3CMIA

Crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
Knots found
sequence length
161
structure length
143
Chain Sequence
b'SEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIGFPCNQFGGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin HYR1
publication title Crystal structure of glutathione-dependent phospholipid peroxidase Hyr1 from the yeast Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 39
structure length 143
sequence length 161
other databases KnotProt 2.0: Artifct K +31
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cmiA00
4LMWA 3UOMA 1YKCA 1OC8A 2K9FA 3KMOA 6GSWA 5J9BA 4K0NA 3QCPA 1YDKA 4MABA 3DVWA 1GP1A 1LBKA 4JR6A 4AJ7A 12GSA 2IJYA 3ZLPA 4L0WA 5L71A 1GSUA 4OFMA 1JLWA 1F37A 2E7PA 3I43A 4K0GA 2F3MA 4KDYA 2L6CA 3FZ9A 4OO4A 3HZ8A 1NHOA 4PUFC 3IAS2 1VGLA 3HYPA 2VCZA 2YP6A 5J5NA 4X43A 1OKTA 1PQNA 4KUNA 3FR3A 3VI7A 1JLVA 2VUPA 5LD0A 2HE3A 4MH2A 2B7KA 3A2WA 2H19A 4GLTA 1XWAA 2P0GA 4F0CA 4PNFA 5DALB 1EEMA 1SL1B 2K8VA 3ME7A 1TJDA 3EU4A 5JWRB 14GSA 3P7XA 4EXJA 3M8NA 1FVJA 4GQFA 4MZBA 5GSTA 2AUVA 3ZIVA 3CXGA 5ECNB 4RQXA 1BG5A 3ZFLA 2LKUA 4MF5A 4I97A 1HQOA 3RPPA 2ES7A 2XC2A 1DSBA 3QD9A 5GSSA 1VF1A 1H75A 2DMMA 2NPBA 1UVZA 4BWSA 2YOIA 5ECOB 2DIZA 1AXDA 1AC1A 1N2AA 3GSTA 4WR4A 4OCFA 3M0FA 5DVBA 3R2QA 2E2GA 3WGDA 4GTUA 2O89A 1E2YA 1GTAA 1FB6A 2IMFA 3F0IA 4GF0A 3GMFA 2VLUA 1PX6A 1R5PA 3GRXA 3TRPA 1WWJA 2HI7A 1TDIA 1OE7A 1PX7A 3EURA 1XOBA 4F03A 5AISA 2P5RA 2B6MA 3A3TA 2ZNMA 3H4KA 3OR5A 5KN1A 1VF3A 2GVPA 2IPAA 3GURA 2C3QA 1XOAA 4O32A 3WD6A 1PRXA 2YN1A 3EVIA 1FG4A 1ERTA 2DLXA 4MPGA 3EWLA 1XW9A 3KMNA 3C71A 3KXOA 1HYUA 5CYYA 2VL2A 4RQRA 1JZWA 2LQQA 4OMVA 4YQVA 5HR2A 2VCVA 4GXZA 3DXBA 6GSVA 2R3XA 4AF2A 2VLTA 5A5KA 2ON7A 2VCWA 4JBBA 3LXZA 5G2ZA 3HD5A 3F63A 1TTZA 3F4RA 22GSA 4NPBA 3O6TA 4CDOA 5ELAA 3LFLA 4YH2A 5D73A 3TJGA 3SWLA 1YKAA 4EDYA 4TKYA 1ERWA 2B1LA 5ECIB 3GV1A 4F2IA 3C7MA 5ECLB 1AAZA 3D6IA 3ERWA 2P31A 2FLSA 1O8WA 5ENUA 2R2JA 1Z5YE 1X0RA 3H8QA 5IM9A 1GUKA 4O5RA 2O87A 5IMAA 2H75A 4ECCA 1HNBA 5IMDA 3BBYA 3A5WA 3EU3A 1R26A 4RI7A 3C73A 1WRYA 3APQA 4GCIA 6GSSA 4J56E 1MDKA 1OC3A 4G10A 4V1Ag 2X64A 4EKZA 5DALA 4K7IA 5C00A 3ZZXA 4DSSB 3RDWA 4JRRA 1CQHA 1B9YC 2V6OA 5HR3A 1VF2A 4JE1A 3ZMLA 4MJCA 1ZGNA 4TRXA 2YCDA 1PL2A 2B5YA 1GULA 2LJAA 3WT2A 3CSJA 1M99A 2FGXA 1WE0A 2GT6A 4KCAA 2L57A 4GSNA 1BQ7A 1QQ2A 2PVOC 2VLVA 3LYPA 2LEGA 5B7CA 2R4VA 2M46A 4ZILA 1EP7A 3GTUA 1R5AA 1GNEA 2YNXA 1EP8A 4MZWA 2F51A 9GSSA 1IYHA 4KH7A 1AIUA 3I9V2 3IDVA 3ZITA 1O7UA 1G7OA 3DYRA 3S9FA 3WGEA 4MCUA 1F2EA 4KE3A 1ABAA 5J4UA 1JHBA 3CSIA 4MA9A 5HR1A 4KX4A 2O85A 3L9SA 2IL3A 3VFIA 2GZYA 3RHCA 1CQGA 3KM6A 4MH3A 5E59A 3VWUA 3EMXA 2H6XA 2JADA 2K8SA 4XIHA 1PMTA 3ERFA 5CP1A 2MMAA 3VLNA 3UBKA 5ABRA 5JCUA 3FKFA 2MBSA 4LA1A 1XPVA 4MJEA 4N30A 1RQMA 3CRUA 1GSFA 3DGQA 2B5XA 2PBJA 1LU4A 3LXTA 4K7NA 3BD2A 10GSA 4NWYA 3J7Yk 3UAPA 3KGKA 4LL4B 2RUEA 4IQAA 3CRTA 1KEBA 1K0NA 1G6WA 4IKHA 3D4TA 3TJKA 3TOTA 3ME8A 1SENA 2WGRA 2X8CA 4JEDA 4WF4A 2IN3A 3FEUA 4V2MA 3LWAA 2JZSA 2PGTA 2OA7A 4ECBA 2PPTA 2MYGA 2H30A 3TKSA 2GSQA 2YV7A 3GN3A 5CNWA 5IQYA 2HRNA 2MZCA 4WBJA 2AYTA 4GWRA 3FYGA 7GSSA 1XBSA 2V6KA 1KTEA 4WBRD 2VM1A 2WFCA 2B3SA 4ISDA 2VIMA 2OKAA 2C0DA 2E2MA 2KLXA 4PXOA 2QGVA 4G2EA 1GRXA 3UBLA 4I5QA 1AUCA 4HI7A 1FHEA 2RUFA 4DSSA 1OC9B 3CBUA 1ZL9A 4YAVA 1TW9A 4KDUA 3U6VA 4MF6A 4IJIA 1JZRA 3LQ7A 1F3BA 3TKSE 2H8LA 4MJAA 1TOFA 3D4MA 5IOXA 1J0FA 1A2LA 1YEXA 4AGSA 2H66A 1A2JA 1M2DA 1BYEA 2I81A 1OAZA 1XVWA 3HKRA 1KBNA 3ERGA 3Q19A 5LNKe 5G1KA 2LNTA 16GSA 4WR5A 4X0XA 4G9HA 3D0ZA 2H73A 2JZTA 2JU5A 2OBKA 1F6MC 3CTFA 4IJ3A 1EV4A 3LSZA 5B6NA 2CVBA 4XCSA 1XW6A 2I1UA 3F4TA 3F3QA 4ID0A 2QSIA 2PERA 4XRAA 3EMPA 1MEKA 2VCXA 1XWCA 3GYKA 5HFIA 11GSA 4K1FA 1GTIA 1GSQA 1PN9A 5HR0A 2FA8A 3P8WA 4V2LA 4NMUA 1K0BA 1Z6MA 5A4UA 3DMLA 4HS1A 2VL9A 4EL1A 5EVOA 2TRCP 1EGOA 1J08A 2NBSA 3QR6A 4HDEA 5DAKB 3IE3A 4K9ZA 3W6GA 3MAKA 2ZUPA 4KSOA 4BA7A 5IMZA 4XS4B 2DSAA 2YWNA 3NZNA 4E8HA 1T1VA 3LORA 2GZZA 3HHVA 2OADA 3V1WA 2CX4A 3DD3A 2M80A 2AB6A 1XZOA 1FAAA 2FHEA 4OD7A 2RLIA 5ID2A 1EOHA 2LSTA 1DUGA 1K0MA 3N5OA 1VF4A 2CA8A 2C0FA 3ZVJA 4QL9A 2YV9A 2DBCA 2EIOA 2K18A 5ELGA 1ZZYA 2LRCA 4F9ZA 4DSRA 4J2FA 1YY7A 1Z7RA 1XIYA 3H79A 1Z3EA 2HFDA 3BJ5A 2X8HA 2WCIA 1ACVA 5IPGA 4LMVA 1KNGA 1T7PB 2FWEA 3FRCA 1ZCPA 1S3AA 2A4VA 3G7IA 1NHYA 4K8MA 3CSHA 1WMJA 2XBIA 3H1NA 1PKZA 4TR1A 2AV4A 3KH9A 2IMIA 5AGYA 3P2AA 4ZL9A 4DEJA 1Y25A 5CRHA 2HLSA 3TDGA 1N8JA 2H0HA 1GNWA 5ECQB 3G7JA 2JACA 2CAIA 4ULXA 3ZYWA 5JCWA 1T8EB 1T3BA 4RI6A 3TUEA 3GKXA 3K8NA 3M1GA 1QUWA 4O7HA 2CQ9A 2N5BA 2V32A 1MD4A 1ILOA 2L4QA 4PX1A 1A2MA 4TXVA 1S3DA 4N10A 1PA3A 1R4WA 2F8AA 5EL8A 2A2RA 3D21A 3QPMA 5KN0A 1EWXA 5D9WA 3PINA 1TU7A 5F05A 2DIYA 4IS0A 5EY6A 2QC7A 18GSA 3UMAA 3F8UA 3VWWA 3LYKA 1K3YA 1S3CA 2G2QA 1TK5B 5B8BA 4OWYA 1W89A 1K3OA 1M2BA 1SKSB 1JFUA 3KZQA 2FWFA 5DJMA 3C1SA 5IO2A 4OFTA 17GSA 4L0UA 2HNLA 3UJ1A 3L4NA 3GFKA 5AIXA 3VPQA 3I6AA 2XBQA 5F0GA 2GTUA 2F9SA 1WJKA 1TKDB 4IW9A 4IP1A 4D73B 1Q98A 2WZ9A 1K0DA 4IGJA 4MF7A 5DJLA 3FHKA 1EGRA 1BAYA 1EV9A 3KCMA 1HNAA 3G9BA 1M7TA 2K6VA 2H74A 1BEDA 2VM2A 3VK9A 2WB9A 3Q18A 1SL2B 5D93A 2IMEA 1GSSA 2WS2A 1GSEA 19GSA 2LQOA 3FR9A 1FB0A 1OE8A 4PQIA 4MMMA 2H6ZA 2IFQB 1A8LA 3HJPA 1SKRB 4YQUA 5KEJA 3TGZA 4IQ1A 2WRTA 2DJJA 3IC4A 3MSZA 2YJ7A 2PWJA 3US3A 2EIRA 5ECRB 2IWTA 4F82A 1EZKA 2LS5A 3TKPA 5G30A 4MDCA 2H76A 3TKRA 2GSSA 4F0BA 3P90A 2VO4A 1Z9HA 4I6XA 4DSQA 2KHPA 4Q5NA 2YANA 4TOPA 2VAFA 2DJ1A 2WDUA 4ACSA 4FIWA 3BOAA 4IELA 3UIWA 3VWVA 3QAVA 5CRDA 1GLQA 3IR4A 1OVNA 3APOA 4WKWA 1V2AA 2PUKC 5AIVA 1O73A 5IMCA 1ERUA 3UL3A 3C8EA 4TXOB 3L9UA 4I8BA 4IHUA 3ZL5A 4HU7A 2MMNA 1Q4JA 4WEYA 2C4JA 2GQLA 1TRSA 2BTOT 5D9TA 2F8FA 1TRUA 2V41A 3IBHA 1QFNA 1A8YA 5H5RA 1M2AA 1U6TA 4KSMA 2P5QA 5CAXA 2OE0A 3D22A 3PH9A 2HZEB 2FUG2 5F06A 1DBYA 1YF0A 2BMXA 2RM5A 1EEJA 3UVHA 1ON4A 2LTKA 4KB3A 2L4CA 3IOSA 1I9DA 2DJ3A 3GIXA 1XXUA 3H93A 3HXSA 5JCGA 4HJMA 5CREA 2L59A 5JWQB 4J57E 4HZ4A 3TJJA 2NVLA 5INYA 6GSTA 3F6DA 1C72A 1MDIA 1Z7PA 4BWQA 2C0EA 1SJIA 4BL7A 2REMA 1YF1A 6GSYA 3ZFBA 1GL8A 3DKSA 1IYIA 2KOKA 1GH2A 3FZ4A 4NHZA 2OACA 2C3TA 4PQ1A 1BJXA 2JSZA 1B9XC 2R37A 1A23A 2TRXA 1K0AA 3GSSA 5COHA 4KW6A 4ECIA 1PGTA 4POMA 1WIKA 4H86A 3W8JA 2CX3A 2PVQA 4XHMA 1Y6EA 1AQWA 3E3EA 3F4SA 2IFQA 2DJ2A 1TRVA 2B7JA 5J41A 4Q5FA 4GSTA 2H72A 4I2TA 5B8AA 3F6FA 4TW5A 1SD9A 2C1YA 4ZB6A 1X5CA 1SK1A 4EVMA 3UARA 1X5DA 3GH9A 4N0ZA 3KP8A 3MDKA 3APSA 3CTGA 2GDRA 2IMKA 3HVSA 4GRFA 4WF5A 2MMOA 1URMA 2E0QA 2GZPA 4HUAA 4OO5A 1UC7A 5FHIA 3HCZA 4NXIA 4KDXA 4POLA 3J7Yb 2ON5A 2YWOA 4HZ2A 1F3AA 3LEFA 1O6JA 2XPDA 4HOJA 2GSTA 2AHEA 4QQ7A 1TI1A 3FW2A 4Q5QA 3TB2A 2PU9C 2GQKA 5J9CA 2HYXA 3DEXA 1MDJA 1SK0A 1U3AA 1THXA 3TKQA 2PN8A 3L9VA 1TK8B 2FWHA 2TIRA 3EYTA 1SJ6A 2KP2A 4ZBDA 4EC0A 2C80A 5HQPA 2HZEA 4IN0A 1K0CA 3EINA 4LLRA 4TN8A 3GKNA 1PL1A 2H0IA 3A2VA 3GNJA 2J23A 2X99A 5DCHA 4V2NA 2I3YA 1XWKA 5G5FA 1NM3A 3QOUA 4ILFA 5GAPD 4FYUA 3HY2A 2QKEA 2N5AA 1SYRA 4YQMA 5DCGA 1YEPA 2GT5A 3WGXA 2YWMA 1BX9A 2KP1A 3KD0A 4ML1A 3M9KA 1PSQA 4KNDA 4EDZA 4EF0A 4GSSA 3GKKA 3M3MA 4N0VA 5FWGA 5AN1A 2H71A 3VI5A 5ECPB 2L5LA 3D5JA 1YQ1A 2DJKA 4BPYA 2VOCA 5HFGA 5F8BA 2ALBA 4O92A 1PD21 1GUHA 1J9BA 2WJUA 4K2DA 4AJ8A 4ECJA 1TU8A 5C04A 3IK9A 2L6DA 3FY7A 4BVXA 2DJ0A 3HVVA 3HJMA 3RPNA 2OE3A 2NDOA 4OCEA 1GSYA 5A4VA 3TKSC 4JR4A 4X1UA 3KEBA 2CT6A 3DIEA 1FVKA 1OYJA 2MMZA 1WP0A 4ZIJA 3O76A 5A4WA 1UA5A 1MD3A 2LV3A 1DE2A 2EIQA 3F9UA 1GWCA 1LJRA 2DC5A 1T4YA 4KAEA 2VL3A 1FO5A 2AJQB 2VD1A 4NHWA 4JZQA 6GSXA 1M9BA 1RW1A 1V40A 3FZ5A 4TR4A 3IHQA 5ECKB 1O81A 2VCQA 3JCML 1YJ6A 3QMXA 1OC9A 4XS1A 1QXHA 1T00A 3QAGA 5IMVA 1X5EA 1RK4A 1USBA 1ST9A 2FY6A 5JWOB 2V1MA 5E4WA 1YZXA 1QK8A 1A0RP 3HVXA 3GTUB 2NTOA 2CZ3A 3IV4A 4MP4A 3TJFA 3BCKA 1ZYQB 5IIZA 4XRDA 3HA9A 3NOFA 3DWVA 2CAQA 4V1Ap 5ECHB 2XHFA 2YPMA 1SU9A 1UN2A 4Q5RA 3HZ4A 1B8XA 2XPEA 2OJLA 3W8SA 1FW1A 4TR0A 4CHSA 3TRXA 4FH8A 3A2XA 1DE1A 5G5EA 1O8XA 3ZVJD 3L0HA 4ZBBA 4MLYA 2HSHA 2V2GA 2GLRA 2H1DA 3PR8A 2R6KA 5D96A 1HD2A 3M9JA 1TK0B 2HSYA 4PURA 2N5FA 1WOUA 5B6MA 1X9SB 3GL5A 4HEA2 20GSA 4XS6A 4POBA 5DAKA 2JL4A 2ZCTA 3CYNA 4XS4A 1JZOA 4CW9A 3UVTA 2EC4A 4Z7XA 2OBIA 3MNGA 4FYBA 5FT3A 1ZOFA 1I5GA 3TRQA 3EE2A 3ED3A 2C0GA 5KN2A 2VD0A 4WETA 3E9JB 2FD3A 2JSYA 3CMIA 4MZCA 1NSWA 2BJXA 3IAM2 4ZB8A 2L5OA 4YAPA 2KUCA 8GSSA 4QL7A 5KN3A 4ZXGA 1X9WB 1GTBA 1ML6A 1QMVA 4MPFA 1SL0B 1GUMA 2FA4A 3GUSA 3PGTA 2IMDA 4IP6A 4RUVA 3I69A 1XVQA 2YZHA 5LCZA 3GX0A 5H5SA 4HJ2A 1TP9A 4G19A 1V57A 1SJZA 2LRNA 1M0UA 2CZ2A 4P3YB 1TRWA 1XCCA 3GL3A 2CVDA 1X9MB 4PUAA 5D9XA 3QFBC 4HQZA 3FR6A 5CO3A 1G0TA 1AQVA 3GHAA 4PGTA 2OE1A 4KGIA 3ZREA 1XW5A 3U5RE 1GTUA 1HNCA 3QAWA 4L5LA 3EC3A 1R7HA 2O7KA 3KIJA 4FO5A 1U87A 4WXTA 3TJBA 2Z9SA 1K0OA 4IBPA 3Q6OA 5CRGA 2I9HA 5DBQA 2MBTA 1JZDA 2DMLA 4FYCA 5ECMB 2A2SA 2AAWA 3IA1A 4K6XA 2LUSA 4ZBAA 1MTCA 5DDLA 4LL1B 1SYXA 5IMFA 1O85A 1B4PA 4ZB9A 2IIYA 1VRSD 2HXKA 5G1LA 1SD8A 3RAZA 1AW9A 2C8UA 1E6BA 1TXXA 1EOGA 3IPZA 1AQXA 2VL2C 2JZRA 2D2ZA 1G7EA 2GQMA 2M72A 1T4ZA 1A24A 2YJHA 3GX8A 1XWBA 3TOUA 3AY8A 3GH6A 3DRNA 3IXRA 2H1GA 3L78A 4POKA 2H6YA 4XTSA 4ZL8A 1ZYEA 1TI3A 2CV4A 5J3RA 2WULA 3ZTLA 4D73A 3KH7A 5IOWA 2YWIA 4HU9A 3DVXA 5IO0A 3LJRA 1GLPA 1A0FA 1WPIA 4HQSA 2B5EA 1W4VA 1B48A 4NV2A 3E0UA 2FCHA 4GQCA 3N9JA 4L8EA 1GSDA 3Q74A 5ID2B 3UEMA 3FK8A 3QFAC 4ML6A 4KCEA 2J9HA 4PQHA 4OFNA 3RBTA 1OKDA 3F3RA 3WT1A 3ZRDA 2LJKA 2HRFA 1F9MA 4EO3A 13GSA 5D9VA 1XFLA 4AJ6A 2B1KA 5EPFA 5CRWA 4EE0A 4MK3A 2PMTA 1QGVA 2FNOA 5G31A 5IPHA 1U88A 2H1AA 3GA4A 2X8GA 1XWGA 6GSUA 4KA0A 3IRAA 2CVKA 2C3NA 2LRTA 4L5OA 1K3LA 1U3IA 4TR1B 2YZUA 3QDNA 3VURA 2G0FA 2HT9A 5HFKA 4TR3A 5DQYA 1ZMAA 2H1BA 4MJBA 3HDCA 3KTBA 1B4QA 2VCTA 3LGCA 2LNSA 3C1RA 2GSRA 1V58A 4IVFA 1PKWA 1NW2A 4BVYA 3FZAA 3KJYA 5D8IA 1ERVA 2HZFA 1Z6NA 3VPTA 3WYWA 3ZMKA 2O8VB 2GS3A 2R5GA 3G7YA 4N11A 4NV5A 1V9WA 4TVEA 5ECSA 5F07A 3ISOA 4PNGA 3NIVA 2RM6A 4EUYA 5GAND 4K7OA 1M9AA 2GGTA 3VWXA 4TXOA 3TCOA 1SKWB 2RIIA 2LJRA 3MWHA 5GZZB 3BCIA 2I4AA 4E8EA 2H70A 2H0GA 3GKMA 1FOVA 2H01A 3KP9A 1G6YA 1THOA 4ZL7A 4DVCA 4JU5A 2FWGA 5H5QA 1H4OA 1V98A 3IK7A 3RHBA 1SK2A 3KTLA 3HJOA 3LG6A 4I2UA 3O3TA 3SBCA 3ZIJA 5DQSA 4NAXA
