1VRSD

Crystal structure of the disulfide-linked complex between the n-terminal and c-terminal domain of the electron transfer catalyst dsbd
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
HLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVASKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Structural basis and kinetics of inter- and intramolecular disulfide exchange in the redox catalyst DsbD
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
total genus 42
structure length 118
sequence length 118
chains with identical sequence E, F
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vrsD00
1TRSA 2VM2A 2FCHA 2OACA 1Y25A 1EGOA 1XCCA 4OFMA 2AAWA 4LL1B 5ECKB 2LKUA 1G7OA 5DQYA 1SK0A 1B4PA 5JCGA 4NPBA 1H4OA 3F9UA 2KHPA 3FZAA 1ZMAA 1ZYQB 2V6KA 2A2SA 1OKDA 5HR3A 1TI3A 10GSA 3FR6A 1AUCA 5C00A 2H8LA 2IFQB 1MDKA 2VO4A 3M1GA 3DKSA 4TXOA 2VL2A 1Q4JA 1TI1A 4PGTA 1OC9B 2C4JA 6GSWA 3CRUA 2DBCA 2FD3A 2LNTA 4GSSA 3DGQA 2PMTA 2VOCA 5FHIA 3H1NA 4HQSA 4ECJA 2IMEA 2H0HA 4O5RA 3FZ4A 3H93A 4MJAA 1ZYEA 3C1SA 5D9WA 3GTUB 3KTLA 5G2ZA 1GSDA 4E8HA 1K0MA 3EURA 2O7KA 3FRCA 3U6VA 3KD0A 3HYPA 5JCWA 4IHUA 2NPBA 2YV9A 4AGSA 4V2LA 3FEUA 4GQCA 1TRWA 3J7Yk 2HZEA 1BAYA 1FB6A 2P31A 1WRYA 1PQNA 4JBBA 2HFDA 1K3YA 2B1LA 1YEPA 4KCEA 4HI7A 4XHMA 4MMMA 1WWJA 4KDYA 3DMLA 5CO3A 2DJ2A 3LQ7A 3ZTLA 2FWFA 2PVOC 3QFAC 1TP9A 3ERGA 1JZRA 3DD3A 3TKPA 4I2UA 2PWJA 2CZ3A 3M3MA 5B8BA 1J08A 1O8XA 2BMXA 4MABA 3SBCA 2IMKA 5CRWA 3QAVA 1X9SB 1QUWA 5KEJA 4GRFA 3C73A 2LRNA 2LUSA 4J2FA 1LJRA 3ZRDA 2F8AA 1GSSA 1SL0B 1GH2A 3F3QA 2HRFA 1A2LA 1SJIA 2R4VA 3HZ4A 3UAPA 2O87A 3F4TA 1F3AA 18GSA 2EIOA 1MDIA 1SK2A 3GKXA 2B5XA 1XW6A 5ECQB 3TGZA 4MJEA 5A5KA 2GQMA 3WD6A 1SJZA 1ZGNA 3V1WA 1V57A 4JR4A 4ZBDA 5F06A 2H0GA 2I3YA 1ILOA 2F3MA 3FR3A 2WRTA 3I6AA 5B6NA 5A4WA 3PGTA 2RUFA 3N5OA 1ZZYA 3D21A 2GZPA 5IO2A 3LXZA 3DXBA 1XIYA 5IQYA 3A2XA 2OJLA 3HDCA 4BWSA 3ZIJA 2O89A 5HFIA 2AJQB 5DQSA 2XBIA 2HT9A 3LFLA 5IPGA 9GSSA 1U87A 3GH6A 3CRTA 2DSAA 3OR5A 2YOIA 4F82A 1GTBA 3GSSA 3BBYA 3QFBC 1AAZA 3BOAA 4N0ZA 1TXXA 1W4VA 4HU7A 5CRHA 3GA4A 4BA7A 1LU4A 1ZL9A 1K0NA 1H75A 1THOA 2K8VA 1XWKA 2RM5A 2LRTA 1GP1A 1U6TA 5IIZA 3E9JB 3GMFA 4ILFA 4HQZA 5G30A 2X99A 1XW9A 3CMIA 3JCML 4ZIJA 3HD5A 5EVOA 2VCWA 4N30A 1KNGA 3ZIVA 2AHEA 4DSRA 1GRXA 4X1UA 5AIVA 2QSIA 1TOFA 4MZCA 4PX1A 2H30A 2M46A 1QXHA 4K2DA 2GGTA 3A2WA 4D73B 5D93A 1QQ2A 4K0NA 5DVBA 1N2AA 5IO0A 2N5AA 1BEDA 4K1FA 5HR0A 1SKWB 1OYJA 1AQWA 4JRRA 2F9SA 2P0GA 4G10A 4N11A 2TRCP 2ON5A 2X8GA 3TUEA 1R5PA 3QAWA 3TJKA 2EIQA 2K18A 1NHYA 5IM9A 2LSTA 1TW9A 4WF5A 4PQIA 4FH8A 4ZB6A 3RPPA 5DALA 5G5FA 3DVXA 3ZLPA 1PD21 2I81A 2WULA 3KM6A 8GSSA 1PN9A 3Q6OA 5JWQB 3N9JA 3EU4A 1M2DA 4IN0A 4G9HA 5J4UA 5CRGA 4JZQA 1XW5A 4PQHA 3LG6A 3UVTA 3KP8A 2GVPA 3GIXA 1G7EA 6GSUA 3CBUA 2KP2A 2X8CA 1SU9A 3O6TA 2CT6A 2WJUA 1YKAA 1PX6A 4WBJA 3PH9A 3O3TA 3BD2A 4POKA 2YWIA 2VL3A 1GSYA 4V2MA 1A2JA 2HXKA 4YAPA 1GSEA 6GSXA 2RIIA 4Q5NA 1FW1A 7GSSA 1B9XC 3MWHA 4L0UA 4K0GA 4GWRA 5DJLA 3L78A 1GNEA 5B7CA 1V58A 2C80A 4EDYA 4IP6A 1J9BA 1GULA 4KA0A 2GQKA 5F8BA 3TRXA 4G19A 3BCIA 2B6MA 2BJXA 4QL9A 4XS4A 2IFQA 4GTUA 4JEDA 4K7OA 3UVHA 3UARA 4Q5FA 2YCDA 3LYPA 4JR6A 3KCMA 4KSOA 2IMDA 1OC9A 4LLRA 5G31A 4POLA 3ZMLA 3TKQA 3IK7A 2VCTA 4HZ4A 3CTGA 1FAAA 4PUAA 5DAKA 2JZRA 3QCPA 2AV4A 2L5LA 3VWWA 5B6MA 4OCFA 3MNGA 1T3BA 3TRQA 1FVJA 4HOJA 4MLYA 1X9WB 3GTUA 4MF7A 3VI7A 2PN8A 3IE3A 5L71A 3W6GA 2YV7A 3GV1A 3D4TA 1I5GA 2PGTA 1EZKA 2ES7A 2HYXA 2R37A 2CA8A 3F6DA 2L59A 4FYUA 5KN3A 4EF0A 1DE1A 3U5RE 1TRVA 1GL8A 2WGRA 2LTKA 4MH2A 1QFNA 1M9BA 1V9WA 4AJ6A 4EUYA 2EC4A 3HY2A 3VWUA 2H19A 2VAFA 5GSSA 2GSSA 4MDCA 5H5SA 1HNCA 1SJ6A 2QGVA 3ISOA 1F6MC 1PGTA 3H4KA 4FIWA 4YAVA 5ECOB 5HFKA 2H72A 5D9TA 3KTBA 3TDGA 1YDKA 3HKRA 4KE3A 1GTAA 1B8XA 2MMZA 1PKZA 2L57A 2C0DA 4IGJA 2NTOA 3KP9A 3IC4A 1TTZA 5HR1A 2C0GA 1FG4A 1EEJA 3DVWA 1K0BA 4V1Ag 5AIXA 5DCGA 2GTUA 2YNXA 1M2BA 3PINA 2VL2C 5HFGA 2VD0A 2LEGA 5DJMA 5KN0A 1XBSA 2MMNA 1URMA 3HVVA 2WS2A 5INYA 1K3OA 4MA9A 1MEKA 3KH7A 1BX9A 3L0HA 5DCHA 1VRSD 1PKWA 2LJRA 1GUHA 2CX3A 1BYEA 4WR4A 4ZB9A 4IKHA 5ECNB 1JFUA 2DMMA 2H66A 3F3RA 3UBKA 5IOWA 2DJJA 3MAKA 1K0OA 1WIKA 2QC7A 4RQRA 1IYIA 2FA4A 1OE8A 2GSQA 3KXOA 5LD0A 1RK4A 4L0WA 4KNDA 2I9HA 3IRAA 5D9VA 3CSIA 3IPZA 1HNAA 2PVQA 3HJPA 4GSTA 4ECCA 1W89A 3D4MA 3I43A 4MF5A 1A8LA 1AIUA 4MZBA 4X0XA 2E0QA 3LORA 3EYTA 4HZ2A 5IMZA 3IBHA 2LRCA 3CSHA 4MZWA 4L8EA 3IR4A 3VPTA 3AY8A 2TIRA 3P7XA 5ID2A 4OD7A 5JWOB 13GSA 2B5YA 4TR1B 4HS1A 5EPFA 2OBKA 3GKMA 5E59A 2X64A 4K9ZA 3K8NA 4I6XA 3IAS2 3MDKA 3LWAA 4ZBBA 2FY6A 2FHEA 2LS5A 1F37A 1O81A 4IVFA 1ZOFA 2H6ZA 3TKSE 4EDZA 5CAXA 2CAQA 1G6YA 4D73A 3C8EA 3TB2A 1O8WA 3FHKA 4HEA2 5ECLB 2DIYA 1SKSB 1SK1A 1BJXA 5COHA 1SYXA 4HU9A 2E2MA 3HA9A 5ECMB 2F8FA 4IJIA 2EIRA 3TCOA 4K7IA 4IJ3A 1CQGA 4EC0A 5AISA 2FWHA 1DE2A 2OE1A 1XZOA 2LQQA 5GAPD 3VWXA 4K8MA 4F0BA 4Q5RA 3A3TA 2R3XA 4J56E 2VCZA 2MBTA 4WEYA 3LXTA 2WFCA 2J23A 4QQ7A 4F0CA 3RAZA 3ED3A 4PURA 3DEXA 3GL5A 1Z7RA 4TRXA 2VLVA 1JLVA 2LJAA 3NIVA 1WMJA 2G0FA 3EC3A 4IP1A 1VF2A 2E7PA 3UBLA 5C04A 2FWEA 5ELGA 1M0UA 4GXZA 1VF4A 4F9ZA 2YZUA 2FNOA 1SENA 4NV2A 4LMVA 1EP7A 2DJ1A 3L9VA 1NW2A 1Q98A 2KP1A 4BWQA 1TRUA 4XS1A 1MD4A 4DSSB 1YKCA 1HNBA 4DSQA 4OWYA 4I2TA 4MP4A 12GSA 2H1DA 4YQMA 2P5RA 3QD9A 2K9FA 1K3LA 1OE7A 2HLSA 4PUFC 3RBTA 3IHQA 2K8SA 1SD9A 1YF0A 2L5OA 1Y6EA 1A0FA 5ENUA 5ECSA 4ZILA 3IV4A 20GSA 2DC5A 1AW9A 2R5GA 3FZ9A 1BG5A 4O7HA 1ZCPA 4RI6A 3EU3A 1KEBA 1QMVA 2CV4A 4CDOA 1S3AA 2H73A 3QPMA 2GZZA 4Z7XA 3DRNA 1JZDA 2H76A 3Q74A 1USBA 1ERVA 4KGIA 4ZXGA 5KN2A 2IIYA 2YJ7A 1Z6MA 3FYGA 3UL3A 2C0EA 2GSTA 4EL1A 2D2ZA 2YWMA 4QL7A 2HSYA 2ZUPA 2FWGA 3HVXA 2IPAA 4XCSA 3GNJA 1NHOA 2L6CA 1E2YA 2DJ3A 3KMNA 1RW1A 3VLNA 3KIJA 3A2VA 4KW6A 3F6FA 3UMAA 4WKWA 2OBIA 4LL4B 3Q19A 1GLPA 2A4VA 1M2AA 3DYRA 2MYGA 3W8SA 2IN3A 3H8QA 2ON7A 2LJKA 2M72A 4MF6A 1G6WA 2GDRA 5IOXA 1GNWA 2L6DA 4Q5QA 1V98A 3C1RA 2CVBA 4ID0A 5IMAA 1DSBA 2IJYA 2R2JA 1EP8A 2C3QA 2MZCA 3G7IA 2H71A 2MMAA 3WGDA 2HSHA 2CAIA 1EV4A 6GSYA 1YF1A 5GZZB 3APSA 2YP6A 4OFTA 2OA7A 2FA8A 2DLXA 2CQ9A 11GSA 1GLQA 4XRAA 2MBSA 3KH9A 4RUVA 4MJCA 3M8NA 1XFLA 3L9UA 2X8HA 4N0VA 5F05A 3P8WA 2H1GA 4NWYA 1XVQA 1PRXA 3M0FA 5JCUA 4TR3A 2VCXA 5D8IA 3GKNA 3F63A 5LCZA 1IYHA 4PNGA 2OE0A 4WR5A 5FT3A 4AJ8A 1F2EA 4BVXA 4O32A 1GSFA 3KZQA 2J9HA 1S3DA 3RPNA 3QDNA 1JLWA 4HDEA 5D9XA 4POBA 1UVZA 4FYBA 2JU5A 2VLUA 4XS6A 2REMA 3GL3A 5J3RA 2JZSA 5F07A 5G5EA 1S3CA 2CVKA 4AF2A 1CQHA 5ECHB 4JU5A 4ZL7A 1E6BA 1AQXA 3Q18A 1PA3A 1GTIA 2JL4A 4TR1A 3I9V2 1MD3A 2OKAA 1QK8A 3GX0A 1YJ6A 1Z9HA 1GTUA 4KB3A 4V1Ap 5DBQA 1X5EA 1OC3A 2NBSA 4OCEA 3D6IA 2HZFA 2PPTA 1A24A 1B9YC 3BJ5A 5H5RA 1PL2A 2K6VA 4IBPA 1VF3A 2ZCTA 2JSYA 1J0FA 1TK8B 3VI5A 5CNWA 4GF0A 3G9BA 5E4WA 3S9FA 2YPMA 4EVMA 1SYRA 1EOHA 3GURA 4RI7A 4ACSA 3FKFA 2TRXA 2HNLA 1EGRA 5CRDA 3KGKA 4XIHA 2C8UA 4N10A 3VK9A 3VURA 3TJFA 5D96A 1X5DA 2H75A 2XC2A 3NZNA 4BPYA 16GSA 5GAND 3TKSA 4FO5A 1VF1A 4ZB8A 3ZITA 2PUKC 3J7Yb 2YANA 1XVWA 3CXGA 2LQOA 2B7JA 3LYKA 2PERA 4HJMA 4ZBAA 1XWGA 1EOGA 3FY7A 3IDVA 3QR6A 1V40A 1XPVA 3CYNA 4ZL9A 5A4VA 4POMA 3ME7A 1R4WA 1FOVA 2G2QA 4TR4A 5A4UA 1XOBA 1Z7PA 3UOMA 1X0RA 3TOTA 1XWAA 2JACA 2VCQA 4J57E 4XS4B 2DJKA 2N5FA 2B5EA 5CYYA 1AQVA 4DSSA 3IAM2 1ERWA 4MJBA 3QMXA 3SWLA 3ZMKA 2V2GA 4K7NA 1UN2A 4BL7A 4KDXA 2C0FA 3D0ZA 3VWVA 5ELAA 2WCIA 3KJYA 2FGXA 1PMTA 3KEBA 2B3SA 5DAKB 3HHVA 3C7MA 2YN1A 4F2IA 2H74A 2L4QA 1THXA 1T4YA 2RLIA 2HE3A 22GSA 1TDIA 5ECIB 4EO3A 2BTOT 4L5LA 1AC1A 3TJJA 4ECBA 3C71A 4O92A 5B8AA 4DEJA 3W8JA 5J9BA 2CZ2A 19GSA 3IOSA 4MCUA 5J5NA 4WBRD 1O73A 1SL1B 3GH9A 3LGCA 1NSWA 2IMFA 4RQXA 1U88A 1MTCA 4KDUA 3BCKA 3TJGA 1MDJA 4NHWA 1M7TA 3TKRA 4MPFA 5G1KA 3RHCA 1XXUA 2C3TA 3M9JA 4KUNA 2VLTA 3MSZA 1T00A 3APQA 2RM6A 4PXOA 2IMIA 3FR9A 1T7PB 3WYWA 1U3IA 2XBQA 2C1YA 2VL9A 2VUPA 2V6OA 1QGVA 3CSJA 3P90A 1EWXA 1F3BA 3EE2A 2FLSA 1DBYA 2P5QA 3ZVJA 1NM3A 1BQ7A 2LV3A 1HQOA 3EMXA 5ECPB 1TK5B 2JADA 3GN3A 4GCIA 3I69A 2YJHA 4G2EA 4P3YB 3L9SA 4TW5A 2O8VB 4EKZA 4TOPA 1YY7A 1GUMA 2AUVA 3UJ1A 5D73A 5EL8A 4TKYA 4TXOB 2GLRA 4ISDA 1M9AA 6GSTA 1K0DA 1R7HA 2FUG2 3HCZA 1T4ZA 2I1UA 4MH3A 3E3EA 1GWCA 3TOUA 4V2NA 5G1LA 1PSQA 4IQAA 1DUGA 2H70A 2XPDA 1XWCA 2NVLA 2H6XA 5F0GA 1SKRB 2N5BA 5EY6A 4X43A 5AN1A 1GSQA 3EINA 4PNFA 4H86A 17GSA 5H5QA 3ZFBA 3QOUA 3ZYWA 3EWLA 4BVYA 2DIZA 2H6YA 3QAGA 5KN1A 2AB6A 3EVIA 2Z9SA 5ID2B 3UIWA 2F51A 3NOFA 4HJ2A 1A2MA 1B48A 4F03A 1GUKA 1U3AA 2HZEB 4EXJA 1O85A 4PQ1A 1YQ1A 4TVEA 4ML6A 2HRNA 3D5JA 2O85A 3FK8A 5HR2A 1KBNA 2OADA 3PR8A 4NMUA 5LNKe 2KUCA 2CX4A 1OC8A 4ZL8A 1O7UA 4FYCA 1KTEA 4NAXA 4IS0A 1X9MB 1XWBA 4WETA 1PL1A 3ERFA 2XHFA 1TK0B 3WT1A 1WPIA 3G7JA 4IELA 2VCVA 2WB9A 1N8JA 2NDOA 3IK9A 3WT2A 3GYKA 4K6XA 5AGYA 2ZNMA 3GFKA 3HJMA 3LSZA 1X5CA 1FB0A 3TRPA 2RUEA 5HQPA 2I4AA 2B1KA 3LEFA 3RDWA 1HYUA 1TJDA 2WZ9A 2V1MA 3GUSA 2IL3A 1UA5A 4XTSA 1FHEA 3FZ5A 1K0CA 2XPEA 4IW9A 3EMPA 1R5AA 2C3NA 4KX4A 2R6KA 3VFIA 1RQMA 1ML6A 2HI7A 1VGLA 2DMLA 1ST9A 5J9CA 1UC7A 2H01A 3GSTA 3A5WA 4I8BA 1ACVA 4NHZA 4YQVA 1JZWA 2JZTA 4I97A 2L4CA 3ERWA 1OAZA 2GT6A 2VD1A 5CREA 1V2AA 4ML1A 4KSMA 1WE0A 1O6JA 2IWTA 1HD2A 3IA1A 1OKTA 4TN8A 1EV9A 1OVNA 4L5OA 1B4QA 4EE0A 3HJOA 1XOAA 4I5QA 2AYTA 1M99A 3FW2A 3WGXA 5J41A 1I9DA 4LMWA 3VPQA 2V41A 2GS3A 2KOKA 4CW9A 4MPGA 4KAEA 4DVCA 3ZL5A 4MK3A 2WDUA 3GKKA 1A23A 2GQLA 3G7YA 1SD8A 14GSA 4OO5A 3DIEA 3HXSA 2YWNA 1G0TA 4KH7A 1WJKA 5IMVA 1TU7A 1AXDA 3F4RA 3F0IA 1YZXA 3F8UA 2M80A 3GX8A 5FWGA 1SL2B 3WGEA 2B7KA 3ZZXA 3ZREA 2E2GA 3P2AA 5IPHA 2YZHA 4KCAA 2GZYA 1F9MA 3KMOA 5GSTA 3GHAA 4OMVA 3R2QA 3US3A 1Z3EA 1ABAA 3L4NA 1LBKA 5JWRB 6GSVA 3ME8A 2QKEA 1WP0A 2KLXA 3HVSA 1EEMA 4YQUA 3F4SA 5CP1A 1FO5A 1GSUA 2H1BA 4ECIA 2V32A 2PBJA 2OE3A 4NV5A 4NXIA 4TXVA 4HUAA 3HZ8A 4XRDA 2JSZA 5DALB 5ABRA 4WXTA 4E8EA 4CHSA 4GLTA 2VIMA 1TU8A 1WOUA 3ZVJD 3TJBA 2GT5A 1R26A 1JHBA 1A8YA 1ON4A 3M9KA 3LJRA 2ALBA 1Z5YE 2DJ0A 3TKSC 6GSSA 1T8EB 4GSNA 1TKDB 3ZFLA 4GQFA 1FVKA 5DDLA 3D22A 5IMCA 2H1AA 1T1VA 3DWVA 4YH2A 1C72A 2YWOA 5ECRB 4OFNA 5IMFA 5IMDA 3APOA 1ERTA 2GSRA 4OO4A 3RHBA 2VM1A 4LA1A 2LNSA 1ERUA 1Z6NA 3IXRA 2H0IA 4ULXA 3UEMA 4JE1A 2CVDA 1PX7A 1JZOA 4AJ7A 3H79A 2A2RA 1A0RP 1K0AA 4WF4A 4TR0A 1YEXA 3CTFA 2PU9C 2MMOA 4IQ1A 3O76A 3E0UA 3GRXA
