1SYRA

Initial structural analysis of plasmodium falciparum thioredoxin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
MVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords thioredoxin
publication title Initial Structural Analysis of Plasmodium falciparum thioredoxin
rcsb
source organism Plasmodium falciparum
total genus 33
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2004-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1syrA00
1VF1A 2MBSA 2LUSA 5B6MA 1AXDA 3IPZA 4KUNA 3EINA 1V58A 2FWHA 4MJEA 3HJOA 1M7TA 4GRFA 4E8HA 3A2VA 4LA1A 4LL4B 3GH6A 3HA9A 4HZ4A 2H73A 1BEDA 1HNAA 2IPAA 3IK7A 1BJXA 3HYPA 2RUFA 2VCVA 4TR1A 3CXGA 1X9SB 2B7JA 4F03A 1K0DA 5D8IA 1G7EA 5ECRB 2HNLA 1WIKA 1B9XC 4GSTA 2C8UA 2GSQA 2YZUA 3CSJA 5J4UA 2O8VB 4ZBDA 2LTKA 4NHWA 1TK0B 4JBBA 1R26A 1KBNA 3FZ5A 1HNBA 4I6XA 2YJHA 3LEFA 5DAKB 13GSA 2MMOA 1ABAA 1E2YA 3M0FA 2M80A 2XBQA 3GSSA 1YKCA 3K8NA 4G2EA 1LJRA 4X1UA 1DUGA 4JR4A 4WF4A 1CQHA 5ECIB 1R5PA 3LWAA 1A8YA 1YY7A 2LRCA 1OC9A 2DIYA 1SD8A 4KDXA 4N0VA 5ECPB 1AW9A 5HR0A 2VUPA 2MMAA 3ED3A 2K6VA 1Z6MA 3CMIA 1GSQA 3VPTA 2CZ2A 1SL0B 16GSA 2OBIA 1YF1A 3MNGA 4Q5QA 3ERFA 4AJ6A 3FZ9A 2NDOA 4MPGA 3D0ZA 3GUSA 2P31A 5D9WA 1OKTA 2WZ9A 3APOA 3SBCA 3U5RE 4FH8A 5B6NA 4RQRA 4X0XA 4DSSB 1K3OA 1V57A 5JCUA 3WYWA 2GQLA 1K0BA 3QD9A 4O32A 4XS6A 2IN3A 3ZVJA 2HRFA 2H0GA 5EL8A 5ECSA 2VCXA 3QOUA 4KA0A 2V1MA 2PMTA 5GAND 2I1UA 4N10A 5E4WA 2F9SA 1KTEA 3F6DA 1R5AA 4XRAA 1XXUA 1EGOA 5AIXA 1FOVA 2Z9SA 2L5OA 4KSOA 4NWYA 1EP7A 4I97A 5ID2A 3KP9A 1EV9A 1PSQA 2DLXA 2L4QA 3IXRA 1SJZA 2X64A 1O85A 4KX4A 3IR4A 3GTUB 3EE2A 2V32A 3O76A 4IHUA 3DVWA 4LMVA 4YAVA 3DGQA 4EE0A 1EGRA 2OBKA 4TKYA 3F9UA 2V41A 4AF2A 1DSBA 3NIVA 1YQ1A 4V1Ap 3ERGA 2VCZA 3GURA 4D73B 2J23A 1M2DA 3GSTA 4OD7A 2L6DA 3IAS2 2H74A 5LNKe 4MZCA 3W8SA 3WT2A 2C0DA 3DXBA 1EOGA 1GTUA 4J2FA 3I69A 5F0GA 5DQSA 2GQMA 4DSRA 3EYTA 1A8LA 4ML1A 3IV4A 2EIQA 4GTUA 2YWMA 2V6OA 1QFNA 2JADA 1ST9A 4IJIA 1QGVA 2O85A 2B6MA 1OE7A 1G0TA 2YNXA 3F8UA 3IC4A 3G7YA 4IELA 3KZQA 2WGRA 3F63A 1ZGNA 1WPIA 2GSSA 3W6GA 2M46A 1V98A 1YDKA 4OWYA 2CT6A 2VL2A 2LJRA 4HOJA 4ZB9A 2IFQB 3JCML 5IMDA 4N30A 2VLTA 4YQUA 4KE3A 4PNGA 1SKSB 3TB2A 5D9XA 3DWVA 2KOKA 4ULXA 3GA4A 2C0EA 2DIZA 4YQMA 2JU5A 1XWCA 1A24A 1AC1A 4KNDA 3UMAA 5ECLB 2X8CA 2JZTA 5DQYA 3QR6A 5ABRA 2AV4A 17GSA 3MSZA 2P5RA 4POKA 3C1RA 3HVXA 1XFLA 3WT1A 2YZHA 1JFUA 3EVIA 2HZFA 5IQYA 2FD3A 4EDYA 1JLWA 1QQ2A 2X8HA 2GQKA 2NBSA 2YCDA 4Q5RA 2IMFA 2L6CA 3HVSA 5INYA 3CSIA 3WGXA 3UEMA 5HR3A 3HZ8A 3LSZA 2NPBA 2H01A 3S9FA 2JZRA 4YAPA 1YF0A 5CAXA 2CAQA 1EEMA 1TXXA 4TRXA 5HFIA 1NSWA 5HFKA 4EXJA 3CYNA 2FWGA 2VLVA 4MF7A 1O73A 2FA4A 4D73A 2QGVA 3KH9A 1R4WA 1WE0A 4ZXGA 4N0ZA 1QK8A 1XVQA 1J08A 2O7KA 2YWNA 1GRXA 3GIXA 3HHVA 2KLXA 2O87A 5FHIA 2B1KA 4KW6A 4XTSA 2WCIA 1HD2A 11GSA 3US3A 2LSTA 4XIHA 3M3MA 1M2BA 4TR1B 1S3DA 1A23A 4KB3A 3KM6A 1JZWA 5FWGA 5IPHA 4ECIA 4CHSA 4P3YB 4XCSA 2E0QA 2FWEA 1NW2A 5CYYA 1OKDA 4K2DA 4PQHA 1HYUA 4OFTA 5AISA 5KN3A 5B7CA 1TI1A 2PVOC 1VGLA 5DJLA 5IMFA 5ECOB 4HJMA 1C72A 1NHYA 3F0IA 3GL5A 2HXKA 4EF0A 1FHEA 1U3AA 3U6VA 3I43A 3H1NA 3FKFA 3HKRA 4OFMA 4J56E 1XCCA 2H6ZA 2YV7A 1T00A 3ZL5A 3WD6A 3ZIVA 3CSHA 4K0NA 1ZOFA 2K9FA 1F2EA 2ALBA 4YQVA 1EOHA 3TOTA 1URMA 2A2RA 2PUKC 1OC9B 1K0OA 3E3EA 3UJ1A 1ILOA 2HT9A 2LKUA 4JE1A 4L5OA 2FA8A 1OC3A 9GSSA 1YEPA 5IOXA 1B48A 3GYKA 4K6XA 1U3IA 2AHEA 3HY2A 5IM9A 3DKSA 1DBYA 2ON7A 3LGCA 5EPFA 3FEUA 4BWQA 1DE2A 1ML6A 2FLSA 3PINA 3UVHA 3GMFA 4HQSA 1JLVA 1F9MA 2YJ7A 4O7HA 1X5DA 1U6TA 1W4VA 1V2AA 4DVCA 2WRTA 5IMVA 5H5QA 2VCQA 1K0AA 5JWOB 5F06A 2B5XA 2OKAA 1EWXA 2MMZA 4IP1A 5F8BA 3DVXA 4LLRA 3I6AA 4IJ3A 4V2NA 2GLRA 1U88A 3UARA 3Q74A 1ACVA 3ZREA 3GHAA 4POLA 3GL3A 2M72A 2H66A 1XWAA 2YWIA 1GLQA 5DCGA 3TKPA 2LS5A 1O8XA 1T4YA 4X43A 5ECQB 1QUWA 2P5QA 3HCZA 5ID2B 1ZL9A 1XIYA 2C0FA 4AGSA 4ZB8A 4IP6A 2PPTA 3P90A 4YH2A 2HRNA 1XOBA 3GKNA 4EKZA 2RM5A 2YWOA 2TRCP 2IMEA 3RHCA 4MA9A 1TU7A 1FAAA 4RUVA 6GSXA 1O8WA 1GWCA 2R4VA 3RDWA 4NV2A 1PKZA 3UVTA 3HDCA 2GSTA 1VRSD 2IL3A 3L78A 1SL2B 3QAWA 1OC8A 1X9MB 2FY6A 1BAYA 3BD2A 5GZZB 1G7OA 1PN9A 4MZWA 3FZAA 1Z7PA 2YV9A 2VM1A 4GCIA 5ECHB 5H5SA 3GRXA 1A0FA 2F8AA 4I5QA 1PL1A 3KCMA 1YJ6A 3TKQA 2R6KA 5ECNB 5C04A 4IKHA 2PWJA 1XWGA 2H1DA 4H86A 3ZVJD 2HYXA 4EC0A 2R2JA 5CREA 2H19A 3UBLA 1UN2A 1M9AA 1UA5A 3ZTLA 3ZMLA 1AQVA 5D9VA 3L9UA 4CW9A 2CVDA 4WBJA 2X99A 2H70A 3O6TA 4F0BA 3VWXA 3QAVA 3VI7A 1MDJA 5KN1A 2IMKA 2LJAA 3ERWA 1G6YA 4EL1A 1WOUA 2OE1A 1K3LA 4O92A 4PQIA 1XW6A 2J9HA 4GQCA 1SJ6A 4XS1A 1BYEA 2CX3A 2VM2A 4MPFA 1TJDA 4MJAA 2YPMA 5AIVA 2H1AA 2PU9C 3KIJA 3KH7A 2MMNA 2IMDA 5E59A 1JZRA 1GUMA 5LD0A 3ZFBA 5J9CA 3HVVA 5CRGA 4QQ7A 2ZUPA 1ZZYA 4L0WA 2EIOA 2H8LA 4EVMA 1PL2A 4KH7A 1V40A 2C3NA 3BOAA 4IGJA 1WP0A 3W8JA 4HU9A 1NHOA 2AJQB 3AY8A 2KUCA 3ME7A 5FT3A 1EEJA 4XS4A 2A2SA 4HZ2A 1SKWB 1PA3A 2PBJA 2VL9A 4V1Ag 3OR5A 1Z3EA 3LORA 3LG6A 4WETA 5DBQA 3CTGA 2GDRA 1PRXA 3UIWA 1B9YC 2KP2A 2WDUA 1I9DA 2GT5A 3E9JB 2LEGA 2CX4A 3EU4A 4ECJA 3E0UA 3CBUA 2HE3A 2C1YA 3EU3A 1GNWA 4TR4A 1OE8A 3EURA 3ISOA 2JZSA 4NXIA 4CDOA 1A0RP 2DMLA 2JL4A 2TRXA 1RW1A 3APSA 4BPYA 2RM6A 3KGKA 3UBKA 1AUCA 3GV1A 3KMNA 2GVPA 4EUYA 2BJXA 3C1SA 1Q98A 1MD4A 3IRAA 2GZYA 2GS3A 2VD0A 2C4JA 3FY7A 2VL3A 2N5BA 3H79A 3GX0A 2LQOA 5G31A 4IBPA 2N5FA 4GQFA 3DMLA 2WFCA 1V9WA 1OVNA 3BCKA 4XRDA 1B4QA 1BQ7A 4G9HA 2B1LA 5D73A 2H75A 3D6IA 1S3AA 4FO5A 4JEDA 5B8BA 5GAPD 2VAFA 1TI3A 5DCHA 1GTIA 1DE1A 4KGIA 3GKKA 5F05A 2FUG2 4OCEA 4KDUA 3RBTA 3KTBA 6GSUA 4LL1B 2MYGA 3A5WA 3NOFA 4DSQA 1Z5YE 3LJRA 4MH3A 1OAZA 2MZCA 2D2ZA 4PUFC 2YANA 4L0UA 1X5EA 2KHPA 2E7PA 4GLTA 4PXOA 1RQMA 3D4MA 1SK0A 4KSMA 2QKEA 1ERVA 1K0CA 6GSVA 3FR6A 5B8AA 3GFKA 2AYTA 2LNTA 5AN1A 3NZNA 2DJ0A 2EIRA 1XWBA 4KAEA 3ME8A 5A4WA 5ELAA 3RPPA 3IOSA 2G0FA 3EC3A 3HZ4A 3IHQA 2NTOA 3QFBC 3H8QA 4IW9A 3I9V2 6GSTA 3F4SA 1ERWA 2QSIA 4HU7A 14GSA 1GSUA 2FHEA 2H6XA 3VLNA 3UOMA 2E2MA 3DRNA 1AIUA 2HSHA 4GSSA 3RHBA 2CQ9A 2OA7A 2HI7A 2FCHA 2H72A 3IAM2 4K7NA 4MCUA 4WEYA 4GWRA 4RQXA 4ZL7A 4GSNA 2OJLA 3EMPA 1H75A 1JZDA 1O6JA 4J57E 4DEJA 1K0NA 3ZYWA 3FR3A 1ERTA 3P2AA 1SU9A 4PX1A 1XVWA 3M9JA 5IIZA 3Q18A 3ZIJA 5IMAA 3J7Yk 4HDEA 1Z7RA 1LU4A 2VCTA 3VWWA 5G1KA 2I81A 4KDYA 4K9ZA 5IPGA 1O7UA 3ZLPA 5CRHA 4WXTA 1FB6A 5HQPA 1YEXA 5J3RA 6GSSA 3TJKA 2RLIA 2F3MA 1R7HA 3QFAC 1ON4A 1TK5B 3SWLA 4WF5A 4AJ7A 3VFIA 3KP8A 2CVBA 1N2AA 3CRUA 2H71A 2RIIA 1G6WA 2PERA 1IYHA 3IK9A 4RI6A 1PX6A 5A5KA 2LJKA 1YZXA 3N9JA 2C0GA 2IWTA 5DALA 5JCGA 3KMOA 5G30A 4G19A 3HD5A 4BVXA 1YKAA 1F37A 4MH2A 4GF0A 1GUKA 4I2UA 1TDIA 4TOPA 2A4VA 20GSA 4MF5A 5CNWA 3HJPA 2PVQA 4BVYA 3HJMA 1USBA 3P7XA 4F2IA 4IVFA 1FVJA 3IA1A 1M2AA 4L5LA 1T8EB 3F4RA 3C71A 2CAIA 5G1LA 3N5OA 4O5RA 3FYGA 2F8FA 2FGXA 3RPNA 5D9TA 1MEKA 1I5GA 1ZCPA 3F6FA 1A2JA 3DD3A 4TN8A 2K18A 3A3TA 5G2ZA 1EV4A 1PKWA 2IJYA 2R5GA 5G5FA 2VD1A 3QCPA 1EP8A 3QDNA 1OYJA 4HS1A 4ZILA 4FYCA 2HFDA 3TKSC 19GSA 4MP4A 3M8NA 1TKDB 1RK4A 2NVLA 4PGTA 1E6BA 4F0CA 2H0IA 4XS4B 4TR0A 1GP1A 3TKSE 2N5AA 5F07A 3H4KA 2JSZA 4WR5A 4JR6A 3UL3A 1GLPA 1XBSA 4XHMA 3FZ4A 3L9SA 5AGYA 3VPQA 5IOWA 4L8EA 4MDCA 3LFLA 2CA8A 3BCIA 3UAPA 12GSA 3QAGA 2VLUA 4OMVA 1MDKA 4IQAA 2LQQA 2GSRA 2DBCA 4MLYA 3D4TA 2H76A 4HQZA 4WKWA 10GSA 2E2GA 4QL7A 3BJ5A 5DDLA 4MZBA 3VI5A 3TJFA 1H4OA 2WB9A 3Q6OA 1J9BA 1M9BA 2DJKA 2H30A 1QXHA 1KNGA 2FWFA 3LYPA 5CP1A 3VWVA 1Z6NA 3GNJA 4PQ1A 5D93A 5ELGA 5JWQB 2HZEA 2DMMA 3J7Yb 5KN2A 1SK1A 22GSA 2XHFA 4TR3A 2AUVA 1K0MA 1FO5A 2PN8A 4NV5A 1PX7A 3DYRA 4ISDA 1AQXA 4ZBBA 4HJ2A 3ZFLA 2L57A 2EC4A 3VWUA 4QL9A 1WWJA 3F3QA 1TK8B 4FIWA 3MDKA 1GUHA 2CZ3A 18GSA 3M1GA 1Y6EA 4LMWA 1HNCA 1SYRA 1O81A 3G7IA 2MBTA 8GSSA 1XW5A 4NAXA 4HUAA 3L9VA 1T7PB 6GSYA 3TJJA 2DC5A 3MAKA 1ERUA 1TTZA 4POBA 3GN3A 1SJIA 3PR8A 1TU8A 1TRVA 2B5EA 1M0UA 3FRCA 1F3BA 3ZZXA 5IO2A 3FW2A 5EVOA 4ZL9A 4PNFA 2GZZA 2V2GA 3FR9A 1FB0A 5ENUA 5CRDA 2VOCA 3IDVA 1XPVA 4F9ZA 3KJYA 2X8GA 3IE3A 2ON5A 4FYUA 3QMXA 2XC2A 4I8BA 4OO4A 3H93A 4HI7A 1F3AA 1GSFA 3MWHA 3TRPA 2BMXA 3RAZA 2IMIA 2F51A 3ZITA 1M99A 3A2WA 4PUAA 5G5EA 5HR2A 2B5YA 2DJ3A 4K7IA 4PURA 2LV3A 3LXZA 3C8EA 1MDIA 2CV4A 4ZB6A 1NM3A 1SL1B 4FYBA 3WGDA 2JSYA 1GSYA 1KEBA 1N8JA 3ZRDA 3BBYA 5KN0A 5J41A 1T1VA 2I9HA 4KCEA 5KEJA 4TXOB 2HSYA 1Q4JA 4MMMA 3LQ7A 3VURA 2BTOT 2ZCTA 2C80A 2PGTA 2WS2A 4ID0A 1XZOA 2XPEA 4EDZA 1SK2A 3HXSA 1S3CA 1WRYA 2VO4A 3IBHA 3LXTA 3TKSA 4IN0A 4ZIJA 5DVBA 3CRTA 2GTUA 4EO3A 5DAKA 3APQA 3TRQA 1XW9A 3WGEA 1HQOA 2OE3A 3FK8A 5J9BA 2O89A 2QC7A 3KD0A 1J0FA 1GSDA 3F3RA 1THOA 1ZYEA 3TOUA 5DALB 2JACA 5L71A 2H6YA 4MF6A 2VIMA 1FVKA 3EMXA 5CRWA 4TVEA 2DJ1A 4NHZA 2H0HA 4NMUA 1Y25A 2R3XA 5IMZA 3GKXA 4IS0A 1VF2A 3DIEA 1XWKA 3PH9A 4G10A 4JU5A 4OO5A 4BL7A 1THXA 4Q5NA 4I2TA 1IYIA 4E8EA 1MD3A 4Z7XA 1WJKA 4JRRA 3L4NA 4TW5A 1WMJA 2HLSA 2GZPA 1VF3A 1GNEA 3R2QA 4WBRD 5IMCA 3A2XA 2L59A 3TJBA 1GTBA 3D5JA 3ZMKA 3V1WA 3KXOA 3DEXA 4MJBA 5GSTA 4DSSA 1TRSA 3EWLA 3KEBA 1JHBA 1Z9HA 1X9WB 1TOFA 2DJJA 4AJ8A 3PGTA 5D96A 4WR4A 5ECMB 2DJ2A 1PD21 7GSSA 3CTFA 2OADA 2RUEA 3D21A 3L0HA 4OFNA 4BA7A 1ZYQB 2OACA 1LBKA 1X0RA 4GXZA 3QPMA 4MJCA 1JZOA 1PMTA 1GSSA 4MABA 3GTUA 1TW9A 4ACSA 1W89A 2VCWA 2K8SA 3O3TA 5HFGA 1QMVA 2LRTA 4BWSA 1B8XA 2CVKA 2WULA 3LYKA 3TUEA 4K1FA 1GULA 2P0GA 5COHA 4TXOA 1VF4A 2GT6A 2K8VA 3GX8A 4RI7A 1BG5A 4ILFA 1A2MA 1UVZA 2ZNMA 4POMA 2B3SA 2C3QA 4V2LA 3C7MA 1TP9A 5A4VA 4MK3A 1BX9A 2H1GA 2AAWA 3G9BA 2L4CA 1K3YA 2I3YA 3G7JA 1T4ZA 5GSSA 5HR1A 1U87A 1CQGA 6GSWA 4F82A 1A2LA 3TKRA 5JCWA 2C3TA 2XBIA 1T3BA 1UC7A 1XOAA 2G2QA 2HZEB 5ECKB 4K7OA 2OE0A 3GH9A 1MTCA 1X5CA 4HEA2 5J5NA 1SYXA 4N11A 4ZL8A 2KP1A 1SD9A 3C73A 2IFQA 3VK9A 2YP6A 2L5LA 2IIYA 2R37A 2B7KA 4IQ1A 5LCZA 1ZMAA 5CO3A 1TRWA 2LNSA 3TGZA 2WJUA 3M9KA 2TIRA 4NPBA 4Q5FA 1GL8A 1GH2A 1PQNA 1AQWA 2I4AA 3FHKA 4K0GA 3TCOA 3Q19A 5IO0A 1AAZA 3KTLA 1PGTA 1F6MC 1GTAA 3TJGA 1B4PA 3F4TA 3D22A 2LRNA 4ECCA 4V2MA 1FG4A 1SENA 2FNOA 5H5RA 3P8WA 5C00A 1SKRB 4K8MA 4JZQA 1GSEA 3TDGA 4ECBA 2REMA 2XPDA 2GGTA 3GKMA 4ML6A 4TXVA 5JWRB 2YOIA 2ES7A 1FW1A 4ZBAA 1TRUA 5EY6A 3TRXA 2AB6A 2H1BA 2DSAA 1EZKA 2YN1A 4OCFA 2V6KA 5A4UA 5DJMA 4KCAA 2VL2C
