2HFDA

Nmr structure of protein hydrogenase-1 operon protein hyae from escherichia coli: northeast structural genomics consortium target er415
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
MSNDTPFDALWQRMLARGWTPVSESRLDDWLTQAPDGVVLLSSDPKRTPEVSDNPVMIGELLREFPDYTWQVAIADLEQSEAIGDRFGVFRFPATLVFTGGNYRGVLNGIHPWAELINLMRGLVEPQQERAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 operon protein hyaE
publication title Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical thioredoxin active site sequence motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 30
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hfdA00
1JZDA 1JFUA 1PQNA 3GX0A 5ECMB 3VURA 1SENA 1EGRA 4MA9A 2L59A 2LTKA 1H4OA 1AXDA 1T4ZA 2MMZA 2YZHA 4PNFA 2NTOA 3F3RA 2IMIA 3CYNA 1SKWB 3UBLA 2L57A 1GNWA 5AGYA 1YEXA 5JCUA 4E8EA 5DJLA 1M9AA 1HNBA 3ZMKA 3EE2A 4IQAA 3HHVA 4O5RA 2JSZA 4ECJA 2KOKA 3FYGA 4AJ6A 1T1VA 2M46A 4HI7A 2YJHA 3FZ5A 4FYCA 5HR0A 3FR9A 1NHYA 4JR6A 2YWIA 2PPTA 2RUEA 4NAXA 2VD0A 3F0IA 1OC8A 2B1LA 5CNWA 2TRXA 4PQIA 1F37A 3H8QA 1BJXA 2P5QA 3TDGA 2CA8A 2H6ZA 3LXZA 2GDRA 1VF4A 2TIRA 5KN0A 4KDYA 2CT6A 3D21A 3M0FA 2H0HA 1A24A 4X1UA 1PSQA 4KX4A 5ECIB 2ON7A 4MF7A 2FUG2 2I9HA 4ILFA 4Q5FA 1JHBA 3QAGA 1XZOA 1X5DA 1A8YA 2QKEA 4K9ZA 1TI3A 2O89A 1M0UA 1W4VA 4TR1A 1TK5B 2H72A 1URMA 2HZEB 1HD2A 5FT3A 3DVXA 3ZIVA 4MJEA 3MWHA 4ZB9A 5HR3A 1HNAA 4K7NA 2VIMA 4HQSA 2N5FA 5KEJA 4PGTA 3LYPA 5CYYA 3LWAA 5H5QA 2JSYA 2I81A 2E0QA 4K6XA 1Z6NA 2C8UA 3BBYA 2WULA 3WT1A 3VWUA 2CZ2A 1XW5A 4DSSB 3IV4A 4J56E 3ZVJD 1K0OA 3WGEA 2YWMA 4PXOA 5EL8A 3DYRA 4GSNA 4HJMA 5G31A 6GSTA 1USBA 5GSSA 2EC4A 3WD6A 2XBQA 1AIUA 3VPQA 4OCEA 1O7UA 2VCQA 2VLTA 3IR4A 3HY2A 3D6IA 1EV9A 3W8JA 2PERA 4IN0A 4IJ3A 2FGXA 1WPIA 3QR6A 5IPHA 3E3EA 3CTGA 1F2EA 3VK9A 2DJJA 3TRXA 4ULXA 1SKSB 1G0TA 4EDZA 2H74A 1PRXA 2H0GA 4O32A 3ERWA 2VUPA 1MDKA 5C00A 1DE1A 1FG4A 3TCOA 1JZOA 2H70A 4TXOA 5JWRB 6GSWA 1BG5A 2OBIA 2DSAA 5DBQA 2H0IA 2GSTA 4TRXA 2CZ3A 1PGTA 4BWSA 5D96A 3KJYA 1K0CA 2NVLA 4HU7A 1OAZA 5D8IA 1YDKA 3H4KA 2XC2A 1X9MB 2ES7A 4DVCA 5J41A 1HNCA 2NDOA 1Y6EA 1O85A 4WBRD 4KSOA 4IVFA 3ISOA 5HR2A 3KMOA 1ZZYA 2FY6A 2K8VA 1K3LA 5HR1A 2GSRA 4PQHA 2B5YA 4MABA 2H1DA 4TVEA 3D22A 5CRGA 5IOXA 2F3MA 1V58A 19GSA 3QOUA 2ZCTA 2IFQB 1WRYA 4MZCA 4EO3A 3VLNA 5IO2A 3KXOA 1EGOA 3G9BA 2B3SA 3JCML 5JCGA 1G7EA 3KEBA 2FWFA 2CAIA 3CRUA 2LJKA 5ELGA 3UOMA 1B9YC 3ZRDA 4PX1A 5DALB 3D4TA 2GVPA 1Z3EA 2DJ0A 3IBHA 3WGXA 2GLRA 3KIJA 2J23A 4LL4B 1DUGA 2IIYA 1XVWA 3W6GA 1ZYEA 2YJ7A 2A2SA 1NSWA 1GH2A 5CRWA 4ZL8A 3TKSE 4GWRA 3E9JB 3L9VA 4OFTA 1BYEA 4IP6A 2I3YA 2FWHA 2HZFA 4LL1B 3M1GA 1G7OA 3EYTA 1IYHA 2IWTA 4RQXA 2VLUA 3BCKA 4N11A 4YAPA 1NW2A 2O8VB 4XHMA 4E8HA 4D73A 1G6YA 2XHFA 3FHKA 5J9BA 3ZFLA 3ZMLA 1TP9A 2M72A 2VL2C 2GQMA 1U3IA 3ZLPA 4XIHA 2VCXA 4MF6A 3GIXA 2WDUA 4HZ4A 4F0BA 1UVZA 3KH9A 3TRQA 3MSZA 1ZOFA 1F9MA 5DQYA 3QFBC 3A2XA 3QFAC 5IO0A 1WE0A 2L4QA 1GRXA 3GKMA 4I8BA 4IQ1A 5D9VA 3M3MA 3IK9A 1B8XA 3BJ5A 4Q5NA 4NWYA 5COHA 5B8BA 2F9SA 2E2GA 4GXZA 3G7JA 4GQFA 1ABAA 2RLIA 4ML1A 1XIYA 1X9WB 3ME7A 1SK2A 1A2JA 2EIRA 4POKA 1SD9A 3V1WA 3TRPA 2IMEA 1PA3A 1ERVA 3QMXA 1K0NA 4NPBA 5GAND 1OC9B 4XS4B 3FEUA 5IMVA 1AQVA 1JZRA 2H1AA 1SK1A 3J7Yb 4NXIA 5CRDA 2HI7A 2YOIA 4ML6A 1EV4A 4HJ2A 3EINA 2G0FA 2D2ZA 3HJOA 1I9DA 2GSSA 4JZQA 3EMPA 4Z7XA 1O8WA 5DAKB 4EKZA 3TKSC 4XRDA 2X8CA 2K6VA 4EUYA 2H71A 4LLRA 3PINA 3IRAA 4MJAA 1T8EB 4K7OA 2F8FA 2VM1A 3OR5A 4MJBA 2YN1A 1JLWA 2HRNA 5F06A 3TOUA 1WP0A 5G1LA 2AJQB 3CTFA 2VOCA 5F07A 2LUSA 3C7MA 3QD9A 5ECLB 3RHBA 1TRVA 2FCHA 3GMFA 5DALA 4BPYA 4ZBAA 1XVQA 4BL7A 4K0NA 2XPEA 1Q98A 3F3QA 2WGRA 3LGCA 1DSBA 1O8XA 4N0VA 2OE0A 3KM6A 17GSA 2BJXA 2KHPA 3IDVA 4RQRA 1SD8A 2V32A 4PUAA 5H5RA 4KH7A 3DXBA 1T3BA 4AF2A 1I5GA 2MMNA 4TR4A 1R4WA 4OFMA 2HFDA 2IJYA 5ID2B 5ECHB 4EF0A 3EVIA 2R3XA 2V6KA 4ECIA 2B5EA 2QGVA 1XCCA 4QL9A 5D93A 1MD4A 1HYUA 3FZ4A 3DGQA 2L6DA 5E4WA 2NBSA 4K7IA 1ZL9A 1SKRB 1K0MA 4O92A 2R6KA 5ECQB 1U87A 1XWKA 1CQGA 2JU5A 2ZNMA 4V2NA 1YKAA 1V9WA 4CDOA 1Z7RA 4FH8A 1VF1A 3E0UA 4CW9A 1ZGNA 3APOA 3GTUB 3ZREA 1Z7PA 3F6DA 3GH9A 3SBCA 2A4VA 1GWCA 1XW9A 4NV5A 2MBTA 5CREA 4ZILA 2DMLA 1SU9A 2AHEA 1SL2B 4F0CA 4GLTA 3VI5A 3ERFA 1FO5A 3VWWA 2PVOC 4BWQA 1WOUA 2C0DA 4J2FA 5J5NA 3WYWA 2GS3A 2O87A 2LQOA 4LMWA 3TJKA 5JWOB 2HYXA 2LV3A 3F9UA 4IELA 1QGVA 4POLA 2L5OA 2H76A 9GSSA 1M7TA 2YPMA 1B4QA 4OCFA 4P3YB 4X0XA 3VPTA 1Z6MA 5DAKA 3KD0A 3ZYWA 3IAS2 3G7IA 1FOVA 5CP1A 3PGTA 2LRCA 1AC1A 5F0GA 2FA4A 3HDCA 3VWVA 3LXTA 5G5FA 1YF1A 1QMVA 2LJRA 3BD2A 2B1KA 3UVHA 1PKZA 2H6XA 1E6BA 4EDYA 2FNOA 4JU5A 5A4VA 2GZZA 2GQKA 3P8WA 3K8NA 4IGJA 1A2MA 3EC3A 4N0ZA 5DVBA 4GF0A 2LJAA 1ML6A 5ECNB 1FVKA 4PUFC 3LEFA 5LNKe 1Z5YE 3EU3A 1ST9A 3IPZA 3KCMA 1XOBA 2H30A 4K0GA 2E7PA 2AB6A 3GUSA 1SYXA 4WF4A 1A0RP 1K3YA 2I1UA 1F6MC 5AIXA 3TKRA 4ZBBA 3MNGA 2C4JA 2GSQA 1MTCA 5H5SA 1V98A 4AJ7A 6GSVA 3LG6A 1C72A 4TOPA 4ZL7A 1PX6A 3TKPA 1TI1A 3FR3A 5IMZA 2YANA 3ERGA 1X5CA 2PN8A 4K2DA 1OE8A 1GSEA 2FA8A 2DJKA 2F51A 5D9XA 1EEJA 4XCSA 1TRWA 5CO3A 3MAKA 1R7HA 1GSYA 3DIEA 5ECSA 1T00A 4I6XA 4K8MA 1FHEA 1U6TA 4HUAA 1T7PB 3GN3A 6GSXA 1UA5A 2GZPA 3F4TA 3U5RE 2L6CA 4F03A 4ISDA 5J3RA 4KA0A 2PGTA 2YNXA 1GNEA 3GV1A 3ZTLA 3O6TA 4N30A 2WCIA 2PBJA 2DBCA 2PUKC 5HFGA 1TDIA 5GSTA 1PMTA 2K18A 4KUNA 1TK0B 4PQ1A 4KSMA 2C3NA 11GSA 4KDXA 5D9WA 2B5XA 2H75A 3UL3A 2FWEA 12GSA 5DJMA 1K0BA 2X8GA 1TXXA 1MDIA 4I2TA 3C73A 1QQ2A 3C1RA 1TOFA 5GAPD 3LSZA 3RPNA 2VCWA 4MF5A 1ZMAA 1K3OA 3P7XA 1TJDA 4BVXA 3FKFA 5B6MA 2NPBA 3RBTA 1VRSD 3TGZA 4KGIA 4ECCA 2C0GA 1K0DA 5EPFA 3I69A 10GSA 1EWXA 1ZYQB 3LYKA 2WJUA 3GHAA 6GSSA 3KP8A 4MK3A 3UIWA 4TXVA 4AGSA 3Q19A 2VL3A 1SJZA 2HZEA 2MMOA 3GKKA 1RQMA 1H75A 2KLXA 3GKXA 3HVSA 2R2JA 3R2QA 4TKYA 2V2GA 3P2AA 2OBKA 4IP1A 1FB6A 1M2DA 4WKWA 4MZBA 1AUCA 5FHIA 4QQ7A 4EVMA 2HT9A 2FD3A 1EEMA 2OKAA 1XWAA 22GSA 5C04A 1S3DA 3D5JA 2H19A 4DEJA 3KH7A 1YY7A 4HDEA 1X9SB 2FHEA 3GL3A 1HQOA 4H86A 4FIWA 1GLQA 4DSSA 5IMAA 8GSSA 1SYRA 1THOA 3Q6OA 1LBKA 2DMMA 2VO4A 4OO5A 1A8LA 2R4VA 4F2IA 3H93A 1G6WA 1BEDA 4MH2A 2CV4A 4I97A 1BQ7A 2LS5A 4KCEA 1J08A 2CVKA 2PVQA 2IMFA 2N5AA 1TU7A 2HE3A 2LSTA 3Q18A 4JEDA 5AISA 1GTUA 4DSRA 2YWNA 1KTEA 3GSTA 4ECBA 3HVVA 1PX7A 1B4PA 3RHCA 3QPMA 1JZWA 1N2AA 3ZVJA 3D0ZA 2P5RA 3QAWA 1A23A 2J9HA 4V2LA 5HQPA 5EVOA 4AJ8A 5ABRA 2EIOA 1Q4JA 1XWBA 5FWGA 5DCGA 4V1Ap 3GKNA 3VFIA 2H73A 2IN3A 3C8EA 2CAQA 3TB2A 5J4UA 3N9JA 3TOTA 5F8BA 5DDLA 4OO4A 4I5QA 3CSHA 4EE0A 1ERUA 1PL2A 4NHZA 4WF5A 3F4SA 4HEA2 3A5WA 2K8SA 3IHQA 1X0RA 3I6AA 3CSIA 2B6MA 2C3QA 3IOSA 1WJKA 3GL5A 1WMJA 5DCHA 4TN8A 3CSJA 5A5KA 2OACA 2IFQA 1GP1A 3M8NA 1A2LA 1GULA 2HSYA 4NMUA 1XW6A 3TKQA 4BA7A 4MLYA 2V1MA 3FK8A 4F82A 1A0FA 3EURA 3FZ9A 2IL3A 2H6YA 3PR8A 3GURA 1GUKA 1ERTA 1ON4A 1RW1A 3Q74A 1E2YA 3N5OA 3CMIA 1TU8A 4KCAA 4EL1A 1GUHA 5ECRB 18GSA 4RI6A 2FWGA 4WETA 2N5BA 4TR1B 5IOWA 5L71A 1ILOA 3SWLA 4ZIJA 1T4YA 4JR4A 4MP4A 5IMFA 3DEXA 3APSA 2OJLA 5B6NA 2VL9A 2X8HA 3GYKA 3HD5A 2X64A 4J57E 1XWGA 2MMAA 1JLVA 3IC4A 3CRTA 5IIZA 5G2ZA 2LQQA 4MMMA 2GTUA 2PU9C 1GTAA 3RDWA 4L5LA 3EU4A 2C0FA 2L4CA 2CX3A 2C1YA 3IAM2 4NV2A 4HQZA 3GNJA 1LU4A 4POBA 3L9SA 2M80A 3KMNA 1MD3A 2GGTA 3UARA 2WS2A 3HKRA 3DKSA 4WXTA 2CVDA 2WRTA 4GCIA 2WFCA 2YP6A 2AAWA 3P90A 4L5OA 1XOAA 1B48A 2VCZA 4CHSA 3FR6A 4IKHA 3KGKA 2JADA 3F6FA 1GSDA 4RUVA 1UC7A 5F05A 5INYA 5LCZA 3HZ4A 2A2RA 2VL2A 4V2MA 5G30A 3HA9A 4OWYA 3H79A 2JACA 4WR4A 3F8UA 3O3TA 2R5GA 2GT6A 2CX4A 2H1BA 4LMVA 5GZZB 2HSHA 5CAXA 1OC9A 4XS4A 1PKWA 1MDJA 1OC3A 3HJMA 1U88A 2HNLA 5KN2A 4TXOB 2YV7A 2QSIA 4MCUA 5ENUA 5LD0A 5IMDA 2F8AA 4V1Ag 3RPPA 2G2QA 1TK8B 5AIVA 1GSQA 3VI7A 1TRSA 4L0UA 2DIZA 2OE1A 2PWJA 2P31A 2HRFA 2AYTA 5D73A 2ON5A 3IA1A 4I2UA 2O7KA 4QL7A 1N8JA 4ZBDA 2OADA 3L9UA 4XTSA 1VF3A 1DE2A 1AQWA 3C71A 1Z9HA 4X43A 3TJFA 1TTZA 4JBBA 3LFLA 2H66A 1GSSA 2LRTA 4MPGA 5EY6A 3ED3A 3FW2A 3KP9A 1AQXA 3LORA 3TJBA 3TKSA 1UN2A 4HOJA 1X5EA 6GSUA 4PURA 1EOGA 1V40A 4IW9A 2OE3A 3HVXA 4ID0A 5A4UA 4L8EA 4G19A 1AW9A 1V2AA 1OKDA 4PNGA 2BTOT 2H8LA 3DWVA 3F4RA 5HFIA 2KUCA 1PD21 2P0GA 3ZFBA 3L0HA 5ID2A 1WIKA 4YQUA 5IMCA 3IE3A 4KW6A 4TW5A 4RI7A 1KEBA 4HZ2A 1QUWA 2WZ9A 2ALBA 5AN1A 4KDUA 1YEPA 2LRNA 1OKTA 1Y25A 4G9HA 4ZL9A 1PN9A 3WGDA 3KZQA 3KTLA 2V41A 5JWQB 1R26A 1TKDB 2CVBA 3QAVA 5KN1A 4MPFA 2YWOA 4XRAA 3GTUA 4MJCA 1W89A 4F9ZA 2YV9A 4JE1A 4TR3A 4D73B 2LNTA 5DQSA 1GUMA 3UJ1A 1ZCPA 2JZSA 4K1FA 4IS0A 3U6VA 2VM2A 1YF0A 3I9V2 2IMDA 2YZUA 3ZIJA 2MBSA 