1VRSD

Crystal structure of the disulfide-linked complex between the n-terminal and c-terminal domain of the electron transfer catalyst dsbd
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
HLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVASKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Structural basis and kinetics of inter- and intramolecular disulfide exchange in the redox catalyst DsbD
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Oxidoreductase
total genus 42
structure length 118
sequence length 118
chains with identical sequence E, F
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vrsD00
3UARA 5ECIB 5IPGA 2VCQA 3TKSA 2YV9A 3EINA 1PSQA 3KTBA 4JR4A 3DEXA 4WETA 3IV4A 5ECRB 2OKAA 4JR6A 1HQOA 1VF3A 3O76A 1FVKA 3GMFA 3OR5A 1E2YA 4CDOA 2AHEA 2FGXA 5AISA 1SENA 2L6DA 5J5NA 2RUEA 2VAFA 1EOGA 1Z5YE 2LV3A 3APOA 1K3LA 5DCGA 3TKQA 3NZNA 1TU8A 5IOWA 1SYRA 1SJ6A 2YZUA 5J9BA 2YJ7A 3S9FA 4ZB8A 4XS1A 1SU9A 3A2XA 3J7Yk 6GSSA 1UA5A 1V40A 2LRTA 1R5AA 2XBQA 2VIMA 3VI5A 5H5SA 4PUAA 3F6DA 3EMPA 2VOCA 2JZRA 4YQUA 1MD3A 3D22A 5E4WA 3VWVA 2BMXA 1GSQA 2NPBA 3QDNA 4FIWA 3KMNA 4PX1A 3US3A 2FY6A 1KBNA 3IR4A 2DC5A 1NM3A 3RDWA 2RM6A 3HA9A 4GTUA 4G2EA 2N5BA 3L0HA 3HCZA 1SL2B 3ZITA 4ML1A 1OKTA 4AJ6A 1WOUA 2GSTA 2IIYA 2CVKA 2OE1A 1GUHA 4E8HA 4WR5A 5IIZA 3UAPA 1PA3A 4IJIA 3L4NA 5ECOB 4PUFC 1EGRA 3VFIA 4FYBA 1M99A 5ELAA 1ST9A 2G0FA 2P5QA 5HFIA 1PKZA 2PN8A 4V2LA 3TJJA 2PVQA 2H1AA 2R5GA 3AY8A 4TRXA 12GSA 1E6BA 3GRXA 5D93A 3UBKA 4OFTA 2K8SA 2X8CA 1FAAA 4KNDA 3KIJA 3LORA 5GSSA 1K0DA 5DALB 4O32A 2HI7A 3QAVA 2B5EA 3GN3A 14GSA 2NTOA 1SD8A 4NV5A 5HR2A 1DE2A 3D6IA 1F9MA 2H0HA 1SKWB 3TKRA 5DQYA 2IJYA 4WEYA 3IRAA 2C3NA 2KUCA 3WT1A 5KN2A 4MDCA 4MJEA 2PERA 4I5QA 4XS4A 2YCDA 3TB2A 1AAZA 1K3YA 4HUAA 4G9HA 1XXUA 1K0OA 4HDEA 5KN0A 1YKAA 1GSYA 4XRDA 4O7HA 1J0FA 5F8BA 3P2AA 3CSJA 5CRWA 5CYYA 2IMIA 3CRTA 1G6WA 4X43A 1Z9HA 1MDJA 3UBLA 4JE1A 3H4KA 1FVJA 1SL0B 3GFKA 3UJ1A 2TRCP 3U6VA 5D8IA 3PGTA 3F8UA 3A2WA 5B7CA 1HNAA 1K0MA 3G7IA 3BD2A 2PVOC 3ZLPA 3IE3A 5H5QA 1SD9A 3LSZA 3KEBA 3L9UA 5CRDA 4LMWA 4I8BA 3ZMLA 1PN9A 3Q6OA 3DKSA 2R37A 1R5PA 1TW9A 2LQQA 2YOIA 3TJGA 3CXGA 1M9AA 1F2EA 2C0GA 5D9WA 1LBKA 2FWGA 2VL2C 3RBTA 4XS4B 2IMFA 4WR4A 2WS2A 1X9WB 2IFQA 4E8EA 2F9SA 3A3TA 5A4UA 3QPMA 4XTSA 2HSHA 2GLRA 1U3AA 1Y25A 2VLUA 4BA7A 4L8EA 1GSUA 1T1VA 3GIXA 2OE3A 2WRTA 3MAKA 3RPNA 4ML6A 2JL4A 2IMEA 1SYXA 3KD0A 3VURA 3TKPA 1XW5A 5J9CA 3M0FA 2GT5A 1V9WA 2JZSA 4ULXA 2DIYA 1NHYA 5F05A 5ECHB 2YWNA 3LXZA 1OE7A 2VCTA 2ZCTA 2I81A 5J41A 4MZWA 3UL3A 1F3AA 4V2NA 1JHBA 3C7MA 4LL4B 3F4SA 3M9JA 4BWSA 4ZL8A 4HI7A 1BEDA 2C4JA 5DAKA 2VL3A 5IMVA 1TI1A 1SK0A 3KP8A 6GSVA 1WPIA 1V58A 3UEMA 1G0TA 4LLRA 1EEJA 1F6MC 5B6MA 1PKWA 4PQHA 4JU5A 2PGTA 3ZVJD 2DJKA 3O3TA 4PQIA 2REMA 1FOVA 1XBSA 2IFQB 5ID2A 1X5CA 3LEFA 4NHZA 1NHOA 4POMA 3VPQA 2HNLA 18GSA 3FZ5A 4KB3A 1H75A 5IMDA 5JCGA 3DGQA 4BVYA 2E2MA 1LJRA 2R6KA 3F9UA 4EL1A 4NAXA 3KGKA 1GWCA 2K6VA 2LRNA 4N30A 4OFMA 4MJAA 5IMAA 4OFNA 4RI6A 1XOAA 5ECPB 3APQA 2LS5A 1R4WA 3GL3A 4L5OA 4YH2A 4EXJA 1M0UA 1U87A 1PD21 4Q5RA 3IK9A 4TXOA 1A2MA 4J2FA 4EF0A 1WJKA 4FH8A 4TVEA 4Z7XA 5DAKB 1WWJA 1GTAA 4WXTA 3C73A 4POLA 1TXXA 3EU3A 2AB6A 1XWKA 4J56E 4PURA 3QD9A 4EDYA 1K0NA 2J23A 3KMOA 6GSYA 4WF4A 2VCVA 1ERWA 2K8VA 2L4QA 3TJBA 2N5AA 3CSIA 4TW5A 3KJYA 3H8QA 3HZ4A 1V98A 5ID2B 5LD0A 3TJKA 5ECLB 1KEBA 2XC2A 4ISDA 2FA4A 2CQ9A 4QL9A 5G1KA 3LFLA 1XOBA 3F3QA 1FG4A 3L9SA 2C80A 2PBJA 5IO2A 2MMOA 1AQVA 2KHPA 1WMJA 2PMTA 1B8XA 3QMXA 4F2IA 4NHWA 2KLXA 3I9V2 3V1WA 2B1LA 2FCHA 3C1RA 4HEA2 3IHQA 3TUEA 2H19A 4TXOB 5ABRA 2H74A 1J9BA 1WRYA 4XRAA 3FW2A 3GTUB 2VD0A 3F4TA 1WE0A 1Z3EA 3E3EA 3GSSA 2LNTA 2YN1A 3I69A 4POKA 3C1SA 5CRGA 5CP1A 1FO5A 1S3CA 4N10A 2GQMA 2VM1A 1ML6A 2PPTA 2PWJA 3BCIA 3U5RE 4K1FA 1XIYA 4AGSA 5CO3A 2OBKA 2F51A 4I2TA 3MNGA 2C3QA 4HZ2A 1I9DA 1I5GA 2G2QA 2IWTA 4D73B 4TR3A 4IQAA 3EC3A 5KN3A 5IO0A 2TIRA 2H1DA 5F07A 1FW1A 1C72A 4IP1A 1XPVA 3G7JA 1H4OA 2H6YA 4LA1A 2ON5A 1ILOA 1PX7A 2K18A 2JZTA 2AJQB 5B6NA 2HT9A 3I6AA 2QKEA 2M46A 3E9JB 5ECNB 3H93A 6GSXA 3HJPA 1SK2A 1BX9A 2XBIA 4ZBAA 2EIQA 1TRWA 3M9KA 1PL1A 2HZEA 4WF5A 1SL1B 1GNWA 3R2QA 4JRRA 1TTZA 2YV7A 2LKUA 2CX4A 4GSNA 1YEPA 2GQLA 2OE0A 1DUGA 2YZHA 2CA8A 3IXRA 4K0GA 1EOHA 2H70A 1QQ2A 1OC3A 3G9BA 2IL3A 2DSAA 4F03A 3HVSA 1T4ZA 3CRUA 4ZBDA 3EYTA 5B8BA 3BCKA 4FYCA 4MPFA 3WD6A 4GXZA 1AQXA 3QR6A 1W4VA 1GTBA 2FWFA 3FR9A 2DMMA 5D9TA 3LWAA 4OO4A 2HYXA 2YWIA 1NW2A 4ZXGA 2WJUA 1GTIA 5HR0A 1Q4JA 2MBTA 3LYKA 2GSQA 4PGTA 4O92A 3RAZA 2FUG2 1AUCA 2FLSA 2V6KA 4ACSA 11GSA 4GQCA 2JACA 1CQHA 2OA7A 3WT2A 2GZYA 2LJAA 4RQXA 4K2DA 1J08A 1JLVA 3FR3A 1T4YA 1BG5A 4KCEA 5GZZB 3L9VA 3H1NA 2HZEB 2A4VA 1VRSD 1PX6A 5KN1A 3LJRA 1YY7A 1XFLA 1ERVA 2E2GA 1TK8B 4IQ1A 3HD5A 3IPZA 4KW6A 2GS3A 1F3BA 2JADA 2MMNA 2CZ3A 5DBQA 3HJMA 2V6OA 3UVHA 4XS6A 1TOFA 1SKSB 3KXOA 4ZL9A 1GLPA 3ZVJA 3DWVA 3D21A 1B9YC 3QAWA 3TOTA 2O8VB 2JSYA 1XW6A 4IELA 2A2SA 2DJ0A 1BYEA 2H8LA 5A5KA 2ZNMA 3TCOA 1G7OA 2DJ1A 3Q18A 4TR4A 4EDZA 2OJLA 3ZZXA 3PR8A 5EL8A 1PMTA 1YQ1A 2LSTA 2IPAA 3F4RA 2C0EA 3LQ7A 2NBSA 1ZZYA 4TR1A 4ZB9A 3KTLA 3UMAA 2GZPA 4K6XA 3IA1A 5AIVA 1YZXA 5L71A 4MP4A 2WULA 2XPDA 1XWGA 2X99A 5JCUA 4L0UA 3LXTA 2C8UA 1A2LA 4F0BA 4MJCA 2LEGA 3GNJA 4GSTA 4MK3A 4KAEA 4JEDA 3KH7A 3ME7A 4I6XA 4ID0A 4HS1A 1BQ7A 1VF4A 4GRFA 4N0VA 5EVOA 2LTKA 3GV1A 1AIUA 1ZYEA 4KGIA 4MMMA 3FKFA 1JZWA 1USBA 3CBUA 2BTOT 5ECSA 1K3OA 1LU4A 4KA0A 4GSSA 2FA8A 1YEXA 3ZIJA 1KTEA 3KH9A 2B6MA 4HZ4A 2ON7A 4MJBA 4OD7A 5F0GA 4EE0A 2E0QA 2FWEA 3FK8A 1TRSA 1EGOA 1ZYQB 5ELGA 2H72A 5FWGA 2H01A 2VL9A 5GAND 3VLNA 2HFDA 3K8NA 4KSOA 1X5EA 2VD1A 3ERFA 4YQMA 4KH7A 2OADA 4ZL7A 4BL7A 2NVLA 4IN0A 1ABAA 1DE1A 4TR1B 3GH6A 4GWRA 3KP9A 1TP9A 3KCMA 1PRXA 1TU7A 2C0FA 1YF1A 3QCPA 4FYUA 4DSSA 3UIWA 4MF7A 2H1BA 2H73A 16GSA 5IQYA 5B8AA 3TOUA 3EWLA 3QOUA 1PL2A 1T8EB 4H86A 3GSTA 2H0IA 1XVWA 2H76A 5AN1A 3TKSC 2MZCA 1B9XC 2GGTA 1SK1A 2NDOA 1MDKA 3FZ9A 2DLXA 5EY6A 1QUWA 3LGCA 1MDIA 4PNFA 1SJZA 3D5JA 4OCEA 3SWLA 3TGZA 1YJ6A 3HVVA 4XHMA 1XZOA 1URMA 4RI7A 3W8SA 5IOXA 5GAPD 3KM6A 1O8XA 3GL5A 4K7OA 4DVCA 2HSYA 2K9FA 2LJKA 3GX8A 1TRVA 4MPGA 2CVDA 4MLYA 2VLVA 1JLWA 1GLQA 1HNBA 4QL7A 3GURA 4L0WA 3F6FA 5KEJA 4V1Ap 5F06A 1GUKA 3DIEA 3IBHA 1YDKA 5DDLA 2CX3A 4ZILA 3FY7A 1JFUA 4MABA 3F63A 4L5LA 2X8GA 4G19A 5ECMB 2VCWA 2VUPA 1SJIA 3ZFBA 3CMIA 2XHFA 1HNCA 3QFBC 3GKKA 5C00A 4EC0A 3CTFA 1W89A 3GUSA 3G7YA 3IDVA 4LL1B 5DVBA 4BPYA 3FRCA 1XWCA 1Z7PA 1THXA 3F0IA 2PUKC 2H0GA 1B4PA 5LCZA 1FHEA 1U3IA 4RQRA 1AQWA 4KDUA 1RQMA 4K9ZA 4POBA 5IMCA 2MBSA 1MD4A 2VL2A 19GSA 2H6ZA 1EV4A 4N0ZA 2V1MA 3P7XA 1R7HA 3GKXA 3O6TA 2J9HA 3FEUA 1OC8A 1ZMAA 1QGVA 1A23A 3VWXA 3D4TA 5A4WA 2FD3A 3GH9A 3ME8A 2KP2A 3FHKA 1BJXA 1XWBA 2V41A 3WGDA 4EKZA 2I3YA 4F82A 4KE3A 3TRPA 1Z6NA 1M2BA 2M80A 4CHSA 1ZOFA 3A2VA 4YQVA 4HJMA 4MH2A 2CVBA 1GUMA 2YNXA 3KZQA 1ACVA 2QSIA 3GHAA 1B48A 3M3MA 4MF6A 2DJJA 1UN2A 5C04A 1NSWA 5JWQB 1QMVA 5AIXA 5DCHA 3ERWA 4K0NA 4XIHA 4ILFA 2RLIA 4Q5FA 4K7IA 1S3DA 2ZUPA 2AUVA 1TRUA 2WZ9A 1WIKA 2WB9A 3FZ4A 4OCFA 3UOMA 1TI3A 4AF2A 3MWHA 4PNGA 2ES7A 3DMLA 1X0RA 1OC9A 4X0XA 4I2UA 4MZBA 2M72A 1TK0B 5DJMA 2L5OA 4KCAA 5CRHA 3DYRA 1RK4A 5D9VA 4NXIA 2VCXA 2YP6A 1TJDA 3HHVA 3EMXA 2O87A 1ERUA 3DVXA 2RUFA 4BVXA 2L5LA 1CQGA 4GQFA 5G5EA 3FZAA 2FWHA 3J7Yb 1SKRB 3I43A 5IMZA 2N5FA 2GVPA 2O85A 4IKHA 1KNGA 5DALA 3ZIVA 4X1UA 2HE3A 1VF2A 5HQPA 4HU7A 5HR1A 3MDKA 4ZBBA 4IVFA 4KX4A 2L6CA 7GSSA 3NIVA 2I4AA 3TKSE 2R2JA 2HRFA 4F9ZA 3NOFA 3F3RA 2GT6A 1TKDB 2HRNA 5EPFA 4ZB6A 3ZL5A 2QGVA 1GSSA 3IOSA 5G31A 2B5YA 5IM9A 5INYA 1O85A 4HQZA 1Q98A 4KSMA 2KP1A 1GTUA 2H6XA 1OE8A 5DJLA 1A8YA 2DMLA 1M2AA 3LG6A 3ZTLA 1OC9B 3TDGA 4EVMA 2GSRA 4DSRA 3ZFLA 2R4VA 2OACA 3HKRA 2VCZA 1GNEA 2LUSA 4FO5A 5FHIA 1XWAA 3H79A 1EWXA 4Q5QA 5COHA 2DJ3A 4JBBA 2TRXA 3DRNA 1JZDA 1X9MB 10GSA 3IAS2 2VO4A 3ZREA 1AC1A 1HYUA 3P8WA 1XCCA 2FNOA 3TJFA 2F8AA 1K0CA 2HLSA 3IAM2 4K7NA 2AAWA 2R3XA 3ZMKA 1N8JA 2CT6A 4NPBA 3CYNA 3PH9A 5J4UA 2B7KA 5IMFA 3C71A 1M2DA 1VGLA 3CTGA 2P0GA 3GKMA 1N2AA 4AJ7A 3FYGA 4TN8A 3HDCA 2EIRA 2LQOA 4EO3A 5J3RA 1M7TA 1OVNA 1MEKA 1X5DA 3VK9A 2H71A 2CAIA 2VLTA 1T00A 4IHUA 4TOPA 1PQNA 2L4CA 1QK8A 4NWYA 1BAYA 5G5FA 4IS0A 4KDXA 1K0BA 3BJ5A 1FB0A 3VWUA 4K8MA 3APSA 3DD3A 4WBJA 3EVIA 4RUVA 3GKNA 1G7EA 2X64A 2MMZA 4MCUA 1JZRA 4IW9A 1ZL9A 2GSSA 1XW9A 1JZOA 1WP0A 1EP8A 2IMKA 4DEJA 4J57E 3N9JA 1V57A 1ZGNA 2CAQA 1PGTA 6GSWA 20GSA 1GL8A 2YWMA 4KDYA 4DSQA 4ECIA 2V32A 2H66A 4CW9A 1Z7RA 3C8EA 2C0DA 3D0ZA 2WCIA 4NMUA 3TRXA 2LRCA 3HJOA 3RHBA 2EC4A 4TR0A 3ED3A 2B3SA 3Q19A 1XVQA 5DQSA 2I9HA 5LNKe 2H75A 1T7PB 1GP1A 5A4VA 1A0RP 2JSZA 2O89A 1OAZA 1EV9A 1QXHA 2YANA 3L78A 2KOKA 4YAPA 4QQ7A 2H30A 2CZ2A 4Q5NA 3BBYA 5E59A 1FB6A 4F0CA 4GLTA 2C3TA 4MH3A 1O81A 3GX0A 2D2ZA 2XPEA 3EURA 3FR6A 1O73A 4ECCA 2B1KA 9GSSA 3D4MA 2F3MA 3P90A 13GSA 4HU9A 3IK7A 3GYKA 4PXOA 2OBIA 1HD2A 5IPHA 1O7UA 5G1LA 1OYJA 2F8FA 5CNWA 1GULA 5ECKB 2MMAA 2A2RA 3VI7A 1YKCA 1VF1A 1UC7A 2LNSA 1U6TA 1IYIA 4V2MA 1V2AA 5ENUA 1A2JA 2GTUA 1GH2A 2IMDA 3ZRDA 1EZKA 4TXVA 4KUNA 2YWOA 1R26A 4G10A 2ALBA 1EP7A 5G2ZA 1O8WA 3DXBA 1UVZA 2DIZA 2H1GA 2P31A 1EEMA 5H5RA 1K0AA 1T3BA 2I1UA 4PQ1A 2O7KA 3HXSA 4BWQA 4P3YB 3IC4A 2CV4A 4GF0A 3HZ8A 1S3AA 4HOJA 1X9SB 1Z6MA 1DSBA 3RHCA 4TKYA 2BJXA 4IP6A 1AW9A 5ECQB 4OWYA 5CREA 3QFAC 4ECJA 5GSTA 4MZCA 3TRQA 4V1Ag 8GSSA 2PU9C 4MA9A 2V2GA 5HR3A 3WGEA 3EE2A 1ON4A 2WFCA 4O5RA 3W6GA 2GZZA 1F37A 6GSUA 3Q74A 3WGXA 2GDRA 4EUYA 1THOA 3HY2A 1G6YA 2E7PA 4DSSB 3JCML 3VPTA 2Z9SA 4IBPA 4JZQA 1A24A 4GCIA 4HQSA 4AJ8A 1MTCA 3GTUA 4OMVA 1IYHA 3HVXA 1ERTA 4LMVA 5AGYA 2RIIA 2LJRA 2DJ2A 1ZCPA 5HFKA 4ZIJA 5HFGA 2VM2A 4WKWA 4I97A 1GSDA 1B4QA 3ISOA 2B7JA 5JWOB 2RM5A 1OKDA 1RW1A 3DVWA 3M8NA 2EIOA 3BOAA 1O6JA 1GSEA 3A5WA 3MSZA 1A8LA 2AYTA 2DBCA 2QC7A 5D96A 4D73A 3CSHA 3VWWA 1U88A 3LYPA 2L57A 2MYGA 3SBCA 3QAGA 1TK5B 1GRXA 5FT3A 2YPMA 3W8JA 1YF0A 1QFNA 5D73A 5JCWA 2YJHA 4NV2A 3GA4A 1AXDA 2IN3A 2WGRA 2P5RA 1M9BA 5JWRB 3UVTA 3N5OA 2JU5A 6GSTA 2AV4A 5G30A 2C1YA 5D9XA 3WYWA 22GSA 3PINA 1A0FA 3ZYWA 2B5XA 3M1GA 3ERGA 2WDUA 4N11A 2FHEA 2X8HA 4HJ2A 3E0UA 4MF5A 2HZFA 4OO5A 4ECBA 3HYPA 3EU4A 1Y6EA 17GSA 4XCSA 2GQKA 3RPPA 4IJ3A 4IGJA 4YAVA 5CAXA 1TDIA 1DBYA 1GSFA 4WBRD 2HXKA 2L59A
