A;  2E2M A;  3IA1 A;  2X8G A;  2LST A;  3WGX A;  1O73 A;  3KEB A;  3GKM A;  4MCU A;  2NVL A;  2IJY A;  2VCQ A;  4D73 B;  1WPI A;  2LKU A;  2YJH A;  5J41 A;  1E6B A;  5CNW A;  4TXO A;  3CBU A;  1R5P A;  5COH A;  2EIQ A;  4MMM A;  3KIJ A;  2R5G A;  4OO5 A;  4HOJ A;  3TOT A;  2JZS A;  2CT6 A;  2H01 A;  3FZA A;  4Z7X A;  1U88 A;  4K2D A;  1FAA A;  1XPV A;  4N0V A;  2I1U A;  4GSN A;  2IMK A;  1A2M A;  1IYI A;  4KCE A;  1YEP A;  3CTG A;  1O8X A;  3DKS A;  2L5L A;  4HI7 A;  3CSH A;  2H6Y A;  1MD3 A;  4IW9 A;  2GSR A;  1WIK A;  2FWG A;  2R37 A;  2YWI A;  1YEX A;  3DML A;  5HR3 A;  1U87 A;  3FRC A;  4BVX B;  3OR5 A;  3KTB A;  2OJL A;  2BTO T;  3APQ A;  4PNG A;  1JZD A;  5E59 A;  2C8U A;  3GX8 A;  3LWA A;  1Z5Y E;  2AAW A;  1BYE A;  2OA7 A;  4ULX A;  1VF4 A;  1WOU A;  2HRA A;  4PTS A;  4ZL7 A;  4XIH A;  1MDJ A;  4Q5N A;  1NW2 A;  2CAQ A;  2OE3 A;  3D22 A;  1X9W B;  4Q5R A;  2A2R A;  2YWO A;  1OKT A;  1X9M B;  2V1M A;  4FIW A;  1Z9H A;  1K0D A;  2GT5 A;  3S9F A;  4NHW A;  2WDU A;  4KW6 A;  3C1S A;  2B5X A;  5ECR B;  3NOF A;  3EPT A;  2R4V A;  3TB2 A;  1FB6 A;  3GSS A;  3WT1 A;  5CAX A;  4HZ2 A;  4IBP A;  1VRS D;  1UVZ A;  3HA9 A;  2IN3 A;  2O89 A;  2AV4 A;  1W4V A;  2B1L A;  2GZP A;  4QL7 A;  1ERT A;  3RPN A;  4TR3 A;  4USS A;  5G5E A;  4MK3 A;  1SU9 A;  3F4T A;  2B7K A;  3HJP A;  5BRT A;  5IMV A;  4TR1 B;  1A23 A;  4WBR D;  2LV3 A;  5ECK B;  3EMP A;  1GNW A;  1PMT A;  4AJ6 A;  4JZQ A;  2TIR A;  1EEM A;  1QK8 A;  1Q4J A;  3MSZ A;  1BX9 A;  1W89 A;  5KN3 A;  2JZT A;  3KP9 A;  5ABR A;  4KH7 A;  1XOB A;  2V6K A;  2H19 A;  5J9B A;  3MNG A;  1WWJ A;  1BG5 A;  5B8B A;  2HZE B;  4GF0 A;  5GAN D;  4P3Y B;  2PUK C;  4GWR A;  3TKS C;  3QPM A;  1J08 A;  4ZL8 A;  2GLR A;  4K7I A;  5GSS A;  3CXG A;  3N9J A;  3QAV A;  5DBQ A;  3TRQ A;  3LEF A;  6GSX A;  1QFN A;  3VK9 A;  3HY2 A;  1ERU A;  2R0G A;  5IO2 A;  2KLX A;  2H8L A;  1ABA A;  4IJ3 A;  1AC1 A;  1CQH A;  1FB0 A;  1F2E A;  22GS A;  1PGT A;  3GUS A;  3IK7 A;  3GX0 A;  1FVK A;  2GZZ A;  1ERW A;  4DSS A;  1HYU A;  5IM9 A;  5CRW A;  3F9U A;  2VO4 A;  3HYP A;  2CA8 A;  4OFM A;  1URM A;  2M46 A;  3EC3 A;  1B9Y C;  3UAP A;  2NBS A;  3C7M A;  4HQS A;  1GUL A;  2H6X A;  2X49 A;  5D9W A;  3ZL5 A;  4EO3 A;  1GP1 A;  3U6V A;  4KDX A;  1SL1 B;  5FWG A;  3US3 A;  2IMF A;  3Q19 A;  2WRT A;  2H0I A;  3R2Q A;  3VFI A;  4K6X A;  3TDG A;  4LL4 B;  3P8W A;  3FY7 A;  4ZB6 A;  2F3M A;  3RDW A;  3GN3 A;  4XRA A;  5IPG A;  1THX