1F3BA 4DSQA 4BVYA 2O85A 2H1GA 3M9KA 4YQVA 1XXUA 3KTBA 1R5AA 4G2EA 4ZB8A 1EZKA 3NIVA 5J9CA 4GRFA 1WWJA 5ELAA 2C80A 1O6JA 2RUFA 1J9BA 2AUVA 3UAPA 1MEKA 2I4AA 4WEYA 1S3AA 3GSSA 4GSSA 1YQ1A 2HLSA 5IQYA 1GSUA 5CRHA 4FO5A 1FB0A 5D9TA 4MZWA 3EMXA 1M2BA 13GSA 1EP8A 3IK7A 1PL1A 1J0FA 4KNDA 1RK4A 2KP2A 2H01A 1QK8A 1QXHA 3TJGA 2DIYA 2JZRA 4IJIA 4Q5QA 5G1KA 1OE7A 3TUEA 3WT2A 3APQA 4OD7A 3UVTA 3DRNA 2OA7A 4ACSA 1XFLA 2C3TA 5IPGA 1BX9A 2MYGA 3UEMA 1NM3A 3A2VA 1CQHA 2VAFA 1V57A 5HFKA 3HYPA 3GX8A 1FW1A 4XS6A 5IM9A 1OYJA 1YZXA 3RAZA 3HXSA 4EC0A 1YKCA 3D4MA 5A4WA 3CBUA 2BMXA 3FY7A 3ZITA 2L5LA 5E59A 3EWLA 1AAZA 3A2WA 4FYBA 4YQMA 3S9FA 3GFKA 1M99A 1DBYA 4HS1A 4IHUA 1SL1B 4GTUA 2RM5A 2IPAA 1EP7A 4O7HA 3DVWA 4YAVA 3O76A 1TW9A 1QFNA 1NHOA 1FAAA 1XPVA 3L4NA 2X99A 3CXGA 1SL0B 1GTIA 2MZCA 2XPDA 1K0AA 1XBSA 2VCTA 2IMKA 3QDNA 4NHWA 3HCZA 1BAYA 1LJRA 2DC5A 2CQ9A 2HXKA 3MDKA 3IXRA 1ERWA 14GSA 2R37A 1F3AA 1FVJA 4KAEA 2DJ3A 4G10A 4HU9A 5JCWA 1M9BA 3UMAA 3J7Yk 4GSTA 3PH9A 1YJ6A 4KE3A 4TR0A 2PMTA 3C1SA 3UBKA 2EIQA 3G7YA 4EXJA 2REMA 3LQ7A 1O81A 4ZB6A 3ME8A 3LJRA 4Q5RA 4N10A 1SJ6A 3TJJA 4ZXGA 2GT5A 5ECOB 2E2MA 3F63A 2DLXA 1VGLA 3ZL5A 2TRCP 1SK0A 3HJPA 4KB3A 1GSFA 3FZAA 4LA1A 2VD1A 3BOAA 7GSSA 4XS1A 3US3A 2GZYA 3GH6A 1TRUA 2B7KA 2V6OA 5ECKB 3AY8A 1U3AA 1S3CA 3GRXA 3DMLA 3NZNA 1O73A 3L78A 20GSA 1IYIA 5G5EA 4YH2A 2LEGA 4WBJA 2DJ1A 3GA4A 3H1NA 1GLPA 2DJ2A 3M9JA 1KNGA 2LKUA 3I43A 2XBIA 3ZZXA 1EOHA 3HZ8A 2GQLA 4IBPA 4OMVA 1SJIA 2KP1A 5ECPB 4POMA 2JL4A 1R5PA 16GSA 1THXA 2AV4A 2WB9A 2FLSA 1ACVA 2LNSA 3DD3A 4OFNA 2VLVA 5B8AA 1GTBA 5KN3A 2JZTA 4GQCA 4MDCA 4FYUA 2C0EA 2B7JA 2RIIA 2ZUPA 3BCIA 1OVNA 1GL8A 4MH3A 2K9FA 3NOFA 2YCDA 4L0WA 1B9XC 3A3TA 2QC7A 4WR5A 5B7CA 3FRCA 6GSYA 2VCVA 2Z9SA 1VF2A 4JRRA 2RM6A 1M2AA 3VWXA 1XWCA 1KBNA 3QCPA 3W8SA
chains in the Genus database with same CATH superfamily
3PPUA 1JZDA 1JFUA 1PQNA 3GX0A 5ECMB 3VURA 1SENA 1EGRA 4MA9A 2L59A 2LTKA 1H4OA 1AXDA 1T4ZA 2MMZA 4ICYA 2YZHA 4PNFA 2NTOA 3F3RA 2IMIA 3CYNA 1SKWB 3UBLA 2L57A 1GNWA 5AGYA 1YEXA 5JCUA 4E8EA 5DJLA 1M9AA 1HNBA 3ZMKA 3EE2A 4IQAA 3HHVA 4O5RA 2JSZA 4ECJA 2KOKA 3FYGA 4AJ6A 1T1VA 2M46A 4HI7A 4K2XA 2YJHA 3FZ5A 4FYCA 5HR0A 3FR9A 1NHYA 4JR6A 2YWIA 2PPTA 2RUEA 4NAXA 2VD0A 3F0IA 1OC8A 2B1LA 5CNWA 2TRXA 4PQIA 1F37A 3H8QA 1BJXA 2P5QA 3TDGA 2CA8A 3IC8A 2H6ZA 3LXZA 2GDRA 1VF4A 2TIRA 5KN0A 4KDYA 2CT6A 3D21A 3M0FA 2H0HA 3HVNA 1A24A 3IHGA 4X1UA 1PSQA 4KX4A 5ECIB 2ON7A 4MF7A 2FUG2 2I9HA 4ILFA 4Q5FA 1JHBA 3QAGA 1XZOA 1X5DA 1A8YA 2QKEA 4K9ZA 1TI3A 2O89A 1M0UA 1W4VA 4TR1A 1TK5B 2H72A 1URMA 2HZEB 1HD2A 5FT3A 3DVXA 3ZIVA 4MJEA 3MWHA 4ZB9A 5HR3A 1HNAA 4K7NA 2VIMA 4HQSA 2N5FA 5KEJA 1M3JA 4PGTA 3LYPA 5CYYA 3LWAA 5H5QA 2JSYA 2I81A 2E0QA 4K6XA 1Z6NA 2C8UA 3BBYA 2WULA 3WT1A 3VWUA 2CZ2A 1XW5A 4DSSB 3IV4A 4J56E 4HSCX 3ZVJD 1K0OA 3WGEA 2YWMA 4PXOA 5EL8A 3DYRA 4GSNA 4HJMA 5G31A 6GSTA 1USBA 5GSSA 2EC4A 3WD6A 2XBQA 1AIUA 3VPQA 4OCEA 1O7UA 2VCQA 2VLTA 3IR4A 3HY2A 3D6IA 1EV9A 3W8JA 2PERA 4IN0A 4IJ3A 4YKGA 2FGXA 1WPIA 3QR6A 5IPHA 3E3EA 3CTGA 1F2EA 3VK9A 2DJJA 3TRXA 4ULXA 1SKSB 1G0TA 4EDZA 2H74A 1PRXA 2H0GA 4O32A 3ERWA 2VUPA 1MDKA 5C00A 1DE1A 1FG4A 3TCOA 1JZOA 2H70A 4TXOA 5JWRB 6GSWA 1BG5A 2OBIA 2DSAA 5DBQA 2H0IA 2GSTA 4TRXA 2CZ3A 1PGTA 4BWSA 5D96A 3KJYA 1K0CA 2NVLA 4HU7A 1OAZA 5D8IA 1YDKA 3H4KA 2XC2A 1X9MB 2ES7A 4DVCA 5J41A 1HNCA 2NDOA 1Y6EA 1O85A 4WBRD 4KSOA 5BMUA 4IVFA 3ISOA 5HR2A 1PFOA 3KMOA 1ZZYA 2FY6A 2K8VA 1K3LA 5HR1A 2GSRA 4PQHA 2B5YA 4MABA 2H1DA 4TVEA 3D22A 5CRGA 5IOXA 2F3MA 1V58A 19GSA 3QOUA 2R0PA 2IFQB 2ZCTA 1WRYA 4MZCA 4EO3A 3VLNA 5IO2A 3KXOA 1EGOA 3G9BA 2B3SA 3JCML 5JCGA 1G7EA 3KEBA 2FWFA 2CAIA 3CRUA 2LJKA 5ELGA 2X4AA 3UOMA 1B9YC 3ZRDA 4PX1A 5DALB 3D4TA 2GVPA 1Z3EA 2DJ0A 3IBHA 5KOXA 3WGXA 2GLRA 4BL7B 3KIJA 2J23A 4LL4B 1DUGA 2IIYA 1XVWA 3W6GA 1ZYEA 2YJ7A 2A2SA 1NSWA 1GH2A 5CRWA 4ZL8A 3TKSE 4GWRA 3E9JB 3L9VA 4OFTA 1BYEA 4IP6A 2I3YA 2FWHA 2HZFA 4LL1B 3M1GA 1G7OA 3EYTA 1IYHA 2IWTA 4RQXA 2VLUA 3BCKA 4N11A 4YAPA 1NW2A 2O8VB 4XHMA 4E8HA 4D73A 1G6YA 2XHFA 3FHKA 5J9BA 3ZFLA 3ZMLA 1TP9A 2M72A 2VL2C 2GQMA 1U3IA 3ZLPA 4XIHA 2VCXA 2A4HA 4MF6A 3GIXA 2WDUA 4HZ4A 4F0BA 1UVZA 3KH9A 3TRQA 3MSZA 1ZOFA 1F9MA 4FQUA 5DQYA 3QFBC 3A2XA 3QFAC 5IO0A 1WE0A 2L4QA 1GRXA 3GKMA 4I8BA 2R0GA 4IQ1A 5D9VA 3M3MA 3IK9A 1B8XA 3BJ5A 4Q5NA 4NWYA 5COHA 4G0IA 5B8BA 2F9SA 2E2GA 4GXZA 3G7JA 4GQFA 1ABAA 2RLIA 4ML1A 1XIYA 1X9WB 3ME7A 1SK2A 1A2JA 2EIRA 4POKA 1SD9A 3V1WA 3TRPA 2IMEA 1PA3A 1ERVA 3QMXA 1K0NA 4NPBA 5GAND 1OC9B 4XS4B 3FEUA 5IMVA 2QA2A 4EIPA 1AQVA 1JZRA 2H1AA 1SK1A 3J7Yb 4NXIA 5CRDA 2HI7A 2YOIA 4ML6A 1EV4A 4HJ2A 3EINA 2G0FA 2D2ZA 3HJOA 1I9DA 2GSSA 4JZQA 3EMPA 4Z7XA 1O8WA 5DAKB 4EKZA 3TKSC 4XRDA 2X8CA 2K6VA 4EUYA 2H71A 4LLRA 3PINA 3IRAA 4MJAA 1T8EB 4K7OA 2F8FA 2VM1A 3OR5A 2HSMA 4MJBA 2YN1A 1JLWA 2HRNA 5F06A 3TOUA 1WP0A 5G1LA 2AJQB 3CTFA 2VOCA 5F07A 2LUSA 3C7MA 3QD9A 5ECLB 3RHBA 1TRVA 2FCHA 3GMFA 5DALA 4BPYA 4ZBAA 1XVQA 4BL7A 4K0NA 2XPEA 1Q98A 3F3QA 2WGRA 3LGCA 1DSBA 1O8XA 4N0VA 2OE0A 3KM6A 17GSA 2BJXA 2KHPA 3IDVA 4RQRA 1SD8A 2V32A 4PUAA 4MNNA 5H5RA 4KH7A 3DXBA 1T3BA 4AF2A 1I5GA 2MMNA 4TR4A 1R4WA 4OFMA 2HFDA 2IJYA 5ID2B 5ECHB 4EF0A 3EVIA 2R3XA 2V6KA 4ECIA 1M3IA 2B5EA 2QGVA 1XCCA 4QL9A 5D93A 1MD4A 1HYUA 3FZ4A 3DGQA 2L6DA 5E4WA 2NBSA 4K7IA 1ZL9A 1SKRB 1K0MA 4O92A 2R6KA 5ECQB 1U87A 1XWKA 1CQGA 2JU5A 2ZNMA 4V2NA 1YKAA 1V9WA 3MIXA 4CDOA 1Z7RA 4FH8A 1VF1A 3E0UA 4CW9A 1ZGNA 3APOA 3GTUB 4Z2RA 3ZREA 1Z7PA 3F6DA 3GH9A 3SBCA 2A4VA 1GWCA 1XW9A 4NV5A 2DKHA 2MBTA 5CREA 4ZILA 2DMLA 1SU9A 2AHEA 1SL2B 4F0CA 4GLTA 3VI5A 4BVYB 3ERFA 1FO5A 3VWWA 2PVOC 4BWQA 1WOUA 2C0DA 4J2FA 5J5NA 3WYWA 2GS3A 2O87A 2LQOA 4LMWA 3TJKA 5JWOB 2HYXA 2LV3A 3F9UA 4IELA 1QGVA 4POLA 2L5OA 2H76A 9GSSA 1M7TA 2YPMA 1B4QA 4OCFA 4P3YB 4X0XA 3VPTA 1Z6MA 4BVXB 5DAKA 3KD0A 3ZYWA 3IAS2 3G7IA 1FOVA 5CP1A 3PGTA 2LRCA 1AC1A 5F0GA 2FA4A 3HDCA 3VWVA 3LXTA 5G5FA 1YF1A 1QMVA 2LJRA 3BD2A 2B1KA 3UVHA 1PKZA 1FOHA 2UZ8A 2H6XA 1E6BA 4EDYA 2FNOA 4JU5A 5A4VA 2GZZA 2GQKA 3P8WA 3K8NA 4IGJA 1A2MA 3EC3A 4N0ZA 5DVBA 4GF0A 2LJAA 1ML6A 5ECNB 1FVKA 4PUFC 3LEFA 5LNKe 1Z5YE 3EU3A 1ST9A 3IPZA 3KCMA 1XOBA 2H30A 4K0GA 2E7PA 2AB6A 3GUSA 1SYXA 4WF4A 1A0RP 1K3YA 2I1UA 1F6MC 5AIXA 3TKRA 4ZBBA 3MNGA 2C4JA 2GSQA 1MTCA 5H5SA 1V98A 4AJ7A 6GSVA 3LG6A 1C72A 4TOPA 4ZL7A 1PX6A 3TKPA 1TI1A 3FR3A 5IMZA 2YANA 3ERGA 1X5CA 2PN8A 4K2DA 1OE8A 1GSEA 2FA8A 4YKFA 2DJKA 2F51A 5D9XA 1EEJA 4XCSA 1TRWA 5CO3A 3MAKA 1R7HA 1GSYA 3DIEA 5ECSA 1T00A 4I6XA 4K8MA 1FHEA 1U6TA 4HUAA 1T7PB 4BIKA 3GN3A 6GSXA 1UA5A 2GZPA 3F4TA 3U5RE 2L6CA 4F03A 4ISDA 5J3RA 4KA0A 2PGTA 2YNXA 1GNEA 3GV1A 3ZTLA 3O6TA 4N30A 2WCIA 2PBJA 2DBCA 2PUKC 5HFGA 1TDIA 5GSTA 1PMTA 2K18A 4KUNA 1TK0B 4PQ1A 4KSMA 2C3NA 11GSA 4KDXA 5D9WA 2B5XA 2H75A 3UL3A 4PTSA 2FWEA 12GSA 5DJMA 1K0BA 2X8GA 1TXXA 1MDIA 4I2TA 3C73A 1QQ2A 3C1RA 1TOFA 5GAPD 3LSZA 3RPNA 2VCWA 4MF5A 1ZMAA 1K3OA 3P7XA 1TJDA 4BVXA 3FKFA 5B6MA 2NPBA 3CQFA 3RBTA 1VRSD 3TGZA 4KGIA 4ECCA 2C0GA 1K0DA 5EPFA 3I69A 10GSA 1EWXA 1ZYQB 3LYKA 2WJUA 3GHAA 6GSSA 3KP8A 4MK3A 3UIWA 4TXVA 4AGSA 3Q19A 2VL3A 1SJZA 2HZEA 2MMOA 3GKKA 1RQMA 1H75A 2KLXA 3GKXA 3HVSA 2R2JA 3R2QA 4TKYA 5BRTA 2V2GA 3P2AA 2OBKA 4IP1A 1FB6A 1M2DA 4WKWA 4MZBA 1AUCA 4K5SA 5FHIA 4QQ7A 4EVMA 2HT9A 2FD3A 1EEMA 2OKAA 1XWAA 22GSA 5C04A 1S3DA 3D5JA 2H19A 4DEJA 3KH7A 1YY7A 4HDEA 1X9SB 2FHEA 3GL3A 1HQOA 4H86A 4FIWA 1GLQA 4DSSA 5IMAA 8GSSA 1SYRA 1THOA 3Q6OA 1LBKA 2DMMA 2VO4A 4OO5A 1A8LA 2R4VA 3R3EA 4F2IA 3H93A 1G6WA 1BEDA 4MH2A 2CV4A 4I97A 1BQ7A 2LS5A 4KCEA 1J08A 2CVKA 2PVQA 2IMFA 2N5AA 1TU7A 2HE3A 2LSTA 3Q18A 4JEDA 5AISA 1GTUA 4DSRA 2YWNA 1KTEA 3GSTA 4ECBA 4EIQA 5KOWA 3HVVA 1PX7A 1B4PA 3RHCA 3QPMA 1JZWA 1N2AA 3ZVJA 3D0ZA 2P5RA 3QAWA 1A23A 2J9HA 4V2LA 5HQPA 5EVOA 4AJ8A 5ABRA 4O5UA 2EIOA 1Q4JA 1XWBA 5FWGA 5DCGA 4V1Ap 3GKNA 3VFIA 2H73A 2IN3A 3LW9A 3C8EA 2CAQA 3TB2A 5J4UA 3N9JA 3TOTA 5F8BA 5DDLA 2HRAA 4OO4A 4I5QA 3CSHA 4EE0A 1ERUA 1PL2A 4NHZA 4WF5A 3F4SA 4HEA2 3A5WA 2K8SA 3IHQA 1X0RA 3I6AA 3CSIA 4X4JA 2B6MA 2C3QA 3IOSA 1WJKA 3GL5A 1WMJA 5DCHA 4TN8A 3CSJA 5A5KA 2OACA 2IFQA 1GP1A 3M8NA 1A2LA 1GULA 2HSYA 4NMUA 1XW6A 3TKQA 4BA7A 4MLYA 1PN0A 2V1MA 3FK8A 4F82A 1A0FA 3EURA 3FZ9A 2IL3A 2X49A 2H6YA 3PR8A 4CY8A 3GURA 1GUKA 1ERTA 1ON4A 1RW1A 3Q74A 1E2YA 3N5OA 3CMIA 1TU8A 4KCAA 4EL1A 1GUHA 5ECRB 18GSA 4RI6A 2FWGA 4WETA 2N5BA 4TR1B 5IOWA 5L71A 1ILOA 3SWLA 4ZIJA 1T4YA 4JR4A 4MP4A 5IMFA 3DEXA 