chains in the Genus database with same CATH superfamily
3UARA 5ECIB 5IPGA 2VCQA 3TKSA 2YV9A 3EINA 1PSQA 3KTBA 4JR4A 3DEXA 4WETA 3IV4A 5ECRB 2OKAA 4JR6A 1HQOA 1VF3A 3O76A 1FVKA 3GMFA 3OR5A 1E2YA 4CDOA 2AHEA 2FGXA 5AISA 1SENA 2L6DA 5J5NA 2RUEA 2VAFA 1EOGA 1Z5YE 2LV3A 4O5QA 3APOA 1K3LA 5DCGA 3TKQA 3NZNA 1TU8A 5IOWA 1SYRA 1SJ6A 2YZUA 5J9BA 2YJ7A 3S9FA 4ZB8A 4XS1A 1SU9A 3A2XA 3J7Yk 6GSSA 1UA5A 1V40A 2LRTA 1R5AA 2XBQA 2VIMA 3VI5A 5H5SA 4PUAA 3F6DA 3EMPA 2VOCA 2JZRA 4YQUA 4KF9A 1MD3A 3D22A 5E4WA 3VWVA 2BMXA 1GSQA 2R0PA 2NPBA 3QDNA 4FIWA 3KMNA 4PX1A 3US3A 2FY6A 1KBNA 3IR4A 2DC5A 1NM3A 3RDWA 2RM6A 3HA9A 4GTUA 4G2EA 2N5BA 3L0HA 3HCZA 1SL2B 3ZITA 4ML1A 1OKTA 4AJ6A 1WOUA 2R0GA 2GSTA 2IIYA 2CVKA 2OE1A 1GUHA 4E8HA 4WR5A 5IIZA 3UAPA 1PA3A 4IJIA 3L4NA 5ECOB 4PUFC 1EGRA 3VFIA 4FYBA 1M99A 5ELAA 1ST9A 2G0FA 2P5QA 5HFIA 1PKZA 2PN8A 4V2LA 3TJJA 2PVQA 2H1AA 2R5GA 3AY8A 4TRXA 12GSA 4BVXB 1E6BA 3GRXA 5D93A 3UBKA 4OFTA 2K8SA 2X8CA 1FAAA 4KNDA 3KIJA 3LORA 5GSSA 1K0DA 5DALB 4O32A 2HI7A 3QAVA 2B5EA 3GN3A 14GSA 2NTOA 1SD8A 3EPTA 4NV5A 5HR2A 1DE2A 3D6IA 1F9MA 2H0HA 1SKWB 3TKRA 5DQYA 2IJYA 4WEYA 3IRAA 2C3NA 2KUCA 3WT1A 5KN2A 4MDCA 4MJEA 2PERA 4I5QA 4XS4A 2YCDA 3TB2A 1AAZA 1K3YA 4HUAA 4G9HA 1XXUA 1K0OA 4HDEA 5KN0A 1YKAA 1GSYA 4XRDA 4O7HA 1J0FA 5F8BA 3P2AA 3CQFA 3CSJA 5CRWA 5CYYA 2IMIA 3CRTA 1G6WA 4X43A 1Z9HA 1MDJA 3UBLA 4JE1A 3H4KA 1FVJA 1SL0B 3GFKA 3UJ1A 3IHGA 2TRCP 3U6VA 5D8IA 3PGTA 4YKGA 3F8UA 3A2WA 1FOHA 5B7CA 1HNAA 1K0MA 3G7IA 4O5UA 3BD2A 2PVOC 3ZLPA 1S3RA 3IE3A 5H5QA 1SD9A 4EIQA 3LSZA 3KEBA 3L9UA 5CRDA 4LMWA 4I8BA 3ZMLA 1PN9A 3Q6OA 3DKSA 2R37A 1R5PA 1TW9A 2LQQA 2YOIA 3TJGA 3CXGA 1M9AA 1F2EA 2C0GA 5D9WA 1LBKA 2FWGA 2VL2C 3RBTA 4XS4B 2IMFA 4WR4A 2WS2A 1X9WB 2IFQA 4E8EA 2F9SA 3A3TA 5A4UA 3QPMA 4XTSA 2HSHA 2GLRA 1U3AA 1Y25A 2VLUA 4BA7A 4L8EA 1GSUA 1T1VA 3GIXA 2OE3A 2WRTA 3MAKA 3RPNA 4ML6A 2JL4A 2IMEA 1SYXA 3KD0A 3VURA 3TKPA 1XW5A 5J9CA 3M0FA 2GT5A 1V9WA 2JZSA 4ULXA 2DIYA 1NHYA 5F05A 5ECHB 2YWNA 3LXZA 1OE7A 2VCTA 2ZCTA 2I81A 5J41A 4MZWA 3UL3A 1F3AA 4V2NA 1JHBA 3C7MA 4LL4B 3F4SA 3M9JA 4BWSA 4ZL8A 4HI7A 1BEDA 2C4JA 5DAKA 2VL3A 5IMVA 1TI1A 1SK0A 3KP8A 6GSVA 1WPIA 1V58A 3UEMA 1G0TA 4LLRA 1EEJA 1F6MC 5B6MA 1PKWA 4PQHA 4JU5A 2PGTA 3ZVJD 2DJKA 3O3TA 4PQIA 2REMA 1FOVA 1XBSA 2IFQB 5ID2A 1X5CA 3LEFA 4NHZA 1NHOA 4POMA 3VPQA 2HNLA 18GSA 3FZ5A 4KB3A 1H75A 5IMDA 5JCGA 3DGQA 4BVYA 2E2MA 1LJRA 2R6KA 3F9UA 4EL1A 4NAXA 3KGKA 1GWCA 2K6VA 2LRNA 4N30A 4OFMA 2QA1A 4MJAA 5IMAA 4OFNA 4RI6A 1XOAA 5ECPB 3APQA 2LS5A 1R4WA 3GL3A 4L5OA 4YH2A 4EXJA 1M0UA 1U87A 1PD21 4Q5RA 3IK9A 4TXOA 1A2MA 4J2FA 4EF0A 1WJKA 4FH8A 4TVEA 4Z7XA 5DAKB 1WWJA 1GTAA 4WXTA 3C73A 4POLA 4G0KA 1TXXA 3EU3A 1ZYNA 2AB6A 1XWKA 4J56E 4PURA 3QD9A 4EDYA 1K0NA 2J23A 3KMOA 6GSYA 4WF4A 2VCVA 1ERWA 2K8VA 2L4QA 3TJBA 2N5AA 3CSIA 4TW5A 3KJYA 3H8QA 3HZ4A 1V98A 5ID2B 5LD0A 3TJKA 5ECLB 1KEBA 2XC2A 4ISDA 2FA4A 2CQ9A 4QL9A 5G1KA 3LFLA 1XOBA 3F3QA 1FG4A 3L9SA 2C80A 2PBJA 5IO2A 2MMOA 1AQVA 2KHPA 1WMJA 2PMTA 1B8XA 3QMXA 4F2IA 4NHWA 2KLXA 3I9V2 3V1WA 2B1LA 2FCHA 3C1RA 4HEA2 3IHQA 3TUEA 2H19A 4TXOB 5ABRA 2H74A 4A5PA 1J9BA 1WRYA 4XRAA 3FW2A 3GTUB 2VD0A 4FQUA 3F4TA 1WE0A 1Z3EA 3E3EA 3GSSA 2LNTA 2YN1A 3HVNA 3I69A 4POKA 3C1SA 5CRGA 5CP1A 1FO5A 1S3CA 4N10A 2GQMA 2VM1A 1ML6A 2PPTA 2PWJA 3BCIA 3U5RE 4K1FA 1XIYA 4AGSA 5CO3A 2OBKA 2F51A 4I2TA 3MNGA 2C3QA 4HZ2A 1I9DA 1I5GA 2G2QA 2IWTA 4D73B 4TR3A 4IQAA 3EC3A 5KN3A 5IO0A 2TIRA 2H1DA 5F07A 1FW1A 1C72A 4IP1A 1XPVA 3G7JA 1H4OA 2H6YA 4LA1A 2ON5A 1ILOA 1M3IA 1PX7A 2K18A 5KOXA 2JZTA 2AJQB 5B6NA 2HT9A 3I6AA 2QKEA 2M46A 3E9JB 5ECNB 2HRAA 3H93A 6GSXA 3HJPA 1SK2A 1BX9A 2XBIA 4ZBAA 2EIQA 1TRWA 3M9KA 1PL1A 2HZEA 4WF5A 1SL1B 1GNWA 3R2QA 4JRRA 1TTZA 2YV7A 2LKUA 2CX4A 4GSNA 4Z2TA 1YEPA 2GQLA 2OE0A 1DUGA 2YZHA 2CA8A 3IXRA 4K0GA 1EOHA 2H70A 1QQ2A 1OC3A 3G9BA 2IL3A 2DSAA 2X49A 4F03A 3HVSA 1T4ZA 3CRUA 4ZBDA 3EYTA 5B8BA 3BCKA 4FYCA 4MPFA 3WD6A 4GXZA 1AQXA 3QR6A 1W4VA 1GTBA 2FWFA 3FR9A 2DMMA 5D9TA 3LWAA 4OO4A 2HYXA 2YWIA 1NW2A 4ZXGA 2WJUA 1GTIA 5HR0A 1Q4JA 2MBTA 3LYKA 2GSQA 4PGTA 4O92A 3RAZA 2FUG2 1AUCA 2FLSA 2V6KA 4ACSA 11GSA 4GQCA 2A4HA 2JACA 1CQHA 2OA7A 3WT2A 2GZYA 2LJAA 4RQXA 4K2DA 1J08A 1JLVA 3FR3A 1T4YA 1BG5A 4KCEA 5GZZB 3L9VA 3H1NA 2HZEB 2A4VA 1VRSD 1PX6A 5KN1A 3LJRA 1YY7A 1XFLA 1ERVA 2E2GA 1TK8B 4IQ1A 3HD5A 3IPZA 4KW6A 2GS3A 1F3BA 2JADA 2MMNA 2CZ3A 5DBQA 3HJMA 2V6OA 3UVHA 4XS6A 1TOFA 1SKSB 3KXOA 4ZL9A 1GLPA 3ZVJA 3DWVA 3D21A 1B9YC 3QAWA 3TOTA 2O8VB 2JSYA 1XW6A 4IELA 2A2SA 2DJ0A 1BYEA 2H8LA 5A5KA 2ZNMA 3TCOA 1G7OA 2DJ1A 3Q18A 4TR4A 4EDZA 2OJLA 3ZZXA 3PR8A 5EL8A 1PMTA 1YQ1A 4K5RA 2LSTA 2IPAA 3F4RA 3MIXA 2C0EA 4USSA 3LQ7A 2NBSA 1ZZYA 4TR1A 4ZB9A 3KTLA 3UMAA 2GZPA 4K6XA 2DKHA 3IA1A 5AIVA 1YZXA 5L71A 4MP4A 2WULA 2XPDA 1XWGA 2X99A 5JCUA 4L0UA 3LXTA 2C8UA 1A2LA 4F0BA 4MJCA 2LEGA 3GNJA 4GSTA 4MK3A 4KAEA 4JEDA 3KH7A 3ME7A 4I6XA 4ID0A 4HS1A 1BQ7A 1VF4A 4GRFA 4N0VA 5EVOA 2LTKA 3GV1A 1AIUA 1ZYEA 4KGIA 4MMMA 3FKFA 1JZWA 1USBA 3CBUA 2BTOT 5ECSA 1K3OA 1LU4A 4KA0A 4GSSA 2FA8A 1YEXA 3ZIJA 1KTEA 3KH9A 2B6MA 4HZ4A 3PPUA 2ON7A 4MJBA 4OD7A 5F0GA 4EE0A 2E0QA 2FWEA 3FK8A 1TRSA 1EGOA 1ZYQB 5ELGA 2H72A 5FWGA 2H01A 5BRTA 2VL9A 5GAND 3VLNA 2HFDA 3K8NA 4KSOA 1X5EA 2VD1A 2A2PA 3MYDA 3ERFA 4YQMA 4KH7A 4Z2UA 2OADA 4ZL7A 4BL7A 2NVLA 4IN0A 1ABAA 1DE1A 4TR1B 3GH6A 4GWRA 3KP9A 1TP9A 3KCMA 1PRXA 1TU7A 2C0FA 1YF1A 3QCPA 4FYUA 4DSSA 3UIWA 4MF7A 2H1BA 2H73A 16GSA 5IQYA 5B8AA 3TOUA 3EWLA 3QOUA 1PL2A 1T8EB 4K5SA 4H86A 3GSTA 2H0IA 1XVWA 2H76A 5AN1A 3TKSC 2MZCA 1B9XC 2GGTA 1SK1A 2NDOA 1MDKA 3FZ9A 2DLXA 5EY6A 1QUWA 3LGCA 1MDIA 4PNFA 1SJZA 3D5JA 4OCEA 3SWLA 3TGZA 1YJ6A 2HRKA 3A5IA 3HVVA 4XHMA 1XZOA 1URMA 4RI7A 3W8SA 5IOXA 5GAPD 3KM6A 2QA2A 1O8XA 3GL5A 4K7OA 4DVCA 2HSYA 2K9FA 2LJKA 3GX8A 1TRVA 1PN0A 4MPGA 2CVDA 4MLYA 2VLVA 1JLWA 1GLQA 1HNBA 4QL7A 3GURA 4L0WA 3F6FA 5KEJA 4V1Ap 5F06A 1GUKA 3DIEA 3IBHA 1YDKA 5DDLA 2CX3A 4ZILA 3FY7A 4BL7B 4MNNA 1JFUA 4MABA 3F63A 4L5LA 2X8GA 4G19A 2VUPA 2VCWA 5ECMB 1SJIA 3ZFBA 3CMIA 2XHFA 1HNCA 3QFBC 3GKKA 5C00A 4EC0A 3CTFA 1W89A 3GUSA 3G7YA 3IDVA 4LL1B 5DVBA 4BPYA 3FRCA 1XWCA 1Z7PA 1THXA 3F0IA 4YKFA 2PUKC 2H0GA 1B4PA 1M3JA 5LCZA 1FHEA 1U3IA 4RQRA 1AQWA 4KDUA 1RQMA 4K9ZA 4POBA 5IMCA 2MBSA 1MD4A 2VL2A 19GSA 2H6ZA 1EV4A 4N0ZA 2V1MA 3P7XA 1R7HA 3GKXA 3O6TA 4BVYB 2J9HA 3FEUA 1OC8A 1ZMAA 1QGVA 1A23A 3VWXA 3D4TA 5A4WA 2FD3A 3GH9A 3ME8A 4G0LA 2KP2A 3FHKA 1BJXA 1XWBA 2V41A 3WGDA 4EKZA 2I3YA 4G0IA 4CY6A 4F82A 4KE3A 3TRPA 1Z6NA 1M2BA 2M80A 4CHSA 1ZOFA 3A2VA 3IC8A 4YQVA 4HJMA 4MH2A 2CVBA 1GUMA 2YNXA 5BMUA 3KZQA 1ACVA 2QSIA 3GHAA 1B48A 3M3MA 4MF6A 2DJJA 1UN2A 5C04A 1PFOA 1NSWA 5JWQB 4X4JA 1QMVA 5AIXA 5DCHA 3ERWA 4K0NA 4XIHA 4ILFA 2RLIA 4Q5FA 4K7IA 1S3DA 2ZUPA 2AUVA 1TRUA 2WZ9A 1WIKA 2WB9A 3FZ4A 4OCFA 3UOMA 1TI3A 4AF2A 3MWHA 4PNGA 2ES7A 3DMLA 1X0RA 1OC9A 4X0XA 4I2UA 4MZBA 2M72A 1TK0B 5DJMA 2L5OA 4KCAA 5CRHA 3DYRA 1RK4A 5D9VA 4NXIA 2VCXA 2YP6A 1TJDA 4K2XA 3HHVA 3EMXA 2O87A 1ERUA 3DVXA 2RUFA 4BVXA 2L5LA 1CQGA 4GQFA 5G5EA 3FZAA 2FWHA 3J7Yb 1SKRB 3I43A 5IMZA 2N5FA 2GVPA 2O85A 4IKHA 1KNGA 5DALA 3ZIVA 4X1UA 2HE3A 1VF2A 5HQPA 4HU7A 5HR1A 3MDKA 4ZBBA 4IVFA 4KX4A 2L6CA 7GSSA 3NIVA 2I4AA 3TKSE 2R2JA 2HRFA 4F9ZA 3NOFA 3F3RA 2GT6A 1TKDB 2HRNA 5EPFA 4ZB6A 3ZL5A 2QGVA 1GSSA 3IOSA 5G31A 2B5YA 5IM9A 5INYA 1O85A 4HQZA 1Q98A 4KSMA 2KP1A 1GTUA 2H6XA 1OE8A 5DJLA 1A8YA 2DMLA 1M2AA 3LG6A 3ZTLA 1OC9B 4BIKA 3TDGA 4EVMA 2GSRA 4DSRA 3ZFLA 2R4VA 2OACA 3HKRA 2VCZA 1GNEA 2LUSA 4FO5A 5FHIA 1XWAA 3H79A 1EWXA 4Q5QA 5COHA 2DJ3A 4JBBA 2TRXA 3DRNA 1JZDA 4ICYA 1X9MB 10GSA 3IAS2 2VO4A 2R0CA 3ZREA 1AC1A 1HYUA 3P8WA 1XCCA 2FNOA 3TJFA 2F8AA 1K0CA 2HLSA 3IAM2 4K7NA 2AAWA 2R3XA 3ZMKA 1N8JA 2CT6A 4NPBA 3CYNA 3PH9A 5J4UA 2B7KA 5IMFA 3C71A 1M2DA 1VGLA 3CTGA 2P0GA 3GKMA 1N2AA 4AJ7A 3FYGA 4CY8A 4TN8A 3HDCA 2EIRA 2LQOA 4EO3A 5J3RA 1M7TA 1OVNA 1MEKA 1X5DA 3VK9A 2H71A 2CAIA 2VLTA 1T00A 4IHUA 4TOPA 1PQNA 2L4CA 1QK8A 4NWYA 1BAYA 5G5FA 4IS0A 4KDXA 1K0BA 3BJ5A 1FB0A 3VWUA 4K8MA 3APSA 3DD3A 4WBJA 3EVIA 4RUVA 3GKNA 1G7EA 2X64A 2MMZA 4MCUA 1JZRA 4IW9A 1ZL9A 2GSSA 1XW9A 1JZOA 1WP0A 1EP8A 2DKIA 2IMKA 4DEJA 4J57E 3N9JA 1V57A 1ZGNA 2CAQA 1PGTA 6GSWA 20GSA 3FMWA 1GL8A 2YWMA 4KDYA 4DSQA 4ECIA 2V32A 2H66A 4CW9A 1Z7RA 3C8EA 2C0DA 3D0ZA 4EIPA 2WCIA 4NMUA 3TRXA 2LRCA 3HJOA 3RHBA 2EC4A 4TR0A 3ED3A 2B3SA 3Q19A 1XVQA 5DQSA 2I9HA 4PTSA 5LNKe 2H75A 1T7PB 1GP1A 5A4VA 1A0RP 2JSZA 2O89A 1OAZA 1EV9A 1QXHA 2YANA 3L78A 2KOKA 4YAPA 4QQ7A 2H30A 2CZ2A 