chains in the Genus database with same CATH superfamily
1TRSA 2VM2A 2FCHA 2OACA 1Y25A 1EGOA 1XCCA 4OFMA 2AAWA 4LL1B 5ECKB 2LKUA 1G7OA 5DQYA 1SK0A 1B4PA 5JCGA 4NPBA 1H4OA 3F9UA 3HVNA 2KHPA 3FZAA 1ZMAA 1ZYQB 2V6KA 2A2SA 1OKDA 5HR3A 1TI3A 10GSA 3FR6A 1AUCA 5C00A 2H8LA 2IFQB 1MDKA 2VO4A 4BVXB 3M1GA 3DKSA 4TXOA 2VL2A 1Q4JA 1TI1A 4PGTA 1OC9B 2C4JA 6GSWA 3CRUA 2DBCA 2FD3A 2LNTA 4GSSA 3DGQA 2PMTA 2VOCA 5FHIA 3H1NA 4HQSA 4ECJA 2IMEA 2H0HA 4O5RA 3FZ4A 3H93A 4MJAA 1ZYEA 3C1SA 4Z2UA 5D9WA 3GTUB 3KTLA 5G2ZA 1GSDA 4E8HA 1K0MA 3EURA 2O7KA 3FRCA 3U6VA 3KD0A 3HYPA 5JCWA 4IHUA 2NPBA 2YV9A 4AGSA 4V2LA 3FEUA 4GQCA 1TRWA 3J7Yk 2HZEA 1BAYA 1FB6A 2P31A 1WRYA 1PQNA 4JBBA 2HFDA 1K3YA 2B1LA 1YEPA 4KCEA 4HI7A 4XHMA 4MMMA 1WWJA 4KDYA 3DMLA 5CO3A 2DJ2A 3LQ7A 3ZTLA 2FWFA 2PVOC 3QFAC 1TP9A 3ERGA 1JZRA 3DD3A 3TKPA 4I2UA 2PWJA 2CZ3A 3M3MA 5B8BA 1J08A 1O8XA 2BMXA 4MABA 3SBCA 2IMKA 5CRWA 3QAVA 4CY6A 1X9SB 1QUWA 5KEJA 4GRFA 3C73A 2LRNA 2LUSA 4J2FA 1LJRA 3ZRDA 2F8AA 1GSSA 1SL0B 1GH2A 3F3QA 2HRFA 1A2LA 1SJIA 4O5UA 2R4VA 3HZ4A 3UAPA 2O87A 3F4TA 1F3AA 18GSA 2EIOA 1MDIA 1SK2A 3GKXA 2B5XA 1XW6A 5ECQB 3TGZA 4MJEA 5A5KA 2GQMA 3WD6A 1SJZA 1ZGNA 3V1WA 1V57A 4JR4A 4ZBDA 5F06A 2H0GA 2I3YA 1ILOA 2F3MA 3FR3A 2WRTA 3I6AA 5B6NA 5A4WA 3PGTA 2RUFA 3N5OA 1ZZYA 3D21A 2GZPA 5IO2A 4CY8A 3LXZA 3DXBA 1XIYA 5IQYA 3A2XA 2OJLA 3HDCA 4BWSA 3ZIJA 2O89A 3A5IA 5HFIA 2AJQB 5DQSA 2XBIA 2HT9A 3LFLA 5IPGA 9GSSA 1U87A 3GH6A 3CRTA 2DSAA 3OR5A 2YOIA 4F82A 1GTBA 3GSSA 3BBYA 3QFBC 1AAZA 3BOAA 4N0ZA 4BL7B 1TXXA 1W4VA 4HU7A 5CRHA 3GA4A 4BA7A 1LU4A 1ZL9A 1K0NA 1H75A 1THOA 2K8VA 1XWKA 2RM5A 2LRTA 1GP1A 1U6TA 5IIZA 3E9JB 3GMFA 4ILFA 4HQZA 5G30A 2X99A 1XW9A 3CMIA 3JCML 4ZIJA 3HD5A 5EVOA 2VCWA 4N30A 1KNGA 3ZIVA 2AHEA 4DSRA 1GRXA 4X1UA 5AIVA 2QSIA 1TOFA 4MZCA 4PX1A 2H30A 2M46A 1QXHA 4K2DA 2GGTA 3A2WA 4D73B 5D93A 1QQ2A 4K0NA 5DVBA 1N2AA 5IO0A 2N5AA 1BEDA 4K1FA 5HR0A 1SKWB 1OYJA 1AQWA 4JRRA 2F9SA 2P0GA 4G10A 4N11A 2TRCP 2ON5A 2X8GA 3TUEA 1R5PA 3QAWA 4Z2TA 3TJKA 2EIQA 2K18A 1NHYA 5IM9A 2LSTA 1TW9A 4WF5A 4PQIA 4FH8A 4ZB6A 3RPPA 5DALA 5G5FA 3DVXA 3ZLPA 1PD21 2I81A 2WULA 3KM6A 8GSSA 1PN9A 3Q6OA 5JWQB 3N9JA 3EU4A 1M2DA 4IN0A 4G9HA 5J4UA 5CRGA 4JZQA 1XW5A 4PQHA 3LG6A 3UVTA 3KP8A 2GVPA 3GIXA 1G7EA 6GSUA 3CBUA 2KP2A 2X8CA 1SU9A 3O6TA 2CT6A 2WJUA 1YKAA 1PX6A 4WBJA 3PH9A 3O3TA 4KF9A 3BD2A 4POKA 2YWIA 2VL3A 1GSYA 4V2MA 1A2JA 2HXKA 4YAPA 1GSEA 6GSXA 2RIIA 4Q5NA 1FW1A 7GSSA 1B9XC 3MWHA 4L0UA 4K0GA 4GWRA 5DJLA 3L78A 1GNEA 5B7CA 1V58A 2C80A 4EDYA 4IP6A 1J9BA 1GULA 4KA0A 2GQKA 5F8BA 3TRXA 4G19A 2R0CA 3BCIA 2B6MA 2BJXA 4QL9A 4XS4A 2IFQA 4GTUA 4JEDA 4K7OA 3UVHA 4USSA 3UARA 4Q5FA 2YCDA 3LYPA 4JR6A 3KCMA 4KSOA 2IMDA 1OC9A 4LLRA 5G31A 4POLA 3ZMLA 3TKQA 3IK7A 2VCTA 4HZ4A 3CTGA 1FAAA 4PUAA 5DAKA 2JZRA 3QCPA 2AV4A 2L5LA 3VWWA 5B6MA 4OCFA 3MNGA 1T3BA 3TRQA 1FVJA 4HOJA 4MLYA 1X9WB 3GTUA 4MF7A 3VI7A 2PN8A 3IE3A 5L71A 5BRTA 3W6GA 2YV7A 3GV1A 3D4TA 1I5GA 2PGTA 1EZKA 2ES7A 2HYXA 2R37A 2CA8A 3F6DA 2L59A 4FYUA 5KN3A 4EF0A 1DE1A 3U5RE 1TRVA 1GL8A 2WGRA 2LTKA 4MH2A 1QFNA 1M9BA 1V9WA 4AJ6A 4EUYA 2EC4A 3HY2A 3VWUA 2H19A 2VAFA 5GSSA 2GSSA 4MDCA 5H5SA 1HNCA 1SJ6A 2QGVA 3ISOA 1F6MC 1PGTA 3H4KA 4FIWA 4YAVA 5ECOB 5HFKA 2H72A 5D9TA 3KTBA 3TDGA 1YDKA 3HKRA 4KE3A 1GTAA 1B8XA 2MMZA 2UZ8A 1PKZA 2L57A 2C0DA 3MYDA 4IGJA 2NTOA 3KP9A 3IC4A 1TTZA 5HR1A 2C0GA 1FG4A 1EEJA 1ZYNA 3DVWA 1K0BA 4V1Ag 5AIXA 5DCGA 2DKHA 2GTUA 2YNXA 1M2BA 3PINA 2VL2C 5HFGA 2VD0A 2LEGA 5DJMA 5KN0A 1XBSA 2MMNA 1URMA 3HVVA 2WS2A 5INYA 1K3OA 4MA9A 1MEKA 3KH7A 1BX9A 3L0HA 5DCHA 1VRSD 1PKWA 2LJRA 1GUHA 2CX3A 1BYEA 2HRKA 4WR4A 4ZB9A 4IKHA 5ECNB 1JFUA 2DMMA 2H66A 3F3RA 3UBKA 5IOWA 2DJJA 3MAKA 1K0OA 1WIKA 2QC7A 4RQRA 1IYIA 2FA4A 1OE8A 2GSQA 3KXOA 5LD0A 1RK4A 4L0WA 4KNDA 2I9HA 3IRAA 5D9VA 3CSIA 3IPZA 1HNAA 2PVQA 3HJPA 4GSTA 4ECCA 1W89A 3D4MA 3I43A 4MF5A 1A8LA 1AIUA 4MZBA 4X0XA 2E0QA 3LORA 3EYTA 4HZ2A 5IMZA 3IBHA 2LRCA 3CSHA 4MZWA 4L8EA 3IR4A 3VPTA 3AY8A 2TIRA 3P7XA 5ID2A 4OD7A 5JWOB 13GSA 2B5YA 4TR1B 4HS1A 5EPFA 2OBKA 3GKMA 4EIQA 5E59A 2X64A 4K9ZA 3K8NA 4I6XA 3IAS2 3MDKA 3LWAA 4O5QA 4ZBBA 2FY6A 2FHEA 2LS5A 1F37A 1O81A 4IVFA 1ZOFA 2H6ZA 3TKSE 4EDZA 5CAXA 2CAQA 1G6YA 4D73A 3C8EA 3TB2A 1O8WA 3FHKA 4HEA2 5ECLB 2DIYA 1SKSB 1SK1A 1BJXA 5COHA 1SYXA 4HU9A 2E2MA 3HA9A 5ECMB 2F8FA 4IJIA 2EIRA 3TCOA 4K7IA 4IJ3A 1CQGA 4EC0A 5AISA 2FWHA 1DE2A 2OE1A 1XZOA 2LQQA 5GAPD 3VWXA 4K8MA 4F0BA 4Q5RA 3A3TA 2R3XA 4J56E 2VCZA 2MBTA 4WEYA 3LXTA 2WFCA 2J23A 4QQ7A 4F0CA 3RAZA 3ED3A 4PURA 3DEXA 3GL5A 1Z7RA 4TRXA 2VLVA 1JLVA 2LJAA 3NIVA 1WMJA 2G0FA 3EC3A 4IP1A 1VF2A 2E7PA 2DKIA 3UBLA 5C04A 2FWEA 5ELGA 1M0UA 4GXZA 2HSMA 1VF4A 4F9ZA 2YZUA 2FNOA 1SENA 4NV2A 4LMVA 1EP7A 2DJ1A 3L9VA 1NW2A 1Q98A 2KP1A 4BWQA 1TRUA 4XS1A 1MD4A 4DSSB 1YKCA 1HNBA 4DSQA 4EIPA 4OWYA 4I2TA 4MP4A 12GSA 2H1DA 4YQMA 2P5RA 3QD9A 2K9FA 1K3LA 1OE7A 2HLSA 4PUFC 3RBTA 3IHQA 2K8SA 1SD9A 1YF0A 2L5OA 1Y6EA 1A0FA 5ENUA 3IHGA 5ECSA 4ZILA 3IV4A 20GSA 2DC5A 1AW9A 2R5GA 3FZ9A 1BG5A 4O7HA 1ZCPA 4RI6A 3EU3A 1KEBA 1QMVA 2CV4A 4CDOA 1S3AA 2H73A 3QPMA 2GZZA 4Z7XA 3DRNA 1JZDA 2H76A 3Q74A 1USBA 1ERVA 4KGIA 4ZXGA 5KN2A 2IIYA 2YJ7A 1Z6MA 3CQFA 3FYGA 3UL3A 2C0EA 2GSTA 4EL1A 2D2ZA 2YWMA 4QL7A 2HSYA 2ZUPA 2FWGA 1XG8A 3HVXA 2IPAA 4XCSA 3GNJA 2R0PA 1NHOA 2L6CA 1E2YA 2DJ3A 3KMNA 1RW1A 3VLNA 3KIJA 3A2VA 4KW6A 3F6FA 3UMAA 4WKWA 2OBIA 4LL4B 3Q19A 1GLPA 2A4VA 1M2AA 3DYRA 2MYGA 1FOHA 3W8SA 2IN3A 3H8QA 2ON7A 2LJKA 2M72A 4MF6A 1G6WA 2GDRA 5IOXA 1GNWA 2L6DA 4Q5QA 1V98A 3C1RA 2CVBA 4ID0A 5IMAA 1DSBA 2IJYA 2R2JA 1EP8A 2C3QA 2MZCA 3G7IA 2H71A 2MMAA 3WGDA 2HSHA 2CAIA 3MIXA 1EV4A 6GSYA 1YF1A 5GZZB 3APSA 2YP6A 4OFTA 2OA7A 2FA8A 2DLXA 2CQ9A 11GSA 1GLQA 4XRAA 2MBSA 1PN0A 3KH9A 4RUVA 4MJCA 3M8NA 1XFLA 3L9UA 2X8HA 4N0VA 5F05A 3P8WA 2H1GA 4NWYA 1XVQA 1PRXA 1M3JA 3M0FA 2QA2A 5JCUA 4TR3A 2VCXA 5D8IA 3GKNA 3F63A 5LCZA 1IYHA 1M3IA 4PNGA 2OE0A 4WR5A 5FT3A 4AJ8A 1F2EA 4BVYB 4BVXA 4O32A 1GSFA 3KZQA 2J9HA 1S3DA 3RPNA 3QDNA 1JLWA 4HDEA 5D9XA 4POBA 1UVZA 4FYBA 4YKFA 2HRAA 2JU5A 2VLUA 4XS6A 2REMA 3GL3A 5J3RA 2JZSA 4G0KA 5F07A 5G5EA 1S3CA 2CVKA 4AF2A 1CQHA 5ECHB 4JU5A 4ZL7A 1E6BA 1AQXA 3Q18A 1PA3A 1GTIA 2JL4A 3R3EA 4TR1A 4HSCX 3I9V2 1MD3A 2QA1A 2OKAA 1QK8A 3GX0A 1YJ6A 1Z9HA 1GTUA 4KB3A 4Z2RA 4V1Ap 5DBQA 1X5EA 1OC3A 2NBSA 4OCEA 3D6IA 2HZFA 2PPTA 1A24A 1B9YC 3BJ5A 5H5RA 1PL2A 2K6VA 4IBPA 1VF3A 2ZCTA 2JSYA 1J0FA 1TK8B 5KOWA 3VI5A 5CNWA 4GF0A 3G9BA 5E4WA 3S9FA 2YPMA 4EVMA 1SYRA 3FMWA 1EOHA 3GURA 4RI7A 4ACSA 4PTSA 3FKFA 2TRXA 2HNLA 1EGRA 5CRDA 3KGKA 4XIHA 2C8UA 4N10A 3VK9A 3VURA 3TJFA 5D96A 2X4AA 1X5DA 2H75A 2XC2A 3NZNA 4BPYA 16GSA 5GAND 3TKSA 4FO5A 1VF1A 4ZB8A 3ZITA 2PUKC 3J7Yb 2YANA 1XVWA 3CXGA 2LQOA 2B7JA 3LYKA 2PERA 4HJMA 4ZBAA 1XWGA 1EOGA 3FY7A 3IDVA 3QR6A 1V40A 1XPVA 3CYNA 4ZL9A 5A4VA 4POMA 3ME7A 1R4WA 1FOVA 4G0LA 2G2QA 4TR4A 5A4UA 1XOBA 1Z7PA 3UOMA 1X0RA 3TOTA 1XWAA 2JACA 2VCQA 4J57E 4XS4B 2DJKA 2N5FA 2B5EA 5CYYA 1AQVA 4DSSA 3IAM2 1ERWA 4MJBA 3QMXA 3SWLA 3ZMKA 2V2GA 4K7NA 1UN2A 4BL7A 4KDXA 2C0FA 3D0ZA 3VWVA 5ELAA 2WCIA 3KJYA 2FGXA 1PMTA 3KEBA 2B3SA 5DAKB 3HHVA 3C7MA 2YN1A 4F2IA 2H74A 2L4QA 1THXA 1T4YA 2RLIA 2HE3A 22GSA 1TDIA 5ECIB 4EO3A 2BTOT 4L5LA 1AC1A 3TJJA 4ECBA 3C71A 4O92A 5B8AA 4DEJA 3W8JA 5J9BA 2CZ2A 19GSA 3IOSA 4MCUA 5J5NA 4WBRD 1O73A 1SL1B 3GH9A 3LGCA 1NSWA 2IMFA 4MNNA 4RQXA 1U88A 1MTCA 4KDUA 3BCKA 3TJGA 1MDJA 4NHWA 1M7TA 3TKRA 4MPFA 5G1KA 3RHCA 1XXUA 2C3TA 3M9JA 4KUNA 2VLTA 3MSZA 1T00A 3APQA 2RM6A 4PXOA 2IMIA 3FR9A 1T7PB 3WYWA 1U3IA 2XBQA 2C1YA 2VL9A 2VUPA 2V6OA 1QGVA 3CSJA 3P90A 1EWXA 1F3BA 3EE2A 2FLSA 1DBYA 2P5QA 3ZVJA 1NM3A 1BQ7A 2LV3A 1HQOA 1PFOA 3EMXA 5ECPB 1TK5B 2JADA 3EPTA 3GN3A 4GCIA 3I69A 2YJHA 4G2EA 4P3YB 3L9SA 4TW5A 2O8VB 1ZYPA 4EKZA 2A2PA 4TOPA 1YY7A 1GUMA 2AUVA 4FQUA 3UJ1A 5D73A 5EL8A 4TKYA 4TXOB 2GLRA 4ISDA 1M9AA 6GSTA 1K0DA 1R7HA 2FUG2 3HCZA 1T4ZA 2I1UA 4MH3A 3E3EA 1GWCA 3TOUA 4V2NA 5G1LA 1PSQA 4IQAA 1DUGA 2H70A 2XPDA 1XWCA 2NVLA 2H6XA 5F0GA 1SKRB 2N5BA 5EY6A 4X43A 5AN1A 1GSQA 3EINA 4PNFA 4H86A 17GSA 5H5QA 3ZFBA 3QOUA 3ZYWA 3EWLA 4BVYA 2DIZA 4K5RA 2H6YA 3QAGA 5KN1A 2AB6A 3EVIA 2Z9SA 5ID2B 3UIWA 2F51A 3NOFA 4HJ2A 1A2MA 1B48A 4F03A 1GUKA 3PPUA 1U3AA 2HZEB 4EXJA 1O85A 4PQ1A 1YQ1A 4TVEA 4ML6A 2HRNA 3D5JA 2O85A 3FK8A 5HR2A 1KBNA 2OADA 3PR8A 4NMUA 5LNKe 2KUCA 2CX4A 1OC8A 3LW9A 4ZL8A 1O7UA 4FYCA 4K5SA 1KTEA 4NAXA 4IS0A 1X9MB 1XWBA 4WETA 3IC8A 1PL1A 3ERFA 2XHFA 1TK0B 3WT1A 1WPIA 3G7JA 4IELA 2VCVA 2WB9A 1N8JA 2NDOA 3IK9A 3WT2A 3GYKA 4K6XA 5AGYA 