3APSA 2OJLA 5B6NA 2VL9A 2X8HA 3GYKA 3HD5A 2X64A 4J57E 1XWGA 2MMAA 1JLVA 3IC4A 3CRTA 5IIZA 5G2ZA 2LQQA 4MMMA 2GTUA 2PU9C 1GTAA 2A2PA 3RDWA 4L5LA 3EU4A 2C0FA 2L4CA 2CX3A 2C1YA 3IAM2 4NV2A 4HQZA 3GNJA 1LU4A 4POBA 4O5QA 3L9SA 2M80A 3KMNA 1MD3A 2GGTA 3UARA 2WS2A 3HKRA 3DKSA 4WXTA 2CVDA 2WRTA 4GCIA 2WFCA 2YP6A 2AAWA 3P90A 4L5OA 1XOAA 1B48A 2VCZA 4CHSA 3FR6A 4IKHA 3KGKA 2JADA 3F6FA 1GSDA 4RUVA 1UC7A 5F05A 5INYA 5LCZA 3HZ4A 2A2RA 2VL2A 4V2MA 5G30A 3HA9A 4OWYA 3H79A 2JACA 4WR4A 3F8UA 3O3TA 2R5GA 2GT6A 2CX4A 2H1BA 4LMVA 5GZZB 2HSHA 5CAXA 1OC9A 4XS4A 1PKWA 1MDJA 1OC3A 3HJMA 1U88A 2HNLA 5KN2A 4TXOB 2YV7A 2QSIA 4MCUA 5ENUA 5LD0A 5IMDA 2R0CA 2F8AA 4V1Ag 3RPPA 2QA1A 2G2QA 1TK8B 5AIVA 1GSQA 3VI7A 1TRSA 4L0UA 2DIZA 2OE1A 2PWJA 2P31A 2HRFA 2AYTA 5D73A 2ON5A 3IA1A 4I2UA 2O7KA 4QL7A 1N8JA 4ZBDA 2OADA 3L9UA 4XTSA 1VF3A 1DE2A 1AQWA 3C71A 1Z9HA 4X43A 3TJFA 4K5RA 1TTZA 4JBBA 3LFLA 2H66A 1GSSA 2LRTA 4MPGA 5EY6A 3ED3A 3FW2A 3KP9A 1AQXA 3LORA 3TJBA 3TKSA 1UN2A 4HOJA 1X5EA 6GSUA 4PURA 1EOGA 1V40A 4IW9A 2OE3A 3HVXA 4ID0A 5A4UA 4L8EA 4G19A 1AW9A 1V2AA 1OKDA 4PNGA 2BTOT 2H8LA 3DWVA 3F4RA 5HFIA 2KUCA 1PD21 2P0GA 3ZFBA 3L0HA 5ID2A 1WIKA 4YQUA 5IMCA 3IE3A 4KW6A 4TW5A 4RI7A 1KEBA 4HZ2A 1QUWA 2WZ9A 2ALBA 5AN1A 4KDUA 1YEPA 2LRNA 1OKTA 1Y25A 4G9HA 4ZL9A 1PN9A 3WGDA 3KZQA 3KTLA 2V41A 5JWQB 1R26A 1TKDB 2CVBA 3QAVA 5KN1A 4MPFA 2YWOA 2HRKA 4KF9A 4XRAA 3GTUA 4MJCA 1W89A 4F9ZA 2YV9A 4JE1A 4TR3A 4D73B 2LNTA 5DQSA 1GUMA 3UJ1A 1ZCPA 2JZSA 4K1FA 4IS0A 3U6VA 2VM2A 1YF0A 3I9V2 2IMDA 2YZUA 3ZIJA 2MBSA 1F3BA 4DSQA 4BVYA 2O85A 4CY6A 2H1GA 3M9KA 4YQVA 1XXUA 3KTBA 1R5AA 4G2EA 4ZB8A 1EZKA 3NIVA 5J9CA 4GRFA 1WWJA 5ELAA 2C80A 1O6JA 2RUFA 1J9BA 2AUVA 3UAPA 1MEKA 2I4AA 4WEYA 1S3AA 3GSSA 4GSSA 1YQ1A 2HLSA 5IQYA 1GSUA 5CRHA 4FO5A 1FB0A 5D9TA 4MZWA 3EMXA 1S3RA 4USSA 1M2BA 13GSA 1EP8A 3IK7A 1PL1A 1ZYNA 4KNDA 1RK4A 2KP2A 1J0FA 2H01A 1QK8A 1QXHA 3TJGA 2DIYA 2JZRA 4IJIA 4Q5QA 5G1KA 1OE7A 3TUEA 3WT2A 3APQA 4OD7A 3UVTA 3DRNA 2OA7A 4ACSA 1XFLA 2C3TA 5IPGA 1BX9A 2MYGA 3UEMA 1NM3A 3A2VA 1CQHA 2VAFA 1V57A 5HFKA 3HYPA 3GX8A 1FW1A 4XS6A 5IM9A 1OYJA 1YZXA 3RAZA 3HXSA 4EC0A 1YKCA 3D4MA 5A4WA 1XG8A 3CBUA 2BMXA 3FY7A 3ZITA 2L5LA 5E59A 3EWLA 1AAZA 3A2WA 4FYBA 4YQMA 3S9FA 3GFKA 1M99A 1DBYA 4HS1A 4IHUA 3A5IA 1SL1B 4GTUA 2RM5A 2IPAA 1EP7A 4O7HA 3DVWA 4YAVA 3O76A 1TW9A 1QFNA 1NHOA 1FAAA 1XPVA 3L4NA 2X99A 4Z2UA 3CXGA 1SL0B 1GTIA 2MZCA 2XPDA 1K0AA 1XBSA 2VCTA 2IMKA 3QDNA 4NHWA 3HCZA 1BAYA 1LJRA 2DC5A 2CQ9A 2HXKA 3MDKA 3IXRA 1ERWA 14GSA 2R37A 1F3AA 1FVJA 4KAEA 2DJ3A 4G10A 4HU9A 4G0KA 5JCWA 1M9BA 3UMAA 3J7Yk 4GSTA 3PH9A 1YJ6A 4KE3A 4TR0A 2PMTA 3C1SA 3UBKA 2EIQA 3G7YA 4EXJA 2REMA 3LQ7A 1O81A 4ZB6A 3ME8A 3LJRA 4Q5RA 4N10A 1SJ6A 3FMWA 3TJJA 4ZXGA 2GT5A 5ECOB 2E2MA 3F63A 2DLXA 1VGLA 3ZL5A 2TRCP 1SK0A 3HJPA 4KB3A 1GSFA 3FZAA 4LA1A 2VD1A 2DKIA 3BOAA 7GSSA 4XS1A 3US3A 2GZYA 3GH6A 1TRUA 2B7KA 2V6OA 5ECKB 3AY8A 1U3AA 1S3CA 3GRXA 3DMLA 3NZNA 1O73A 3L78A 1ZYPA 20GSA 1IYIA 5G5EA 4YH2A 2LEGA 4WBJA 2DJ1A 3GA4A 4A5PA 3H1NA 1GLPA 2DJ2A 3M9JA 1KNGA 2LKUA 3I43A 2XBIA 3ZZXA 1EOHA 3HZ8A 2GQLA 3MYDA 4IBPA 4OMVA 1SJIA 2KP1A 5ECPB 4POMA 2JL4A 1R5PA 16GSA 1THXA 2AV4A 2WB9A 2FLSA 1ACVA 2LNSA 3DD3A 4OFNA 2VLVA 5B8AA 1GTBA 4G0LA 5KN3A 2JZTA 4GQCA 4MDCA 4FYUA 2C0EA 2B7JA 2RIIA 2ZUPA 3BCIA 1OVNA 1GL8A 4MH3A 2K9FA 3NOFA 2YCDA 4L0WA 1B9XC 3A3TA 2QC7A 4WR5A 5B7CA 3FRCA 6GSYA 2VCVA 2Z9SA 1VF2A 4Z2TA 4JRRA 2RM6A 1M2AA 3VWXA 1XWCA 1KBNA 3QCPA 3W8SA 3EPTA
chains in the Genus database with same CATH topology
3PPUA 1JZDA 1JFUA 1PQNA 3GX0A 5ECMB 3VURA 1SENA 1EGRA 4MA9A 2L59A 2LTKA 1H4OA 1AXDA 1T4ZA 2MMZA 4ICYA 2YZHA 4PNFA 2NTOA 3F3RA 2IMIA 3CYNA 1SKWB 3UBLA 2L57A 1GNWA 5AGYA 1YEXA 5JCUA 4E8EA 5DJLA 1M9AA 1HNBA 3ZMKA 3EE2A 4IQAA 3HHVA 4O5RA 2JSZA 4ECJA 2KOKA 3FYGA 4AJ6A 1T1VA 2M46A 4HI7A 4K2XA 2YJHA 3FZ5A 4FYCA 5HR0A 3FR9A 1NHYA 4JR6A 2YWIA 2PPTA 2RUEA 4NAXA 2VD0A 3F0IA 1OC8A 2B1LA 5CNWA 2TRXA 4PQIA 1F37A 3H8QA 1BJXA 2P5QA 3TDGA 2CA8A 3IC8A 2H6ZA 3LXZA 2GDRA 1VF4A 2TIRA 5KN0A 4KDYA 2CT6A 3D21A 3M0FA 2H0HA 1A24A 3IHGA 4X1UA 1PSQA 4KX4A 5ECIB 2ON7A 4MF7A 2FUG2 2I9HA 4ILFA 4Q5FA 1JHBA 3QAGA 1XZOA 1X5DA 1A8YA 2QKEA 4K9ZA 1TI3A 2O89A 1M0UA 1W4VA 4TR1A 1TK5B 2H72A 1URMA 2HZEB 1HD2A 5FT3A 3DVXA 3ZIVA 4MJEA 3MWHA 4ZB9A 5HR3A 1HNAA 4K7NA 2VIMA 4HQSA 2N5FA 5KEJA 4PGTA 3LYPA 5CYYA 3LWAA 5H5QA 2JSYA 2I81A 2E0QA 4K6XA 1Z6NA 2C8UA 3BBYA 2WULA 3WT1A 3VWUA 2CZ2A 1XW5A 4DSSB 3IV4A 4J56E 3ZVJD 1K0OA 3WGEA 2YWMA 4PXOA 5EL8A 3DYRA 4GSNA 4HJMA 5G31A 6GSTA 1USBA 5GSSA 2EC4A 3WD6A 2XBQA 1AIUA 3VPQA 4OCEA 1O7UA 2VCQA 2VLTA 3IR4A 3HY2A 3D6IA 1EV9A 3W8JA 2PERA 4IN0A 4IJ3A 4YKGA 2FGXA 1WPIA 3QR6A 5IPHA 3E3EA 3CTGA 1F2EA 3VK9A 2DJJA 3TRXA 4ULXA 1SKSB 1G0TA 4EDZA 2H74A 1PRXA 2H0GA 4O32A 3ERWA 2VUPA 1MDKA 5C00A 1DE1A 1FG4A 3TCOA 1JZOA 2H70A 4TXOA 5JWRB 6GSWA 1BG5A 2OBIA 2DSAA 5DBQA 2H0IA 2GSTA 4TRXA 2CZ3A 1PGTA 4BWSA 5D96A 3KJYA 1K0CA 2NVLA 4HU7A 1OAZA 5D8IA 1YDKA 3H4KA 2XC2A 1X9MB 2ES7A 4DVCA 5J41A 1HNCA 2NDOA 1Y6EA 1O85A 4WBRD 4KSOA 5BMUA 4IVFA 3ISOA 5HR2A 3KMOA 1ZZYA 2FY6A 2K8VA 1K3LA 5HR1A 2GSRA 4PQHA 2B5YA 4MABA 2H1DA 4TVEA 3D22A 5CRGA 5IOXA 2F3MA 1V58A 19GSA 3QOUA 2R0PA 2IFQB 2ZCTA 1WRYA 4MZCA 4EO3A 3VLNA 5IO2A 3KXOA 1EGOA 3G9BA 2B3SA 3JCML 5JCGA 1G7EA 3KEBA 2FWFA 2CAIA 3CRUA 2LJKA 5ELGA 2X4AA 3UOMA 1B9YC 3ZRDA 4PX1A 5DALB 3D4TA 2GVPA 1Z3EA 2DJ0A 3IBHA 5KOXA 3WGXA 2GLRA 4BL7B 3KIJA 2J23A 4LL4B 1DUGA 2IIYA 1XVWA 3W6GA 1ZYEA 2YJ7A 2A2SA 1NSWA 1GH2A 5CRWA 4ZL8A 3TKSE 4GWRA 3E9JB 3L9VA 4OFTA 1BYEA 4IP6A 2I3YA 2FWHA 2HZFA 4LL1B 3M1GA 1G7OA 3EYTA 1IYHA 2IWTA 4RQXA 2VLUA 3BCKA 4N11A 4YAPA 1NW2A 2O8VB 4XHMA 4E8HA 4D73A 1G6YA 2XHFA 3FHKA 5J9BA 3ZFLA 3ZMLA 1TP9A 2M72A 2VL2C 2GQMA 1U3IA 3ZLPA 4XIHA 2VCXA 2A4HA 4MF6A 3GIXA 2WDUA 4HZ4A 4F0BA 1UVZA 3KH9A 3TRQA 3MSZA 1ZOFA 1F9MA 4FQUA 5DQYA 3QFBC 3A2XA 3QFAC 5IO0A 1WE0A 2L4QA 1GRXA 3GKMA 4I8BA 2R0GA 4IQ1A 5D9VA 3M3MA 3IK9A 1B8XA 3BJ5A 4Q5NA 4NWYA 5COHA 4G0IA 5B8BA 2F9SA 2E2GA 4GXZA 3G7JA 4GQFA 1ABAA 2RLIA 4ML1A 1XIYA 1X9WB 3ME7A 1SK2A 1A2JA 2EIRA 4POKA 1SD9A 3V1WA 3TRPA 2IMEA 1PA3A 1ERVA 3QMXA 1K0NA 4NPBA 5GAND 1OC9B 4XS4B 3FEUA 5IMVA 2QA2A 4EIPA 1AQVA 1JZRA 2H1AA 1SK1A 3J7Yb 4NXIA 5CRDA 2HI7A 2YOIA 4ML6A 1EV4A 4HJ2A 3EINA 2G0FA 2D2ZA 3HJOA 1I9DA 2GSSA 4JZQA 3EMPA 4Z7XA 1O8WA 5DAKB 4EKZA 3TKSC 4XRDA 2X8CA 2K6VA 4EUYA 2H71A 4LLRA 3PINA 3IRAA 4MJAA 1T8EB 4K7OA 2F8FA 2VM1A 3OR5A 2HSMA 4MJBA 2YN1A 1JLWA 2HRNA 5F06A 3TOUA 1WP0A 5G1LA 2AJQB 3CTFA 2VOCA 5F07A 2LUSA 3C7MA 3QD9A 5ECLB 3RHBA 1TRVA 2FCHA 3GMFA 5DALA 4BPYA 4ZBAA 1XVQA 4BL7A 4K0NA 2XPEA 1Q98A 3F3QA 2WGRA 3LGCA 1DSBA 1O8XA 4N0VA 2OE0A 3KM6A 17GSA 2BJXA 2KHPA 3IDVA 4RQRA 1SD8A 2V32A 4PUAA 4MNNA 5H5RA 4KH7A 3DXBA 1T3BA 4AF2A 1I5GA 2MMNA 4TR4A 1R4WA 4OFMA 2HFDA 2IJYA 5ID2B 5ECHB 4EF0A 3EVIA 2R3XA 2V6KA 4ECIA 2B5EA 2QGVA 1XCCA 4QL9A 5D93A 1MD4A 1HYUA 3FZ4A 3DGQA 2L6DA 5E4WA 2NBSA 4K7IA 1ZL9A 1SKRB 1K0MA 4O92A 2R6KA 5ECQB 1U87A 1XWKA 1CQGA 2JU5A 2ZNMA 4V2NA 1YKAA 1V9WA 3MIXA 4CDOA 1Z7RA 4FH8A 1VF1A 3E0UA 4CW9A 1ZGNA 3APOA 3GTUB 4Z2RA 3ZREA 1Z7PA 3F6DA 3GH9A 3SBCA 2A4VA 1GWCA 1XW9A 4NV5A 2DKHA 2MBTA 5CREA 4ZILA 2DMLA 1SU9A 2AHEA 1SL2B 4F0CA 4GLTA 3VI5A 4BVYB 3ERFA 1FO5A 3VWWA 2PVOC 4BWQA 1WOUA 2C0DA 4J2FA 5J5NA 3WYWA 2GS3A 2O87A 2LQOA 4LMWA 3TJKA 5JWOB 2HYXA 2LV3A 3F9UA 4IELA 1QGVA 4POLA 2L5OA 2H76A 9GSSA 1M7TA 2YPMA 1B4QA 4OCFA 4P3YB 4X0XA 3VPTA 1Z6MA 4BVXB 5DAKA 3KD0A 3ZYWA 3IAS2 3G7IA 1FOVA 5CP1A 3PGTA 2LRCA 1AC1A 5F0GA 2FA4A 3HDCA 3VWVA 3LXTA 5G5FA 1YF1A 1QMVA 2LJRA 3BD2A 2B1KA 3UVHA 1PKZA 1FOHA 2UZ8A 2H6XA 1E6BA 4EDYA 2FNOA 4JU5A 5A4VA 2GZZA 2GQKA 3P8WA 3K8NA 4IGJA 1A2MA 3EC3A 4N0ZA 5DVBA 4GF0A 2LJAA 1ML6A 5ECNB 1FVKA 4PUFC 3LEFA 5LNKe 1Z5YE 3EU3A 1ST9A 3IPZA 3KCMA 1XOBA 2H30A 4K0GA 2E7PA 2AB6A 3GUSA 1SYXA 4WF4A 1A0RP 1K3YA 2I1UA 1F6MC 5AIXA 3TKRA 4ZBBA 3MNGA 2C4JA 2GSQA 1MTCA 5H5SA 1V98A 4AJ7A 6GSVA 3LG6A 1C72A 4TOPA 4ZL7A 1PX6A 3TKPA 1TI1A 3FR3A 5IMZA 2YANA 3ERGA 1X5CA 2PN8A 4K2DA 1OE8A 1GSEA 2FA8A 4YKFA 2DJKA 2F51A 5D9XA 1EEJA 4XCSA 1TRWA 5CO3A 3MAKA 1R7HA 1GSYA 3DIEA 5ECSA 1T00A 4I6XA 4K8MA 1FHEA 1U6TA 4HUAA 1T7PB 3GN3A 6GSXA 1UA5A 2GZPA 3F4TA 3U5RE 2L6CA 4F03A 4ISDA 5J3RA 4KA0A 2PGTA 2YNXA 1GNEA 3GV1A 3ZTLA 3O6TA 4N30A 2WCIA 2PBJA 2DBCA 2PUKC 5HFGA 1TDIA 5GSTA 1PMTA 2K18A 4KUNA 1TK0B 4PQ1A 4KSMA 2C3NA 11GSA 4KDXA 5D9WA 2B5XA 2H75A 3UL3A 4PTSA 2FWEA 12GSA 5DJMA 