4Q5NA 3BBYA 5E59A 1FB6A 4F0CA 5KOWA 4GLTA 2C3TA 4MH3A 1O81A 3GX0A 2D2ZA 2XPEA 3EURA 3FR6A 1O73A 4ECCA 2B1KA 9GSSA 3D4MA 2F3MA 3P90A 13GSA 4HU9A 3IK7A 3GYKA 4PXOA 2OBIA 1HD2A 5IPHA 1O7UA 1ZYPA 5G1LA 1OYJA 2F8FA 5CNWA 1GULA 5ECKB 2MMAA 2A2RA 3VI7A 1YKCA 1VF1A 1UC7A 2LNSA 1U6TA 1IYIA 4V2MA 1V2AA 5ENUA 1A2JA 2GTUA 2HSMA 1GH2A 2IMDA 3ZRDA 1EZKA 4TXVA 4KUNA 2X4AA 2YWOA 1R26A 4G10A 2ALBA 1EP7A 5G2ZA 1O8WA 3DXBA 1UVZA 4Z2RA 2DIZA 2H1GA 2P31A 1EEMA 5H5RA 1K0AA 1T3BA 2I1UA 4PQ1A 2O7KA 3HXSA 4BWQA 4P3YB 3IC4A 2CV4A 4GF0A 3HZ8A 1S3AA 4HOJA 1X9SB 1Z6MA 1DSBA 3RHCA 4TKYA 2BJXA 3R3EA 4IP6A 1AW9A 5ECQB 4OWYA 5CREA 3QFAC 4ECJA 5GSTA 4MZCA 3TRQA 4V1Ag 8GSSA 2PU9C 4MA9A 2V2GA 5HR3A 3WGEA 2UZ8A 3EE2A 1ON4A 2WFCA 4O5RA 3W6GA 2GZZA 1F37A 6GSUA 3Q74A 3WGXA 2GDRA 4EUYA 1THOA 3HY2A 1G6YA 2E7PA 4DSSB 1XG8A 3JCML 3VPTA 2Z9SA 4IBPA 4JZQA 1A24A 4GCIA 4HQSA 4AJ8A 1MTCA 3GTUA 4OMVA 1IYHA 3HVXA 1ERTA 4LMVA 5AGYA 2RIIA 2LJRA 2DJ2A 1ZCPA 5HFKA 4HSCX 4ZIJA 5HFGA 2VM2A 4WKWA 4I97A 1GSDA 1B4QA 3ISOA 2B7JA 5JWOB 2RM5A 1OKDA 1RW1A 3DVWA 3M8NA 2EIOA 3BOAA 1O6JA 1GSEA 3A5WA 3MSZA 1A8LA 2AYTA 2DBCA 2QC7A 5D96A 4D73A 3LW9A 3CSHA 3VWWA 1U88A 3LYPA 2L57A 2MYGA 3SBCA 3QAGA 1TK5B 1GRXA 5FT3A 2YPMA 3W8JA 1YF0A 1QFNA 5D73A 5JCWA 2YJHA 4NV2A 3GA4A 1AXDA 2IN3A 2WGRA 2P5RA 1M9BA 5JWRB 3UVTA 3N5OA 2JU5A 6GSTA 2AV4A 5G30A 2C1YA 5D9XA 3WYWA 22GSA 3PINA 1A0FA 3ZYWA 2B5XA 3M1GA 3ERGA 2WDUA 4N11A 2FHEA 2X8HA 4HJ2A 3E0UA 4MF5A 2HZFA 4OO5A 4ECBA 3HYPA 3EU4A 1Y6EA 17GSA 4XCSA 2GQKA 3RPPA 4IJ3A 4IGJA 4YAVA 5CAXA 1TDIA 1DBYA 1GSFA 4WBRD 2HXKA 2L59A
chains in the Genus database with same CATH topology
3UARA 5ECIB 5IPGA 2VCQA 3TKSA 2YV9A 3EINA 1PSQA 3KTBA 4JR4A 3DEXA 4WETA 3IV4A 5ECRB 2OKAA 4JR6A 1HQOA 1VF3A 3O76A 1FVKA 3GMFA 3OR5A 1E2YA 4CDOA 2AHEA 2FGXA 5AISA 1SENA 2L6DA 5J5NA 2RUEA 2VAFA 1EOGA 1Z5YE 2LV3A 4O5QA 3APOA 1K3LA 5DCGA 3TKQA 3NZNA 1TU8A 5IOWA 1SYRA 1SJ6A 2YZUA 5J9BA 2YJ7A 3S9FA 4ZB8A 4XS1A 1SU9A 3A2XA 3J7Yk 6GSSA 1UA5A 1V40A 2LRTA 1R5AA 2XBQA 2VIMA 3VI5A 5H5SA 4PUAA 3F6DA 3EMPA 2VOCA 2JZRA 4YQUA 4KF9A 1MD3A 3D22A 5E4WA 3VWVA 2BMXA 1GSQA 2R0PA 2NPBA 3QDNA 4FIWA 3KMNA 4PX1A 3US3A 2FY6A 1KBNA 3IR4A 2DC5A 1NM3A 3RDWA 2RM6A 3HA9A 4GTUA 4G2EA 2N5BA 3L0HA 3HCZA 1SL2B 3ZITA 4ML1A 1OKTA 4AJ6A 1WOUA 2R0GA 2GSTA 2IIYA 2CVKA 2OE1A 1GUHA 4E8HA 4WR5A 5IIZA 3UAPA 1PA3A 4IJIA 3L4NA 5ECOB 4PUFC 1EGRA 3VFIA 4FYBA 1M99A 5ELAA 1ST9A 2G0FA 2P5QA 5HFIA 1PKZA 2PN8A 4V2LA 3TJJA 2PVQA 2H1AA 2R5GA 3AY8A 4TRXA 12GSA 4BVXB 1E6BA 3GRXA 5D93A 3UBKA 4OFTA 2K8SA 2X8CA 1FAAA 4KNDA 3KIJA 3LORA 5GSSA 1K0DA 5DALB 4O32A 2HI7A 3QAVA 2B5EA 3GN3A 14GSA 2NTOA 1SD8A 3EPTA 4NV5A 5HR2A 1DE2A 3D6IA 1F9MA 2H0HA 1SKWB 3TKRA 5DQYA 2IJYA 4WEYA 3IRAA 2C3NA 2KUCA 3WT1A 5KN2A 4MDCA 4MJEA 2PERA 4I5QA 4XS4A 2YCDA 3TB2A 1AAZA 1K3YA 4HUAA 4G9HA 1XXUA 1K0OA 4HDEA 5KN0A 1YKAA 1GSYA 4XRDA 4O7HA 1J0FA 5F8BA 3P2AA 3CSJA 5CRWA 5CYYA 2IMIA 3CRTA 1G6WA 4X43A 1Z9HA 1MDJA 3UBLA 4JE1A 3H4KA 1FVJA 1SL0B 3GFKA 3UJ1A 3IHGA 2TRCP 3U6VA 5D8IA 3PGTA 4YKGA 3F8UA 3A2WA 1FOHA 5B7CA 1HNAA 1K0MA 3G7IA 4O5UA 3BD2A 2PVOC 3ZLPA 3IE3A 5H5QA 1SD9A 4EIQA 3LSZA 3KEBA 3L9UA 5CRDA 4LMWA 4I8BA 3ZMLA 1PN9A 3Q6OA 3DKSA 2R37A 1R5PA 1TW9A 2LQQA 2YOIA 3TJGA 3CXGA 1M9AA 1F2EA 2C0GA 5D9WA 1LBKA 2FWGA 2VL2C 3RBTA 4XS4B 2IMFA 4WR4A 2WS2A 1X9WB 2IFQA 4E8EA 2F9SA 3A3TA 5A4UA 3QPMA 4XTSA 2HSHA 2GLRA 1U3AA 1Y25A 2VLUA 4BA7A 4L8EA 1GSUA 1T1VA 3GIXA 2OE3A 2WRTA 3MAKA 3RPNA 4ML6A 2JL4A 2IMEA 1SYXA 3KD0A 3VURA 3TKPA 1XW5A 5J9CA 3M0FA 2GT5A 1V9WA 2JZSA 4ULXA 2DIYA 1NHYA 5F05A 5ECHB 2YWNA 3LXZA 1OE7A 2VCTA 2ZCTA 2I81A 5J41A 4MZWA 3UL3A 1F3AA 4V2NA 1JHBA 3C7MA 4LL4B 3F4SA 3M9JA 4BWSA 4ZL8A 4HI7A 1BEDA 2C4JA 5DAKA 2VL3A 5IMVA 1TI1A 1SK0A 3KP8A 6GSVA 1WPIA 1V58A 3UEMA 1G0TA 4LLRA 1EEJA 1F6MC 5B6MA 1PKWA 4PQHA 4JU5A 2PGTA 3ZVJD 2DJKA 3O3TA 4PQIA 2REMA 1FOVA 1XBSA 2IFQB 5ID2A 1X5CA 3LEFA 4NHZA 1NHOA 4POMA 3VPQA 2HNLA 18GSA 3FZ5A 4KB3A 1H75A 5IMDA 5JCGA 3DGQA 4BVYA 2E2MA 1LJRA 2R6KA 3F9UA 4EL1A 4NAXA 3KGKA 1GWCA 2K6VA 2LRNA 4N30A 4OFMA 2QA1A 4MJAA 5IMAA 4OFNA 4RI6A 1XOAA 5ECPB 3APQA 2LS5A 1R4WA 3GL3A 4L5OA 4YH2A 4EXJA 1M0UA 1U87A 1PD21 4Q5RA 3IK9A 4TXOA 1A2MA 4J2FA 4EF0A 1WJKA 4FH8A 4TVEA 4Z7XA 5DAKB 1WWJA 1GTAA 4WXTA 3C73A 4POLA 4G0KA 1TXXA 3EU3A 1ZYNA 2AB6A 1XWKA 4J56E 4PURA 3QD9A 4EDYA 1K0NA 2J23A 3KMOA 6GSYA 4WF4A 2VCVA 1ERWA 2K8VA 2L4QA 3TJBA 2N5AA 3CSIA 4TW5A 3KJYA 3H8QA 3HZ4A 1V98A 5ID2B 5LD0A 3TJKA 5ECLB 1KEBA 2XC2A 4ISDA 2FA4A 2CQ9A 4QL9A 5G1KA 3LFLA 1XOBA 3F3QA 1FG4A 3L9SA 2C80A 2PBJA 5IO2A 2MMOA 1AQVA 2KHPA 1WMJA 2PMTA 1B8XA 3QMXA 4F2IA 4NHWA 2KLXA 3I9V2 3V1WA 2B1LA 2FCHA 3C1RA 4HEA2 3IHQA 3TUEA 2H19A 4TXOB 5ABRA 2H74A 4A5PA 1J9BA 1WRYA 4XRAA 3FW2A 3GTUB 2VD0A 4FQUA 3F4TA 1WE0A 1Z3EA 3E3EA 3GSSA 2LNTA 2YN1A 3I69A 4POKA 3C1SA 5CRGA 5CP1A 1FO5A 1S3CA 4N10A 2GQMA 2VM1A 1ML6A 2PPTA 2PWJA 3BCIA 3U5RE 4K1FA 1XIYA 4AGSA 5CO3A 2OBKA 2F51A 4I2TA 3MNGA 2C3QA 4HZ2A 1I9DA 1I5GA 2G2QA 2IWTA 4D73B 4TR3A 4IQAA 3EC3A 5KN3A 5IO0A 2TIRA 2H1DA 5F07A 1FW1A 1C72A 4IP1A 1XPVA 3G7JA 1H4OA 2H6YA 4LA1A 2ON5A 1ILOA 1PX7A 2K18A 5KOXA 2JZTA 2AJQB 5B6NA 2HT9A 3I6AA 2QKEA 2M46A 3E9JB 5ECNB 2HRAA 3H93A 6GSXA 3HJPA 1SK2A 1BX9A 2XBIA 4ZBAA 2EIQA 1TRWA 3M9KA 1PL1A 2HZEA 4WF5A 1SL1B 1GNWA 3R2QA 4JRRA 1TTZA 2YV7A 2LKUA 2CX4A 4GSNA 4Z2TA 1YEPA 2GQLA 2OE0A 1DUGA 2YZHA 2CA8A 3IXRA 4K0GA 1EOHA 2H70A 1QQ2A 1OC3A 3G9BA 2IL3A 2DSAA 2X49A 4F03A 3HVSA 1T4ZA 3CRUA 4ZBDA 3EYTA 5B8BA 3BCKA 4FYCA 4MPFA 3WD6A 4GXZA 1AQXA 3QR6A 1W4VA 1GTBA 2FWFA 3FR9A 2DMMA 5D9TA 3LWAA 4OO4A 2HYXA 2YWIA 1NW2A 4ZXGA 2WJUA 1GTIA 5HR0A 1Q4JA 2MBTA 3LYKA 2GSQA 4PGTA 4O92A 3RAZA 2FUG2 1AUCA 2FLSA 2V6KA 4ACSA 11GSA 4GQCA 2A4HA 2JACA 1CQHA 2OA7A 3WT2A 2GZYA 2LJAA 4RQXA 4K2DA 1J08A 1JLVA 3FR3A 1T4YA 1BG5A 4KCEA 5GZZB 3L9VA 3H1NA 2HZEB 2A4VA 1VRSD 1PX6A 5KN1A 3LJRA 1YY7A 1XFLA 1ERVA 2E2GA 1TK8B 4IQ1A 3HD5A 3IPZA 4KW6A 2GS3A 1F3BA 2JADA 2MMNA 2CZ3A 5DBQA 3HJMA 2V6OA 3UVHA 4XS6A 1TOFA 1SKSB 3KXOA 4ZL9A 1GLPA 3ZVJA 3DWVA 3D21A 1B9YC 3QAWA 3TOTA 2O8VB 2JSYA 1XW6A 4IELA 2A2SA 2DJ0A 1BYEA 2H8LA 5A5KA 2ZNMA 3TCOA 1G7OA 2DJ1A 3Q18A 4TR4A 4EDZA 2OJLA 3ZZXA 3PR8A 5EL8A 1PMTA 1YQ1A 4K5RA 2LSTA 2IPAA 3F4RA 3MIXA 2C0EA 4USSA 3LQ7A 2NBSA 1ZZYA 4TR1A 4ZB9A 3KTLA 3UMAA 2GZPA 4K6XA 2DKHA 3IA1A 5AIVA 1YZXA 5L71A 4MP4A 2WULA 2XPDA 1XWGA 2X99A 5JCUA 4L0UA 3LXTA 2C8UA 1A2LA 4F0BA 4MJCA 2LEGA 3GNJA 4GSTA 4MK3A 4KAEA 4JEDA 3KH7A 3ME7A 4I6XA 4ID0A 4HS1A 1BQ7A 1VF4A 4GRFA 4N0VA 5EVOA 2LTKA 3GV1A 1AIUA 1ZYEA 4KGIA 4MMMA 3FKFA 1JZWA 1USBA 3CBUA 2BTOT 5ECSA 1K3OA 1LU4A 4KA0A 4GSSA 2FA8A 1YEXA 3ZIJA 1KTEA 3KH9A 2B6MA 4HZ4A 3PPUA 2ON7A 4MJBA 4OD7A 5F0GA 4EE0A 2E0QA 2FWEA 3FK8A 1TRSA 1EGOA 1ZYQB 5ELGA 2H72A 5FWGA 2H01A 5BRTA 2VL9A 5GAND 3VLNA 2HFDA 3K8NA 4KSOA 1X5EA 2VD1A 2A2PA 3MYDA 3ERFA 4YQMA 4KH7A 4Z2UA 2OADA 4ZL7A 4BL7A 2NVLA 4IN0A 1ABAA 1DE1A 4TR1B 3GH6A 4GWRA 3KP9A 1TP9A 3KCMA 1PRXA 1TU7A 2C0FA 1YF1A 3QCPA 4FYUA 4DSSA 3UIWA 4MF7A 2H1BA 2H73A 16GSA 5IQYA 5B8AA 3TOUA 3EWLA 3QOUA 1PL2A 1T8EB 4K5SA 4H86A 3GSTA 2H0IA 1XVWA 2H76A 5AN1A 3TKSC 2MZCA 1B9XC 2GGTA 1SK1A 2NDOA 1MDKA 3FZ9A 2DLXA 5EY6A 1QUWA 3LGCA 1MDIA 4PNFA 1SJZA 3D5JA 4OCEA 3SWLA 3TGZA 1YJ6A 2HRKA 3A5IA 3HVVA 4XHMA 1XZOA 1URMA 4RI7A 3W8SA 5IOXA 5GAPD 3KM6A 2QA2A 1O8XA 3GL5A 4K7OA 4DVCA 2HSYA 2K9FA 2LJKA 3GX8A 1TRVA 1PN0A 4MPGA 2CVDA 4MLYA 2VLVA 1JLWA 1GLQA 1HNBA 4QL7A 3GURA 4L0WA 3F6FA 5KEJA 4V1Ap 5F06A 1GUKA 3DIEA 3IBHA 1YDKA 5DDLA 2CX3A 4ZILA 3FY7A 4BL7B 4MNNA 1JFUA 4MABA 3F63A 4L5LA 2X8GA 4G19A 2VUPA 2VCWA 5ECMB 1SJIA 3ZFBA 3CMIA 2XHFA 1HNCA 3QFBC 3GKKA 5C00A 4EC0A 3CTFA 1W89A 3GUSA 3G7YA 3IDVA 4LL1B 5DVBA 4BPYA 3FRCA 1XWCA 1Z7PA 1THXA 3F0IA 4YKFA 2PUKC 2H0GA 1B4PA 5LCZA 1FHEA 1U3IA 4RQRA 1AQWA 4KDUA 1RQMA 4K9ZA 4POBA 5IMCA 2MBSA 1MD4A 2VL2A 19GSA 2H6ZA 1EV4A 4N0ZA 2V1MA 3P7XA 1R7HA 3GKXA 3O6TA 4BVYB 2J9HA 3FEUA 1OC8A 1ZMAA 1QGVA 1A23A 3VWXA 3D4TA 5A4WA 2FD3A 3GH9A 3ME8A 4G0LA 2KP2A 3FHKA 1BJXA 1XWBA 2V41A 3WGDA 4EKZA 2I3YA 4G0IA 4CY6A 4F82A 4KE3A 3TRPA 1Z6NA 1M2BA 2M80A 4CHSA 1ZOFA 3A2VA 3IC8A 4YQVA 4HJMA 4MH2A 2CVBA 1GUMA 2YNXA 5BMUA 3KZQA 1ACVA 2QSIA 3GHAA 1B48A 3M3MA 4MF6A 2DJJA 1UN2A 5C04A 1NSWA 5JWQB 4X4JA 1QMVA 5AIXA 5DCHA 3ERWA 4K0NA 4XIHA 4ILFA 2RLIA 4Q5FA 4K7IA 1S3DA 2ZUPA 2AUVA 1TRUA 2WZ9A 1WIKA 2WB9A 3FZ4A 4OCFA 3UOMA 1TI3A 4AF2A 3MWHA 4PNGA 2ES7A 3DMLA 1X0RA 1OC9A 4X0XA 4I2UA 4MZBA 2M72A 1TK0B 5DJMA 2L5OA 4KCAA 5CRHA 3DYRA 1RK4A 5D9VA 4NXIA 2VCXA 2YP6A 1TJDA 4K2XA 3HHVA 3EMXA 2O87A 1ERUA 3DVXA 2RUFA 4BVXA 2L5LA 1CQGA 4GQFA 5G5EA 3FZAA 2FWHA 3J7Yb 1SKRB 3I43A 5IMZA 2N5FA 2GVPA 2O85A 4IKHA 1KNGA 5DALA 3ZIVA 4X1UA 2HE3A 1VF2A 5HQPA 4HU7A 5HR1A 3MDKA 4ZBBA 4IVFA 4KX4A 2L6CA 7GSSA 3NIVA 2I4AA 3TKSE 2R2JA 2HRFA 4F9ZA 3NOFA 3F3RA 2GT6A 1TKDB 2HRNA 5EPFA 4ZB6A 3ZL5A 2QGVA 1GSSA 3IOSA 5G31A 2B5YA 5IM9A 5INYA 1O85A 4HQZA 1Q98A 4KSMA 2KP1A 1GTUA 2H6XA 1OE8A 5DJLA 1A8YA 2DMLA 1M2AA 3LG6A 3ZTLA 1OC9B 3TDGA 4EVMA 2GSRA 4DSRA 3ZFLA 2R4VA 2OACA 3HKRA 2VCZA 1GNEA 2LUSA 4FO5A 5FHIA 1XWAA 3H79A 1EWXA 4Q5QA 5COHA 2DJ3A 4JBBA 2TRXA 3DRNA 1JZDA 4ICYA 1X9MB 10GSA 3IAS2 2VO4A 2R0CA 3ZREA 1AC1A 1HYUA 3P8WA 1XCCA 2FNOA 3TJFA 2F8AA 1K0CA 2HLSA 3IAM2 4K7NA 2AAWA 2R3XA 3ZMKA 1N8JA 2CT6A 4NPBA 3CYNA 3PH9A 5J4UA 2B7KA 5IMFA 3C71A 1M2DA 1VGLA 3CTGA 2P0GA 3GKMA 1N2AA 4AJ7A 3FYGA 4CY8A 4TN8A 