2ZNMA 3GFKA 3HJMA 3LSZA 4YKGA 1X5CA 1FB0A 3TRPA 2RUEA 5HQPA 2I4AA 2B1KA 3LEFA 3RDWA 1HYUA 1TJDA 2WZ9A 2V1MA 3GUSA 2IL3A 1UA5A 4XTSA 1FHEA 3FZ5A 1K0CA 2XPEA 4IW9A 3EMPA 1R5AA 2C3NA 4KX4A 2R6KA 3VFIA 1RQMA 1ML6A 2HI7A 1VGLA 2DMLA 1ST9A 5J9CA 1UC7A 2H01A 3GSTA 3A5WA 4I8BA 1ACVA 4NHZA 4YQVA 1JZWA 2JZTA 4I97A 2L4CA 3ERWA 1OAZA 2GT6A 2VD1A 5CREA 1V2AA 4ML1A 4X4JA 4KSMA 1WE0A 1O6JA 2IWTA 1HD2A 3IA1A 1OKTA 4TN8A 1EV9A 1OVNA 4L5OA 1B4QA 4EE0A 3HJOA 1XOAA 4I5QA 2AYTA 1M99A 3FW2A 3WGXA 5J41A 1I9DA 4LMWA 3VPQA 2V41A 2GS3A 2KOKA 2X49A 4CW9A 4MPGA 4KAEA 4DVCA 3ZL5A 4MK3A 2WDUA 3GKKA 1A23A 2GQLA 3G7YA 1SD8A 14GSA 4OO5A 3DIEA 3HXSA 2YWNA 1G0TA 4KH7A 1WJKA 5IMVA 1TU7A 1AXDA 4A5PA 3F4RA 5KOXA 3F0IA 1YZXA 3F8UA 2M80A 3GX8A 5FWGA 1SL2B 3WGEA 2B7KA 3ZZXA 3ZREA 4ICYA 2E2GA 3P2AA 5IPHA 2YZHA 4KCAA 2GZYA 1F9MA 3KMOA 5GSTA 3GHAA 1S3RA 4OMVA 2A4HA 3R2QA 3US3A 1Z3EA 1ABAA 3L4NA 1LBKA 5JWRB 6GSVA 3ME8A 2QKEA 1WP0A 2KLXA 3HVSA 1EEMA 4YQUA 3F4SA 5CP1A 1FO5A 1GSUA 2H1BA 2R0GA 4ECIA 2V32A 2PBJA 2OE3A 4NV5A 4NXIA 4TXVA 4HUAA 4K2XA 3HZ8A 4XRDA 2JSZA 5DALB 5ABRA 4WXTA 4E8EA 4CHSA 4GLTA 2VIMA 1TU8A 1WOUA 3ZVJD 3TJBA 2GT5A 1R26A 1JHBA 1A8YA 1ON4A 3M9KA 3LJRA 2ALBA 1Z5YE 2DJ0A 3TKSC 6GSSA 5BMUA 4GSNA 1T8EB 1TKDB 4G0IA 3ZFLA 4GQFA 1FVKA 5DDLA 3D22A 5IMCA 2H1AA 1T1VA 3DWVA 4YH2A 1C72A 2YWOA 5ECRB 4OFNA 5IMFA 5IMDA 3APOA 1ERTA 2GSRA 4OO4A 3RHBA 2VM1A 4LA1A 2LNSA 1ERUA 1Z6NA 3IXRA 2H0IA 4ULXA 3UEMA 4JE1A 2CVDA 1PX7A 1JZOA 4AJ7A 3H79A 2A2RA 1A0RP 1K0AA 4WF4A 4TR0A 1YEXA 3CTFA 2PU9C 2MMOA 4BIKA 4IQ1A 3O76A 3E0UA 3GRXA
chains in the Genus database with same CATH topology
1TRSA 2VM2A 2FCHA 2OACA 1Y25A 1EGOA 1XCCA 4OFMA 2AAWA 4LL1B 5ECKB 2LKUA 1G7OA 5DQYA 1SK0A 1B4PA 5JCGA 4NPBA 1H4OA 3F9UA 2KHPA 3FZAA 1ZMAA 1ZYQB 2V6KA 2A2SA 1OKDA 5HR3A 1TI3A 10GSA 3FR6A 1AUCA 5C00A 2H8LA 2IFQB 1MDKA 2VO4A 4BVXB 3M1GA 3DKSA 4TXOA 2VL2A 1Q4JA 1TI1A 4PGTA 1OC9B 2C4JA 6GSWA 3CRUA 2DBCA 2FD3A 2LNTA 4GSSA 3DGQA 2PMTA 2VOCA 5FHIA 3H1NA 4HQSA 4ECJA 2IMEA 2H0HA 4O5RA 3FZ4A 3H93A 4MJAA 1ZYEA 3C1SA 4Z2UA 5D9WA 3GTUB 3KTLA 5G2ZA 1GSDA 4E8HA 1K0MA 3EURA 2O7KA 3FRCA 3U6VA 3KD0A 3HYPA 5JCWA 4IHUA 2NPBA 2YV9A 4AGSA 4V2LA 3FEUA 4GQCA 1TRWA 3J7Yk 2HZEA 1BAYA 1FB6A 2P31A 1WRYA 1PQNA 4JBBA 2HFDA 1K3YA 2B1LA 1YEPA 4KCEA 4HI7A 4XHMA 4MMMA 1WWJA 4KDYA 3DMLA 5CO3A 2DJ2A 3LQ7A 3ZTLA 2FWFA 2PVOC 3QFAC 1TP9A 3ERGA 1JZRA 3DD3A 3TKPA 4I2UA 2PWJA 2CZ3A 3M3MA 5B8BA 1J08A 1O8XA 2BMXA 4MABA 3SBCA 2IMKA 5CRWA 3QAVA 4CY6A 1X9SB 1QUWA 5KEJA 4GRFA 3C73A 2LRNA 2LUSA 4J2FA 1LJRA 3ZRDA 2F8AA 1GSSA 1SL0B 1GH2A 3F3QA 2HRFA 1A2LA 1SJIA 4O5UA 2R4VA 3HZ4A 3UAPA 2O87A 3F4TA 1F3AA 18GSA 2EIOA 1MDIA 1SK2A 3GKXA 2B5XA 1XW6A 5ECQB 3TGZA 4MJEA 5A5KA 2GQMA 3WD6A 1SJZA 1ZGNA 3V1WA 1V57A 4JR4A 4ZBDA 5F06A 2H0GA 2I3YA 1ILOA 2F3MA 3FR3A 2WRTA 3I6AA 5B6NA 5A4WA 3PGTA 2RUFA 3N5OA 1ZZYA 3D21A 2GZPA 5IO2A 4CY8A 3LXZA 3DXBA 1XIYA 5IQYA 3A2XA 2OJLA 3HDCA 4BWSA 3ZIJA 2O89A 3A5IA 5HFIA 2AJQB 5DQSA 2XBIA 2HT9A 3LFLA 5IPGA 9GSSA 1U87A 3GH6A 3CRTA 2DSAA 3OR5A 2YOIA 4F82A 1GTBA 3GSSA 3BBYA 3QFBC 1AAZA 3BOAA 4N0ZA 4BL7B 1TXXA 1W4VA 4HU7A 5CRHA 3GA4A 4BA7A 1LU4A 1ZL9A 1K0NA 1H75A 1THOA 2K8VA 1XWKA 2RM5A 2LRTA 1GP1A 1U6TA 5IIZA 3E9JB 3GMFA 4ILFA 4HQZA 5G30A 2X99A 1XW9A 3CMIA 3JCML 4ZIJA 3HD5A 5EVOA 2VCWA 4N30A 1KNGA 3ZIVA 2AHEA 4DSRA 1GRXA 4X1UA 5AIVA 2QSIA 1TOFA 4MZCA 4PX1A 2H30A 2M46A 1QXHA 4K2DA 2GGTA 3A2WA 4D73B 5D93A 1QQ2A 4K0NA 5DVBA 1N2AA 5IO0A 2N5AA 1BEDA 4K1FA 5HR0A 1SKWB 1OYJA 1AQWA 4JRRA 2F9SA 2P0GA 4G10A 4N11A 2TRCP 2ON5A 2X8GA 3TUEA 1R5PA 3QAWA 4Z2TA 3TJKA 2EIQA 2K18A 1NHYA 5IM9A 2LSTA 1TW9A 4WF5A 4PQIA 4FH8A 4ZB6A 3RPPA 5DALA 5G5FA 3DVXA 3ZLPA 1PD21 2I81A 2WULA 3KM6A 8GSSA 1PN9A 3Q6OA 5JWQB 3N9JA 3EU4A 1M2DA 4IN0A 4G9HA 5J4UA 5CRGA 4JZQA 1XW5A 4PQHA 3LG6A 3UVTA 3KP8A 2GVPA 3GIXA 1G7EA 6GSUA 3CBUA 2KP2A 2X8CA 1SU9A 3O6TA 2CT6A 2WJUA 1YKAA 1PX6A 4WBJA 3PH9A 3O3TA 4KF9A 3BD2A 4POKA 2YWIA 2VL3A 1GSYA 4V2MA 1A2JA 2HXKA 4YAPA 1GSEA 6GSXA 2RIIA 4Q5NA 1FW1A 7GSSA 1B9XC 3MWHA 4L0UA 4K0GA 4GWRA 5DJLA 3L78A 1GNEA 5B7CA 1V58A 2C80A 4EDYA 4IP6A 1J9BA 1GULA 4KA0A 2GQKA 5F8BA 3TRXA 4G19A 2R0CA 3BCIA 2B6MA 2BJXA 4QL9A 4XS4A 2IFQA 4GTUA 4JEDA 4K7OA 3UVHA 4USSA 3UARA 4Q5FA 2YCDA 3LYPA 4JR6A 3KCMA 4KSOA 2IMDA 1OC9A 4LLRA 5G31A 4POLA 3ZMLA 3TKQA 3IK7A 2VCTA 4HZ4A 3CTGA 1FAAA 4PUAA 5DAKA 2JZRA 3QCPA 2AV4A 2L5LA 3VWWA 5B6MA 4OCFA 3MNGA 1T3BA 3TRQA 1FVJA 4HOJA 4MLYA 1X9WB 3GTUA 4MF7A 3VI7A 2PN8A 3IE3A 5L71A 5BRTA 3W6GA 2YV7A 3GV1A 3D4TA 1I5GA 2PGTA 1EZKA 2ES7A 2HYXA 2R37A 2CA8A 3F6DA 2L59A 4FYUA 5KN3A 4EF0A 1DE1A 3U5RE 1TRVA 1GL8A 2WGRA 2LTKA 4MH2A 1QFNA 1M9BA 1V9WA 4AJ6A 4EUYA 2EC4A 3HY2A 3VWUA 2H19A 2VAFA 5GSSA 2GSSA 4MDCA 5H5SA 1HNCA 1SJ6A 2QGVA 3ISOA 1F6MC 1PGTA 3H4KA 4FIWA 4YAVA 5ECOB 5HFKA 2H72A 5D9TA 3KTBA 3TDGA 1YDKA 3HKRA 4KE3A 1GTAA 1B8XA 2MMZA 2UZ8A 1PKZA 2L57A 2C0DA 3MYDA 4IGJA 2NTOA 3KP9A 3IC4A 1TTZA 5HR1A 2C0GA 1FG4A 1EEJA 1ZYNA 3DVWA 1K0BA 4V1Ag 5AIXA 5DCGA 2DKHA 2GTUA 2YNXA 1M2BA 3PINA 2VL2C 5HFGA 2VD0A 2LEGA 5DJMA 5KN0A 1XBSA 2MMNA 1URMA 3HVVA 2WS2A 5INYA 1K3OA 4MA9A 1MEKA 3KH7A 1BX9A 3L0HA 5DCHA 1VRSD 1PKWA 2LJRA 1GUHA 2CX3A 1BYEA 2HRKA 4WR4A 4ZB9A 4IKHA 5ECNB 1JFUA 2DMMA 2H66A 3F3RA 3UBKA 5IOWA 2DJJA 3MAKA 1K0OA 1WIKA 2QC7A 4RQRA 1IYIA 2FA4A 1OE8A 2GSQA 3KXOA 5LD0A 1RK4A 4L0WA 4KNDA 2I9HA 3IRAA 5D9VA 3CSIA 3IPZA 1HNAA 2PVQA 3HJPA 4GSTA 4ECCA 1W89A 3D4MA 3I43A 4MF5A 1A8LA 1AIUA 4MZBA 4X0XA 2E0QA 3LORA 3EYTA 4HZ2A 5IMZA 3IBHA 2LRCA 3CSHA 4MZWA 4L8EA 3IR4A 3VPTA 3AY8A 2TIRA 3P7XA 5ID2A 4OD7A 5JWOB 13GSA 2B5YA 4TR1B 4HS1A 5EPFA 2OBKA 3GKMA 4EIQA 5E59A 2X64A 4K9ZA 3K8NA 4I6XA 3IAS2 3MDKA 3LWAA 4O5QA 4ZBBA 2FY6A 2FHEA 2LS5A 1F37A 1O81A 4IVFA 1ZOFA 2H6ZA 3TKSE 4EDZA 5CAXA 2CAQA 1G6YA 4D73A 3C8EA 3TB2A 1O8WA 3FHKA 4HEA2 5ECLB 2DIYA 1SKSB 1SK1A 1BJXA 5COHA 1SYXA 4HU9A 2E2MA 3HA9A 5ECMB 2F8FA 4IJIA 2EIRA 3TCOA 4K7IA 4IJ3A 1CQGA 4EC0A 5AISA 2FWHA 1DE2A 2OE1A 1XZOA 2LQQA 5GAPD 3VWXA 4K8MA 4F0BA 4Q5RA 3A3TA 2R3XA 4J56E 2VCZA 2MBTA 4WEYA 3LXTA 2WFCA 2J23A 4QQ7A 4F0CA 3RAZA 3ED3A 4PURA 3DEXA 3GL5A 1Z7RA 4TRXA 2VLVA 1JLVA 2LJAA 3NIVA 1WMJA 2G0FA 3EC3A 4IP1A 1VF2A 2E7PA 2DKIA 3UBLA 5C04A 2FWEA 5ELGA 1M0UA 4GXZA 2HSMA 1VF4A 4F9ZA 2YZUA 2FNOA 1SENA 4NV2A 4LMVA 1EP7A 2DJ1A 3L9VA 1NW2A 1Q98A 2KP1A 4BWQA 1TRUA 4XS1A 1MD4A 4DSSB 1YKCA 1HNBA 4DSQA 4EIPA 4OWYA 4I2TA 4MP4A 12GSA 2H1DA 4YQMA 2P5RA 3QD9A 2K9FA 1K3LA 1OE7A 2HLSA 4PUFC 3RBTA 3IHQA 2K8SA 1SD9A 1YF0A 2L5OA 1Y6EA 1A0FA 5ENUA 3IHGA 5ECSA 4ZILA 3IV4A 20GSA 2DC5A 1AW9A 2R5GA 3FZ9A 1BG5A 4O7HA 1ZCPA 4RI6A 3EU3A 1KEBA 1QMVA 2CV4A 4CDOA 1S3AA 2H73A 3QPMA 2GZZA 4Z7XA 3DRNA 1JZDA 2H76A 3Q74A 1USBA 1ERVA 4KGIA 4ZXGA 5KN2A 2IIYA 2YJ7A 1Z6MA 3FYGA 3UL3A 2C0EA 2GSTA 4EL1A 2D2ZA 2YWMA 4QL7A 2HSYA 2ZUPA 2FWGA 3HVXA 2IPAA 4XCSA 3GNJA 2R0PA 1NHOA 2L6CA 1E2YA 2DJ3A 3KMNA 1RW1A 3VLNA 3KIJA 3A2VA 4KW6A 3F6FA 3UMAA 4WKWA 2OBIA 4LL4B 3Q19A 1GLPA 2A4VA 1M2AA 3DYRA 2MYGA 1FOHA 3W8SA 2IN3A 3H8QA 2ON7A 2LJKA 2M72A 4MF6A 1G6WA 2GDRA 5IOXA 1GNWA 2L6DA 4Q5QA 1V98A 3C1RA 2CVBA 4ID0A 5IMAA 1DSBA 2IJYA 2R2JA 1EP8A 2C3QA 2MZCA 3G7IA 2H71A 2MMAA 3WGDA 2HSHA 2CAIA 3MIXA 1EV4A 6GSYA 1YF1A 5GZZB 3APSA 2YP6A 4OFTA 2OA7A 2FA8A 2DLXA 2CQ9A 11GSA 1GLQA 4XRAA 2MBSA 1PN0A 3KH9A 4RUVA 4MJCA 3M8NA 1XFLA 3L9UA 2X8HA 4N0VA 5F05A 3P8WA 2H1GA 4NWYA 1XVQA 1PRXA 3M0FA 2QA2A 5JCUA 4TR3A 2VCXA 5D8IA 3GKNA 3F63A 5LCZA 1IYHA 4PNGA 2OE0A 4WR5A 5FT3A 4AJ8A 1F2EA 4BVYB 4BVXA 4O32A 1GSFA 3KZQA 2J9HA 1S3DA 3RPNA 3QDNA 1JLWA 4HDEA 5D9XA 4POBA 1UVZA 4FYBA 4YKFA 2HRAA 2JU5A 2VLUA 4XS6A 2REMA 3GL3A 5J3RA 2JZSA 4G0KA 5F07A 5G5EA 1S3CA 2CVKA 4AF2A 1CQHA 5ECHB 4JU5A 4ZL7A 1E6BA 1AQXA 3Q18A 1PA3A 1GTIA 2JL4A 3R3EA 4TR1A 3I9V2 1MD3A 2QA1A 2OKAA 1QK8A 3GX0A 1YJ6A 1Z9HA 1GTUA 4KB3A 4Z2RA 4V1Ap 5DBQA 1X5EA 1OC3A 2NBSA 4OCEA 3D6IA 2HZFA 2PPTA 1A24A 1B9YC 3BJ5A 5H5RA 1PL2A 2K6VA 4IBPA 1VF3A 2ZCTA 2JSYA 1J0FA 1TK8B 5KOWA 3VI5A 5CNWA 4GF0A 3G9BA 5E4WA 3S9FA 2YPMA 4EVMA 1SYRA 3FMWA 1EOHA 3GURA 4RI7A 4ACSA 4PTSA 3FKFA 2TRXA 2HNLA 1EGRA 5CRDA 3KGKA 4XIHA 2C8UA 4N10A 3VK9A 3VURA 3TJFA 5D96A 2X4AA 1X5DA 2H75A 2XC2A 3NZNA 4BPYA 16GSA 5GAND 3TKSA 4FO5A 1VF1A 4ZB8A 3ZITA 2PUKC 3J7Yb 2YANA 1XVWA 3CXGA 2LQOA 2B7JA 3LYKA 2PERA 4HJMA 4ZBAA 1XWGA 1EOGA 3FY7A 3IDVA 3QR6A 1V40A 1XPVA 3CYNA 4ZL9A 5A4VA 4POMA 3ME7A 1R4WA 1FOVA 4G0LA 2G2QA 4TR4A 5A4UA 1XOBA 1Z7PA 3UOMA 1X0RA 3TOTA 1XWAA 2JACA 2VCQA 4J57E 4XS4B 2DJKA 2N5FA 2B5EA 5CYYA 1AQVA 4DSSA 3IAM2 1ERWA 4MJBA 3QMXA 3SWLA 3ZMKA 2V2GA 4K7NA 1UN2A 4BL7A 4KDXA 2C0FA 3D0ZA 3VWVA 5ELAA 2WCIA 3KJYA 2FGXA 1PMTA 3KEBA 2B3SA 5DAKB 3HHVA 3C7MA 2YN1A 4F2IA 2H74A 2L4QA 1THXA 1T4YA 2RLIA 2HE3A 22GSA 1TDIA 5ECIB 4EO3A 2BTOT 4L5LA 1AC1A 3TJJA 4ECBA 3C71A 4O92A 5B8AA 4DEJA 3W8JA 5J9BA 2CZ2A 19GSA 3IOSA 4MCUA 5J5NA 4WBRD 1O73A 1SL1B 3GH9A 3LGCA 1NSWA 2IMFA 4MNNA 4RQXA 1U88A 1MTCA 4KDUA 3BCKA 3TJGA 1MDJA 4NHWA 1M7TA 3TKRA 4MPFA 5G1KA 3RHCA 1XXUA 2C3TA 3M9JA 4KUNA 2VLTA 3MSZA 1T00A 3APQA 2RM6A 4PXOA 2IMIA 3FR9A 1T7PB 3WYWA 1U3IA 2XBQA 2C1YA 2VL9A 2VUPA 2V6OA 1QGVA 3CSJA 3P90A 1EWXA 1F3BA 3EE2A 2FLSA 1DBYA 2P5QA 3ZVJA 1NM3A 1BQ7A 2LV3A 1HQOA 3EMXA 5ECPB 1TK5B 2JADA 3EPTA 3GN3A 4GCIA 3I69A 2YJHA 4G2EA 4P3YB 3L9SA 4TW5A 2O8VB 1ZYPA 4EKZA 2A2PA 4TOPA 1YY7A 1GUMA 2AUVA 4FQUA 3UJ1A 5D73A 5EL8A 4TKYA 4TXOB 2GLRA 4ISDA 1M9AA 