1K0BA 2X8GA 1TXXA 1MDIA 4I2TA 3C73A 1QQ2A 3C1RA 1TOFA 5GAPD 3LSZA 3RPNA 2VCWA 4MF5A 1ZMAA 1K3OA 3P7XA 1TJDA 4BVXA 3FKFA 5B6MA 2NPBA 3RBTA 1VRSD 3TGZA 4KGIA 4ECCA 2C0GA 1K0DA 5EPFA 3I69A 10GSA 1EWXA 1ZYQB 3LYKA 2WJUA 3GHAA 6GSSA 3KP8A 4MK3A 3UIWA 4TXVA 4AGSA 3Q19A 2VL3A 1SJZA 2HZEA 2MMOA 3GKKA 1RQMA 1H75A 2KLXA 3GKXA 3HVSA 2R2JA 3R2QA 4TKYA 5BRTA 2V2GA 3P2AA 2OBKA 4IP1A 1FB6A 1M2DA 4WKWA 4MZBA 1AUCA 4K5SA 5FHIA 4QQ7A 4EVMA 2HT9A 2FD3A 1EEMA 2OKAA 1XWAA 22GSA 5C04A 1S3DA 3D5JA 2H19A 4DEJA 3KH7A 1YY7A 4HDEA 1X9SB 2FHEA 3GL3A 1HQOA 4H86A 4FIWA 1GLQA 4DSSA 5IMAA 8GSSA 1SYRA 1THOA 3Q6OA 1LBKA 2DMMA 2VO4A 4OO5A 1A8LA 2R4VA 3R3EA 4F2IA 3H93A 1G6WA 1BEDA 4MH2A 2CV4A 4I97A 1BQ7A 2LS5A 4KCEA 1J08A 2CVKA 2PVQA 2IMFA 2N5AA 1TU7A 2HE3A 2LSTA 3Q18A 4JEDA 5AISA 1GTUA 4DSRA 2YWNA 1KTEA 3GSTA 4ECBA 4EIQA 5KOWA 3HVVA 1PX7A 1B4PA 3RHCA 3QPMA 1JZWA 1N2AA 3ZVJA 3D0ZA 2P5RA 3QAWA 1A23A 2J9HA 4V2LA 5HQPA 5EVOA 4AJ8A 5ABRA 4O5UA 2EIOA 1Q4JA 1XWBA 5FWGA 5DCGA 4V1Ap 3GKNA 3VFIA 2H73A 2IN3A 3LW9A 3C8EA 2CAQA 3TB2A 5J4UA 3N9JA 3TOTA 5F8BA 5DDLA 2HRAA 4OO4A 4I5QA 3CSHA 4EE0A 1ERUA 1PL2A 4NHZA 4WF5A 3F4SA 4HEA2 3A5WA 2K8SA 3IHQA 1X0RA 3I6AA 3CSIA 4X4JA 2B6MA 2C3QA 3IOSA 1WJKA 3GL5A 1WMJA 5DCHA 4TN8A 3CSJA 5A5KA 2OACA 2IFQA 1GP1A 3M8NA 1A2LA 1GULA 2HSYA 4NMUA 1XW6A 3TKQA 4BA7A 4MLYA 1PN0A 2V1MA 3FK8A 4F82A 1A0FA 3EURA 3FZ9A 2IL3A 2X49A 2H6YA 3PR8A 4CY8A 3GURA 1GUKA 1ERTA 1ON4A 1RW1A 3Q74A 1E2YA 3N5OA 3CMIA 1TU8A 4KCAA 4EL1A 1GUHA 5ECRB 18GSA 4RI6A 2FWGA 4WETA 2N5BA 4TR1B 5IOWA 5L71A 1ILOA 3SWLA 4ZIJA 1T4YA 4JR4A 4MP4A 5IMFA 3DEXA 3APSA 2OJLA 5B6NA 2VL9A 2X8HA 3GYKA 3HD5A 2X64A 4J57E 1XWGA 2MMAA 1JLVA 3IC4A 3CRTA 5IIZA 5G2ZA 2LQQA 4MMMA 2GTUA 2PU9C 1GTAA 2A2PA 3RDWA 4L5LA 3EU4A 2C0FA 2L4CA 2CX3A 2C1YA 3IAM2 4NV2A 4HQZA 3GNJA 1LU4A 4POBA 4O5QA 3L9SA 2M80A 3KMNA 1MD3A 2GGTA 3UARA 2WS2A 3HKRA 3DKSA 4WXTA 2CVDA 2WRTA 4GCIA 2WFCA 2YP6A 2AAWA 3P90A 4L5OA 1XOAA 1B48A 2VCZA 4CHSA 3FR6A 4IKHA 3KGKA 2JADA 3F6FA 1GSDA 4RUVA 1UC7A 5F05A 5INYA 5LCZA 3HZ4A 2A2RA 2VL2A 4V2MA 5G30A 3HA9A 4OWYA 3H79A 2JACA 4WR4A 3F8UA 3O3TA 2R5GA 2GT6A 2CX4A 2H1BA 4LMVA 5GZZB 2HSHA 5CAXA 1OC9A 4XS4A 1PKWA 1MDJA 1OC3A 3HJMA 1U88A 2HNLA 5KN2A 4TXOB 2YV7A 2QSIA 4MCUA 5ENUA 5LD0A 5IMDA 2R0CA 2F8AA 4V1Ag 3RPPA 2QA1A 2G2QA 1TK8B 5AIVA 1GSQA 3VI7A 1TRSA 4L0UA 2DIZA 2OE1A 2PWJA 2P31A 2HRFA 2AYTA 5D73A 2ON5A 3IA1A 4I2UA 2O7KA 4QL7A 1N8JA 4ZBDA 2OADA 3L9UA 4XTSA 1VF3A 1DE2A 1AQWA 3C71A 1Z9HA 4X43A 3TJFA 4K5RA 1TTZA 4JBBA 3LFLA 2H66A 1GSSA 2LRTA 4MPGA 5EY6A 3ED3A 3FW2A 3KP9A 1AQXA 3LORA 3TJBA 3TKSA 1UN2A 4HOJA 1X5EA 6GSUA 4PURA 1EOGA 1V40A 4IW9A 2OE3A 3HVXA 4ID0A 5A4UA 4L8EA 4G19A 1AW9A 1V2AA 1OKDA 4PNGA 2BTOT 2H8LA 3DWVA 3F4RA 5HFIA 2KUCA 1PD21 2P0GA 3ZFBA 3L0HA 5ID2A 1WIKA 4YQUA 5IMCA 3IE3A 4KW6A 4TW5A 4RI7A 1KEBA 4HZ2A 1QUWA 2WZ9A 2ALBA 5AN1A 4KDUA 1YEPA 2LRNA 1OKTA 1Y25A 4G9HA 4ZL9A 1PN9A 3WGDA 3KZQA 3KTLA 2V41A 5JWQB 1R26A 1TKDB 2CVBA 3QAVA 5KN1A 4MPFA 2YWOA 2HRKA 4KF9A 4XRAA 3GTUA 4MJCA 1W89A 4F9ZA 2YV9A 4JE1A 4TR3A 4D73B 2LNTA 5DQSA 1GUMA 3UJ1A 1ZCPA 2JZSA 4K1FA 4IS0A 3U6VA 2VM2A 1YF0A 3I9V2 2IMDA 2YZUA 3ZIJA 2MBSA 1F3BA 4DSQA 4BVYA 2O85A 4CY6A 2H1GA 3M9KA 4YQVA 1XXUA 3KTBA 1R5AA 4G2EA 4ZB8A 1EZKA 3NIVA 5J9CA 4GRFA 1WWJA 5ELAA 2C80A 1O6JA 2RUFA 1J9BA 2AUVA 3UAPA 1MEKA 2I4AA 4WEYA 1S3AA 3GSSA 4GSSA 1YQ1A 2HLSA 5IQYA 1GSUA 5CRHA 4FO5A 1FB0A 5D9TA 4MZWA 3EMXA 4USSA 1M2BA 13GSA 1EP8A 3IK7A 1PL1A 1ZYNA 4KNDA 1RK4A 2KP2A 1J0FA 2H01A 1QK8A 1QXHA 3TJGA 2DIYA 2JZRA 4IJIA 4Q5QA 5G1KA 1OE7A 3TUEA 3WT2A 3APQA 4OD7A 3UVTA 3DRNA 2OA7A 4ACSA 1XFLA 2C3TA 5IPGA 1BX9A 2MYGA 3UEMA 1NM3A 3A2VA 1CQHA 2VAFA 1V57A 5HFKA 3HYPA 3GX8A 1FW1A 4XS6A 5IM9A 1OYJA 1YZXA 3RAZA 3HXSA 4EC0A 1YKCA 3D4MA 5A4WA 3CBUA 2BMXA 3FY7A 3ZITA 2L5LA 5E59A 3EWLA 1AAZA 3A2WA 4FYBA 4YQMA 3S9FA 3GFKA 1M99A 1DBYA 4HS1A 4IHUA 3A5IA 1SL1B 4GTUA 2RM5A 2IPAA 1EP7A 4O7HA 3DVWA 4YAVA 3O76A 1TW9A 1QFNA 1NHOA 1FAAA 1XPVA 3L4NA 2X99A 4Z2UA 3CXGA 1SL0B 1GTIA 2MZCA 2XPDA 1K0AA 1XBSA 2VCTA 2IMKA 3QDNA 4NHWA 3HCZA 1BAYA 1LJRA 2DC5A 2CQ9A 2HXKA 3MDKA 3IXRA 1ERWA 14GSA 2R37A 1F3AA 1FVJA 4KAEA 2DJ3A 4G10A 4HU9A 4G0KA 5JCWA 1M9BA 3UMAA 3J7Yk 4GSTA 3PH9A 1YJ6A 4KE3A 4TR0A 2PMTA 3C1SA 3UBKA 2EIQA 3G7YA 4EXJA 2REMA 3LQ7A 1O81A 4ZB6A 3ME8A 3LJRA 4Q5RA 4N10A 1SJ6A 3FMWA 3TJJA 4ZXGA 2GT5A 5ECOB 2E2MA 3F63A 2DLXA 1VGLA 3ZL5A 2TRCP 1SK0A 3HJPA 4KB3A 1GSFA 3FZAA 4LA1A 2VD1A 2DKIA 3BOAA 7GSSA 4XS1A 3US3A 2GZYA 3GH6A 1TRUA 2B7KA 2V6OA 5ECKB 3AY8A 1U3AA 1S3CA 3GRXA 3DMLA 3NZNA 1O73A 3L78A 1ZYPA 20GSA 1IYIA 5G5EA 4YH2A 2LEGA 4WBJA 2DJ1A 3GA4A 4A5PA 3H1NA 1GLPA 2DJ2A 3M9JA 1KNGA 2LKUA 3I43A 2XBIA 3ZZXA 1EOHA 3HZ8A 2GQLA 3MYDA 4IBPA 4OMVA 1SJIA 2KP1A 5ECPB 4POMA 2JL4A 1R5PA 16GSA 1THXA 2AV4A 2WB9A 2FLSA 1ACVA 2LNSA 3DD3A 4OFNA 2VLVA 5B8AA 1GTBA 4G0LA 5KN3A 2JZTA 4GQCA 4MDCA 4FYUA 2C0EA 2B7JA 2RIIA 2ZUPA 3BCIA 1OVNA 1GL8A 4MH3A 2K9FA 3NOFA 2YCDA 4L0WA 1B9XC 3A3TA 2QC7A 4WR5A 5B7CA 3FRCA 6GSYA 2VCVA 2Z9SA 1VF2A 4Z2TA 4JRRA 2RM6A 1M2AA 3VWXA 1XWCA 1KBNA 3QCPA 3W8SA 3EPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZD A;  1JFU A;  1PQN A;  3GX0 A;  5ECM B;  3VUR A;  1SEN A;  1EGR A;  4MA9 A;  2L59 A;  2LTK A;  1H4O A;  1AXD A;  1T4Z A;  2MMZ A;  2YZH A;  4PNF A;  2NTO A;  3F3R A;  2IMI A;  3CYN A;  1SKW B;  3UBL A;  2L57 A;  1GNW A;  5AGY A;  1YEX A;  5JCU A;  4E8E A;  5DJL A;  1M9A A;  1HNB A;  3ZMK A;  3EE2 A;  4IQA A;  3HHV A;  4O5R A;  2JSZ A;  4ECJ A;  2KOK A;  3FYG A;  4AJ6 A;  1T1V A;  2M46 A;  4HI7 A;  2YJH A;  3FZ5 A;  4FYC A;  5HR0 A;  3FR9 A;  1NHY A;  4JR6 A;  2YWI A;  2PPT A;  2RUE A;  4NAX A;  2VD0 A;  3F0I A;  1OC8 A;  2B1L A;  5CNW A;  2TRX A;  4PQI A;  1F37 A;  3H8Q A;  1BJX A;  2P5Q A;  3TDG A;  2CA8 A;  2H6Z A;  3LXZ A;  2GDR A;  1VF4 A;  2TIR A;  5KN0 A;  4KDY A;  2CT6 A;  3D21 A;  3M0F A;  2H0H A;  1A24 A;  4X1U A;  1PSQ A;  4KX4 A;  5ECI B;  2ON7 A;  4MF7 A;  2FUG 2;  2I9H A;  4ILF A;  4Q5F A;  1JHB A;  3QAG A;  1XZO A;  1X5D A;  1A8Y A;  2QKE A;  4K9Z A;  1TI3 A;  2O89 A;  1M0U A;  1W4V A;  4TR1 A;  1TK5 B;  2H72 A;  1URM A;  2HZE B;  1HD2 A;  5FT3 A;  3DVX A;  3ZIV A;  4MJE A;  3MWH A;  4ZB9 A;  5HR3 A;  1HNA A;  4K7N A;  2VIM A;  4HQS A;  2N5F A;  5KEJ A;  4PGT A;  3LYP A;  5CYY A;  3LWA A;  5H5Q A;  2JSY A;  2I81 A;  2E0Q A;  4K6X A;  1Z6N A;  2C8U A;  3BBY A;  2WUL A;  3WT1 A;  3VWU A;  2CZ2 A;  1XW5 A;  4DSS B;  3IV4 A;  4J56 E;  3ZVJ D;  1K0O A;  3WGE A;  2YWM A;  4PXO A;  5EL8 A;  3DYR A;  4GSN A;  4HJM A;  5G31 A;  6GST A;  1USB A;  5GSS A;  2EC4 A;  3WD6 A;  2XBQ A;  1AIU A;  3VPQ A;  4OCE A;  1O7U A;  2VCQ A;  2VLT A;  3IR4 A;  3HY2 A;  3D6I A;  1EV9 A;  3W8J A;  2PER A;  4IN0 A;  4IJ3 A;  2FGX A;  1WPI A;  3QR6 A;  5IPH A;  3E3E A;  3CTG A;  1F2E A;  3VK9 A;  2DJJ A;  3TRX A;  4ULX A;  1SKS B;  1G0T A;  4EDZ A;  2H74 A;  1PRX A;  2H0G A;  4O32 A;  3ERW A;  2VUP A;  1MDK A;  5C00 A;  1DE1 A;  1FG4 A;  3TCO A;  1JZO A;  2H70 A;  4TXO A;  5JWR B;  6GSW A;  1BG5 A;  2OBI A;  2DSA A;  5DBQ A;  2H0I A;  2GST A;  4TRX A;  2CZ3 A;  1PGT A;  4BWS A;  5D96 A;  3KJY A;  1K0C A;  2NVL A;  4HU7 A;  1OAZ A;  5D8I A;  1YDK A;  3H4K A;  2XC2 A;  1X9M B;  2ES7 A;  4DVC A;  5J41 A;  1HNC A;  2NDO A;  1Y6E A;  1O85 A;  4WBR D;  4KSO A;  4IVF A;  3ISO A;  5HR2 A;  3KMO A;  1ZZY A;  2FY6 A;  2K8V A;  1K3L A;  5HR1 A;  2GSR A;  4PQH A;  2B5Y A;  4MAB A;  2H1D A;  4TVE A;  3D22 A;  5CRG A;  5IOX A;  2F3M A;  1V58 A;  19GS A;  3QOU A;  2ZCT A;  2IFQ B;  1WRY A;  4MZC A;  4EO3 A;  3VLN A;  5IO2 A;  3KXO A;  1EGO A;  3G9B A;  2B3S A;  3JCM L;  5JCG A;  1G7E A;  3KEB A;  2FWF A;  2CAI A;  3CRU A;  2LJK A;  5ELG A;  3UOM A;  1B9Y C;  3ZRD A;  4PX1 A;  5DAL B;  3D4T A;  2GVP A;  1Z3E A;  2DJ0 A;  3IBH A;  3WGX A;  2GLR A;  3KIJ A;  2J23 A;  4LL4 B;  1DUG A;  2IIY A;  1XVW A;  3W6G A;  1ZYE A;  2YJ7 A;  2A2S A;  1NSW A;  1GH2 A;  5CRW A;  4ZL8 A;  3TKS E;  4GWR A;  3E9J B;  3L9V A;  4OFT A;  1BYE A;  4IP6 A;  2I3Y A;  2FWH A;  2HZF A;  4LL1 B;  3M1G A;  1G7O A;  3EYT A;  1IYH A;  2IWT A;  4RQX A;  2VLU A;  3BCK A;  4N11 A;  4YAP A;  1NW2 A;  2O8V B;  4XHM A;  4E8H A;  4D73 A;  1G6Y A;  2XHF A;  3FHK A;  5J9B A;  3ZFL A;  3ZML A;  1TP9 A;  2M72 A;  2VL2 C;  2GQM A;  1U3I A;  3ZLP A;  4XIH A;  2VCX A;  4MF6 A;  3GIX A;  2WDU A;  4HZ4 A;  4F0B A;  1UVZ A;  