3HDCA 2EIRA 2LQOA 4EO3A 5J3RA 1M7TA 1OVNA 1MEKA 1X5DA 3VK9A 2H71A 2CAIA 2VLTA 1T00A 4IHUA 4TOPA 1PQNA 2L4CA 1QK8A 4NWYA 1BAYA 5G5FA 4IS0A 4KDXA 1K0BA 3BJ5A 1FB0A 3VWUA 4K8MA 3APSA 3DD3A 4WBJA 3EVIA 4RUVA 3GKNA 1G7EA 2X64A 2MMZA 4MCUA 1JZRA 4IW9A 1ZL9A 2GSSA 1XW9A 1JZOA 1WP0A 1EP8A 2DKIA 2IMKA 4DEJA 4J57E 3N9JA 1V57A 1ZGNA 2CAQA 1PGTA 6GSWA 20GSA 3FMWA 1GL8A 2YWMA 4KDYA 4DSQA 4ECIA 2V32A 2H66A 4CW9A 1Z7RA 3C8EA 2C0DA 3D0ZA 4EIPA 2WCIA 4NMUA 3TRXA 2LRCA 3HJOA 3RHBA 2EC4A 4TR0A 3ED3A 2B3SA 3Q19A 1XVQA 5DQSA 2I9HA 4PTSA 5LNKe 2H75A 1T7PB 1GP1A 5A4VA 1A0RP 2JSZA 2O89A 1OAZA 1EV9A 1QXHA 2YANA 3L78A 2KOKA 4YAPA 4QQ7A 2H30A 2CZ2A 4Q5NA 3BBYA 5E59A 1FB6A 4F0CA 5KOWA 4GLTA 2C3TA 4MH3A 1O81A 3GX0A 2D2ZA 2XPEA 3EURA 3FR6A 1O73A 4ECCA 2B1KA 9GSSA 3D4MA 2F3MA 3P90A 13GSA 4HU9A 3IK7A 3GYKA 4PXOA 2OBIA 1HD2A 5IPHA 1O7UA 1ZYPA 5G1LA 1OYJA 2F8FA 5CNWA 1GULA 5ECKB 2MMAA 2A2RA 3VI7A 1YKCA 1VF1A 1UC7A 2LNSA 1U6TA 1IYIA 4V2MA 1V2AA 5ENUA 1A2JA 2GTUA 2HSMA 1GH2A 2IMDA 3ZRDA 1EZKA 4TXVA 4KUNA 2X4AA 2YWOA 1R26A 4G10A 2ALBA 1EP7A 5G2ZA 1O8WA 3DXBA 1UVZA 4Z2RA 2DIZA 2H1GA 2P31A 1EEMA 5H5RA 1K0AA 1T3BA 2I1UA 4PQ1A 2O7KA 3HXSA 4BWQA 4P3YB 3IC4A 2CV4A 4GF0A 3HZ8A 1S3AA 4HOJA 1X9SB 1Z6MA 1DSBA 3RHCA 4TKYA 2BJXA 3R3EA 4IP6A 1AW9A 5ECQB 4OWYA 5CREA 3QFAC 4ECJA 5GSTA 4MZCA 3TRQA 4V1Ag 8GSSA 2PU9C 4MA9A 2V2GA 5HR3A 3WGEA 2UZ8A 3EE2A 1ON4A 2WFCA 4O5RA 3W6GA 2GZZA 1F37A 6GSUA 3Q74A 3WGXA 2GDRA 4EUYA 1THOA 3HY2A 1G6YA 2E7PA 4DSSB 3JCML 3VPTA 2Z9SA 4IBPA 4JZQA 1A24A 4GCIA 4HQSA 4AJ8A 1MTCA 3GTUA 4OMVA 1IYHA 3HVXA 1ERTA 4LMVA 5AGYA 2RIIA 2LJRA 2DJ2A 1ZCPA 5HFKA 4ZIJA 5HFGA 2VM2A 4WKWA 4I97A 1GSDA 1B4QA 3ISOA 2B7JA 5JWOB 2RM5A 1OKDA 1RW1A 3DVWA 3M8NA 2EIOA 3BOAA 1O6JA 1GSEA 3A5WA 3MSZA 1A8LA 2AYTA 2DBCA 2QC7A 5D96A 4D73A 3LW9A 3CSHA 3VWWA 1U88A 3LYPA 2L57A 2MYGA 3SBCA 3QAGA 1TK5B 1GRXA 5FT3A 2YPMA 3W8JA 1YF0A 1QFNA 5D73A 5JCWA 2YJHA 4NV2A 3GA4A 1AXDA 2IN3A 2WGRA 2P5RA 1M9BA 5JWRB 3UVTA 3N5OA 2JU5A 6GSTA 2AV4A 5G30A 2C1YA 5D9XA 3WYWA 22GSA 3PINA 1A0FA 3ZYWA 2B5XA 3M1GA 3ERGA 2WDUA 4N11A 2FHEA 2X8HA 4HJ2A 3E0UA 4MF5A 2HZFA 4OO5A 4ECBA 3HYPA 3EU4A 1Y6EA 17GSA 4XCSA 2GQKA 3RPPA 4IJ3A 4IGJA 4YAVA 5CAXA 1TDIA 1DBYA 1GSFA 4WBRD 2HXKA 2L59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAR A;  5ECI B;  5IPG A;  2VCQ A;  3TKS A;  2YV9 A;  3EIN A;  1PSQ A;  3KTB A;  4JR4 A;  3DEX A;  4WET A;  3IV4 A;  5ECR B;  2OKA A;  4JR6 A;  1HQO A;  1VF3 A;  3O76 A;  1FVK A;  3GMF A;  3OR5 A;  1E2Y A;  4CDO A;  2AHE A;  2FGX A;  5AIS A;  1SEN A;  2L6D A;  5J5N A;  2RUE A;  2VAF A;  1EOG A;  1Z5Y E;  2LV3 A;  3APO A;  1K3L A;  5DCG A;  3TKQ A;  3NZN A;  1TU8 A;  5IOW A;  1SYR A;  1SJ6 A;  2YZU A;  5J9B A;  2YJ7 A;  3S9F A;  4ZB8 A;  4XS1 A;  1SU9 A;  3A2X A;  3J7Y k;  6GSS A;  1UA5 A;  1V40 A;  2LRT A;  1R5A A;  2XBQ A;  2VIM A;  3VI5 A;  5H5S A;  4PUA A;  3F6D A;  3EMP A;  2VOC A;  2JZR A;  4YQU A;  1MD3 A;  3D22 A;  5E4W A;  3VWV A;  2BMX A;  1GSQ A;  2NPB A;  3QDN A;  4FIW A;  3KMN A;  4PX1 A;  3US3 A;  2FY6 A;  1KBN A;  3IR4 A;  2DC5 A;  1NM3 A;  3RDW A;  2RM6 A;  3HA9 A;  4GTU A;  4G2E A;  2N5B A;  3L0H A;  3HCZ A;  1SL2 B;  3ZIT A;  4ML1 A;  1OKT A;  4AJ6 A;  1WOU A;  2GST A;  2IIY A;  2CVK A;  2OE1 A;  1GUH A;  4E8H A;  4WR5 A;  5IIZ A;  3UAP A;  1PA3 A;  4IJI A;  3L4N A;  5ECO B;  4PUF C;  1EGR A;  3VFI A;  4FYB A;  1M99 A;  5ELA A;  1ST9 A;  2G0F A;  2P5Q A;  5HFI A;  1PKZ A;  2PN8 A;  4V2L A;  3TJJ A;  2PVQ A;  2H1A A;  2R5G A;  3AY8 A;  4TRX A;  12GS A;  1E6B A;  3GRX A;  5D93 A;  3UBK A;  4OFT A;  2K8S A;  2X8C A;  1FAA A;  4KND A;  3KIJ A;  3LOR A;  5GSS A;  1K0D A;  5DAL B;  4O32 A;  2HI7 A;  3QAV A;  2B5E A;  3GN3 A;  14GS A;  2NTO A;  1SD8 A;  4NV5 A;  5HR2 A;  1DE2 A;  3D6I A;  1F9M A;  2H0H A;  1SKW B;  3TKR A;  5DQY A;  2IJY A;  4WEY A;  3IRA A;  2C3N A;  2KUC A;  3WT1 A;  5KN2 A;  4MDC A;  4MJE A;  2PER A;  4I5Q A;  4XS4 A;  2YCD A;  3TB2 A;  1AAZ A;  1K3Y A;  4HUA A;  4G9H A;  1XXU A;  1K0O A;  4HDE A;  5KN0 A;  1YKA A;  1GSY A;  4XRD A;  4O7H A;  1J0F A;  5F8B A;  3P2A A;  3CSJ A;  5CRW A;  5CYY A;  2IMI A;  3CRT A;  1G6W A;  4X43 A;  1Z9H A;  1MDJ A;  3UBL A;  4JE1 A;  3H4K A;  1FVJ A;  1SL0 B;  3GFK A;  3UJ1 A;  2TRC P;  3U6V A;  5D8I A;  3PGT A;  3F8U A;  3A2W A;  5B7C A;  1HNA A;  1K0M A;  3G7I A;  3BD2 A;  2PVO C;  3ZLP A;  3IE3 A;  5H5Q A;  1SD9 A;  3LSZ A;  3KEB A;  3L9U A;  5CRD A;  4LMW A;  4I8B A;  3ZML A;  1PN9 A;  3Q6O A;  3DKS A;  2R37 A;  1R5P A;  1TW9 A;  2LQQ A;  2YOI A;  3TJG A;  3CXG A;  1M9A A;  1F2E A;  2C0G A;  5D9W A;  1LBK A;  2FWG A;  2VL2 C;  3RBT A;  4XS4 B;  2IMF A;  4WR4 A;  2WS2 A;  1X9W B;  2IFQ A;  4E8E A;  2F9S A;  3A3T A;  5A4U A;  3QPM A;  4XTS A;  2HSH A;  2GLR A;  1U3A A;  1Y25 A;  2VLU A;  4BA7 A;  4L8E A;  1GSU A;  1T1V A;  3GIX A;  2OE3 A;  2WRT A;  3MAK A;  3RPN A;  4ML6 A;  2JL4 A;  2IME A;  1SYX A;  3KD0 A;  3VUR A;  3TKP A;  1XW5 A;  5J9C A;  3M0F A;  2GT5 A;  1V9W A;  2JZS A;  4ULX A;  2DIY A;  1NHY A;  5F05 A;  5ECH B;  2YWN A;  3LXZ A;  1OE7 A;  2VCT A;  2ZCT A;  2I81 A;  5J41 A;  4MZW A;  3UL3 A;  1F3A A;  4V2N A;  1JHB A;  3C7M A;  4LL4 B;  3F4S A;  3M9J A;  4BWS A;  4ZL8 A;  4HI7 A;  1BED A;  2C4J A;  5DAK A;  2VL3 A;  5IMV A;  1TI1 A;  1SK0 A;  3KP8 A;  6GSV A;  1WPI A;  1V58 A;  3UEM A;  1G0T A;  4LLR A;  1EEJ A;  1F6M C;  5B6M A;  1PKW A;  4PQH A;  4JU5 A;  2PGT A;  3ZVJ D;  2DJK A;  3O3T A;  4PQI A;  2REM A;  1FOV A;  1XBS A;  2IFQ B;  5ID2 A;  1X5C A;  3LEF A;  4NHZ A;  1NHO A;  4POM A;  3VPQ A;  2HNL A;  18GS A;  3FZ5 A;  4KB3 A;  1H75 A;  5IMD A;  5JCG A;  3DGQ A;  4BVY A;  2E2M A;  1LJR A;  2R6K A;  3F9U A;  4EL1 A;  4NAX A;  3KGK A;  1GWC A;  2K6V A;  2LRN A;  4N30 A;  4OFM A;  4MJA A;  5IMA A;  4OFN A;  4RI6 A;  1XOA A;  5ECP B;  3APQ A;  2LS5 A;  1R4W A;  3GL3 A;  4L5O A;  4YH2 A;  4EXJ A;  1M0U A;  1U87 A;  1PD2 1;  4Q5R A;  3IK9 A;  4TXO A;  1A2M A;  4J2F A;  4EF0 A;  1WJK A;  4FH8 A;  4TVE A;  4Z7X A;  5DAK B;  1WWJ A;  1GTA A;  4WXT A;  3C73 A;  4POL A;  1TXX A;  3EU3 A;  2AB6 A;  1XWK A;  4J56 E;  4PUR A;  3QD9 A;  4EDY A;  1K0N A;  2J23 A;  3KMO A;  6GSY A;  4WF4 A;  2VCV A;  1ERW A;  2K8V A;  2L4Q A;  3TJB A;  2N5A A;  3CSI A;  4TW5 A;  3KJY A;  3H8Q A;  3HZ4 A;  1V98 A;  5ID2 B;  5LD0 A;  3TJK A;  5ECL B;  1KEB A;  2XC2 A;  4ISD A;  2FA4 A;  2CQ9 A;  4QL9 A;  5G1K A;  3LFL A;  1XOB A;  3F3Q A;  1FG4 A;  3L9S A;  2C80 A;  2PBJ A;  5IO2 A;  2MMO A;  1AQV A;  2KHP A;  1WMJ A;  2PMT A;  1B8X A;  3QMX A;  4F2I A;  4NHW A;  2KLX A;  3I9V 2;  3V1W A;  2B1L A;  2FCH A;  3C1R A;  4HEA 2;  3IHQ A;  3TUE A;  2H19 A;  4TXO B;  5ABR A;  2H74 A;  1J9B A;  1WRY A;  4XRA A;  3FW2 A;  3GTU B;  2VD0 A;  3F4T A;  1WE0 A;  1Z3E A;  3E3E A;  3GSS A;  2LNT A;  2YN1 A;  3I69 A;  4POK A;  3C1S A;  5CRG A;  5CP1 A;  1FO5 A;  1S3C A;  4N10 A;  2GQM A;  2VM1 A;  1ML6 A;  2PPT A;  2PWJ A;  3BCI A;  3U5R E;  4K1F A;  1XIY A;  4AGS A;  5CO3 A;  2OBK A;  2F51 A;  4I2T A;  3MNG A;  2C3Q A;  4HZ2 A;  1I9D A;  1I5G A;  2G2Q A;  2IWT A;  4D73 B;  4TR3 A;  4IQA A;  3EC3 A;  5KN3 A;  5IO0 A;  2TIR A;  2H1D A;  5F07 A;  1FW1 A;  1C72 A;  4IP1 A;  1XPV A;  3G7J A;  1H4O A;  2H6Y A;  4LA1 A;  2ON5 A;  1ILO A;  1PX7 A;  2K18 A;  2JZT A;  2AJQ B;  5B6N A;  2HT9 A;  3I6A A;  2QKE A;  2M46 A;  3E9J B;  5ECN B;  3H93 A;  6GSX A;  3HJP A;  1SK2 A;  1BX9 A;  2XBI A;  4ZBA A;  2EIQ A;  1TRW A;  3M9K A;  1PL1 A;  2HZE A;  4WF5 A;  1SL1 B;  1GNW A;  3R2Q A;  4JRR A;  1TTZ A;  2YV7 A;  2LKU A;  2CX4 A;  4GSN A;  1YEP A;  2GQL A;  2OE0 A;  1DUG A;  2YZH A;  2CA8 A;  3IXR A;  4K0G A;  1EOH A;  2H70 A;  1QQ2 A;  1OC3 A;  3G9B A;  2IL3 A;  2DSA A;  4F03 A;  3HVS A;  1T4Z A;  3CRU A;  4ZBD A;  3EYT A;  5B8B A;  3BCK A;  4FYC A;  4MPF A;  3WD6 A;  4GXZ A;  1AQX A;  3QR6 A;  1W4V A;  1GTB A;  2FWF A;  3FR9 A;  2DMM A;  5D9T A;  3LWA A;  4OO4 A;  2HYX A;  2YWI A;  1NW2 A;  4ZXG A;  2WJU A;  1GTI A;  5HR0 A;  1Q4J A;  2MBT A;  3LYK A;  2GSQ A;  4PGT A;  4O92 A;  3RAZ A;  2FUG 2;  1AUC A;  2FLS A;  2V6K A;  4ACS A;  11GS A;  4GQC A;  2JAC A;  1CQH A;  2OA7 A;  3WT2 A;  2GZY A;  2LJA A;  4RQX A;  4K2D A;  1J08 A;  1JLV A;  3FR3 A;  1T4Y A;  1BG5 A;  4KCE A;  5GZZ B;  3L9V A;  3H1N A;  2HZE B;  2A4V A;  1VRS D;  1PX6 A;  5KN1 A;  3LJR A;  1YY7 A;  1XFL A;  1ERV A;  2E2G A;  1TK8 B;  4IQ1 A;  3HD5 A;  3IPZ A;  4KW6 A;  2GS3 A;  1F3B A;  2JAD A;  2MMN A;  2CZ3 A;  5DBQ A;  3HJM A;  2V6O A;  3UVH A;  4XS6 A;  1TOF A;  1SKS B;  3KXO A;  4ZL9 A;  1GLP A;  3ZVJ A;  3DWV A;  3D21 A;  1B9Y C;  3QAW A;  3TOT A;  2O8V B;  2JSY A;  1XW6 A;  4IEL A;  2A2S A;  2DJ0 A;  1BYE A;  2H8L A;  5A5K A;  2ZNM A;  3TCO A;  1G7O A;  2DJ1 A;  3Q18 A;  4TR4 A;  4EDZ A;  2OJL A;  3ZZX A;  3PR8 A;  5EL8 A;  1PMT A;  1YQ1 A;  2LST A;  2IPA A;  3F4R A;  2C0E A;  3LQ7 A;  2NBS A;  1ZZY A;  4TR1 A;  4ZB9 A;  3KTL A;  3UMA A;  2GZP A;  4K6X A;  3IA1 A;  5AIV A;  1YZX A;  5L71 A;  4MP4 A;  2WUL A;  2XPD A;  1XWG A;  2X99 A;  5JCU A;  4L0U A;  3LXT A;  2C8U A;  1A2L A;  4F0B A;  4MJC A;  2LEG A;  3GNJ A;  4GST A;  4MK3 A;  4KAE A;  4JED A;  3KH7 A;  3ME7 A;  4I6X A;  4ID0 A;  4HS1 A;  1BQ7 A;  1VF4 A;  4GRF A;  4N0V A;  5EVO A;  2LTK A;  3GV1 A;  