chains in the Genus database with same CATH superfamily
1VF1A 2MBSA 2LUSA 5B6MA 1AXDA 3IPZA 4KUNA 3EINA 1V58A 2FWHA 4MJEA 3HJOA 1M7TA 4GRFA 4E8HA 3A2VA 3HVNA 4LA1A 4LL4B 3GH6A 3HA9A 4HZ4A 2H73A 1BEDA 1HNAA 2IPAA 3IK7A 1BJXA 3HYPA 2RUFA 2VCVA 4TR1A 3CXGA 1X9SB 2B7JA 4F03A 1K0DA 5D8IA 1G7EA 5ECRB 2HNLA 1WIKA 1B9XC 4GSTA 2C8UA 2GSQA 2YZUA 3CSJA 5J4UA 2O8VB 4ZBDA 2LTKA 4NHWA 1TK0B 4JBBA 1R26A 5BRTA 1KBNA 3FZ5A 1HNBA 4I6XA 2YJHA 3LEFA 5DAKB 13GSA 2MMOA 1ABAA 1E2YA 3M0FA 2M80A 2XBQA 3GSSA 1YKCA 3K8NA 4G2EA 1LJRA 4X1UA 1DUGA 4JR4A 4WF4A 1CQHA 5ECIB 1R5PA 3LWAA 1A8YA 1YY7A 2LRCA 1OC9A 2DIYA 1SD8A 4KDXA 4N0VA 5ECPB 1AW9A 5HR0A 2VUPA 2MMAA 3ED3A 2K6VA 1Z6MA 3CMIA 1GSQA 3VPTA 4BL7B 2CZ2A 1SL0B 16GSA 2OBIA 1YF1A 3MNGA 4Q5QA 3ERFA 4AJ6A 3FZ9A 2NDOA 4K2XA 4MPGA 3D0ZA 3GUSA 2P31A 1OKTA 5D9WA 2DKIA 2WZ9A 3APOA 3SBCA 3U5RE 4HSCX 4FH8A 5B6NA 4RQRA 4X0XA 4DSSB 1K3OA 1V57A 5JCUA 3WYWA 2GQLA 1K0BA 3QD9A 4O32A 4XS6A 2IN3A 3ZVJA 2HRFA 2H0GA 5EL8A 5ECSA 2VCXA 3QOUA 4KA0A 2V1MA 2PMTA 5GAND 2I1UA 4N10A 5E4WA 2F9SA 1KTEA 3F6DA 1R5AA 4XRAA 1XXUA 1EGOA 5AIXA 1FOVA 2Z9SA 2L5OA 4KSOA 4NWYA 1EP7A 4I97A 5ID2A 3KP9A 1EV9A 1PSQA 2DLXA 2L4QA 3IXRA 1SJZA 2X64A 1O85A 4KX4A 3IR4A 5KOXA 3GTUB 3EE2A 2V32A 3O76A 4IHUA 3DVWA 4LMVA 4YAVA 3DGQA 4EE0A 1EGRA 2OBKA 4TKYA 3F9UA 2V41A 4AF2A 1DSBA 3NIVA 1YQ1A 4V1Ap 3ERGA 2VCZA 3GURA 4D73B 2J23A 1M2DA 3GSTA 4OD7A 2L6DA 3IAS2 2H74A 5LNKe 4MZCA 3W8SA 3WT2A 4O5UA 2C0DA 3DXBA 1EOGA 1GTUA 4J2FA 3I69A 5F0GA 5DQSA 2GQMA 4DSRA 3EYTA 1A8LA 4ML1A 2HSMA 3IV4A 2EIQA 4GTUA 5KOWA 2YWMA 2V6OA 1QFNA 2JADA 1ST9A 4IJIA 1QGVA 2O85A 2B6MA 1OE7A 1G0TA 2YNXA 3F8UA 3IC4A 3G7YA 4IELA 3KZQA 2WGRA 3F63A 1ZGNA 1WPIA 2GSSA 3W6GA 2M46A 1V98A 1YDKA 4K5SA 4OWYA 2CT6A 2VL2A 2LJRA 4HOJA 4ZB9A 2IFQB 3JCML 5IMDA 4N30A 2VLTA 4YQUA 4KE3A 4PNGA 1SKSB 3TB2A 5D9XA 3DWVA 1FOHA 2KOKA 4ULXA 3GA4A 2C0EA 2DIZA 4YQMA 2JU5A 1XWCA 1A24A 1AC1A 4KNDA 3UMAA 5ECLB 2X8CA 2JZTA 5DQYA 3QR6A 5ABRA 2AV4A 17GSA 3MSZA 3MYDA 2P5RA 4POKA 3C1RA 3HVXA 1XFLA 3WT1A 2YZHA 1JFUA 3EVIA 2HZFA 5IQYA 2FD3A 4EDYA 1JLWA 1QQ2A 2X8HA 2GQKA 2NBSA 2YCDA 4Q5RA 2IMFA 2L6CA 3HVSA 5INYA 3CSIA 3WGXA 3UEMA 5HR3A 3HZ8A 3LSZA 2NPBA 2H01A 3S9FA 2JZRA 4YAPA 1YF0A 5CAXA 2CAQA 1EEMA 1TXXA 4TRXA 5HFIA 1NSWA 5HFKA 4EXJA 3CYNA 2FWGA 2VLVA 4MF7A 1O73A 4FQUA 2FA4A 4D73A 2QGVA 3KH9A 1R4WA 1WE0A 4ZXGA 4N0ZA 1QK8A 1XVQA 1J08A 2O7KA 2YWNA 1GRXA 3GIXA 3HHVA 2KLXA 2O87A 5FHIA 2B1KA 4KW6A 4XTSA 2WCIA 1HD2A 11GSA 3US3A 2LSTA 4XIHA 3M3MA 1M2BA 4TR1B 1S3DA 1A23A 4KB3A 3KM6A 1JZWA 5FWGA 5IPHA 4ECIA 4CHSA 4P3YB 2A4HA 4XCSA 2E0QA 2FWEA 1NW2A 5CYYA 1OKDA 4K2DA 4PQHA 1HYUA 4OFTA 5AISA 5KN3A 5B7CA 1TI1A 2PVOC 1VGLA 5DJLA 5IMFA 5ECOB 4HJMA 1C72A 1NHYA 3F0IA 3GL5A 2HXKA 4EF0A 1FHEA 2UZ8A 1U3AA 3U6VA 3I43A 3H1NA 3FKFA 3HKRA 4OFMA 4J56E 1XCCA 2H6ZA 2YV7A 1T00A 3ZL5A 3WD6A 4YKFA 3ZIVA 3R3EA 3CSHA 4K0NA 1ZOFA 2K9FA 1F2EA 2ALBA 4YQVA 1EOHA 3TOTA 1URMA 2A2RA 2PUKC 1OC9B 4O5QA 1K0OA 3E3EA 3UJ1A 1ILOA 2HT9A 2LKUA 4JE1A 4L5OA 2FA8A 1OC3A 9GSSA 1YEPA 5IOXA 1B48A 3GYKA 4K6XA 1U3IA 2AHEA 3HY2A 5IM9A 3DKSA 1DBYA 2ON7A 3LGCA 5EPFA 3FEUA 4BWQA 1DE2A 1ML6A 2FLSA 3PINA 3UVHA 3GMFA 4HQSA 1JLVA 1F9MA 2R0CA 2YJ7A 4O7HA 1X5DA 1U6TA 1W4VA 4EIQA 1V2AA 4DVCA 2WRTA 5IMVA 5H5QA 2VCQA 1K0AA 5JWOB 5F06A 2B5XA 2OKAA 1EWXA 2MMZA 4IP1A 5F8BA 3DVXA 4LLRA 3I6AA 4IJ3A 4V2NA 2GLRA 1U88A 3UARA 3Q74A 1ACVA 3ZREA 3GHAA 4POLA 3GL3A 2M72A 2H66A 1XWAA 2YWIA 1GLQA 5DCGA 3TKPA 2LS5A 1O8XA 1T4YA 4X43A 5ECQB 1QUWA 2P5QA 3HCZA 5ID2B 1ZL9A 1XIYA 2C0FA 4AGSA 4ZB8A 4IP6A 2PPTA 3P90A 4YH2A 2HRNA 1XOBA 3GKNA 1M3IA 4EKZA 2RM5A 2YWOA 2TRCP 2IMEA 3RHCA 4MA9A 1TU7A 1FAAA 4RUVA 6GSXA 1O8WA 1GWCA 2R4VA 3RDWA 4NV2A 1PKZA 3UVTA 3HDCA 2GSTA 1VRSD 2IL3A 3L78A 1SL2B 3QAWA 1OC8A 1X9MB 2FY6A 1BAYA 3BD2A 5GZZB 1G7OA 1PN9A 4MZWA 2X49A 3FZAA 1Z7PA 2YV9A 2VM1A 4GCIA 5ECHB 5H5SA 3GRXA 1A0FA 2F8AA 4I5QA 1PL1A 3KCMA 1YJ6A 3TKQA 2R6KA 5ECNB 5C04A 4IKHA 2PWJA 4MNNA 1XWGA 2H1DA 4H86A 3LW9A 3ZVJD 2HYXA 4EC0A 2R2JA 5CREA 2R0GA 2H19A 3UBLA 1UN2A 1M9AA 1UA5A 3ZTLA 3ZMLA 1AQVA 5D9VA 3L9UA 4CW9A 4G0IA 2CVDA 4WBJA 2X99A 2H70A 3O6TA 4F0BA 4X4JA 3VWXA 3QAVA 3VI7A 1MDJA 5KN1A 2IMKA 2LJAA 3ERWA 1G6YA 4EL1A 1WOUA 2OE1A 1K3LA 4O92A 4PQIA 1XW6A 2J9HA 4GQCA 1SJ6A 4XS1A 1BYEA 2CX3A 2VM2A 4MPFA 1TJDA 5BMUA 4MJAA 2YPMA 5AIVA 2H1AA 2PU9C 3KIJA 3KH7A 2MMNA 2IMDA 5E59A 1JZRA 1GUMA 5LD0A 3ZFBA 5J9CA 3HVVA 5CRGA 4QQ7A 2ZUPA 1ZZYA 4L0WA 2EIOA 2H8LA 4EVMA 1PL2A 4KH7A 1V40A 2C3NA 3BOAA 4IGJA 4USSA 1WP0A 3W8JA 1ZYPA 4HU9A 1NHOA 2AJQB 3AY8A 2KUCA 3ME7A 5FT3A 1EEJA 4XS4A 2A2SA 2HRKA 4HZ2A 1SKWB 1PA3A 2PBJA 2VL9A 4V1Ag 3OR5A 1Z3EA 3LORA 3LG6A 4WETA 5DBQA 3CTGA 2GDRA 1PRXA 3UIWA 1B9YC 2KP2A 2WDUA 1I9DA 2GT5A 3E9JB 2LEGA 2CX4A 3EU4A 4ECJA 3E0UA 3CBUA 2HE3A 2C1YA 3EU3A 1GNWA 4TR4A 1OE8A 3EURA 3ISOA 2JZSA 4NXIA 4CDOA 1A0RP 3PPUA 2DMLA 2JL4A 2TRXA 1RW1A 3APSA 4BPYA 2RM6A 3KGKA 3UBKA 1AUCA 3GV1A 3KMNA 2GVPA 4EUYA 2BJXA 3C1SA 1Q98A 1MD4A 3IRAA 2GZYA 2GS3A 2VD0A 2C4JA 3FY7A 2VL3A 2N5BA 3H79A 3GX0A 2LQOA 5G31A 4IBPA 2N5FA 4GQFA 3DMLA 2WFCA 1PFOA 1V9WA 1OVNA 3BCKA 4XRDA 1B4QA 4EIPA 1BQ7A 4G9HA 2B1LA 5D73A 2H75A 3D6IA 1S3AA 4FO5A 4JEDA 5B8BA 5GAPD 2VAFA 1TI3A 5DCHA 1GTIA 1DE1A 4KGIA 3GKKA 5F05A 2FUG2 4OCEA 4KDUA 3RBTA 3KTBA 6GSUA 4LL1B 2MYGA 3A5WA 3IC8A 3NOFA 4DSQA 1Z5YE 3LJRA 4MH3A 1OAZA 2MZCA 2D2ZA 4PUFC 2YANA 4L0UA 1X5EA 2KHPA 2E7PA 4GLTA 4PXOA 1RQMA 3D4MA 1SK0A 4KSMA 2QKEA 1ERVA 1K0CA 6GSVA 3FR6A 5B8AA 3GFKA 2AYTA 2LNTA 5AN1A 3NZNA 2DJ0A 2EIRA 1XWBA 4KAEA 3ME8A 5A4WA 5ELAA 3RPPA 3IOSA 2G0FA 3EC3A 3HZ4A 3IHQA 2NTOA 3QFBC 3H8QA 4IW9A 3I9V2 6GSTA 3CQFA 3F4SA 1ERWA 2QSIA 4HU7A 14GSA 3MIXA 1GSUA 2FHEA 2H6XA 3VLNA 3UOMA 4G0KA 2E2MA 3DRNA 1AIUA 2HSHA 4GSSA 3RHBA 2CQ9A 2OA7A 2HI7A 2FCHA 2H72A 3IAM2 4K7NA 4MCUA 4WEYA 4GWRA 4RQXA 4ZL7A 4GSNA 2OJLA 3EMPA 1H75A 1JZDA 1O6JA 4J57E 4DEJA 1K0NA 3ZYWA 3FR3A 1ERTA 3P2AA 1SU9A 4PX1A 1XVWA 3M9JA 5IIZA 3Q18A 3ZIJA 4ICYA 5IMAA 3J7Yk 4HDEA 3A5IA 1Z7RA 1LU4A 2VCTA 3VWWA 5G1KA 2I81A 4KDYA 4K9ZA 5IPGA 1O7UA 4Z2TA 1S3RA 3ZLPA 5CRHA 4WXTA 1FB6A 5HQPA 1YEXA 5J3RA 6GSSA 3TJKA 2RLIA 2F3MA 1R7HA 3QFAC 1ON4A 1TK5B 3SWLA 4WF5A 4AJ7A 3VFIA 3KP8A 2CVBA 1N2AA 3CRUA 2H71A 2RIIA 1G6WA 2PERA 1IYHA 3IK9A 4RI6A 1PX6A 5A5KA 2LJKA 1YZXA 3N9JA 2C0GA 2IWTA 5DALA 5JCGA 3KMOA 5G30A 4G19A 3HD5A 4BVXA 1YKAA 1F37A 4MH2A 4GF0A 1GUKA 4I2UA 1TDIA 4TOPA 2A4VA 20GSA 4MF5A 5CNWA 3HJPA 2PVQA 4BVYA 3HJMA 1USBA 3P7XA 4F2IA 4IVFA 1FVJA 3IA1A 1M2AA 4L5LA 1T8EB 3F4RA 3C71A 2CAIA 5G1LA 3N5OA 4O5RA 3FYGA 2F8FA 2FGXA 3RPNA 5D9TA 1MEKA 1I5GA 1ZCPA 4G0LA 3F6FA 4KF9A 1A2JA 3DD3A 4TN8A 2K18A 3A3TA 5G2ZA 1EV4A 1PKWA 2IJYA 2R5GA 5G5FA 2VD1A 3QCPA 1EP8A 3QDNA 1OYJA 4HS1A 4ZILA 4FYCA 2HFDA 3TKSC 19GSA 4MP4A 3M8NA 1TKDB 1RK4A 2NVLA 4PGTA 1E6BA 4F0CA 2H0IA 4XS4B 4TR0A 1GP1A 3TKSE 2N5AA 5F07A 3H4KA 2JSZA 4WR5A 4JR6A 3UL3A 1GLPA 1XBSA 4XHMA 3FZ4A 3L9SA 5AGYA 3VPQA 5IOWA 4L8EA 4MDCA 3LFLA 2CA8A 3BCIA 3UAPA 12GSA 3QAGA 2VLUA 4OMVA 1MDKA 4IQAA 2LQQA 2GSRA 2DBCA 4MLYA 3D4TA 2H76A 4HQZA 4K5RA 4WKWA 10GSA 3EPTA 2E2GA 4QL7A 3BJ5A 5DDLA 4MZBA 3VI5A 3TJFA 1H4OA 2WB9A 3Q6OA 1J9BA 1M9BA 2DJKA 2H30A 1QXHA 1KNGA 2FWFA 3LYPA 5CP1A 3VWVA 1Z6NA 3GNJA 4PQ1A 5D93A 5ELGA 5JWQB 2HZEA 2DMMA 3J7Yb 5KN2A 1SK1A 22GSA 2XHFA 4TR3A 2AUVA 1K0MA 1FO5A 2PN8A 4NV5A 1PX7A 3DYRA 4ISDA 1AQXA 4ZBBA 4HJ2A 3ZFLA 4CY6A 2L57A 1ZYNA 2EC4A 3VWUA 4QL9A 1WWJA 3F3QA 3IHGA 2QA1A 1TK8B 4FIWA 3MDKA 1GUHA 2CZ3A 18GSA 3M1GA 1Y6EA 4LMWA 1HNCA 1SYRA 1O81A 3G7IA 2MBTA 8GSSA 1XW5A 2A2PA 4NAXA 4HUAA 3L9VA 1T7PB 6GSYA 3TJJA 2DC5A 3MAKA 1ERUA 1TTZA 4POBA 3GN3A 1SJIA 3PR8A 1TU8A 1TRVA 2B5EA 1M0UA 3FRCA 1F3BA 3ZZXA 5IO2A 3FW2A 5EVOA 4ZL9A 4PNFA 2GZZA 2V2GA 3FR9A 1FB0A 5ENUA 5CRDA 2VOCA 3IDVA 1XPVA 4F9ZA 3KJYA 2X8GA 3IE3A 2ON5A 4FYUA 3QMXA 2XC2A 4I8BA 1M3JA 4BIKA 4OO4A 3H93A 4HI7A 1F3AA 1GSFA 3MWHA 3TRPA 2BMXA 3RAZA 2IMIA 2F51A 3ZITA 1M99A 3A2WA 4PUAA 5G5EA 5HR2A 2B5YA 2DJ3A 4K7IA 4PURA 2LV3A 3LXZA 3C8EA 1MDIA 2CV4A 4ZB6A 1NM3A 1SL1B 4FYBA 3WGDA 2JSYA 1GSYA 1KEBA 1N8JA 3ZRDA 3BBYA 5KN0A 5J41A 1T1VA 2I9HA 4KCEA 5KEJA 4TXOB 2HSYA 1Q4JA 2DKHA 4MMMA 3LQ7A 3VURA 2BTOT 2ZCTA 2C80A 2PGTA 2WS2A 4ID0A 1XZOA 2XPEA 4EDZA 1SK2A 3HXSA 1S3CA 1WRYA 2VO4A 3IBHA 3LXTA 3TKSA 4IN0A 4ZIJA 5DVBA 3CRTA 2GTUA 4EO3A 5DAKA 3APQA 3TRQA 1XW9A 3WGEA 1HQOA 2OE3A 3FK8A 5J9BA 2O89A 2QC7A 3KD0A 1J0FA 1GSDA 3F3RA 1THOA 1ZYEA 3TOUA 5DALB 2JACA 5L71A 2H6YA 4MF6A 2VIMA 4BVXB 1FVKA 3EMXA 5CRWA 4TVEA 2DJ1A 4NHZA 2H0HA 4NMUA 1Y25A 2R3XA 5IMZA 3GKXA 4IS0A 1VF2A 3DIEA 4PTSA 1XWKA 4BVYB 3PH9A 4G10A 4JU5A 4OO5A 4BL7A 1THXA 4Q5NA 4I2TA 