6GSTA 1K0DA 1R7HA 2FUG2 3HCZA 1T4ZA 2I1UA 4MH3A 3E3EA 1GWCA 3TOUA 4V2NA 5G1LA 1PSQA 4IQAA 1DUGA 2H70A 2XPDA 1XWCA 2NVLA 2H6XA 5F0GA 1SKRB 2N5BA 5EY6A 4X43A 5AN1A 1GSQA 3EINA 4PNFA 4H86A 17GSA 5H5QA 3ZFBA 3QOUA 3ZYWA 3EWLA 4BVYA 2DIZA 4K5RA 2H6YA 3QAGA 5KN1A 2AB6A 3EVIA 2Z9SA 5ID2B 3UIWA 2F51A 3NOFA 4HJ2A 1A2MA 1B48A 4F03A 1GUKA 3PPUA 1U3AA 2HZEB 4EXJA 1O85A 4PQ1A 1YQ1A 4TVEA 4ML6A 2HRNA 3D5JA 2O85A 3FK8A 5HR2A 1KBNA 2OADA 3PR8A 4NMUA 5LNKe 2KUCA 2CX4A 1OC8A 3LW9A 4ZL8A 1O7UA 4FYCA 4K5SA 1KTEA 4NAXA 4IS0A 1X9MB 1XWBA 4WETA 3IC8A 1PL1A 3ERFA 2XHFA 1TK0B 3WT1A 1WPIA 3G7JA 4IELA 2VCVA 2WB9A 1N8JA 2NDOA 3IK9A 3WT2A 3GYKA 4K6XA 5AGYA 2ZNMA 3GFKA 3HJMA 3LSZA 4YKGA 1X5CA 1FB0A 3TRPA 2RUEA 5HQPA 2I4AA 2B1KA 3LEFA 3RDWA 1HYUA 1TJDA 2WZ9A 2V1MA 3GUSA 2IL3A 1UA5A 4XTSA 1FHEA 3FZ5A 1K0CA 2XPEA 4IW9A 3EMPA 1R5AA 2C3NA 4KX4A 2R6KA 3VFIA 1RQMA 1ML6A 2HI7A 1VGLA 2DMLA 1ST9A 5J9CA 1UC7A 2H01A 3GSTA 3A5WA 4I8BA 1ACVA 4NHZA 4YQVA 1JZWA 2JZTA 4I97A 2L4CA 3ERWA 1OAZA 2GT6A 2VD1A 5CREA 1V2AA 4ML1A 4X4JA 4KSMA 1WE0A 1O6JA 2IWTA 1HD2A 3IA1A 1OKTA 4TN8A 1EV9A 1OVNA 4L5OA 1B4QA 4EE0A 3HJOA 1XOAA 4I5QA 2AYTA 1M99A 3FW2A 3WGXA 5J41A 1I9DA 4LMWA 3VPQA 2V41A 2GS3A 2KOKA 2X49A 4CW9A 4MPGA 4KAEA 4DVCA 3ZL5A 4MK3A 2WDUA 3GKKA 1A23A 2GQLA 3G7YA 1SD8A 14GSA 4OO5A 3DIEA 3HXSA 2YWNA 1G0TA 4KH7A 1WJKA 5IMVA 1TU7A 1AXDA 4A5PA 3F4RA 5KOXA 3F0IA 1YZXA 3F8UA 2M80A 3GX8A 5FWGA 1SL2B 3WGEA 2B7KA 3ZZXA 3ZREA 4ICYA 2E2GA 3P2AA 5IPHA 2YZHA 4KCAA 2GZYA 1F9MA 3KMOA 5GSTA 3GHAA 4OMVA 2A4HA 3R2QA 3US3A 1Z3EA 1ABAA 3L4NA 1LBKA 5JWRB 6GSVA 3ME8A 2QKEA 1WP0A 2KLXA 3HVSA 1EEMA 4YQUA 3F4SA 5CP1A 1FO5A 1GSUA 2H1BA 2R0GA 4ECIA 2V32A 2PBJA 2OE3A 4NV5A 4NXIA 4TXVA 4HUAA 4K2XA 3HZ8A 4XRDA 2JSZA 5DALB 5ABRA 4WXTA 4E8EA 4CHSA 4GLTA 2VIMA 1TU8A 1WOUA 3ZVJD 3TJBA 2GT5A 1R26A 1JHBA 1A8YA 1ON4A 3M9KA 3LJRA 2ALBA 1Z5YE 2DJ0A 3TKSC 6GSSA 5BMUA 4GSNA 1T8EB 1TKDB 4G0IA 3ZFLA 4GQFA 1FVKA 5DDLA 3D22A 5IMCA 2H1AA 1T1VA 3DWVA 4YH2A 1C72A 2YWOA 5ECRB 4OFNA 5IMFA 5IMDA 3APOA 1ERTA 2GSRA 4OO4A 3RHBA 2VM1A 4LA1A 2LNSA 1ERUA 1Z6NA 3IXRA 2H0IA 4ULXA 3UEMA 4JE1A 2CVDA 1PX7A 1JZOA 4AJ7A 3H79A 2A2RA 1A0RP 1K0AA 4WF4A 4TR0A 1YEXA 3CTFA 2PU9C 2MMOA 4IQ1A 3O76A 3E0UA 3GRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRS A;  2VM2 A;  2FCH A;  2OAC A;  1Y25 A;  1EGO A;  1XCC A;  4OFM A;  2AAW A;  4LL1 B;  5ECK B;  2LKU A;  1G7O A;  5DQY A;  1SK0 A;  1B4P A;  5JCG A;  4NPB A;  1H4O A;  3F9U A;  2KHP A;  3FZA A;  1ZMA A;  1ZYQ B;  2V6K A;  2A2S A;  1OKD A;  5HR3 A;  1TI3 A;  10GS A;  3FR6 A;  1AUC A;  5C00 A;  2H8L A;  2IFQ B;  1MDK A;  2VO4 A;  3M1G A;  3DKS A;  4TXO A;  2VL2 A;  1Q4J A;  1TI1 A;  4PGT A;  1OC9 B;  2C4J A;  6GSW A;  3CRU A;  2DBC A;  2FD3 A;  2LNT A;  4GSS A;  3DGQ A;  2PMT A;  2VOC A;  5FHI A;  3H1N A;  4HQS A;  4ECJ A;  2IME A;  2H0H A;  4O5R A;  3FZ4 A;  3H93 A;  4MJA A;  1ZYE A;  3C1S A;  5D9W A;  3GTU B;  3KTL A;  5G2Z A;  1GSD A;  4E8H A;  1K0M A;  3EUR A;  2O7K A;  3FRC A;  3U6V A;  3KD0 A;  3HYP A;  5JCW A;  4IHU A;  2NPB A;  2YV9 A;  4AGS A;  4V2L A;  3FEU A;  4GQC A;  1TRW A;  3J7Y k;  2HZE A;  1BAY A;  1FB6 A;  2P31 A;  1WRY A;  1PQN A;  4JBB A;  2HFD A;  1K3Y A;  2B1L A;  1YEP A;  4KCE A;  4HI7 A;  4XHM A;  4MMM A;  1WWJ A;  4KDY A;  3DML A;  5CO3 A;  2DJ2 A;  3LQ7 A;  3ZTL A;  2FWF A;  2PVO C;  3QFA C;  1TP9 A;  3ERG A;  1JZR A;  3DD3 A;  3TKP A;  4I2U A;  2PWJ A;  2CZ3 A;  3M3M A;  5B8B A;  1J08 A;  1O8X A;  2BMX A;  4MAB A;  3SBC A;  2IMK A;  5CRW A;  3QAV A;  1X9S B;  1QUW A;  5KEJ A;  4GRF A;  3C73 A;  2LRN A;  2LUS A;  4J2F A;  1LJR A;  3ZRD A;  2F8A A;  1GSS A;  1SL0 B;  1GH2 A;  3F3Q A;  2HRF A;  1A2L A;  1SJI A;  2R4V A;  3HZ4 A;  3UAP A;  2O87 A;  3F4T A;  1F3A A;  18GS A;  2EIO A;  1MDI A;  1SK2 A;  3GKX A;  2B5X A;  1XW6 A;  5ECQ B;  3TGZ A;  4MJE A;  5A5K A;  2GQM A;  3WD6 A;  1SJZ A;  1ZGN A;  3V1W A;  1V57 A;  4JR4 A;  4ZBD A;  5F06 A;  2H0G A;  2I3Y A;  1ILO A;  2F3M A;  3FR3 A;  2WRT A;  3I6A A;  5B6N A;  5A4W A;  3PGT A;  2RUF A;  3N5O A;  1ZZY A;  3D21 A;  2GZP A;  5IO2 A;  3LXZ A;  3DXB A;  1XIY A;  5IQY A;  3A2X A;  2OJL A;  3HDC A;  4BWS A;  3ZIJ A;  2O89 A;  5HFI A;  2AJQ B;  5DQS A;  2XBI A;  2HT9 A;  3LFL A;  5IPG A;  9GSS A;  1U87 A;  3GH6 A;  3CRT A;  2DSA A;  3OR5 A;  2YOI A;  4F82 A;  1GTB A;  3GSS A;  3BBY A;  3QFB C;  1AAZ A;  3BOA A;  4N0Z A;  1TXX A;  1W4V A;  4HU7 A;  5CRH A;  3GA4 A;  4BA7 A;  1LU4 A;  1ZL9 A;  1K0N A;  1H75 A;  1THO A;  2K8V A;  1XWK A;  2RM5 A;  2LRT A;  1GP1 A;  1U6T A;  5IIZ A;  3E9J B;  3GMF A;  4ILF A;  4HQZ A;  5G30 A;  2X99 A;  1XW9 A;  3CMI A;  3JCM L;  4ZIJ A;  3HD5 A;  5EVO A;  2VCW A;  4N30 A;  1KNG A;  3ZIV A;  2AHE A;  4DSR A;  1GRX A;  4X1U A;  5AIV A;  2QSI A;  1TOF A;  4MZC A;  4PX1 A;  2H30 A;  2M46 A;  1QXH A;  4K2D A;  2GGT A;  3A2W A;  4D73 B;  5D93 A;  1QQ2 A;  4K0N A;  5DVB A;  1N2A A;  5IO0 A;  2N5A A;  1BED A;  4K1F A;  5HR0 A;  1SKW B;  1OYJ A;  1AQW A;  4JRR A;  2F9S A;  2P0G A;  4G10 A;  4N11 A;  2TRC P;  2ON5 A;  2X8G A;  3TUE A;  1R5P A;  3QAW A;  3TJK A;  2EIQ A;  2K18 A;  1NHY A;  5IM9 A;  2LST A;  1TW9 A;  4WF5 A;  4PQI A;  4FH8 A;  4ZB6 A;  3RPP A;  5DAL A;  5G5F A;  3DVX A;  3ZLP A;  1PD2 1;  2I81 A;  2WUL A;  3KM6 A;  8GSS A;  1PN9 A;  3Q6O A;  5JWQ B;  3N9J A;  3EU4 A;  1M2D A;  4IN0 A;  4G9H A;  5J4U A;  5CRG A;  4JZQ A;  1XW5 A;  4PQH A;  3LG6 A;  3UVT A;  3KP8 A;  2GVP A;  3GIX A;  1G7E A;  6GSU A;  3CBU A;  2KP2 A;  2X8C A;  1SU9 A;  3O6T A;  2CT6 A;  2WJU A;  1YKA A;  1PX6 A;  4WBJ A;  3PH9 A;  3O3T A;  3BD2 A;  4POK A;  2YWI A;  2VL3 A;  1GSY A;  4V2M A;  1A2J A;  2HXK A;  4YAP A;  1GSE A;  6GSX A;  2RII A;  4Q5N A;  1FW1 A;  7GSS A;  1B9X C;  3MWH A;  4L0U A;  4K0G A;  4GWR A;  5DJL A;  3L78 A;  1GNE A;  5B7C A;  1V58 A;  2C80 A;  4EDY A;  4IP6 A;  1J9B A;  1GUL A;  4KA0 A;  2GQK A;  5F8B A;  3TRX A;  4G19 A;  3BCI A;  2B6M A;  2BJX A;  4QL9 A;  4XS4 A;  2IFQ A;  4GTU A;  4JED A;  4K7O A;  3UVH A;  3UAR A;  4Q5F A;  2YCD A;  3LYP A;  4JR6 A;  3KCM A;  4KSO A;  2IMD A;  1OC9 A;  4LLR A;  5G31 A;  4POL A;  3ZML A;  3TKQ A;  3IK7 A;  2VCT A;  4HZ4 A;  3CTG A;  1FAA A;  4PUA A;  5DAK A;  2JZR A;  3QCP A;  2AV4 A;  2L5L A;  3VWW A;  5B6M A;  4OCF A;  3MNG A;  1T3B A;  3TRQ A;  1FVJ A;  4HOJ A;  4MLY A;  1X9W B;  3GTU A;  4MF7 A;  3VI7 A;  2PN8 A;  3IE3 A;  5L71 A;  3W6G A;  2YV7 A;  3GV1 A;  3D4T A;  1I5G A;  2PGT A;  1EZK A;  2ES7 A;  2HYX A;  2R37 A;  2CA8 A;  3F6D A;  2L59 A;  4FYU A;  5KN3 A;  4EF0 A;  1DE1 A;  3U5R E;  1TRV A;  1GL8 A;  2WGR A;  2LTK A;  4MH2 A;  1QFN A;  1M9B A;  1V9W A;  4AJ6 A;  4EUY A;  2EC4 A;  3HY2 A;  3VWU A;  2H19 A;  2VAF A;  5GSS A;  2GSS A;  4MDC A;  5H5S A;  1HNC A;  1SJ6 A;  2QGV A;  3ISO A;  1F6M C;  1PGT A;  3H4K A;  4FIW A;  4YAV A;  5ECO B;  5HFK A;  2H72 A;  5D9T A;  3KTB A;  3TDG A;  1YDK A;  3HKR A;  4KE3 A;  1GTA A;  1B8X A;  2MMZ A;  1PKZ A;  2L57 A;  2C0D A;  4IGJ A;  2NTO A;  3KP9 A;  3IC4 A;  1TTZ A;  5HR1 A;  2C0G A;  1FG4 A;  1EEJ A;  3DVW A;  1K0B A;  4V1A g;  5AIX A;  5DCG A;  2GTU A;  2YNX A;  1M2B A;  3PIN A;  2VL2 C;  5HFG A;  2VD0 A;  2LEG A;  5DJM A;  5KN0 A;  1XBS A;  2MMN A;  1URM A;  3HVV A;  2WS2 A;  5INY A;  1K3O A;  4MA9 A;  1MEK A;  3KH7 A;  1BX9 A;  3L0H A;  5DCH A;  1VRS D;  1PKW A;  2LJR A;  1GUH A;  2CX3 A;  1BYE A;  4WR4 A;  4ZB9 A;  4IKH A;  5ECN B;  1JFU A;  2DMM A;  2H66 A;  3F3R A;  3UBK A;  5IOW A;  2DJJ A;  3MAK A;  1K0O A;  1WIK A;  2QC7 A;  4RQR A;  1IYI A;  2FA4 A;  1OE8 A;  2GSQ A;  3KXO A;  5LD0 A;  1RK4 A;  4L0W A;  4KND A;  2I9H A;  3IRA A;  5D9V A;  3CSI A;  3IPZ A;  1HNA A;  2PVQ A;  3HJP A;  4GST A;  4ECC A;  1W89 A;  3D4M A;  3I43 A;  4MF5 A;  1A8L A;  1AIU A;  4MZB A;  4X0X A;  2E0Q A;  3LOR A;  3EYT A;  4HZ2 A;  5IMZ A;  3IBH A;  2LRC A;  3CSH A;  4MZW A;  4L8E A;  3IR4 A;  3VPT A;  3AY8 A;  2TIR A;  3P7X A;  5ID2 A;  4OD7 A;  5JWO B;  13GS A;  2B5Y A;  4TR1 B;  4HS1 A;  5EPF A;  2OBK A;  3GKM A;  5E59 A;  2X64 A;  4K9Z A;  3K8N A;  4I6X A;  3IAS 2;  3MDK A;  3LWA A;  4ZBB A;  2FY6 A;  2FHE A;  2LS5 A;  1F37 A;  1O81 A;  4IVF A;  1ZOF A;  2H6Z A;  3TKS E;  4EDZ A;  5CAX A;  2CAQ A;  1G6Y A;  4D73 A;  3C8E A;  3TB2 A;  1O8W A;  3FHK A;  4HEA 2;  5ECL B;  2DIY A;  1SKS B;  1SK1 A;  1BJX A;  5COH A;  1SYX A;  4HU9 A;  2E2M A;  3HA9 A;  5ECM B;  2F8F A;  4IJI A;  2EIR A;  3TCO A;  4K7I A;  4IJ3 A;  1CQG A;  4EC0 A;  5AIS A;  2FWH A;  1DE2 A;  2OE1 A;  1XZO A;  2LQQ A;  5GAP D;  3VWX A;  4K8M A;  4F0B A;  4Q5R A;  3A3T A;  2R3X A;  4J56 E;  2VCZ A;  2MBT A;  4WEY A;  3LXT A;  2WFC A;  2J23 A;  4QQ7 A;  4F0C A;  3RAZ A;  3ED3 A;  4PUR A;  3DEX A;  3GL5 A;  1Z7R A;  4TRX A;  2VLV A;  1JLV A;  2LJA A;  3NIV A;  1WMJ A;  2G0F A;  3EC3 A;  4IP1 A;  1VF2 A;  2E7P A;  3UBL A;  5C04 A;  2FWE A;  5ELG A;  1M0U A;  4GXZ A;  1VF4 A;  4F9Z A;  2YZU A;  2FNO A;  1SEN A;  4NV2 A;  4LMV A;  1EP7 A;  2DJ1 A;  3L9V A;  1NW2 A;  1Q98 A;  2KP1 A;  4BWQ A;  1TRU A;  4XS1 A;  1MD4 A;  4DSS B;  1YKC A;  1HNB A;  4DSQ A;  4OWY A;  4I2T A;  4MP4 A;  12GS A;  2H1D A;  4YQM A;  2P5R A;  3QD9 A;  2K9F A;  1K3L A;  1OE7 A;  2HLS A;  4PUF C;  3RBT A;  3IHQ A;  2K8S A;  1SD9 A;  1YF0 A;  2L5O