chains in the Genus database with same CATH superfamily
4LMWA 3UOMA 1YKCA 1OC8A 2K9FA 3KMOA 6GSWA 5J9BA 4K0NA 3QCPA 1YDKA 4MABA 3DVWA 1GP1A 1LBKA 4JR6A 4AJ7A 12GSA 2IJYA 3ZLPA 4L0WA 5L71A 1M3IA 1GSUA 4OFMA 1JLWA 1F37A 2E7PA 3I43A 4K0GA 2F3MA 4KDYA 2L6CA 3FZ9A 4OO4A 3HZ8A 1NHOA 4PUFC 3IAS2 1VGLA 3HYPA 2VCZA 2YP6A 5J5NA 4X43A 1OKTA 1PQNA 4KUNA 3FR3A 4YKGA 3VI7A 1JLVA 2VUPA 5LD0A 2HE3A 4MH2A 2B7KA 3A2WA 2H19A 4GLTA 1XWAA 2P0GA 2DKHA 4F0CA 4PNFA 5DALB 1EEMA 1SL1B 2K8VA 3ME7A 1TJDA 3EU4A 5JWRB 14GSA 3P7XA 4EXJA 3M8NA 1FVJA 4GQFA 4MZBA 5GSTA 2AUVA 3ZIVA 3CXGA 5ECNB 4RQXA 1BG5A 3ZFLA 2LKUA 4MF5A 4I97A 1HQOA 3RPPA 2ES7A 2XC2A 1DSBA 1S3RA 3QD9A 5GSSA 1VF1A 1H75A 2DMMA 2NPBA 1UVZA 4BWSA 2YOIA 5ECOB 2DIZA 1AXDA 1AC1A 1N2AA 3GSTA 4WR4A 4OCFA 3M0FA 5DVBA 3R2QA 2E2GA 3WGDA 4GTUA 2O89A 1E2YA 1GTAA 1FB6A 2IMFA 3F0IA 4GF0A 3GMFA 2VLUA 1PX6A 1R5PA 3GRXA 3TRPA 1WWJA 2HI7A 1TDIA 1OE7A 1PX7A 3EURA 1XOBA 4F03A 5AISA 2P5RA 2B6MA 3A3TA 2ZNMA 3H4KA 3OR5A 5KN1A 1VF3A 2GVPA 2IPAA 3GURA 2C3QA 1XOAA 4O32A 3WD6A 1PRXA 2YN1A 3EVIA 4A5PA 1FG4A 1ERTA 2DLXA 4MPGA 3EWLA 1XW9A 3KMNA 3C71A 3KXOA 1HYUA 5CYYA 2VL2A 4RQRA 1JZWA 2LQQA 4OMVA 4YQVA 5HR2A 2VCVA 4GXZA 3DXBA 6GSVA 2R3XA 4AF2A 2VLTA 5A5KA 2ON7A 2VCWA 4BL7B 4JBBA 3LXZA 5G2ZA 3HD5A 3F63A 1TTZA 3F4RA 22GSA 4NPBA 3O6TA 4CDOA 5ELAA 3LFLA 4YH2A 5D73A 3TJGA 3SWLA 1YKAA 4EDYA 4TKYA 1ERWA 2B1LA 5ECIB 3GV1A 4F2IA 3C7MA 5ECLB 1AAZA 3D6IA 3ERWA 2P31A 2FLSA 1O8WA 5ENUA 2R2JA 1Z5YE 1X0RA 3H8QA 5IM9A 1GUKA 4O5RA 2O87A 5IMAA 2H75A 4ICYA 4ECCA 1HNBA 5IMDA 3BBYA 3A5WA 3EU3A 1R26A 4RI7A 3C73A 1WRYA 3APQA 4GCIA 6GSSA 4J56E 4O5UA 1MDKA 1OC3A 4G10A 4V1Ag 2X64A 4EKZA 5DALA 4K7IA 5C00A 3ZZXA 4DSSB 4EIPA 3FMWA 3RDWA 4JRRA 1CQHA 1B9YC 2V6OA 5HR3A 1VF2A 4JE1A 3ZMLA 4MJCA 1ZGNA 4TRXA 2YCDA 1PL2A 2B5YA 1GULA 2LJAA 3WT2A 3CSJA 1M99A 2FGXA 1WE0A 2GT6A 4KCAA 2L57A 4GSNA 1BQ7A 1QQ2A 2PVOC 2VLVA 3LYPA 2LEGA 5B7CA 2R4VA 2M46A 4ZILA 1EP7A 3GTUA 1R5AA 1GNEA 2YNXA 1EP8A 4MZWA 2F51A 9GSSA 1IYHA 4KH7A 1AIUA 3I9V2 3IDVA 3ZITA 1O7UA 1G7OA 3DYRA 3S9FA 3WGEA 4MCUA 1F2EA 4KE3A 1ABAA 5J4UA 1JHBA 3CSIA 4MA9A 5HR1A 4KX4A 2O85A 3L9SA 2IL3A 3VFIA 2GZYA 3RHCA 1CQGA 3KM6A 4MH3A 5E59A 3VWUA 4USSA 3EMXA 2H6XA 2JADA 2K8SA 4XIHA 3A5IA 1PMTA 3ERFA 5CP1A 2MMAA 3VLNA 3UBKA 5ABRA 5JCUA 3FKFA 2MBSA 4LA1A 1XPVA 4MJEA 4N30A 1RQMA 3CRUA 1GSFA 3DGQA 2B5XA 2PBJA 1LU4A 3LXTA 4K7NA 3BD2A 10GSA 4NWYA 3J7Yk 3UAPA 3KGKA 4LL4B 2RUEA 4IQAA 3CRTA 4K5RA 1KEBA 1K0NA 1G6WA 4IKHA 3D4TA 3TJKA 3TOTA 3ME8A 1SENA 2WGRA 2X8CA 4JEDA 4WF4A 2IN3A 3FEUA 4V2MA 3LWAA 2JZSA 2PGTA 2OA7A 4ECBA 4BVXB 2PPTA 2MYGA 2H30A 3TKSA 2GSQA 2YV7A 3GN3A 5CNWA 5IQYA 2HRNA 2MZCA 4WBJA 2AYTA 4GWRA 3FYGA 7GSSA 1XBSA 2V6KA 1KTEA 4WBRD 2VM1A 2WFCA 2B3SA 4ISDA 2VIMA 2OKAA 2C0DA 2E2MA 2KLXA 4PXOA 2QGVA 4G2EA 1GRXA 3UBLA 4I5QA 1AUCA 2HRKA 4HI7A 1FHEA 2RUFA 4DSSA 1OC9B 3CBUA 1ZL9A 4YAVA 1TW9A 4KDUA 3U6VA 4MF6A 4IJIA 1JZRA 3LQ7A 1F3BA 3TKSE 2H8LA 4MJAA 1TOFA 3D4MA 5IOXA 1J0FA 1A2LA 1YEXA 4AGSA 2H66A 1A2JA 4CY8A 1M2DA 1BYEA 2I81A 1OAZA 1XVWA 3HKRA 1KBNA 3ERGA 3Q19A 5LNKe 5G1KA 2LNTA 16GSA 4WR5A 4X0XA 4G9HA 3D0ZA 2H73A 2JZTA 2JU5A 2OBKA 1F6MC 3CTFA 3R3EA 4IJ3A 1EV4A 3LSZA 5B6NA 2CVBA 4XCSA 1XW6A 2I1UA 3F4TA 3F3QA 4ID0A 2QSIA 2PERA 4XRAA 3EMPA 1MEKA 2VCXA 1XWCA 3GYKA 5HFIA 11GSA 4K1FA 1GTIA 1GSQA 1PN9A 5HR0A 2FA8A 3P8WA 4V2LA 4NMUA 1K0BA 1Z6MA 5A4UA 3DMLA 4K5SA 4HS1A 2VL9A 4EL1A 5EVOA 2TRCP 1EGOA 1J08A 2NBSA 3QR6A 4HDEA 5DAKB 3IE3A 4K9ZA 3W6GA 3MAKA 2ZUPA 4KSOA 4BA7A 5IMZA 4XS4B 2DSAA 2YWNA 3NZNA 4Z2RA 4E8HA 1T1VA 3LORA 2GZZA 3HHVA 2OADA 3V1WA 2CX4A 3DD3A 2M80A 2AB6A 1XZOA 1FAAA 2FHEA 4OD7A 2RLIA 5ID2A 1EOHA 2LSTA 1DUGA 1K0MA 3N5OA 1VF4A 2CA8A 2C0FA 3ZVJA 4QL9A 2YV9A 2DBCA 2EIOA 2K18A 5ELGA 1ZZYA 2LRCA 4F9ZA 4DSRA 4J2FA 1YY7A 1Z7RA 1XIYA 3H79A 1Z3EA 2HFDA 3MIXA 3BJ5A 2X8HA 2WCIA 1ACVA 5IPGA 4LMVA 1KNGA 1T7PB 2FWEA 3FRCA 1ZCPA 1S3AA 2A4VA 3G7IA 1NHYA 4K8MA 3CSHA 1WMJA 2XBIA 3H1NA 1PKZA 4TR1A 2AV4A 3KH9A 2IMIA 5AGYA 3P2AA 4FQUA 4ZL9A 1M3JA 4DEJA 1Y25A 5CRHA 2HLSA 3TDGA 1N8JA 2H0HA 1GNWA 5ECQB 3G7JA 2JACA 2CAIA 4ULXA 3ZYWA 5JCWA 1T8EB 1T3BA 4RI6A 3TUEA 3GKXA 3K8NA 3M1GA 1QUWA 4O7HA 2CQ9A 2N5BA 2V32A 1MD4A 1ILOA 2L4QA 4PX1A 3MYDA 1A2MA 4TXVA 1S3DA 4N10A 1PA3A 1R4WA 2F8AA 5EL8A 2A2RA 3D21A 3QPMA 5KN0A 1EWXA 5D9WA 3PINA 1TU7A 5F05A 2DIYA 4IS0A 5EY6A 2QC7A 18GSA 3UMAA 4G0KA 3F8UA 3VWWA 3LYKA 1K3YA 1S3CA 2G2QA 1TK5B 5B8BA 4OWYA 1W89A 1K3OA 1M2BA 1SKSB 1JFUA 3KZQA 2FWFA 5DJMA 3C1SA 5IO2A 4OFTA 17GSA 4L0UA 2HNLA 3UJ1A 3L4NA 3GFKA 5AIXA 3VPQA 3I6AA 2XBQA 2X4AA 5F0GA 2GTUA 2F9SA 1WJKA 1TKDB 4IW9A 4IP1A 4D73B 1Q98A 2WZ9A 2A4HA 1K0DA 4IGJA 4MF7A 5DJLA 3CQFA 3FHKA 1EGRA 1BAYA 1EV9A 3KCMA 1HNAA 3G9BA 1M7TA 2K6VA 2H74A 1BEDA 2VM2A 3VK9A 2WB9A 3Q18A 1SL2B 5D93A 2IMEA 1GSSA 2WS2A 1GSEA 19GSA 2LQOA 3FR9A 1FB0A 1OE8A 4PQIA 4MMMA 2H6ZA 2IFQB 1A8LA 3HJPA 1SKRB 4YQUA 5KEJA 3TGZA 4IQ1A 2WRTA 2DJJA 3IC4A 3MSZA 2YJ7A 2PWJA 3US3A 2EIRA 5ECRB 2IWTA 4F82A 1EZKA 2LS5A 2R0PA 3TKPA 5G30A 4MDCA 5BMUA 2H76A 3TKRA 2GSSA 4F0BA 3P90A 2VO4A 1Z9HA 4I6XA 4DSQA 2KHPA 4Q5NA 4BVYB 2YANA 4TOPA 2VAFA 2DJ1A 2WDUA 4ACSA 4FIWA 3BOAA 4IELA 3UIWA 4PTSA 3VWVA 3QAVA 5CRDA 1GLQA 3IR4A 1OVNA 3APOA 4WKWA 1V2AA 2PUKC 5AIVA 1O73A 5IMCA 1ERUA 3UL3A 3C8EA 4TXOB 3L9UA 4I8BA 4IHUA 3ZL5A 4HU7A 2MMNA 1Q4JA 4WEYA 2C4JA 2GQLA 1TRSA 2BTOT 5D9TA 2F8FA 1TRUA 2V41A 3IBHA 1QFNA 1A8YA 5H5RA 1M2AA 1U6TA 2HRAA 4KSMA 2P5QA 5CAXA 2OE0A 3D22A 3PH9A 2HZEB 2FUG2 5F06A 1DBYA 1YF0A 2BMXA 2RM5A 1EEJA 3UVHA 1ON4A 2LTKA 4KB3A 2L4CA 3IOSA 1I9DA 2DJ3A 3GIXA 1XXUA 3H93A 3HXSA 5JCGA 4HJMA 5CREA 2L59A 5JWQB 4J57E 4HZ4A 3TJJA 2NVLA 5INYA 6GSTA 3F6DA 1C72A 1MDIA 1Z7PA 4BWQA 2C0EA 1SJIA 4BL7A 2REMA 1YF1A 6GSYA 3ZFBA 1GL8A 3DKSA 1IYIA 4EIQA 2KOKA 1GH2A 3FZ4A 4NHZA 2OACA 2C3TA 4PQ1A 1BJXA 2JSZA 1B9XC 2R37A 1A23A 2TRXA 1K0AA 3GSSA 5COHA 4KW6A 4ECIA 1PGTA 4POMA 1WIKA 4H86A 3W8JA 2CX3A 2PVQA 4XHMA 1Y6EA 1AQWA 4G0IA 3E3EA 3F4SA 2IFQA 2DJ2A 1TRVA 2B7JA 1ZYPA 5J41A 4Q5FA 4GSTA 2H72A 4I2TA 5B8AA 3F6FA 4TW5A 1SD9A 2C1YA 4ZB6A 1X5CA 1SK1A 4EVMA 3UARA 1X5DA 3GH9A 4N0ZA 3KP8A 3MDKA 3APSA 3CTGA 2GDRA 2IMKA 3HVSA 4GRFA 4WF5A 2MMOA 1URMA 2E0QA 2GZPA 4HUAA 4OO5A 1UC7A 5FHIA 3HCZA 4NXIA 4KDXA 4POLA 3J7Yb 2ON5A 2YWOA 4HZ2A 1F3AA 3LEFA 1O6JA 2XPDA 4HOJA 2GSTA 2AHEA 4QQ7A 1TI1A 3FW2A 4Q5QA 3TB2A 2PU9C 2GQKA 5J9CA 2HYXA 3DEXA 1MDJA 1SK0A 2QA2A 1U3AA 1THXA 3TKQA 2PN8A 1PFOA 3L9VA 1TK8B 2FWHA 2TIRA 3EYTA 1SJ6A 2KP2A 4ZBDA 4EC0A 2C80A 5HQPA 2HZEA 4IN0A 1K0CA 3EINA 4LLRA 4TN8A 3GKNA 1PL1A 2H0IA 3A2VA 3GNJA 2J23A 2X99A 5DCHA 4V2NA 2I3YA 1XWKA 5G5FA 1NM3A 3QOUA 4ILFA 5GAPD 4FYUA 3HY2A 2QA1A 2QKEA 2N5AA 4MNNA 1SYRA 4YQMA 5DCGA 1YEPA 2GT5A 3WGXA 2YWMA 1BX9A 2KP1A 3KD0A 4ML1A 3M9KA 1PSQA 4KNDA 4EDZA 4EF0A 4GSSA 3GKKA 3M3MA 4N0VA 5FWGA 5AN1A 2H71A 3VI5A 5ECPB 2L5LA 3D5JA 1YQ1A 2DJKA 4BPYA 2VOCA 5HFGA 5F8BA 2ALBA 4O92A 1PD21 1GUHA 1J9BA 2WJUA 4K2DA 4AJ8A 4ECJA 1TU8A 5C04A 3IK9A 2L6DA 3FY7A 4BVXA 2DJ0A 3HVVA 3HJMA 3RPNA 2OE3A 2NDOA 4OCEA 5BRTA 1GSYA 5A4VA 3TKSC 4JR4A 4X1UA 3KEBA 2CT6A 3DIEA 1FVKA 1OYJA 2MMZA 4Z2UA 1WP0A 4X4JA 4ZIJA 3O76A 5A4WA 1UA5A 1MD3A 2LV3A 1DE2A 2EIQA 3F9UA 1GWCA 1LJRA 2DC5A 2HSMA 1T4YA 4KAEA 2VL3A 1FO5A 2UZ8A 2AJQB 2R0GA 2VD1A 4NHWA 4JZQA 6GSXA 1M9BA 1RW1A 1V40A 1PN0A 3FZ5A 4TR4A 3IHQA 5ECKB 1O81A 2VCQA 3JCML 1YJ6A 3QMXA 1OC9A 4XS1A 1QXHA 1T00A 3QAGA 5IMVA 1X5EA 1RK4A 1USBA 1ST9A 2FY6A 5JWOB 2V1MA 5E4WA 1YZXA 1QK8A 1A0RP 3HVXA 3GTUB 2NTOA 2CZ3A 3IV4A 4MP4A 3TJFA 3BCKA 1ZYQB 5IIZA 4XRDA 3HA9A 3NOFA 3DWVA 2CAQA 1FOHA 4V1Ap 5ECHB 2XHFA 2YPMA 1SU9A 1UN2A 4Q5RA 3HZ4A 1B8XA 2XPEA 2OJLA 3W8SA 1FW1A 4TR0A 4CHSA 3TRXA 4FH8A 3A2XA 1DE1A 5G5EA 1O8XA 3ZVJD 3L0HA 4ZBBA 4MLYA 2HSHA 2V2GA 2GLRA 2H1DA 3PR8A 2R6KA 5D96A 1ZYNA 1HD2A 3M9JA 1TK0B 2HSYA 4PURA 2N5FA 1WOUA 5B6MA 1X9SB 3GL5A 5KOXA 4HEA2 20GSA 4XS6A 4POBA 5DAKA 2JL4A 2ZCTA 3CYNA 4XS4A 1JZOA 4CW9A 3UVTA 2EC4A 4Z7XA 2OBIA 3MNGA 4FYBA 4YKFA 5FT3A 1ZOFA 1I5GA 3TRQA 3EE2A 3ED3A 2C0GA 2A2PA 5KN2A 2VD0A 4WETA 3E9JB 2FD3A 2JSYA 3CMIA 4MZCA 1NSWA 2BJXA 3IAM2 4ZB8A 2L5OA 4YAPA 4CY6A 2KUCA 8GSSA 4QL7A 5KN3A 4ZXGA 1X9WB 1GTBA 1ML6A 1QMVA 4MPFA 1SL0B 1GUMA 2FA4A 3GUSA 3PGTA 2IMDA 4IP6A 4RUVA 3I69A 1XVQA 2YZHA 5LCZA 3GX0A 3LW9A 5H5SA 4HJ2A 1TP9A 4G19A 1V57A 1SJZA 2LRNA 1M0UA 2CZ2A 3PPUA 4P3YB 1TRWA 1XCCA 3GL3A 2CVDA 1X9MB 4PUAA 5D9XA 3QFBC 4HQZA 3FR6A 5CO3A 1G0TA 1AQVA 3GHAA 4PGTA 2OE1A 4KGIA 3ZREA 1XW5A 3U5RE 1GTUA 1HNCA 3QAWA 4L5LA 3EC3A 1R7HA 2O7KA 3KIJA 4FO5A 1U87A 4WXTA 1XG8A 