3KH9 A;  3TRQ A;  3MSZ A;  1ZOF A;  1F9M A;  5DQY A;  3QFB C;  3A2X A;  3QFA C;  5IO0 A;  1WE0 A;  2L4Q A;  1GRX A;  3GKM A;  4I8B A;  4IQ1 A;  5D9V A;  3M3M A;  3IK9 A;  1B8X A;  3BJ5 A;  4Q5N A;  4NWY A;  5COH A;  5B8B A;  2F9S A;  2E2G A;  4GXZ A;  3G7J A;  4GQF A;  1ABA A;  2RLI A;  4ML1 A;  1XIY A;  1X9W B;  3ME7 A;  1SK2 A;  1A2J A;  2EIR A;  4POK A;  1SD9 A;  3V1W A;  3TRP A;  2IME A;  1PA3 A;  1ERV A;  3QMX A;  1K0N A;  4NPB A;  5GAN D;  1OC9 B;  4XS4 B;  3FEU A;  5IMV A;  1AQV A;  1JZR A;  2H1A A;  1SK1 A;  3J7Y b;  4NXI A;  5CRD A;  2HI7 A;  2YOI A;  4ML6 A;  1EV4 A;  4HJ2 A;  3EIN A;  2G0F A;  2D2Z A;  3HJO A;  1I9D A;  2GSS A;  4JZQ A;  3EMP A;  4Z7X A;  1O8W A;  5DAK B;  4EKZ A;  3TKS C;  4XRD A;  2X8C A;  2K6V A;  4EUY A;  2H71 A;  4LLR A;  3PIN A;  3IRA A;  4MJA A;  1T8E B;  4K7O A;  2F8F A;  2VM1 A;  3OR5 A;  4MJB A;  2YN1 A;  1JLW A;  2HRN A;  5F06 A;  3TOU A;  1WP0 A;  5G1L A;  2AJQ B;  3CTF A;  2VOC A;  5F07 A;  2LUS A;  3C7M A;  3QD9 A;  5ECL B;  3RHB A;  1TRV A;  2FCH A;  3GMF A;  5DAL A;  4BPY A;  4ZBA A;  1XVQ A;  4BL7 A;  4K0N A;  2XPE A;  1Q98 A;  3F3Q A;  2WGR A;  3LGC A;  1DSB A;  1O8X A;  4N0V A;  2OE0 A;  3KM6 A;  17GS A;  2BJX A;  2KHP A;  3IDV A;  4RQR A;  1SD8 A;  2V32 A;  4PUA A;  5H5R A;  4KH7 A;  3DXB A;  1T3B A;  4AF2 A;  1I5G A;  2MMN A;  4TR4 A;  1R4W A;  4OFM A;  2HFD A;  2IJY A;  5ID2 B;  5ECH B;  4EF0 A;  3EVI A;  2R3X A;  2V6K A;  4ECI A;  2B5E A;  2QGV A;  1XCC A;  4QL9 A;  5D93 A;  1MD4 A;  1HYU A;  3FZ4 A;  3DGQ A;  2L6D A;  5E4W A;  2NBS A;  4K7I A;  1ZL9 A;  1SKR B;  1K0M A;  4O92 A;  2R6K A;  5ECQ B;  1U87 A;  1XWK A;  1CQG A;  2JU5 A;  2ZNM A;  4V2N A;  1YKA A;  1V9W A;  4CDO A;  1Z7R A;  4FH8 A;  1VF1 A;  3E0U A;  4CW9 A;  1ZGN A;  3APO A;  3GTU B;  3ZRE A;  1Z7P A;  3F6D A;  3GH9 A;  3SBC A;  2A4V A;  1GWC A;  1XW9 A;  4NV5 A;  2MBT A;  5CRE A;  4ZIL A;  2DML A;  1SU9 A;  2AHE A;  1SL2 B;  4F0C A;  4GLT A;  3VI5 A;  3ERF A;  1FO5 A;  3VWW A;  2PVO C;  4BWQ A;  1WOU A;  2C0D A;  4J2F A;  5J5N A;  3WYW A;  2GS3 A;  2O87 A;  2LQO A;  4LMW A;  3TJK A;  5JWO B;  2HYX A;  2LV3 A;  3F9U A;  4IEL A;  1QGV A;  4POL A;  2L5O A;  2H76 A;  9GSS A;  1M7T A;  2YPM A;  1B4Q A;  4OCF A;  4P3Y B;  4X0X A;  3VPT A;  1Z6M A;  5DAK A;  3KD0 A;  3ZYW A;  3IAS 2;  3G7I A;  1FOV A;  5CP1 A;  3PGT A;  2LRC A;  1AC1 A;  5F0G A;  2FA4 A;  3HDC A;  3VWV A;  3LXT A;  5G5F A;  1YF1 A;  1QMV A;  2LJR A;  3BD2 A;  2B1K A;  3UVH A;  1PKZ A;  2H6X A;  1E6B A;  4EDY A;  2FNO A;  4JU5 A;  5A4V A;  2GZZ A;  2GQK A;  3P8W A;  3K8N A;  4IGJ A;  1A2M A;  3EC3 A;  4N0Z A;  5DVB A;  4GF0 A;  2LJA A;  1ML6 A;  5ECN B;  1FVK A;  4PUF C;  3LEF A;  5LNK e;  1Z5Y E;  3EU3 A;  1ST9 A;  3IPZ A;  3KCM A;  1XOB A;  2H30 A;  4K0G A;  2E7P A;  2AB6 A;  3GUS A;  1SYX A;  4WF4 A;  1A0R P;  1K3Y A;  2I1U A;  1F6M C;  5AIX A;  3TKR A;  4ZBB A;  3MNG A;  2C4J A;  2GSQ A;  1MTC A;  5H5S A;  1V98 A;  4AJ7 A;  6GSV A;  3LG6 A;  1C72 A;  4TOP A;  4ZL7 A;  1PX6 A;  3TKP A;  1TI1 A;  3FR3 A;  5IMZ A;  2YAN A;  3ERG A;  1X5C A;  2PN8 A;  4K2D A;  1OE8 A;  1GSE A;  2FA8 A;  2DJK A;  2F51 A;  5D9X A;  1EEJ A;  4XCS A;  1TRW A;  5CO3 A;  3MAK A;  1R7H A;  1GSY A;  3DIE A;  5ECS A;  1T00 A;  4I6X A;  4K8M A;  1FHE A;  1U6T A;  4HUA A;  1T7P B;  3GN3 A;  6GSX A;  1UA5 A;  2GZP A;  3F4T A;  3U5R E;  2L6C A;  4F03 A;  4ISD A;  5J3R A;  4KA0 A;  2PGT A;  2YNX A;  1GNE A;  3GV1 A;  3ZTL A;  3O6T A;  4N30 A;  2WCI A;  2PBJ A;  2DBC A;  2PUK C;  5HFG A;  1TDI A;  5GST A;  1PMT A;  2K18 A;  4KUN A;  1TK0 B;  4PQ1 A;  4KSM A;  2C3N A;  11GS A;  4KDX A;  5D9W A;  2B5X A;  2H75 A;  3UL3 A;  2FWE A;  12GS A;  5DJM A;  1K0B A;  2X8G A;  1TXX A;  1MDI A;  4I2T A;  3C73 A;  1QQ2 A;  3C1R A;  1TOF A;  5GAP D;  3LSZ A;  3RPN A;  2VCW A;  4MF5 A;  1ZMA A;  1K3O A;  3P7X A;  1TJD A;  4BVX A;  3FKF A;  5B6M A;  2NPB A;  3RBT A;  1VRS D;  3TGZ A;  4KGI A;  4ECC A;  2C0G A;  1K0D A;  5EPF A;  3I69 A;  10GS A;  1EWX A;  1ZYQ B;  3LYK A;  2WJU A;  3GHA A;  6GSS A;  3KP8 A;  4MK3 A;  3UIW A;  4TXV A;  4AGS A;  3Q19 A;  2VL3 A;  1SJZ A;  2HZE A;  2MMO A;  3GKK A;  1RQM A;  1H75 A;  2KLX A;  3GKX A;  3HVS A;  2R2J A;  3R2Q A;  4TKY A;  2V2G A;  3P2A A;  2OBK A;  4IP1 A;  1FB6 A;  1M2D A;  4WKW A;  4MZB A;  1AUC A;  5FHI A;  4QQ7 A;  4EVM A;  2HT9 A;  2FD3 A;  1EEM A;  2OKA A;  1XWA A;  22GS A;  5C04 A;  1S3D A;  3D5J A;  2H19 A;  4DEJ A;  3KH7 A;  1YY7 A;  4HDE A;  1X9S B;  2FHE A;  3GL3 A;  1HQO A;  4H86 A;  4FIW A;  1GLQ A;  4DSS A;  5IMA A;  8GSS A;  1SYR A;  1THO A;  3Q6O A;  1LBK A;  2DMM A;  2VO4 A;  4OO5 A;  1A8L A;  2R4V A;  4F2I A;  3H93 A;  1G6W A;  1BED A;  4MH2 A;  2CV4 A;  4I97 A;  1BQ7 A;  2LS5 A;  4KCE A;  1J08 A;  2CVK A;  2PVQ A;  2IMF A;  2N5A A;  1TU7 A;  2HE3 A;  2LST A;  3Q18 A;  4JED A;  5AIS A;  1GTU A;  4DSR A;  2YWN A;  1KTE A;  3GST A;  4ECB A;  3HVV A;  1PX7 A;  1B4P A;  3RHC A;  3QPM A;  1JZW A;  1N2A A;  3ZVJ A;  3D0Z A;  2P5R A;  3QAW A;  1A23 A;  2J9H A;  4V2L A;  5HQP A;  5EVO A;  4AJ8 A;  5ABR A;  2EIO A;  1Q4J A;  1XWB A;  5FWG A;  5DCG A;  4V1A p;  3GKN A;  3VFI A;  2H73 A;  2IN3 A;  3C8E A;  2CAQ A;  3TB2 A;  5J4U A;  3N9J A;  3TOT A;  5F8B A;  5DDL A;  4OO4 A;  4I5Q A;  3CSH A;  4EE0 A;  1ERU A;  1PL2 A;  4NHZ A;  4WF5 A;  3F4S A;  4HEA 2;  3A5W A;  2K8S A;  3IHQ A;  1X0R A;  3I6A A;  3CSI A;  2B6M A;  2C3Q A;  3IOS A;  1WJK A;  3GL5 A;  1WMJ A;  5DCH A;  4TN8 A;  3CSJ A;  5A5K A;  2OAC A;  2IFQ A;  1GP1 A;  3M8N A;  1A2L A;  1GUL A;  2HSY A;  4NMU A;  1XW6 A;  3TKQ A;  4BA7 A;  4MLY A;  2V1M A;  3FK8 A;  4F82 A;  1A0F A;  3EUR A;  3FZ9 A;  2IL3 A;  2H6Y A;  3PR8 A;  3GUR A;  1GUK A;  1ERT A;  1ON4 A;  1RW1 A;  3Q74 A;  1E2Y A;  3N5O A;  3CMI A;  1TU8 A;  4KCA A;  4EL1 A;  1GUH A;  5ECR B;  18GS A;  4RI6 A;  2FWG A;  4WET A;  2N5B A;  4TR1 B;  5IOW A;  5L71 A;  1ILO A;  3SWL A;  4ZIJ A;  1T4Y A;  4JR4 A;  4MP4 A;  5IMF A;  3DEX A;  3APS A;  2OJL A;  5B6N A;  2VL9 A;  2X8H A;  3GYK A;  3HD5 A;  2X64 A;  4J57 E;  1XWG A;  2MMA A;  1JLV A;  3IC4 A;  3CRT A;  5IIZ A;  5G2Z A;  2LQQ A;  4MMM A;  2GTU A;  2PU9 C;  1GTA A;  3RDW A;  4L5L A;  3EU4 A;  2C0F A;  2L4C A;  2CX3 A;  2C1Y A;  3IAM 2;  4NV2 A;  4HQZ A;  3GNJ A;  1LU4 A;  4POB A;  3L9S A;  2M80 A;  3KMN A;  1MD3 A;  2GGT A;  3UAR A;  2WS2 A;  3HKR A;  3DKS A;  4WXT A;  2CVD A;  2WRT A;  4GCI A;  2WFC A;  2YP6 A;  2AAW A;  3P90 A;  4L5O A;  1XOA A;  1B48 A;  2VCZ A;  4CHS A;  3FR6 A;  4IKH A;  3KGK A;  2JAD A;  3F6F A;  1GSD A;  4RUV A;  1UC7 A;  5F05 A;  5INY A;  5LCZ A;  3HZ4 A;  2A2R A;  2VL2 A;  4V2M A;  5G30 A;  3HA9 A;  4OWY A;  3H79 A;  2JAC A;  4WR4 A;  3F8U A;  3O3T A;  2R5G A;  2GT6 A;  2CX4 A;  2H1B A;  4LMV A;  5GZZ B;  2HSH A;  5CAX A;  1OC9 A;  4XS4 A;  1PKW A;  1MDJ A;  1OC3 A;  3HJM A;  1U88 A;  2HNL A;  5KN2 A;  4TXO B;  2YV7 A;  2QSI A;  4MCU A;  5ENU A;  5LD0 A;  5IMD A;  2F8A A;  4V1A g;  3RPP A;  2G2Q A;  1TK8 B;  5AIV A;  1GSQ A;  3VI7 A;  1TRS A;  4L0U A;  2DIZ A;  2OE1 A;  2PWJ A;  2P31 A;  2HRF A;  2AYT A;  5D73 A;  2ON5 A;  3IA1 A;  4I2U A;  2O7K A;  4QL7 A;  1N8J A;  4ZBD A;  2OAD A;  3L9U A;  4XTS A;  1VF3 A;  1DE2 A;  1AQW A;  3C71 A;  1Z9H A;  4X43 A;  3TJF A;  1TTZ A;  4JBB A;  3LFL A;  2H66 A;  1GSS A;  2LRT A;  4MPG A;  5EY6 A;  3ED3 A;  3FW2 A;  3KP9 A;  1AQX A;  3LOR A;  3TJB A;  3TKS A;  1UN2 A;  4HOJ A;  1X5E A;  6GSU A;  4PUR A;  1EOG A;  1V40 A;  4IW9 A;  2OE3 A;  3HVX A;  4ID0 A;  5A4U A;  4L8E A;  4G19 A;  1AW9 A;  1V2A A;  1OKD A;  4PNG A;  2BTO T;  2H8L A;  3DWV A;  3F4R A;  5HFI A;  2KUC A;  1PD2 1;  2P0G A;  3ZFB A;  3L0H A;  5ID2 A;  1WIK A;  4YQU A;  5IMC A;  3IE3 A;  4KW6 A;  4TW5 A;  4RI7 A;  1KEB A;  4HZ2 A;  1QUW A;  2WZ9 A;  2ALB A;  5AN1 A;  4KDU A;  1YEP A;  2LRN A;  1OKT A;  1Y25 A;  4G9H A;  4ZL9 A;  1PN9 A;  3WGD A;  3KZQ A;  3KTL A;  2V41 A;  5JWQ B;  1R26 A;  1TKD B;  2CVB A;  3QAV A;  5KN1 A;  4MPF A;  2YWO A;  4XRA A;  3GTU A;  4MJC A;  1W89 A;  4F9Z A;  2YV9 A;  4JE1 A;  4TR3 A;  4D73 B;  2LNT A;  5DQS A;  1GUM A;  3UJ1 A;  1ZCP A;  2JZS A;  4K1F A;  4IS0 A;  3U6V A;  2VM2 A;  1YF0 A;  3I9V 2;  2IMD A;  2YZU A;  3ZIJ A;  2MBS A;  1F3B A;  4DSQ A;  4BVY A;  2O85 A;  2H1G A;  3M9K A;  4YQV A;  1XXU