A;  1Y6E A;  1A0F A;  5ENU A;  5ECS A;  4ZIL A;  3IV4 A;  20GS A;  2DC5 A;  1AW9 A;  2R5G A;  3FZ9 A;  1BG5 A;  4O7H A;  1ZCP A;  4RI6 A;  3EU3 A;  1KEB A;  1QMV A;  2CV4 A;  4CDO A;  1S3A A;  2H73 A;  3QPM A;  2GZZ A;  4Z7X A;  3DRN A;  1JZD A;  2H76 A;  3Q74 A;  1USB A;  1ERV A;  4KGI A;  4ZXG A;  5KN2 A;  2IIY A;  2YJ7 A;  1Z6M A;  3FYG A;  3UL3 A;  2C0E A;  2GST A;  4EL1 A;  2D2Z A;  2YWM A;  4QL7 A;  2HSY A;  2ZUP A;  2FWG A;  3HVX A;  2IPA A;  4XCS A;  3GNJ A;  1NHO A;  2L6C A;  1E2Y A;  2DJ3 A;  3KMN A;  1RW1 A;  3VLN A;  3KIJ A;  3A2V A;  4KW6 A;  3F6F A;  3UMA A;  4WKW A;  2OBI A;  4LL4 B;  3Q19 A;  1GLP A;  2A4V A;  1M2A A;  3DYR A;  2MYG A;  3W8S A;  2IN3 A;  3H8Q A;  2ON7 A;  2LJK A;  2M72 A;  4MF6 A;  1G6W A;  2GDR A;  5IOX A;  1GNW A;  2L6D A;  4Q5Q A;  1V98 A;  3C1R A;  2CVB A;  4ID0 A;  5IMA A;  1DSB A;  2IJY A;  2R2J A;  1EP8 A;  2C3Q A;  2MZC A;  3G7I A;  2H71 A;  2MMA A;  3WGD A;  2HSH A;  2CAI A;  1EV4 A;  6GSY A;  1YF1 A;  5GZZ B;  3APS A;  2YP6 A;  4OFT A;  2OA7 A;  2FA8 A;  2DLX A;  2CQ9 A;  11GS A;  1GLQ A;  4XRA A;  2MBS A;  3KH9 A;  4RUV A;  4MJC A;  3M8N A;  1XFL A;  3L9U A;  2X8H A;  4N0V A;  5F05 A;  3P8W A;  2H1G A;  4NWY A;  1XVQ A;  1PRX A;  3M0F A;  5JCU A;  4TR3 A;  2VCX A;  5D8I A;  3GKN A;  3F63 A;  5LCZ A;  1IYH A;  4PNG A;  2OE0 A;  4WR5 A;  5FT3 A;  4AJ8 A;  1F2E A;  4BVX A;  4O32 A;  1GSF A;  3KZQ A;  2J9H A;  1S3D A;  3RPN A;  3QDN A;  1JLW A;  4HDE A;  5D9X A;  4POB A;  1UVZ A;  4FYB A;  2JU5 A;  2VLU A;  4XS6 A;  2REM A;  3GL3 A;  5J3R A;  2JZS A;  5F07 A;  5G5E A;  1S3C A;  2CVK A;  4AF2 A;  1CQH A;  5ECH B;  4JU5 A;  4ZL7 A;  1E6B A;  1AQX A;  3Q18 A;  1PA3 A;  1GTI A;  2JL4 A;  4TR1 A;  3I9V 2;  1MD3 A;  2OKA A;  1QK8 A;  3GX0 A;  1YJ6 A;  1Z9H A;  1GTU A;  4KB3 A;  4V1A p;  5DBQ A;  1X5E A;  1OC3 A;  2NBS A;  4OCE A;  3D6I A;  2HZF A;  2PPT A;  1A24 A;  1B9Y C;  3BJ5 A;  5H5R A;  1PL2 A;  2K6V A;  4IBP A;  1VF3 A;  2ZCT A;  2JSY A;  1J0F A;  1TK8 B;  3VI5 A;  5CNW A;  4GF0 A;  3G9B A;  5E4W A;  3S9F A;  2YPM A;  4EVM A;  1SYR A;  1EOH A;  3GUR A;  4RI7 A;  4ACS A;  3FKF A;  2TRX A;  2HNL A;  1EGR A;  5CRD A;  3KGK A;  4XIH A;  2C8U A;  4N10 A;  3VK9 A;  3VUR A;  3TJF A;  5D96 A;  1X5D A;  2H75 A;  2XC2 A;  3NZN A;  4BPY A;  16GS A;  5GAN D;  3TKS A;  4FO5 A;  1VF1 A;  4ZB8 A;  3ZIT A;  2PUK C;  3J7Y b;  2YAN A;  1XVW A;  3CXG A;  2LQO A;  2B7J A;  3LYK A;  2PER A;  4HJM A;  4ZBA A;  1XWG A;  1EOG A;  3FY7 A;  3IDV A;  3QR6 A;  1V40 A;  1XPV A;  3CYN A;  4ZL9 A;  5A4V A;  4POM A;  3ME7 A;  1R4W A;  1FOV A;  2G2Q A;  4TR4 A;  5A4U A;  1XOB A;  1Z7P A;  3UOM A;  1X0R A;  3TOT A;  1XWA A;  2JAC A;  2VCQ A;  4J57 E;  4XS4 B;  2DJK A;  2N5F A;  2B5E A;  5CYY A;  1AQV A;  4DSS A;  3IAM 2;  1ERW A;  4MJB A;  3QMX A;  3SWL A;  3ZMK A;  2V2G A;  4K7N A;  1UN2 A;  4BL7 A;  4KDX A;  2C0F A;  3D0Z A;  3VWV A;  5ELA A;  2WCI A;  3KJY A;  2FGX A;  1PMT A;  3KEB A;  2B3S A;  5DAK B;  3HHV A;  3C7M A;  2YN1 A;  4F2I A;  2H74 A;  2L4Q A;  1THX A;  1T4Y A;  2RLI A;  2HE3 A;  22GS A;  1TDI A;  5ECI B;  4EO3 A;  2BTO T;  4L5L A;  1AC1 A;  3TJJ A;  4ECB A;  3C71 A;  4O92 A;  5B8A A;  4DEJ A;  3W8J A;  5J9B A;  2CZ2 A;  19GS A;  3IOS A;  4MCU A;  5J5N A;  4WBR D;  1O73 A;  1SL1 B;  3GH9 A;  3LGC A;  1NSW A;  2IMF A;  4RQX A;  1U88 A;  1MTC A;  4KDU A;  3BCK A;  3TJG A;  1MDJ A;  4NHW A;  1M7T A;  3TKR A;  4MPF A;  5G1K A;  3RHC A;  1XXU A;  2C3T A;  3M9J A;  4KUN A;  2VLT A;  3MSZ A;  1T00 A;  3APQ A;  2RM6 A;  4PXO A;  2IMI A;  3FR9 A;  1T7P B;  3WYW A;  1U3I A;  2XBQ A;  2C1Y A;  2VL9 A;  2VUP A;  2V6O A;  1QGV A;  3CSJ A;  3P90 A;  1EWX A;  1F3B A;  3EE2 A;  2FLS A;  1DBY A;  2P5Q A;  3ZVJ A;  1NM3 A;  1BQ7 A;  2LV3 A;  1HQO A;  3EMX A;  5ECP B;  1TK5 B;  2JAD A;  3GN3 A;  4GCI A;  3I69 A;  2YJH A;  4G2E A;  4P3Y B;  3L9S A;  4TW5 A;  2O8V B;  4EKZ A;  4TOP A;  1YY7 A;  1GUM A;  2AUV A;  3UJ1 A;  5D73 A;  5EL8 A;  4TKY A;  4TXO B;  2GLR A;  4ISD A;  1M9A A;  6GST A;  1K0D A;  1R7H A;  2FUG 2;  3HCZ A;  1T4Z A;  2I1U A;  4MH3 A;  3E3E A;  1GWC A;  3TOU A;  4V2N A;  5G1L A;  1PSQ A;  4IQA A;  1DUG A;  2H70 A;  2XPD A;  1XWC A;  2NVL A;  2H6X A;  5F0G A;  1SKR B;  2N5B A;  5EY6 A;  4X43 A;  5AN1 A;  1GSQ A;  3EIN A;  4PNF A;  4H86 A;  17GS A;  5H5Q A;  3ZFB A;  3QOU A;  3ZYW A;  3EWL A;  4BVY A;  2DIZ A;  2H6Y A;  3QAG A;  5KN1 A;  2AB6 A;  3EVI A;  2Z9S A;  5ID2 B;  3UIW A;  2F51 A;  3NOF A;  4HJ2 A;  1A2M A;  1B48 A;  4F03 A;  1GUK A;  1U3A A;  2HZE B;  4EXJ A;  1O85 A;  4PQ1 A;  1YQ1 A;  4TVE A;  4ML6 A;  2HRN A;  3D5J A;  2O85 A;  3FK8 A;  5HR2 A;  1KBN A;  2OAD A;  3PR8 A;  4NMU A;  5LNK e;  2KUC A;  2CX4 A;  1OC8 A;  4ZL8 A;  1O7U A;  4FYC A;  1KTE A;  4NAX A;  4IS0 A;  1X9M B;  1XWB A;  4WET A;  1PL1 A;  3ERF A;  2XHF A;  1TK0 B;  3WT1 A;  1WPI A;  3G7J A;  4IEL A;  2VCV A;  2WB9 A;  1N8J A;  2NDO A;  3IK9 A;  3WT2 A;  3GYK A;  4K6X A;  5AGY A;  2ZNM A;  3GFK A;  3HJM A;  3LSZ A;  1X5C A;  1FB0 A;  3TRP A;  2RUE A;  5HQP A;  2I4A A;  2B1K A;  3LEF A;  3RDW A;  1HYU A;  1TJD A;  2WZ9 A;  2V1M A;  3GUS A;  2IL3 A;  1UA5 A;  4XTS A;  1FHE A;  3FZ5 A;  1K0C A;  2XPE A;  4IW9 A;  3EMP A;  1R5A A;  2C3N A;  4KX4 A;  2R6K A;  3VFI A;  1RQM A;  1ML6 A;  2HI7 A;  1VGL A;  2DML A;  1ST9 A;  5J9C A;  1UC7 A;  2H01 A;  3GST A;  3A5W A;  4I8B A;  1ACV A;  4NHZ A;  4YQV A;  1JZW A;  2JZT A;  4I97 A;  2L4C A;  3ERW A;  1OAZ A;  2GT6 A;  2VD1 A;  5CRE A;  1V2A A;  4ML1 A;  4KSM A;  1WE0 A;  1O6J A;  2IWT A;  1HD2 A;  3IA1 A;  1OKT A;  4TN8 A;  1EV9 A;  1OVN A;  4L5O A;  1B4Q A;  4EE0 A;  3HJO A;  1XOA A;  4I5Q A;  2AYT A;  1M99 A;  3FW2 A;  3WGX A;  5J41 A;  1I9D A;  4LMW A;  3VPQ A;  2V41 A;  2GS3 A;  2KOK A;  4CW9 A;  4MPG A;  4KAE A;  4DVC A;  3ZL5 A;  4MK3 A;  2WDU A;  3GKK A;  1A23 A;  2GQL A;  3G7Y A;  1SD8 A;  14GS A;  4OO5 A;  3DIE A;  3HXS A;  2YWN A;  1G0T A;  4KH7 A;  1WJK A;  5IMV A;  1TU7 A;  1AXD A;  3F4R A;  3F0I A;  1YZX A;  3F8U A;  2M80 A;  3GX8 A;  5FWG A;  1SL2 B;  3WGE A;  2B7K A;  3ZZX A;  3ZRE A;  2E2G A;  3P2A A;  5IPH A;  2YZH A;  4KCA A;  2GZY A;  1F9M A;  3KMO A;  5GST A;  3GHA A;  4OMV A;  3R2Q A;  3US3 A;  1Z3E A;  1ABA A;  3L4N A;  1LBK A;  5JWR B;  6GSV A;  3ME8 A;  2QKE A;  1WP0 A;  2KLX A;  3HVS A;  1EEM A;  4YQU A;  3F4S A;  5CP1 A;  1FO5 A;  1GSU A;  2H1B A;  4ECI A;  2V32 A;  2PBJ A;  2OE3 A;  4NV5 A;  4NXI A;  4TXV A;  4HUA A;  3HZ8 A;  4XRD A;  2JSZ A;  5DAL B;  5ABR A;  4WXT A;  4E8E A;  4CHS A;  4GLT A;  2VIM A;  1TU8 A;  1WOU A;  3ZVJ D;  3TJB A;  2GT5 A;  1R26 A;  1JHB A;  1A8Y A;  1ON4 A;  3M9K A;  3LJR A;  2ALB A;  1Z5Y E;  2DJ0 A;  3TKS C;  6GSS A;  1T8E B;  4GSN A;  1TKD B;  3ZFL A;  4GQF A;  1FVK A;  5DDL A;  3D22 A;  5IMC A;  2H1A A;  1T1V A;  3DWV A;  4YH2 A;  1C72 A;  2YWO A;  5ECR B;  4OFN A;  5IMF A;  5IMD A;  3APO A;  1ERT A;  2GSR A;  4OO4 A;  3RHB A;  2VM1 A;  4LA1 A;  2LNS A;  1ERU A;  1Z6N A;  3IXR A;  2H0I A;  4ULX A;  3UEM A;  4JE1 A;  2CVD A;  1PX7 A;  1JZO A;  4AJ7 A;  3H79 A;  2A2R A;  1A0R P;  1K0A A;  4WF4 A;  4TR0 A;  1YEX A;  3CTF A;  2PU9 C;  2MMO A;  4IQ1 A;  3O76 A;  3E0U A;  3GRX A; 
#chains in the Genus database with same CATH topology
 1TRS A;  2VM2 A;  2FCH A;  2OAC A;  1Y25 A;  1EGO A;  1XCC A;  4OFM A;  2AAW A;  4LL1 B;  5ECK B;  2LKU A;  1G7O A;  5DQY A;  1SK0 A;  1B4P A;  5JCG A;  4NPB A;  1H4O A;  3F9U A;  3HVN A;  2KHP A;  3FZA A;  1ZMA A;  1ZYQ B;  2V6K A;  2A2S A;  1OKD A;  5HR3 A;  1TI3 A;  10GS A;  3FR6 A;  1AUC A;  5C00 A;  2H8L A;  2IFQ B;  1MDK A;  2VO4 A;  4BVX B;  3M1G A;  3DKS A;  4TXO A;  2VL2 A;  1Q4J A;  1TI1 A;  4PGT A;  1OC9 B;  2C4J A;  6GSW A;  3CRU A;  2DBC A;  2FD3 A;  2LNT A;  4GSS A;  3DGQ A;  2PMT A;  2VOC A;  5FHI A;  3H1N A;  4HQS A;  4ECJ A;  2IME A;  2H0H A;  4O5R A;  3FZ4 A;  3H93 A;  4MJA A;  1ZYE A;  3C1S A;  4Z2U A;  5D9W A;  3GTU B;  3KTL A;  5G2Z A;  1GSD A;  4E8H A;  1K0M A;  3EUR A;  2O7K A;  3FRC A;  3U6V A;  3KD0 A;  3HYP A;  5JCW A;  4IHU A;  2NPB A;  2YV9 A;  4AGS A;  4V2L A;  3FEU A;  4GQC A;  1TRW A;  3J7Y k;  2HZE A;  1BAY A;  1FB6 A;  2P31 A;  1WRY A;  1PQN A;  4JBB A;  2HFD A;  1K3Y A;  2B1L A;  1YEP A;  4KCE A;  4HI7 A;  4XHM A;  4MMM A;  1WWJ A;  4KDY A;  3DML A;  5CO3 A;  2DJ2 A;  3LQ7 A;  3ZTL A;  2FWF A;  2PVO C;  3QFA C;  1TP9 A;  3ERG A;  1JZR A;  3DD3 A;  3TKP A;  4I2U A;  2PWJ A;  2CZ3 A;  3M3M A;  5B8B A;  1J08 A;  1O8X A;  2BMX A;  4MAB A;  3SBC A;  2IMK A;  5CRW A;  3QAV A;  4CY6 A;  1X9S B;  1QUW A;  5KEJ A;  4GRF A;  3C73 A;  2LRN A;  2LUS A;  4J2F A;  1LJR A;  3ZRD A;  2F8A A;  1GSS A;  1SL0 B;  1GH2 A;  3F3Q A;  2HRF A;  1A2L A;  1SJI A;  4O5U A;  2R4V A;  3HZ4 A;  3UAP A;  2O87 A;  3F4T A;  1F3A A;  18GS A;  2EIO A;  1MDI A;  1SK2 A;  3GKX A;  2B5X A;  1XW6 A;  5ECQ B;  3TGZ A;  4MJE A;  5A5K A;  2GQM A;  3WD6 A;  1SJZ A;  1ZGN A;  3V1W A;  1V57 A;  4JR4 A;  4ZBD A;  5F06 A;  2H0G A;  2I3Y A;  1ILO A;  2F3M A;  3FR3 A;  2WRT A;  3I6A A;  5B6N A;  5A4W A;  3PGT A;  2RUF A;  3N5O A;  1ZZY A;  3D21 A;  2GZP A;  5IO2 A;  4CY8 A;  3LXZ A;  3DXB A;  1XIY A;  5IQY A;  3A2X A;  2OJL A;  3HDC A;  4BWS A;  3ZIJ A;  2O89 A;  3A5I A;  5HFI