1AIU A;  1ZYE A;  4KGI A;  4MMM A;  3FKF A;  1JZW A;  1USB A;  3CBU A;  2BTO T;  5ECS A;  1K3O A;  1LU4 A;  4KA0 A;  4GSS A;  2FA8 A;  1YEX A;  3ZIJ A;  1KTE A;  3KH9 A;  2B6M A;  4HZ4 A;  2ON7 A;  4MJB A;  4OD7 A;  5F0G A;  4EE0 A;  2E0Q A;  2FWE A;  3FK8 A;  1TRS A;  1EGO A;  1ZYQ B;  5ELG A;  2H72 A;  5FWG A;  2H01 A;  2VL9 A;  5GAN D;  3VLN A;  2HFD A;  3K8N A;  4KSO A;  1X5E A;  2VD1 A;  3ERF A;  4YQM A;  4KH7 A;  2OAD A;  4ZL7 A;  4BL7 A;  2NVL A;  4IN0 A;  1ABA A;  1DE1 A;  4TR1 B;  3GH6 A;  4GWR A;  3KP9 A;  1TP9 A;  3KCM A;  1PRX A;  1TU7 A;  2C0F A;  1YF1 A;  3QCP A;  4FYU A;  4DSS A;  3UIW A;  4MF7 A;  2H1B A;  2H73 A;  16GS A;  5IQY A;  5B8A A;  3TOU A;  3EWL A;  3QOU A;  1PL2 A;  1T8E B;  4H86 A;  3GST A;  2H0I A;  1XVW A;  2H76 A;  5AN1 A;  3TKS C;  2MZC A;  1B9X C;  2GGT A;  1SK1 A;  2NDO A;  1MDK A;  3FZ9 A;  2DLX A;  5EY6 A;  1QUW A;  3LGC A;  1MDI A;  4PNF A;  1SJZ A;  3D5J A;  4OCE A;  3SWL A;  3TGZ A;  1YJ6 A;  3HVV A;  4XHM A;  1XZO A;  1URM A;  4RI7 A;  3W8S A;  5IOX A;  5GAP D;  3KM6 A;  1O8X A;  3GL5 A;  4K7O A;  4DVC A;  2HSY A;  2K9F A;  2LJK A;  3GX8 A;  1TRV A;  4MPG A;  2CVD A;  4MLY A;  2VLV A;  1JLW A;  1GLQ A;  1HNB A;  4QL7 A;  3GUR A;  4L0W A;  3F6F A;  5KEJ A;  4V1A p;  5F06 A;  1GUK A;  3DIE A;  3IBH A;  1YDK A;  5DDL A;  2CX3 A;  4ZIL A;  3FY7 A;  1JFU A;  4MAB A;  3F63 A;  4L5L A;  2X8G A;  4G19 A;  5ECM B;  2VCW A;  2VUP A;  1SJI A;  3ZFB A;  3CMI A;  2XHF A;  1HNC A;  3QFB C;  3GKK A;  5C00 A;  4EC0 A;  3CTF A;  1W89 A;  3GUS A;  3G7Y A;  3IDV A;  4LL1 B;  5DVB A;  4BPY A;  3FRC A;  1XWC A;  1Z7P A;  1THX A;  3F0I A;  2PUK C;  2H0G A;  1B4P A;  5LCZ A;  1FHE A;  1U3I A;  4RQR A;  1AQW A;  4KDU A;  1RQM A;  4K9Z A;  4POB A;  5IMC A;  2MBS A;  1MD4 A;  2VL2 A;  19GS A;  2H6Z A;  1EV4 A;  4N0Z A;  2V1M A;  3P7X A;  1R7H A;  3GKX A;  3O6T A;  2J9H A;  3FEU A;  1OC8 A;  1ZMA A;  1QGV A;  1A23 A;  3VWX A;  3D4T A;  5A4W A;  2FD3 A;  3GH9 A;  3ME8 A;  2KP2 A;  3FHK A;  1BJX A;  1XWB A;  2V41 A;  3WGD A;  4EKZ A;  2I3Y A;  4F82 A;  4KE3 A;  3TRP A;  1Z6N A;  1M2B A;  2M80 A;  4CHS A;  1ZOF A;  3A2V A;  4YQV A;  4HJM A;  4MH2 A;  2CVB A;  1GUM A;  2YNX A;  3KZQ A;  1ACV A;  2QSI A;  3GHA A;  1B48 A;  3M3M A;  4MF6 A;  2DJJ A;  1UN2 A;  5C04 A;  1NSW A;  5JWQ B;  1QMV A;  5AIX A;  5DCH A;  3ERW A;  4K0N A;  4XIH A;  4ILF A;  2RLI A;  4Q5F A;  4K7I A;  1S3D A;  2ZUP A;  2AUV A;  1TRU A;  2WZ9 A;  1WIK A;  2WB9 A;  3FZ4 A;  4OCF A;  3UOM A;  1TI3 A;  4AF2 A;  3MWH A;  4PNG A;  2ES7 A;  3DML A;  1X0R A;  1OC9 A;  4X0X A;  4I2U A;  4MZB A;  2M72 A;  1TK0 B;  5DJM A;  2L5O A;  4KCA A;  5CRH A;  3DYR A;  1RK4 A;  5D9V A;  4NXI A;  2VCX A;  2YP6 A;  1TJD A;  3HHV A;  3EMX A;  2O87 A;  1ERU A;  3DVX A;  2RUF A;  4BVX A;  2L5L A;  1CQG A;  4GQF A;  5G5E A;  3FZA A;  2FWH A;  3J7Y b;  1SKR B;  3I43 A;  5IMZ A;  2N5F A;  2GVP A;  2O85 A;  4IKH A;  1KNG A;  5DAL A;  3ZIV A;  4X1U A;  2HE3 A;  1VF2 A;  5HQP A;  4HU7 A;  5HR1 A;  3MDK A;  4ZBB A;  4IVF A;  4KX4 A;  2L6C A;  7GSS A;  3NIV A;  2I4A A;  3TKS E;  2R2J A;  2HRF A;  4F9Z A;  3NOF A;  3F3R A;  2GT6 A;  1TKD B;  2HRN A;  5EPF A;  4ZB6 A;  3ZL5 A;  2QGV A;  1GSS A;  3IOS A;  5G31 A;  2B5Y A;  5IM9 A;  5INY A;  1O85 A;  4HQZ A;  1Q98 A;  4KSM A;  2KP1 A;  1GTU A;  2H6X A;  1OE8 A;  5DJL A;  1A8Y A;  2DML A;  1M2A A;  3LG6 A;  3ZTL A;  1OC9 B;  3TDG A;  4EVM A;  2GSR A;  4DSR A;  3ZFL A;  2R4V A;  2OAC A;  3HKR A;  2VCZ A;  1GNE A;  2LUS A;  4FO5 A;  5FHI A;  1XWA A;  3H79 A;  1EWX A;  4Q5Q A;  5COH A;  2DJ3 A;  4JBB A;  2TRX A;  3DRN A;  1JZD A;  1X9M B;  10GS A;  3IAS 2;  2VO4 A;  3ZRE A;  1AC1 A;  1HYU A;  3P8W A;  1XCC A;  2FNO A;  3TJF A;  2F8A A;  1K0C A;  2HLS A;  3IAM 2;  4K7N A;  2AAW A;  2R3X A;  3ZMK A;  1N8J A;  2CT6 A;  4NPB A;  3CYN A;  3PH9 A;  5J4U A;  2B7K A;  5IMF A;  3C71 A;  1M2D A;  1VGL A;  3CTG A;  2P0G A;  3GKM A;  1N2A A;  4AJ7 A;  3FYG A;  4TN8 A;  3HDC A;  2EIR A;  2LQO A;  4EO3 A;  5J3R A;  1M7T A;  1OVN A;  1MEK A;  1X5D A;  3VK9 A;  2H71 A;  2CAI A;  2VLT A;  1T00 A;  4IHU A;  4TOP A;  1PQN A;  2L4C A;  1QK8 A;  4NWY A;  1BAY A;  5G5F A;  4IS0 A;  4KDX A;  1K0B A;  3BJ5 A;  1FB0 A;  3VWU A;  4K8M A;  3APS A;  3DD3 A;  4WBJ A;  3EVI A;  4RUV A;  3GKN A;  1G7E A;  2X64 A;  2MMZ A;  4MCU A;  1JZR A;  4IW9 A;  1ZL9 A;  2GSS A;  1XW9 A;  1JZO A;  1WP0 A;  1EP8 A;  2IMK A;  4DEJ A;  4J57 E;  3N9J A;  1V57 A;  1ZGN A;  2CAQ A;  1PGT A;  6GSW A;  20GS A;  1GL8 A;  2YWM A;  4KDY A;  4DSQ A;  4ECI A;  2V32 A;  2H66 A;  4CW9 A;  1Z7R A;  3C8E A;  2C0D A;  3D0Z A;  2WCI A;  4NMU A;  3TRX A;  2LRC A;  3HJO A;  3RHB A;  2EC4 A;  4TR0 A;  3ED3 A;  2B3S A;  3Q19 A;  1XVQ A;  5DQS A;  2I9H A;  5LNK e;  2H75 A;  1T7P B;  1GP1 A;  5A4V A;  1A0R P;  2JSZ A;  2O89 A;  1OAZ A;  1EV9 A;  1QXH A;  2YAN A;  3L78 A;  2KOK A;  4YAP A;  4QQ7 A;  2H30 A;  2CZ2 A;  4Q5N A;  3BBY A;  5E59 A;  1FB6 A;  4F0C A;  4GLT A;  2C3T A;  4MH3 A;  1O81 A;  3GX0 A;  2D2Z A;  2XPE A;  3EUR A;  3FR6 A;  1O73 A;  4ECC A;  2B1K A;  9GSS A;  3D4M A;  2F3M A;  3P90 A;  13GS A;  4HU9 A;  3IK7 A;  3GYK A;  4PXO A;  2OBI A;  1HD2 A;  5IPH A;  1O7U A;  5G1L A;  1OYJ A;  2F8F A;  5CNW A;  1GUL A;  5ECK B;  2MMA A;  2A2R A;  3VI7 A;  1YKC A;  1VF1 A;  1UC7 A;  2LNS A;  1U6T A;  1IYI A;  4V2M A;  1V2A A;  5ENU A;  1A2J A;  2GTU A;  1GH2 A;  2IMD A;  3ZRD A;  1EZK A;  4TXV A;  4KUN A;  2YWO A;  1R26 A;  4G10 A;  2ALB A;  1EP7 A;  5G2Z A;  1O8W A;  3DXB A;  1UVZ A;  2DIZ A;  2H1G A;  2P31 A;  1EEM A;  5H5R A;  1K0A A;  1T3B A;  2I1U A;  4PQ1 A;  2O7K A;  3HXS A;  4BWQ A;  4P3Y B;  3IC4 A;  2CV4 A;  4GF0 A;  3HZ8 A;  1S3A A;  4HOJ A;  1X9S B;  1Z6M A;  1DSB A;  3RHC A;  4TKY A;  2BJX A;  4IP6 A;  1AW9 A;  5ECQ B;  4OWY A;  5CRE A;  3QFA C;  4ECJ A;  5GST A;  4MZC A;  3TRQ A;  4V1A g;  8GSS A;  2PU9 C;  4MA9 A;  2V2G A;  5HR3 A;  3WGE A;  3EE2 A;  1ON4 A;  2WFC A;  4O5R A;  3W6G A;  2GZZ A;  1F37 A;  6GSU A;  3Q74 A;  3WGX A;  2GDR A;  4EUY A;  1THO A;  3HY2 A;  1G6Y A;  2E7P A;  4DSS B;  3JCM L;  3VPT A;  2Z9S A;  4IBP A;  4JZQ A;  1A24 A;  4GCI A;  4HQS A;  4AJ8 A;  1MTC A;  3GTU A;  4OMV A;  1IYH A;  3HVX A;  1ERT A;  4LMV A;  5AGY A;  2RII A;  2LJR A;  2DJ2 A;  1ZCP A;  5HFK A;  4ZIJ A;  5HFG A;  2VM2 A;  4WKW A;  4I97 A;  1GSD A;  1B4Q A;  3ISO A;  2B7J A;  5JWO B;  2RM5 A;  1OKD A;  1RW1 A;  3DVW A;  3M8N A;  2EIO A;  3BOA A;  1O6J A;  1GSE A;  3A5W A;  3MSZ A;  1A8L A;  2AYT A;  2DBC A;  2QC7 A;  5D96 A;  4D73 A;  3CSH A;  3VWW A;  1U88 A;  3LYP A;  2L57 A;  2MYG A;  3SBC A;  3QAG A;  1TK5 B;  1GRX A;  5FT3 A;  2YPM A;  3W8J A;  1YF0 A;  1QFN A;  5D73 A;  5JCW A;  2YJH A;  4NV2 A;  3GA4 A;  1AXD A;  2IN3 A;  2WGR A;  2P5R A;  1M9B A;  5JWR B;  3UVT A;  3N5O A;  2JU5 A;  6GST A;  2AV4 A;  5G30 A;  2C1Y A;  5D9X A;  3WYW A;  22GS A;  3PIN A;  1A0F A;  3ZYW A;  2B5X A;  3M1G A;  3ERG A;  2WDU A;  4N11 A;  2FHE A;  2X8H A;  4HJ2 A;  3E0U A;  4MF5 A;  2HZF A;  4OO5 A;  4ECB A;  3HYP A;  3EU4 A;  1Y6E A;  17GS A;  4XCS A;  2GQK A;  3RPP A;  4IJ3 A;  4IGJ A;  4YAV A;  5CAX A;  1TDI A;  1DBY A;  1GSF A;  4WBR D;  2HXK A;  2L59 A; 
#chains in the Genus database with same CATH topology
 3UAR A;  5ECI B;  5IPG A;  2VCQ A;  3TKS A;  2YV9 A;  3EIN A;  1PSQ A;  3KTB A;  4JR4 A;  3DEX A;  4WET A;  3IV4 A;  5ECR B;  2OKA A;  4JR6 A;  1HQO A;  1VF3 A;  3O76 A;  1FVK A;  3GMF A;  3OR5 A;  1E2Y A;  4CDO A;  2AHE A;  2FGX A;  5AIS A;  1SEN A;  2L6D A;  5J5N A;  2RUE A;  2VAF A;  1EOG A;  1Z5Y E;  2LV3 A;  4O5Q A;  3APO A;  1K3L A;  5DCG A;  3TKQ A;  3NZN A;  1TU8 A;  5IOW A;  1SYR A;  1SJ6 A;  2YZU A;  5J9B A;  2YJ7 A;  3S9F A;  4ZB8 A;  4XS1 A;  1SU9 A;  3A2X A;  3J7Y k;  6GSS A;  1UA5 A;  1V40 A;  2LRT A;  1R5A A;  2XBQ A;  2VIM A;  3VI5 A;  5H5S A;  4PUA A;  3F6D A;  3EMP A;  2VOC A;  2JZR A;  4YQU A;  4KF9 A;  1MD3 A;  3D22 A;  5E4W A;  3VWV A;  2BMX A;  1GSQ A;  2R0P A;  2NPB A;  3QDN A;  4FIW A;  3KMN A;  4PX1 A;  3US3 A;  2FY6 A;  1KBN A;  3IR4 A;  2DC5 A;  1NM3 A;  3RDW A;  2RM6 A;  3HA9 A;  4GTU A;  4G2E A;  2N5B A;  3L0H A;  3HCZ A;  1SL2 B;  3ZIT A;  4ML1 A;  1OKT A;  4AJ6 A;  1WOU A;  2R0G A;  2GST A;  2IIY A;  2CVK A;  2OE1 A;  1GUH A;  4E8H A;  4WR5 A;  5IIZ A;  3UAP A;  1PA3 A;  4IJI A;  3L4N A;  5ECO B;  4PUF C;  1EGR A;  3VFI A;  4FYB A;  1M99 A;  5ELA A;  1ST9 A;  2G0F A;  2P5Q A;  5HFI A;  1PKZ A;  2PN8 A;  4V2L A;  3TJJ A;  2PVQ A;  2H1A A;  2R5G A;  3AY8 A;  4TRX A;  12GS A;  4BVX B;  1E6B A;  3GRX A;  5D93 A;  3UBK A;  4OFT A;  2K8S A;  2X8C A;  1FAA A;  4KND A;  3KIJ A;  3LOR A;  5GSS A;  1K0D A;  5DAL B;  4O32 A;  2HI7 A;  3QAV A;  2B5E A;  3GN3 A;  14GS A;  2NTO A;  1SD8 A;  3EPT A;  4NV5 A;  5HR2 A;  1DE2 A;  3D6I A;  1F9M A;  2H0H A;  1SKW B;  3TKR A;  5DQY A;  2IJY A;  4WEY A;  3IRA A;  2C3N A;  2KUC A;  3WT1 A;  5KN2 A;  4MDC A;  4MJE A;  2PER A;  4I5Q A;  4XS4 A;  2YCD A;  3TB2 A;  1AAZ A;  1K3Y A;  4HUA A;  4G9H A;  1XXU A;  1K0O A;  4HDE A;  5KN0 A;  1YKA A;  1GSY A;  4XRD A;  4O7H A;  1J0F A;  5F8B A;  3P2A A;  3CQF A;  3CSJ A;  5CRW A;  5CYY A;  2IMI A;  3CRT A;  1G6W A;  4X43 A;  1Z9H A;  1MDJ A;  3UBL A;  4JE1 