A;  3KTB A;  1R5A A;  4G2E A;  4ZB8 A;  1EZK A;  3NIV A;  5J9C A;  4GRF A;  1WWJ A;  5ELA A;  2C80 A;  1O6J A;  2RUF A;  1J9B A;  2AUV A;  3UAP A;  1MEK A;  2I4A A;  4WEY A;  1S3A A;  3GSS A;  4GSS A;  1YQ1 A;  2HLS A;  5IQY A;  1GSU A;  5CRH A;  4FO5 A;  1FB0 A;  5D9T A;  4MZW A;  3EMX A;  1M2B A;  13GS A;  1EP8 A;  3IK7 A;  1PL1 A;  1J0F A;  4KND A;  1RK4 A;  2KP2 A;  2H01 A;  1QK8 A;  1QXH A;  3TJG A;  2DIY A;  2JZR A;  4IJI A;  4Q5Q A;  5G1K A;  1OE7 A;  3TUE A;  3WT2 A;  3APQ A;  4OD7 A;  3UVT A;  3DRN A;  2OA7 A;  4ACS A;  1XFL A;  2C3T A;  5IPG A;  1BX9 A;  2MYG A;  3UEM A;  1NM3 A;  3A2V A;  1CQH A;  2VAF A;  1V57 A;  5HFK A;  3HYP A;  3GX8 A;  1FW1 A;  4XS6 A;  5IM9 A;  1OYJ A;  1YZX A;  3RAZ A;  3HXS A;  4EC0 A;  1YKC A;  3D4M A;  5A4W A;  3CBU A;  2BMX A;  3FY7 A;  3ZIT A;  2L5L A;  5E59 A;  3EWL A;  1AAZ A;  3A2W A;  4FYB A;  4YQM A;  3S9F A;  3GFK A;  1M99 A;  1DBY A;  4HS1 A;  4IHU A;  1SL1 B;  4GTU A;  2RM5 A;  2IPA A;  1EP7 A;  4O7H A;  3DVW A;  4YAV A;  3O76 A;  1TW9 A;  1QFN A;  1NHO A;  1FAA A;  1XPV A;  3L4N A;  2X99 A;  3CXG A;  1SL0 B;  1GTI A;  2MZC A;  2XPD A;  1K0A A;  1XBS A;  2VCT A;  2IMK A;  3QDN A;  4NHW A;  3HCZ A;  1BAY A;  1LJR A;  2DC5 A;  2CQ9 A;  2HXK A;  3MDK A;  3IXR A;  1ERW A;  14GS A;  2R37 A;  1F3A A;  1FVJ A;  4KAE A;  2DJ3 A;  4G10 A;  4HU9 A;  5JCW A;  1M9B A;  3UMA A;  3J7Y k;  4GST A;  3PH9 A;  1YJ6 A;  4KE3 A;  4TR0 A;  2PMT A;  3C1S A;  3UBK A;  2EIQ A;  3G7Y A;  4EXJ A;  2REM A;  3LQ7 A;  1O81 A;  4ZB6 A;  3ME8 A;  3LJR A;  4Q5R A;  4N10 A;  1SJ6 A;  3TJJ A;  4ZXG A;  2GT5 A;  5ECO B;  2E2M A;  3F63 A;  2DLX A;  1VGL A;  3ZL5 A;  2TRC P;  1SK0 A;  3HJP A;  4KB3 A;  1GSF A;  3FZA A;  4LA1 A;  2VD1 A;  3BOA A;  7GSS A;  4XS1 A;  3US3 A;  2GZY A;  3GH6 A;  1TRU A;  2B7K A;  2V6O A;  5ECK B;  3AY8 A;  1U3A A;  1S3C A;  3GRX A;  3DML A;  3NZN A;  1O73 A;  3L78 A;  20GS A;  1IYI A;  5G5E A;  4YH2 A;  2LEG A;  4WBJ A;  2DJ1 A;  3GA4 A;  3H1N A;  1GLP A;  2DJ2 A;  3M9J A;  1KNG A;  2LKU A;  3I43 A;  2XBI A;  3ZZX A;  1EOH A;  3HZ8 A;  2GQL A;  4IBP A;  4OMV A;  1SJI A;  2KP1 A;  5ECP B;  4POM A;  2JL4 A;  1R5P A;  16GS A;  1THX A;  2AV4 A;  2WB9 A;  2FLS A;  1ACV A;  2LNS A;  3DD3 A;  4OFN A;  2VLV A;  5B8A A;  1GTB A;  5KN3 A;  2JZT A;  4GQC A;  4MDC A;  4FYU A;  2C0E A;  2B7J A;  2RII A;  2ZUP A;  3BCI A;  1OVN A;  1GL8 A;  4MH3 A;  2K9F A;  3NOF A;  2YCD A;  4L0W A;  1B9X C;  3A3T A;  2QC7 A;  4WR5 A;  5B7C A;  3FRC A;  6GSY A;  2VCV A;  2Z9S A;  1VF2 A;  4JRR A;  2RM6 A;  1M2A A;  3VWX A;  1XWC A;  1KBN A;  3QCP A;  3W8S A; 
#chains in the Genus database with same CATH topology
 3PPU A;  1JZD A;  1JFU A;  1PQN A;  3GX0 A;  5ECM B;  3VUR A;  1SEN A;  1EGR A;  4MA9 A;  2L59 A;  2LTK A;  1H4O A;  1AXD A;  1T4Z A;  2MMZ A;  4ICY A;  2YZH A;  4PNF A;  2NTO A;  3F3R A;  2IMI A;  3CYN A;  1SKW B;  3UBL A;  2L57 A;  1GNW A;  5AGY A;  1YEX A;  5JCU A;  4E8E A;  5DJL A;  1M9A A;  1HNB A;  3ZMK A;  3EE2 A;  4IQA A;  3HHV A;  4O5R A;  2JSZ A;  4ECJ A;  2KOK A;  3FYG A;  4AJ6 A;  1T1V A;  2M46 A;  4HI7 A;  4K2X A;  2YJH A;  3FZ5 A;  4FYC A;  5HR0 A;  3FR9 A;  1NHY A;  4JR6 A;  2YWI A;  2PPT A;  2RUE A;  4NAX A;  2VD0 A;  3F0I A;  1OC8 A;  2B1L A;  5CNW A;  2TRX A;  4PQI A;  1F37 A;  3H8Q A;  1BJX A;  2P5Q A;  3TDG A;  2CA8 A;  3IC8 A;  2H6Z A;  3LXZ A;  2GDR A;  1VF4 A;  2TIR A;  5KN0 A;  4KDY A;  2CT6 A;  3D21 A;  3M0F A;  2H0H A;  3HVN A;  1A24 A;  3IHG A;  4X1U A;  1PSQ A;  4KX4 A;  5ECI B;  2ON7 A;  4MF7 A;  2FUG 2;  2I9H A;  4ILF A;  4Q5F A;  1JHB A;  3QAG A;  1XZO A;  1X5D A;  1A8Y A;  2QKE A;  4K9Z A;  1TI3 A;  2O89 A;  1M0U A;  1W4V A;  4TR1 A;  1TK5 B;  2H72 A;  1URM A;  2HZE B;  1HD2 A;  5FT3 A;  3DVX A;  3ZIV A;  4MJE A;  3MWH A;  4ZB9 A;  5HR3 A;  1HNA A;  4K7N A;  2VIM A;  4HQS A;  2N5F A;  5KEJ A;  1M3J A;  4PGT A;  3LYP A;  5CYY A;  3LWA A;  5H5Q A;  2JSY A;  2I81 A;  2E0Q A;  4K6X A;  1Z6N A;  2C8U A;  3BBY A;  2WUL A;  3WT1 A;  3VWU A;  2CZ2 A;  1XW5 A;  4DSS B;  3IV4 A;  4J56 E;  4HSC X;  3ZVJ D;  1K0O A;  3WGE A;  2YWM A;  4PXO A;  5EL8 A;  3DYR A;  4GSN A;  4HJM A;  5G31 A;  6GST A;  1USB A;  5GSS A;  2EC4 A;  3WD6 A;  2XBQ A;  1AIU A;  3VPQ A;  4OCE A;  1O7U A;  2VCQ A;  2VLT A;  3IR4 A;  3HY2 A;  3D6I A;  1EV9 A;  3W8J A;  2PER A;  4IN0 A;  4IJ3 A;  4YKG A;  2FGX A;  1WPI A;  3QR6 A;  5IPH A;  3E3E A;  3CTG A;  1F2E A;  3VK9 A;  2DJJ A;  3TRX A;  4ULX A;  1SKS B;  1G0T A;  4EDZ A;  2H74 A;  1PRX A;  2H0G A;  4O32 A;  3ERW A;  2VUP A;  1MDK A;  5C00 A;  1DE1 A;  1FG4 A;  3TCO A;  1JZO A;  2H70 A;  4TXO A;  5JWR B;  6GSW A;  1BG5 A;  2OBI A;  2DSA A;  5DBQ A;  2H0I A;  2GST A;  4TRX A;  2CZ3 A;  1PGT A;  4BWS A;  5D96 A;  3KJY A;  1K0C A;  2NVL A;  4HU7 A;  1OAZ A;  5D8I A;  1YDK A;  3H4K A;  2XC2 A;  1X9M B;  2ES7 A;  4DVC A;  5J41 A;  1HNC A;  2NDO A;  1Y6E A;  1O85 A;  4WBR D;  4KSO A;  5BMU A;  4IVF A;  3ISO A;  5HR2 A;  1PFO A;  3KMO A;  1ZZY A;  2FY6 A;  2K8V A;  1K3L A;  5HR1 A;  2GSR A;  4PQH A;  2B5Y A;  4MAB A;  2H1D A;  4TVE A;  3D22 A;  5CRG A;  5IOX A;  2F3M A;  1V58 A;  19GS A;  3QOU A;  2R0P A;  2IFQ B;  2ZCT A;  1WRY A;  4MZC A;  4EO3 A;  3VLN A;  5IO2 A;  3KXO A;  1EGO A;  3G9B A;  2B3S A;  3JCM L;  5JCG A;  1G7E A;  3KEB A;  2FWF A;  2CAI A;  3CRU A;  2LJK A;  5ELG A;  2X4A A;  3UOM A;  1B9Y C;  3ZRD A;  4PX1 A;  5DAL B;  3D4T A;  2GVP A;  1Z3E A;  2DJ0 A;  3IBH A;  5KOX A;  3WGX A;  2GLR A;  4BL7 B;  3KIJ A;  2J23 A;  4LL4 B;  1DUG A;  2IIY A;  1XVW A;  3W6G A;  1ZYE A;  2YJ7 A;  2A2S A;  1NSW A;  1GH2 A;  5CRW A;  4ZL8 A;  3TKS E;  4GWR A;  3E9J B;  3L9V A;  4OFT A;  1BYE A;  4IP6 A;  2I3Y A;  2FWH A;  2HZF A;  4LL1 B;  3M1G A;  1G7O A;  3EYT A;  1IYH A;  2IWT A;  4RQX A;  2VLU A;  3BCK A;  4N11 A;  4YAP A;  1NW2 A;  2O8V B;  4XHM A;  4E8H A;  4D73 A;  1G6Y A;  2XHF A;  3FHK A;  5J9B A;  3ZFL A;  3ZML A;  1TP9 A;  2M72 A;  2VL2 C;  2GQM A;  1U3I A;  3ZLP A;  4XIH A;  2VCX A;  2A4H A;  4MF6 A;  3GIX A;  2WDU A;  4HZ4 A;  4F0B A;  1UVZ A;  3KH9 A;  3TRQ A;  3MSZ A;  1ZOF A;  1F9M A;  4FQU A;  5DQY A;  3QFB C;  3A2X A;  3QFA C;  5IO0 A;  1WE0 A;  2L4Q A;  1GRX A;  3GKM A;  4I8B A;  2R0G A;  4IQ1 A;  5D9V A;  3M3M A;  3IK9 A;  1B8X A;  3BJ5 A;  4Q5N A;  4NWY A;  5COH A;  4G0I A;  5B8B A;  2F9S A;  2E2G A;  4GXZ A;  3G7J A;  4GQF A;  1ABA A;  2RLI A;  4ML1 A;  1XIY A;  1X9W B;  3ME7 A;  1SK2 A;  1A2J A;  2EIR A;  4POK A;  1SD9 A;  3V1W A;  3TRP A;  2IME A;  1PA3 A;  1ERV A;  3QMX A;  1K0N A;  4NPB A;  5GAN D;  1OC9 B;  4XS4 B;  3FEU A;  5IMV A;  2QA2 A;  4EIP A;  1AQV A;  1JZR A;  2H1A A;  1SK1 A;  3J7Y b;  4NXI A;  5CRD A;  2HI7 A;  2YOI A;  4ML6 A;  1EV4 A;  4HJ2 A;  3EIN A;  2G0F A;  2D2Z A;  3HJO A;  1I9D A;  2GSS A;  4JZQ A;  3EMP A;  4Z7X A;  1O8W A;  5DAK B;  4EKZ A;  3TKS C;  4XRD A;  2X8C A;  2K6V A;  4EUY A;  2H71 A;  4LLR A;  3PIN A;  3IRA A;  4MJA A;  1T8E B;  4K7O A;  2F8F A;  2VM1 A;  3OR5 A;  2HSM A;  4MJB A;  2YN1 A;  1JLW A;  2HRN A;  5F06 A;  3TOU A;  1WP0 A;  5G1L A;  2AJQ B;  3CTF A;  2VOC A;  5F07 A;  2LUS A;  3C7M A;  3QD9 A;  5ECL B;  3RHB A;  1TRV A;  2FCH A;  3GMF A;  5DAL A;  4BPY A;  4ZBA A;  1XVQ A;  4BL7 A;  4K0N A;  2XPE A;  1Q98 A;  3F3Q A;  2WGR A;  3LGC A;  1DSB A;  1O8X A;  4N0V A;  2OE0 A;  3KM6 A;  17GS A;  2BJX A;  2KHP A;  3IDV A;  4RQR A;  1SD8 A;  2V32 A;  4PUA A;  4MNN A;  5H5R A;  4KH7 A;  3DXB A;  1T3B A;  4AF2 A;  1I5G A;  2MMN A;  4TR4 A;  1R4W A;  4OFM A;  2HFD A;  2IJY A;  5ID2 B;  5ECH B;  4EF0 A;  3EVI A;  2R3X A;  2V6K A;  4ECI A;  1M3I A;  2B5E A;  2QGV A;  1XCC A;  4QL9 A;  5D93 A;  1MD4 A;  1HYU A;  3FZ4 A;  3DGQ A;  2L6D A;  5E4W A;  2NBS A;  4K7I A;  1ZL9 A;  1SKR B;  1K0M A;  4O92 A;  2R6K A;  5ECQ B;  1U87 A;  1XWK A;  1CQG A;  2JU5 A;  2ZNM A;  4V2N A;  1YKA A;  1V9W A;  3MIX A;  4CDO A;  1Z7R A;  4FH8 A;  1VF1 A;  3E0U A;  4CW9 A;  1ZGN A;  3APO A;  3GTU B;  4Z2R A;  3ZRE A;  1Z7P A;  3F6D A;  3GH9 A;  3SBC A;  2A4V A;  1GWC A;  1XW9 A;  4NV5 A;  2DKH A;  2MBT A;  5CRE A;  4ZIL A;  2DML A;  1SU9 A;  2AHE A;  1SL2 B;  4F0C A;  4GLT A;  3VI5 A;  4BVY B;  3ERF A;  1FO5 A;  3VWW A;  2PVO C;  4BWQ A;  1WOU A;  2C0D A;  4J2F A;  5J5N A;  3WYW A;  2GS3 A;  2O87 A;  2LQO A;  4LMW A;  3TJK