3TJBA 2Z9SA 1K0OA 4IBPA 3Q6OA 3IC8A 5CRGA 2I9HA 4HSCX 5DBQA 2MBTA 1JZDA 2DMLA 4FYCA 5ECMB 2A2SA 2AAWA 3IA1A 4K6XA 2LUSA 4ZBAA 1MTCA 5DDLA 4K2XA 4LL1B 1SYXA 4KF9A 5IMFA 1O85A 1B4PA 4ZB9A 4G0LA 2IIYA 1VRSD 2HXKA 5G1LA 1SD8A 3RAZA 1AW9A 2C8UA 1E6BA 1TXXA 1EOGA 3IPZA 3HVNA 1AQXA 2VL2C 2JZRA 2D2ZA 1G7EA 2GQMA 2M72A 1T4ZA 1A24A 5KOWA 2YJHA 3GX8A 1XWBA 3EPTA 3TOUA 3AY8A 3GH6A 3DRNA 3IXRA 2H1GA 3L78A 4POKA 2H6YA 4XTSA 4ZL8A 1ZYEA 1TI3A 2CV4A 5J3RA 2WULA 3ZTLA 4D73A 3KH7A 5IOWA 2YWIA 4HU9A 4Z2TA 3DVXA 5IO0A 3LJRA 1GLPA 1A0FA 1WPIA 4HQSA 2B5EA 1W4VA 1B48A 4NV2A 3E0UA 2FCHA 4GQCA 3N9JA 4L8EA 1GSDA 3Q74A 5ID2B 3UEMA 3FK8A 3QFAC 4ML6A 4KCEA 2J9HA 2DKIA 4PQHA 4OFNA 3RBTA 1OKDA 2R0CA 3F3RA 3WT1A 3ZRDA 2LJKA 2HRFA 1F9MA 4EO3A 13GSA 5D9VA 1XFLA 4AJ6A 2B1KA 5EPFA 5CRWA 4EE0A 4MK3A 2PMTA 1QGVA 2FNOA 5G31A 5IPHA 1U88A 2H1AA 3GA4A 2X8GA 1XWGA 6GSUA 4KA0A 3IRAA 2CVKA 2C3NA 2LRTA 4L5OA 1K3LA 1U3IA 4TR1B 2YZUA 3QDNA 3VURA 2G0FA 2HT9A 5HFKA 4TR3A 3IHGA 5DQYA 1ZMAA 2H1BA 4MJBA 3HDCA 3KTBA 1B4QA 2VCTA 3LGCA 2LNSA 3C1RA 2GSRA 1V58A 4IVFA 4BIKA 1PKWA 1NW2A 4BVYA 3FZAA 3KJYA 5D8IA 1ERVA 2HZFA 1Z6NA 3VPTA 3WYWA 3ZMKA 2O8VB 2GS3A 2R5GA 3G7YA 4N11A 4NV5A 1V9WA 4TVEA 5ECSA 5F07A 3ISOA 4PNGA 3NIVA 2RM6A 4EUYA 5GAND 4K7OA 1M9AA 2GGTA 3VWXA 4TXOA 4O5QA 3TCOA 1SKWB 2RIIA 2LJRA 3MWHA 5GZZB 3BCIA 2I4AA 4E8EA 2H70A 2H0GA 3GKMA 1FOVA 2H01A 3KP9A 1G6YA 1THOA 4ZL7A 4DVCA 4JU5A 2FWGA 5H5QA 1H4OA 1V98A 3IK7A 3RHBA 1SK2A 3KTLA 3HJOA 3LG6A 4I2UA 3O3TA 3SBCA 3ZIJA 5DQSA 2X49A 4NAXA
chains in the Genus database with same CATH topology
4LMWA 3UOMA 1YKCA 1OC8A 2K9FA 3KMOA 6GSWA 5J9BA 4K0NA 3QCPA 1YDKA 4MABA 3DVWA 1GP1A 1LBKA 4JR6A 4AJ7A 12GSA 2IJYA 3ZLPA 4L0WA 5L71A 1GSUA 4OFMA 1JLWA 1F37A 2E7PA 3I43A 4K0GA 2F3MA 4KDYA 2L6CA 3FZ9A 4OO4A 3HZ8A 1NHOA 4PUFC 3IAS2 1VGLA 3HYPA 2VCZA 2YP6A 5J5NA 4X43A 1OKTA 1PQNA 4KUNA 3FR3A 4YKGA 3VI7A 1JLVA 2VUPA 5LD0A 2HE3A 4MH2A 2B7KA 3A2WA 2H19A 4GLTA 1XWAA 2P0GA 2DKHA 4F0CA 4PNFA 5DALB 1EEMA 1SL1B 2K8VA 3ME7A 1TJDA 3EU4A 5JWRB 14GSA 3P7XA 4EXJA 3M8NA 1FVJA 4GQFA 4MZBA 5GSTA 2AUVA 3ZIVA 3CXGA 5ECNB 4RQXA 1BG5A 3ZFLA 2LKUA 4MF5A 4I97A 1HQOA 3RPPA 2ES7A 2XC2A 1DSBA 3QD9A 5GSSA 1VF1A 1H75A 2DMMA 2NPBA 1UVZA 4BWSA 2YOIA 5ECOB 2DIZA 1AXDA 1AC1A 1N2AA 3GSTA 4WR4A 4OCFA 3M0FA 5DVBA 3R2QA 2E2GA 3WGDA 4GTUA 2O89A 1E2YA 1GTAA 1FB6A 2IMFA 3F0IA 4GF0A 3GMFA 2VLUA 1PX6A 1R5PA 3GRXA 3TRPA 1WWJA 2HI7A 1TDIA 1OE7A 1PX7A 3EURA 1XOBA 4F03A 5AISA 2P5RA 2B6MA 3A3TA 2ZNMA 3H4KA 3OR5A 5KN1A 1VF3A 2GVPA 2IPAA 3GURA 2C3QA 1XOAA 4O32A 3WD6A 1PRXA 2YN1A 3EVIA 4A5PA 1FG4A 1ERTA 2DLXA 4MPGA 3EWLA 1XW9A 3KMNA 3C71A 3KXOA 1HYUA 5CYYA 2VL2A 4RQRA 1JZWA 2LQQA 4OMVA 4YQVA 5HR2A 2VCVA 4GXZA 3DXBA 6GSVA 2R3XA 4AF2A 2VLTA 5A5KA 2ON7A 2VCWA 4BL7B 4JBBA 3LXZA 5G2ZA 3HD5A 3F63A 1TTZA 3F4RA 22GSA 4NPBA 3O6TA 4CDOA 5ELAA 3LFLA 4YH2A 5D73A 3TJGA 3SWLA 1YKAA 4EDYA 4TKYA 1ERWA 2B1LA 5ECIB 3GV1A 4F2IA 3C7MA 5ECLB 1AAZA 3D6IA 3ERWA 2P31A 2FLSA 1O8WA 5ENUA 2R2JA 1Z5YE 1X0RA 3H8QA 5IM9A 1GUKA 4O5RA 2O87A 5IMAA 2H75A 4ICYA 4ECCA 1HNBA 5IMDA 3BBYA 3A5WA 3EU3A 1R26A 4RI7A 3C73A 1WRYA 3APQA 4GCIA 6GSSA 4J56E 4O5UA 1MDKA 1OC3A 4G10A 4V1Ag 2X64A 4EKZA 5DALA 4K7IA 5C00A 3ZZXA 4DSSB 4EIPA 3FMWA 3RDWA 4JRRA 1CQHA 1B9YC 2V6OA 5HR3A 1VF2A 4JE1A 3ZMLA 4MJCA 1ZGNA 4TRXA 2YCDA 1PL2A 2B5YA 1GULA 2LJAA 3WT2A 3CSJA 1M99A 2FGXA 1WE0A 2GT6A 4KCAA 2L57A 4GSNA 1BQ7A 1QQ2A 2PVOC 2VLVA 3LYPA 2LEGA 5B7CA 2R4VA 2M46A 4ZILA 1EP7A 3GTUA 1R5AA 1GNEA 2YNXA 1EP8A 4MZWA 2F51A 9GSSA 1IYHA 4KH7A 1AIUA 3I9V2 3IDVA 3ZITA 1O7UA 1G7OA 3DYRA 3S9FA 3WGEA 4MCUA 1F2EA 4KE3A 1ABAA 5J4UA 1JHBA 3CSIA 4MA9A 5HR1A 4KX4A 2O85A 3L9SA 2IL3A 3VFIA 2GZYA 3RHCA 1CQGA 3KM6A 4MH3A 5E59A 3VWUA 4USSA 3EMXA 2H6XA 2JADA 2K8SA 4XIHA 3A5IA 1PMTA 3ERFA 5CP1A 2MMAA 3VLNA 3UBKA 5ABRA 5JCUA 3FKFA 2MBSA 4LA1A 1XPVA 4MJEA 4N30A 1RQMA 3CRUA 1GSFA 3DGQA 2B5XA 2PBJA 1LU4A 3LXTA 4K7NA 3BD2A 10GSA 4NWYA 3J7Yk 3UAPA 3KGKA 4LL4B 2RUEA 4IQAA 3CRTA 4K5RA 1KEBA 1K0NA 1G6WA 4IKHA 3D4TA 3TJKA 3TOTA 3ME8A 1SENA 2WGRA 2X8CA 4JEDA 4WF4A 2IN3A 3FEUA 4V2MA 3LWAA 2JZSA 2PGTA 2OA7A 4ECBA 4BVXB 2PPTA 2MYGA 2H30A 3TKSA 2GSQA 2YV7A 3GN3A 5CNWA 5IQYA 2HRNA 2MZCA 4WBJA 2AYTA 4GWRA 3FYGA 7GSSA 1XBSA 2V6KA 1KTEA 4WBRD 2VM1A 2WFCA 2B3SA 4ISDA 2VIMA 2OKAA 2C0DA 2E2MA 2KLXA 4PXOA 2QGVA 4G2EA 1GRXA 3UBLA 4I5QA 1AUCA 2HRKA 4HI7A 1FHEA 2RUFA 4DSSA 1OC9B 3CBUA 1ZL9A 4YAVA 1TW9A 4KDUA 3U6VA 4MF6A 4IJIA 1JZRA 3LQ7A 1F3BA 3TKSE 2H8LA 4MJAA 1TOFA 3D4MA 5IOXA 1J0FA 1A2LA 1YEXA 4AGSA 2H66A 1A2JA 4CY8A 1M2DA 1BYEA 2I81A 1OAZA 1XVWA 3HKRA 1KBNA 3ERGA 3Q19A 5LNKe 5G1KA 2LNTA 16GSA 4WR5A 4X0XA 4G9HA 3D0ZA 2H73A 2JZTA 2JU5A 2OBKA 1F6MC 3CTFA 3R3EA 4IJ3A 1EV4A 3LSZA 5B6NA 2CVBA 4XCSA 1XW6A 2I1UA 3F4TA 3F3QA 4ID0A 2QSIA 2PERA 4XRAA 3EMPA 1MEKA 2VCXA 1XWCA 3GYKA 5HFIA 11GSA 4K1FA 1GTIA 1GSQA 1PN9A 5HR0A 2FA8A 3P8WA 4V2LA 4NMUA 1K0BA 1Z6MA 5A4UA 3DMLA 4K5SA 4HS1A 2VL9A 4EL1A 5EVOA 2TRCP 1EGOA 1J08A 2NBSA 3QR6A 4HDEA 5DAKB 3IE3A 4K9ZA 3W6GA 3MAKA 2ZUPA 4KSOA 4BA7A 5IMZA 4XS4B 2DSAA 2YWNA 3NZNA 4Z2RA 4E8HA 1T1VA 3LORA 2GZZA 3HHVA 2OADA 3V1WA 2CX4A 3DD3A 2M80A 2AB6A 1XZOA 1FAAA 2FHEA 4OD7A 2RLIA 5ID2A 1EOHA 2LSTA 1DUGA 1K0MA 3N5OA 1VF4A 2CA8A 2C0FA 3ZVJA 4QL9A 2YV9A 2DBCA 2EIOA 2K18A 5ELGA 1ZZYA 2LRCA 4F9ZA 4DSRA 4J2FA 1YY7A 1Z7RA 1XIYA 3H79A 1Z3EA 2HFDA 3MIXA 3BJ5A 2X8HA 2WCIA 1ACVA 5IPGA 4LMVA 1KNGA 1T7PB 2FWEA 3FRCA 1ZCPA 1S3AA 2A4VA 3G7IA 1NHYA 4K8MA 3CSHA 1WMJA 2XBIA 3H1NA 1PKZA 4TR1A 2AV4A 3KH9A 2IMIA 5AGYA 3P2AA 4FQUA 4ZL9A 4DEJA 1Y25A 5CRHA 2HLSA 3TDGA 1N8JA 2H0HA 1GNWA 5ECQB 3G7JA 2JACA 2CAIA 4ULXA 3ZYWA 5JCWA 1T8EB 1T3BA 4RI6A 3TUEA 3GKXA 3K8NA 3M1GA 1QUWA 4O7HA 2CQ9A 2N5BA 2V32A 1MD4A 1ILOA 2L4QA 4PX1A 3MYDA 1A2MA 4TXVA 1S3DA 4N10A 1PA3A 1R4WA 2F8AA 5EL8A 2A2RA 3D21A 3QPMA 5KN0A 1EWXA 5D9WA 3PINA 1TU7A 5F05A 2DIYA 4IS0A 5EY6A 2QC7A 18GSA 3UMAA 4G0KA 3F8UA 3VWWA 3LYKA 1K3YA 1S3CA 2G2QA 1TK5B 5B8BA 4OWYA 1W89A 1K3OA 1M2BA 1SKSB 1JFUA 3KZQA 2FWFA 5DJMA 3C1SA 5IO2A 4OFTA 17GSA 4L0UA 2HNLA 3UJ1A 3L4NA 3GFKA 5AIXA 3VPQA 3I6AA 2XBQA 2X4AA 5F0GA 2GTUA 2F9SA 1WJKA 1TKDB 4IW9A 4IP1A 4D73B 1Q98A 2WZ9A 2A4HA 1K0DA 4IGJA 4MF7A 5DJLA 3FHKA 1EGRA 1BAYA 1EV9A 3KCMA 1HNAA 3G9BA 1M7TA 2K6VA 2H74A 1BEDA 2VM2A 3VK9A 2WB9A 3Q18A 1SL2B 5D93A 2IMEA 1GSSA 2WS2A 1GSEA 19GSA 2LQOA 3FR9A 1FB0A 1OE8A 4PQIA 4MMMA 2H6ZA 2IFQB 1A8LA 3HJPA 1SKRB 4YQUA 5KEJA 3TGZA 4IQ1A 2WRTA 2DJJA 3IC4A 3MSZA 2YJ7A 2PWJA 3US3A 2EIRA 5ECRB 2IWTA 4F82A 1EZKA 2LS5A 2R0PA 3TKPA 5G30A 4MDCA 5BMUA 2H76A 3TKRA 2GSSA 4F0BA 3P90A 2VO4A 1Z9HA 4I6XA 4DSQA 2KHPA 4Q5NA 4BVYB 2YANA 4TOPA 2VAFA 2DJ1A 2WDUA 4ACSA 4FIWA 3BOAA 4IELA 3UIWA 4PTSA 3VWVA 3QAVA 5CRDA 1GLQA 3IR4A 1OVNA 3APOA 4WKWA 1V2AA 2PUKC 5AIVA 1O73A 5IMCA 1ERUA 3UL3A 3C8EA 4TXOB 3L9UA 4I8BA 4IHUA 3ZL5A 4HU7A 2MMNA 1Q4JA 4WEYA 2C4JA 2GQLA 1TRSA 2BTOT 5D9TA 2F8FA 1TRUA 2V41A 3IBHA 1QFNA 1A8YA 5H5RA 1M2AA 1U6TA 2HRAA 4KSMA 2P5QA 5CAXA 2OE0A 3D22A 3PH9A 2HZEB 2FUG2 5F06A 1DBYA 1YF0A 2BMXA 2RM5A 1EEJA 3UVHA 1ON4A 2LTKA 4KB3A 2L4CA 3IOSA 1I9DA 2DJ3A 3GIXA 1XXUA 3H93A 3HXSA 5JCGA 4HJMA 5CREA 2L59A 5JWQB 4J57E 4HZ4A 3TJJA 2NVLA 5INYA 6GSTA 3F6DA 1C72A 1MDIA 1Z7PA 4BWQA 2C0EA 1SJIA 4BL7A 2REMA 1YF1A 6GSYA 3ZFBA 1GL8A 3DKSA 1IYIA 4EIQA 2KOKA 1GH2A 3FZ4A 4NHZA 2OACA 2C3TA 4PQ1A 1BJXA 2JSZA 1B9XC 2R37A 1A23A 2TRXA 1K0AA 3GSSA 5COHA 4KW6A 4ECIA 1PGTA 4POMA 1WIKA 4H86A 3W8JA 2CX3A 2PVQA 4XHMA 1Y6EA 1AQWA 4G0IA 3E3EA 3F4SA 2IFQA 2DJ2A 1TRVA 2B7JA 1ZYPA 5J41A 4Q5FA 4GSTA 2H72A 4I2TA 5B8AA 3F6FA 4TW5A 1SD9A 2C1YA 4ZB6A 1X5CA 1SK1A 4EVMA 3UARA 1X5DA 3GH9A 4N0ZA 3KP8A 3MDKA 3APSA 3CTGA 2GDRA 2IMKA 3HVSA 4GRFA 4WF5A 2MMOA 1URMA 2E0QA 2GZPA 4HUAA 4OO5A 1UC7A 5FHIA 3HCZA 4NXIA 4KDXA 4POLA 3J7Yb 2ON5A 2YWOA 4HZ2A 1F3AA 3LEFA 1O6JA 2XPDA 4HOJA 2GSTA 2AHEA 4QQ7A 1TI1A 3FW2A 4Q5QA 3TB2A 2PU9C 2GQKA 5J9CA 2HYXA 3DEXA 1MDJA 1SK0A 2QA2A 1U3AA 1THXA 3TKQA 2PN8A 3L9VA 1TK8B 2FWHA 2TIRA 3EYTA 1SJ6A 2KP2A 4ZBDA 4EC0A 2C80A 5HQPA 2HZEA 4IN0A 1K0CA 3EINA 4LLRA 4TN8A 3GKNA 1PL1A 2H0IA 3A2VA 3GNJA 2J23A 2X99A 5DCHA 4V2NA 2I3YA 1XWKA 5G5FA 1NM3A 3QOUA 4ILFA 5GAPD 4FYUA 3HY2A 2QA1A 2QKEA 2N5AA 4MNNA 1SYRA 4YQMA 5DCGA 1YEPA 2GT5A 3WGXA 2YWMA 1BX9A 2KP1A 3KD0A 4ML1A 3M9KA 1PSQA 4KNDA 4EDZA 4EF0A 4GSSA 3GKKA 3M3MA 4N0VA 5FWGA 5AN1A 2H71A 3VI5A 5ECPB 2L5LA 3D5JA 1YQ1A 2DJKA 4BPYA 2VOCA 5HFGA 5F8BA 2ALBA 4O92A 1PD21 1GUHA 1J9BA 2WJUA 4K2DA 4AJ8A 4ECJA 1TU8A 5C04A 3IK9A 2L6DA 3FY7A 4BVXA 2DJ0A 3HVVA 3HJMA 3RPNA 2OE3A 2NDOA 4OCEA 5BRTA 1GSYA 5A4VA 3TKSC 4JR4A 4X1UA 3KEBA 2CT6A 3DIEA 1FVKA 1OYJA 2MMZA 4Z2UA 1WP0A 4X4JA 4ZIJA 3O76A 5A4WA 1UA5A 1MD3A 2LV3A 1DE2A 2EIQA 3F9UA 1GWCA 1LJRA 2DC5A 2HSMA 1T4YA 4KAEA 2VL3A 1FO5A 2UZ8A 2AJQB 2R0GA 2VD1A 4NHWA 4JZQA 6GSXA 1M9BA 1RW1A 1V40A 1PN0A 3FZ5A 4TR4A 3IHQA 5ECKB 1O81A 2VCQA 3JCML 1YJ6A 3QMXA 1OC9A 4XS1A 1QXHA 1T00A 3QAGA 5IMVA 1X5EA 1RK4A 1USBA 1ST9A 2FY6A 5JWOB 2V1MA 5E4WA 1YZXA 1QK8A 1A0RP 3HVXA 3GTUB 2NTOA 2CZ3A 3IV4A 4MP4A 3TJFA 3BCKA 1ZYQB 5IIZA 4XRDA 3HA9A 3NOFA 3DWVA 2CAQA 1FOHA 4V1Ap 5ECHB 2XHFA 2YPMA 1SU9A 1UN2A 4Q5RA 3HZ4A 1B8XA 2XPEA 2OJLA 3W8SA 1FW1A 4TR0A 4CHSA 3TRXA 4FH8A 3A2XA 1DE1A 5G5EA 1O8XA 3ZVJD 3L0HA 4ZBBA 4MLYA 2HSHA 2V2GA 2GLRA 2H1DA 3PR8A 2R6KA 5D96A 1ZYNA 1HD2A 3M9JA 1TK0B 2HSYA 4PURA 2N5FA 1WOUA 5B6MA 1X9SB 3GL5A 