A;  3H4K A;  1FVJ A;  1SL0 B;  3GFK A;  3UJ1 A;  3IHG A;  2TRC P;  3U6V A;  5D8I A;  3PGT A;  4YKG A;  3F8U A;  3A2W A;  1FOH A;  5B7C A;  1HNA A;  1K0M A;  3G7I A;  4O5U A;  3BD2 A;  2PVO C;  3ZLP A;  1S3R A;  3IE3 A;  5H5Q A;  1SD9 A;  4EIQ A;  3LSZ A;  3KEB A;  3L9U A;  5CRD A;  4LMW A;  4I8B A;  3ZML A;  1PN9 A;  3Q6O A;  3DKS A;  2R37 A;  1R5P A;  1TW9 A;  2LQQ A;  2YOI A;  3TJG A;  3CXG A;  1M9A A;  1F2E A;  2C0G A;  5D9W A;  1LBK A;  2FWG A;  2VL2 C;  3RBT A;  4XS4 B;  2IMF A;  4WR4 A;  2WS2 A;  1X9W B;  2IFQ A;  4E8E A;  2F9S A;  3A3T A;  5A4U A;  3QPM A;  4XTS A;  2HSH A;  2GLR A;  1U3A A;  1Y25 A;  2VLU A;  4BA7 A;  4L8E A;  1GSU A;  1T1V A;  3GIX A;  2OE3 A;  2WRT A;  3MAK A;  3RPN A;  4ML6 A;  2JL4 A;  2IME A;  1SYX A;  3KD0 A;  3VUR A;  3TKP A;  1XW5 A;  5J9C A;  3M0F A;  2GT5 A;  1V9W A;  2JZS A;  4ULX A;  2DIY A;  1NHY A;  5F05 A;  5ECH B;  2YWN A;  3LXZ A;  1OE7 A;  2VCT A;  2ZCT A;  2I81 A;  5J41 A;  4MZW A;  3UL3 A;  1F3A A;  4V2N A;  1JHB A;  3C7M A;  4LL4 B;  3F4S A;  3M9J A;  4BWS A;  4ZL8 A;  4HI7 A;  1BED A;  2C4J A;  5DAK A;  2VL3 A;  5IMV A;  1TI1 A;  1SK0 A;  3KP8 A;  6GSV A;  1WPI A;  1V58 A;  3UEM A;  1G0T A;  4LLR A;  1EEJ A;  1F6M C;  5B6M A;  1PKW A;  4PQH A;  4JU5 A;  2PGT A;  3ZVJ D;  2DJK A;  3O3T A;  4PQI A;  2REM A;  1FOV A;  1XBS A;  2IFQ B;  5ID2 A;  1X5C A;  3LEF A;  4NHZ A;  1NHO A;  4POM A;  3VPQ A;  2HNL A;  18GS A;  3FZ5 A;  4KB3 A;  1H75 A;  5IMD A;  5JCG A;  3DGQ A;  4BVY A;  2E2M A;  1LJR A;  2R6K A;  3F9U A;  4EL1 A;  4NAX A;  3KGK A;  1GWC A;  2K6V A;  2LRN A;  4N30 A;  4OFM A;  2QA1 A;  4MJA A;  5IMA A;  4OFN A;  4RI6 A;  1XOA A;  5ECP B;  3APQ A;  2LS5 A;  1R4W A;  3GL3 A;  4L5O A;  4YH2 A;  4EXJ A;  1M0U A;  1U87 A;  1PD2 1;  4Q5R A;  3IK9 A;  4TXO A;  1A2M A;  4J2F A;  4EF0 A;  1WJK A;  4FH8 A;  4TVE A;  4Z7X A;  5DAK B;  1WWJ A;  1GTA A;  4WXT A;  3C73 A;  4POL A;  4G0K A;  1TXX A;  3EU3 A;  1ZYN A;  2AB6 A;  1XWK A;  4J56 E;  4PUR A;  3QD9 A;  4EDY A;  1K0N A;  2J23 A;  3KMO A;  6GSY A;  4WF4 A;  2VCV A;  1ERW A;  2K8V A;  2L4Q A;  3TJB A;  2N5A A;  3CSI A;  4TW5 A;  3KJY A;  3H8Q A;  3HZ4 A;  1V98 A;  5ID2 B;  5LD0 A;  3TJK A;  5ECL B;  1KEB A;  2XC2 A;  4ISD A;  2FA4 A;  2CQ9 A;  4QL9 A;  5G1K A;  3LFL A;  1XOB A;  3F3Q A;  1FG4 A;  3L9S A;  2C80 A;  2PBJ A;  5IO2 A;  2MMO A;  1AQV A;  2KHP A;  1WMJ A;  2PMT A;  1B8X A;  3QMX A;  4F2I A;  4NHW A;  2KLX A;  3I9V 2;  3V1W A;  2B1L A;  2FCH A;  3C1R A;  4HEA 2;  3IHQ A;  3TUE A;  2H19 A;  4TXO B;  5ABR A;  2H74 A;  4A5P A;  1J9B A;  1WRY A;  4XRA A;  3FW2 A;  3GTU B;  2VD0 A;  4FQU A;  3F4T A;  1WE0 A;  1Z3E A;  3E3E A;  3GSS A;  2LNT A;  2YN1 A;  3HVN A;  3I69 A;  4POK A;  3C1S A;  5CRG A;  5CP1 A;  1FO5 A;  1S3C A;  4N10 A;  2GQM A;  2VM1 A;  1ML6 A;  2PPT A;  2PWJ A;  3BCI A;  3U5R E;  4K1F A;  1XIY A;  4AGS A;  5CO3 A;  2OBK A;  2F51 A;  4I2T A;  3MNG A;  2C3Q A;  4HZ2 A;  1I9D A;  1I5G A;  2G2Q A;  2IWT A;  4D73 B;  4TR3 A;  4IQA A;  3EC3 A;  5KN3 A;  5IO0 A;  2TIR A;  2H1D A;  5F07 A;  1FW1 A;  1C72 A;  4IP1 A;  1XPV A;  3G7J A;  1H4O A;  2H6Y A;  4LA1 A;  2ON5 A;  1ILO A;  1M3I A;  1PX7 A;  2K18 A;  5KOX A;  2JZT A;  2AJQ B;  5B6N A;  2HT9 A;  3I6A A;  2QKE A;  2M46 A;  3E9J B;  5ECN B;  2HRA A;  3H93 A;  6GSX A;  3HJP A;  1SK2 A;  1BX9 A;  2XBI A;  4ZBA A;  2EIQ A;  1TRW A;  3M9K A;  1PL1 A;  2HZE A;  4WF5 A;  1SL1 B;  1GNW A;  3R2Q A;  4JRR A;  1TTZ A;  2YV7 A;  2LKU A;  2CX4 A;  4GSN A;  4Z2T A;  1YEP A;  2GQL A;  2OE0 A;  1DUG A;  2YZH A;  2CA8 A;  3IXR A;  4K0G A;  1EOH A;  2H70 A;  1QQ2 A;  1OC3 A;  3G9B A;  2IL3 A;  2DSA A;  2X49 A;  4F03 A;  3HVS A;  1T4Z A;  3CRU A;  4ZBD A;  3EYT A;  5B8B A;  3BCK A;  4FYC A;  4MPF A;  3WD6 A;  4GXZ A;  1AQX A;  3QR6 A;  1W4V A;  1GTB A;  2FWF A;  3FR9 A;  2DMM A;  5D9T A;  3LWA A;  4OO4 A;  2HYX A;  2YWI A;  1NW2 A;  4ZXG A;  2WJU A;  1GTI A;  5HR0 A;  1Q4J A;  2MBT A;  3LYK A;  2GSQ A;  4PGT A;  4O92 A;  3RAZ A;  2FUG 2;  1AUC A;  2FLS A;  2V6K A;  4ACS A;  11GS A;  4GQC A;  2A4H A;  2JAC A;  1CQH A;  2OA7 A;  3WT2 A;  2GZY A;  2LJA A;  4RQX A;  4K2D A;  1J08 A;  1JLV A;  3FR3 A;  1T4Y A;  1BG5 A;  4KCE A;  5GZZ B;  3L9V A;  3H1N A;  2HZE B;  2A4V A;  1VRS D;  1PX6 A;  5KN1 A;  3LJR A;  1YY7 A;  1XFL A;  1ERV A;  2E2G A;  1TK8 B;  4IQ1 A;  3HD5 A;  3IPZ A;  4KW6 A;  2GS3 A;  1F3B A;  2JAD A;  2MMN A;  2CZ3 A;  5DBQ A;  3HJM A;  2V6O A;  3UVH A;  4XS6 A;  1TOF A;  1SKS B;  3KXO A;  4ZL9 A;  1GLP A;  3ZVJ A;  3DWV A;  3D21 A;  1B9Y C;  3QAW A;  3TOT A;  2O8V B;  2JSY A;  1XW6 A;  4IEL A;  2A2S A;  2DJ0 A;  1BYE A;  2H8L A;  5A5K A;  2ZNM A;  3TCO A;  1G7O A;  2DJ1 A;  3Q18 A;  4TR4 A;  4EDZ A;  2OJL A;  3ZZX A;  3PR8 A;  5EL8 A;  1PMT A;  1YQ1 A;  4K5R A;  2LST A;  2IPA A;  3F4R A;  3MIX A;  2C0E A;  4USS A;  3LQ7 A;  2NBS A;  1ZZY A;  4TR1 A;  4ZB9 A;  3KTL A;  3UMA A;  2GZP A;  4K6X A;  2DKH A;  3IA1 A;  5AIV A;  1YZX A;  5L71 A;  4MP4 A;  2WUL A;  2XPD A;  1XWG A;  2X99 A;  5JCU A;  4L0U A;  3LXT A;  2C8U A;  1A2L A;  4F0B A;  4MJC A;  2LEG A;  3GNJ A;  4GST A;  4MK3 A;  4KAE A;  4JED A;  3KH7 A;  3ME7 A;  4I6X A;  4ID0 A;  4HS1 A;  1BQ7 A;  1VF4 A;  4GRF A;  4N0V A;  5EVO A;  2LTK A;  3GV1 A;  1AIU A;  1ZYE A;  4KGI A;  4MMM A;  3FKF A;  1JZW A;  1USB A;  3CBU A;  2BTO T;  5ECS A;  1K3O A;  1LU4 A;  4KA0 A;  4GSS A;  2FA8 A;  1YEX A;  3ZIJ A;  1KTE A;  3KH9 A;  2B6M A;  4HZ4 A;  3PPU A;  2ON7 A;  4MJB A;  4OD7 A;  5F0G A;  4EE0 A;  2E0Q A;  2FWE A;  3FK8 A;  1TRS A;  1EGO A;  1ZYQ B;  5ELG A;  2H72 A;  5FWG A;  2H01 A;  5BRT A;  2VL9 A;  5GAN D;  3VLN A;  2HFD A;  3K8N A;  4KSO A;  1X5E A;  2VD1 A;  2A2P A;  3MYD A;  3ERF A;  4YQM A;  4KH7 A;  4Z2U A;  2OAD A;  4ZL7 A;  4BL7 A;  2NVL A;  4IN0 A;  1ABA A;  1DE1 A;  4TR1 B;  3GH6 A;  4GWR A;  3KP9 A;  1TP9 A;  3KCM A;  1PRX A;  1TU7 A;  2C0F A;  1YF1 A;  3QCP A;  4FYU A;  4DSS A;  3UIW A;  4MF7 A;  2H1B A;  2H73 A;  16GS A;  5IQY A;  5B8A A;  3TOU A;  3EWL A;  3QOU A;  1PL2 A;  1T8E B;  4K5S A;  4H86 A;  3GST A;  2H0I A;  1XVW A;  2H76 A;  5AN1 A;  3TKS C;  2MZC A;  1B9X C;  2GGT A;  1SK1 A;  2NDO A;  1MDK A;  3FZ9 A;  2DLX A;  5EY6 A;  1QUW A;  3LGC A;  1MDI A;  4PNF A;  1SJZ A;  3D5J A;  4OCE A;  3SWL A;  3TGZ A;  1YJ6 A;  2HRK A;  3A5I A;  3HVV A;  4XHM A;  1XZO A;  1URM A;  4RI7 A;  3W8S A;  5IOX A;  5GAP D;  3KM6 A;  2QA2 A;  1O8X A;  3GL5 A;  4K7O A;  4DVC A;  2HSY A;  2K9F A;  2LJK A;  3GX8 A;  1TRV A;  1PN0 A;  4MPG A;  2CVD A;  4MLY A;  2VLV A;  1JLW A;  1GLQ A;  1HNB A;  4QL7 A;  3GUR A;  4L0W A;  3F6F A;  5KEJ A;  4V1A p;  5F06 A;  1GUK A;  3DIE A;  3IBH A;  1YDK A;  5DDL A;  2CX3 A;  4ZIL A;  3FY7 A;  4BL7 B;  4MNN A;  1JFU A;  4MAB A;  3F63 A;  4L5L A;  2X8G A;  4G19 A;  2VUP A;  2VCW A;  5ECM B;  1SJI A;  3ZFB A;  3CMI A;  2XHF A;  1HNC A;  3QFB C;  3GKK A;  5C00 A;  4EC0 A;  3CTF A;  1W89 A;  3GUS A;  3G7Y A;  3IDV A;  4LL1 B;  5DVB A;  4BPY A;  3FRC A;  1XWC A;  1Z7P A;  1THX A;  3F0I A;  4YKF A;  2PUK C;  2H0G A;  1B4P A;  1M3J A;  5LCZ A;  1FHE A;  1U3I A;  4RQR A;  1AQW A;  4KDU A;  1RQM A;  4K9Z A;  4POB A;  5IMC A;  2MBS A;  1MD4 A;  2VL2 A;  19GS A;  2H6Z A;  1EV4 A;  4N0Z A;  2V1M A;  3P7X A;  1R7H A;  3GKX A;  3O6T A;  4BVY B;  2J9H A;  3FEU A;  1OC8 A;  1ZMA A;  1QGV A;  1A23 A;  3VWX A;  3D4T A;  5A4W A;  2FD3 A;  3GH9 A;  3ME8 A;  4G0L A;  2KP2 A;  3FHK A;  1BJX A;  1XWB A;  2V41 A;  3WGD A;  4EKZ A;  2I3Y A;  4G0I A;  4CY6 A;  4F82 A;  4KE3 A;  3TRP A;  1Z6N A;  1M2B A;  2M80 A;  4CHS A;  1ZOF A;  3A2V A;  3IC8 A;  4YQV A;  4HJM A;  4MH2 A;  2CVB A;  1GUM A;  2YNX A;  5BMU A;  3KZQ A;  1ACV A;  2QSI A;  3GHA A;  1B48 A;  3M3M A;  4MF6 A;  2DJJ A;  1UN2 A;  5C04 A;  1PFO A;  1NSW A;  5JWQ B;  4X4J A;  1QMV A;  5AIX A;  5DCH A;  3ERW A;  4K0N A;  4XIH A;  4ILF A;  2RLI A;  4Q5F A;  4K7I A;  1S3D A;  2ZUP A;  2AUV A;  1TRU A;  2WZ9 A;  1WIK A;  2WB9 A;  3FZ4 A;  4OCF A;  3UOM A;  1TI3 A;  4AF2 A;  3MWH A;  4PNG A;  2ES7 A;  3DML A;  1X0R A;  1OC9 A;  4X0X A;  4I2U A;  4MZB A;  2M72 A;  1TK0 B;  5DJM A;  2L5O A;  4KCA A;  5CRH A;  3DYR A;  1RK4 A;  5D9V A;  4NXI A;  2VCX A;  2YP6 A;  1TJD A;  4K2X A;  3HHV A;  3EMX A;  2O87 A;  1ERU A;  3DVX A;  2RUF A;  4BVX A;  2L5L A;  1CQG A;  4GQF A;  5G5E A;  3FZA A;  2FWH A;  3J7Y b;  1SKR B;  3I43 A;  5IMZ A;  2N5F A;  2GVP A;  2O85 A;  4IKH A;  1KNG A;  5DAL A;  3ZIV A;  4X1U A;  2HE3 A;  1VF2 A;  5HQP A;  4HU7 A;  5HR1 A;  3MDK A;  4ZBB A;  4IVF A;  4KX4 A;  2L6C A;  7GSS A;  3NIV A;  2I4A A;  3TKS E;  2R2J A;  2HRF A;  4F9Z A;  3NOF A;  3F3R A;  2GT6 A;  1TKD B;  2HRN A;  5EPF A;  4ZB6 A;  3ZL5 A;  2QGV A;  1GSS A;  3IOS A;  5G31 A;  2B5Y A;  5IM9 A;  5INY A;  1O85 A;  4HQZ A;  1Q98 A;  4KSM A;  2KP1 A;  1GTU A;  2H6X A;  1OE8 A;  5DJL A;  1A8Y A;  2DML A;  1M2A A;  3LG6 A;  3ZTL A;  1OC9 B;  4BIK A;  3TDG A;  4EVM A;  2GSR A;  4DSR A;  3ZFL A;  2R4V A;  2OAC A;  3HKR A;  2VCZ A;  1GNE A;  2LUS A;  4FO5 A;  5FHI A;  1XWA A;  3H79 A;  1EWX A;  4Q5Q A;  5COH A;  2DJ3 A;  4JBB A;  2TRX A;  3DRN A;  1JZD A;  4ICY A;  1X9M B;  10GS A;  3IAS 2;  2VO4 A;  2R0C A;  3ZRE A;  1AC1 A;  1HYU A;  3P8W A;  1XCC A;  2FNO