A;  2AJQ B;  5DQS A;  2XBI A;  2HT9 A;  3LFL A;  5IPG A;  9GSS A;  1U87 A;  3GH6 A;  3CRT A;  2DSA A;  3OR5 A;  2YOI A;  4F82 A;  1GTB A;  3GSS A;  3BBY A;  3QFB C;  1AAZ A;  3BOA A;  4N0Z A;  4BL7 B;  1TXX A;  1W4V A;  4HU7 A;  5CRH A;  3GA4 A;  4BA7 A;  1LU4 A;  1ZL9 A;  1K0N A;  1H75 A;  1THO A;  2K8V A;  1XWK A;  2RM5 A;  2LRT A;  1GP1 A;  1U6T A;  5IIZ A;  3E9J B;  3GMF A;  4ILF A;  4HQZ A;  5G30 A;  2X99 A;  1XW9 A;  3CMI A;  3JCM L;  4ZIJ A;  3HD5 A;  5EVO A;  2VCW A;  4N30 A;  1KNG A;  3ZIV A;  2AHE A;  4DSR A;  1GRX A;  4X1U A;  5AIV A;  2QSI A;  1TOF A;  4MZC A;  4PX1 A;  2H30 A;  2M46 A;  1QXH A;  4K2D A;  2GGT A;  3A2W A;  4D73 B;  5D93 A;  1QQ2 A;  4K0N A;  5DVB A;  1N2A A;  5IO0 A;  2N5A A;  1BED A;  4K1F A;  5HR0 A;  1SKW B;  1OYJ A;  1AQW A;  4JRR A;  2F9S A;  2P0G A;  4G10 A;  4N11 A;  2TRC P;  2ON5 A;  2X8G A;  3TUE A;  1R5P A;  3QAW A;  4Z2T A;  3TJK A;  2EIQ A;  2K18 A;  1NHY A;  5IM9 A;  2LST A;  1TW9 A;  4WF5 A;  4PQI A;  4FH8 A;  4ZB6 A;  3RPP A;  5DAL A;  5G5F A;  3DVX A;  3ZLP A;  1PD2 1;  2I81 A;  2WUL A;  3KM6 A;  8GSS A;  1PN9 A;  3Q6O A;  5JWQ B;  3N9J A;  3EU4 A;  1M2D A;  4IN0 A;  4G9H A;  5J4U A;  5CRG A;  4JZQ A;  1XW5 A;  4PQH A;  3LG6 A;  3UVT A;  3KP8 A;  2GVP A;  3GIX A;  1G7E A;  6GSU A;  3CBU A;  2KP2 A;  2X8C A;  1SU9 A;  3O6T A;  2CT6 A;  2WJU A;  1YKA A;  1PX6 A;  4WBJ A;  3PH9 A;  3O3T A;  4KF9 A;  3BD2 A;  4POK A;  2YWI A;  2VL3 A;  1GSY A;  4V2M A;  1A2J A;  2HXK A;  4YAP A;  1GSE A;  6GSX A;  2RII A;  4Q5N A;  1FW1 A;  7GSS A;  1B9X C;  3MWH A;  4L0U A;  4K0G A;  4GWR A;  5DJL A;  3L78 A;  1GNE A;  5B7C A;  1V58 A;  2C80 A;  4EDY A;  4IP6 A;  1J9B A;  1GUL A;  4KA0 A;  2GQK A;  5F8B A;  3TRX A;  4G19 A;  2R0C A;  3BCI A;  2B6M A;  2BJX A;  4QL9 A;  4XS4 A;  2IFQ A;  4GTU A;  4JED A;  4K7O A;  3UVH A;  4USS A;  3UAR A;  4Q5F A;  2YCD A;  3LYP A;  4JR6 A;  3KCM A;  4KSO A;  2IMD A;  1OC9 A;  4LLR A;  5G31 A;  4POL A;  3ZML A;  3TKQ A;  3IK7 A;  2VCT A;  4HZ4 A;  3CTG A;  1FAA A;  4PUA A;  5DAK A;  2JZR A;  3QCP A;  2AV4 A;  2L5L A;  3VWW A;  5B6M A;  4OCF A;  3MNG A;  1T3B A;  3TRQ A;  1FVJ A;  4HOJ A;  4MLY A;  1X9W B;  3GTU A;  4MF7 A;  3VI7 A;  2PN8 A;  3IE3 A;  5L71 A;  5BRT A;  3W6G A;  2YV7 A;  3GV1 A;  3D4T A;  1I5G A;  2PGT A;  1EZK A;  2ES7 A;  2HYX A;  2R37 A;  2CA8 A;  3F6D A;  2L59 A;  4FYU A;  5KN3 A;  4EF0 A;  1DE1 A;  3U5R E;  1TRV A;  1GL8 A;  2WGR A;  2LTK A;  4MH2 A;  1QFN A;  1M9B A;  1V9W A;  4AJ6 A;  4EUY A;  2EC4 A;  3HY2 A;  3VWU A;  2H19 A;  2VAF A;  5GSS A;  2GSS A;  4MDC A;  5H5S A;  1HNC A;  1SJ6 A;  2QGV A;  3ISO A;  1F6M C;  1PGT A;  3H4K A;  4FIW A;  4YAV A;  5ECO B;  5HFK A;  2H72 A;  5D9T A;  3KTB A;  3TDG A;  1YDK A;  3HKR A;  4KE3 A;  1GTA A;  1B8X A;  2MMZ A;  2UZ8 A;  1PKZ A;  2L57 A;  2C0D A;  3MYD A;  4IGJ A;  2NTO A;  3KP9 A;  3IC4 A;  1TTZ A;  5HR1 A;  2C0G A;  1FG4 A;  1EEJ A;  1ZYN A;  3DVW A;  1K0B A;  4V1A g;  5AIX A;  5DCG A;  2DKH A;  2GTU A;  2YNX A;  1M2B A;  3PIN A;  2VL2 C;  5HFG A;  2VD0 A;  2LEG A;  5DJM A;  5KN0 A;  1XBS A;  2MMN A;  1URM A;  3HVV A;  2WS2 A;  5INY A;  1K3O A;  4MA9 A;  1MEK A;  3KH7 A;  1BX9 A;  3L0H A;  5DCH A;  1VRS D;  1PKW A;  2LJR A;  1GUH A;  2CX3 A;  1BYE A;  2HRK A;  4WR4 A;  4ZB9 A;  4IKH A;  5ECN B;  1JFU A;  2DMM A;  2H66 A;  3F3R A;  3UBK A;  5IOW A;  2DJJ A;  3MAK A;  1K0O A;  1WIK A;  2QC7 A;  4RQR A;  1IYI A;  2FA4 A;  1OE8 A;  2GSQ A;  3KXO A;  5LD0 A;  1RK4 A;  4L0W A;  4KND A;  2I9H A;  3IRA A;  5D9V A;  3CSI A;  3IPZ A;  1HNA A;  2PVQ A;  3HJP A;  4GST A;  4ECC A;  1W89 A;  3D4M A;  3I43 A;  4MF5 A;  1A8L A;  1AIU A;  4MZB A;  4X0X A;  2E0Q A;  3LOR A;  3EYT A;  4HZ2 A;  5IMZ A;  3IBH A;  2LRC A;  3CSH A;  4MZW A;  4L8E A;  3IR4 A;  3VPT A;  3AY8 A;  2TIR A;  3P7X A;  5ID2 A;  4OD7 A;  5JWO B;  13GS A;  2B5Y A;  4TR1 B;  4HS1 A;  5EPF A;  2OBK A;  3GKM A;  4EIQ A;  5E59 A;  2X64 A;  4K9Z A;  3K8N A;  4I6X A;  3IAS 2;  3MDK A;  3LWA A;  4O5Q A;  4ZBB A;  2FY6 A;  2FHE A;  2LS5 A;  1F37 A;  1O81 A;  4IVF A;  1ZOF A;  2H6Z A;  3TKS E;  4EDZ A;  5CAX A;  2CAQ A;  1G6Y A;  4D73 A;  3C8E A;  3TB2 A;  1O8W A;  3FHK A;  4HEA 2;  5ECL B;  2DIY A;  1SKS B;  1SK1 A;  1BJX A;  5COH A;  1SYX A;  4HU9 A;  2E2M A;  3HA9 A;  5ECM B;  2F8F A;  4IJI A;  2EIR A;  3TCO A;  4K7I A;  4IJ3 A;  1CQG A;  4EC0 A;  5AIS A;  2FWH A;  1DE2 A;  2OE1 A;  1XZO A;  2LQQ A;  5GAP D;  3VWX A;  4K8M A;  4F0B A;  4Q5R A;  3A3T A;  2R3X A;  4J56 E;  2VCZ A;  2MBT A;  4WEY A;  3LXT A;  2WFC A;  2J23 A;  4QQ7 A;  4F0C A;  3RAZ A;  3ED3 A;  4PUR A;  3DEX A;  3GL5 A;  1Z7R A;  4TRX A;  2VLV A;  1JLV A;  2LJA A;  3NIV A;  1WMJ A;  2G0F A;  3EC3 A;  4IP1 A;  1VF2 A;  2E7P A;  2DKI A;  3UBL A;  5C04 A;  2FWE A;  5ELG A;  1M0U A;  4GXZ A;  2HSM A;  1VF4 A;  4F9Z A;  2YZU A;  2FNO A;  1SEN A;  4NV2 A;  4LMV A;  1EP7 A;  2DJ1 A;  3L9V A;  1NW2 A;  1Q98 A;  2KP1 A;  4BWQ A;  1TRU A;  4XS1 A;  1MD4 A;  4DSS B;  1YKC A;  1HNB A;  4DSQ A;  4EIP A;  4OWY A;  4I2T A;  4MP4 A;  12GS A;  2H1D A;  4YQM A;  2P5R A;  3QD9 A;  2K9F A;  1K3L A;  1OE7 A;  2HLS A;  4PUF C;  3RBT A;  3IHQ A;  2K8S A;  1SD9 A;  1YF0 A;  2L5O A;  1Y6E A;  1A0F A;  5ENU A;  3IHG A;  5ECS A;  4ZIL A;  3IV4 A;  20GS A;  2DC5 A;  1AW9 A;  2R5G A;  3FZ9 A;  1BG5 A;  4O7H A;  1ZCP A;  4RI6 A;  3EU3 A;  1KEB A;  1QMV A;  2CV4 A;  4CDO A;  1S3A A;  2H73 A;  3QPM A;  2GZZ A;  4Z7X A;  3DRN A;  1JZD A;  2H76 A;  3Q74 A;  1USB A;  1ERV A;  4KGI A;  4ZXG A;  5KN2 A;  2IIY A;  2YJ7 A;  1Z6M A;  3CQF A;  3FYG A;  3UL3 A;  2C0E A;  2GST A;  4EL1 A;  2D2Z A;  2YWM A;  4QL7 A;  2HSY A;  2ZUP A;  2FWG A;  1XG8 A;  3HVX A;  2IPA A;  4XCS A;  3GNJ A;  2R0P A;  1NHO A;  2L6C A;  1E2Y A;  2DJ3 A;  3KMN A;  1RW1 A;  3VLN A;  3KIJ A;  3A2V A;  4KW6 A;  3F6F A;  3UMA A;  4WKW A;  2OBI A;  4LL4 B;  3Q19 A;  1GLP A;  2A4V A;  1M2A A;  3DYR A;  2MYG A;  1FOH A;  3W8S A;  2IN3 A;  3H8Q A;  2ON7 A;  2LJK A;  2M72 A;  4MF6 A;  1G6W A;  2GDR A;  5IOX A;  1GNW A;  2L6D A;  4Q5Q A;  1V98 A;  3C1R A;  2CVB A;  4ID0 A;  5IMA A;  1DSB A;  2IJY A;  2R2J A;  1EP8 A;  2C3Q A;  2MZC A;  3G7I A;  2H71 A;  2MMA A;  3WGD A;  2HSH A;  2CAI A;  3MIX A;  1EV4 A;  6GSY A;  1YF1 A;  5GZZ B;  3APS A;  2YP6 A;  4OFT A;  2OA7 A;  2FA8 A;  2DLX A;  2CQ9 A;  11GS A;  1GLQ A;  4XRA A;  2MBS A;  1PN0 A;  3KH9 A;  4RUV A;  4MJC A;  3M8N A;  1XFL A;  3L9U A;  2X8H A;  4N0V A;  5F05 A;  3P8W A;  2H1G A;  4NWY A;  1XVQ A;  1PRX A;  1M3J A;  3M0F A;  2QA2 A;  5JCU A;  4TR3 A;  2VCX A;  5D8I A;  3GKN A;  3F63 A;  5LCZ A;  1IYH A;  1M3I A;  4PNG A;  2OE0 A;  4WR5 A;  5FT3 A;  4AJ8 A;  1F2E A;  4BVY B;  4BVX A;  4O32 A;  1GSF A;  3KZQ A;  2J9H A;  1S3D A;  3RPN A;  3QDN A;  1JLW A;  4HDE A;  5D9X A;  4POB A;  1UVZ A;  4FYB A;  4YKF A;  2HRA A;  2JU5 A;  2VLU A;  4XS6 A;  2REM A;  3GL3 A;  5J3R A;  2JZS A;  4G0K A;  5F07 A;  5G5E A;  1S3C A;  2CVK A;  4AF2 A;  1CQH A;  5ECH B;  4JU5 A;  4ZL7 A;  1E6B A;  1AQX A;  3Q18 A;  1PA3 A;  1GTI A;  2JL4 A;  3R3E A;  4TR1 A;  4HSC X;  3I9V 2;  1MD3 A;  2QA1 A;  2OKA A;  1QK8 A;  3GX0 A;  1YJ6 A;  1Z9H A;  1GTU A;  4KB3 A;  4Z2R A;  4V1A p;  5DBQ A;  1X5E A;  1OC3 A;  2NBS A;  4OCE A;  3D6I A;  2HZF A;  2PPT A;  1A24 A;  1B9Y C;  3BJ5 A;  5H5R A;  1PL2 A;  2K6V A;  4IBP A;  1VF3 A;  2ZCT A;  2JSY A;  1J0F A;  1TK8 B;  5KOW A;  3VI5 A;  5CNW A;  4GF0 A;  3G9B A;  5E4W A;  3S9F A;  2YPM A;  4EVM A;  1SYR A;  3FMW A;  1EOH A;  3GUR A;  4RI7 A;  4ACS A;  4PTS A;  3FKF A;  2TRX A;  2HNL A;  1EGR A;  5CRD A;  3KGK A;  4XIH A;  2C8U A;  4N10 A;  3VK9 A;  3VUR A;  3TJF A;  5D96 A;  2X4A A;  1X5D A;  2H75 A;  2XC2 A;  3NZN A;  4BPY A;  16GS A;  5GAN D;  3TKS A;  4FO5 A;  1VF1 A;  4ZB8 A;  3ZIT A;  2PUK C;  3J7Y b;  2YAN A;  1XVW A;  3CXG A;  2LQO A;  2B7J A;  3LYK A;  2PER A;  4HJM A;  4ZBA A;  1XWG A;  1EOG A;  3FY7 A;  3IDV A;  3QR6 A;  1V40 A;  1XPV A;  3CYN A;  4ZL9 A;  5A4V A;  4POM A;  3ME7 A;  1R4W A;  1FOV A;  4G0L A;  2G2Q A;  4TR4 A;  5A4U A;  1XOB A;  1Z7P A;  3UOM A;  1X0R A;  3TOT A;  1XWA A;  2JAC A;  2VCQ A;  4J57 E;  4XS4 B;  2DJK A;  2N5F A;  2B5E A;  5CYY A;  1AQV A;  4DSS A;  3IAM 2;  1ERW A;  4MJB A;  3QMX A;  3SWL A;  3ZMK A;  2V2G A;  4K7N A;  1UN2 A;  4BL7 A;  4KDX A;  2C0F A;  3D0Z A;  3VWV A;  5ELA A;  2WCI A;  3KJY A;  2FGX A;  1PMT A;  3KEB A;  2B3S A;  5DAK B;  3HHV A;  3C7M A;  2YN1 A;  4F2I A;  2H74 A;  2L4Q A;  1THX A;  1T4Y A;  2RLI A;  2HE3 A;  22GS A;  1TDI A;  5ECI B;  4EO3 A;  2BTO T;  4L5L A;  1AC1 A;  3TJJ A;  4ECB A;  3C71 A;  4O92 A;  5B8A A;  4DEJ A;  3W8J A;  5J9B A;  2CZ2 A;  19GS A;  3IOS A;  4MCU A;  5J5N A;  4WBR D;  1O73 A;  1SL1 B;  3GH9 A;  3LGC A;  1NSW A;  2IMF A;  4MNN A;  4RQX A;  1U88 A;  1MTC A;  4KDU A;  3BCK A;  3TJG A;  1MDJ A;  4NHW A;  1M7T A;  3TKR A;  4MPF A;  5G1K A;  3RHC A;  1XXU A;  2C3T A;  3M9J A;  4KUN A;  2VLT A;  3MSZ A;  1T00 A;  3APQ A;  2RM6 A;  4PXO A;  2IMI A;  3FR9 A;  1T7P B;  3WYW A;  1U3I A;  2XBQ A;  2C1Y A;  2VL9 A;  2VUP A;  2V6O A;  1QGV A;  3CSJ A;  3P90 A;  1EWX A;  1F3B A;  3EE2 A;  2FLS A;  1DBY A;  2P5Q A;  3ZVJ A;  1NM3 A;  1BQ7 A;  2LV3 A;  1HQO A;  1PFO A;  3EMX A;  