A;  5JWO B;  2HYX A;  2LV3 A;  3F9U A;  4IEL A;  1QGV A;  4POL A;  2L5O A;  2H76 A;  9GSS A;  1M7T A;  2YPM A;  1B4Q A;  4OCF A;  4P3Y B;  4X0X A;  3VPT A;  1Z6M A;  4BVX B;  5DAK A;  3KD0 A;  3ZYW A;  3IAS 2;  3G7I A;  1FOV A;  5CP1 A;  3PGT A;  2LRC A;  1AC1 A;  5F0G A;  2FA4 A;  3HDC A;  3VWV A;  3LXT A;  5G5F A;  1YF1 A;  1QMV A;  2LJR A;  3BD2 A;  2B1K A;  3UVH A;  1PKZ A;  1FOH A;  2UZ8 A;  2H6X A;  1E6B A;  4EDY A;  2FNO A;  4JU5 A;  5A4V A;  2GZZ A;  2GQK A;  3P8W A;  3K8N A;  4IGJ A;  1A2M A;  3EC3 A;  4N0Z A;  5DVB A;  4GF0 A;  2LJA A;  1ML6 A;  5ECN B;  1FVK A;  4PUF C;  3LEF A;  5LNK e;  1Z5Y E;  3EU3 A;  1ST9 A;  3IPZ A;  3KCM A;  1XOB A;  2H30 A;  4K0G A;  2E7P A;  2AB6 A;  3GUS A;  1SYX A;  4WF4 A;  1A0R P;  1K3Y A;  2I1U A;  1F6M C;  5AIX A;  3TKR A;  4ZBB A;  3MNG A;  2C4J A;  2GSQ A;  1MTC A;  5H5S A;  1V98 A;  4AJ7 A;  6GSV A;  3LG6 A;  1C72 A;  4TOP A;  4ZL7 A;  1PX6 A;  3TKP A;  1TI1 A;  3FR3 A;  5IMZ A;  2YAN A;  3ERG A;  1X5C A;  2PN8 A;  4K2D A;  1OE8 A;  1GSE A;  2FA8 A;  4YKF A;  2DJK A;  2F51 A;  5D9X A;  1EEJ A;  4XCS A;  1TRW A;  5CO3 A;  3MAK A;  1R7H A;  1GSY A;  3DIE A;  5ECS A;  1T00 A;  4I6X A;  4K8M A;  1FHE A;  1U6T A;  4HUA A;  1T7P B;  4BIK A;  3GN3 A;  6GSX A;  1UA5 A;  2GZP A;  3F4T A;  3U5R E;  2L6C A;  4F03 A;  4ISD A;  5J3R A;  4KA0 A;  2PGT A;  2YNX A;  1GNE A;  3GV1 A;  3ZTL A;  3O6T A;  4N30 A;  2WCI A;  2PBJ A;  2DBC A;  2PUK C;  5HFG A;  1TDI A;  5GST A;  1PMT A;  2K18 A;  4KUN A;  1TK0 B;  4PQ1 A;  4KSM A;  2C3N A;  11GS A;  4KDX A;  5D9W A;  2B5X A;  2H75 A;  3UL3 A;  4PTS A;  2FWE A;  12GS A;  5DJM A;  1K0B A;  2X8G A;  1TXX A;  1MDI A;  4I2T A;  3C73 A;  1QQ2 A;  3C1R A;  1TOF A;  5GAP D;  3LSZ A;  3RPN A;  2VCW A;  4MF5 A;  1ZMA A;  1K3O A;  3P7X A;  1TJD A;  4BVX A;  3FKF A;  5B6M A;  2NPB A;  3CQF A;  3RBT A;  1VRS D;  3TGZ A;  4KGI A;  4ECC A;  2C0G A;  1K0D A;  5EPF A;  3I69 A;  10GS A;  1EWX A;  1ZYQ B;  3LYK A;  2WJU A;  3GHA A;  6GSS A;  3KP8 A;  4MK3 A;  3UIW A;  4TXV A;  4AGS A;  3Q19 A;  2VL3 A;  1SJZ A;  2HZE A;  2MMO A;  3GKK A;  1RQM A;  1H75 A;  2KLX A;  3GKX A;  3HVS A;  2R2J A;  3R2Q A;  4TKY A;  5BRT A;  2V2G A;  3P2A A;  2OBK A;  4IP1 A;  1FB6 A;  1M2D A;  4WKW A;  4MZB A;  1AUC A;  4K5S A;  5FHI A;  4QQ7 A;  4EVM A;  2HT9 A;  2FD3 A;  1EEM A;  2OKA A;  1XWA A;  22GS A;  5C04 A;  1S3D A;  3D5J A;  2H19 A;  4DEJ A;  3KH7 A;  1YY7 A;  4HDE A;  1X9S B;  2FHE A;  3GL3 A;  1HQO A;  4H86 A;  4FIW A;  1GLQ A;  4DSS A;  5IMA A;  8GSS A;  1SYR A;  1THO A;  3Q6O A;  1LBK A;  2DMM A;  2VO4 A;  4OO5 A;  1A8L A;  2R4V A;  3R3E A;  4F2I A;  3H93 A;  1G6W A;  1BED A;  4MH2 A;  2CV4 A;  4I97 A;  1BQ7 A;  2LS5 A;  4KCE A;  1J08 A;  2CVK A;  2PVQ A;  2IMF A;  2N5A A;  1TU7 A;  2HE3 A;  2LST A;  3Q18 A;  4JED A;  5AIS A;  1GTU A;  4DSR A;  2YWN A;  1KTE A;  3GST A;  4ECB A;  4EIQ A;  5KOW A;  3HVV A;  1PX7 A;  1B4P A;  3RHC A;  3QPM A;  1JZW A;  1N2A A;  3ZVJ A;  3D0Z A;  2P5R A;  3QAW A;  1A23 A;  2J9H A;  4V2L A;  5HQP A;  5EVO A;  4AJ8 A;  5ABR A;  4O5U A;  2EIO A;  1Q4J A;  1XWB A;  5FWG A;  5DCG A;  4V1A p;  3GKN A;  3VFI A;  2H73 A;  2IN3 A;  3LW9 A;  3C8E A;  2CAQ A;  3TB2 A;  5J4U A;  3N9J A;  3TOT A;  5F8B A;  5DDL A;  2HRA A;  4OO4 A;  4I5Q A;  3CSH A;  4EE0 A;  1ERU A;  1PL2 A;  4NHZ A;  4WF5 A;  3F4S A;  4HEA 2;  3A5W A;  2K8S A;  3IHQ A;  1X0R A;  3I6A A;  3CSI A;  4X4J A;  2B6M A;  2C3Q A;  3IOS A;  1WJK A;  3GL5 A;  1WMJ A;  5DCH A;  4TN8 A;  3CSJ A;  5A5K A;  2OAC A;  2IFQ A;  1GP1 A;  3M8N A;  1A2L A;  1GUL A;  2HSY A;  4NMU A;  1XW6 A;  3TKQ A;  4BA7 A;  4MLY A;  1PN0 A;  2V1M A;  3FK8 A;  4F82 A;  1A0F A;  3EUR A;  3FZ9 A;  2IL3 A;  2X49 A;  2H6Y A;  3PR8 A;  4CY8 A;  3GUR A;  1GUK A;  1ERT A;  1ON4 A;  1RW1 A;  3Q74 A;  1E2Y A;  3N5O A;  3CMI A;  1TU8 A;  4KCA A;  4EL1 A;  1GUH A;  5ECR B;  18GS A;  4RI6 A;  2FWG A;  4WET A;  2N5B A;  4TR1 B;  5IOW A;  5L71 A;  1ILO A;  3SWL A;  4ZIJ A;  1T4Y A;  4JR4 A;  4MP4 A;  5IMF A;  3DEX A;  3APS A;  2OJL A;  5B6N A;  2VL9 A;  2X8H A;  3GYK A;  3HD5 A;  2X64 A;  4J57 E;  1XWG A;  2MMA A;  1JLV A;  3IC4 A;  3CRT A;  5IIZ A;  5G2Z A;  2LQQ A;  4MMM A;  2GTU A;  2PU9 C;  1GTA A;  2A2P A;  3RDW A;  4L5L A;  3EU4 A;  2C0F A;  2L4C A;  2CX3 A;  2C1Y A;  3IAM 2;  4NV2 A;  4HQZ A;  3GNJ A;  1LU4 A;  4POB A;  4O5Q A;  3L9S A;  2M80 A;  3KMN A;  1MD3 A;  2GGT A;  3UAR A;  2WS2 A;  3HKR A;  3DKS A;  4WXT A;  2CVD A;  2WRT A;  4GCI A;  2WFC A;  2YP6 A;  2AAW A;  3P90 A;  4L5O A;  1XOA A;  1B48 A;  2VCZ A;  4CHS A;  3FR6 A;  4IKH A;  3KGK A;  2JAD A;  3F6F A;  1GSD A;  4RUV A;  1UC7 A;  5F05 A;  5INY A;  5LCZ A;  3HZ4 A;  2A2R A;  2VL2 A;  4V2M A;  5G30 A;  3HA9 A;  4OWY A;  3H79 A;  2JAC A;  4WR4 A;  3F8U A;  3O3T A;  2R5G A;  2GT6 A;  2CX4 A;  2H1B A;  4LMV A;  5GZZ B;  2HSH A;  5CAX A;  1OC9 A;  4XS4 A;  1PKW A;  1MDJ A;  1OC3 A;  3HJM A;  1U88 A;  2HNL A;  5KN2 A;  4TXO B;  2YV7 A;  2QSI A;  4MCU A;  5ENU A;  5LD0 A;  5IMD A;  2R0C A;  2F8A A;  4V1A g;  3RPP A;  2QA1 A;  2G2Q A;  1TK8 B;  5AIV A;  1GSQ A;  3VI7 A;  1TRS A;  4L0U A;  2DIZ A;  2OE1 A;  2PWJ A;  2P31 A;  2HRF A;  2AYT A;  5D73 A;  2ON5 A;  3IA1 A;  4I2U A;  2O7K A;  4QL7 A;  1N8J A;  4ZBD A;  2OAD A;  3L9U A;  4XTS A;  1VF3 A;  1DE2 A;  1AQW A;  3C71 A;  1Z9H A;  4X43 A;  3TJF A;  4K5R A;  1TTZ A;  4JBB A;  3LFL A;  2H66 A;  1GSS A;  2LRT A;  4MPG A;  5EY6 A;  3ED3 A;  3FW2 A;  3KP9 A;  1AQX A;  3LOR A;  3TJB A;  3TKS A;  1UN2 A;  4HOJ A;  1X5E A;  6GSU A;  4PUR A;  1EOG A;  1V40 A;  4IW9 A;  2OE3 A;  3HVX A;  4ID0 A;  5A4U A;  4L8E A;  4G19 A;  1AW9 A;  1V2A A;  1OKD A;  4PNG A;  2BTO T;  2H8L A;  3DWV A;  3F4R A;  5HFI A;  2KUC A;  1PD2 1;  2P0G A;  3ZFB A;  3L0H A;  5ID2 A;  1WIK A;  4YQU A;  5IMC A;  3IE3 A;  4KW6 A;  4TW5 A;  4RI7 A;  1KEB A;  4HZ2 A;  1QUW A;  2WZ9 A;  2ALB A;  5AN1 A;  4KDU A;  1YEP A;  2LRN A;  1OKT A;  1Y25 A;  4G9H A;  4ZL9 A;  1PN9 A;  3WGD A;  3KZQ A;  3KTL A;  2V41 A;  5JWQ B;  1R26 A;  1TKD B;  2CVB A;  3QAV A;  5KN1 A;  4MPF A;  2YWO A;  2HRK A;  4KF9 A;  4XRA A;  3GTU A;  4MJC A;  1W89 A;  4F9Z A;  2YV9 A;  4JE1 A;  4TR3 A;  4D73 B;  2LNT A;  5DQS A;  1GUM A;  3UJ1 A;  1ZCP A;  2JZS A;  4K1F A;  4IS0 A;  3U6V A;  2VM2 A;  1YF0 A;  3I9V 2;  2IMD A;  2YZU A;  3ZIJ A;  2MBS A;  1F3B A;  4DSQ A;  4BVY A;  2O85 A;  4CY6 A;  2H1G A;  3M9K A;  4YQV A;  1XXU A;  3KTB A;  1R5A A;  4G2E A;  4ZB8 A;  1EZK A;  3NIV A;  5J9C A;  4GRF A;  1WWJ A;  5ELA A;  2C80 A;  1O6J A;  2RUF A;  1J9B A;  2AUV A;  3UAP A;  1MEK A;  2I4A A;  4WEY A;  1S3A A;  3GSS A;  4GSS A;  1YQ1 A;  2HLS A;  5IQY A;  1GSU A;  5CRH A;  4FO5 A;  1FB0 A;  5D9T A;  4MZW A;  3EMX A;  1S3R A;  4USS A;  1M2B A;  13GS A;  1EP8 A;  3IK7 A;  1PL1 A;  1ZYN A;  4KND A;  1RK4 A;  2KP2 A;  1J0F A;  2H01 A;  1QK8 A;  1QXH A;  3TJG A;  2DIY A;  2JZR A;  4IJI A;  4Q5Q A;  5G1K A;  1OE7 A;  3TUE A;  3WT2 A;  3APQ A;  4OD7 A;  3UVT A;  3DRN A;  2OA7 A;  4ACS A;  1XFL A;  2C3T A;  5IPG A;  1BX9 A;  2MYG A;  3UEM A;  1NM3 A;  3A2V A;  1CQH A;  2VAF A;  1V57 A;  5HFK A;  3HYP A;  3GX8 A;  1FW1 A;  4XS6 A;  5IM9 A;  1OYJ A;  1YZX A;  3RAZ A;  3HXS A;  4EC0 A;  1YKC A;  3D4M A;  5A4W A;  1XG8 A;  3CBU A;  2BMX A;  3FY7 A;  3ZIT A;  2L5L A;  5E59 A;  3EWL A;  1AAZ A;  3A2W A;  4FYB A;  4YQM A;  3S9F A;  3GFK A;  1M99 A;  1DBY A;  4HS1 A;  4IHU A;  3A5I A;  1SL1 B;  4GTU A;  2RM5 A;  2IPA A;  1EP7 A;  4O7H A;  3DVW A;  4YAV A;  3O76 A;  1TW9 A;  1QFN A;  1NHO A;  1FAA A;  1XPV A;  3L4N A;  2X99 A;  4Z2U A;  3CXG A;  1SL0 B;  1GTI A;  2MZC A;  2XPD A;  1K0A A;  1XBS A;  2VCT A;  2IMK A;  3QDN A;  4NHW A;  3HCZ A;  1BAY A;  1LJR A;  2DC5 A;  2CQ9 A;  2HXK A;  3MDK A;  3IXR A;  1ERW A;  14GS A;  2R37 A;  1F3A A;  1FVJ A;  4KAE A;  2DJ3 A;  4G10 A;  4HU9 A;  4G0K A;  5JCW A;  1M9B A;  3UMA A;  3J7Y k;  4GST A;  3PH9 A;  1YJ6 A;  4KE3 A;  4TR0 A;  2PMT A;  3C1S A;  3UBK A;  2EIQ A;  3G7Y A;  4EXJ A;  2REM A;  3LQ7 A;  1O81 A;  4ZB6 A;  3ME8 A;  3LJR A;  4Q5R A;  4N10 A;  1SJ6 A;  3FMW A;  3TJJ A;  4ZXG A;  2GT5 A;  5ECO B;  2E2M A;  3F63 A;  2DLX A;  1VGL A;  3ZL5 A;  2TRC P;  1SK0 A;  3HJP A;  4KB3 A;  1GSF A;  3FZA A;  4LA1 A;  2VD1 A;  2DKI A;  3BOA A;  7GSS A;  4XS1 A;  3US3 A;  2GZY A;  3GH6 A;  1TRU A;  2B7K A;  2V6O A;  5ECK B;  3AY8 A;  1U3A A;  1S3C A;  3GRX A;  3DML A;  3NZN A;  1O73 A;  3L78 A;  1ZYP A;  20GS A;  1IYI A;  5G5E A;  4YH2 A;  2LEG A;  4WBJ A;  2DJ1 A;  3GA4 A;  4A5P A;  3H1N A;  1GLP A;  2DJ2 A;  3M9J A;  1KNG A;  2LKU A;  3I43 A;  2XBI A;  3ZZX A;  1EOH A;  3HZ8 A;  2GQL A;  3MYD A;  4IBP A;  4OMV A;  1SJI A;  2KP1 A;  5ECP B;  4POM A;  2JL4 A;  1R5P A;  16GS A;  1THX A;  2AV4 A;  2WB9 A;  2FLS A;  1ACV A;  2LNS A;  3DD3 A;  4OFN A;  2VLV A;  5B8A A;  1GTB A;  4G0L A;  5KN3 A;  2JZT A;  4GQC A;  4MDC A;  4FYU A;  2C0E A;  2B7J A;  2RII A;  2ZUP A;  3BCI A;  1OVN A;  1GL8 A;  4MH3 A;  2K9F A;  3NOF A;  2YCD A;  4L0W A;  1B9X C;  3A3T A;  2QC7 A;  4WR5 A;  5B7C A;  3FRC A;  6GSY A;  2VCV A;  2Z9S A;  1VF2 A;  4Z2T A;  4JRR A;  2RM6 A;  1M2A A;  3VWX A;  1XWC A;  1KBN A;  3QCP A;  3W8S A;  3EPT A; 