A;  3TJF A;  2F8A A;  1K0C A;  2HLS A;  3IAM 2;  4K7N A;  2AAW A;  2R3X A;  3ZMK A;  1N8J A;  2CT6 A;  4NPB A;  3CYN A;  3PH9 A;  5J4U A;  2B7K A;  5IMF A;  3C71 A;  1M2D A;  1VGL A;  3CTG A;  2P0G A;  3GKM A;  1N2A A;  4AJ7 A;  3FYG A;  4CY8 A;  4TN8 A;  3HDC A;  2EIR A;  2LQO A;  4EO3 A;  5J3R A;  1M7T A;  1OVN A;  1MEK A;  1X5D A;  3VK9 A;  2H71 A;  2CAI A;  2VLT A;  1T00 A;  4IHU A;  4TOP A;  1PQN A;  2L4C A;  1QK8 A;  4NWY A;  1BAY A;  5G5F A;  4IS0 A;  4KDX A;  1K0B A;  3BJ5 A;  1FB0 A;  3VWU A;  4K8M A;  3APS A;  3DD3 A;  4WBJ A;  3EVI A;  4RUV A;  3GKN A;  1G7E A;  2X64 A;  2MMZ A;  4MCU A;  1JZR A;  4IW9 A;  1ZL9 A;  2GSS A;  1XW9 A;  1JZO A;  1WP0 A;  1EP8 A;  2DKI A;  2IMK A;  4DEJ A;  4J57 E;  3N9J A;  1V57 A;  1ZGN A;  2CAQ A;  1PGT A;  6GSW A;  20GS A;  3FMW A;  1GL8 A;  2YWM A;  4KDY A;  4DSQ A;  4ECI A;  2V32 A;  2H66 A;  4CW9 A;  1Z7R A;  3C8E A;  2C0D A;  3D0Z A;  4EIP A;  2WCI A;  4NMU A;  3TRX A;  2LRC A;  3HJO A;  3RHB A;  2EC4 A;  4TR0 A;  3ED3 A;  2B3S A;  3Q19 A;  1XVQ A;  5DQS A;  2I9H A;  4PTS A;  5LNK e;  2H75 A;  1T7P B;  1GP1 A;  5A4V A;  1A0R P;  2JSZ A;  2O89 A;  1OAZ A;  1EV9 A;  1QXH A;  2YAN A;  3L78 A;  2KOK A;  4YAP A;  4QQ7 A;  2H30 A;  2CZ2 A;  4Q5N A;  3BBY A;  5E59 A;  1FB6 A;  4F0C A;  5KOW A;  4GLT A;  2C3T A;  4MH3 A;  1O81 A;  3GX0 A;  2D2Z A;  2XPE A;  3EUR A;  3FR6 A;  1O73 A;  4ECC A;  2B1K A;  9GSS A;  3D4M A;  2F3M A;  3P90 A;  13GS A;  4HU9 A;  3IK7 A;  3GYK A;  4PXO A;  2OBI A;  1HD2 A;  5IPH A;  1O7U A;  1ZYP A;  5G1L A;  1OYJ A;  2F8F A;  5CNW A;  1GUL A;  5ECK B;  2MMA A;  2A2R A;  3VI7 A;  1YKC A;  1VF1 A;  1UC7 A;  2LNS A;  1U6T A;  1IYI A;  4V2M A;  1V2A A;  5ENU A;  1A2J A;  2GTU A;  2HSM A;  1GH2 A;  2IMD A;  3ZRD A;  1EZK A;  4TXV A;  4KUN A;  2X4A A;  2YWO A;  1R26 A;  4G10 A;  2ALB A;  1EP7 A;  5G2Z A;  1O8W A;  3DXB A;  1UVZ A;  4Z2R A;  2DIZ A;  2H1G A;  2P31 A;  1EEM A;  5H5R A;  1K0A A;  1T3B A;  2I1U A;  4PQ1 A;  2O7K A;  3HXS A;  4BWQ A;  4P3Y B;  3IC4 A;  2CV4 A;  4GF0 A;  3HZ8 A;  1S3A A;  4HOJ A;  1X9S B;  1Z6M A;  1DSB A;  3RHC A;  4TKY A;  2BJX A;  3R3E A;  4IP6 A;  1AW9 A;  5ECQ B;  4OWY A;  5CRE A;  3QFA C;  4ECJ A;  5GST A;  4MZC A;  3TRQ A;  4V1A g;  8GSS A;  2PU9 C;  4MA9 A;  2V2G A;  5HR3 A;  3WGE A;  2UZ8 A;  3EE2 A;  1ON4 A;  2WFC A;  4O5R A;  3W6G A;  2GZZ A;  1F37 A;  6GSU A;  3Q74 A;  3WGX A;  2GDR A;  4EUY A;  1THO A;  3HY2 A;  1G6Y A;  2E7P A;  4DSS B;  1XG8 A;  3JCM L;  3VPT A;  2Z9S A;  4IBP A;  4JZQ A;  1A24 A;  4GCI A;  4HQS A;  4AJ8 A;  1MTC A;  3GTU A;  4OMV A;  1IYH A;  3HVX A;  1ERT A;  4LMV A;  5AGY A;  2RII A;  2LJR A;  2DJ2 A;  1ZCP A;  5HFK A;  4HSC X;  4ZIJ A;  5HFG A;  2VM2 A;  4WKW A;  4I97 A;  1GSD A;  1B4Q A;  3ISO A;  2B7J A;  5JWO B;  2RM5 A;  1OKD A;  1RW1 A;  3DVW A;  3M8N A;  2EIO A;  3BOA A;  1O6J A;  1GSE A;  3A5W A;  3MSZ A;  1A8L A;  2AYT A;  2DBC A;  2QC7 A;  5D96 A;  4D73 A;  3LW9 A;  3CSH A;  3VWW A;  1U88 A;  3LYP A;  2L57 A;  2MYG A;  3SBC A;  3QAG A;  1TK5 B;  1GRX A;  5FT3 A;  2YPM A;  3W8J A;  1YF0 A;  1QFN A;  5D73 A;  5JCW A;  2YJH A;  4NV2 A;  3GA4 A;  1AXD A;  2IN3 A;  2WGR A;  2P5R A;  1M9B A;  5JWR B;  3UVT A;  3N5O A;  2JU5 A;  6GST A;  2AV4 A;  5G30 A;  2C1Y A;  5D9X A;  3WYW A;  22GS A;  3PIN A;  1A0F A;  3ZYW A;  2B5X A;  3M1G A;  3ERG A;  2WDU A;  4N11 A;  2FHE A;  2X8H A;  4HJ2 A;  3E0U A;  4MF5 A;  2HZF A;  4OO5 A;  4ECB A;  3HYP A;  3EU4 A;  1Y6E A;  17GS A;  4XCS A;  2GQK A;  3RPP A;  4IJ3 A;  4IGJ A;  4YAV A;  5CAX A;  1TDI A;  1DBY A;  1GSF A;  4WBR D;  2HXK A;  2L59 A; 
#chains in the Genus database with same CATH homology
 3UAR A;  5ECI B;  5IPG A;  2VCQ A;  3TKS A;  2YV9 A;  3EIN A;  1PSQ A;  3KTB A;  4JR4 A;  3DEX A;  4WET A;  3IV4 A;  5ECR B;  2OKA A;  4JR6 A;  1HQO A;  1VF3 A;  3O76 A;  1FVK A;  3GMF A;  3OR5 A;  1E2Y A;  4CDO A;  2AHE A;  2FGX A;  5AIS A;  1SEN A;  2L6D A;  5J5N A;  2RUE A;  2VAF A;  1EOG A;  1Z5Y E;  2LV3 A;  4O5Q A;  3APO A;  1K3L A;  5DCG A;  3TKQ A;  3NZN A;  1TU8 A;  5IOW A;  1SYR A;  1SJ6 A;  2YZU A;  5J9B A;  2YJ7 A;  3S9F A;  4ZB8 A;  4XS1 A;  1SU9 A;  3A2X A;  3J7Y k;  6GSS A;  1UA5 A;  1V40 A;  2LRT A;  1R5A A;  2XBQ A;  2VIM A;  3VI5 A;  5H5S A;  4PUA A;  3F6D A;  3EMP A;  2VOC A;  2JZR A;  4YQU A;  4KF9 A;  1MD3 A;  3D22 A;  5E4W A;  3VWV A;  2BMX A;  1GSQ A;  2R0P A;  2NPB A;  3QDN A;  4FIW A;  3KMN A;  4PX1 A;  3US3 A;  2FY6 A;  1KBN A;  3IR4 A;  2DC5 A;  1NM3 A;  3RDW A;  2RM6 A;  3HA9 A;  4GTU A;  4G2E A;  2N5B A;  3L0H A;  3HCZ A;  1SL2 B;  3ZIT A;  4ML1 A;  1OKT A;  4AJ6 A;  1WOU A;  2R0G A;  2GST A;  2IIY A;  2CVK A;  2OE1 A;  1GUH A;  4E8H A;  4WR5 A;  5IIZ A;  3UAP A;  1PA3 A;  4IJI A;  3L4N A;  5ECO B;  4PUF C;  1EGR A;  3VFI A;  4FYB A;  1M99 A;  5ELA A;  1ST9 A;  2G0F A;  2P5Q A;  5HFI A;  1PKZ A;  2PN8 A;  4V2L A;  3TJJ A;  2PVQ A;  2H1A A;  2R5G A;  3AY8 A;  4TRX A;  12GS A;  4BVX B;  1E6B A;  3GRX A;  5D93 A;  3UBK A;  4OFT A;  2K8S A;  2X8C A;  1FAA A;  4KND A;  3KIJ A;  3LOR A;  5GSS A;  1K0D A;  5DAL B;  4O32 A;  2HI7 A;  3QAV A;  2B5E A;  3GN3 A;  14GS A;  2NTO A;  1SD8 A;  3EPT A;  4NV5 A;  5HR2 A;  1DE2 A;  3D6I A;  1F9M A;  2H0H A;  1SKW B;  3TKR A;  5DQY A;  2IJY A;  4WEY A;  3IRA A;  2C3N A;  2KUC A;  3WT1 A;  5KN2 A;  4MDC A;  4MJE A;  2PER A;  4I5Q A;  4XS4 A;  2YCD A;  3TB2 A;  1AAZ A;  1K3Y A;  4HUA A;  4G9H A;  1XXU A;  1K0O A;  4HDE A;  5KN0 A;  1YKA A;  1GSY A;  4XRD A;  4O7H A;  1J0F A;  5F8B A;  3P2A A;  3CSJ A;  5CRW A;  5CYY A;  2IMI A;  3CRT A;  1G6W A;  4X43 A;  1Z9H A;  1MDJ A;  3UBL A;  4JE1 A;  3H4K A;  1FVJ A;  1SL0 B;  3GFK A;  3UJ1 A;  3IHG A;  2TRC P;  3U6V A;  5D8I A;  3PGT A;  4YKG A;  3F8U A;  3A2W A;  1FOH A;  5B7C A;  1HNA A;  1K0M A;  3G7I A;  4O5U A;  3BD2 A;  2PVO C;  3ZLP A;  3IE3 A;  5H5Q A;  1SD9 A;  4EIQ A;  3LSZ A;  3KEB A;  3L9U A;  5CRD A;  4LMW A;  4I8B A;  3ZML A;  1PN9 A;  3Q6O A;  3DKS A;  2R37 A;  1R5P A;  1TW9 A;  2LQQ A;  2YOI A;  3TJG A;  3CXG A;  1M9A A;  1F2E A;  2C0G A;  5D9W A;  1LBK A;  2FWG A;  2VL2 C;  3RBT A;  4XS4 B;  2IMF A;  4WR4 A;  2WS2 A;  1X9W B;  2IFQ A;  4E8E A;  2F9S A;  3A3T A;  5A4U A;  3QPM A;  4XTS A;  2HSH A;  2GLR A;  1U3A A;  1Y25 A;  2VLU A;  4BA7 A;  4L8E A;  1GSU A;  1T1V A;  3GIX A;  2OE3 A;  2WRT A;  3MAK A;  3RPN A;  4ML6 A;  2JL4 A;  2IME A;  1SYX A;  3KD0 A;  3VUR A;  3TKP A;  1XW5 A;  5J9C A;  3M0F A;  2GT5 A;  1V9W A;  2JZS A;  4ULX A;  2DIY A;  1NHY A;  5F05 A;  5ECH B;  2YWN A;  3LXZ A;  1OE7 A;  2VCT A;  2ZCT A;  2I81 A;  5J41 A;  4MZW A;  3UL3 A;  1F3A A;  4V2N A;  1JHB A;  3C7M A;  4LL4 B;  3F4S A;  3M9J A;  4BWS A;  4ZL8 A;  4HI7 A;  1BED A;  2C4J A;  5DAK A;  2VL3 A;  5IMV A;  1TI1 A;  1SK0 A;  3KP8 A;  6GSV A;  1WPI A;  1V58 A;  3UEM A;  1G0T A;  4LLR A;  1EEJ A;  1F6M C;  5B6M A;  1PKW A;  4PQH A;  4JU5 A;  2PGT A;  3ZVJ D;  2DJK A;  3O3T A;  4PQI A;  2REM A;  1FOV A;  1XBS A;  2IFQ B;  5ID2 A;  1X5C A;  3LEF A;  4NHZ A;  1NHO A;  4POM A;  3VPQ A;  2HNL A;  18GS A;  3FZ5 A;  4KB3 A;  1H75 A;  5IMD A;  5JCG A;  3DGQ A;  4BVY A;  2E2M A;  1LJR A;  2R6K A;  3F9U A;  4EL1 A;  4NAX A;  3KGK A;  1GWC A;  2K6V A;  2LRN A;  4N30 A;  4OFM A;  2QA1 A;  4MJA A;  5IMA A;  4OFN A;  4RI6 A;  1XOA A;  5ECP B;  3APQ A;  2LS5 A;  1R4W A;  3GL3 A;  4L5O A;  4YH2 A;  4EXJ A;  1M0U A;  1U87 A;  1PD2 1;  4Q5R A;  3IK9 A;  4TXO A;  1A2M A;  4J2F A;  4EF0 A;  1WJK A;  4FH8 A;  4TVE A;  4Z7X A;  5DAK B;  1WWJ A;  1GTA A;  4WXT A;  3C73 A;  4POL A;  4G0K A;  1TXX A;  3EU3 A;  1ZYN A;  2AB6 A;  1XWK A;  4J56 E;  4PUR A;  3QD9 A;  4EDY A;  1K0N A;  2J23 A;  3KMO A;  6GSY A;  4WF4 A;  2VCV A;  1ERW A;  2K8V A;  2L4Q A;  3TJB A;  2N5A A;  3CSI A;  4TW5 A;  3KJY A;  3H8Q A;  3HZ4 A;  1V98 A;  5ID2 B;  5LD0 A;  3TJK A;  5ECL B;  1KEB A;  2XC2 A;  4ISD A;  2FA4 A;  2CQ9 A;  4QL9 A;  5G1K A;  3LFL A;  1XOB A;  3F3Q A;  1FG4 A;  3L9S A;  2C80 A;  2PBJ A;  5IO2 A;  2MMO A;  1AQV A;  2KHP A;  1WMJ A;  2PMT A;  1B8X A;  3QMX A;  4F2I A;  4NHW A;  2KLX A;  3I9V 2;  3V1W A;  2B1L A;  2FCH A;  3C1R A;  4HEA 2;  3IHQ A;  3TUE A;  2H19 A;  4TXO B;  5ABR A;  2H74 A;  4A5P A;  1J9B A;  1WRY A;  4XRA A;  3FW2 A;  3GTU B;  2VD0 A;  4FQU A;  3F4T A;  1WE0 A;  1Z3E A;  3E3E A;  3GSS A;  2LNT A;  2YN1 A;  3I69 A;  4POK A;  3C1S A;  5CRG A;  5CP1 A;  1FO5 A;  1S3C A;  4N10 A;  2GQM A;  2VM1 A;  1ML6 A;  2PPT A;  2PWJ A;  3BCI A;  3U5R E;  4K1F A;  1XIY A;  4AGS A;  5CO3 A;  2OBK A;  2F51 A;  4I2T A;  3MNG A;  2C3Q A;  4HZ2 A;  1I9D A;  1I5G A;  2G2Q A;  2IWT A;  4D73 B;  4TR3 A;  4IQA A;  3EC3 A;  5KN3 A;  5IO0 A;  2TIR A;  2H1D A;  5F07 A;  1FW1 A;  1C72 A;  4IP1 A;  1XPV A;  3G7J A;  1H4O A;  2H6Y A;  4LA1 A;  2ON5 A;  1ILO A;  1PX7 A;  2K18 A;  5KOX A;  2JZT A;  2AJQ B;  5B6N A;  2HT9 A;  3I6A A;  2QKE A;  2M46 A;  3E9J B;  5ECN B;  2HRA A;  3H93 A;  6GSX A;  3HJP A;  1SK2 A;  1BX9 A;  2XBI A;  4ZBA A;  2EIQ A;  1TRW A;  3M9K A;  1PL1 A;  2HZE A;  4WF5 A;  1SL1 B;  1GNW A;  3R2Q A;  4JRR A;  1TTZ A;  2YV7 A;  2LKU A;  2CX4 A;  4GSN A;  4Z2T A;  1YEP A;  2GQL A;  2OE0 A;  1DUG A;  2YZH A;  2CA8 A;  3IXR A;  4K0G A;  1EOH A;  2H70 A;  1QQ2 A;  1OC3 