5KOXA 4HEA2 20GSA 4XS6A 4POBA 5DAKA 2JL4A 2ZCTA 3CYNA 4XS4A 1JZOA 4CW9A 3UVTA 2EC4A 4Z7XA 2OBIA 3MNGA 4FYBA 4YKFA 5FT3A 1ZOFA 1I5GA 3TRQA 3EE2A 3ED3A 2C0GA 2A2PA 5KN2A 2VD0A 4WETA 3E9JB 2FD3A 2JSYA 3CMIA 4MZCA 1NSWA 2BJXA 3IAM2 4ZB8A 2L5OA 4YAPA 4CY6A 2KUCA 8GSSA 4QL7A 5KN3A 4ZXGA 1X9WB 1GTBA 1ML6A 1QMVA 4MPFA 1SL0B 1GUMA 2FA4A 3GUSA 3PGTA 2IMDA 4IP6A 4RUVA 3I69A 1XVQA 2YZHA 5LCZA 3GX0A 3LW9A 5H5SA 4HJ2A 1TP9A 4G19A 1V57A 1SJZA 2LRNA 1M0UA 2CZ2A 3PPUA 4P3YB 1TRWA 1XCCA 3GL3A 2CVDA 1X9MB 4PUAA 5D9XA 3QFBC 4HQZA 3FR6A 5CO3A 1G0TA 1AQVA 3GHAA 4PGTA 2OE1A 4KGIA 3ZREA 1XW5A 3U5RE 1GTUA 1HNCA 3QAWA 4L5LA 3EC3A 1R7HA 2O7KA 3KIJA 4FO5A 1U87A 4WXTA 3TJBA 2Z9SA 1K0OA 4IBPA 3Q6OA 3IC8A 5CRGA 2I9HA 5DBQA 2MBTA 1JZDA 2DMLA 4FYCA 5ECMB 2A2SA 2AAWA 3IA1A 4K6XA 2LUSA 4ZBAA 1MTCA 5DDLA 4K2XA 4LL1B 1SYXA 4KF9A 5IMFA 1O85A 1B4PA 4ZB9A 4G0LA 2IIYA 1VRSD 2HXKA 5G1LA 1SD8A 3RAZA 1AW9A 2C8UA 1E6BA 1TXXA 1EOGA 3IPZA 1AQXA 2VL2C 2JZRA 2D2ZA 1G7EA 2GQMA 2M72A 1T4ZA 1A24A 5KOWA 2YJHA 3GX8A 1XWBA 3EPTA 3TOUA 3AY8A 3GH6A 3DRNA 3IXRA 2H1GA 3L78A 4POKA 2H6YA 4XTSA 4ZL8A 1ZYEA 1TI3A 2CV4A 5J3RA 2WULA 3ZTLA 4D73A 3KH7A 5IOWA 2YWIA 4HU9A 4Z2TA 3DVXA 5IO0A 3LJRA 1GLPA 1A0FA 1WPIA 4HQSA 2B5EA 1W4VA 1B48A 4NV2A 3E0UA 2FCHA 4GQCA 3N9JA 4L8EA 1GSDA 3Q74A 5ID2B 3UEMA 3FK8A 3QFAC 4ML6A 4KCEA 2J9HA 2DKIA 4PQHA 4OFNA 3RBTA 1OKDA 2R0CA 3F3RA 3WT1A 3ZRDA 2LJKA 2HRFA 1F9MA 4EO3A 13GSA 5D9VA 1XFLA 4AJ6A 2B1KA 5EPFA 5CRWA 4EE0A 4MK3A 2PMTA 1QGVA 2FNOA 5G31A 5IPHA 1U88A 2H1AA 3GA4A 2X8GA 1XWGA 6GSUA 4KA0A 3IRAA 2CVKA 2C3NA 2LRTA 4L5OA 1K3LA 1U3IA 4TR1B 2YZUA 3QDNA 3VURA 2G0FA 2HT9A 5HFKA 4TR3A 3IHGA 5DQYA 1ZMAA 2H1BA 4MJBA 3HDCA 3KTBA 1B4QA 2VCTA 3LGCA 2LNSA 3C1RA 2GSRA 1V58A 4IVFA 1PKWA 1NW2A 4BVYA 3FZAA 3KJYA 5D8IA 1ERVA 2HZFA 1Z6NA 3VPTA 3WYWA 3ZMKA 2O8VB 2GS3A 2R5GA 3G7YA 4N11A 4NV5A 1V9WA 4TVEA 5ECSA 5F07A 3ISOA 4PNGA 3NIVA 2RM6A 4EUYA 5GAND 4K7OA 1M9AA 2GGTA 3VWXA 4TXOA 4O5QA 3TCOA 1SKWB 2RIIA 2LJRA 3MWHA 5GZZB 3BCIA 2I4AA 4E8EA 2H70A 2H0GA 3GKMA 1FOVA 2H01A 3KP9A 1G6YA 1THOA 4ZL7A 4DVCA 4JU5A 2FWGA 5H5QA 1H4OA 1V98A 3IK7A 3RHBA 1SK2A 3KTLA 3HJOA 3LG6A 4I2UA 3O3TA 3SBCA 3ZIJA 5DQSA 2X49A 4NAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMW A;  3UOM A;  1YKC A;  1OC8 A;  2K9F A;  3KMO A;  6GSW A;  5J9B A;  4K0N A;  3QCP A;  1YDK A;  4MAB A;  3DVW A;  1GP1 A;  1LBK A;  4JR6 A;  4AJ7 A;  12GS A;  2IJY A;  3ZLP A;  4L0W A;  5L71 A;  1GSU A;  4OFM A;  1JLW A;  1F37 A;  2E7P A;  3I43 A;  4K0G A;  2F3M A;  4KDY A;  2L6C A;  3FZ9 A;  4OO4 A;  3HZ8 A;  1NHO A;  4PUF C;  3IAS 2;  1VGL A;  3HYP A;  2VCZ A;  2YP6 A;  5J5N A;  4X43 A;  1OKT A;  1PQN A;  4KUN A;  3FR3 A;  3VI7 A;  1JLV A;  2VUP A;  5LD0 A;  2HE3 A;  4MH2 A;  2B7K A;  3A2W A;  2H19 A;  4GLT A;  1XWA A;  2P0G A;  4F0C A;  4PNF A;  5DAL B;  1EEM A;  1SL1 B;  2K8V A;  3ME7 A;  1TJD A;  3EU4 A;  5JWR B;  14GS A;  3P7X A;  4EXJ A;  3M8N A;  1FVJ A;  4GQF A;  4MZB A;  5GST A;  2AUV A;  3ZIV A;  3CXG A;  5ECN B;  4RQX A;  1BG5 A;  3ZFL A;  2LKU A;  4MF5 A;  4I97 A;  1HQO A;  3RPP A;  2ES7 A;  2XC2 A;  1DSB A;  3QD9 A;  5GSS A;  1VF1 A;  1H75 A;  2DMM A;  2NPB A;  1UVZ A;  4BWS A;  2YOI A;  5ECO B;  2DIZ A;  1AXD A;  1AC1 A;  1N2A A;  3GST A;  4WR4 A;  4OCF A;  3M0F A;  5DVB A;  3R2Q A;  2E2G A;  3WGD A;  4GTU A;  2O89 A;  1E2Y A;  1GTA A;  1FB6 A;  2IMF A;  3F0I A;  4GF0 A;  3GMF A;  2VLU A;  1PX6 A;  1R5P A;  3GRX A;  3TRP A;  1WWJ A;  2HI7 A;  1TDI A;  1OE7 A;  1PX7 A;  3EUR A;  1XOB A;  4F03 A;  5AIS A;  2P5R A;  2B6M A;  3A3T A;  2ZNM A;  3H4K A;  3OR5 A;  5KN1 A;  1VF3 A;  2GVP A;  2IPA A;  3GUR A;  2C3Q A;  1XOA A;  4O32 A;  3WD6 A;  1PRX A;  2YN1 A;  3EVI A;  1FG4 A;  1ERT A;  2DLX A;  4MPG A;  3EWL A;  1XW9 A;  3KMN A;  3C71 A;  3KXO A;  1HYU A;  5CYY A;  2VL2 A;  4RQR A;  1JZW A;  2LQQ A;  4OMV A;  4YQV A;  5HR2 A;  2VCV A;  4GXZ A;  3DXB A;  6GSV A;  2R3X A;  4AF2 A;  2VLT A;  5A5K A;  2ON7 A;  2VCW A;  4JBB A;  3LXZ A;  5G2Z A;  3HD5 A;  3F63 A;  1TTZ A;  3F4R A;  22GS A;  4NPB A;  3O6T A;  4CDO A;  5ELA A;  3LFL A;  4YH2 A;  5D73 A;  3TJG A;  3SWL A;  1YKA A;  4EDY A;  4TKY A;  1ERW A;  2B1L A;  5ECI B;  3GV1 A;  4F2I A;  3C7M A;  5ECL B;  1AAZ A;  3D6I A;  3ERW A;  2P31 A;  2FLS A;  1O8W A;  5ENU A;  2R2J A;  1Z5Y E;  1X0R A;  3H8Q A;  5IM9 A;  1GUK A;  4O5R A;  2O87 A;  5IMA A;  2H75 A;  4ECC A;  1HNB A;  5IMD A;  3BBY A;  3A5W A;  3EU3 A;  1R26 A;  4RI7 A;  3C73 A;  1WRY A;  3APQ A;  4GCI A;  6GSS A;  4J56 E;  1MDK A;  1OC3 A;  4G10 A;  4V1A g;  2X64 A;  4EKZ A;  5DAL A;  4K7I A;  5C00 A;  3ZZX A;  4DSS B;  3RDW A;  4JRR A;  1CQH A;  1B9Y C;  2V6O A;  5HR3 A;  1VF2 A;  4JE1 A;  3ZML A;  4MJC A;  1ZGN A;  4TRX A;  2YCD A;  1PL2 A;  2B5Y A;  1GUL A;  2LJA A;  3WT2 A;  3CSJ A;  1M99 A;  2FGX A;  1WE0 A;  2GT6 A;  4KCA A;  2L57 A;  4GSN A;  1BQ7 A;  1QQ2 A;  2PVO C;  2VLV A;  3LYP A;  2LEG A;  5B7C A;  2R4V A;  2M46 A;  4ZIL A;  1EP7 A;  3GTU A;  1R5A A;  1GNE A;  2YNX A;  1EP8 A;  4MZW A;  2F51 A;  9GSS A;  1IYH A;  4KH7 A;  1AIU A;  3I9V 2;  3IDV A;  3ZIT A;  1O7U A;  1G7O A;  3DYR A;  3S9F A;  3WGE A;  4MCU A;  1F2E A;  4KE3 A;  1ABA A;  5J4U A;  1JHB A;  3CSI A;  4MA9 A;  5HR1 A;  4KX4 A;  2O85 A;  3L9S A;  2IL3 A;  3VFI A;  2GZY A;  3RHC A;  1CQG A;  3KM6 A;  4MH3 A;  5E59 A;  3VWU A;  3EMX A;  2H6X A;  2JAD A;  2K8S A;  4XIH A;  1PMT A;  3ERF A;  5CP1 A;  2MMA A;  3VLN A;  3UBK A;  5ABR A;  5JCU A;  3FKF A;  2MBS A;  4LA1 A;  1XPV A;  4MJE A;  4N30 A;  1RQM A;  3CRU A;  1GSF A;  3DGQ A;  2B5X A;  2PBJ A;  1LU4 A;  3LXT A;  4K7N A;  3BD2 A;  10GS A;  4NWY A;  3J7Y k;  3UAP A;  3KGK A;  4LL4 B;  2RUE A;  4IQA A;  3CRT A;  1KEB A;  1K0N A;  1G6W A;  4IKH A;  3D4T A;  3TJK A;  3TOT A;  3ME8 A;  1SEN A;  2WGR A;  2X8C A;  4JED A;  4WF4 A;  2IN3 A;  3FEU A;  4V2M A;  3LWA A;  2JZS A;  2PGT A;  2OA7 A;  4ECB A;  2PPT A;  2MYG A;  2H30 A;  3TKS A;  2GSQ A;  2YV7 A;  3GN3 A;  5CNW A;  5IQY A;  2HRN A;  2MZC A;  4WBJ A;  2AYT A;  4GWR A;  3FYG A;  7GSS A;  1XBS A;  2V6K A;  1KTE A;  4WBR D;  2VM1 A;  2WFC A;  2B3S A;  4ISD A;  2VIM A;  2OKA A;  2C0D A;  2E2M A;  2KLX A;  4PXO A;  2QGV A;  4G2E A;  1GRX A;  3UBL A;  4I5Q A;  1AUC A;  4HI7 A;  1FHE A;  2RUF A;  4DSS A;  1OC9 B;  3CBU A;  1ZL9 A;  4YAV A;  1TW9 A;  4KDU A;  3U6V A;  4MF6 A;  4IJI A;  1JZR A;  3LQ7 A;  1F3B A;  3TKS E;  2H8L A;  4MJA A;  1TOF A;  3D4M A;  5IOX A;  1J0F A;  1A2L A;  1YEX A;  4AGS A;  2H66 A;  1A2J A;  1M2D A;  1BYE A;  2I81 A;  1OAZ A;  1XVW A;  3HKR A;  1KBN A;  3ERG A;  3Q19 A;  5LNK e;  5G1K A;  2LNT A;  16GS A;  4WR5 A;  4X0X A;  4G9H A;  3D0Z A;  2H73 A;  2JZT A;  2JU5 A;  2OBK A;  1F6M C;  3CTF A;  4IJ3 A;  1EV4 A;  3LSZ A;  5B6N A;  2CVB A;  4XCS A;  1XW6 A;  2I1U A;  3F4T A;  3F3Q A;  4ID0 A;  2QSI A;  2PER A;  4XRA A;  3EMP A;  1MEK A;  2VCX A;  1XWC A;  3GYK A;  5HFI A;  11GS A;  4K1F A;  1GTI A;  1GSQ A;  1PN9 A;  5HR0 A;  2FA8 A;  3P8W A;  4V2L A;  4NMU A;  1K0B A;  1Z6M A;  5A4U A;  3DML A;  4HS1 A;  2VL9 A;  4EL1 A;  5EVO A;  2TRC P;  1EGO A;  1J08 A;  2NBS A;  3QR6 A;  4HDE A;  5DAK B;  3IE3 A;  4K9Z A;  3W6G A;  3MAK A;  2ZUP A;  4KSO A;  4BA7 A;  5IMZ A;  4XS4 B;  2DSA A;  2YWN A;  3NZN A;  4E8H A;  1T1V A;  3LOR A;  2GZZ A;  3HHV A;  2OAD A;  3V1W A;  2CX4 A;  3DD3 A;  2M80 A;  2AB6 A;  1XZO A;  1FAA A;  2FHE A;  4OD7 A;  2RLI A;  5ID2 A;  1EOH A;  2LST A;  1DUG A;  1K0M A;  3N5O A;  1VF4 A;  2CA8 A;  2C0F A;  3ZVJ A;  4QL9 A;  2YV9 A;  2DBC A;  2EIO A;  2K18 A;  5ELG A;  1ZZY A;  2LRC A;  4F9Z A;  4DSR A;  4J2F A;  1YY7 A;  1Z7R A;  1XIY A;  3H79 A;  1Z3E A;  2HFD A;  3BJ5 A;  2X8H A;  2WCI A;  1ACV A;  5IPG A;  4LMV A;  1KNG A;  1T7P B;  2FWE A;  3FRC A;  1ZCP A;  1S3A A;  2A4V A;  3G7I A;  1NHY A;  4K8M A;  3CSH A;  1WMJ A;  2XBI A;  3H1N A;  1PKZ A;  4TR1 A;  2AV4 A;  3KH9 A;  2IMI A;  5AGY A;  3P2A A;  4ZL9 A;  4DEJ A;  1Y25 A;  5CRH A;  2HLS A;  3TDG A;  1N8J A;  2H0H A;  1GNW A;  5ECQ B;  3G7J A;  2JAC A;  2CAI A;  4ULX A;  3ZYW A;  5JCW A;  1T8E B;  1T3B A;  4RI6 A;  3TUE A;  3GKX A;  3K8N A;  3M1G A;  1QUW A;  4O7H A;  2CQ9 A;  2N5B A;  2V32 A;  1MD4 A;  1ILO A;  2L4Q A;  4PX1 A;  1A2M A;  4TXV A;  1S3D A;  4N10 A;  1PA3 A;  1R4W A;  2F8A A;  5EL8 A;  2A2R A;  3D21 A;  3QPM A;  5KN0 A;  1EWX A;  5D9W A;  3PIN A;  1TU7 A;  5F05 A;  2DIY A;  4IS0 A;  5EY6 A;  2QC7 A;  18GS A;  3UMA A;  3F8U A;  3VWW A;  3LYK A;  1K3Y A;  1S3C A;  2G2Q A;  1TK5 B;  5B8B A;  4OWY A;  1W89 A;  1K3O A;  1M2B A;  1SKS B;  1JFU A;  3KZQ A;  2FWF A;  5DJM A;  3C1S A;  5IO2 A;  4OFT A;  17GS A;  4L0U A;  2HNL A;  3UJ1 A;  3L4N A;  3GFK A;  5AIX A;  3VPQ A;  3I6A A;  2XBQ A;  5F0G A;  2GTU A;  2F9S A;  1WJK A;  1TKD B;  4IW9 A;  4IP1 A;  4D73 B;  1Q98 A;  2WZ9 A;  1K0D A;  4IGJ A;  4MF7 A;  5DJL A;  3FHK A;  1EGR A;  1BAY A;  1EV9 A;  3KCM A;  1HNA A;  3G9B A;  1M7T A;  2K6V A;  2H74 A;  1BED A;  2VM2 A;  3VK9 A;  2WB9 A;  3Q18 A;  1SL2 B;  5D93 A;  2IME A;  1GSS A;  2WS2 A;  1GSE A;  19GS A;  2LQO A;  3FR9 A;  1FB0 A;  1OE8 A;  4PQI A;  4MMM A;  2H6Z A;  2IFQ B;  1A8L A;  3HJP A;  1SKR B;  4YQU A;  5KEJ A;  3TGZ A;  4IQ1 A;  2WRT A;  2DJJ A;  3IC4 A;  3MSZ A;  2YJ7 A;  2PWJ A;  3US3 A;  2EIR A;  5ECR B;  2IWT A;  4F82 A;  1EZK A;  2LS5 A;  3TKP A;  5G30 A;  4MDC A;  2H76 A;  3TKR A;  2GSS A;  4F0B A;  3P90 A;  2VO4 A;  1Z9H A;  4I6X A;  4DSQ A;  2KHP A;  4Q5N A;  2YAN A;  4TOP A;  2VAF A;  2DJ1 A;  2WDU A;  4ACS A;  4FIW A;  3BOA A;  4IEL A;  3UIW A;  3VWV A;  3QAV A;  5CRD A;  1GLQ A;  3IR4 A;  1OVN A;  3APO A;  4WKW A;  1V2A A;  2PUK C;  5AIV A;  1O73 A;  5IMC A;  1ERU A;  3UL3 A;  3C8E A;  4TXO B;  3L9U A;  4I8B A;  4IHU A;  3ZL5 A;  4HU7 A;  2MMN A;  1Q4J A;  4WEY A;  2C4J A;  2GQL A;  1TRS A;  2BTO T;  5D9T A;  2F8F A;  1TRU A;  2V41 A;  3IBH A;  1QFN A;  1A8Y A;  5H5R A;  1M2A A;  1U6T A;  4KSM A;  2P5Q A;  5CAX A;  2OE0 A;  3D22 A;  3PH9 A;  2HZE B;  2FUG 2;  5F06 A;  1DBY A;  1YF0 A;  2BMX A;  2RM5 A;  1EEJ A;  3UVH A;  1ON4 A;  2LTK A;  4KB3 A;  2L4C A;  3IOS A;  1I9D A;  2DJ3 A;  3GIX A;  1XXU A;  3H93 A;  3HXS A;  5JCG A;  4HJM A;  5CRE A;  2L59 A;  5JWQ B;  4J57 E;  4HZ4 A;  3TJJ A;  2NVL A;  5INY A;  6GST A;  3F6D A;  1C72 A;  1MDI A;  1Z7P A;  4BWQ A;  2C0E A;  1SJI A;  4BL7 A;  2REM A;  1YF1 A;  6GSY A;  3ZFB A;  1GL8 A;  3DKS A;  1IYI A;  2KOK A;  1GH2 A;  3FZ4 A;  4NHZ A;  2OAC A;  2C3T A;  4PQ1 A;  1BJX A;  2JSZ A;  1B9X C;  2R37 A;  1A23 A;  2TRX A;  1K0A A;  3GSS A;  5COH A;  4KW6 A;  4ECI A;  1PGT A;  4POM A;  1WIK A;  4H86 A;  3W8J A;  2CX3 A;  2PVQ A;  4XHM A;  1Y6E A;  1AQW A;  3E3E A;  3F4S A;  2IFQ A;  2DJ2 A;  1TRV A;  2B7J A;  5J41 A;  4Q5F A;  4GST A;  2H72 A;  4I2T A;  5B8A A;  3F6F A;  4TW5 A;  1SD9 A;  2C1Y A;  4ZB6 A;  1X5C A;  1SK1 A;  4EVM A;  3UAR A;  1X5D A;  3GH9 A;  4N0Z A;  3KP8 A;  3MDK A;  3APS A;  3CTG A;  2GDR A;  2IMK A;  3HVS A;  4GRF A;  4WF5 A;  2MMO A;  1URM A;  2E0Q A;  2GZP A;  4HUA A;  4OO5 A;  1UC7 A;  5FHI A;  3HCZ A;  4NXI A;  4KDX A;  4POL A;  3J7Y b;  2ON5 A;  2YWO A;  4HZ2 A;  1F3A A;  3LEF A;  1O6J A;  2XPD A;  4HOJ A;  2GST A;  2AHE A;  4QQ7 A;  1TI1 A;  3FW2 A;  4Q5Q A;  3TB2 A;  2PU9 C;  2GQK A;  5J9C A;  2HYX A;  3DEX A;  1MDJ A;  1SK0 A;  1U3A A;  1THX A;  3TKQ A;  2PN8 A;  3L9V A;  1TK8 B;  2FWH A;  2TIR A;  3EYT A;  1SJ6 A;  2KP2 A;  4ZBD A;  4EC0 A;  2C80 A;  5HQP A;  2HZE A;  4IN0 A;  1K0C A;  3EIN A;  4LLR A;  4TN8 A;  3GKN A;  1PL1 A;  2H0I A;  3A2V A;  3GNJ A;  2J23 A;  2X99 A;  5DCH A;  4V2N A;  2I3Y A;  1XWK A;  5G5F A;  1NM3 A;  3QOU A;  4ILF A;  5GAP D;  4FYU A;  3HY2 A;  2QKE A;  2N5A A;  1SYR A;  4YQM A;  5DCG A;  1YEP A;  2GT5 A;  3WGX A;  2YWM A;  1BX9 A;  2KP1 A;  3KD0 A;  4ML1 A;  3M9K A;  1PSQ A;  4KND A;  4EDZ A;  4EF0 A;  4GSS A;  3GKK A;  3M3M A;  4N0V A;  5FWG A;  5AN1 A;  2H71 A;  3VI5 A;  5ECP B;  2L5L A;  3D5J A;  1YQ1 A;  2DJK A;  4BPY A;  2VOC A;  5HFG A;  5F8B A;  2ALB A;  4O92 A;  1PD2 1;  1GUH A;  1J9B A;  2WJU A;  4K2D A;  4AJ8 A;  4ECJ A;  1TU8 A;  5C04 A;  3IK9 A;  2L6D A;  3FY7 A;  4BVX A;  2DJ0 A;  3HVV A;  3HJM A;  3RPN A;  2OE3 A;  2NDO A;  4OCE A;  1GSY A;  5A4V A;  3TKS C;  4JR4 A;  4X1U A;  3KEB A;  2CT6 A;  3DIE A;  1FVK A;  1OYJ A;  2MMZ A;  1WP0 A;  4ZIJ A;  3O76 A;  5A4W A;  1UA5 A;  1MD3 A;  2LV3 A;  1DE2 A;  2EIQ A;  3F9U A;  1GWC A;  1LJR A;  2DC5 A;  1T4Y A;  4KAE A;  2VL3 A;  1FO5 A;  2AJQ B;  2VD1 A;  4NHW A;  4JZQ A;  6GSX A;  1M9B A;  1RW1 A;  1V40 A;  3FZ5 A;  4TR4 A;  3IHQ A;  5ECK B;  1O81 A;  2VCQ A;  3JCM L;  1YJ6 A;  3QMX A;  1OC9 A;  4XS1 A;  1QXH A;  1T00 A;  3QAG A;  5IMV A;  1X5E A;  1RK4 A;  1USB A;  1ST9 A;  2FY6 A;  5JWO B;  2V1M A;  5E4W A;  1YZX A;  1QK8 A;  1A0R P;  3HVX A;  3GTU B;  2NTO A;  2CZ3 A;  3IV4 A;  4MP4 A;  3TJF A;  3BCK A;  1ZYQ B;  5IIZ A;  4XRD A;  3HA9 A;  3NOF A;  3DWV A;  2CAQ A;  4V1A p;  5ECH B;  2XHF A;  2YPM A;  1SU9 A;  1UN2 A;  4Q5R A;  3HZ4 A;  1B8X A;  2XPE A;  2OJL A;  3W8S A;  1FW1 A;  4TR0 A;  4CHS A;  3TRX A;  4FH8 A;  3A2X A;  1DE1 A;  5G5E A;  1O8X A;  3ZVJ D;  3L0H A;  4ZBB A;  4MLY A;  2HSH A;  2V2G A;  2GLR A;  2H1D A;  3PR8 A;  2R6K A;  5D96 A;  1HD2 A;  3M9J A;  1TK0 B;  2HSY A;  4PUR A;  2N5F A;  1WOU A;  5B6M A;  1X9S B;  3GL5 A;  4HEA 2;  20GS A;  4XS6 A;  4POB A;  5DAK A;  2JL4 A;  2ZCT A;  3CYN A;  4XS4 A;  1JZO A;  4CW9 A;  3UVT A;  2EC4 A;  4Z7X A;  2OBI A;  3MNG A;  4FYB A;  5FT3 A;  1ZOF A;  1I5G A;  3TRQ A;  3EE2 A;  3ED3 A;  2C0G A;  5KN2 A;  2VD0 A;  4WET A;  3E9J B;  2FD3 A;  2JSY A;  3CMI A;  4MZC A;  1NSW A;  2BJX A;  3IAM 2;  4ZB8 A;  2L5O A;  4YAP A;  2KUC A;  8GSS A;  4QL7 A;  5KN3 A;  4ZXG A;  1X9W B;  1GTB A;  1ML6 A;  1QMV A;  4MPF A;  1SL0 B;  1GUM A;  2FA4 A;  3GUS A;  3PGT A;  2IMD A;  4IP6 A;  4RUV A;  3I69 A;  1XVQ A;  2YZH A;  5LCZ A;  3GX0 A;  5H5S A;  4HJ2 A;  1TP9 A;  4G19 A;  1V57 A;  1SJZ A;  2LRN A;  1M0U A;  2CZ2 A;  4P3Y B;  1TRW A;  1XCC A;  3GL3 A;  2CVD A;  1X9M B;  4PUA A;  5D9X A;  3QFB C;  4HQZ A;  3FR6 A;  5CO3 A;  1G0T A;  1AQV A;  3GHA A;  4PGT A;  2OE1 A;  4KGI A;  3ZRE A;  1XW5 A;  3U5R E;  1GTU A;  1HNC A;  3QAW A;  4L5L A;  3EC3 A;  1R7H A;  2O7K A;  3KIJ A;  4FO5 A;  1U87 A;  4WXT A;  3TJB A;  2Z9S A;  1K0O A;  4IBP A;  3Q6O A;  5CRG A;  2I9H A;  5DBQ A;  2MBT A;  1JZD A;  2DML A;  4FYC A;  5ECM B;  2A2S A;  2AAW A;  3IA1 A;  4K6X A;  2LUS A;  4ZBA A;  1MTC A;  5DDL A;  4LL1 B;  1SYX A;  5IMF A;  1O85 A;  1B4P A;  4ZB9 A;  2IIY A;  1VRS D;  2HXK A;  5G1L A;  1SD8 A;  3RAZ A;  1AW9 A;  2C8U A;  1E6B A;  1TXX A;  1EOG A;  3IPZ A;  1AQX A;  2VL2 C;  2JZR A;  2D2Z A;  1G7E A;  2GQM A;  2M72 A;  1T4Z A;  1A24 A;  2YJH A;  3GX8 A;  1XWB A;  3TOU A;  3AY8 A;  3GH6 A;  3DRN A;  3IXR A;  2H1G A;  3L78 A;  4POK A;  2H6Y A;  4XTS A;  4ZL8 A;  1ZYE A;  1TI3 A;  2CV4 A;  5J3R A;  2WUL A;  3ZTL A;  4D73 A;  3KH7 A;  5IOW A;  2YWI A;  4HU9 A;  3DVX A;  5IO0 A;  3LJR A;  1GLP A;  1A0F A;  1WPI A;  4HQS A;  2B5E A;  1W4V A;  1B48 A;  4NV2 A;  3E0U A;  2FCH A;  4GQC A;  3N9J A;  4L8E A;  1GSD A;  3Q74 A;  5ID2 B;  3UEM A;  3FK8 A;  3QFA C;  4ML6 A;  4KCE A;  2J9H A;  4PQH A;  4OFN A;  3RBT A;  1OKD A;  3F3R A;  3WT1 A;  3ZRD A;  2LJK A;  2HRF A;  1F9M A;  4EO3 A;  13GS A;  5D9V A;  1XFL A;  4AJ6 A;  2B1K A;  5EPF A;  5CRW A;  4EE0 A;  4MK3 A;  2PMT A;  1QGV A;  2FNO A;  5G31 A;  5IPH A;  1U88 A;  2H1A A;  3GA4 A;  2X8G A;  1XWG A;  6GSU A;  4KA0 A;  3IRA A;  2CVK A;  2C3N A;  2LRT A;  4L5O A;  1K3L A;  1U3I A;  4TR1 B;  2YZU A;  3QDN A;  3VUR A;  2G0F A;  2HT9 A;  5HFK A;  4TR3 A;  5DQY A;  1ZMA A;  2H1B A;  4MJB A;  3HDC A;  3KTB A;  1B4Q A;  2VCT A;  3LGC A;  2LNS A;  3C1R A;  2GSR A;  1V58 A;  4IVF A;  1PKW A;  1NW2 A;  4BVY A;  3FZA A;  3KJY A;  5D8I A;  1ERV A;  2HZF A;  1Z6N A;  3VPT A;  3WYW A;  3ZMK A;  2O8V B;  2GS3 A;  2R5G A;  3G7Y A;  4N11 A;  4NV5 A;  1V9W A;  4TVE A;  5ECS A;  5F07 A;  3ISO A;  4PNG A;  3NIV A;  2RM6 A;  4EUY A;  5GAN D;  4K7O A;  1M9A A;  2GGT A;  3VWX A;  4TXO A;  3TCO A;  1SKW B;  2RII A;  2LJR A;  3MWH A;  5GZZ B;  3BCI A;  2I4A A;  4E8E A;  2H70 A;  2H0G A;  3GKM A;  1FOV A;  2H01 A;  3KP9 A;  1G6Y A;  1THO A;  4ZL7 A;  4DVC A;  4JU5 A;  2FWG A;  5H5Q A;  1H4O A;  1V98 A;  3IK7 A;  3RHB A;  1SK2 A;  3KTL A;  3HJO A;  3LG6 A;  4I2U A;  3O3T A;  3SBC A;  3ZIJ A;  5DQS A;  4NAX A; 
#chains in the Genus database with same CATH topology
 4LMW A;  3UOM A;  1YKC A;  1OC8 A;  2K9F A;  3KMO A;  6GSW A;  5J9B A;  4K0N A;  3QCP A;  1YDK A;  4MAB A;  3DVW A;  1GP1 A;  1LBK A;  4JR6 A;  4AJ7 A;  12GS A;  2IJY A;  3ZLP A;  4L0W A;  5L71 A;  1M3I A;  1GSU A;  4OFM A;  1JLW A;  1F37 A;  2E7P A;  3I43 A;  4K0G A;  2F3M A;  4KDY A;  2L6C A;  3FZ9 A;  4OO4 A;  3HZ8 A;  1NHO A;  4PUF C;  3IAS 2;  1VGL A;  3HYP A;  2VCZ A;  2YP6 A;  5J5N A;  4X43 A;  1OKT A;  1PQN A;  4KUN A;  3FR3 A;  4YKG A;  3VI7 A;  1JLV A;  2VUP A;  5LD0 A;  2HE3 A;  4MH2 A;  2B7K A;  3A2W A;  2H19 A;  4GLT A;  1XWA A;  2P0G A;  2DKH A;  4F0C A;  4PNF A;  5DAL B;  1EEM A;  1SL1 B;  2K8V A;  3ME7 A;  1TJD A;  3EU4 A;  5JWR B;  14GS A;  3P7X A;  4EXJ A;  3M8N A;  1FVJ A;  4GQF A;  4MZB A;  5GST A;  2AUV A;  3ZIV A;  3CXG A;  5ECN B;  4RQX A;  1BG5 A;  3ZFL A;  2LKU A;  4MF5 A;  4I97 A;  1HQO A;  3RPP A;  2ES7 A;  2XC2 A;  1DSB A;  1S3R A;  3QD9 A;  5GSS A;  1VF1 A;  1H75 A;  2DMM A;  2NPB A;  1UVZ A;  4BWS A;  2YOI A;  5ECO B;  2DIZ A;  1AXD A;  1AC1 A;  1N2A A;  3GST A;  4WR4 A;  4OCF A;  3M0F A;  5DVB A;  3R2Q A;  2E2G A;  3WGD A;  4GTU A;  2O89 A;  1E2Y A;  1GTA A;  1FB6 A;  2IMF A;  3F0I A;  4GF0 A;  3GMF A;  2VLU A;  1PX6 A;  1R5P A;  3GRX A;  3TRP A;  1WWJ A;  2HI7 A;  1TDI A;  1OE7 A;  1PX7 A;  3EUR A;  1XOB A;  4F03 A;  5AIS A;  2P5R A;  2B6M A;  3A3T A;  2ZNM A;  3H4K A;  3OR5 A;  5KN1 A;  1VF3 A;  2GVP A;  2IPA A;  3GUR A;  2C3Q A;  1XOA A;  4O32 A;  3WD6 A;  1PRX A;  2YN1 A;  3EVI A;  4A5P A;  1FG4 A;  1ERT A;  2DLX A;  4MPG A;  3EWL A;  1XW9 A;  3KMN A;  3C71 A;  3KXO A;  1HYU A;  5CYY A;  2VL2 A;  4RQR A;  1JZW A;  2LQQ A;  4OMV A;  4YQV A;  5HR2 A;  2VCV A;  4GXZ A;  3DXB A;  6GSV A;  2R3X A;  4AF2 A;  2VLT A;  5A5K A;  2ON7 A;  2VCW A;  4BL7 B;  4JBB A;  3LXZ A;  5G2Z A;  3HD5 A;  3F63 A;  1TTZ A;  3F4R A;  22GS A;  4NPB A;  3O6T A;  4CDO A;  5ELA A;  3LFL A;  4YH2 A;  5D73 A;  3TJG A;  3SWL A;  1YKA A;  4EDY A;  4TKY A;  1ERW A;  2B1L A;  5ECI