1IYIA 4E8EA 1MD3A 4Z7XA 1WJKA 4JRRA 3L4NA 4TW5A 1WMJA 2HLSA 2GZPA 1VF3A 1GNEA 3R2QA 3FMWA 4WBRD 5IMCA 3A2XA 2L59A 3TJBA 1GTBA 3D5JA 3ZMKA 3V1WA 3KXOA 3DEXA 4MJBA 5GSTA 4DSSA 1TRSA 3EWLA 3KEBA 4Z2RA 1JHBA 1Z9HA 1X9WB 1TOFA 2DJJA 4AJ8A 3PGTA 5D96A 4WR4A 4CY8A 5ECMB 2DJ2A 1PD21 7GSSA 3CTFA 2OADA 2RUEA 3D21A 3L0HA 4OFNA 4BA7A 4Z2UA 1ZYQB 2OACA 1LBKA 1X0RA 4GXZA 3QPMA 4MJCA 1JZOA 1PMTA 1GSSA 4MABA 3GTUA 1TW9A 4ACSA 1W89A 2VCWA 2K8SA 3O3TA 5HFGA 1QMVA 2LRTA 4BWSA 1B8XA 2CVKA 2WULA 4YKGA 3LYKA 3TUEA 4K1FA 1GULA 2P0GA 5COHA 4TXOA 1VF4A 2GT6A 2K8VA 3GX8A 4RI7A 1BG5A 4ILFA 1A2MA 1UVZA 2ZNMA 4POMA 2B3SA 2C3QA 4V2LA 3C7MA 1TP9A 5A4VA 4MK3A 1BX9A 2H1GA 2AAWA 3G9BA 2L4CA 1K3YA 2I3YA 3G7JA 1T4ZA 5GSSA 5HR1A 1U87A 1CQGA 6GSWA 4F82A 1A2LA 3TKRA 5JCWA 2C3TA 2XBIA 1T3BA 1UC7A 1XOAA 2G2QA 2HZEB 5ECKB 4K7OA 2OE0A 3GH9A 1MTCA 1X5CA 2X4AA 4HEA2 5J5NA 2R0PA 1SYXA 4N11A 4ZL8A 2KP1A 2HRAA 1SD9A 3C73A 2IFQA 3VK9A 2YP6A 2L5LA 2IIYA 2R37A 2B7KA 4IQ1A 5LCZA 1ZMAA 5CO3A 1TRWA 2LNSA 3TGZA 2WJUA 3M9KA 1PN0A 2TIRA 4NPBA 4Q5FA 1GL8A 1GH2A 1PQNA 1AQWA 2I4AA 3FHKA 4K0GA 1XG8A 3TCOA 3Q19A 5IO0A 1AAZA 3KTLA 1PGTA 1F6MC 1GTAA 3TJGA 1B4PA 3F4TA 3D22A 2LRNA 4ECCA 4V2MA 1FG4A 1SENA 2FNOA 5H5RA 3P8WA 5C00A 1SKRB 4K8MA 4JZQA 1GSEA 3TDGA 4ECBA 2REMA 2XPDA 2QA2A 2GGTA 3GKMA 4ML6A 4TXVA 5JWRB 2YOIA 2ES7A 1FW1A 4ZBAA 1TRUA 5EY6A 3TRXA 2AB6A 2H1BA 4A5PA 2DSAA 1EZKA 2YN1A 4OCFA 2V6KA 5A4UA 5DJMA 4KCAA 2VL2C
chains in the Genus database with same CATH topology
1VF1A 2MBSA 2LUSA 5B6MA 1AXDA 3IPZA 4KUNA 3EINA 1V58A 2FWHA 4MJEA 3HJOA 1M7TA 4GRFA 4E8HA 3A2VA 4LA1A 4LL4B 3GH6A 3HA9A 4HZ4A 2H73A 1BEDA 1HNAA 2IPAA 3IK7A 1BJXA 3HYPA 2RUFA 2VCVA 4TR1A 3CXGA 1X9SB 2B7JA 4F03A 1K0DA 5D8IA 1G7EA 5ECRB 2HNLA 1WIKA 1B9XC 4GSTA 2C8UA 2GSQA 2YZUA 3CSJA 5J4UA 2O8VB 4ZBDA 2LTKA 4NHWA 1TK0B 4JBBA 1R26A 5BRTA 1KBNA 3FZ5A 1HNBA 4I6XA 2YJHA 3LEFA 5DAKB 13GSA 2MMOA 1ABAA 1E2YA 3M0FA 2M80A 2XBQA 3GSSA 1YKCA 3K8NA 4G2EA 1LJRA 4X1UA 1DUGA 4JR4A 4WF4A 1CQHA 5ECIB 1R5PA 3LWAA 1A8YA 1YY7A 2LRCA 1OC9A 2DIYA 1SD8A 4KDXA 4N0VA 5ECPB 1AW9A 5HR0A 2VUPA 2MMAA 3ED3A 2K6VA 1Z6MA 3CMIA 1GSQA 3VPTA 4BL7B 2CZ2A 1SL0B 16GSA 2OBIA 1YF1A 3MNGA 4Q5QA 3ERFA 4AJ6A 3FZ9A 2NDOA 4K2XA 4MPGA 3D0ZA 3GUSA 2P31A 1OKTA 5D9WA 2DKIA 2WZ9A 3APOA 3SBCA 3U5RE 4FH8A 5B6NA 4RQRA 4X0XA 4DSSB 1K3OA 1V57A 5JCUA 3WYWA 2GQLA 1K0BA 3QD9A 4O32A 4XS6A 2IN3A 3ZVJA 2HRFA 2H0GA 5EL8A 5ECSA 2VCXA 3QOUA 4KA0A 2V1MA 2PMTA 5GAND 2I1UA 4N10A 5E4WA 2F9SA 1KTEA 3F6DA 1R5AA 4XRAA 1XXUA 1EGOA 5AIXA 1FOVA 2Z9SA 2L5OA 4KSOA 4NWYA 1EP7A 4I97A 5ID2A 3KP9A 1EV9A 1PSQA 2DLXA 2L4QA 3IXRA 1SJZA 2X64A 1O85A 4KX4A 3IR4A 5KOXA 3GTUB 3EE2A 2V32A 3O76A 4IHUA 3DVWA 4LMVA 4YAVA 3DGQA 4EE0A 1EGRA 2OBKA 4TKYA 3F9UA 2V41A 4AF2A 1DSBA 3NIVA 1YQ1A 4V1Ap 3ERGA 2VCZA 3GURA 4D73B 2J23A 1M2DA 3GSTA 4OD7A 2L6DA 3IAS2 2H74A 5LNKe 4MZCA 3W8SA 3WT2A 4O5UA 2C0DA 3DXBA 1EOGA 1GTUA 4J2FA 3I69A 5F0GA 5DQSA 2GQMA 4DSRA 3EYTA 1A8LA 4ML1A 2HSMA 3IV4A 2EIQA 4GTUA 5KOWA 2YWMA 2V6OA 1QFNA 2JADA 1ST9A 4IJIA 1QGVA 2O85A 2B6MA 1OE7A 1G0TA 2YNXA 3F8UA 3IC4A 3G7YA 4IELA 3KZQA 2WGRA 3F63A 1ZGNA 1WPIA 2GSSA 3W6GA 2M46A 1V98A 1YDKA 4K5SA 4OWYA 2CT6A 2VL2A 2LJRA 4HOJA 4ZB9A 2IFQB 3JCML 5IMDA 4N30A 2VLTA 4YQUA 4KE3A 4PNGA 1SKSB 3TB2A 5D9XA 3DWVA 1FOHA 2KOKA 4ULXA 3GA4A 2C0EA 2DIZA 4YQMA 2JU5A 1XWCA 1A24A 1AC1A 4KNDA 3UMAA 5ECLB 2X8CA 2JZTA 5DQYA 3QR6A 5ABRA 2AV4A 17GSA 3MSZA 3MYDA 2P5RA 4POKA 3C1RA 3HVXA 1XFLA 3WT1A 2YZHA 1JFUA 3EVIA 2HZFA 5IQYA 2FD3A 4EDYA 1JLWA 1QQ2A 2X8HA 2GQKA 2NBSA 2YCDA 4Q5RA 2IMFA 2L6CA 3HVSA 5INYA 3CSIA 3WGXA 3UEMA 5HR3A 3HZ8A 3LSZA 2NPBA 2H01A 3S9FA 2JZRA 4YAPA 1YF0A 5CAXA 2CAQA 1EEMA 1TXXA 4TRXA 5HFIA 1NSWA 5HFKA 4EXJA 3CYNA 2FWGA 2VLVA 4MF7A 1O73A 4FQUA 2FA4A 4D73A 2QGVA 3KH9A 1R4WA 1WE0A 4ZXGA 4N0ZA 1QK8A 1XVQA 1J08A 2O7KA 2YWNA 1GRXA 3GIXA 3HHVA 2KLXA 2O87A 5FHIA 2B1KA 4KW6A 4XTSA 2WCIA 1HD2A 11GSA 3US3A 2LSTA 4XIHA 3M3MA 1M2BA 4TR1B 1S3DA 1A23A 4KB3A 3KM6A 1JZWA 5FWGA 5IPHA 4ECIA 4CHSA 4P3YB 2A4HA 4XCSA 2E0QA 2FWEA 1NW2A 5CYYA 1OKDA 4K2DA 4PQHA 1HYUA 4OFTA 5AISA 5KN3A 5B7CA 1TI1A 2PVOC 1VGLA 5DJLA 5IMFA 5ECOB 4HJMA 1C72A 1NHYA 3F0IA 3GL5A 2HXKA 4EF0A 1FHEA 2UZ8A 1U3AA 3U6VA 3I43A 3H1NA 3FKFA 3HKRA 4OFMA 4J56E 1XCCA 2H6ZA 2YV7A 1T00A 3ZL5A 3WD6A 4YKFA 3ZIVA 3R3EA 3CSHA 4K0NA 1ZOFA 2K9FA 1F2EA 2ALBA 4YQVA 1EOHA 3TOTA 1URMA 2A2RA 2PUKC 1OC9B 4O5QA 1K0OA 3E3EA 3UJ1A 1ILOA 2HT9A 2LKUA 4JE1A 4L5OA 2FA8A 1OC3A 9GSSA 1YEPA 5IOXA 1B48A 3GYKA 4K6XA 1U3IA 2AHEA 3HY2A 5IM9A 3DKSA 1DBYA 2ON7A 3LGCA 5EPFA 3FEUA 4BWQA 1DE2A 1ML6A 2FLSA 3PINA 3UVHA 3GMFA 4HQSA 1JLVA 1F9MA 2R0CA 2YJ7A 4O7HA 1X5DA 1U6TA 1W4VA 4EIQA 1V2AA 4DVCA 2WRTA 5IMVA 5H5QA 2VCQA 1K0AA 5JWOB 5F06A 2B5XA 2OKAA 1EWXA 2MMZA 4IP1A 5F8BA 3DVXA 4LLRA 3I6AA 4IJ3A 4V2NA 2GLRA 1U88A 3UARA 3Q74A 1ACVA 3ZREA 3GHAA 4POLA 3GL3A 2M72A 2H66A 1XWAA 2YWIA 1GLQA 5DCGA 3TKPA 2LS5A 1O8XA 1T4YA 4X43A 5ECQB 1QUWA 2P5QA 3HCZA 5ID2B 1ZL9A 1XIYA 2C0FA 4AGSA 4ZB8A 4IP6A 2PPTA 3P90A 4YH2A 2HRNA 1XOBA 3GKNA 4EKZA 2RM5A 2YWOA 2TRCP 2IMEA 3RHCA 4MA9A 1TU7A 1FAAA 4RUVA 6GSXA 1O8WA 1GWCA 2R4VA 3RDWA 4NV2A 1PKZA 3UVTA 3HDCA 2GSTA 1VRSD 2IL3A 3L78A 1SL2B 3QAWA 1OC8A 1X9MB 2FY6A 1BAYA 3BD2A 5GZZB 1G7OA 1PN9A 4MZWA 2X49A 3FZAA 1Z7PA 2YV9A 2VM1A 4GCIA 5ECHB 5H5SA 3GRXA 1A0FA 2F8AA 4I5QA 1PL1A 3KCMA 1YJ6A 3TKQA 2R6KA 5ECNB 5C04A 4IKHA 2PWJA 4MNNA 1XWGA 2H1DA 4H86A 3LW9A 3ZVJD 2HYXA 4EC0A 2R2JA 5CREA 2R0GA 2H19A 3UBLA 1UN2A 1M9AA 1UA5A 3ZTLA 3ZMLA 1AQVA 5D9VA 3L9UA 4CW9A 4G0IA 2CVDA 4WBJA 2X99A 2H70A 3O6TA 4F0BA 4X4JA 3VWXA 3QAVA 3VI7A 1MDJA 5KN1A 2IMKA 2LJAA 3ERWA 1G6YA 4EL1A 1WOUA 2OE1A 1K3LA 4O92A 4PQIA 1XW6A 2J9HA 4GQCA 1SJ6A 4XS1A 1BYEA 2CX3A 2VM2A 4MPFA 1TJDA 5BMUA 4MJAA 2YPMA 5AIVA 2H1AA 2PU9C 3KIJA 3KH7A 2MMNA 2IMDA 5E59A 1JZRA 1GUMA 5LD0A 3ZFBA 5J9CA 3HVVA 5CRGA 4QQ7A 2ZUPA 1ZZYA 4L0WA 2EIOA 2H8LA 4EVMA 1PL2A 4KH7A 1V40A 2C3NA 3BOAA 4IGJA 4USSA 1WP0A 3W8JA 1ZYPA 4HU9A 1NHOA 2AJQB 3AY8A 2KUCA 3ME7A 5FT3A 1EEJA 4XS4A 2A2SA 2HRKA 4HZ2A 1SKWB 1PA3A 2PBJA 2VL9A 4V1Ag 3OR5A 1Z3EA 3LORA 3LG6A 4WETA 5DBQA 3CTGA 2GDRA 1PRXA 3UIWA 1B9YC 2KP2A 2WDUA 1I9DA 2GT5A 3E9JB 2LEGA 2CX4A 3EU4A 4ECJA 3E0UA 3CBUA 2HE3A 2C1YA 3EU3A 1GNWA 4TR4A 1OE8A 3EURA 3ISOA 2JZSA 4NXIA 4CDOA 1A0RP 3PPUA 2DMLA 2JL4A 2TRXA 1RW1A 3APSA 4BPYA 2RM6A 3KGKA 3UBKA 1AUCA 3GV1A 3KMNA 2GVPA 4EUYA 2BJXA 3C1SA 1Q98A 1MD4A 3IRAA 2GZYA 2GS3A 2VD0A 2C4JA 3FY7A 2VL3A 2N5BA 3H79A 3GX0A 2LQOA 5G31A 4IBPA 2N5FA 4GQFA 3DMLA 2WFCA 1V9WA 1OVNA 3BCKA 4XRDA 1B4QA 4EIPA 1BQ7A 4G9HA 2B1LA 5D73A 2H75A 3D6IA 1S3AA 4FO5A 4JEDA 5B8BA 5GAPD 2VAFA 1TI3A 5DCHA 1GTIA 1DE1A 4KGIA 3GKKA 5F05A 2FUG2 4OCEA 4KDUA 3RBTA 3KTBA 6GSUA 4LL1B 2MYGA 3A5WA 3IC8A 3NOFA 4DSQA 1Z5YE 3LJRA 4MH3A 1OAZA 2MZCA 2D2ZA 4PUFC 2YANA 4L0UA 1X5EA 2KHPA 2E7PA 4GLTA 4PXOA 1RQMA 3D4MA 1SK0A 4KSMA 2QKEA 1ERVA 1K0CA 6GSVA 3FR6A 5B8AA 3GFKA 2AYTA 2LNTA 5AN1A 3NZNA 2DJ0A 2EIRA 1XWBA 4KAEA 3ME8A 5A4WA 5ELAA 3RPPA 3IOSA 2G0FA 3EC3A 3HZ4A 3IHQA 2NTOA 3QFBC 3H8QA 4IW9A 3I9V2 6GSTA 3F4SA 1ERWA 2QSIA 4HU7A 14GSA 3MIXA 1GSUA 2FHEA 2H6XA 3VLNA 3UOMA 4G0KA 2E2MA 3DRNA 1AIUA 2HSHA 4GSSA 3RHBA 2CQ9A 2OA7A 2HI7A 2FCHA 2H72A 3IAM2 4K7NA 4MCUA 4WEYA 4GWRA 4RQXA 4ZL7A 4GSNA 2OJLA 3EMPA 1H75A 1JZDA 1O6JA 4J57E 4DEJA 1K0NA 3ZYWA 3FR3A 1ERTA 3P2AA 1SU9A 4PX1A 1XVWA 3M9JA 5IIZA 3Q18A 3ZIJA 4ICYA 5IMAA 3J7Yk 4HDEA 3A5IA 1Z7RA 1LU4A 2VCTA 3VWWA 5G1KA 2I81A 4KDYA 4K9ZA 5IPGA 1O7UA 4Z2TA 3ZLPA 5CRHA 4WXTA 1FB6A 5HQPA 1YEXA 5J3RA 6GSSA 3TJKA 2RLIA 2F3MA 1R7HA 3QFAC 1ON4A 1TK5B 3SWLA 4WF5A 4AJ7A 3VFIA 3KP8A 2CVBA 1N2AA 3CRUA 2H71A 2RIIA 1G6WA 2PERA 1IYHA 3IK9A 4RI6A 1PX6A 5A5KA 2LJKA 1YZXA 3N9JA 2C0GA 2IWTA 5DALA 5JCGA 3KMOA 5G30A 4G19A 3HD5A 4BVXA 1YKAA 1F37A 4MH2A 4GF0A 1GUKA 4I2UA 1TDIA 4TOPA 2A4VA 20GSA 4MF5A 5CNWA 3HJPA 2PVQA 4BVYA 3HJMA 1USBA 3P7XA 4F2IA 4IVFA 1FVJA 3IA1A 1M2AA 4L5LA 1T8EB 3F4RA 3C71A 2CAIA 5G1LA 3N5OA 4O5RA 3FYGA 2F8FA 2FGXA 3RPNA 5D9TA 1MEKA 1I5GA 1ZCPA 4G0LA 3F6FA 4KF9A 1A2JA 3DD3A 4TN8A 2K18A 3A3TA 5G2ZA 1EV4A 1PKWA 2IJYA 2R5GA 5G5FA 2VD1A 3QCPA 1EP8A 3QDNA 1OYJA 4HS1A 4ZILA 4FYCA 2HFDA 3TKSC 19GSA 4MP4A 3M8NA 1TKDB 1RK4A 2NVLA 4PGTA 1E6BA 4F0CA 2H0IA 4XS4B 4TR0A 1GP1A 3TKSE 2N5AA 5F07A 3H4KA 2JSZA 4WR5A 4JR6A 3UL3A 1GLPA 1XBSA 4XHMA 3FZ4A 3L9SA 5AGYA 3VPQA 5IOWA 4L8EA 4MDCA 3LFLA 2CA8A 3BCIA 3UAPA 12GSA 3QAGA 2VLUA 4OMVA 1MDKA 4IQAA 2LQQA 2GSRA 2DBCA 4MLYA 3D4TA 2H76A 4HQZA 4K5RA 4WKWA 10GSA 3EPTA 2E2GA 4QL7A 3BJ5A 5DDLA 4MZBA 3VI5A 3TJFA 1H4OA 2WB9A 3Q6OA 1J9BA 1M9BA 2DJKA 2H30A 1QXHA 1KNGA 2FWFA 3LYPA 5CP1A 3VWVA 1Z6NA 3GNJA 4PQ1A 5D93A 5ELGA 5JWQB 2HZEA 2DMMA 3J7Yb 5KN2A 1SK1A 22GSA 2XHFA 4TR3A 2AUVA 1K0MA 1FO5A 2PN8A 4NV5A 1PX7A 3DYRA 4ISDA 1AQXA 4ZBBA 4HJ2A 3ZFLA 4CY6A 2L57A 1ZYNA 2EC4A 3VWUA 4QL9A 1WWJA 3F3QA 3IHGA 2QA1A 1TK8B 4FIWA 3MDKA 1GUHA 2CZ3A 18GSA 3M1GA 1Y6EA 4LMWA 1HNCA 1SYRA 1O81A 3G7IA 2MBTA 8GSSA 1XW5A 2A2PA 4NAXA 4HUAA 3L9VA 1T7PB 6GSYA 3TJJA 2DC5A 3MAKA 1ERUA 1TTZA 4POBA 3GN3A 1SJIA 3PR8A 1TU8A 1TRVA 2B5EA 1M0UA 3FRCA 1F3BA 3ZZXA 5IO2A 3FW2A 5EVOA 4ZL9A 4PNFA 2GZZA 2V2GA 3FR9A 1FB0A 5ENUA 5CRDA 2VOCA 3IDVA 1XPVA 4F9ZA 3KJYA 2X8GA 3IE3A 2ON5A 4FYUA 3QMXA 2XC2A 4I8BA 4OO4A 3H93A 4HI7A 1F3AA 1GSFA 3MWHA 3TRPA 2BMXA 3RAZA 2IMIA 2F51A 3ZITA 1M99A 3A2WA 4PUAA 5G5EA 5HR2A 2B5YA 2DJ3A 4K7IA 4PURA 2LV3A 3LXZA 3C8EA 1MDIA 2CV4A 4ZB6A 1NM3A 1SL1B 4FYBA 3WGDA 2JSYA 1GSYA 1KEBA 1N8JA 3ZRDA 3BBYA 5KN0A 5J41A 1T1VA 2I9HA 4KCEA 5KEJA 4TXOB 2HSYA 1Q4JA 2DKHA 4MMMA 3LQ7A 3VURA 2BTOT 2ZCTA 2C80A 2PGTA 2WS2A 4ID0A 1XZOA 2XPEA 4EDZA 1SK2A 3HXSA 1S3CA 1WRYA 2VO4A 3IBHA 3LXTA 3TKSA 4IN0A 4ZIJA 5DVBA 3CRTA 2GTUA 4EO3A 5DAKA 3APQA 3TRQA 1XW9A 3WGEA 1HQOA 2OE3A 3FK8A 5J9BA 2O89A 2QC7A 3KD0A 1J0FA 1GSDA 3F3RA 1THOA 1ZYEA 3TOUA 5DALB 2JACA 5L71A 2H6YA 4MF6A 2VIMA 4BVXB 1FVKA 3EMXA 5CRWA 4TVEA 2DJ1A 4NHZA 2H0HA 4NMUA 1Y25A 2R3XA 5IMZA 3GKXA 4IS0A 1VF2A 3DIEA 4PTSA 1XWKA 4BVYB 3PH9A 4G10A 4JU5A 4OO5A 4BL7A 1THXA 4Q5NA 4I2TA 1IYIA 4E8EA 1MD3A 4Z7XA 1WJKA 4JRRA 3L4NA 4TW5A 1WMJA 2HLSA 2GZPA 1VF3A 1GNEA 3R2QA 3FMWA 4WBRD 5IMCA 3A2XA 2L59A 3TJBA 1GTBA 3D5JA 3ZMKA 3V1WA 3KXOA 3DEXA 4MJBA 5GSTA 4DSSA 1TRSA 3EWLA 3KEBA 4Z2RA 1JHBA 1Z9HA 1X9WB 1TOFA 2DJJA 4AJ8A 3PGTA 5D96A 4WR4A 4CY8A 5ECMB 2DJ2A 1PD21 7GSSA 3CTFA 2OADA 2RUEA 3D21A 3L0HA 4OFNA 4BA7A 4Z2UA 1ZYQB 2OACA 1LBKA 1X0RA 4GXZA 3QPMA 4MJCA 1JZOA 1PMTA 1GSSA 4MABA 3GTUA 1TW9A 4ACSA 1W89A 2VCWA 2K8SA 3O3TA 5HFGA 1QMVA 2LRTA 4BWSA 1B8XA 2CVKA 2WULA 4YKGA 3LYKA 3TUEA 4K1FA 1GULA 2P0GA 5COHA 4TXOA 1VF4A 2GT6A 2K8VA 3GX8A 4RI7A 1BG5A 4ILFA 1A2MA 1UVZA 2ZNMA 4POMA 2B3SA 2C3QA 4V2LA 3C7MA 1TP9A 5A4VA 4MK3A 1BX9A 2H1GA 2AAWA 3G9BA 2L4CA 1K3YA 2I3YA 3G7JA 1T4ZA 5GSSA 5HR1A 1U87A 1CQGA 6GSWA 4F82A 1A2LA 3TKRA 5JCWA 2C3TA 2XBIA 1T3BA 1UC7A 1XOAA 2G2QA 2HZEB 5ECKB 4K7OA 2OE0A 3GH9A 1MTCA 1X5CA 2X4AA 4HEA2 5J5NA 2R0PA 1SYXA 4N11A 4ZL8A 2KP1A 2HRAA 1SD9A 3C73A 2IFQA 3VK9A 2YP6A 2L5LA 2IIYA 2R37A 2B7KA 4IQ1A 5LCZA 1ZMAA 5CO3A 1TRWA 2LNSA 3TGZA 2WJUA 3M9KA 1PN0A 2TIRA 4NPBA 4Q5FA 1GL8A 1GH2A 1PQNA 1AQWA 2I4AA 3FHKA 4K0GA 3TCOA 3Q19A 5IO0A 1AAZA 3KTLA 1PGTA 1F6MC 1GTAA 3TJGA 1B4PA 3F4TA 3D22A 2LRNA 4ECCA 4V2MA 1FG4A 1SENA 2FNOA 5H5RA 3P8WA 5C00A 1SKRB 4K8MA 4JZQA 1GSEA 3TDGA 4ECBA 2REMA 2XPDA 2QA2A 2GGTA 3GKMA 4ML6A 4TXVA 5JWRB 2YOIA 2ES7A 1FW1A 4ZBAA 1TRUA 5EY6A 3TRXA 2AB6A 2H1BA 4A5PA 2DSAA 1EZKA 2YN1A 4OCFA 2V6KA 5A4UA 5DJMA 4KCAA 2VL2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF1 A;  2MBS A;  2LUS A;  5B6M A;  1AXD A;  3IPZ A;  4KUN A;  3EIN A;  1V58 A;  2FWH A;  4MJE A;  3HJO A;  1M7T A;  4GRF A;  4E8H A;  3A2V A;  4LA1 A;  4LL4 B;  3GH6 A;  3HA9 A;  4HZ4 A;  2H73 A;  1BED A;  1HNA A;  2IPA A;  3IK7 A;  1BJX A;  3HYP A;  2RUF A;  2VCV A;  4TR1 A;  3CXG A;  1X9S B;  2B7J A;  4F03 A;  1K0D A;  5D8I A;  1G7E A;  5ECR B;  2HNL A;  1WIK A;  1B9X C;  4GST A;  2C8U A;  2GSQ A;  2YZU A;  3CSJ A;  5J4U A;  2O8V B;  4ZBD A;  2LTK A;  4NHW A;  1TK0 B;  4JBB A;  1R26 A;  1KBN A;  3FZ5 A;  1HNB A;  4I6X A;  2YJH A;  3LEF A;  5DAK B;  13GS A;  2MMO A;  1ABA A;  1E2Y A;  3M0F A;  2M80 A;  2XBQ A;  3GSS A;  1YKC A;  3K8N A;  4G2E A;  1LJR A;  4X1U A;  1DUG A;  4JR4 A;  4WF4 A;  1CQH A;  5ECI B;  1R5P A;  3LWA A;  1A8Y A;  1YY7 A;  2LRC A;  1OC9 A;  2DIY A;  1SD8 A;  4KDX A;  4N0V A;  5ECP B;  1AW9 A;  5HR0 A;  2VUP A;  2MMA A;  3ED3 A;  2K6V A;  1Z6M A;  3CMI A;  1GSQ A;  3VPT A;  2CZ2 A;  1SL0 B;  16GS A;  2OBI A;  1YF1 A;  3MNG A;  4Q5Q A;  3ERF A;  4AJ6 A;  3FZ9 A;  2NDO A;  4MPG A;  3D0Z A;  3GUS A;  2P31 A;  5D9W A;  1OKT A;  2WZ9 A;  3APO A;  3SBC A;  3U5R E;  4FH8 A;  5B6N A;  4RQR A;  4X0X A;  4DSS B;  1K3O A;  1V57 A;  5JCU A;  3WYW A;  2GQL A;  1K0B A;  3QD9 A;  4O32 A;  4XS6 A;  2IN3 A;  3ZVJ A;  2HRF A;  2H0G A;  5EL8 A;  5ECS A;  2VCX A;  3QOU A;  4KA0 A;  2V1M A;  2PMT A;  5GAN D;  2I1U A;  4N10 A;  5E4W A;  2F9S A;  1KTE A;  3F6D A;  1R5A A;  4XRA A;  1XXU A;  1EGO A;  5AIX A;  1FOV A;  2Z9S A;  2L5O A;  4KSO A;  4NWY A;  1EP7 A;  4I97 A;  5ID2 A;  3KP9 A;  1EV9 A;  1PSQ A;  2DLX A;  2L4Q A;  3IXR A;  1SJZ A;  2X64 A;  1O85 A;  4KX4 A;  3IR4 A;  3GTU B;  3EE2 A;  2V32 A;  3O76 A;  4IHU A;  3DVW A;  4LMV A;  4YAV A;  3DGQ A;  4EE0 A;  1EGR A;  2OBK A;  4TKY A;  3F9U A;  2V41 A;  4AF2 A;  1DSB A;  3NIV A;  1YQ1 A;  4V1A p;  3ERG A;  2VCZ A;  3GUR A;  4D73 B;  2J23 A;  1M2D A;  3GST A;  4OD7 A;  2L6D A;  3IAS 2;  2H74 A;  5LNK e;  4MZC A;  3W8S A;  3WT2 A;  2C0D A;  3DXB A;  1EOG A;  1GTU A;  4J2F A;  3I69 A;  5F0G A;  5DQS A;  2GQM A;  4DSR A;  3EYT A;  1A8L A;  4ML1 A;  3IV4 A;  2EIQ A;  4GTU A;  2YWM A;  2V6O A;  1QFN A;  2JAD A;  1ST9 A;  4IJI A;  1QGV A;  2O85 A;  2B6M A;  1OE7 A;  1G0T A;  2YNX A;  3F8U A;  3IC4 A;  3G7Y A;  4IEL A;  3KZQ A;  2WGR A;  3F63 A;  1ZGN A;  1WPI A;  2GSS A;  3W6G A;  2M46 A;  1V98 A;  1YDK A;  4OWY A;  2CT6 A;  2VL2 A;  2LJR A;  4HOJ A;  4ZB9 A;  2IFQ B;  3JCM L;  5IMD A;  4N30 A;  2VLT A;  4YQU A;  4KE3 A;  4PNG A;  1SKS B;  3TB2 A;  5D9X A;  3DWV A;  2KOK A;  4ULX A;  3GA4 A;  2C0E A;  2DIZ A;  4YQM A;  2JU5 A;  1XWC A;  1A24 A;  1AC1 A;  4KND A;  3UMA A;  5ECL B;  2X8C A;  2JZT A;  5DQY A;  3QR6 A;  5ABR A;  2AV4 A;  17GS A;  3MSZ A;  2P5R A;  4POK A;  3C1R A;  3HVX A;  1XFL A;  3WT1 A;  2YZH A;  1JFU A;  3EVI A;  2HZF A;  5IQY A;  2FD3 A;  4EDY A;  1JLW A;  1QQ2 A;  2X8H A;  2GQK A;  2NBS A;  2YCD A;  4Q5R A;  2IMF A;  2L6C A;  3HVS A;  5INY A;  3CSI A;  3WGX A;  3UEM A;  5HR3 A;  3HZ8 A;  3LSZ A;  2NPB A;  2H01 A;  3S9F A;  2JZR A;  4YAP A;  1YF0 A;  5CAX A;  2CAQ A;  1EEM A;  1TXX A;  4TRX A;  5HFI A;  1NSW A;  5HFK A;  4EXJ A;  3CYN A;  2FWG A;  2VLV A;  4MF7 A;  1O73 A;  2FA4 A;  4D73 A;  2QGV A;  3KH9 A;  1R4W A;  1WE0 A;  4ZXG A;  4N0Z A;  1QK8 A;  1XVQ A;  1J08 A;  2O7K A;  2YWN A;  1GRX A;  3GIX A;  3HHV A;  2KLX A;  2O87 A;  5FHI A;  2B1K A;  4KW6 A;  4XTS A;  2WCI A;  1HD2 A;  11GS A;  3US3 A;  2LST A;  4XIH A;  3M3M A;  1M2B A;  4TR1 B;  1S3D A;  1A23 A;  4KB3 A;  3KM6 A;  1JZW A;  5FWG A;  5IPH A;  4ECI A;  4CHS A;  4P3Y B;  4XCS A;  2E0Q A;  2FWE A;  1NW2 A;  5CYY A;  1OKD A;  4K2D A;  4PQH A;  1HYU A;  4OFT A;  5AIS A;  5KN3 A;  5B7C A;  1TI1 A;  2PVO C;  1VGL A;  5DJL A;  5IMF A;  5ECO B;  4HJM A;  1C72 A;  1NHY A;  3F0I A;  3GL5 A;  2HXK A;  4EF0 A;  1FHE A;  1U3A A;  3U6V A;  3I43 A;  3H1N A;  3FKF A;  3HKR A;  4OFM A;  4J56 E;  1XCC A;  2H6Z A;  2YV7 A;  1T00 A;  3ZL5 A;  3WD6 A;  3ZIV A;  3CSH A;  4K0N A;  1ZOF A;  2K9F A;  1F2E A;  2ALB A;  4YQV A;  1EOH A;  3TOT A;  1URM A;  2A2R A;  2PUK C;  1OC9 B;  1K0O A;  3E3E A;  3UJ1 A;  1ILO A;  2HT9 A;  2LKU A;  4JE1 A;  4L5O A;  2FA8 A;  1OC3 A;  9GSS A;  1YEP A;  5IOX A;  1B48 A;  3GYK A;  4K6X A;  1U3I A;  2AHE A;  3HY2 A;  5IM9 A;  3DKS A;  1DBY A;  2ON7 A;  3LGC A;  5EPF A;  3FEU A;  4BWQ A;  1DE2 A;  1ML6 A;  2FLS A;  3PIN A;  3UVH A;  3GMF A;  4HQS A;  1JLV A;  1F9M A;  2YJ7 A;  4O7H A;  1X5D A;  1U6T A;  1W4V A;  1V2A A;  4DVC A;  2WRT A;  5IMV A;  5H5Q A;  2VCQ A;  1K0A A;  5JWO B;  5F06 A;  2B5X A;  2OKA A;  1EWX A;  2MMZ A;  4IP1 A;  5F8B A;  3DVX A;  4LLR A;  3I6A A;  4IJ3 A;  4V2N A;  2GLR A;  1U88 A;  3UAR A;  3Q74 A;  1ACV A;  3ZRE A;  3GHA A;  4POL A;  3GL3 A;  2M72 A;  2H66 A;  1XWA A;  2YWI A;  1GLQ A;  5DCG A;  3TKP A;  2LS5 A;  1O8X A;  1T4Y A;  4X43 A;  5ECQ B;  1QUW A;  2P5Q A;  3HCZ A;  5ID2 B;  1ZL9 A;  1XIY A;  2C0F A;  4AGS A;  4ZB8 A;  4IP6 A;  2PPT A;  3P90 A;  4YH2 A;  2HRN A;  1XOB A;  3GKN A;  4EKZ A;  2RM5 A;  2YWO A;  2TRC P;  2IME A;  3RHC A;  4MA9 A;  1TU7 A;  1FAA A;  4RUV A;  6GSX A;  1O8W A;  1GWC A;  2R4V A;  3RDW A;  4NV2 A;  1PKZ A;  3UVT A;  3HDC A;  2GST A;  1VRS D;  2IL3 A;  3L78 A;  1SL2 B;  3QAW A;  1OC8 A;  1X9M B;  2FY6 A;  1BAY A;  3BD2 A;  5GZZ B;  1G7O A;  1PN9 A;  4MZW A;  3FZA A;  1Z7P A;  2YV9 A;  2VM1 A;  4GCI A;  5ECH B;  5H5S A;  3GRX A;  1A0F A;  2F8A A;  4I5Q A;  1PL1 A;  3KCM A;  1YJ6 A;  3TKQ A;  2R6K A;  5ECN B;  5C04 A;  4IKH A;  2PWJ A;  1XWG A;  2H1D A;  4H86 A;  3ZVJ D;  2HYX A;  4EC0 A;  2R2J A;  5CRE A;  2H19 A;  3UBL A;  1UN2 A;  1M9A A;  1UA5 A;  3ZTL A;  3ZML A;  1AQV A;  5D9V A;  3L9U A;  4CW9 A;  2CVD A;  4WBJ A;  2X99 A;  2H70 A;  3O6T A;  4F0B A;  3VWX A;  3QAV A;  3VI7 A;  1MDJ A;  5KN1 A;  2IMK A;  2LJA A;  3ERW A;  1G6Y A;  4EL1 A;  1WOU A;  2OE1 A;  1K3L A;  4O92 A;  4PQI A;  1XW6 A;  2J9H A;  4GQC A;  1SJ6 A;  4XS1 A;  1BYE A;  2CX3 A;  2VM2 A;  4MPF A;  1TJD A;  4MJA A;  2YPM A;  5AIV A;  2H1A A;  2PU9 C;  3KIJ A;  3KH7 A;  2MMN A;  2IMD A;  5E59 A;  1JZR A;  1GUM A;  5LD0 A;  3ZFB A;  5J9C A;  3HVV A;  5CRG A;  4QQ7 A;  2ZUP A;  1ZZY A;  4L0W A;  2EIO A;  2H8L A;  4EVM A;  1PL2 A;  4KH7 A;  1V40 A;  2C3N A;  3BOA A;  4IGJ A;  1WP0 A;  3W8J A;  4HU9 A;  1NHO A;  2AJQ B;  3AY8 A;  2KUC A;  3ME7 A;  5FT3 A;  1EEJ A;  4XS4 A;  2A2S A;  4HZ2 A;  1SKW B;  1PA3 A;  2PBJ A;  2VL9 A;  4V1A g;  3OR5 A;  1Z3E A;  3LOR A;  3LG6 A;  4WET A;  5DBQ A;  3CTG A;  2GDR A;  1PRX A;  3UIW A;  1B9Y C;  2KP2 A;  2WDU A;  1I9D A;  2GT5 A;  3E9J B;  2LEG A;  2CX4 A;  3EU4 A;  4ECJ A;  3E0U A;  3CBU A;  2HE3 A;  2C1Y A;  3EU3 A;  1GNW A;  4TR4 A;  1OE8 A;  3EUR A;  3ISO A;  2JZS A;  4NXI A;  4CDO A;  1A0R P;  2DML A;  2JL4 A;  2TRX A;  1RW1 A;  3APS A;  4BPY A;  2RM6 A;  3KGK A;  3UBK A;  1AUC A;  3GV1 A;  3KMN A;  2GVP A;  4EUY A;  2BJX A;  3C1S A;  1Q98 A;  1MD4 A;  3IRA A;  2GZY A;  2GS3 A;  2VD0 A;  2C4J A;  3FY7 A;  2VL3 A;  2N5B A;  3H79 