5ECP B;  1TK5 B;  2JAD A;  3EPT A;  3GN3 A;  4GCI A;  3I69 A;  2YJH A;  4G2E A;  4P3Y B;  3L9S A;  4TW5 A;  2O8V B;  1ZYP A;  4EKZ A;  2A2P A;  4TOP A;  1YY7 A;  1GUM A;  2AUV A;  4FQU A;  3UJ1 A;  5D73 A;  5EL8 A;  4TKY A;  4TXO B;  2GLR A;  4ISD A;  1M9A A;  6GST A;  1K0D A;  1R7H A;  2FUG 2;  3HCZ A;  1T4Z A;  2I1U A;  4MH3 A;  3E3E A;  1GWC A;  3TOU A;  4V2N A;  5G1L A;  1PSQ A;  4IQA A;  1DUG A;  2H70 A;  2XPD A;  1XWC A;  2NVL A;  2H6X A;  5F0G A;  1SKR B;  2N5B A;  5EY6 A;  4X43 A;  5AN1 A;  1GSQ A;  3EIN A;  4PNF A;  4H86 A;  17GS A;  5H5Q A;  3ZFB A;  3QOU A;  3ZYW A;  3EWL A;  4BVY A;  2DIZ A;  4K5R A;  2H6Y A;  3QAG A;  5KN1 A;  2AB6 A;  3EVI A;  2Z9S A;  5ID2 B;  3UIW A;  2F51 A;  3NOF A;  4HJ2 A;  1A2M A;  1B48 A;  4F03 A;  1GUK A;  3PPU A;  1U3A A;  2HZE B;  4EXJ A;  1O85 A;  4PQ1 A;  1YQ1 A;  4TVE A;  4ML6 A;  2HRN A;  3D5J A;  2O85 A;  3FK8 A;  5HR2 A;  1KBN A;  2OAD A;  3PR8 A;  4NMU A;  5LNK e;  2KUC A;  2CX4 A;  1OC8 A;  3LW9 A;  4ZL8 A;  1O7U A;  4FYC A;  4K5S A;  1KTE A;  4NAX A;  4IS0 A;  1X9M B;  1XWB A;  4WET A;  3IC8 A;  1PL1 A;  3ERF A;  2XHF A;  1TK0 B;  3WT1 A;  1WPI A;  3G7J A;  4IEL A;  2VCV A;  2WB9 A;  1N8J A;  2NDO A;  3IK9 A;  3WT2 A;  3GYK A;  4K6X A;  5AGY A;  2ZNM A;  3GFK A;  3HJM A;  3LSZ A;  4YKG A;  1X5C A;  1FB0 A;  3TRP A;  2RUE A;  5HQP A;  2I4A A;  2B1K A;  3LEF A;  3RDW A;  1HYU A;  1TJD A;  2WZ9 A;  2V1M A;  3GUS A;  2IL3 A;  1UA5 A;  4XTS A;  1FHE A;  3FZ5 A;  1K0C A;  2XPE A;  4IW9 A;  3EMP A;  1R5A A;  2C3N A;  4KX4 A;  2R6K A;  3VFI A;  1RQM A;  1ML6 A;  2HI7 A;  1VGL A;  2DML A;  1ST9 A;  5J9C A;  1UC7 A;  2H01 A;  3GST A;  3A5W A;  4I8B A;  1ACV A;  4NHZ A;  4YQV A;  1JZW A;  2JZT A;  4I97 A;  2L4C A;  3ERW A;  1OAZ A;  2GT6 A;  2VD1 A;  5CRE A;  1V2A A;  4ML1 A;  4X4J A;  4KSM A;  1WE0 A;  1O6J A;  2IWT A;  1HD2 A;  3IA1 A;  1OKT A;  4TN8 A;  1EV9 A;  1OVN A;  4L5O A;  1B4Q A;  4EE0 A;  3HJO A;  1XOA A;  4I5Q A;  2AYT A;  1M99 A;  3FW2 A;  3WGX A;  5J41 A;  1I9D A;  4LMW A;  3VPQ A;  2V41 A;  2GS3 A;  2KOK A;  2X49 A;  4CW9 A;  4MPG A;  4KAE A;  4DVC A;  3ZL5 A;  4MK3 A;  2WDU A;  3GKK A;  1A23 A;  2GQL A;  3G7Y A;  1SD8 A;  14GS A;  4OO5 A;  3DIE A;  3HXS A;  2YWN A;  1G0T A;  4KH7 A;  1WJK A;  5IMV A;  1TU7 A;  1AXD A;  4A5P A;  3F4R A;  5KOX A;  3F0I A;  1YZX A;  3F8U A;  2M80 A;  3GX8 A;  5FWG A;  1SL2 B;  3WGE A;  2B7K A;  3ZZX A;  3ZRE A;  4ICY A;  2E2G A;  3P2A A;  5IPH A;  2YZH A;  4KCA A;  2GZY A;  1F9M A;  3KMO A;  5GST A;  3GHA A;  1S3R A;  4OMV A;  2A4H A;  3R2Q A;  3US3 A;  1Z3E A;  1ABA A;  3L4N A;  1LBK A;  5JWR B;  6GSV A;  3ME8 A;  2QKE A;  1WP0 A;  2KLX A;  3HVS A;  1EEM A;  4YQU A;  3F4S A;  5CP1 A;  1FO5 A;  1GSU A;  2H1B A;  2R0G A;  4ECI A;  2V32 A;  2PBJ A;  2OE3 A;  4NV5 A;  4NXI A;  4TXV A;  4HUA A;  4K2X A;  3HZ8 A;  4XRD A;  2JSZ A;  5DAL B;  5ABR A;  4WXT A;  4E8E A;  4CHS A;  4GLT A;  2VIM A;  1TU8 A;  1WOU A;  3ZVJ D;  3TJB A;  2GT5 A;  1R26 A;  1JHB A;  1A8Y A;  1ON4 A;  3M9K A;  3LJR A;  2ALB A;  1Z5Y E;  2DJ0 A;  3TKS C;  6GSS A;  5BMU A;  4GSN A;  1T8E B;  1TKD B;  4G0I A;  3ZFL A;  4GQF A;  1FVK A;  5DDL A;  3D22 A;  5IMC A;  2H1A A;  1T1V A;  3DWV A;  4YH2 A;  1C72 A;  2YWO A;  5ECR B;  4OFN A;  5IMF A;  5IMD A;  3APO A;  1ERT A;  2GSR A;  4OO4 A;  3RHB A;  2VM1 A;  4LA1 A;  2LNS A;  1ERU A;  1Z6N A;  3IXR A;  2H0I A;  4ULX A;  3UEM A;  4JE1 A;  2CVD A;  1PX7 A;  1JZO A;  4AJ7 A;  3H79 A;  2A2R A;  1A0R P;  1K0A A;  4WF4 A;  4TR0 A;  1YEX A;  3CTF A;  2PU9 C;  2MMO A;  4BIK A;  4IQ1 A;  3O76 A;  3E0U A;  3GRX A; 
#chains in the Genus database with same CATH homology
 1TRS A;  2VM2 A;  2FCH A;  2OAC A;  1Y25 A;  1EGO A;  1XCC A;  4OFM A;  2AAW A;  4LL1 B;  5ECK B;  2LKU A;  1G7O A;  5DQY A;  1SK0 A;  1B4P A;  5JCG A;  4NPB A;  1H4O A;  3F9U A;  2KHP A;  3FZA A;  1ZMA A;  1ZYQ B;  2V6K A;  2A2S A;  1OKD A;  5HR3 A;  1TI3 A;  10GS A;  3FR6 A;  1AUC A;  5C00 A;  2H8L A;  2IFQ B;  1MDK A;  2VO4 A;  4BVX B;  3M1G A;  3DKS A;  4TXO A;  2VL2 A;  1Q4J A;  1TI1 A;  4PGT A;  1OC9 B;  2C4J A;  6GSW A;  3CRU A;  2DBC A;  2FD3 A;  2LNT A;  4GSS A;  3DGQ A;  2PMT A;  2VOC A;  5FHI A;  3H1N A;  4HQS A;  4ECJ A;  2IME A;  2H0H A;  4O5R A;  3FZ4 A;  3H93 A;  4MJA A;  1ZYE A;  3C1S A;  4Z2U A;  5D9W A;  3GTU B;  3KTL A;  5G2Z A;  1GSD A;  4E8H A;  1K0M A;  3EUR A;  2O7K A;  3FRC A;  3U6V A;  3KD0 A;  3HYP A;  5JCW A;  4IHU A;  2NPB A;  2YV9 A;  4AGS A;  4V2L A;  3FEU A;  4GQC A;  1TRW A;  3J7Y k;  2HZE A;  1BAY A;  1FB6 A;  2P31 A;  1WRY A;  1PQN A;  4JBB A;  2HFD A;  1K3Y A;  2B1L A;  1YEP A;  4KCE A;  4HI7 A;  4XHM A;  4MMM A;  1WWJ A;  4KDY A;  3DML A;  5CO3 A;  2DJ2 A;  3LQ7 A;  3ZTL A;  2FWF A;  2PVO C;  3QFA C;  1TP9 A;  3ERG A;  1JZR A;  3DD3 A;  3TKP A;  4I2U A;  2PWJ A;  2CZ3 A;  3M3M A;  5B8B A;  1J08 A;  1O8X A;  2BMX A;  4MAB A;  3SBC A;  2IMK A;  5CRW A;  3QAV A;  4CY6 A;  1X9S B;  1QUW A;  5KEJ A;  4GRF A;  3C73 A;  2LRN A;  2LUS A;  4J2F A;  1LJR A;  3ZRD A;  2F8A A;  1GSS A;  1SL0 B;  1GH2 A;  3F3Q A;  2HRF A;  1A2L A;  1SJI A;  4O5U A;  2R4V A;  3HZ4 A;  3UAP A;  2O87 A;  3F4T A;  1F3A A;  18GS A;  2EIO A;  1MDI A;  1SK2 A;  3GKX A;  2B5X A;  1XW6 A;  5ECQ B;  3TGZ A;  4MJE A;  5A5K A;  2GQM A;  3WD6 A;  1SJZ A;  1ZGN A;  3V1W A;  1V57 A;  4JR4 A;  4ZBD A;  5F06 A;  2H0G A;  2I3Y A;  1ILO A;  2F3M A;  3FR3 A;  2WRT A;  3I6A A;  5B6N A;  5A4W A;  3PGT A;  2RUF A;  3N5O A;  1ZZY A;  3D21 A;  2GZP A;  5IO2 A;  4CY8 A;  3LXZ A;  3DXB A;  1XIY A;  5IQY A;  3A2X A;  2OJL A;  3HDC A;  4BWS A;  3ZIJ A;  2O89 A;  3A5I A;  5HFI A;  2AJQ B;  5DQS A;  2XBI A;  2HT9 A;  3LFL A;  5IPG A;  9GSS A;  1U87 A;  3GH6 A;  3CRT A;  2DSA A;  3OR5 A;  2YOI A;  4F82 A;  1GTB A;  3GSS A;  3BBY A;  3QFB C;  1AAZ A;  3BOA A;  4N0Z A;  4BL7 B;  1TXX A;  1W4V A;  4HU7 A;  5CRH A;  3GA4 A;  4BA7 A;  1LU4 A;  1ZL9 A;  1K0N A;  1H75 A;  1THO A;  2K8V A;  1XWK A;  2RM5 A;  2LRT A;  1GP1 A;  1U6T A;  5IIZ A;  3E9J B;  3GMF A;  4ILF A;  4HQZ A;  5G30 A;  2X99 A;  1XW9 A;  3CMI A;  3JCM L;  4ZIJ A;  3HD5 A;  5EVO A;  2VCW A;  4N30 A;  1KNG A;  3ZIV A;  2AHE A;  4DSR A;  1GRX A;  4X1U A;  5AIV A;  2QSI A;  1TOF A;  4MZC A;  4PX1 A;  2H30 A;  2M46 A;  1QXH A;  4K2D A;  2GGT A;  3A2W A;  4D73 B;  5D93 A;  1QQ2 A;  4K0N A;  5DVB A;  1N2A A;  5IO0 A;  2N5A A;  1BED A;  4K1F A;  5HR0 A;  1SKW B;  1OYJ A;  1AQW A;  4JRR A;  2F9S A;  2P0G A;  4G10 A;  4N11 A;  2TRC P;  2ON5 A;  2X8G A;  3TUE A;  1R5P A;  3QAW A;  4Z2T A;  3TJK A;  2EIQ A;  2K18 A;  1NHY A;  5IM9 A;  2LST A;  1TW9 A;  4WF5 A;  4PQI A;  4FH8 A;  4ZB6 A;  3RPP A;  5DAL A;  5G5F A;  3DVX A;  3ZLP A;  1PD2 1;  2I81 A;  2WUL A;  3KM6 A;  8GSS A;  1PN9 A;  3Q6O A;  5JWQ B;  3N9J A;  3EU4 A;  1M2D A;  4IN0 A;  4G9H A;  5J4U A;  5CRG A;  4JZQ A;  1XW5 A;  4PQH A;  3LG6 A;  3UVT A;  3KP8 A;  2GVP A;  3GIX A;  1G7E A;  6GSU A;  3CBU A;  2KP2 A;  2X8C A;  1SU9 A;  3O6T A;  2CT6 A;  2WJU A;  1YKA A;  1PX6 A;  4WBJ A;  3PH9 A;  3O3T A;  4KF9 A;  3BD2 A;  4POK A;  2YWI A;  2VL3 A;  1GSY A;  4V2M A;  1A2J A;  2HXK A;  4YAP A;  1GSE A;  6GSX A;  2RII A;  4Q5N A;  1FW1 A;  7GSS A;  1B9X C;  3MWH A;  4L0U A;  4K0G A;  4GWR A;  5DJL A;  3L78 A;  1GNE A;  5B7C A;  1V58 A;  2C80 A;  4EDY A;  4IP6 A;  1J9B A;  1GUL A;  4KA0 A;  2GQK A;  5F8B A;  3TRX A;  4G19 A;  2R0C A;  3BCI A;  2B6M A;  2BJX A;  4QL9 A;  4XS4 A;  2IFQ A;  4GTU A;  4JED A;  4K7O A;  3UVH A;  4USS A;  3UAR A;  4Q5F A;  2YCD A;  3LYP A;  4JR6 A;  3KCM A;  4KSO A;  2IMD A;  1OC9 A;  4LLR A;  5G31 A;  4POL A;  3ZML A;  3TKQ A;  3IK7 A;  2VCT A;  4HZ4 A;  3CTG A;  1FAA A;  4PUA A;  5DAK A;  2JZR A;  3QCP A;  2AV4 A;  2L5L A;  3VWW A;  5B6M A;  4OCF A;  3MNG A;  1T3B A;  3TRQ A;  1FVJ A;  4HOJ A;  4MLY A;  1X9W B;  3GTU A;  4MF7 A;  3VI7 A;  2PN8 A;  3IE3 A;  5L71 A;  5BRT A;  3W6G A;  2YV7 A;  3GV1 A;  3D4T A;  1I5G A;  2PGT A;  1EZK A;  2ES7 A;  2HYX A;  2R37 A;  2CA8 A;  3F6D A;  2L59 A;  4FYU A;  5KN3 A;  4EF0 A;  1DE1 A;  3U5R E;  1TRV A;  1GL8 A;  2WGR A;  2LTK A;  4MH2 A;  1QFN A;  1M9B A;  1V9W A;  4AJ6 A;  4EUY A;  2EC4 A;  3HY2 A;  3VWU A;  2H19 A;  2VAF A;  5GSS A;  2GSS A;  4MDC A;  5H5S A;  1HNC A;  1SJ6 A;  2QGV A;  3ISO A;  1F6M C;  1PGT A;  3H4K A;  4FIW A;  4YAV A;  5ECO B;  5HFK A;  2H72 A;  5D9T A;  3KTB A;  3TDG A;  1YDK A;  3HKR A;  4KE3 A;  1GTA A;  1B8X A;  2MMZ A;  2UZ8 A;  1PKZ A;  2L57 A;  2C0D A;  3MYD A;  4IGJ A;  2NTO A;  3KP9 A;  3IC4 A;  1TTZ A;  5HR1 A;  2C0G A;  1FG4 A;  1EEJ A;  1ZYN A;  3DVW A;  1K0B A;  4V1A g;  5AIX A;  5DCG A;  2DKH A;  2GTU A;  2YNX A;  1M2B A;  3PIN A;  2VL2 C;  5HFG A;  2VD0 A;  2LEG A;  5DJM A;  5KN0 A;  1XBS A;  2MMN A;  1URM A;  3HVV A;  2WS2 A;  5INY A;  1K3O A;  4MA9 A;  1MEK A;  3KH7 A;  1BX9 A;  3L0H A;  5DCH A;  1VRS D;  1PKW A;  2LJR A;  1GUH A;  2CX3 A;  1BYE A;  2HRK A;  4WR4 A;  4ZB9 A;  4IKH A;  5ECN B;  1JFU A;  2DMM A;  2H66 A;  3F3R A;  3UBK A;  5IOW A;  2DJJ A;  3MAK A;  1K0O A;  1WIK A;  2QC7 A;  4RQR A;  1IYI A;  2FA4 A;  1OE8 A;  2GSQ A;  3KXO A;  5LD0 A;  1RK4 A;  4L0W A;  4KND A;  2I9H A;  3IRA A;  5D9V A;  3CSI A;  3IPZ A;  1HNA A;  2PVQ A;  3HJP