B;  3GV1 A;  4F2I A;  3C7M A;  5ECL B;  1AAZ A;  3D6I A;  3ERW A;  2P31 A;  2FLS A;  1O8W A;  5ENU A;  2R2J A;  1Z5Y E;  1X0R A;  3H8Q A;  5IM9 A;  1GUK A;  4O5R A;  2O87 A;  5IMA A;  2H75 A;  4ICY A;  4ECC A;  1HNB A;  5IMD A;  3BBY A;  3A5W A;  3EU3 A;  1R26 A;  4RI7 A;  3C73 A;  1WRY A;  3APQ A;  4GCI A;  6GSS A;  4J56 E;  4O5U A;  1MDK A;  1OC3 A;  4G10 A;  4V1A g;  2X64 A;  4EKZ A;  5DAL A;  4K7I A;  5C00 A;  3ZZX A;  4DSS B;  4EIP A;  3FMW A;  3RDW A;  4JRR A;  1CQH A;  1B9Y C;  2V6O A;  5HR3 A;  1VF2 A;  4JE1 A;  3ZML A;  4MJC A;  1ZGN A;  4TRX A;  2YCD A;  1PL2 A;  2B5Y A;  1GUL A;  2LJA A;  3WT2 A;  3CSJ A;  1M99 A;  2FGX A;  1WE0 A;  2GT6 A;  4KCA A;  2L57 A;  4GSN A;  1BQ7 A;  1QQ2 A;  2PVO C;  2VLV A;  3LYP A;  2LEG A;  5B7C A;  2R4V A;  2M46 A;  4ZIL A;  1EP7 A;  3GTU A;  1R5A A;  1GNE A;  2YNX A;  1EP8 A;  4MZW A;  2F51 A;  9GSS A;  1IYH A;  4KH7 A;  1AIU A;  3I9V 2;  3IDV A;  3ZIT A;  1O7U A;  1G7O A;  3DYR A;  3S9F A;  3WGE A;  4MCU A;  1F2E A;  4KE3 A;  1ABA A;  5J4U A;  1JHB A;  3CSI A;  4MA9 A;  5HR1 A;  4KX4 A;  2O85 A;  3L9S A;  2IL3 A;  3VFI A;  2GZY A;  3RHC A;  1CQG A;  3KM6 A;  4MH3 A;  5E59 A;  3VWU A;  4USS A;  3EMX A;  2H6X A;  2JAD A;  2K8S A;  4XIH A;  3A5I A;  1PMT A;  3ERF A;  5CP1 A;  2MMA A;  3VLN A;  3UBK A;  5ABR A;  5JCU A;  3FKF A;  2MBS A;  4LA1 A;  1XPV A;  4MJE A;  4N30 A;  1RQM A;  3CRU A;  1GSF A;  3DGQ A;  2B5X A;  2PBJ A;  1LU4 A;  3LXT A;  4K7N A;  3BD2 A;  10GS A;  4NWY A;  3J7Y k;  3UAP A;  3KGK A;  4LL4 B;  2RUE A;  4IQA A;  3CRT A;  4K5R A;  1KEB A;  1K0N A;  1G6W A;  4IKH A;  3D4T A;  3TJK A;  3TOT A;  3ME8 A;  1SEN A;  2WGR A;  2X8C A;  4JED A;  4WF4 A;  2IN3 A;  3FEU A;  4V2M A;  3LWA A;  2JZS A;  2PGT A;  2OA7 A;  4ECB A;  4BVX B;  2PPT A;  2MYG A;  2H30 A;  3TKS A;  2GSQ A;  2YV7 A;  3GN3 A;  5CNW A;  5IQY A;  2HRN A;  2MZC A;  4WBJ A;  2AYT A;  4GWR A;  3FYG A;  7GSS A;  1XBS A;  2V6K A;  1KTE A;  4WBR D;  2VM1 A;  2WFC A;  2B3S A;  4ISD A;  2VIM A;  2OKA A;  2C0D A;  2E2M A;  2KLX A;  4PXO A;  2QGV A;  4G2E A;  1GRX A;  3UBL A;  4I5Q A;  1AUC A;  2HRK A;  4HI7 A;  1FHE A;  2RUF A;  4DSS A;  1OC9 B;  3CBU A;  1ZL9 A;  4YAV A;  1TW9 A;  4KDU A;  3U6V A;  4MF6 A;  4IJI A;  1JZR A;  3LQ7 A;  1F3B A;  3TKS E;  2H8L A;  4MJA A;  1TOF A;  3D4M A;  5IOX A;  1J0F A;  1A2L A;  1YEX A;  4AGS A;  2H66 A;  1A2J A;  4CY8 A;  1M2D A;  1BYE A;  2I81 A;  1OAZ A;  1XVW A;  3HKR A;  1KBN A;  3ERG A;  3Q19 A;  5LNK e;  5G1K A;  2LNT A;  16GS A;  4WR5 A;  4X0X A;  4G9H A;  3D0Z A;  2H73 A;  2JZT A;  2JU5 A;  2OBK A;  1F6M C;  3CTF A;  3R3E A;  4IJ3 A;  1EV4 A;  3LSZ A;  5B6N A;  2CVB A;  4XCS A;  1XW6 A;  2I1U A;  3F4T A;  3F3Q A;  4ID0 A;  2QSI A;  2PER A;  4XRA A;  3EMP A;  1MEK A;  2VCX A;  1XWC A;  3GYK A;  5HFI A;  11GS A;  4K1F A;  1GTI A;  1GSQ A;  1PN9 A;  5HR0 A;  2FA8 A;  3P8W A;  4V2L A;  4NMU A;  1K0B A;  1Z6M A;  5A4U A;  3DML A;  4K5S A;  4HS1 A;  2VL9 A;  4EL1 A;  5EVO A;  2TRC P;  1EGO A;  1J08 A;  2NBS A;  3QR6 A;  4HDE A;  5DAK B;  3IE3 A;  4K9Z A;  3W6G A;  3MAK A;  2ZUP A;  4KSO A;  4BA7 A;  5IMZ A;  4XS4 B;  2DSA A;  2YWN A;  3NZN A;  4Z2R A;  4E8H A;  1T1V A;  3LOR A;  2GZZ A;  3HHV A;  2OAD A;  3V1W A;  2CX4 A;  3DD3 A;  2M80 A;  2AB6 A;  1XZO A;  1FAA A;  2FHE A;  4OD7 A;  2RLI A;  5ID2 A;  1EOH A;  2LST A;  1DUG A;  1K0M A;  3N5O A;  1VF4 A;  2CA8 A;  2C0F A;  3ZVJ A;  4QL9 A;  2YV9 A;  2DBC A;  2EIO A;  2K18 A;  5ELG A;  1ZZY A;  2LRC A;  4F9Z A;  4DSR A;  4J2F A;  1YY7 A;  1Z7R A;  1XIY A;  3H79 A;  1Z3E A;  2HFD A;  3MIX A;  3BJ5 A;  2X8H A;  2WCI A;  1ACV A;  5IPG A;  4LMV A;  1KNG A;  1T7P B;  2FWE A;  3FRC A;  1ZCP A;  1S3A A;  2A4V A;  3G7I A;  1NHY A;  4K8M A;  3CSH A;  1WMJ A;  2XBI A;  3H1N A;  1PKZ A;  4TR1 A;  2AV4 A;  3KH9 A;  2IMI A;  5AGY A;  3P2A A;  4FQU A;  4ZL9 A;  1M3J A;  4DEJ A;  1Y25 A;  5CRH A;  2HLS A;  3TDG A;  1N8J A;  2H0H A;  1GNW A;  5ECQ B;  3G7J A;  2JAC A;  2CAI A;  4ULX A;  3ZYW A;  5JCW A;  1T8E B;  1T3B A;  4RI6 A;  3TUE A;  3GKX A;  3K8N A;  3M1G A;  1QUW A;  4O7H A;  2CQ9 A;  2N5B A;  2V32 A;  1MD4 A;  1ILO A;  2L4Q A;  4PX1 A;  3MYD A;  1A2M A;  4TXV A;  1S3D A;  4N10 A;  1PA3 A;  1R4W A;  2F8A A;  5EL8 A;  2A2R A;  3D21 A;  3QPM A;  5KN0 A;  1EWX A;  5D9W A;  3PIN A;  1TU7 A;  5F05 A;  2DIY A;  4IS0 A;  5EY6 A;  2QC7 A;  18GS A;  3UMA A;  4G0K A;  3F8U A;  3VWW A;  3LYK A;  1K3Y A;  1S3C A;  2G2Q A;  1TK5 B;  5B8B A;  4OWY A;  1W89 A;  1K3O A;  1M2B A;  1SKS B;  1JFU A;  3KZQ A;  2FWF A;  5DJM A;  3C1S A;  5IO2 A;  4OFT A;  17GS A;  4L0U A;  2HNL A;  3UJ1 A;  3L4N A;  3GFK A;  5AIX A;  3VPQ A;  3I6A A;  2XBQ A;  2X4A A;  5F0G A;  2GTU A;  2F9S A;  1WJK A;  1TKD B;  4IW9 A;  4IP1 A;  4D73 B;  1Q98 A;  2WZ9 A;  2A4H A;  1K0D A;  4IGJ A;  4MF7 A;  5DJL A;  3CQF A;  3FHK A;  1EGR A;  1BAY A;  1EV9 A;  3KCM A;  1HNA A;  3G9B A;  1M7T A;  2K6V A;  2H74 A;  1BED A;  2VM2 A;  3VK9 A;  2WB9 A;  3Q18 A;  1SL2 B;  5D93 A;  2IME A;  1GSS A;  2WS2 A;  1GSE A;  19GS A;  2LQO A;  3FR9 A;  1FB0 A;  1OE8 A;  4PQI A;  4MMM A;  2H6Z A;  2IFQ B;  1A8L A;  3HJP A;  1SKR B;  4YQU A;  5KEJ A;  3TGZ A;  4IQ1 A;  2WRT A;  2DJJ A;  3IC4 A;  3MSZ A;  2YJ7 A;  2PWJ A;  3US3 A;  2EIR A;  5ECR B;  2IWT A;  4F82 A;  1EZK A;  2LS5 A;  2R0P A;  3TKP A;  5G30 A;  4MDC A;  5BMU A;  2H76 A;  3TKR A;  2GSS A;  4F0B A;  3P90 A;  2VO4 A;  1Z9H A;  4I6X A;  4DSQ A;  2KHP A;  4Q5N A;  4BVY B;  2YAN A;  4TOP A;  2VAF A;  2DJ1 A;  2WDU A;  4ACS A;  4FIW A;  3BOA A;  4IEL A;  3UIW A;  4PTS A;  3VWV A;  3QAV A;  5CRD A;  1GLQ A;  3IR4 A;  1OVN A;  3APO A;  4WKW A;  1V2A A;  2PUK C;  5AIV A;  1O73 A;  5IMC A;  1ERU A;  3UL3 A;  3C8E A;  4TXO B;  3L9U A;  4I8B A;  4IHU A;  3ZL5 A;  4HU7 A;  2MMN A;  1Q4J A;  4WEY A;  2C4J A;  2GQL A;  1TRS A;  2BTO T;  5D9T A;  2F8F A;  1TRU A;  2V41 A;  3IBH A;  1QFN A;  1A8Y A;  5H5R A;  1M2A A;  1U6T A;  2HRA A;  4KSM A;  2P5Q A;  5CAX A;  2OE0 A;  3D22 A;  3PH9 A;  2HZE B;  2FUG 2;  5F06 A;  1DBY A;  1YF0 A;  2BMX A;  2RM5 A;  1EEJ A;  3UVH A;  1ON4 A;  2LTK A;  4KB3 A;  2L4C A;  3IOS A;  1I9D A;  2DJ3 A;  3GIX A;  1XXU A;  3H93 A;  3HXS A;  5JCG A;  4HJM A;  5CRE A;  2L59 A;  5JWQ B;  4J57 E;  4HZ4 A;  3TJJ A;  2NVL A;  5INY A;  6GST A;  3F6D A;  1C72 A;  1MDI A;  1Z7P A;  4BWQ A;  2C0E A;  1SJI A;  4BL7 A;  2REM A;  1YF1 A;  6GSY A;  3ZFB A;  1GL8 A;  3DKS A;  1IYI A;  4EIQ A;  2KOK A;  1GH2 A;  3FZ4 A;  4NHZ A;  2OAC A;  2C3T A;  4PQ1 A;  1BJX A;  2JSZ A;  1B9X C;  2R37 A;  1A23 A;  2TRX A;  1K0A A;  3GSS A;  5COH A;  4KW6 A;  4ECI A;  1PGT A;  4POM A;  1WIK A;  4H86 A;  3W8J A;  2CX3 A;  2PVQ A;  4XHM A;  1Y6E A;  1AQW A;  4G0I A;  3E3E A;  3F4S A;  2IFQ A;  2DJ2 A;  1TRV A;  2B7J A;  1ZYP A;  5J41 A;  4Q5F A;  4GST A;  2H72 A;  4I2T A;  5B8A A;  3F6F A;  4TW5 A;  1SD9 A;  2C1Y A;  4ZB6 A;  1X5C A;  1SK1 A;  4EVM A;  3UAR A;  1X5D A;  3GH9 A;  4N0Z A;  3KP8 A;  3MDK A;  3APS A;  3CTG A;  2GDR A;  2IMK A;  3HVS A;  4GRF A;  4WF5 A;  2MMO A;  1URM A;  2E0Q A;  2GZP A;  4HUA A;  4OO5 A;  1UC7 A;  5FHI A;  3HCZ A;  4NXI A;  4KDX A;  4POL A;  3J7Y b;  2ON5 A;  2YWO A;  4HZ2 A;  1F3A A;  3LEF A;  1O6J A;  2XPD A;  4HOJ A;  2GST A;  2AHE A;  4QQ7 A;  1TI1 A;  3FW2 A;  4Q5Q A;  3TB2 A;  2PU9 C;  2GQK A;  5J9C A;  2HYX A;  3DEX A;  1MDJ A;  1SK0 A;  2QA2 A;  1U3A A;  1THX A;  3TKQ A;  2PN8 A;  1PFO A;  3L9V A;  1TK8 B;  2FWH A;  2TIR A;  3EYT A;  1SJ6 A;  2KP2 A;  4ZBD A;  4EC0 A;  2C80 A;  5HQP A;  2HZE A;  4IN0 A;  1K0C A;  3EIN A;  4LLR A;  4TN8 A;  3GKN A;  1PL1 A;  2H0I A;  3A2V A;  3GNJ A;  2J23 A;  2X99 A;  5DCH A;  4V2N A;  2I3Y A;  1XWK A;  5G5F A;  1NM3 A;  3QOU A;  4ILF A;  5GAP D;  4FYU A;  3HY2 A;  2QA1 A;  2QKE A;  2N5A A;  4MNN A;  1SYR A;  4YQM A;  5DCG A;  1YEP A;  2GT5 A;  3WGX A;  2YWM A;  1BX9 A;  2KP1 A;  3KD0 A;  4ML1 A;  3M9K A;  1PSQ A;  4KND A;  4EDZ A;  4EF0 A;  4GSS A;  3GKK A;  3M3M A;  4N0V A;  5FWG A;  5AN1 A;  2H71 A;  3VI5 A;  5ECP B;  2L5L A;  3D5J A;  1YQ1 A;  2DJK A;  4BPY A;  2VOC A;  5HFG A;  5F8B A;  2ALB A;  4O92 A;  1PD2 1;  1GUH A;  1J9B A;  2WJU A;  4K2D A;  4AJ8 A;  4ECJ A;  1TU8 A;  5C04 A;  3IK9 A;  2L6D A;  3FY7 A;  4BVX A;  2DJ0 A;  3HVV A;  3HJM A;  3RPN A;  2OE3 A;  2NDO A;  4OCE A;  5BRT A;  1GSY A;  5A4V A;  3TKS C;  4JR4 A;  4X1U A;  3KEB A;  2CT6 A;  3DIE A;  1FVK A;  1OYJ A;  2MMZ A;  4Z2U A;  1WP0 A;  4X4J A;  4ZIJ A;  3O76 A;  5A4W A;  1UA5 A;  1MD3 A;  2LV3 A;  1DE2 A;  2EIQ A;  3F9U A;  1GWC A;  1LJR A;  2DC5 A;  2HSM A;  1T4Y A;  4KAE A;  2VL3 A;  1FO5 A;  2UZ8 A;  2AJQ B;  2R0G A;  2VD1 A;  4NHW A;  4JZQ A;  6GSX A;  1M9B A;  1RW1 A;  1V40 A;  1PN0 A;  3FZ5 A;  4TR4 A;  3IHQ A;  5ECK B;  1O81 A;  2VCQ A;  3JCM L;  1YJ6 A;  3QMX A;  1OC9 A;  4XS1 A;  1QXH A;  1T00 A;  3QAG A;  5IMV A;  1X5E A;  1RK4 A;  1USB A;  1ST9 A;  2FY6 A;  5JWO B;  2V1M A;  5E4W A;  1YZX A;  1QK8 A;  1A0R P;  3HVX A;  3GTU B;  2NTO A;  2CZ3 A;  3IV4 A;  4MP4 A;  3TJF A;  3BCK A;  1ZYQ B;  5IIZ A;  4XRD A;  3HA9 A;  3NOF A;  3DWV A;  2CAQ A;  1FOH A;  4V1A p;  5ECH B;  2XHF A;  2YPM A;  1SU9 A;  1UN2 A;  4Q5R A;  3HZ4 A;  1B8X A;  2XPE A;  2OJL A;  3W8S