A;  3GX0 A;  2LQO A;  5G31 A;  4IBP A;  2N5F A;  4GQF A;  3DML A;  2WFC A;  1V9W A;  1OVN A;  3BCK A;  4XRD A;  1B4Q A;  1BQ7 A;  4G9H A;  2B1L A;  5D73 A;  2H75 A;  3D6I A;  1S3A A;  4FO5 A;  4JED A;  5B8B A;  5GAP D;  2VAF A;  1TI3 A;  5DCH A;  1GTI A;  1DE1 A;  4KGI A;  3GKK A;  5F05 A;  2FUG 2;  4OCE A;  4KDU A;  3RBT A;  3KTB A;  6GSU A;  4LL1 B;  2MYG A;  3A5W A;  3NOF A;  4DSQ A;  1Z5Y E;  3LJR A;  4MH3 A;  1OAZ A;  2MZC A;  2D2Z A;  4PUF C;  2YAN A;  4L0U A;  1X5E A;  2KHP A;  2E7P A;  4GLT A;  4PXO A;  1RQM A;  3D4M A;  1SK0 A;  4KSM A;  2QKE A;  1ERV A;  1K0C A;  6GSV A;  3FR6 A;  5B8A A;  3GFK A;  2AYT A;  2LNT A;  5AN1 A;  3NZN A;  2DJ0 A;  2EIR A;  1XWB A;  4KAE A;  3ME8 A;  5A4W A;  5ELA A;  3RPP A;  3IOS A;  2G0F A;  3EC3 A;  3HZ4 A;  3IHQ A;  2NTO A;  3QFB C;  3H8Q A;  4IW9 A;  3I9V 2;  6GST A;  3F4S A;  1ERW A;  2QSI A;  4HU7 A;  14GS A;  1GSU A;  2FHE A;  2H6X A;  3VLN A;  3UOM A;  2E2M A;  3DRN A;  1AIU A;  2HSH A;  4GSS A;  3RHB A;  2CQ9 A;  2OA7 A;  2HI7 A;  2FCH A;  2H72 A;  3IAM 2;  4K7N A;  4MCU A;  4WEY A;  4GWR A;  4RQX A;  4ZL7 A;  4GSN A;  2OJL A;  3EMP A;  1H75 A;  1JZD A;  1O6J A;  4J57 E;  4DEJ A;  1K0N A;  3ZYW A;  3FR3 A;  1ERT A;  3P2A A;  1SU9 A;  4PX1 A;  1XVW A;  3M9J A;  5IIZ A;  3Q18 A;  3ZIJ A;  5IMA A;  3J7Y k;  4HDE A;  1Z7R A;  1LU4 A;  2VCT A;  3VWW A;  5G1K A;  2I81 A;  4KDY A;  4K9Z A;  5IPG A;  1O7U A;  3ZLP A;  5CRH A;  4WXT A;  1FB6 A;  5HQP A;  1YEX A;  5J3R A;  6GSS A;  3TJK A;  2RLI A;  2F3M A;  1R7H A;  3QFA C;  1ON4 A;  1TK5 B;  3SWL A;  4WF5 A;  4AJ7 A;  3VFI A;  3KP8 A;  2CVB A;  1N2A A;  3CRU A;  2H71 A;  2RII A;  1G6W A;  2PER A;  1IYH A;  3IK9 A;  4RI6 A;  1PX6 A;  5A5K A;  2LJK A;  1YZX A;  3N9J A;  2C0G A;  2IWT A;  5DAL A;  5JCG A;  3KMO A;  5G30 A;  4G19 A;  3HD5 A;  4BVX A;  1YKA A;  1F37 A;  4MH2 A;  4GF0 A;  1GUK A;  4I2U A;  1TDI A;  4TOP A;  2A4V A;  20GS A;  4MF5 A;  5CNW A;  3HJP A;  2PVQ A;  4BVY A;  3HJM A;  1USB A;  3P7X A;  4F2I A;  4IVF A;  1FVJ A;  3IA1 A;  1M2A A;  4L5L A;  1T8E B;  3F4R A;  3C71 A;  2CAI A;  5G1L A;  3N5O A;  4O5R A;  3FYG A;  2F8F A;  2FGX A;  3RPN A;  5D9T A;  1MEK A;  1I5G A;  1ZCP A;  3F6F A;  1A2J A;  3DD3 A;  4TN8 A;  2K18 A;  3A3T A;  5G2Z A;  1EV4 A;  1PKW A;  2IJY A;  2R5G A;  5G5F A;  2VD1 A;  3QCP A;  1EP8 A;  3QDN A;  1OYJ A;  4HS1 A;  4ZIL A;  4FYC A;  2HFD A;  3TKS C;  19GS A;  4MP4 A;  3M8N A;  1TKD B;  1RK4 A;  2NVL A;  4PGT A;  1E6B A;  4F0C A;  2H0I A;  4XS4 B;  4TR0 A;  1GP1 A;  3TKS E;  2N5A A;  5F07 A;  3H4K A;  2JSZ A;  4WR5 A;  4JR6 A;  3UL3 A;  1GLP A;  1XBS A;  4XHM A;  3FZ4 A;  3L9S A;  5AGY A;  3VPQ A;  5IOW A;  4L8E A;  4MDC A;  3LFL A;  2CA8 A;  3BCI A;  3UAP A;  12GS A;  3QAG A;  2VLU A;  4OMV A;  1MDK A;  4IQA A;  2LQQ A;  2GSR A;  2DBC A;  4MLY A;  3D4T A;  2H76 A;  4HQZ A;  4WKW A;  10GS A;  2E2G A;  4QL7 A;  3BJ5 A;  5DDL A;  4MZB A;  3VI5 A;  3TJF A;  1H4O A;  2WB9 A;  3Q6O A;  1J9B A;  1M9B A;  2DJK A;  2H30 A;  1QXH A;  1KNG A;  2FWF A;  3LYP A;  5CP1 A;  3VWV A;  1Z6N A;  3GNJ A;  4PQ1 A;  5D93 A;  5ELG A;  5JWQ B;  2HZE A;  2DMM A;  3J7Y b;  5KN2 A;  1SK1 A;  22GS A;  2XHF A;  4TR3 A;  2AUV A;  1K0M A;  1FO5 A;  2PN8 A;  4NV5 A;  1PX7 A;  3DYR A;  4ISD A;  1AQX A;  4ZBB A;  4HJ2 A;  3ZFL A;  2L57 A;  2EC4 A;  3VWU A;  4QL9 A;  1WWJ A;  3F3Q A;  1TK8 B;  4FIW A;  3MDK A;  1GUH A;  2CZ3 A;  18GS A;  3M1G A;  1Y6E A;  4LMW A;  1HNC A;  1SYR A;  1O81 A;  3G7I A;  2MBT A;  8GSS A;  1XW5 A;  4NAX A;  4HUA A;  3L9V A;  1T7P B;  6GSY A;  3TJJ A;  2DC5 A;  3MAK A;  1ERU A;  1TTZ A;  4POB A;  3GN3 A;  1SJI A;  3PR8 A;  1TU8 A;  1TRV A;  2B5E A;  1M0U A;  3FRC A;  1F3B A;  3ZZX A;  5IO2 A;  3FW2 A;  5EVO A;  4ZL9 A;  4PNF A;  2GZZ A;  2V2G A;  3FR9 A;  1FB0 A;  5ENU A;  5CRD A;  2VOC A;  3IDV A;  1XPV A;  4F9Z A;  3KJY A;  2X8G A;  3IE3 A;  2ON5 A;  4FYU A;  3QMX A;  2XC2 A;  4I8B A;  4OO4 A;  3H93 A;  4HI7 A;  1F3A A;  1GSF A;  3MWH A;  3TRP A;  2BMX A;  3RAZ A;  2IMI A;  2F51 A;  3ZIT A;  1M99 A;  3A2W A;  4PUA A;  5G5E A;  5HR2 A;  2B5Y A;  2DJ3 A;  4K7I A;  4PUR A;  2LV3 A;  3LXZ A;  3C8E A;  1MDI A;  2CV4 A;  4ZB6 A;  1NM3 A;  1SL1 B;  4FYB A;  3WGD A;  2JSY A;  1GSY A;  1KEB A;  1N8J A;  3ZRD A;  3BBY A;  5KN0 A;  5J41 A;  1T1V A;  2I9H A;  4KCE A;  5KEJ A;  4TXO B;  2HSY A;  1Q4J A;  4MMM A;  3LQ7 A;  3VUR A;  2BTO T;  2ZCT A;  2C80 A;  2PGT A;  2WS2 A;  4ID0 A;  1XZO A;  2XPE A;  4EDZ A;  1SK2 A;  3HXS A;  1S3C A;  1WRY A;  2VO4 A;  3IBH A;  3LXT A;  3TKS A;  4IN0 A;  4ZIJ A;  5DVB A;  3CRT A;  2GTU A;  4EO3 A;  5DAK A;  3APQ A;  3TRQ A;  1XW9 A;  3WGE A;  1HQO A;  2OE3 A;  3FK8 A;  5J9B A;  2O89 A;  2QC7 A;  3KD0 A;  1J0F A;  1GSD A;  3F3R A;  1THO A;  1ZYE A;  3TOU A;  5DAL B;  2JAC A;  5L71 A;  2H6Y A;  4MF6 A;  2VIM A;  1FVK A;  3EMX A;  5CRW A;  4TVE A;  2DJ1 A;  4NHZ A;  2H0H A;  4NMU A;  1Y25 A;  2R3X A;  5IMZ A;  3GKX A;  4IS0 A;  1VF2 A;  3DIE A;  1XWK A;  3PH9 A;  4G10 A;  4JU5 A;  4OO5 A;  4BL7 A;  1THX A;  4Q5N A;  4I2T A;  1IYI A;  4E8E A;  1MD3 A;  4Z7X A;  1WJK A;  4JRR A;  3L4N A;  4TW5 A;  1WMJ A;  2HLS A;  2GZP A;  1VF3 A;  1GNE A;  3R2Q A;  4WBR D;  5IMC A;  3A2X A;  2L59 A;  3TJB A;  1GTB A;  3D5J A;  3ZMK A;  3V1W A;  3KXO A;  3DEX A;  4MJB A;  5GST A;  4DSS A;  1TRS A;  3EWL A;  3KEB A;  1JHB A;  1Z9H A;  1X9W B;  1TOF A;  2DJJ A;  4AJ8 A;  3PGT A;  5D96 A;  4WR4 A;  5ECM B;  2DJ2 A;  1PD2 1;  7GSS A;  3CTF A;  2OAD A;  2RUE A;  3D21 A;  3L0H A;  4OFN A;  4BA7 A;  1ZYQ B;  2OAC A;  1LBK A;  1X0R A;  4GXZ A;  3QPM A;  4MJC A;  1JZO A;  1PMT A;  1GSS A;  4MAB A;  3GTU A;  1TW9 A;  4ACS A;  1W89 A;  2VCW A;  2K8S A;  3O3T A;  5HFG A;  1QMV A;  2LRT A;  4BWS A;  1B8X A;  2CVK A;  2WUL A;  3LYK A;  3TUE A;  4K1F A;  1GUL A;  2P0G A;  5COH A;  4TXO A;  1VF4 A;  2GT6 A;  2K8V A;  3GX8 A;  4RI7 A;  1BG5 A;  4ILF A;  1A2M A;  1UVZ A;  2ZNM A;  4POM A;  2B3S A;  2C3Q A;  4V2L A;  3C7M A;  1TP9 A;  5A4V A;  4MK3 A;  1BX9 A;  2H1G A;  2AAW A;  3G9B A;  2L4C A;  1K3Y A;  2I3Y A;  3G7J A;  1T4Z A;  5GSS A;  5HR1 A;  1U87 A;  1CQG A;  6GSW A;  4F82 A;  1A2L A;  3TKR A;  5JCW A;  2C3T A;  2XBI A;  1T3B A;  1UC7 A;  1XOA A;  2G2Q A;  2HZE B;  5ECK B;  4K7O A;  2OE0 A;  3GH9 A;  1MTC A;  1X5C A;  4HEA 2;  5J5N A;  1SYX A;  4N11 A;  4ZL8 A;  2KP1 A;  1SD9 A;  3C73 A;  2IFQ A;  3VK9 A;  2YP6 A;  2L5L A;  2IIY A;  2R37 A;  2B7K A;  4IQ1 A;  5LCZ A;  1ZMA A;  5CO3 A;  1TRW A;  2LNS A;  3TGZ A;  2WJU A;  3M9K A;  2TIR A;  4NPB A;  4Q5F A;  1GL8 A;  1GH2 A;  1PQN A;  1AQW A;  2I4A A;  3FHK A;  4K0G A;  3TCO A;  3Q19 A;  5IO0 A;  1AAZ A;  3KTL A;  1PGT A;  1F6M C;  1GTA A;  3TJG A;  1B4P A;  3F4T A;  3D22 A;  2LRN A;  4ECC A;  4V2M A;  1FG4 A;  1SEN A;  2FNO A;  5H5R A;  3P8W A;  5C00 A;  1SKR B;  4K8M A;  4JZQ A;  1GSE A;  3TDG A;  4ECB A;  2REM A;  2XPD A;  2GGT A;  3GKM A;  4ML6 A;  4TXV A;  5JWR B;  2YOI A;  2ES7 A;  1FW1 A;  4ZBA A;  1TRU A;  5EY6 A;  3TRX A;  2AB6 A;  2H1B A;  2DSA A;  1EZK A;  2YN1 A;  4OCF A;  2V6K A;  5A4U A;  5DJM A;  4KCA A;  2VL2 C; 
#chains in the Genus database with same CATH topology
 1VF1 A;  2MBS A;  2LUS A;  5B6M A;  1AXD A;  3IPZ A;  4KUN A;  3EIN A;  1V58 A;  2FWH A;  4MJE A;  3HJO A;  1M7T A;  4GRF A;  4E8H A;  3A2V A;  3HVN A;  4LA1 A;  4LL4 B;  3GH6 A;  3HA9 A;  4HZ4 A;  2H73 A;  1BED A;  1HNA A;  2IPA A;  3IK7 A;  1BJX A;  3HYP A;  2RUF A;  2VCV A;  4TR1 A;  3CXG A;  1X9S B;  2B7J A;  4F03 A;  1K0D A;  5D8I A;  1G7E A;  5ECR B;  2HNL A;  1WIK A;  1B9X C;  4GST A;  2C8U A;  2GSQ A;  2YZU A;  3CSJ A;  5J4U A;  2O8V B;  4ZBD A;  2LTK A;  4NHW A;  1TK0 B;  4JBB A;  1R26 A;  5BRT A;  1KBN A;  3FZ5 A;  1HNB A;  4I6X A;  2YJH A;  3LEF A;  5DAK B;  13GS A;  2MMO A;  1ABA A;  1E2Y A;  3M0F A;  2M80 A;  2XBQ A;  3GSS A;  1YKC A;  3K8N A;  4G2E A;  1LJR A;  4X1U A;  1DUG A;  4JR4 A;  4WF4 A;  1CQH A;  5ECI B;  1R5P A;  3LWA A;  1A8Y A;  1YY7 A;  2LRC A;  1OC9 A;  2DIY A;  1SD8 A;  4KDX A;  4N0V A;  5ECP B;  1AW9 A;  5HR0 A;  2VUP A;  2MMA A;  3ED3 A;  2K6V A;  1Z6M A;  3CMI A;  1GSQ A;  3VPT A;  4BL7 B;  2CZ2 A;  1SL0 B;  16GS A;  2OBI A;  1YF1 A;  3MNG A;  4Q5Q A;  3ERF A;  4AJ6 A;  3FZ9 A;  2NDO A;  4K2X A;  4MPG A;  3D0Z A;  3GUS A;  2P31 A;  1OKT A;  5D9W A;  2DKI A;  2WZ9 A;  3APO A;  3SBC A;  3U5R E;  4HSC X;  4FH8 A;  5B6N A;  4RQR A;  4X0X A;  4DSS B;  1K3O A;  1V57 A;  5JCU A;  3WYW A;  2GQL A;  1K0B A;  3QD9 A;  4O32 A;  4XS6 A;  2IN3 A;  3ZVJ A;  2HRF A;  2H0G A;  5EL8 A;  5ECS A;  2VCX A;  3QOU A;  4KA0 A;  2V1M A;  2PMT A;  5GAN D;  2I1U A;  4N10 A;  5E4W A;  2F9S A;  1KTE A;  3F6D A;  1R5A A;  4XRA A;  1XXU A;  1EGO A;  5AIX A;  1FOV A;  2Z9S A;  2L5O A;  4KSO A;  4NWY A;  1EP7 A;  4I97 A;  5ID2 A;  3KP9 A;  1EV9 A;  1PSQ A;  2DLX A;  2L4Q A;  3IXR A;  1SJZ A;  2X64 A;  1O85 A;  4KX4 A;  3IR4 A;  5KOX A;  3GTU B;  3EE2 A;  2V32 A;  3O76 A;  4IHU A;  3DVW A;  4LMV A;  4YAV A;  3DGQ A;  4EE0 A;  1EGR A;  2OBK A;  4TKY A;  3F9U A;  2V41 A;  4AF2 A;  1DSB A;  3NIV A;  1YQ1 A;  4V1A p;  3ERG A;  2VCZ A;  3GUR A;  4D73 B;  2J23 A;  1M2D A;  3GST A;  4OD7 A;  2L6D A;  3IAS 2;  2H74 A;  5LNK e;  