A;  3G9B A;  2IL3 A;  2DSA A;  2X49 A;  4F03 A;  3HVS A;  1T4Z A;  3CRU A;  4ZBD A;  3EYT A;  5B8B A;  3BCK A;  4FYC A;  4MPF A;  3WD6 A;  4GXZ A;  1AQX A;  3QR6 A;  1W4V A;  1GTB A;  2FWF A;  3FR9 A;  2DMM A;  5D9T A;  3LWA A;  4OO4 A;  2HYX A;  2YWI A;  1NW2 A;  4ZXG A;  2WJU A;  1GTI A;  5HR0 A;  1Q4J A;  2MBT A;  3LYK A;  2GSQ A;  4PGT A;  4O92 A;  3RAZ A;  2FUG 2;  1AUC A;  2FLS A;  2V6K A;  4ACS A;  11GS A;  4GQC A;  2A4H A;  2JAC A;  1CQH A;  2OA7 A;  3WT2 A;  2GZY A;  2LJA A;  4RQX A;  4K2D A;  1J08 A;  1JLV A;  3FR3 A;  1T4Y A;  1BG5 A;  4KCE A;  5GZZ B;  3L9V A;  3H1N A;  2HZE B;  2A4V A;  1VRS D;  1PX6 A;  5KN1 A;  3LJR A;  1YY7 A;  1XFL A;  1ERV A;  2E2G A;  1TK8 B;  4IQ1 A;  3HD5 A;  3IPZ A;  4KW6 A;  2GS3 A;  1F3B A;  2JAD A;  2MMN A;  2CZ3 A;  5DBQ A;  3HJM A;  2V6O A;  3UVH A;  4XS6 A;  1TOF A;  1SKS B;  3KXO A;  4ZL9 A;  1GLP A;  3ZVJ A;  3DWV A;  3D21 A;  1B9Y C;  3QAW A;  3TOT A;  2O8V B;  2JSY A;  1XW6 A;  4IEL A;  2A2S A;  2DJ0 A;  1BYE A;  2H8L A;  5A5K A;  2ZNM A;  3TCO A;  1G7O A;  2DJ1 A;  3Q18 A;  4TR4 A;  4EDZ A;  2OJL A;  3ZZX A;  3PR8 A;  5EL8 A;  1PMT A;  1YQ1 A;  4K5R A;  2LST A;  2IPA A;  3F4R A;  3MIX A;  2C0E A;  4USS A;  3LQ7 A;  2NBS A;  1ZZY A;  4TR1 A;  4ZB9 A;  3KTL A;  3UMA A;  2GZP A;  4K6X A;  2DKH A;  3IA1 A;  5AIV A;  1YZX A;  5L71 A;  4MP4 A;  2WUL A;  2XPD A;  1XWG A;  2X99 A;  5JCU A;  4L0U A;  3LXT A;  2C8U A;  1A2L A;  4F0B A;  4MJC A;  2LEG A;  3GNJ A;  4GST A;  4MK3 A;  4KAE A;  4JED A;  3KH7 A;  3ME7 A;  4I6X A;  4ID0 A;  4HS1 A;  1BQ7 A;  1VF4 A;  4GRF A;  4N0V A;  5EVO A;  2LTK A;  3GV1 A;  1AIU A;  1ZYE A;  4KGI A;  4MMM A;  3FKF A;  1JZW A;  1USB A;  3CBU A;  2BTO T;  5ECS A;  1K3O A;  1LU4 A;  4KA0 A;  4GSS A;  2FA8 A;  1YEX A;  3ZIJ A;  1KTE A;  3KH9 A;  2B6M A;  4HZ4 A;  3PPU A;  2ON7 A;  4MJB A;  4OD7 A;  5F0G A;  4EE0 A;  2E0Q A;  2FWE A;  3FK8 A;  1TRS A;  1EGO A;  1ZYQ B;  5ELG A;  2H72 A;  5FWG A;  2H01 A;  5BRT A;  2VL9 A;  5GAN D;  3VLN A;  2HFD A;  3K8N A;  4KSO A;  1X5E A;  2VD1 A;  2A2P A;  3MYD A;  3ERF A;  4YQM A;  4KH7 A;  4Z2U A;  2OAD A;  4ZL7 A;  4BL7 A;  2NVL A;  4IN0 A;  1ABA A;  1DE1 A;  4TR1 B;  3GH6 A;  4GWR A;  3KP9 A;  1TP9 A;  3KCM A;  1PRX A;  1TU7 A;  2C0F A;  1YF1 A;  3QCP A;  4FYU A;  4DSS A;  3UIW A;  4MF7 A;  2H1B A;  2H73 A;  16GS A;  5IQY A;  5B8A A;  3TOU A;  3EWL A;  3QOU A;  1PL2 A;  1T8E B;  4K5S A;  4H86 A;  3GST A;  2H0I A;  1XVW A;  2H76 A;  5AN1 A;  3TKS C;  2MZC A;  1B9X C;  2GGT A;  1SK1 A;  2NDO A;  1MDK A;  3FZ9 A;  2DLX A;  5EY6 A;  1QUW A;  3LGC A;  1MDI A;  4PNF A;  1SJZ A;  3D5J A;  4OCE A;  3SWL A;  3TGZ A;  1YJ6 A;  2HRK A;  3A5I A;  3HVV A;  4XHM A;  1XZO A;  1URM A;  4RI7 A;  3W8S A;  5IOX A;  5GAP D;  3KM6 A;  2QA2 A;  1O8X A;  3GL5 A;  4K7O A;  4DVC A;  2HSY A;  2K9F A;  2LJK A;  3GX8 A;  1TRV A;  1PN0 A;  4MPG A;  2CVD A;  4MLY A;  2VLV A;  1JLW A;  1GLQ A;  1HNB A;  4QL7 A;  3GUR A;  4L0W A;  3F6F A;  5KEJ A;  4V1A p;  5F06 A;  1GUK A;  3DIE A;  3IBH A;  1YDK A;  5DDL A;  2CX3 A;  4ZIL A;  3FY7 A;  4BL7 B;  4MNN A;  1JFU A;  4MAB A;  3F63 A;  4L5L A;  2X8G A;  4G19 A;  2VUP A;  2VCW A;  5ECM B;  1SJI A;  3ZFB A;  3CMI A;  2XHF A;  1HNC A;  3QFB C;  3GKK A;  5C00 A;  4EC0 A;  3CTF A;  1W89 A;  3GUS A;  3G7Y A;  3IDV A;  4LL1 B;  5DVB A;  4BPY A;  3FRC A;  1XWC A;  1Z7P A;  1THX A;  3F0I A;  4YKF A;  2PUK C;  2H0G A;  1B4P A;  5LCZ A;  1FHE A;  1U3I A;  4RQR A;  1AQW A;  4KDU A;  1RQM A;  4K9Z A;  4POB A;  5IMC A;  2MBS A;  1MD4 A;  2VL2 A;  19GS A;  2H6Z A;  1EV4 A;  4N0Z A;  2V1M A;  3P7X A;  1R7H A;  3GKX A;  3O6T A;  4BVY B;  2J9H A;  3FEU A;  1OC8 A;  1ZMA A;  1QGV A;  1A23 A;  3VWX A;  3D4T A;  5A4W A;  2FD3 A;  3GH9 A;  3ME8 A;  4G0L A;  2KP2 A;  3FHK A;  1BJX A;  1XWB A;  2V41 A;  3WGD A;  4EKZ A;  2I3Y A;  4G0I A;  4CY6 A;  4F82 A;  4KE3 A;  3TRP A;  1Z6N A;  1M2B A;  2M80 A;  4CHS A;  1ZOF A;  3A2V A;  3IC8 A;  4YQV A;  4HJM A;  4MH2 A;  2CVB A;  1GUM A;  2YNX A;  5BMU A;  3KZQ A;  1ACV A;  2QSI A;  3GHA A;  1B48 A;  3M3M A;  4MF6 A;  2DJJ A;  1UN2 A;  5C04 A;  1NSW A;  5JWQ B;  4X4J A;  1QMV A;  5AIX A;  5DCH A;  3ERW A;  4K0N A;  4XIH A;  4ILF A;  2RLI A;  4Q5F A;  4K7I A;  1S3D A;  2ZUP A;  2AUV A;  1TRU A;  2WZ9 A;  1WIK A;  2WB9 A;  3FZ4 A;  4OCF A;  3UOM A;  1TI3 A;  4AF2 A;  3MWH A;  4PNG A;  2ES7 A;  3DML A;  1X0R A;  1OC9 A;  4X0X A;  4I2U A;  4MZB A;  2M72 A;  1TK0 B;  5DJM A;  2L5O A;  4KCA A;  5CRH A;  3DYR A;  1RK4 A;  5D9V A;  4NXI A;  2VCX A;  2YP6 A;  1TJD A;  4K2X A;  3HHV A;  3EMX A;  2O87 A;  1ERU A;  3DVX A;  2RUF A;  4BVX A;  2L5L A;  1CQG A;  4GQF A;  5G5E A;  3FZA A;  2FWH A;  3J7Y b;  1SKR B;  3I43 A;  5IMZ A;  2N5F A;  2GVP A;  2O85 A;  4IKH A;  1KNG A;  5DAL A;  3ZIV A;  4X1U A;  2HE3 A;  1VF2 A;  5HQP A;  4HU7 A;  5HR1 A;  3MDK A;  4ZBB A;  4IVF A;  4KX4 A;  2L6C A;  7GSS A;  3NIV A;  2I4A A;  3TKS E;  2R2J A;  2HRF A;  4F9Z A;  3NOF A;  3F3R A;  2GT6 A;  1TKD B;  2HRN A;  5EPF A;  4ZB6 A;  3ZL5 A;  2QGV A;  1GSS A;  3IOS A;  5G31 A;  2B5Y A;  5IM9 A;  5INY A;  1O85 A;  4HQZ A;  1Q98 A;  4KSM A;  2KP1 A;  1GTU A;  2H6X A;  1OE8 A;  5DJL A;  1A8Y A;  2DML A;  1M2A A;  3LG6 A;  3ZTL A;  1OC9 B;  3TDG A;  4EVM A;  2GSR A;  4DSR A;  3ZFL A;  2R4V A;  2OAC A;  3HKR A;  2VCZ A;  1GNE A;  2LUS A;  4FO5 A;  5FHI A;  1XWA A;  3H79 A;  1EWX A;  4Q5Q A;  5COH A;  2DJ3 A;  4JBB A;  2TRX A;  3DRN A;  1JZD A;  4ICY A;  1X9M B;  10GS A;  3IAS 2;  2VO4 A;  2R0C A;  3ZRE A;  1AC1 A;  1HYU A;  3P8W A;  1XCC A;  2FNO A;  3TJF A;  2F8A A;  1K0C A;  2HLS A;  3IAM 2;  4K7N A;  2AAW A;  2R3X A;  3ZMK A;  1N8J A;  2CT6 A;  4NPB A;  3CYN A;  3PH9 A;  5J4U A;  2B7K A;  5IMF A;  3C71 A;  1M2D A;  1VGL A;  3CTG A;  2P0G A;  3GKM A;  1N2A A;  4AJ7 A;  3FYG A;  4CY8 A;  4TN8 A;  3HDC A;  2EIR A;  2LQO A;  4EO3 A;  5J3R A;  1M7T A;  1OVN A;  1MEK A;  1X5D A;  3VK9 A;  2H71 A;  2CAI A;  2VLT A;  1T00 A;  4IHU A;  4TOP A;  1PQN A;  2L4C A;  1QK8 A;  4NWY A;  1BAY A;  5G5F A;  4IS0 A;  4KDX A;  1K0B A;  3BJ5 A;  1FB0 A;  3VWU A;  4K8M A;  3APS A;  3DD3 A;  4WBJ A;  3EVI A;  4RUV A;  3GKN A;  1G7E A;  2X64 A;  2MMZ A;  4MCU A;  1JZR A;  4IW9 A;  1ZL9 A;  2GSS A;  1XW9 A;  1JZO A;  1WP0 A;  1EP8 A;  2DKI A;  2IMK A;  4DEJ A;  4J57 E;  3N9J A;  1V57 A;  1ZGN A;  2CAQ A;  1PGT A;  6GSW A;  20GS A;  3FMW A;  1GL8 A;  2YWM A;  4KDY A;  4DSQ A;  4ECI A;  2V32 A;  2H66 A;  4CW9 A;  1Z7R A;  3C8E A;  2C0D A;  3D0Z A;  4EIP A;  2WCI A;  4NMU A;  3TRX A;  2LRC A;  3HJO A;  3RHB A;  2EC4 A;  4TR0 A;  3ED3 A;  2B3S A;  3Q19 A;  1XVQ A;  5DQS A;  2I9H A;  4PTS A;  5LNK e;  2H75 A;  1T7P B;  1GP1 A;  5A4V A;  1A0R P;  2JSZ A;  2O89 A;  1OAZ A;  1EV9 A;  1QXH A;  2YAN A;  3L78 A;  2KOK A;  4YAP A;  4QQ7 A;  2H30 A;  2CZ2 A;  4Q5N A;  3BBY A;  5E59 A;  1FB6 A;  4F0C A;  5KOW A;  4GLT A;  2C3T A;  4MH3 A;  1O81 A;  3GX0 A;  2D2Z A;  2XPE A;  3EUR A;  3FR6 A;  1O73 A;  4ECC A;  2B1K A;  9GSS A;  3D4M A;  2F3M A;  3P90 A;  13GS A;  4HU9 A;  3IK7 A;  3GYK A;  4PXO A;  2OBI A;  1HD2 A;  5IPH A;  1O7U A;  1ZYP A;  5G1L A;  1OYJ A;  2F8F A;  5CNW A;  1GUL A;  5ECK B;  2MMA A;  2A2R A;  3VI7 A;  1YKC A;  1VF1 A;  1UC7 A;  2LNS A;  1U6T A;  1IYI A;  4V2M A;  1V2A A;  5ENU A;  1A2J A;  2GTU A;  2HSM A;  1GH2 A;  2IMD A;  3ZRD A;  1EZK A;  4TXV A;  4KUN A;  2X4A A;  2YWO A;  1R26 A;  4G10 A;  2ALB A;  1EP7 A;  5G2Z A;  1O8W A;  3DXB A;  1UVZ A;  4Z2R A;  2DIZ A;  2H1G A;  2P31 A;  1EEM A;  5H5R A;  1K0A A;  1T3B A;  2I1U A;  4PQ1 A;  2O7K A;  3HXS A;  4BWQ A;  4P3Y B;  3IC4 A;  2CV4 A;  4GF0 A;  3HZ8 A;  1S3A A;  4HOJ A;  1X9S B;  1Z6M A;  1DSB A;  3RHC A;  4TKY A;  2BJX A;  3R3E A;  4IP6 A;  1AW9 A;  5ECQ B;  4OWY A;  5CRE A;  3QFA C;  4ECJ A;  5GST A;  4MZC A;  3TRQ A;  4V1A g;  8GSS A;  2PU9 C;  4MA9 A;  2V2G A;  5HR3 A;  3WGE A;  2UZ8 A;  3EE2 A;  1ON4 A;  2WFC A;  4O5R A;  3W6G A;  2GZZ A;  1F37 A;  6GSU A;  3Q74 A;  3WGX A;  2GDR A;  4EUY A;  1THO A;  3HY2 A;  1G6Y A;  2E7P A;  4DSS B;  3JCM L;  3VPT A;  2Z9S A;  4IBP A;  4JZQ A;  1A24 A;  4GCI A;  4HQS A;  4AJ8 A;  1MTC A;  3GTU A;  4OMV A;  1IYH A;  3HVX A;  1ERT A;  4LMV A;  5AGY A;  2RII A;  2LJR A;  2DJ2 A;  1ZCP A;  5HFK A;  4ZIJ A;  5HFG A;  2VM2 A;  4WKW A;  4I97 A;  1GSD A;  1B4Q A;  3ISO A;  2B7J A;  5JWO B;  2RM5 A;  1OKD A;  1RW1 A;  3DVW A;  3M8N A;  2EIO A;  3BOA A;  1O6J A;  1GSE A;  3A5W A;  3MSZ A;  1A8L A;  2AYT A;  2DBC A;  2QC7 A;  5D96 A;  4D73 A;  3LW9 A;  3CSH A;  3VWW A;  1U88 A;  3LYP A;  2L57 A;  2MYG A;  3SBC A;  3QAG A;  1TK5 B;  1GRX A;  5FT3 A;  2YPM A;  3W8J A;  1YF0 A;  1QFN A;  5D73 A;  5JCW A;  2YJH A;  4NV2 A;  3GA4 A;  1AXD A;  2IN3 A;  2WGR A;  2P5R A;  1M9B A;  5JWR B;  3UVT A;  3N5O A;  2JU5 A;  6GST A;  2AV4 A;  5G30 A;  2C1Y A;  5D9X A;  3WYW A;  22GS A;  3PIN A;  1A0F A;  3ZYW A;  2B5X A;  3M1G A;  3ERG A;  2WDU A;  4N11 A;  2FHE A;  2X8H A;  4HJ2 A;  3E0U A;  4MF5 A;  2HZF A;  4OO5 A;  4ECB A;  3HYP A;  3EU4 A;  1Y6E A;  17GS A;  4XCS A;  2GQK A;  3RPP A;  4IJ3 A;  4IGJ A;  4YAV A;  5CAX A;  1TDI A;  1DBY A;  1GSF A;  4WBR D;  2HXK A;  2L59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...