A;  2CV4 A;  1PQN A;  4ZBD A;  5CO3 A;  4K0G A;  2X8C A;  2V32 A;  2P0G A;  3HJO A;  5AN1 A;  3TGZ A;  4V1A g;  3O3T A;  5HFI A;  4POB A;  4MJE A;  5ECP B;  2JAD A;  3UOM A;  3TKP A;  5IPH A;  3EWL A;  4PGT A;  4X0X A;  3SBC A;  3FZ5 A;  3W8S A;  2VLT A;  4O7H A;  2QC7 A;  5FHI A;  3L0H A;  2QKE A;  4NAX A;  7GSS A;  1DUG A;  2IFQ A;  4YQU A;  1EZK A;  2DBC A;  5JWO B;  2YV7 A;  3TRP A;  3LYP A;  5CRG A;  4POL A;  3HVV A;  3ZRE A;  4K7N A;  1WJK A;  3IHG A;  1UA5 A;  1XW9 A;  3J7Y k;  3KCM A;  1T4Y A;  3DYR A;  2PMT A;  3D0Z A;  3VLN A;  5DVB A;  1MDI A;  1K3O A;  1Z3E A;  1K0N A;  2CX3 A;  4KND A;  4PUR A;  1G0T A;  4OFN A;  5DDL A;  4N11 A;  3ZRD A;  2H1A A;  2KHP A;  4PQI A;  5JWQ B;  1B4Q A;  2NPB A;  1S3D A;  2EIO A;  4O32 A;  1GLP A;  1V98 A;  1DSB A;  3IXR A;  1Y6E A;  2MYG A;  4TOP A;  1ML6 A;  2CX4 A;  2JSY A;  2PVO C;  3HKR A;  3VPQ A;  3CYN A;  2PN8 A;  3FR3 A;  2OKA A;  3LJR A;  2AHE A;  3F3Q A;  3DEX A;  2WB9 A;  3G9B A;  3KTL A;  5D73 A;  4DEJ A;  1BQ7 A;  3A5W A;  1GH2 A;  4ZBA A;  1TTZ A;  2N5A A;  5H5Q A;  5KOX A;  1DBY A;  5D8I A;  1PSQ A;  2B1K A;  3TCO A;  5DAK B;  1IYH A;  3MAK A;  2DIY A;  3ZYW A;  4EKZ A;  1GTB A;  2FGX A;  5B6N A;  2OE1 A;  1A0F A;  1UC7 A;  1WE0 A;  1EGO A;  4BVY A;  2PBJ A;  1FOH A;  3EYT A;  1YJ6 A;  2VUP A;  2CZ3 A;  2E0Q A;  5GST A;  1SK1 A;  2XHF A;  1RQM A;  2V6O A;  2D2Z A;  1T00 A;  2XBI A;  8GSS A;  4JR6 A;  1XWB A;  2VLV A;  2NTO A;  2VLU A;  3Q18 A;  1NHO A;  3EMX A;  4K7O A;  3A2X A;  18GS A;  1SKW B;  1TI3 A;  3TUE A;  3KH7 A;  2GQM A;  2HXK A;  3KZQ A;  4X43 A;  2YV9 A;  1AQW A;  2KP2 A;  1OC9 A;  1GSS A;  4MNN A;  4IQA A;  1X5E A;  5KEJ A;  2PU9 C;  1JZW A;  5D9V A;  1TRV A;  5G1L A;  5LCZ A;  5IOX A;  1Z7R A;  3ZMK A;  4ECB A;  1XZO A;  3GNJ A;  4GQC A;  1R26 A;  2G0F A;  1G6Y A;  5A5K A;  1HQO A;  1PKW A;  4BA7 A;  4ISD A;  4WBJ A;  4IQ1 A;  2GQK A;  5DAL B;  3ZIT A;  3HZ4 A;  1GLQ A;  2K18 A;  6GSV A;  1VGL A;  2P5Q A;  4F2I A;  2VL2 C;  3E9J B;  4MAB A;  1FW1 A;  2ALB A;  1WMJ A;  2AJQ B;  4IVF A;  4I2U A;  1AXD A;  1ZMA A;  3FK8 A;  2NDO A;  2VL2 A;  5ELG A;  2HFD A;  3QFB C;  4FO5 A;  4XS6 A;  5H5R A;  4KX4 A;  5GZZ B;  1BED A;  3EUR A;  4ACS A;  4TRX A;  3TJF A;  4FH8 A;  4KB3 A;  2L57 A;  2O7K A;  4G0I A;  5BMU A;  1OE7 A;  3FKF A;  2MZC A;  3IPZ A;  1SJI A;  1A2J A;  3DRN A;  3L78 A;  4ZXG A;  3UVH A;  5EL8 A;  2I9H A;  3H79 A;  2H75 A;  1S3A A;  1OAZ A;  3DVX A;  1NHY