4MZC A;  3W8S A;  3WT2 A;  4O5U A;  2C0D A;  3DXB A;  1EOG A;  1GTU A;  4J2F A;  3I69 A;  5F0G A;  5DQS A;  2GQM A;  4DSR A;  3EYT A;  1A8L A;  4ML1 A;  2HSM A;  3IV4 A;  2EIQ A;  4GTU A;  5KOW A;  2YWM A;  2V6O A;  1QFN A;  2JAD A;  1ST9 A;  4IJI A;  1QGV A;  2O85 A;  2B6M A;  1OE7 A;  1G0T A;  2YNX A;  3F8U A;  3IC4 A;  3G7Y A;  4IEL A;  3KZQ A;  2WGR A;  3F63 A;  1ZGN A;  1WPI A;  2GSS A;  3W6G A;  2M46 A;  1V98 A;  1YDK A;  4K5S A;  4OWY A;  2CT6 A;  2VL2 A;  2LJR A;  4HOJ A;  4ZB9 A;  2IFQ B;  3JCM L;  5IMD A;  4N30 A;  2VLT A;  4YQU A;  4KE3 A;  4PNG A;  1SKS B;  3TB2 A;  5D9X A;  3DWV A;  1FOH A;  2KOK A;  4ULX A;  3GA4 A;  2C0E A;  2DIZ A;  4YQM A;  2JU5 A;  1XWC A;  1A24 A;  1AC1 A;  4KND A;  3UMA A;  5ECL B;  2X8C A;  2JZT A;  5DQY A;  3QR6 A;  5ABR A;  2AV4 A;  17GS A;  3MSZ A;  3MYD A;  2P5R A;  4POK A;  3C1R A;  3HVX A;  1XFL A;  3WT1 A;  2YZH A;  1JFU A;  3EVI A;  2HZF A;  5IQY A;  2FD3 A;  4EDY A;  1JLW A;  1QQ2 A;  2X8H A;  2GQK A;  2NBS A;  2YCD A;  4Q5R A;  2IMF A;  2L6C A;  3HVS A;  5INY A;  3CSI A;  3WGX A;  3UEM A;  5HR3 A;  3HZ8 A;  3LSZ A;  2NPB A;  2H01 A;  3S9F A;  2JZR A;  4YAP A;  1YF0 A;  5CAX A;  2CAQ A;  1EEM A;  1TXX A;  4TRX A;  5HFI A;  1NSW A;  5HFK A;  4EXJ A;  3CYN A;  2FWG A;  2VLV A;  4MF7 A;  1O73 A;  4FQU A;  2FA4 A;  4D73 A;  2QGV A;  3KH9 A;  1R4W A;  1WE0 A;  4ZXG A;  4N0Z A;  1QK8 A;  1XVQ A;  1J08 A;  2O7K A;  2YWN A;  1GRX A;  3GIX A;  3HHV A;  2KLX A;  2O87 A;  5FHI A;  2B1K A;  4KW6 A;  4XTS A;  2WCI A;  1HD2 A;  11GS A;  3US3 A;  2LST A;  4XIH A;  3M3M A;  1M2B A;  4TR1 B;  1S3D A;  1A23 A;  4KB3 A;  3KM6 A;  1JZW A;  5FWG A;  5IPH A;  4ECI A;  4CHS A;  4P3Y B;  2A4H A;  4XCS A;  2E0Q A;  2FWE A;  1NW2 A;  5CYY A;  1OKD A;  4K2D A;  4PQH A;  1HYU A;  4OFT A;  5AIS A;  5KN3 A;  5B7C A;  1TI1 A;  2PVO C;  1VGL A;  5DJL A;  5IMF A;  5ECO B;  4HJM A;  1C72 A;  1NHY A;  3F0I A;  3GL5 A;  2HXK A;  4EF0 A;  1FHE A;  2UZ8 A;  1U3A A;  3U6V A;  3I43 A;  3H1N A;  3FKF A;  3HKR A;  4OFM A;  4J56 E;  1XCC A;  2H6Z A;  2YV7 A;  1T00 A;  3ZL5 A;  3WD6 A;  4YKF A;  3ZIV A;  3R3E A;  3CSH A;  4K0N A;  1ZOF A;  2K9F A;  1F2E A;  2ALB A;  4YQV A;  1EOH A;  3TOT A;  1URM A;  2A2R A;  2PUK C;  1OC9 B;  4O5Q A;  1K0O A;  3E3E A;  3UJ1 A;  1ILO A;  2HT9 A;  2LKU A;  4JE1 A;  4L5O A;  2FA8 A;  1OC3 A;  9GSS A;  1YEP A;  5IOX A;  1B48 A;  3GYK A;  4K6X A;  1U3I A;  2AHE A;  3HY2 A;  5IM9 A;  3DKS A;  1DBY A;  2ON7 A;  3LGC A;  5EPF A;  3FEU A;  4BWQ A;  1DE2 A;  1ML6 A;  2FLS A;  3PIN A;  3UVH A;  3GMF A;  4HQS A;  1JLV A;  1F9M A;  2R0C A;  2YJ7 A;  4O7H A;  1X5D A;  1U6T A;  1W4V A;  4EIQ A;  1V2A A;  4DVC A;  2WRT A;  5IMV A;  5H5Q A;  2VCQ A;  1K0A A;  5JWO B;  5F06 A;  2B5X A;  2OKA A;  1EWX A;  2MMZ A;  4IP1 A;  5F8B A;  3DVX A;  4LLR A;  3I6A A;  4IJ3 A;  4V2N A;  2GLR A;  1U88 A;  3UAR A;  3Q74 A;  1ACV A;  3ZRE A;  3GHA A;  4POL A;  3GL3 A;  2M72 A;  2H66 A;  1XWA A;  2YWI A;  1GLQ A;  5DCG A;  3TKP A;  2LS5 A;  1O8X A;  1T4Y A;  4X43 A;  5ECQ B;  1QUW A;  2P5Q A;  3HCZ A;  5ID2 B;  1ZL9 A;  1XIY A;  2C0F A;  4AGS A;  4ZB8 A;  4IP6 A;  2PPT A;  3P90 A;  4YH2 A;  2HRN A;  1XOB A;  3GKN A;  1M3I A;  4EKZ A;  2RM5 A;  2YWO A;  2TRC P;  2IME A;  3RHC A;  4MA9 A;  1TU7 A;  1FAA A;  4RUV A;  6GSX A;  1O8W A;  1GWC A;  2R4V A;  3RDW A;  4NV2 A;  1PKZ A;  3UVT A;  3HDC A;  2GST A;  1VRS D;  2IL3 A;  3L78 A;  1SL2 B;  3QAW A;  1OC8 A;  1X9M B;  2FY6 A;  1BAY A;  3BD2 A;  5GZZ B;  1G7O A;  1PN9 A;  4MZW A;  2X49 A;  3FZA A;  1Z7P A;  2YV9 A;  2VM1 A;  4GCI A;  5ECH B;  5H5S A;  3GRX A;  1A0F A;  2F8A A;  4I5Q A;  1PL1 A;  3KCM A;  1YJ6 A;  3TKQ A;  2R6K A;  5ECN B;  5C04 A;  4IKH A;  2PWJ A;  4MNN A;  1XWG A;  2H1D A;  4H86 A;  3LW9 A;  3ZVJ D;  2HYX A;  4EC0 A;  2R2J A;  5CRE A;  2R0G A;  2H19 A;  3UBL A;  1UN2 A;  1M9A A;  1UA5 A;  3ZTL A;  3ZML A;  1AQV A;  5D9V A;  3L9U A;  4CW9 A;  4G0I A;  2CVD A;  4WBJ A;  2X99 A;  2H70 A;  3O6T A;  4F0B A;  4X4J A;  3VWX A;  3QAV A;  3VI7 A;  1MDJ A;  5KN1 A;  2IMK A;  2LJA A;  3ERW A;  1G6Y A;  4EL1 A;  1WOU A;  2OE1 A;  1K3L A;  4O92 A;  4PQI A;  1XW6 A;  2J9H A;  4GQC A;  1SJ6 A;  4XS1 A;  1BYE A;  2CX3 A;  2VM2 A;  4MPF A;  1TJD A;  5BMU A;  4MJA A;  2YPM A;  5AIV A;  2H1A A;  2PU9 C;  3KIJ A;  3KH7 A;  2MMN A;  2IMD A;  5E59 A;  1JZR A;  1GUM A;  5LD0 A;  3ZFB A;  5J9C A;  3HVV A;  5CRG A;  4QQ7 A;  2ZUP A;  1ZZY A;  4L0W A;  2EIO A;  2H8L A;  4EVM A;  1PL2 A;  4KH7 A;  1V40 A;  2C3N A;  3BOA A;  4IGJ A;  4USS A;  1WP0 A;  3W8J A;  1ZYP A;  4HU9 A;  1NHO A;  2AJQ B;  3AY8 A;  2KUC A;  3ME7 A;  5FT3 A;  1EEJ A;  4XS4 A;  2A2S A;  2HRK A;  4HZ2 A;  1SKW B;  1PA3 A;  2PBJ A;  2VL9 A;  4V1A g;  3OR5 A;  1Z3E A;  3LOR A;  3LG6 A;  4WET A;  5DBQ A;  3CTG A;  2GDR A;  1PRX A;  3UIW A;  1B9Y C;  2KP2 A;  2WDU A;  1I9D A;  2GT5 A;  3E9J B;  2LEG A;  2CX4 A;  3EU4 A;  4ECJ A;  3E0U A;  3CBU A;  2HE3 A;  2C1Y A;  3EU3 A;  1GNW A;  4TR4 A;  1OE8 A;  3EUR A;  3ISO A;  2JZS A;  4NXI A;  4CDO A;  1A0R P;  3PPU A;  2DML A;  2JL4 A;  2TRX A;  1RW1 A;  3APS A;  4BPY A;  2RM6 A;  3KGK A;  3UBK A;  1AUC A;  3GV1 A;  3KMN A;  2GVP A;  4EUY A;  2BJX A;  3C1S A;  1Q98 A;  1MD4 A;  3IRA A;  2GZY A;  2GS3 A;  2VD0 A;  2C4J A;  3FY7 A;  2VL3 A;  2N5B A;  3H79 A;  3GX0 A;  2LQO A;  5G31 A;  4IBP A;  2N5F A;  4GQF A;  3DML A;  2WFC A;  1PFO A;  1V9W A;  1OVN A;  3BCK A;  4XRD A;  1B4Q A;  4EIP A;  1BQ7 A;  4G9H A;  2B1L A;  5D73 A;  2H75 A;  3D6I A;  1S3A A;  4FO5 A;  4JED A;  5B8B A;  5GAP D;  2VAF A;  1TI3 A;  5DCH A;  1GTI A;  1DE1 A;  4KGI A;  3GKK A;  5F05 A;  2FUG 2;  4OCE A;  4KDU A;  3RBT A;  3KTB A;  6GSU A;  4LL1 B;  2MYG A;  3A5W A;  3IC8 A;  3NOF A;  4DSQ A;  1Z5Y E;  3LJR A;  4MH3 A;  1OAZ A;  2MZC A;  2D2Z A;  4PUF C;  2YAN A;  4L0U A;  1X5E A;  2KHP A;  2E7P A;  4GLT A;  4PXO A;  1RQM A;  3D4M A;  1SK0 A;  4KSM A;  2QKE A;  1ERV A;  1K0C A;  6GSV A;  3FR6 A;  5B8A A;  3GFK A;  2AYT A;  2LNT A;  5AN1 A;  3NZN A;  2DJ0 A;  2EIR A;  1XWB A;  4KAE A;  3ME8 A;  5A4W A;  5ELA A;  3RPP A;  3IOS A;  2G0F A;  3EC3 A;  3HZ4 A;  3IHQ A;  2NTO A;  3QFB C;  3H8Q A;  4IW9 A;  3I9V 2;  6GST A;  3CQF A;  3F4S A;  1ERW A;  2QSI A;  4HU7 A;  14GS A;  3MIX A;  1GSU A;  2FHE A;  2H6X A;  3VLN A;  3UOM A;  4G0K A;  2E2M A;  3DRN A;  1AIU A;  2HSH A;  4GSS A;  3RHB A;  2CQ9 A;  2OA7 A;  2HI7 A;  2FCH A;  2H72 A;  3IAM 2;  4K7N A;  4MCU A;  4WEY A;  4GWR A;  4RQX A;  4ZL7 A;  4GSN A;  2OJL A;  3EMP A;  1H75 A;  1JZD A;  1O6J A;  4J57 E;  4DEJ A;  1K0N A;  3ZYW A;  3FR3 A;  1ERT A;  3P2A A;  1SU9 A;  4PX1 A;  1XVW A;  3M9J A;  5IIZ A;  3Q18 A;  3ZIJ A;  4ICY A;  5IMA A;  3J7Y k;  4HDE A;  3A5I A;  1Z7R A;  1LU4 A;  2VCT A;  3VWW A;  5G1K A;  2I81 A;  4KDY A;  4K9Z A;  5IPG A;  1O7U A;  4Z2T A;  1S3R A;  3ZLP A;  5CRH A;  4WXT A;  1FB6 A;  5HQP A;  1YEX A;  5J3R A;  6GSS A;  3TJK A;  2RLI A;  2F3M A;  1R7H A;  3QFA C;  1ON4 A;  1TK5 B;  3SWL A;  4WF5 A;  4AJ7 A;  3VFI A;  3KP8 A;  2CVB A;  1N2A A;  3CRU A;  2H71 A;  2RII A;  1G6W A;  2PER A;  1IYH A;  3IK9 A;  4RI6 A;  1PX6 A;  5A5K A;  2LJK A;  1YZX A;  3N9J A;  2C0G A;  2IWT A;  5DAL A;  5JCG A;  3KMO A;  5G30 A;  4G19 A;  3HD5 A;  4BVX A;  1YKA A;  1F37 A;  4MH2 A;  4GF0 A;  1GUK A;  4I2U A;  1TDI A;  4TOP A;  2A4V A;  20GS A;  4MF5 A;  5CNW A;  3HJP A;  2PVQ A;  4BVY A;  3HJM A;  1USB A;  3P7X A;  4F2I A;  4IVF A;  1FVJ A;  3IA1 A;  1M2A A;  4L5L A;  1T8E B;  3F4R A;  3C71 A;  2CAI A;  5G1L A;  3N5O A;  4O5R A;  3FYG A;  2F8F A;  2FGX A;  3RPN A;  5D9T A;  1MEK A;  1I5G A;  1ZCP A;  4G0L A;  3F6F A;  4KF9 A;  1A2J A;  3DD3 A;  4TN8 A;  2K18 A;  3A3T A;  5G2Z A;  1EV4 A;  1PKW A;  2IJY A;  2R5G A;  5G5F A;  2VD1 A;  3QCP A;  1EP8 A;  3QDN A;  1OYJ A;  4HS1 A;  4ZIL A;  4FYC A;  2HFD A;  3TKS C;  19GS A;  4MP4 A;  3M8N A;  1TKD B;  1RK4 A;  2NVL A;  4PGT A;  1E6B A;  4F0C A;  2H0I A;  4XS4 B;  4TR0 A;  1GP1 A;  3TKS E;  2N5A A;  5F07 A;  3H4K A;  2JSZ A;  4WR5 A;  4JR6 A;  3UL3 A;  1GLP A;  1XBS A;  4XHM A;  3FZ4 A;  3L9S A;  5AGY A;  3VPQ A;  5IOW A;  4L8E A;  4MDC A;  3LFL A;  2CA8 A;  3BCI A;  3UAP A;  12GS A;  3QAG A;  2VLU A;  4OMV A;  1MDK A;  4IQA A;  2LQQ A;  2GSR A;  2DBC A;  4MLY A;  3D4T A;  2H76 A;  4HQZ A;  4K5R A;  4WKW A;  10GS A;  3EPT A;  2E2G A;  4QL7 A;  3BJ5 A;  5DDL A;  4MZB A;  3VI5 A;  3TJF A;  1H4O A;  2WB9 A;  3Q6O A;  1J9B A;  1M9B A;  2DJK A;  2H30 A;  1QXH A;  1KNG A;  2FWF A;  3LYP A;  5CP1 A;  3VWV A;  1Z6N A;  3GNJ A;  4PQ1 A;  5D93 A;  5ELG A;  5JWQ B;  2HZE A;  2DMM A;  3J7Y b;  5KN2 A;  1SK1 A;  22GS A;  2XHF A;  4TR3 A;  2AUV A;  1K0M A;  1FO5 A;  2PN8 A;  4NV5 A;  1PX7 A;  3DYR A;  4ISD A;  1AQX A;  4ZBB A;  4HJ2 A;  3ZFL A;  4CY6 A;  2L57 A;  1ZYN A;  2EC4 A;  3VWU A;  4QL9 A;  1WWJ A;  3F3Q A;  3IHG A;  2QA1 A;  1TK8 B;  4FIW A;  3MDK A;  1GUH A;  2CZ3 A;  18GS A;  3M1G A;  1Y6E A;  4LMW A;  1HNC A;  1SYR A;  1O81 A;  3G7I A;  2MBT A;  8GSS A;  1XW5 A;  2A2P A;  4NAX A;  4HUA A;  3L9V A;  1T7P B;  6GSY A;  3TJJ A;  2DC5 A;  3MAK A;  1ERU A;  1TTZ A;  4POB A;  3GN3 A;  1SJI A;  3PR8 A;  1TU8 A;  1TRV A;  2B5E A;  1M0U A;  3FRC A;  1F3B