A;  1FW1 A;  4TR0 A;  4CHS A;  3TRX A;  4FH8 A;  3A2X A;  1DE1 A;  5G5E A;  1O8X A;  3ZVJ D;  3L0H A;  4ZBB A;  4MLY A;  2HSH A;  2V2G A;  2GLR A;  2H1D A;  3PR8 A;  2R6K A;  5D96 A;  1ZYN A;  1HD2 A;  3M9J A;  1TK0 B;  2HSY A;  4PUR A;  2N5F A;  1WOU A;  5B6M A;  1X9S B;  3GL5 A;  5KOX A;  4HEA 2;  20GS A;  4XS6 A;  4POB A;  5DAK A;  2JL4 A;  2ZCT A;  3CYN A;  4XS4 A;  1JZO A;  4CW9 A;  3UVT A;  2EC4 A;  4Z7X A;  2OBI A;  3MNG A;  4FYB A;  4YKF A;  5FT3 A;  1ZOF A;  1I5G A;  3TRQ A;  3EE2 A;  3ED3 A;  2C0G A;  2A2P A;  5KN2 A;  2VD0 A;  4WET A;  3E9J B;  2FD3 A;  2JSY A;  3CMI A;  4MZC A;  1NSW A;  2BJX A;  3IAM 2;  4ZB8 A;  2L5O A;  4YAP A;  4CY6 A;  2KUC A;  8GSS A;  4QL7 A;  5KN3 A;  4ZXG A;  1X9W B;  1GTB A;  1ML6 A;  1QMV A;  4MPF A;  1SL0 B;  1GUM A;  2FA4 A;  3GUS A;  3PGT A;  2IMD A;  4IP6 A;  4RUV A;  3I69 A;  1XVQ A;  2YZH A;  5LCZ A;  3GX0 A;  3LW9 A;  5H5S A;  4HJ2 A;  1TP9 A;  4G19 A;  1V57 A;  1SJZ A;  2LRN A;  1M0U A;  2CZ2 A;  3PPU A;  4P3Y B;  1TRW A;  1XCC A;  3GL3 A;  2CVD A;  1X9M B;  4PUA A;  5D9X A;  3QFB C;  4HQZ A;  3FR6 A;  5CO3 A;  1G0T A;  1AQV A;  3GHA A;  4PGT A;  2OE1 A;  4KGI A;  3ZRE A;  1XW5 A;  3U5R E;  1GTU A;  1HNC A;  3QAW A;  4L5L A;  3EC3 A;  1R7H A;  2O7K A;  3KIJ A;  4FO5 A;  1U87 A;  4WXT A;  1XG8 A;  3TJB A;  2Z9S A;  1K0O A;  4IBP A;  3Q6O A;  3IC8 A;  5CRG A;  2I9H A;  4HSC X;  5DBQ A;  2MBT A;  1JZD A;  2DML A;  4FYC A;  5ECM B;  2A2S A;  2AAW A;  3IA1 A;  4K6X A;  2LUS A;  4ZBA A;  1MTC A;  5DDL A;  4K2X A;  4LL1 B;  1SYX A;  4KF9 A;  5IMF A;  1O85 A;  1B4P A;  4ZB9 A;  4G0L A;  2IIY A;  1VRS D;  2HXK A;  5G1L A;  1SD8 A;  3RAZ A;  1AW9 A;  2C8U A;  1E6B A;  1TXX A;  1EOG A;  3IPZ A;  3HVN A;  1AQX A;  2VL2 C;  2JZR A;  2D2Z A;  1G7E A;  2GQM A;  2M72 A;  1T4Z A;  1A24 A;  5KOW A;  2YJH A;  3GX8 A;  1XWB A;  3EPT A;  3TOU A;  3AY8 A;  3GH6 A;  3DRN A;  3IXR A;  2H1G A;  3L78 A;  4POK A;  2H6Y A;  4XTS A;  4ZL8 A;  1ZYE A;  1TI3 A;  2CV4 A;  5J3R A;  2WUL A;  3ZTL A;  4D73 A;  3KH7 A;  5IOW A;  2YWI A;  4HU9 A;  4Z2T A;  3DVX A;  5IO0 A;  3LJR A;  1GLP A;  1A0F A;  1WPI A;  4HQS A;  2B5E A;  1W4V A;  1B48 A;  4NV2 A;  3E0U A;  2FCH A;  4GQC A;  3N9J A;  4L8E A;  1GSD A;  3Q74 A;  5ID2 B;  3UEM A;  3FK8 A;  3QFA C;  4ML6 A;  4KCE A;  2J9H A;  2DKI A;  4PQH A;  4OFN A;  3RBT A;  1OKD A;  2R0C A;  3F3R A;  3WT1 A;  3ZRD A;  2LJK A;  2HRF A;  1F9M A;  4EO3 A;  13GS A;  5D9V A;  1XFL A;  4AJ6 A;  2B1K A;  5EPF A;  5CRW A;  4EE0 A;  4MK3 A;  2PMT A;  1QGV A;  2FNO A;  5G31 A;  5IPH A;  1U88 A;  2H1A A;  3GA4 A;  2X8G A;  1XWG A;  6GSU A;  4KA0 A;  3IRA A;  2CVK A;  2C3N A;  2LRT A;  4L5O A;  1K3L A;  1U3I A;  4TR1 B;  2YZU A;  3QDN A;  3VUR A;  2G0F A;  2HT9 A;  5HFK A;  4TR3 A;  3IHG A;  5DQY A;  1ZMA A;  2H1B A;  4MJB A;  3HDC A;  3KTB A;  1B4Q A;  2VCT A;  3LGC A;  2LNS A;  3C1R A;  2GSR A;  1V58 A;  4IVF A;  4BIK A;  1PKW A;  1NW2 A;  4BVY A;  3FZA A;  3KJY A;  5D8I A;  1ERV A;  2HZF A;  1Z6N A;  3VPT A;  3WYW A;  3ZMK A;  2O8V B;  2GS3 A;  2R5G A;  3G7Y A;  4N11 A;  4NV5 A;  1V9W A;  4TVE A;  5ECS A;  5F07 A;  3ISO A;  4PNG A;  3NIV A;  2RM6 A;  4EUY A;  5GAN D;  4K7O A;  1M9A A;  2GGT A;  3VWX A;  4TXO A;  4O5Q A;  3TCO A;  1SKW B;  2RII A;  2LJR A;  3MWH A;  5GZZ B;  3BCI A;  2I4A A;  4E8E A;  2H70 A;  2H0G A;  3GKM A;  1FOV A;  2H01 A;  3KP9 A;  1G6Y A;  1THO A;  4ZL7 A;  4DVC A;  4JU5 A;  2FWG A;  5H5Q A;  1H4O A;  1V98 A;  3IK7 A;  3RHB A;  1SK2 A;  3KTL A;  3HJO A;  3LG6 A;  4I2U A;  3O3T A;  3SBC A;  3ZIJ A;  5DQS A;  2X49 A;  4NAX A; 
#chains in the Genus database with same CATH homology
 4LMW A;  3UOM A;  1YKC A;  1OC8 A;  2K9F A;  3KMO A;  6GSW A;  5J9B A;  4K0N A;  3QCP A;  1YDK A;  4MAB A;  3DVW A;  1GP1 A;  1LBK A;  4JR6 A;  4AJ7 A;  12GS A;  2IJY A;  3ZLP A;  4L0W A;  5L71 A;  1GSU A;  4OFM A;  1JLW A;  1F37 A;  2E7P A;  3I43 A;  4K0G A;  2F3M A;  4KDY A;  2L6C A;  3FZ9 A;  4OO4 A;  3HZ8 A;  1NHO A;  4PUF C;  3IAS 2;  1VGL A;  3HYP A;  2VCZ A;  2YP6 A;  5J5N A;  4X43 A;  1OKT A;  1PQN A;  4KUN A;  3FR3 A;  4YKG A;  3VI7 A;  1JLV A;  2VUP A;  5LD0 A;  2HE3 A;  4MH2 A;  2B7K A;  3A2W A;  2H19 A;  4GLT A;  1XWA A;  2P0G A;  2DKH A;  4F0C A;  4PNF A;  5DAL B;  1EEM A;  1SL1 B;  2K8V A;  3ME7 A;  1TJD A;  3EU4 A;  5JWR B;  14GS A;  3P7X A;  4EXJ A;  3M8N A;  1FVJ A;  4GQF A;  4MZB A;  5GST A;  2AUV A;  3ZIV A;  3CXG A;  5ECN B;  4RQX A;  1BG5 A;  3ZFL A;  2LKU A;  4MF5 A;  4I97 A;  1HQO A;  3RPP A;  2ES7 A;  2XC2 A;  1DSB A;  3QD9 A;  5GSS A;  1VF1 A;  1H75 A;  2DMM A;  2NPB A;  1UVZ A;  4BWS A;  2YOI A;  5ECO B;  2DIZ A;  1AXD A;  1AC1 A;  1N2A A;  3GST A;  4WR4 A;  4OCF A;  3M0F A;  5DVB A;  3R2Q A;  2E2G A;  3WGD A;  4GTU A;  2O89 A;  1E2Y A;  1GTA A;  1FB6 A;  2IMF A;  3F0I A;  4GF0 A;  3GMF A;  2VLU A;  1PX6 A;  1R5P A;  3GRX A;  3TRP A;  1WWJ A;  2HI7 A;  1TDI A;  1OE7 A;  1PX7 A;  3EUR A;  1XOB A;  4F03 A;  5AIS A;  2P5R A;  2B6M A;  3A3T A;  2ZNM A;  3H4K A;  3OR5 A;  5KN1 A;  1VF3 A;  2GVP A;  2IPA A;  3GUR A;  2C3Q A;  1XOA A;  4O32 A;  3WD6 A;  1PRX A;  2YN1 A;  3EVI A;  4A5P A;  1FG4 A;  1ERT A;  2DLX A;  4MPG A;  3EWL A;  1XW9 A;  3KMN A;  3C71 A;  3KXO A;  1HYU A;  5CYY A;  2VL2 A;  4RQR A;  1JZW A;  2LQQ A;  4OMV A;  4YQV A;  5HR2 A;  2VCV A;  4GXZ A;  3DXB A;  6GSV A;  2R3X A;  4AF2 A;  2VLT A;  5A5K A;  2ON7 A;  2VCW A;  4BL7 B;  4JBB A;  3LXZ A;  5G2Z A;  3HD5 A;  3F63 A;  1TTZ A;  3F4R A;  22GS A;  4NPB A;  3O6T A;  4CDO A;  5ELA A;  3LFL A;  4YH2 A;  5D73 A;  3TJG A;  3SWL A;  1YKA A;  4EDY A;  4TKY A;  1ERW A;  2B1L A;  5ECI B;  3GV1 A;  4F2I A;  3C7M A;  5ECL B;  1AAZ A;  3D6I A;  3ERW A;  2P31 A;  2FLS A;  1O8W A;  5ENU A;  2R2J A;  1Z5Y E;  1X0R A;  3H8Q A;  5IM9 A;  1GUK A;  4O5R A;  2O87 A;  5IMA A;  2H75 A;  4ICY A;  4ECC A;  1HNB A;  5IMD A;  3BBY A;  3A5W A;  3EU3 A;  1R26 A;  4RI7 A;  3C73 A;  1WRY A;  3APQ A;  4GCI A;  6GSS A;  4J56 E;  4O5U A;  1MDK A;  1OC3 A;  4G10 A;  4V1A g;  2X64 A;  4EKZ A;  5DAL A;  4K7I A;  5C00 A;  3ZZX A;  4DSS B;  4EIP A;  3FMW A;  3RDW A;  4JRR A;  1CQH A;  1B9Y C;  2V6O A;  5HR3 A;  1VF2 A;  4JE1 A;  3ZML A;  4MJC A;  1ZGN A;  4TRX A;  2YCD A;  1PL2 A;  2B5Y A;  1GUL A;  2LJA A;  3WT2 A;  3CSJ A;  1M99 A;  2FGX A;  1WE0 A;  2GT6 A;  4KCA A;  2L57 A;  4GSN A;  1BQ7 A;  1QQ2 A;  2PVO C;  2VLV A;  3LYP A;  2LEG A;  5B7C A;  2R4V A;  2M46 A;  4ZIL A;  1EP7 A;  3GTU A;  1R5A A;  1GNE A;  2YNX A;  1EP8 A;  4MZW A;  2F51 A;  9GSS A;  1IYH A;  4KH7 A;  1AIU A;  3I9V 2;  3IDV A;  3ZIT A;  1O7U A;  1G7O A;  3DYR A;  3S9F A;  3WGE A;  4MCU A;  1F2E A;  4KE3 A;  1ABA A;  5J4U A;  1JHB A;  3CSI A;  4MA9 A;  5HR1 A;  4KX4 A;  2O85 A;  3L9S A;  2IL3 A;  3VFI A;  2GZY A;  3RHC A;  1CQG A;  3KM6 A;  4MH3 A;  5E59 A;  3VWU A;  4USS A;  3EMX A;  2H6X A;  2JAD A;  2K8S A;  4XIH A;  3A5I A;  1PMT A;  3ERF A;  5CP1 A;  2MMA A;  3VLN A;  3UBK A;  5ABR A;  5JCU A;  3FKF A;  2MBS A;  4LA1 A;  1XPV A;  4MJE A;  4N30 A;  1RQM A;  3CRU A;  1GSF A;  3DGQ A;  2B5X A;  2PBJ A;  1LU4 A;  3LXT A;  4K7N A;  3BD2 A;  10GS A;  4NWY A;  3J7Y k;  3UAP A;  3KGK A;  4LL4 B;  2RUE A;  4IQA A;  3CRT A;  4K5R A;  1KEB A;  1K0N A;  1G6W A;  4IKH A;  3D4T A;  3TJK A;  3TOT A;  3ME8 A;  1SEN A;  2WGR A;  2X8C A;  4JED A;  4WF4 A;  2IN3 A;  3FEU A;  4V2M A;  3LWA A;  2JZS A;  2PGT A;  2OA7 A;  4ECB A;  4BVX B;  2PPT A;  2MYG A;  2H30 A;  3TKS A;  2GSQ A;  2YV7 A;  3GN3 A;  5CNW A;  5IQY A;  2HRN A;  2MZC A;  4WBJ A;  2AYT A;  4GWR A;  3FYG A;  7GSS A;  1XBS A;  2V6K A;  1KTE A;  4WBR D;  2VM1 A;  2WFC A;  2B3S A;  4ISD A;  2VIM A;  2OKA A;  2C0D A;  2E2M A;  2KLX A;  4PXO A;  2QGV A;  4G2E A;  1GRX A;  3UBL A;  4I5Q A;  1AUC A;  2HRK A;  4HI7 A;  1FHE A;  2RUF A;  4DSS A;  1OC9 B;  3CBU A;  1ZL9 A;  4YAV A;  1TW9 A;  4KDU A;  3U6V A;  4MF6 A;  4IJI A;  1JZR A;  3LQ7 A;  1F3B A;  3TKS E;  2H8L A;  4MJA A;  1TOF A;  3D4M A;  5IOX A;  1J0F A;  1A2L A;  1YEX A;  4AGS A;  2H66 A;  1A2J A;  4CY8 A;  1M2D A;  1BYE A;  2I81 A;  1OAZ A;  1XVW A;  3HKR A;  1KBN A;  3ERG A;  3Q19 A;  5LNK e;  5G1K A;  2LNT A;  16GS A;  4WR5 A;  4X0X A;  4G9H A;  3D0Z A;  2H73 A;  2JZT A;  2JU5 A;  2OBK A;  1F6M C;  3CTF A;  3R3E A;  4IJ3 A;  1EV4 A;  3LSZ A;  5B6N A;  2CVB A;  4XCS A;  1XW6 A;  2I1U A;  3F4T A;  3F3Q A;  4ID0 A;  2QSI A;  2PER A;  4XRA A;  3EMP A;  1MEK A;  2VCX A;  1XWC A;  3GYK A;  5HFI A;  11GS A;  4K1F A;  1GTI A;  1GSQ A;  1PN9 A;  5HR0 A;  2FA8 A;  3P8W A;  4V2L A;  4NMU A;  1K0B A;  1Z6M A;  5A4U A;  3DML A;  4K5S A;  4HS1 A;  2VL9 A;  4EL1 A;  5EVO A;  2TRC P;  1EGO A;  1J08 A;  2NBS A;  3QR6 A;  4HDE A;  5DAK B;  3IE3 A;  4K9Z A;  3W6G A;  3MAK A;  2ZUP A;  4KSO A;  4BA7 A;  5IMZ A;  4XS4 B;  2DSA A;  2YWN A;  3NZN A;  4Z2R A;  4E8H A;  1T1V A;  3LOR A;  2GZZ A;  3HHV A;  2OAD A;  3V1W A;  2CX4 A;  3DD3 A;  2M80 A;  2AB6 A;  1XZO A;  1FAA A;  2FHE A;  4OD7 A;  2RLI A;  5ID2 A;  1EOH A;  2LST A;  1DUG A;  1K0M A;  3N5O A;  1VF4 A;  2CA8 A;  2C0F A;  3ZVJ A;  4QL9 A;  2YV9 A;  2DBC A;  2EIO A;  2K18 A;  5ELG A;  1ZZY A;  2LRC A;  4F9Z A;  4DSR A;  4J2F A;  1YY7 A;  1Z7R A;  1XIY A;  3H79 A;  1Z3E A;  2HFD