A;  4GST A;  4ECC A;  1W89 A;  3D4M A;  3I43 A;  4MF5 A;  1A8L A;  1AIU A;  4MZB A;  4X0X A;  2E0Q A;  3LOR A;  3EYT A;  4HZ2 A;  5IMZ A;  3IBH A;  2LRC A;  3CSH A;  4MZW A;  4L8E A;  3IR4 A;  3VPT A;  3AY8 A;  2TIR A;  3P7X A;  5ID2 A;  4OD7 A;  5JWO B;  13GS A;  2B5Y A;  4TR1 B;  4HS1 A;  5EPF A;  2OBK A;  3GKM A;  4EIQ A;  5E59 A;  2X64 A;  4K9Z A;  3K8N A;  4I6X A;  3IAS 2;  3MDK A;  3LWA A;  4O5Q A;  4ZBB A;  2FY6 A;  2FHE A;  2LS5 A;  1F37 A;  1O81 A;  4IVF A;  1ZOF A;  2H6Z A;  3TKS E;  4EDZ A;  5CAX A;  2CAQ A;  1G6Y A;  4D73 A;  3C8E A;  3TB2 A;  1O8W A;  3FHK A;  4HEA 2;  5ECL B;  2DIY A;  1SKS B;  1SK1 A;  1BJX A;  5COH A;  1SYX A;  4HU9 A;  2E2M A;  3HA9 A;  5ECM B;  2F8F A;  4IJI A;  2EIR A;  3TCO A;  4K7I A;  4IJ3 A;  1CQG A;  4EC0 A;  5AIS A;  2FWH A;  1DE2 A;  2OE1 A;  1XZO A;  2LQQ A;  5GAP D;  3VWX A;  4K8M A;  4F0B A;  4Q5R A;  3A3T A;  2R3X A;  4J56 E;  2VCZ A;  2MBT A;  4WEY A;  3LXT A;  2WFC A;  2J23 A;  4QQ7 A;  4F0C A;  3RAZ A;  3ED3 A;  4PUR A;  3DEX A;  3GL5 A;  1Z7R A;  4TRX A;  2VLV A;  1JLV A;  2LJA A;  3NIV A;  1WMJ A;  2G0F A;  3EC3 A;  4IP1 A;  1VF2 A;  2E7P A;  2DKI A;  3UBL A;  5C04 A;  2FWE A;  5ELG A;  1M0U A;  4GXZ A;  2HSM A;  1VF4 A;  4F9Z A;  2YZU A;  2FNO A;  1SEN A;  4NV2 A;  4LMV A;  1EP7 A;  2DJ1 A;  3L9V A;  1NW2 A;  1Q98 A;  2KP1 A;  4BWQ A;  1TRU A;  4XS1 A;  1MD4 A;  4DSS B;  1YKC A;  1HNB A;  4DSQ A;  4EIP A;  4OWY A;  4I2T A;  4MP4 A;  12GS A;  2H1D A;  4YQM A;  2P5R A;  3QD9 A;  2K9F A;  1K3L A;  1OE7 A;  2HLS A;  4PUF C;  3RBT A;  3IHQ A;  2K8S A;  1SD9 A;  1YF0 A;  2L5O A;  1Y6E A;  1A0F A;  5ENU A;  3IHG A;  5ECS A;  4ZIL A;  3IV4 A;  20GS A;  2DC5 A;  1AW9 A;  2R5G A;  3FZ9 A;  1BG5 A;  4O7H A;  1ZCP A;  4RI6 A;  3EU3 A;  1KEB A;  1QMV A;  2CV4 A;  4CDO A;  1S3A A;  2H73 A;  3QPM A;  2GZZ A;  4Z7X A;  3DRN A;  1JZD A;  2H76 A;  3Q74 A;  1USB A;  1ERV A;  4KGI A;  4ZXG A;  5KN2 A;  2IIY A;  2YJ7 A;  1Z6M A;  3FYG A;  3UL3 A;  2C0E A;  2GST A;  4EL1 A;  2D2Z A;  2YWM A;  4QL7 A;  2HSY A;  2ZUP A;  2FWG A;  3HVX A;  2IPA A;  4XCS A;  3GNJ A;  2R0P A;  1NHO A;  2L6C A;  1E2Y A;  2DJ3 A;  3KMN A;  1RW1 A;  3VLN A;  3KIJ A;  3A2V A;  4KW6 A;  3F6F A;  3UMA A;  4WKW A;  2OBI A;  4LL4 B;  3Q19 A;  1GLP A;  2A4V A;  1M2A A;  3DYR A;  2MYG A;  1FOH A;  3W8S A;  2IN3 A;  3H8Q A;  2ON7 A;  2LJK A;  2M72 A;  4MF6 A;  1G6W A;  2GDR A;  5IOX A;  1GNW A;  2L6D A;  4Q5Q A;  1V98 A;  3C1R A;  2CVB A;  4ID0 A;  5IMA A;  1DSB A;  2IJY A;  2R2J A;  1EP8 A;  2C3Q A;  2MZC A;  3G7I A;  2H71 A;  2MMA A;  3WGD A;  2HSH A;  2CAI A;  3MIX A;  1EV4 A;  6GSY A;  1YF1 A;  5GZZ B;  3APS A;  2YP6 A;  4OFT A;  2OA7 A;  2FA8 A;  2DLX A;  2CQ9 A;  11GS A;  1GLQ A;  4XRA A;  2MBS A;  1PN0 A;  3KH9 A;  4RUV A;  4MJC A;  3M8N A;  1XFL A;  3L9U A;  2X8H A;  4N0V A;  5F05 A;  3P8W A;  2H1G A;  4NWY A;  1XVQ A;  1PRX A;  3M0F A;  2QA2 A;  5JCU A;  4TR3 A;  2VCX A;  5D8I A;  3GKN A;  3F63 A;  5LCZ A;  1IYH A;  4PNG A;  2OE0 A;  4WR5 A;  5FT3 A;  4AJ8 A;  1F2E A;  4BVY B;  4BVX A;  4O32 A;  1GSF A;  3KZQ A;  2J9H A;  1S3D A;  3RPN A;  3QDN A;  1JLW A;  4HDE A;  5D9X A;  4POB A;  1UVZ A;  4FYB A;  4YKF A;  2HRA A;  2JU5 A;  2VLU A;  4XS6 A;  2REM A;  3GL3 A;  5J3R A;  2JZS A;  4G0K A;  5F07 A;  5G5E A;  1S3C A;  2CVK A;  4AF2 A;  1CQH A;  5ECH B;  4JU5 A;  4ZL7 A;  1E6B A;  1AQX A;  3Q18 A;  1PA3 A;  1GTI A;  2JL4 A;  3R3E A;  4TR1 A;  3I9V 2;  1MD3 A;  2QA1 A;  2OKA A;  1QK8 A;  3GX0 A;  1YJ6 A;  1Z9H A;  1GTU A;  4KB3 A;  4Z2R A;  4V1A p;  5DBQ A;  1X5E A;  1OC3 A;  2NBS A;  4OCE A;  3D6I A;  2HZF A;  2PPT A;  1A24 A;  1B9Y C;  3BJ5 A;  5H5R A;  1PL2 A;  2K6V A;  4IBP A;  1VF3 A;  2ZCT A;  2JSY A;  1J0F A;  1TK8 B;  5KOW A;  3VI5 A;  5CNW A;  4GF0 A;  3G9B A;  5E4W A;  3S9F A;  2YPM A;  4EVM A;  1SYR A;  3FMW A;  1EOH A;  3GUR A;  4RI7 A;  4ACS A;  4PTS A;  3FKF A;  2TRX A;  2HNL A;  1EGR A;  5CRD A;  3KGK A;  4XIH A;  2C8U A;  4N10 A;  3VK9 A;  3VUR A;  3TJF A;  5D96 A;  2X4A A;  1X5D A;  2H75 A;  2XC2 A;  3NZN A;  4BPY A;  16GS A;  5GAN D;  3TKS A;  4FO5 A;  1VF1 A;  4ZB8 A;  3ZIT A;  2PUK C;  3J7Y b;  2YAN A;  1XVW A;  3CXG A;  2LQO A;  2B7J A;  3LYK A;  2PER A;  4HJM A;  4ZBA A;  1XWG A;  1EOG A;  3FY7 A;  3IDV A;  3QR6 A;  1V40 A;  1XPV A;  3CYN A;  4ZL9 A;  5A4V A;  4POM A;  3ME7 A;  1R4W A;  1FOV A;  4G0L A;  2G2Q A;  4TR4 A;  5A4U A;  1XOB A;  1Z7P A;  3UOM A;  1X0R A;  3TOT A;  1XWA A;  2JAC A;  2VCQ A;  4J57 E;  4XS4 B;  2DJK A;  2N5F A;  2B5E A;  5CYY A;  1AQV A;  4DSS A;  3IAM 2;  1ERW A;  4MJB A;  3QMX A;  3SWL A;  3ZMK A;  2V2G A;  4K7N A;  1UN2 A;  4BL7 A;  4KDX A;  2C0F A;  3D0Z A;  3VWV A;  5ELA A;  2WCI A;  3KJY A;  2FGX A;  1PMT A;  3KEB A;  2B3S A;  5DAK B;  3HHV A;  3C7M A;  2YN1 A;  4F2I A;  2H74 A;  2L4Q A;  1THX A;  1T4Y A;  2RLI A;  2HE3 A;  22GS A;  1TDI A;  5ECI B;  4EO3 A;  2BTO T;  4L5L A;  1AC1 A;  3TJJ A;  4ECB A;  3C71 A;  4O92 A;  5B8A A;  4DEJ A;  3W8J A;  5J9B A;  2CZ2 A;  19GS A;  3IOS A;  4MCU A;  5J5N A;  4WBR D;  1O73 A;  1SL1 B;  3GH9 A;  3LGC A;  1NSW A;  2IMF A;  4MNN A;  4RQX A;  1U88 A;  1MTC A;  4KDU A;  3BCK A;  3TJG A;  1MDJ A;  4NHW A;  1M7T A;  3TKR A;  4MPF A;  5G1K A;  3RHC A;  1XXU A;  2C3T A;  3M9J A;  4KUN A;  2VLT A;  3MSZ A;  1T00 A;  3APQ A;  2RM6 A;  4PXO A;  2IMI A;  3FR9 A;  1T7P B;  3WYW A;  1U3I A;  2XBQ A;  2C1Y A;  2VL9 A;  2VUP A;  2V6O A;  1QGV A;  3CSJ A;  3P90 A;  1EWX A;  1F3B A;  3EE2 A;  2FLS A;  1DBY A;  2P5Q A;  3ZVJ A;  1NM3 A;  1BQ7 A;  2LV3 A;  1HQO A;  3EMX A;  5ECP B;  1TK5 B;  2JAD A;  3EPT A;  3GN3 A;  4GCI A;  3I69 A;  2YJH A;  4G2E A;  4P3Y B;  3L9S A;  4TW5 A;  2O8V B;  1ZYP A;  4EKZ A;  2A2P A;  4TOP A;  1YY7 A;  1GUM A;  2AUV A;  4FQU A;  3UJ1 A;  5D73 A;  5EL8 A;  4TKY A;  4TXO B;  2GLR A;  4ISD A;  1M9A A;  6GST A;  1K0D A;  1R7H A;  2FUG 2;  3HCZ A;  1T4Z A;  2I1U A;  4MH3 A;  3E3E A;  1GWC A;  3TOU A;  4V2N A;  5G1L A;  1PSQ A;  4IQA A;  1DUG A;  2H70 A;  2XPD A;  1XWC A;  2NVL A;  2H6X A;  5F0G A;  1SKR B;  2N5B A;  5EY6 A;  4X43 A;  5AN1 A;  1GSQ A;  3EIN A;  4PNF A;  4H86 A;  17GS A;  5H5Q A;  3ZFB A;  3QOU A;  3ZYW A;  3EWL A;  4BVY A;  2DIZ A;  4K5R A;  2H6Y A;  3QAG A;  5KN1 A;  2AB6 A;  3EVI A;  2Z9S A;  5ID2 B;  3UIW A;  2F51 A;  3NOF A;  4HJ2 A;  1A2M A;  1B48 A;  4F03 A;  1GUK A;  3PPU A;  1U3A A;  2HZE B;  4EXJ A;  1O85 A;  4PQ1 A;  1YQ1 A;  4TVE A;  4ML6 A;  2HRN A;  3D5J A;  2O85 A;  3FK8 A;  5HR2 A;  1KBN A;  2OAD A;  3PR8 A;  4NMU A;  5LNK e;  2KUC A;  2CX4 A;  1OC8 A;  3LW9 A;  4ZL8 A;  1O7U A;  4FYC A;  4K5S A;  1KTE A;  4NAX A;  4IS0 A;  1X9M B;  1XWB A;  4WET A;  3IC8 A;  1PL1 A;  3ERF A;  2XHF A;  1TK0 B;  3WT1 A;  1WPI A;  3G7J A;  4IEL A;  2VCV A;  2WB9 A;  1N8J A;  2NDO A;  3IK9 A;  3WT2 A;  3GYK A;  4K6X A;  5AGY A;  2ZNM A;  3GFK A;  3HJM A;  3LSZ A;  4YKG A;  1X5C A;  1FB0 A;  3TRP A;  2RUE A;  5HQP A;  2I4A A;  2B1K A;  3LEF A;  3RDW A;  1HYU A;  1TJD A;  2WZ9 A;  2V1M A;  3GUS A;  2IL3 A;  1UA5 A;  4XTS A;  1FHE A;  3FZ5 A;  1K0C A;  2XPE A;  4IW9 A;  3EMP A;  1R5A A;  2C3N A;  4KX4 A;  2R6K A;  3VFI A;  1RQM A;  1ML6 A;  2HI7 A;  1VGL A;  2DML A;  1ST9 A;  5J9C A;  1UC7 A;  2H01 A;  3GST A;  3A5W A;  4I8B A;  1ACV A;  4NHZ A;  4YQV A;  1JZW A;  2JZT A;  4I97 A;  2L4C A;  3ERW A;  1OAZ A;  2GT6 A;  2VD1 A;  5CRE A;  1V2A A;  4ML1 A;  4X4J A;  4KSM A;  1WE0 A;  1O6J A;  2IWT A;  1HD2 A;  3IA1 A;  1OKT A;  4TN8 A;  1EV9 A;  1OVN A;  4L5O A;  1B4Q A;  4EE0 A;  3HJO A;  1XOA A;  4I5Q A;  2AYT A;  1M99 A;  3FW2 A;  3WGX A;  5J41 A;  1I9D A;  4LMW A;  3VPQ A;  2V41 A;  2GS3 A;  2KOK A;  2X49 A;  4CW9 A;  4MPG A;  4KAE A;  4DVC A;  3ZL5 A;  4MK3 A;  2WDU A;  3GKK A;  1A23 A;  2GQL A;  3G7Y A;  1SD8 A;  14GS A;  4OO5 A;  3DIE A;  3HXS A;  2YWN A;  1G0T A;  4KH7 A;  1WJK A;  5IMV A;  1TU7 A;  1AXD A;  4A5P A;  3F4R A;  5KOX A;  3F0I A;  1YZX A;  3F8U A;  2M80 A;  3GX8 A;  5FWG A;  1SL2 B;  3WGE A;  2B7K A;  3ZZX A;  3ZRE A;  4ICY A;  2E2G A;  3P2A A;  5IPH A;  2YZH A;  4KCA A;  2GZY A;  1F9M A;  3KMO A;  5GST A;  3GHA A;  4OMV A;  2A4H A;  3R2Q A;  3US3 A;  1Z3E A;  1ABA A;  3L4N A;  1LBK A;  5JWR B;  6GSV A;  3ME8 A;  2QKE A;  1WP0 A;  2KLX A;  3HVS A;  1EEM A;  4YQU A;  3F4S A;  5CP1 A;  1FO5 A;  1GSU A;  2H1B A;  2R0G A;  4ECI A;  2V32 A;  2PBJ A;  2OE3 A;  4NV5 A;  4NXI A;  4TXV A;  4HUA A;  4K2X A;  3HZ8 A;  4XRD A;  2JSZ A;  5DAL B;  5ABR A;  4WXT A;  4E8E A;  4CHS A;  4GLT A;  2VIM A;  1TU8 A;  1WOU A;  3ZVJ D;  3TJB A;  2GT5 A;  1R26 A;  1JHB A;  1A8Y A;  1ON4 A;  3M9K A;  3LJR A;  2ALB A;  1Z5Y E;  2DJ0 A;  3TKS C;  6GSS A;  5BMU A;  4GSN A;  1T8E B;  1TKD B;  4G0I A;  3ZFL A;  4GQF A;  1FVK A;  5DDL A;  3D22 A;  5IMC A;  2H1A A;  1T1V A;  3DWV A;  4YH2 A;  1C72 A;  2YWO A;  5ECR B;  4OFN A;  5IMF A;  5IMD A;  3APO A;  1ERT A;  2GSR A;  4OO4 A;  3RHB A;  2VM1 A;  4LA1 A;  2LNS A;  1ERU A;  1Z6N A;  3IXR A;  2H0I A;  4ULX A;  3UEM A;  4JE1 A;  2CVD A;  1PX7 A;  1JZO A;  4AJ7 A;  3H79 A;  2A2R A;  1A0R P;  1K0A A;  4WF4 A;  4TR0 A;  1YEX A;  3CTF A;  2PU9 C;  2MMO A;  4IQ1 A;  3O76 A;  3E0U A;  3GRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...