A;  3ZZX A;  5IO2 A;  3FW2 A;  5EVO A;  4ZL9 A;  4PNF A;  2GZZ A;  2V2G A;  3FR9 A;  1FB0 A;  5ENU A;  5CRD A;  2VOC A;  3IDV A;  1XPV A;  4F9Z A;  3KJY A;  2X8G A;  3IE3 A;  2ON5 A;  4FYU A;  3QMX A;  2XC2 A;  4I8B A;  1M3J A;  4BIK A;  4OO4 A;  3H93 A;  4HI7 A;  1F3A A;  1GSF A;  3MWH A;  3TRP A;  2BMX A;  3RAZ A;  2IMI A;  2F51 A;  3ZIT A;  1M99 A;  3A2W A;  4PUA A;  5G5E A;  5HR2 A;  2B5Y A;  2DJ3 A;  4K7I A;  4PUR A;  2LV3 A;  3LXZ A;  3C8E A;  1MDI A;  2CV4 A;  4ZB6 A;  1NM3 A;  1SL1 B;  4FYB A;  3WGD A;  2JSY A;  1GSY A;  1KEB A;  1N8J A;  3ZRD A;  3BBY A;  5KN0 A;  5J41 A;  1T1V A;  2I9H A;  4KCE A;  5KEJ A;  4TXO B;  2HSY A;  1Q4J A;  2DKH A;  4MMM A;  3LQ7 A;  3VUR A;  2BTO T;  2ZCT A;  2C80 A;  2PGT A;  2WS2 A;  4ID0 A;  1XZO A;  2XPE A;  4EDZ A;  1SK2 A;  3HXS A;  1S3C A;  1WRY A;  2VO4 A;  3IBH A;  3LXT A;  3TKS A;  4IN0 A;  4ZIJ A;  5DVB A;  3CRT A;  2GTU A;  4EO3 A;  5DAK A;  3APQ A;  3TRQ A;  1XW9 A;  3WGE A;  1HQO A;  2OE3 A;  3FK8 A;  5J9B A;  2O89 A;  2QC7 A;  3KD0 A;  1J0F A;  1GSD A;  3F3R A;  1THO A;  1ZYE A;  3TOU A;  5DAL B;  2JAC A;  5L71 A;  2H6Y A;  4MF6 A;  2VIM A;  4BVX B;  1FVK A;  3EMX A;  5CRW A;  4TVE A;  2DJ1 A;  4NHZ A;  2H0H A;  4NMU A;  1Y25 A;  2R3X A;  5IMZ A;  3GKX A;  4IS0 A;  1VF2 A;  3DIE A;  4PTS A;  1XWK A;  4BVY B;  3PH9 A;  4G10 A;  4JU5 A;  4OO5 A;  4BL7 A;  1THX A;  4Q5N A;  4I2T A;  1IYI A;  4E8E A;  1MD3 A;  4Z7X A;  1WJK A;  4JRR A;  3L4N A;  4TW5 A;  1WMJ A;  2HLS A;  2GZP A;  1VF3 A;  1GNE A;  3R2Q A;  3FMW A;  4WBR D;  5IMC A;  3A2X A;  2L59 A;  3TJB A;  1GTB A;  3D5J A;  3ZMK A;  3V1W A;  3KXO A;  3DEX A;  4MJB A;  5GST A;  4DSS A;  1TRS A;  3EWL A;  3KEB A;  4Z2R A;  1JHB A;  1Z9H A;  1X9W B;  1TOF A;  2DJJ A;  4AJ8 A;  3PGT A;  5D96 A;  4WR4 A;  4CY8 A;  5ECM B;  2DJ2 A;  1PD2 1;  7GSS A;  3CTF A;  2OAD A;  2RUE A;  3D21 A;  3L0H A;  4OFN A;  4BA7 A;  4Z2U A;  1ZYQ B;  2OAC A;  1LBK A;  1X0R A;  4GXZ A;  3QPM A;  4MJC A;  1JZO A;  1PMT A;  1GSS A;  4MAB A;  3GTU A;  1TW9 A;  4ACS A;  1W89 A;  2VCW A;  2K8S A;  3O3T A;  5HFG A;  1QMV A;  2LRT A;  4BWS A;  1B8X A;  2CVK A;  2WUL A;  4YKG A;  3LYK A;  3TUE A;  4K1F A;  1GUL A;  2P0G A;  5COH A;  4TXO A;  1VF4 A;  2GT6 A;  2K8V A;  3GX8 A;  4RI7 A;  1BG5 A;  4ILF A;  1A2M A;  1UVZ A;  2ZNM A;  4POM A;  2B3S A;  2C3Q A;  4V2L A;  3C7M A;  1TP9 A;  5A4V A;  4MK3 A;  1BX9 A;  2H1G A;  2AAW A;  3G9B A;  2L4C A;  1K3Y A;  2I3Y A;  3G7J A;  1T4Z A;  5GSS A;  5HR1 A;  1U87 A;  1CQG A;  6GSW A;  4F82 A;  1A2L A;  3TKR A;  5JCW A;  2C3T A;  2XBI A;  1T3B A;  1UC7 A;  1XOA A;  2G2Q A;  2HZE B;  5ECK B;  4K7O A;  2OE0 A;  3GH9 A;  1MTC A;  1X5C A;  2X4A A;  4HEA 2;  5J5N A;  2R0P A;  1SYX A;  4N11 A;  4ZL8 A;  2KP1 A;  2HRA A;  1SD9 A;  3C73 A;  2IFQ A;  3VK9 A;  2YP6 A;  2L5L A;  2IIY A;  2R37 A;  2B7K A;  4IQ1 A;  5LCZ A;  1ZMA A;  5CO3 A;  1TRW A;  2LNS A;  3TGZ A;  2WJU A;  3M9K A;  1PN0 A;  2TIR A;  4NPB A;  4Q5F A;  1GL8 A;  1GH2 A;  1PQN A;  1AQW A;  2I4A A;  3FHK A;  4K0G A;  1XG8 A;  3TCO A;  3Q19 A;  5IO0 A;  1AAZ A;  3KTL A;  1PGT A;  1F6M C;  1GTA A;  3TJG A;  1B4P A;  3F4T A;  3D22 A;  2LRN A;  4ECC A;  4V2M A;  1FG4 A;  1SEN A;  2FNO A;  5H5R A;  3P8W A;  5C00 A;  1SKR B;  4K8M A;  4JZQ A;  1GSE A;  3TDG A;  4ECB A;  2REM A;  2XPD A;  2QA2 A;  2GGT A;  3GKM A;  4ML6 A;  4TXV A;  5JWR B;  2YOI A;  2ES7 A;  1FW1 A;  4ZBA A;  1TRU A;  5EY6 A;  3TRX A;  2AB6 A;  2H1B A;  4A5P A;  2DSA A;  1EZK A;  2YN1 A;  4OCF A;  2V6K A;  5A4U A;  5DJM A;  4KCA A;  2VL2 C; 
#chains in the Genus database with same CATH homology
 1VF1 A;  2MBS A;  2LUS A;  5B6M A;  1AXD A;  3IPZ A;  4KUN A;  3EIN A;  1V58 A;  2FWH A;  4MJE A;  3HJO A;  1M7T A;  4GRF A;  4E8H A;  3A2V A;  4LA1 A;  4LL4 B;  3GH6 A;  3HA9 A;  4HZ4 A;  2H73 A;  1BED A;  1HNA A;  2IPA A;  3IK7 A;  1BJX A;  3HYP A;  2RUF A;  2VCV A;  4TR1 A;  3CXG A;  1X9S B;  2B7J A;  4F03 A;  1K0D A;  5D8I A;  1G7E A;  5ECR B;  2HNL A;  1WIK A;  1B9X C;  4GST A;  2C8U A;  2GSQ A;  2YZU A;  3CSJ A;  5J4U A;  2O8V B;  4ZBD A;  2LTK A;  4NHW A;  1TK0 B;  4JBB A;  1R26 A;  5BRT A;  1KBN A;  3FZ5 A;  1HNB A;  4I6X A;  2YJH A;  3LEF A;  5DAK B;  13GS A;  2MMO A;  1ABA A;  1E2Y A;  3M0F A;  2M80 A;  2XBQ A;  3GSS A;  1YKC A;  3K8N A;  4G2E A;  1LJR A;  4X1U A;  1DUG A;  4JR4 A;  4WF4 A;  1CQH A;  5ECI B;  1R5P A;  3LWA A;  1A8Y A;  1YY7 A;  2LRC A;  1OC9 A;  2DIY A;  1SD8 A;  4KDX A;  4N0V A;  5ECP B;  1AW9 A;  5HR0 A;  2VUP A;  2MMA A;  3ED3 A;  2K6V A;  1Z6M A;  3CMI A;  1GSQ A;  3VPT A;  4BL7 B;  2CZ2 A;  1SL0 B;  16GS A;  2OBI A;  1YF1 A;  3MNG A;  4Q5Q A;  3ERF A;  4AJ6 A;  3FZ9 A;  2NDO A;  4K2X A;  4MPG A;  3D0Z A;  3GUS A;  2P31 A;  1OKT A;  5D9W A;  2DKI A;  2WZ9 A;  3APO A;  3SBC A;  3U5R E;  4FH8 A;  5B6N A;  4RQR A;  4X0X A;  4DSS B;  1K3O A;  1V57 A;  5JCU A;  3WYW A;  2GQL A;  1K0B A;  3QD9 A;  4O32 A;  4XS6 A;  2IN3 A;  3ZVJ A;  2HRF A;  2H0G A;  5EL8 A;  5ECS A;  2VCX A;  3QOU A;  4KA0 A;  2V1M A;  2PMT A;  5GAN D;  2I1U A;  4N10 A;  5E4W A;  2F9S A;  1KTE A;  3F6D A;  1R5A A;  4XRA A;  1XXU A;  1EGO A;  5AIX A;  1FOV A;  2Z9S A;  2L5O A;  4KSO A;  4NWY A;  1EP7 A;  4I97 A;  5ID2 A;  3KP9 A;  1EV9 A;  1PSQ A;  2DLX A;  2L4Q A;  3IXR A;  1SJZ A;  2X64 A;  1O85 A;  4KX4 A;  3IR4 A;  5KOX A;  3GTU B;  3EE2 A;  2V32 A;  3O76 A;  4IHU A;  3DVW A;  4LMV A;  4YAV A;  3DGQ A;  4EE0 A;  1EGR A;  2OBK A;  4TKY A;  3F9U A;  2V41 A;  4AF2 A;  1DSB A;  3NIV A;  1YQ1 A;  4V1A p;  3ERG A;  2VCZ A;  3GUR A;  4D73 B;  2J23 A;  1M2D A;  3GST A;  4OD7 A;  2L6D A;  3IAS 2;  2H74 A;  5LNK e;  4MZC A;  3W8S A;  3WT2 A;  4O5U A;  2C0D A;  3DXB A;  1EOG A;  1GTU A;  4J2F A;  3I69 A;  5F0G A;  5DQS A;  2GQM A;  4DSR A;  3EYT A;  1A8L A;  4ML1 A;  2HSM A;  3IV4 A;  2EIQ A;  4GTU A;  5KOW A;  2YWM A;  2V6O A;  1QFN A;  2JAD A;  1ST9 A;  4IJI A;  1QGV A;  2O85 A;  2B6M A;  1OE7 A;  1G0T A;  2YNX A;  3F8U A;  3IC4 A;  3G7Y A;  4IEL A;  3KZQ A;  2WGR A;  3F63 A;  1ZGN A;  1WPI A;  2GSS A;  3W6G A;  2M46 A;  1V98 A;  1YDK A;  4K5S A;  4OWY A;  2CT6 A;  2VL2 A;  2LJR A;  4HOJ A;  4ZB9 A;  2IFQ B;  3JCM L;  5IMD A;  4N30 A;  2VLT A;  4YQU A;  4KE3 A;  4PNG A;  1SKS B;  3TB2 A;  5D9X A;  3DWV A;  1FOH A;  2KOK A;  4ULX A;  3GA4 A;  2C0E A;  2DIZ A;  4YQM A;  2JU5 A;  1XWC A;  1A24 A;  1AC1 A;  4KND A;  3UMA A;  5ECL B;  2X8C A;  2JZT A;  5DQY A;  3QR6 A;  5ABR A;  2AV4 A;  17GS A;  3MSZ A;  3MYD A;  2P5R A;  4POK A;  3C1R A;  3HVX A;  1XFL A;  3WT1 A;  2YZH A;  1JFU A;  3EVI A;  2HZF A;  5IQY A;  2FD3 A;  4EDY A;  1JLW A;  1QQ2 A;  2X8H A;  2GQK A;  2NBS A;  2YCD A;  4Q5R A;  2IMF A;  2L6C A;  3HVS A;  5INY A;  3CSI A;  3WGX A;  3UEM A;  5HR3 A;  3HZ8 A;  3LSZ A;  2NPB A;  2H01 A;  3S9F A;  2JZR A;  4YAP A;  1YF0 A;  5CAX A;  2CAQ A;  1EEM A;  1TXX A;  4TRX A;  5HFI A;  1NSW A;  5HFK A;  4EXJ A;  3CYN A;  2FWG A;  2VLV A;  4MF7 A;  1O73 A;  4FQU A;  2FA4 A;  4D73 A;  2QGV A;  3KH9 A;  1R4W A;  1WE0 A;  4ZXG A;  4N0Z A;  1QK8 A;  1XVQ A;  1J08 A;  2O7K A;  2YWN A;  1GRX A;  3GIX A;  3HHV A;  2KLX A;  2O87 A;  5FHI A;  2B1K A;  4KW6 A;  4XTS A;  2WCI A;  1HD2 A;  11GS A;  3US3 A;  2LST A;  4XIH A;  3M3M A;  1M2B A;  4TR1 B;  1S3D A;  1A23 A;  4KB3 A;  3KM6 A;  1JZW A;  5FWG A;  5IPH A;  4ECI A;  4CHS A;  4P3Y B;  2A4H A;  4XCS A;  2E0Q A;  2FWE A;  1NW2 A;  5CYY A;  1OKD A;  4K2D A;  4PQH A;  1HYU A;  4OFT A;  5AIS A;  5KN3 A;  5B7C A;  1TI1 A;  2PVO C;  1VGL A;  5DJL A;  5IMF A;  5ECO B;  4HJM A;  1C72 A;  1NHY A;  3F0I A;  3GL5 A;  2HXK A;  4EF0 A;  1FHE A;  2UZ8 A;  1U3A A;  3U6V A;  3I43 A;  3H1N A;  3FKF A;  3HKR A;  4OFM A;  4J56 E;  1XCC A;  2H6Z A;  2YV7 A;  1T00 A;  3ZL5 A;  3WD6 A;  4YKF A;  3ZIV A;  3R3E A;  3CSH A;  4K0N A;  1ZOF A;  2K9F A;  1F2E A;  2ALB A;  4YQV A;  1EOH A;  3TOT A;  1URM A;  2A2R A;  2PUK C;  1OC9 B;  4O5Q A;  1K0O A;  3E3E A;  3UJ1 A;  1ILO A;  2HT9 A;  2LKU A;  4JE1 A;  4L5O A;  2FA8 A;  1OC3 A;  9GSS A;  1YEP A;  5IOX A;  1B48 A;  3GYK A;  4K6X A;  1U3I A;  2AHE A;  3HY2 A;  5IM9 A;  3DKS A;  1DBY A;  2ON7 A;  3LGC A;  5EPF A;  3FEU A;  4BWQ A;  1DE2 A;  1ML6 A;  2FLS A;  3PIN A;  3UVH A;  3GMF A;  4HQS A;  1JLV A;  1F9M A;  2R0C A;  2YJ7 A;  4O7H A;  1X5D A;  1U6T A;  1W4V A;  4EIQ A;  1V2A A;  4DVC A;  2WRT A;  5IMV A;  5H5Q A;  2VCQ A;  1K0A A;  5JWO B;  5F06 A;  2B5X A;  2OKA A;  1EWX A;  2MMZ A;  4IP1 A;  5F8B A;  3DVX A;  4LLR A;  3I6A A;  4IJ3 A;  4V2N A;  2GLR A;  1U88 A;  3UAR A;  3Q74 A;  1ACV A;  3ZRE A;  3GHA A;  4POL A;  3GL3 A;  2M72 A;  2H66 A;  1XWA A;  2YWI A;  1GLQ A;  5DCG A;  3TKP A;  2LS5 A;  1O8X A;  1T4Y A;  4X43 A;  5ECQ B;  1QUW A;  2P5Q A;  3HCZ A;  5ID2 B;  1ZL9 A;  1XIY A;  2C0F A;  4AGS A;  4ZB8 A;  4IP6 A;  2PPT A;  3P90 A;  4YH2 A;  2HRN A;  1XOB A;  3GKN A;  4EKZ A;  2RM5 A;  2YWO A;  2TRC P;  2IME A;  3RHC A;  4MA9 A;  1TU7 A;  1FAA A;  4RUV A;  6GSX A;  1O8W A;  1GWC A;  2R4V A;  3RDW A;  4NV2 A;  1PKZ A;  3UVT A;  3HDC A;  2GST A;  1VRS D;  2IL3 A;  3L78 A;  1SL2 B;  3QAW A;  1OC8 A;  1X9M B;  2FY6 A;  1BAY A;  3BD2 A;  5GZZ B;  1G7O A;  1PN9 A;  4MZW A;  2X49 A;  3FZA A;  1Z7P A;  