A;  3MIX A;  3BJ5 A;  2X8H A;  2WCI A;  1ACV A;  5IPG A;  4LMV A;  1KNG A;  1T7P B;  2FWE A;  3FRC A;  1ZCP A;  1S3A A;  2A4V A;  3G7I A;  1NHY A;  4K8M A;  3CSH A;  1WMJ A;  2XBI A;  3H1N A;  1PKZ A;  4TR1 A;  2AV4 A;  3KH9 A;  2IMI A;  5AGY A;  3P2A A;  4FQU A;  4ZL9 A;  4DEJ A;  1Y25 A;  5CRH A;  2HLS A;  3TDG A;  1N8J A;  2H0H A;  1GNW A;  5ECQ B;  3G7J A;  2JAC A;  2CAI A;  4ULX A;  3ZYW A;  5JCW A;  1T8E B;  1T3B A;  4RI6 A;  3TUE A;  3GKX A;  3K8N A;  3M1G A;  1QUW A;  4O7H A;  2CQ9 A;  2N5B A;  2V32 A;  1MD4 A;  1ILO A;  2L4Q A;  4PX1 A;  3MYD A;  1A2M A;  4TXV A;  1S3D A;  4N10 A;  1PA3 A;  1R4W A;  2F8A A;  5EL8 A;  2A2R A;  3D21 A;  3QPM A;  5KN0 A;  1EWX A;  5D9W A;  3PIN A;  1TU7 A;  5F05 A;  2DIY A;  4IS0 A;  5EY6 A;  2QC7 A;  18GS A;  3UMA A;  4G0K A;  3F8U A;  3VWW A;  3LYK A;  1K3Y A;  1S3C A;  2G2Q A;  1TK5 B;  5B8B A;  4OWY A;  1W89 A;  1K3O A;  1M2B A;  1SKS B;  1JFU A;  3KZQ A;  2FWF A;  5DJM A;  3C1S A;  5IO2 A;  4OFT A;  17GS A;  4L0U A;  2HNL A;  3UJ1 A;  3L4N A;  3GFK A;  5AIX A;  3VPQ A;  3I6A A;  2XBQ A;  2X4A A;  5F0G A;  2GTU A;  2F9S A;  1WJK A;  1TKD B;  4IW9 A;  4IP1 A;  4D73 B;  1Q98 A;  2WZ9 A;  2A4H A;  1K0D A;  4IGJ A;  4MF7 A;  5DJL A;  3FHK A;  1EGR A;  1BAY A;  1EV9 A;  3KCM A;  1HNA A;  3G9B A;  1M7T A;  2K6V A;  2H74 A;  1BED A;  2VM2 A;  3VK9 A;  2WB9 A;  3Q18 A;  1SL2 B;  5D93 A;  2IME A;  1GSS A;  2WS2 A;  1GSE A;  19GS A;  2LQO A;  3FR9 A;  1FB0 A;  1OE8 A;  4PQI A;  4MMM A;  2H6Z A;  2IFQ B;  1A8L A;  3HJP A;  1SKR B;  4YQU A;  5KEJ A;  3TGZ A;  4IQ1 A;  2WRT A;  2DJJ A;  3IC4 A;  3MSZ A;  2YJ7 A;  2PWJ A;  3US3 A;  2EIR A;  5ECR B;  2IWT A;  4F82 A;  1EZK A;  2LS5 A;  2R0P A;  3TKP A;  5G30 A;  4MDC A;  5BMU A;  2H76 A;  3TKR A;  2GSS A;  4F0B A;  3P90 A;  2VO4 A;  1Z9H A;  4I6X A;  4DSQ A;  2KHP A;  4Q5N A;  4BVY B;  2YAN A;  4TOP A;  2VAF A;  2DJ1 A;  2WDU A;  4ACS A;  4FIW A;  3BOA A;  4IEL A;  3UIW A;  4PTS A;  3VWV A;  3QAV A;  5CRD A;  1GLQ A;  3IR4 A;  1OVN A;  3APO A;  4WKW A;  1V2A A;  2PUK C;  5AIV A;  1O73 A;  5IMC A;  1ERU A;  3UL3 A;  3C8E A;  4TXO B;  3L9U A;  4I8B A;  4IHU A;  3ZL5 A;  4HU7 A;  2MMN A;  1Q4J A;  4WEY A;  2C4J A;  2GQL A;  1TRS A;  2BTO T;  5D9T A;  2F8F A;  1TRU A;  2V41 A;  3IBH A;  1QFN A;  1A8Y A;  5H5R A;  1M2A A;  1U6T A;  2HRA A;  4KSM A;  2P5Q A;  5CAX A;  2OE0 A;  3D22 A;  3PH9 A;  2HZE B;  2FUG 2;  5F06 A;  1DBY A;  1YF0 A;  2BMX A;  2RM5 A;  1EEJ A;  3UVH A;  1ON4 A;  2LTK A;  4KB3 A;  2L4C A;  3IOS A;  1I9D A;  2DJ3 A;  3GIX A;  1XXU A;  3H93 A;  3HXS A;  5JCG A;  4HJM A;  5CRE A;  2L59 A;  5JWQ B;  4J57 E;  4HZ4 A;  3TJJ A;  2NVL A;  5INY A;  6GST A;  3F6D A;  1C72 A;  1MDI A;  1Z7P A;  4BWQ A;  2C0E A;  1SJI A;  4BL7 A;  2REM A;  1YF1 A;  6GSY A;  3ZFB A;  1GL8 A;  3DKS A;  1IYI A;  4EIQ A;  2KOK A;  1GH2 A;  3FZ4 A;  4NHZ A;  2OAC A;  2C3T A;  4PQ1 A;  1BJX A;  2JSZ A;  1B9X C;  2R37 A;  1A23 A;  2TRX A;  1K0A A;  3GSS A;  5COH A;  4KW6 A;  4ECI A;  1PGT A;  4POM A;  1WIK A;  4H86 A;  3W8J A;  2CX3 A;  2PVQ A;  4XHM A;  1Y6E A;  1AQW A;  4G0I A;  3E3E A;  3F4S A;  2IFQ A;  2DJ2 A;  1TRV A;  2B7J A;  1ZYP A;  5J41 A;  4Q5F A;  4GST A;  2H72 A;  4I2T A;  5B8A A;  3F6F A;  4TW5 A;  1SD9 A;  2C1Y A;  4ZB6 A;  1X5C A;  1SK1 A;  4EVM A;  3UAR A;  1X5D A;  3GH9 A;  4N0Z A;  3KP8 A;  3MDK A;  3APS A;  3CTG A;  2GDR A;  2IMK A;  3HVS A;  4GRF A;  4WF5 A;  2MMO A;  1URM A;  2E0Q A;  2GZP A;  4HUA A;  4OO5 A;  1UC7 A;  5FHI A;  3HCZ A;  4NXI A;  4KDX A;  4POL A;  3J7Y b;  2ON5 A;  2YWO A;  4HZ2 A;  1F3A A;  3LEF A;  1O6J A;  2XPD A;  4HOJ A;  2GST A;  2AHE A;  4QQ7 A;  1TI1 A;  3FW2 A;  4Q5Q A;  3TB2 A;  2PU9 C;  2GQK A;  5J9C A;  2HYX A;  3DEX A;  1MDJ A;  1SK0 A;  2QA2 A;  1U3A A;  1THX A;  3TKQ A;  2PN8 A;  3L9V A;  1TK8 B;  2FWH A;  2TIR A;  3EYT A;  1SJ6 A;  2KP2 A;  4ZBD A;  4EC0 A;  2C80 A;  5HQP A;  2HZE A;  4IN0 A;  1K0C A;  3EIN A;  4LLR A;  4TN8 A;  3GKN A;  1PL1 A;  2H0I A;  3A2V A;  3GNJ A;  2J23 A;  2X99 A;  5DCH A;  4V2N A;  2I3Y A;  1XWK A;  5G5F A;  1NM3 A;  3QOU A;  4ILF A;  5GAP D;  4FYU A;  3HY2 A;  2QA1 A;  2QKE A;  2N5A A;  4MNN A;  1SYR A;  4YQM A;  5DCG A;  1YEP A;  2GT5 A;  3WGX A;  2YWM A;  1BX9 A;  2KP1 A;  3KD0 A;  4ML1 A;  3M9K A;  1PSQ A;  4KND A;  4EDZ A;  4EF0 A;  4GSS A;  3GKK A;  3M3M A;  4N0V A;  5FWG A;  5AN1 A;  2H71 A;  3VI5 A;  5ECP B;  2L5L A;  3D5J A;  1YQ1 A;  2DJK A;  4BPY A;  2VOC A;  5HFG A;  5F8B A;  2ALB A;  4O92 A;  1PD2 1;  1GUH A;  1J9B A;  2WJU A;  4K2D A;  4AJ8 A;  4ECJ A;  1TU8 A;  5C04 A;  3IK9 A;  2L6D A;  3FY7 A;  4BVX A;  2DJ0 A;  3HVV A;  3HJM A;  3RPN A;  2OE3 A;  2NDO A;  4OCE A;  5BRT A;  1GSY A;  5A4V A;  3TKS C;  4JR4 A;  4X1U A;  3KEB A;  2CT6 A;  3DIE A;  1FVK A;  1OYJ A;  2MMZ A;  4Z2U A;  1WP0 A;  4X4J A;  4ZIJ A;  3O76 A;  5A4W A;  1UA5 A;  1MD3 A;  2LV3 A;  1DE2 A;  2EIQ A;  3F9U A;  1GWC A;  1LJR A;  2DC5 A;  2HSM A;  1T4Y A;  4KAE A;  2VL3 A;  1FO5 A;  2UZ8 A;  2AJQ B;  2R0G A;  2VD1 A;  4NHW A;  4JZQ A;  6GSX A;  1M9B A;  1RW1 A;  1V40 A;  1PN0 A;  3FZ5 A;  4TR4 A;  3IHQ A;  5ECK B;  1O81 A;  2VCQ A;  3JCM L;  1YJ6 A;  3QMX A;  1OC9 A;  4XS1 A;  1QXH A;  1T00 A;  3QAG A;  5IMV A;  1X5E A;  1RK4 A;  1USB A;  1ST9 A;  2FY6 A;  5JWO B;  2V1M A;  5E4W A;  1YZX A;  1QK8 A;  1A0R P;  3HVX A;  3GTU B;  2NTO A;  2CZ3 A;  3IV4 A;  4MP4 A;  3TJF A;  3BCK A;  1ZYQ B;  5IIZ A;  4XRD A;  3HA9 A;  3NOF A;  3DWV A;  2CAQ A;  1FOH A;  4V1A p;  5ECH B;  2XHF A;  2YPM A;  1SU9 A;  1UN2 A;  4Q5R A;  3HZ4 A;  1B8X A;  2XPE A;  2OJL A;  3W8S A;  1FW1 A;  4TR0 A;  4CHS A;  3TRX A;  4FH8 A;  3A2X A;  1DE1 A;  5G5E A;  1O8X A;  3ZVJ D;  3L0H A;  4ZBB A;  4MLY A;  2HSH A;  2V2G A;  2GLR A;  2H1D A;  3PR8 A;  2R6K A;  5D96 A;  1ZYN A;  1HD2 A;  3M9J A;  1TK0 B;  2HSY A;  4PUR A;  2N5F A;  1WOU A;  5B6M A;  1X9S B;  3GL5 A;  5KOX A;  4HEA 2;  20GS A;  4XS6 A;  4POB A;  5DAK A;  2JL4 A;  2ZCT A;  3CYN A;  4XS4 A;  1JZO A;  4CW9 A;  3UVT A;  2EC4 A;  4Z7X A;  2OBI A;  3MNG A;  4FYB A;  4YKF A;  5FT3 A;  1ZOF A;  1I5G A;  3TRQ A;  3EE2 A;  3ED3 A;  2C0G A;  2A2P A;  5KN2 A;  2VD0 A;  4WET A;  3E9J B;  2FD3 A;  2JSY A;  3CMI A;  4MZC A;  1NSW A;  2BJX A;  3IAM 2;  4ZB8 A;  2L5O A;  4YAP A;  4CY6 A;  2KUC A;  8GSS A;  4QL7 A;  5KN3 A;  4ZXG A;  1X9W B;  1GTB A;  1ML6 A;  1QMV A;  4MPF A;  1SL0 B;  1GUM A;  2FA4 A;  3GUS A;  3PGT A;  2IMD A;  4IP6 A;  4RUV A;  3I69 A;  1XVQ A;  2YZH A;  5LCZ A;  3GX0 A;  3LW9 A;  5H5S A;  4HJ2 A;  1TP9 A;  4G19 A;  1V57 A;  1SJZ A;  2LRN A;  1M0U A;  2CZ2 A;  3PPU A;  4P3Y B;  1TRW A;  1XCC A;  3GL3 A;  2CVD A;  1X9M B;  4PUA A;  5D9X A;  3QFB C;  4HQZ A;  3FR6 A;  5CO3 A;  1G0T A;  1AQV A;  3GHA A;  4PGT A;  2OE1 A;  4KGI A;  3ZRE A;  1XW5 A;  3U5R E;  1GTU A;  1HNC A;  3QAW A;  4L5L A;  3EC3 A;  1R7H A;  2O7K A;  3KIJ A;  4FO5 A;  1U87 A;  4WXT A;  3TJB A;  2Z9S A;  1K0O A;  4IBP A;  3Q6O A;  3IC8 A;  5CRG A;  2I9H A;  5DBQ A;  2MBT A;  1JZD A;  2DML A;  4FYC A;  5ECM B;  2A2S A;  2AAW A;  3IA1 A;  4K6X A;  2LUS A;  4ZBA A;  1MTC A;  5DDL A;  4K2X A;  4LL1 B;  1SYX A;  4KF9 A;  5IMF A;  1O85 A;  1B4P A;  4ZB9 A;  4G0L A;  2IIY A;  1VRS D;  2HXK A;  5G1L A;  1SD8 A;  3RAZ A;  1AW9 A;  2C8U A;  1E6B A;  1TXX A;  1EOG A;  3IPZ A;  1AQX A;  2VL2 C;  2JZR A;  2D2Z A;  1G7E A;  2GQM A;  2M72 A;  1T4Z A;  1A24 A;  5KOW A;  2YJH A;  3GX8 A;  1XWB A;  3EPT A;  3TOU A;  3AY8 A;  3GH6 A;  3DRN A;  3IXR A;  2H1G A;  3L78 A;  4POK A;  2H6Y A;  4XTS A;  4ZL8 A;  1ZYE A;  1TI3 A;  2CV4 A;  5J3R A;  2WUL A;  3ZTL A;  4D73 A;  3KH7 A;  5IOW A;  2YWI A;  4HU9 A;  4Z2T A;  3DVX A;  5IO0 A;  3LJR A;  1GLP A;  1A0F A;  1WPI A;  4HQS A;  2B5E A;  1W4V A;  1B48 A;  4NV2 A;  3E0U A;  2FCH A;  4GQC A;  3N9J A;  4L8E A;  1GSD A;  3Q74 A;  5ID2 B;  3UEM A;  3FK8 A;  3QFA C;  4ML6 A;  4KCE A;  2J9H A;  2DKI A;  4PQH A;  4OFN A;  3RBT A;  1OKD A;  2R0C A;  3F3R A;  3WT1 A;  3ZRD A;  2LJK A;  2HRF A;  1F9M A;  4EO3 A;  13GS A;  5D9V A;  1XFL A;  4AJ6 A;  2B1K A;  5EPF A;  5CRW A;  4EE0 A;  4MK3 A;  2PMT A;  1QGV A;  2FNO A;  5G31 A;  5IPH A;  1U88 A;  2H1A A;  3GA4 A;  2X8G A;  1XWG A;  6GSU A;  4KA0 A;  3IRA A;  2CVK A;  2C3N A;  2LRT A;  4L5O A;  1K3L A;  1U3I A;  4TR1 B;  2YZU A;  3QDN A;  3VUR A;  2G0F A;  2HT9 A;  5HFK A;  4TR3 A;  3IHG A;  5DQY A;  1ZMA A;  2H1B A;  4MJB A;  3HDC A;  3KTB A;  1B4Q A;  2VCT A;  3LGC A;  2LNS A;  3C1R A;  2GSR A;  1V58 A;  4IVF A;  1PKW A;  1NW2 A;  4BVY A;  3FZA A;  3KJY A;  5D8I A;  1ERV A;  2HZF A;  1Z6N A;  3VPT A;  3WYW A;  3ZMK A;  2O8V B;  2GS3 A;  2R5G A;  3G7Y A;  4N11 A;  4NV5 A;  1V9W A;  4TVE A;  5ECS A;  5F07 A;  3ISO A;  4PNG A;  3NIV A;  2RM6 A;  4EUY A;  5GAN D;  4K7O A;  1M9A A;  2GGT A;  3VWX A;  4TXO A;  4O5Q A;  3TCO A;  1SKW B;  2RII A;  2LJR A;  3MWH A;  5GZZ B;  3BCI A;  2I4A A;  4E8E A;  2H70 A;  2H0G A;  3GKM A;  1FOV A;  2H01 A;  3KP9 A;  1G6Y A;  1THO A;  4ZL7 A;  4DVC A;  4JU5 A;  2FWG A;  5H5Q A;  1H4O A;  1V98 A;  3IK7 A;  3RHB A;  1SK2 A;  3KTL A;  3HJO A;  3LG6 A;  4I2U A;  3O3T A;  3SBC A;  3ZIJ A;  5DQS A;  2X49 A;  4NAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...