A;  2LNS A;  2WFC A;  4L5L A;  1GUK A;  4CY6 A;  1PL1 A;  4WXT A;  1F3B A;  3D21 A;  5C00 A;  3C73 A;  5FT3 A;  3PR8 A;  2R6K A;  3APO A;  3UBK A;  5ID2 B;  1PN9 A;  4POK A;  5IMD A;  3DIE A;  3GTU A;  3I43 A;  1XOA A;  4XCS A;  4WEY A;  1EV4 A;  4ZIL A;  4GCI A;  1ZGN A;  2LS5 A;  3LG6 A;  1HNB A;  3I9V 2;  4I8B A;  3CMI A;  3L9S A;  2HRK A;  1K0M A;  2DMM A;  4MH3 A;  2E7P A;  2LJK A;  5F07 A;  4TN8 A;  4WF4 A;  2HLS A;  5EY6 A;  3A2W A;  3FHK A;  4ID0 A;  2RM6 A;  3GFK A;  3ED3 A;  2GZY A;  4TKY A;  1YKA A;  1XVQ A;  3IOS A;  3BCK A;  3J7Y b;  1MEK A;  4AJ7 A;  1M9A A;  4GXZ A;  3ZTL A;  4NHZ A;  5IQY A;  4XS4 A;  1A8L A;  4MH2 A;  3PIN A;  3VI5 A;  3IRA A;  2VD1 A;  4TR4 A;  2R3X A;  1GL8 A;  2AUV A;  1JZR A;  3LQ7 A;  1YKC A;  4JBB A;  3QCP A;  4EDY A;  1TI1 A;  3FR6 A;  5DCH A;  2CVD A;  3APS A;  5IMC A;  2VCT A;  4KUN A;  3UBL A;  3ZFL A;  3ZML A;  1CQG A;  1JLW A;  4IP6 A;  2EIR A;  1TW9 A;  3I6A A;  3UMA A;  1M99 A;  1M2D A;  4TW5 A;  1K3Y A;  2LRT A;  2VD0 A;  2I81 A;  1SKS B;  3K8N A;  1YY7 A;  3QAW A;  2VCV A;  3TKR A;  4LMV A;  2E2G A;  1Q98 A;  3CRU A;  4X4J A;  2H71 A;  4MJA A;  2H0G A;  4ZIJ A;  3IC8 A;  1U3A A;  1V57 A;  2HSY A;  1E2Y A;  3VI7 A;  1A24 A;  1M0U A;  2H66 A;  16GS A;  1DE2 A;  5CRE A;  2H73 A;  4MJC A;  2H6Z A;  3ERW A;  1O7U A;  5ECI B;  2VOC A;  5G1K A;  5ECQ B;  2CZ2 A;  2JSZ A;  4IKH A;  3WD6 A;  4KE3 A;  4Z2U A;  1QUW A;  3MYD A;  1ZYP A;  5EVO A;  1PL2 A;  1U3I A;  3BD2 A;  1FHE A;  3ISO A;  3ZZX A;  2GSS A;  4V1A p;  1JHB A;  2ZUP A;  4I2T A;  4L0U A;  1R4W A;  3M9J A;  1PX7 A;  3IAM 2;  2X99 A;  4RQX A;  4G10 A;  2IWT A;  1F6M C;  1Z6M A;  2IIY A;  1FVJ A;  4GQF A;  5DJM A;  3IR4 A;  4TXO B;  3DD3 A;  4RI6 A;  2EC4 A;  5B8A A;  1QQ2 A;  3H93 A;  2YZH A;  1GRX A;  4O92 A;  2FHE A;  1C72 A;  1XCC A;  2PVQ A;  1T3B A;  4EUY A;  3IAS 2;  4MF7 A;  2OAD A;  4IEL A;  2JAC A;  1JFU A;  1K3L A;  2DML A;  4OWY A;  3Q6O A;  1M2A A;  3HD5 A;  1SYR A;  2FA4 A;  2PGT A;  2ES7 A;  2PER A;  2A4H A;  2VM1 A;  1U6T A;  5DAK A;  5IOW A;  2DIZ A;  2QSI A;  1N8J A;  3GV1 A;  4CDO A;  3VUR A;  1R5A A;  5L71 A;  3D4M A;  5J9C A;  2A2P A;  3LSZ A;  11GS A;  5JCU A;  1J9B A;  1HNC A;  2H30 A;  2G2Q A;  5IO0 A;  2L59 A;  2YNX A;  1NSW A;  4QL9 A;  2H74 A;  3QR6 A;  2VCZ A;  2H76 A;  4K0N A;  2HRN A;  3F3R A;  1GUM A;  4ZL9 A;  2K8S A;  3HDC A;  2CVB A;  3HVS A;  4KAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...