2YV9 A;  2VM1 A;  4GCI A;  5ECH B;  5H5S A;  3GRX A;  1A0F A;  2F8A A;  4I5Q A;  1PL1 A;  3KCM A;  1YJ6 A;  3TKQ A;  2R6K A;  5ECN B;  5C04 A;  4IKH A;  2PWJ A;  4MNN A;  1XWG A;  2H1D A;  4H86 A;  3LW9 A;  3ZVJ D;  2HYX A;  4EC0 A;  2R2J A;  5CRE A;  2R0G A;  2H19 A;  3UBL A;  1UN2 A;  1M9A A;  1UA5 A;  3ZTL A;  3ZML A;  1AQV A;  5D9V A;  3L9U A;  4CW9 A;  4G0I A;  2CVD A;  4WBJ A;  2X99 A;  2H70 A;  3O6T A;  4F0B A;  4X4J A;  3VWX A;  3QAV A;  3VI7 A;  1MDJ A;  5KN1 A;  2IMK A;  2LJA A;  3ERW A;  1G6Y A;  4EL1 A;  1WOU A;  2OE1 A;  1K3L A;  4O92 A;  4PQI A;  1XW6 A;  2J9H A;  4GQC A;  1SJ6 A;  4XS1 A;  1BYE A;  2CX3 A;  2VM2 A;  4MPF A;  1TJD A;  5BMU A;  4MJA A;  2YPM A;  5AIV A;  2H1A A;  2PU9 C;  3KIJ A;  3KH7 A;  2MMN A;  2IMD A;  5E59 A;  1JZR A;  1GUM A;  5LD0 A;  3ZFB A;  5J9C A;  3HVV A;  5CRG A;  4QQ7 A;  2ZUP A;  1ZZY A;  4L0W A;  2EIO A;  2H8L A;  4EVM A;  1PL2 A;  4KH7 A;  1V40 A;  2C3N A;  3BOA A;  4IGJ A;  4USS A;  1WP0 A;  3W8J A;  1ZYP A;  4HU9 A;  1NHO A;  2AJQ B;  3AY8 A;  2KUC A;  3ME7 A;  5FT3 A;  1EEJ A;  4XS4 A;  2A2S A;  2HRK A;  4HZ2 A;  1SKW B;  1PA3 A;  2PBJ A;  2VL9 A;  4V1A g;  3OR5 A;  1Z3E A;  3LOR A;  3LG6 A;  4WET A;  5DBQ A;  3CTG A;  2GDR A;  1PRX A;  3UIW A;  1B9Y C;  2KP2 A;  2WDU A;  1I9D A;  2GT5 A;  3E9J B;  2LEG A;  2CX4 A;  3EU4 A;  4ECJ A;  3E0U A;  3CBU A;  2HE3 A;  2C1Y A;  3EU3 A;  1GNW A;  4TR4 A;  1OE8 A;  3EUR A;  3ISO A;  2JZS A;  4NXI A;  4CDO A;  1A0R P;  3PPU A;  2DML A;  2JL4 A;  2TRX A;  1RW1 A;  3APS A;  4BPY A;  2RM6 A;  3KGK A;  3UBK A;  1AUC A;  3GV1 A;  3KMN A;  2GVP A;  4EUY A;  2BJX A;  3C1S A;  1Q98 A;  1MD4 A;  3IRA A;  2GZY A;  2GS3 A;  2VD0 A;  2C4J A;  3FY7 A;  2VL3 A;  2N5B A;  3H79 A;  3GX0 A;  2LQO A;  5G31 A;  4IBP A;  2N5F A;  4GQF A;  3DML A;  2WFC A;  1V9W A;  1OVN A;  3BCK A;  4XRD A;  1B4Q A;  4EIP A;  1BQ7 A;  4G9H A;  2B1L A;  5D73 A;  2H75 A;  3D6I A;  1S3A A;  4FO5 A;  4JED A;  5B8B A;  5GAP D;  2VAF A;  1TI3 A;  5DCH A;  1GTI A;  1DE1 A;  4KGI A;  3GKK A;  5F05 A;  2FUG 2;  4OCE A;  4KDU A;  3RBT A;  3KTB A;  6GSU A;  4LL1 B;  2MYG A;  3A5W A;  3IC8 A;  3NOF A;  4DSQ A;  1Z5Y E;  3LJR A;  4MH3 A;  1OAZ A;  2MZC A;  2D2Z A;  4PUF C;  2YAN A;  4L0U A;  1X5E A;  2KHP A;  2E7P A;  4GLT A;  4PXO A;  1RQM A;  3D4M A;  1SK0 A;  4KSM A;  2QKE A;  1ERV A;  1K0C A;  6GSV A;  3FR6 A;  5B8A A;  3GFK A;  2AYT A;  2LNT A;  5AN1 A;  3NZN A;  2DJ0 A;  2EIR A;  1XWB A;  4KAE A;  3ME8 A;  5A4W A;  5ELA A;  3RPP A;  3IOS A;  2G0F A;  3EC3 A;  3HZ4 A;  3IHQ A;  2NTO A;  3QFB C;  3H8Q A;  4IW9 A;  3I9V 2;  6GST A;  3F4S A;  1ERW A;  2QSI A;  4HU7 A;  14GS A;  3MIX A;  1GSU A;  2FHE A;  2H6X A;  3VLN A;  3UOM A;  4G0K A;  2E2M A;  3DRN A;  1AIU A;  2HSH A;  4GSS A;  3RHB A;  2CQ9 A;  2OA7 A;  2HI7 A;  2FCH A;  2H72 A;  3IAM 2;  4K7N A;  4MCU A;  4WEY A;  4GWR A;  4RQX A;  4ZL7 A;  4GSN A;  2OJL A;  3EMP A;  1H75 A;  1JZD A;  1O6J A;  4J57 E;  4DEJ A;  1K0N A;  3ZYW A;  3FR3 A;  1ERT A;  3P2A A;  1SU9 A;  4PX1 A;  1XVW A;  3M9J A;  5IIZ A;  3Q18 A;  3ZIJ A;  4ICY A;  5IMA A;  3J7Y k;  4HDE A;  3A5I A;  1Z7R A;  1LU4 A;  2VCT A;  3VWW A;  5G1K A;  2I81 A;  4KDY A;  4K9Z A;  5IPG A;  1O7U A;  4Z2T A;  3ZLP A;  5CRH A;  4WXT A;  1FB6 A;  5HQP A;  1YEX A;  5J3R A;  6GSS A;  3TJK A;  2RLI A;  2F3M A;  1R7H A;  3QFA C;  1ON4 A;  1TK5 B;  3SWL A;  4WF5 A;  4AJ7 A;  3VFI A;  3KP8 A;  2CVB A;  1N2A A;  3CRU A;  2H71 A;  2RII A;  1G6W A;  2PER A;  1IYH A;  3IK9 A;  4RI6 A;  1PX6 A;  5A5K A;  2LJK A;  1YZX A;  3N9J A;  2C0G A;  2IWT A;  5DAL A;  5JCG A;  3KMO A;  5G30 A;  4G19 A;  3HD5 A;  4BVX A;  1YKA A;  1F37 A;  4MH2 A;  4GF0 A;  1GUK A;  4I2U A;  1TDI A;  4TOP A;  2A4V A;  20GS A;  4MF5 A;  5CNW A;  3HJP A;  2PVQ A;  4BVY A;  3HJM A;  1USB A;  3P7X A;  4F2I A;  4IVF A;  1FVJ A;  3IA1 A;  1M2A A;  4L5L A;  1T8E B;  3F4R A;  3C71 A;  2CAI A;  5G1L A;  3N5O A;  4O5R A;  3FYG A;  2F8F A;  2FGX A;  3RPN A;  5D9T A;  1MEK A;  1I5G A;  1ZCP A;  4G0L A;  3F6F A;  4KF9 A;  1A2J A;  3DD3 A;  4TN8 A;  2K18 A;  3A3T A;  5G2Z A;  1EV4 A;  1PKW A;  2IJY A;  2R5G A;  5G5F A;  2VD1 A;  3QCP A;  1EP8 A;  3QDN A;  1OYJ A;  4HS1 A;  4ZIL A;  4FYC A;  2HFD A;  3TKS C;  19GS A;  4MP4 A;  3M8N A;  1TKD B;  1RK4 A;  2NVL A;  4PGT A;  1E6B A;  4F0C A;  2H0I A;  4XS4 B;  4TR0 A;  1GP1 A;  3TKS E;  2N5A A;  5F07 A;  3H4K A;  2JSZ A;  4WR5 A;  4JR6 A;  3UL3 A;  1GLP A;  1XBS A;  4XHM A;  3FZ4 A;  3L9S A;  5AGY A;  3VPQ A;  5IOW A;  4L8E A;  4MDC A;  3LFL A;  2CA8 A;  3BCI A;  3UAP A;  12GS A;  3QAG A;  2VLU A;  4OMV A;  1MDK A;  4IQA A;  2LQQ A;  2GSR A;  2DBC A;  4MLY A;  3D4T A;  2H76 A;  4HQZ A;  4K5R A;  4WKW A;  10GS A;  3EPT A;  2E2G A;  4QL7 A;  3BJ5 A;  5DDL A;  4MZB A;  3VI5 A;  3TJF A;  1H4O A;  2WB9 A;  3Q6O A;  1J9B A;  1M9B A;  2DJK A;  2H30 A;  1QXH A;  1KNG A;  2FWF A;  3LYP A;  5CP1 A;  3VWV A;  1Z6N A;  3GNJ A;  4PQ1 A;  5D93 A;  5ELG A;  5JWQ B;  2HZE A;  2DMM A;  3J7Y b;  5KN2 A;  1SK1 A;  22GS A;  2XHF A;  4TR3 A;  2AUV A;  1K0M A;  1FO5 A;  2PN8 A;  4NV5 A;  1PX7 A;  3DYR A;  4ISD A;  1AQX A;  4ZBB A;  4HJ2 A;  3ZFL A;  4CY6 A;  2L57 A;  1ZYN A;  2EC4 A;  3VWU A;  4QL9 A;  1WWJ A;  3F3Q A;  3IHG A;  2QA1 A;  1TK8 B;  4FIW A;  3MDK A;  1GUH A;  2CZ3 A;  18GS A;  3M1G A;  1Y6E A;  4LMW A;  1HNC A;  1SYR A;  1O81 A;  3G7I A;  2MBT A;  8GSS A;  1XW5 A;  2A2P A;  4NAX A;  4HUA A;  3L9V A;  1T7P B;  6GSY A;  3TJJ A;  2DC5 A;  3MAK A;  1ERU A;  1TTZ A;  4POB A;  3GN3 A;  1SJI A;  3PR8 A;  1TU8 A;  1TRV A;  2B5E A;  1M0U A;  3FRC A;  1F3B A;  3ZZX A;  5IO2 A;  3FW2 A;  5EVO A;  4ZL9 A;  4PNF A;  2GZZ A;  2V2G A;  3FR9 A;  1FB0 A;  5ENU A;  5CRD A;  2VOC A;  3IDV A;  1XPV A;  4F9Z A;  3KJY A;  2X8G A;  3IE3 A;  2ON5 A;  4FYU A;  3QMX A;  2XC2 A;  4I8B A;  4OO4 A;  3H93 A;  4HI7 A;  1F3A A;  1GSF A;  3MWH A;  3TRP A;  2BMX A;  3RAZ A;  2IMI A;  2F51 A;  3ZIT A;  1M99 A;  3A2W A;  4PUA A;  5G5E A;  5HR2 A;  2B5Y A;  2DJ3 A;  4K7I A;  4PUR A;  2LV3 A;  3LXZ A;  3C8E A;  1MDI A;  2CV4 A;  4ZB6 A;  1NM3 A;  1SL1 B;  4FYB A;  3WGD A;  2JSY A;  1GSY A;  1KEB A;  1N8J A;  3ZRD A;  3BBY A;  5KN0 A;  5J41 A;  1T1V A;  2I9H A;  4KCE A;  5KEJ A;  4TXO B;  2HSY A;  1Q4J A;  2DKH A;  4MMM A;  3LQ7 A;  3VUR A;  2BTO T;  2ZCT A;  2C80 A;  2PGT A;  2WS2 A;  4ID0 A;  1XZO A;  2XPE A;  4EDZ A;  1SK2 A;  3HXS A;  1S3C A;  1WRY A;  2VO4 A;  3IBH A;  3LXT A;  3TKS A;  4IN0 A;  4ZIJ A;  5DVB A;  3CRT A;  2GTU A;  4EO3 A;  5DAK A;  3APQ A;  3TRQ A;  1XW9 A;  3WGE A;  1HQO A;  2OE3 A;  3FK8 A;  5J9B A;  2O89 A;  2QC7 A;  3KD0 A;  1J0F A;  1GSD A;  3F3R A;  1THO A;  1ZYE A;  3TOU A;  5DAL B;  2JAC A;  5L71 A;  2H6Y A;  4MF6 A;  2VIM A;  4BVX B;  1FVK A;  3EMX A;  5CRW A;  4TVE A;  2DJ1 A;  4NHZ A;  2H0H A;  4NMU A;  1Y25 A;  2R3X A;  5IMZ A;  3GKX A;  4IS0 A;  1VF2 A;  3DIE A;  4PTS A;  1XWK A;  4BVY B;  3PH9 A;  4G10 A;  4JU5 A;  4OO5 A;  4BL7 A;  1THX A;  4Q5N A;  4I2T A;  1IYI A;  4E8E A;  1MD3 A;  4Z7X A;  1WJK A;  4JRR A;  3L4N A;  4TW5 A;  1WMJ A;  2HLS A;  2GZP A;  1VF3 A;  1GNE A;  3R2Q A;  3FMW A;  4WBR D;  5IMC A;  3A2X A;  2L59 A;  3TJB A;  1GTB A;  3D5J A;  3ZMK A;  3V1W A;  3KXO A;  3DEX A;  4MJB A;  5GST A;  4DSS A;  1TRS A;  3EWL A;  3KEB A;  4Z2R A;  1JHB A;  1Z9H A;  1X9W B;  1TOF A;  2DJJ A;  4AJ8 A;  3PGT A;  5D96 A;  4WR4 A;  4CY8 A;  5ECM B;  2DJ2 A;  1PD2 1;  7GSS A;  3CTF A;  2OAD A;  2RUE A;  3D21 A;  3L0H A;  4OFN A;  4BA7 A;  4Z2U A;  1ZYQ B;  2OAC A;  1LBK A;  1X0R A;  4GXZ A;  3QPM A;  4MJC A;  1JZO A;  1PMT A;  1GSS A;  4MAB A;  3GTU A;  1TW9 A;  4ACS A;  1W89 A;  2VCW A;  2K8S A;  3O3T A;  5HFG A;  1QMV A;  2LRT A;  4BWS A;  1B8X A;  2CVK A;  2WUL A;  4YKG A;  3LYK A;  3TUE A;  4K1F A;  1GUL A;  2P0G A;  5COH A;  4TXO A;  1VF4 A;  2GT6 A;  2K8V A;  3GX8 A;  4RI7 A;  1BG5 A;  4ILF A;  1A2M A;  1UVZ A;  2ZNM A;  4POM A;  2B3S A;  2C3Q A;  4V2L A;  3C7M A;  1TP9 A;  5A4V A;  4MK3 A;  1BX9 A;  2H1G A;  2AAW A;  3G9B A;  2L4C A;  1K3Y A;  2I3Y A;  3G7J A;  1T4Z A;  5GSS A;  5HR1 A;  1U87 A;  1CQG A;  6GSW A;  4F82 A;  1A2L A;  3TKR A;  5JCW A;  2C3T A;  2XBI A;  1T3B A;  1UC7 A;  1XOA A;  2G2Q A;  2HZE B;  5ECK B;  4K7O A;  2OE0 A;  3GH9 A;  1MTC A;  1X5C A;  2X4A A;  4HEA 2;  5J5N A;  2R0P A;  1SYX A;  4N11 A;  4ZL8 A;  2KP1 A;  2HRA A;  1SD9 A;  3C73 A;  2IFQ A;  3VK9 A;  2YP6 A;  2L5L A;  2IIY A;  2R37 A;  2B7K A;  4IQ1 A;  5LCZ A;  1ZMA A;  5CO3 A;  1TRW A;  2LNS A;  3TGZ A;  2WJU A;  3M9K A;  1PN0 A;  2TIR A;  4NPB A;  4Q5F A;  1GL8 A;  1GH2 A;  1PQN A;  1AQW A;  2I4A A;  3FHK A;  4K0G A;  3TCO A;  3Q19 A;  5IO0 A;  1AAZ A;  3KTL A;  1PGT A;  1F6M C;  1GTA A;  3TJG A;  1B4P A;  3F4T A;  3D22 A;  2LRN A;  4ECC A;  4V2M A;  1FG4 A;  1SEN A;  2FNO A;  5H5R A;  3P8W A;  5C00 A;  1SKR B;  4K8M A;  4JZQ A;  1GSE A;  3TDG A;  4ECB A;  2REM A;  2XPD A;  2QA2 A;  2GGT A;  3GKM A;  4ML6 A;  4TXV A;  5JWR B;  2YOI A;  2ES7 A;  1FW1 A;  4ZBA A;  1TRU A;  5EY6 A;  3TRX A;  2AB6 A;  2H1B A;  4A5P A;  2DSA A;  1EZK A;  2YN1 A;  4OCF A;  2V6K A;  5A4U A;  5DJM A;  4KCA A;  2VL2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...