#chains in the Genus database with same CATH homology
 3PPU A;  1JZD A;  1JFU A;  1PQN A;  3GX0 A;  5ECM B;  3VUR A;  1SEN A;  1EGR A;  4MA9 A;  2L59 A;  2LTK A;  1H4O A;  1AXD A;  1T4Z A;  2MMZ A;  4ICY A;  2YZH A;  4PNF A;  2NTO A;  3F3R A;  2IMI A;  3CYN A;  1SKW B;  3UBL A;  2L57 A;  1GNW A;  5AGY A;  1YEX A;  5JCU A;  4E8E A;  5DJL A;  1M9A A;  1HNB A;  3ZMK A;  3EE2 A;  4IQA A;  3HHV A;  4O5R A;  2JSZ A;  4ECJ A;  2KOK A;  3FYG A;  4AJ6 A;  1T1V A;  2M46 A;  4HI7 A;  4K2X A;  2YJH A;  3FZ5 A;  4FYC A;  5HR0 A;  3FR9 A;  1NHY A;  4JR6 A;  2YWI A;  2PPT A;  2RUE A;  4NAX A;  2VD0 A;  3F0I A;  1OC8 A;  2B1L A;  5CNW A;  2TRX A;  4PQI A;  1F37 A;  3H8Q A;  1BJX A;  2P5Q A;  3TDG A;  2CA8 A;  3IC8 A;  2H6Z A;  3LXZ A;  2GDR A;  1VF4 A;  2TIR A;  5KN0 A;  4KDY A;  2CT6 A;  3D21 A;  3M0F A;  2H0H A;  1A24 A;  3IHG A;  4X1U A;  1PSQ A;  4KX4 A;  5ECI B;  2ON7 A;  4MF7 A;  2FUG 2;  2I9H A;  4ILF A;  4Q5F A;  1JHB A;  3QAG A;  1XZO A;  1X5D A;  1A8Y A;  2QKE A;  4K9Z A;  1TI3 A;  2O89 A;  1M0U A;  1W4V A;  4TR1 A;  1TK5 B;  2H72 A;  1URM A;  2HZE B;  1HD2 A;  5FT3 A;  3DVX A;  3ZIV A;  4MJE A;  3MWH A;  4ZB9 A;  5HR3 A;  1HNA A;  4K7N A;  2VIM A;  4HQS A;  2N5F A;  5KEJ A;  4PGT A;  3LYP A;  5CYY A;  3LWA A;  5H5Q A;  2JSY A;  2I81 A;  2E0Q A;  4K6X A;  1Z6N A;  2C8U A;  3BBY A;  2WUL A;  3WT1 A;  3VWU A;  2CZ2 A;  1XW5 A;  4DSS B;  3IV4 A;  4J56 E;  3ZVJ D;  1K0O A;  3WGE A;  2YWM A;  4PXO A;  5EL8 A;  3DYR A;  4GSN A;  4HJM A;  5G31 A;  6GST A;  1USB A;  5GSS A;  2EC4 A;  3WD6 A;  2XBQ A;  1AIU A;  3VPQ A;  4OCE A;  1O7U A;  2VCQ A;  2VLT A;  3IR4 A;  3HY2 A;  3D6I A;  1EV9 A;  3W8J A;  2PER A;  4IN0 A;  4IJ3 A;  4YKG A;  2FGX A;  1WPI A;  3QR6 A;  5IPH A;  3E3E A;  3CTG A;  1F2E A;  3VK9 A;  2DJJ A;  3TRX A;  4ULX A;  1SKS B;  1G0T A;  4EDZ A;  2H74 A;  1PRX A;  2H0G A;  4O32 A;  3ERW A;  2VUP A;  1MDK A;  5C00 A;  1DE1 A;  1FG4 A;  3TCO A;  1JZO A;  2H70 A;  4TXO A;  5JWR B;  6GSW A;  1BG5 A;  2OBI A;  2DSA A;  5DBQ A;  2H0I A;  2GST A;  4TRX A;  2CZ3 A;  1PGT A;  4BWS A;  5D96 A;  3KJY A;  1K0C A;  2NVL A;  4HU7 A;  1OAZ A;  5D8I A;  1YDK A;  3H4K A;  2XC2 A;  1X9M B;  2ES7 A;  4DVC A;  5J41 A;  1HNC A;  2NDO A;  1Y6E A;  1O85 A;  4WBR D;  4KSO A;  5BMU A;  4IVF A;  3ISO A;  5HR2 A;  3KMO A;  1ZZY A;  2FY6 A;  2K8V A;  1K3L A;  5HR1 A;  2GSR A;  4PQH A;  2B5Y A;  4MAB A;  2H1D A;  4TVE A;  3D22 A;  5CRG A;  5IOX A;  2F3M A;  1V58 A;  19GS A;  3QOU A;  2R0P A;  2IFQ B;  2ZCT A;  1WRY A;  4MZC A;  4EO3 A;  3VLN A;  5IO2 A;  3KXO A;  1EGO A;  3G9B A;  2B3S A;  3JCM L;  5JCG A;  1G7E A;  3KEB A;  2FWF A;  2CAI A;  3CRU A;  2LJK A;  5ELG A;  2X4A A;  3UOM A;  1B9Y C;  3ZRD A;  4PX1 A;  5DAL B;  3D4T A;  2GVP A;  1Z3E A;  2DJ0 A;  3IBH A;  5KOX A;  3WGX A;  2GLR A;  4BL7 B;  3KIJ A;  2J23 A;  4LL4 B;  1DUG A;  2IIY A;  1XVW A;  3W6G A;  1ZYE A;  2YJ7 A;  2A2S A;  1NSW A;  1GH2 A;  5CRW A;  4ZL8 A;  3TKS E;  4GWR A;  3E9J B;  3L9V A;  4OFT A;  1BYE A;  4IP6 A;  2I3Y A;  2FWH A;  2HZF A;  4LL1 B;  3M1G A;  1G7O A;  3EYT A;  1IYH A;  2IWT A;  4RQX A;  2VLU A;  3BCK A;  4N11 A;  4YAP A;  1NW2 A;  2O8V B;  4XHM A;  4E8H A;  4D73 A;  1G6Y A;  2XHF A;  3FHK A;  5J9B A;  3ZFL A;  3ZML A;  1TP9 A;  2M72 A;  2VL2 C;  2GQM A;  1U3I A;  3ZLP A;  4XIH A;  2VCX A;  2A4H A;  4MF6 A;  3GIX A;  2WDU A;  4HZ4 A;  4F0B A;  1UVZ A;  3KH9 A;  3TRQ A;  3MSZ A;  1ZOF A;  1F9M A;  4FQU A;  5DQY A;  3QFB C;  3A2X A;  3QFA C;  5IO0 A;  1WE0 A;  2L4Q A;  1GRX A;  3GKM A;  4I8B A;  2R0G A;  4IQ1 A;  5D9V A;  3M3M A;  3IK9 A;  1B8X A;  3BJ5 A;  4Q5N A;  4NWY A;  5COH A;  4G0I A;  5B8B A;  2F9S A;  2E2G A;  4GXZ A;  3G7J A;  4GQF A;  1ABA A;  2RLI A;  4ML1 A;  1XIY A;  1X9W B;  3ME7 A;  1SK2 A;  1A2J A;  2EIR A;  4POK A;  1SD9 A;  3V1W A;  3TRP A;  2IME A;  1PA3 A;  1ERV A;  3QMX A;  1K0N A;  4NPB A;  5GAN D;  1OC9 B;  4XS4 B;  3FEU A;  5IMV A;  2QA2 A;  4EIP A;  1AQV A;  1JZR A;  2H1A A;  1SK1 A;  3J7Y b;  4NXI A;  5CRD A;  2HI7 A;  2YOI A;  4ML6 A;  1EV4 A;  4HJ2 A;  3EIN A;  2G0F A;  2D2Z A;  3HJO A;  1I9D A;  2GSS A;  4JZQ A;  3EMP A;  4Z7X A;  1O8W A;  5DAK B;  4EKZ A;  3TKS C;  4XRD A;  2X8C A;  2K6V A;  4EUY A;  2H71 A;  4LLR A;  3PIN A;  3IRA A;  4MJA A;  1T8E B;  4K7O A;  2F8F A;  2VM1 A;  3OR5 A;  2HSM A;  4MJB A;  2YN1 A;  1JLW A;  2HRN A;  5F06 A;  3TOU A;  1WP0 A;  5G1L A;  2AJQ B;  3CTF A;  2VOC A;  5F07 A;  2LUS A;  3C7M A;  3QD9 A;  5ECL B;  3RHB A;  1TRV A;  2FCH A;  3GMF A;  5DAL A;  4BPY A;  4ZBA A;  1XVQ A;  4BL7 A;  4K0N A;  2XPE A;  1Q98 A;  3F3Q A;  2WGR A;  3LGC A;  1DSB A;  1O8X A;  4N0V A;  2OE0 A;  3KM6 A;  17GS A;  2BJX A;  2KHP A;  3IDV A;  4RQR A;  1SD8 A;  2V32 A;  4PUA A;  4MNN A;  5H5R A;  4KH7 A;  3DXB A;  1T3B A;  4AF2 A;  1I5G A;  2MMN A;  4TR4 A;  1R4W A;  4OFM A;  2HFD A;  2IJY A;  5ID2 B;  5ECH B;  4EF0 A;  3EVI A;  2R3X A;  2V6K A;  4ECI A;  2B5E A;  2QGV A;  1XCC A;  4QL9 A;  5D93 A;  1MD4 A;  1HYU A;  3FZ4 A;  3DGQ A;  2L6D A;  5E4W A;  2NBS A;  4K7I A;  1ZL9 A;  1SKR B;  1K0M A;  4O92 A;  2R6K A;  5ECQ B;  1U87 A;  1XWK A;  1CQG A;  2JU5 A;  2ZNM A;  4V2N A;  1YKA A;  1V9W A;  3MIX A;  4CDO A;  1Z7R A;  4FH8 A;  1VF1 A;  3E0U A;  4CW9 A;  1ZGN A;  3APO A;  3GTU B;  4Z2R A;  3ZRE A;  1Z7P A;  3F6D A;  3GH9 A;  3SBC A;  2A4V A;  1GWC A;  1XW9 A;  4NV5 A;  2DKH A;  2MBT A;  5CRE A;  4ZIL A;  2DML A;  1SU9 A;  2AHE A;  1SL2 B;  4F0C A;  4GLT A;  3VI5 A;  4BVY B;  3ERF A;  1FO5 A;  3VWW A;  2PVO C;  4BWQ A;  1WOU A;  2C0D A;  4J2F A;  5J5N A;  3WYW A;  2GS3 A;  2O87 A;  2LQO A;  4LMW A;  3TJK A;  5JWO B;  2HYX A;  2LV3 A;  3F9U A;  4IEL A;  1QGV A;  4POL A;  2L5O A;  2H76 A;  9GSS A;  1M7T A;  2YPM A;  1B4Q A;  4OCF A;  4P3Y B;  4X0X A;  3VPT A;  1Z6M A;  4BVX B;  5DAK A;  3KD0 A;  3ZYW A;  3IAS 2;  3G7I A;  1FOV A;  5CP1 A;  3PGT A;  2LRC A;  1AC1 A;  5F0G A;  2FA4 A;  3HDC A;  3VWV A;  3LXT A;  5G5F A;  1YF1 A;  1QMV A;  2LJR A;  3BD2 A;  2B1K A;  3UVH A;  1PKZ A;  1FOH A;  2UZ8 A;  2H6X A;  1E6B A;  4EDY A;  2FNO A;  4JU5 A;  5A4V A;  2GZZ A;  2GQK A;  3P8W A;  3K8N A;  4IGJ A;  1A2M A;  3EC3 A;  4N0Z A;  5DVB A;  4GF0 A;  2LJA A;  1ML6 A;  5ECN B;  1FVK A;  4PUF C;  3LEF A;  5LNK e;  1Z5Y E;  3EU3 A;  1ST9 A;  3IPZ A;  3KCM A;  1XOB A;  2H30 A;  4K0G A;  2E7P A;  2AB6 A;  3GUS A;  1SYX A;  4WF4 A;  1A0R P;  1K3Y A;  2I1U A;  1F6M C;  5AIX A;  3TKR A;  4ZBB A;  3MNG A;  2C4J A;  2GSQ A;  1MTC A;  5H5S A;  1V98 A;  4AJ7 A;  6GSV A;  3LG6 A;  1C72 A;  4TOP A;  4ZL7 A;  1PX6 A;  3TKP A;  1TI1 A;  3FR3 A;  5IMZ A;  2YAN A;  3ERG A;  1X5C A;  2PN8 A;  4K2D A;  1OE8 A;  1GSE A;  2FA8 A;  4YKF A;  2DJK A;  2F51 A;  5D9X A;  1EEJ A;  4XCS A;  1TRW A;  5CO3 A;  3MAK A;  1R7H A;  1GSY A;  3DIE A;  5ECS A;  1T00 A;  4I6X A;  4K8M A;  1FHE A;  1U6T A;  4HUA A;  1T7P B;  3GN3 A;  6GSX A;  1UA5 A;  2GZP A;  3F4T A;  3U5R E;  2L6C A;  4F03 A;  4ISD A;  5J3R A;  4KA0 A;  2PGT A;  2YNX A;  1GNE A;  3GV1 A;  3ZTL A;  3O6T A;  4N30 A;  2WCI A;  2PBJ A;  2DBC A;  2PUK C;  5HFG A;  1TDI A;  5GST A;  1PMT A;  2K18 A;  4KUN A;  1TK0 B;  4PQ1 A;  4KSM A;  2C3N A;  11GS A;  4KDX A;  5D9W A;  2B5X A;  2H75 A;  3UL3 A;  4PTS A;  2FWE A;  12GS A;  5DJM A;  1K0B A;  2X8G A;  1TXX A;  1MDI A;  4I2T A;  3C73 A;  1QQ2 A;  3C1R A;  1TOF A;  5GAP D;  3LSZ A;  3RPN A;  2VCW A;  4MF5 A;  1ZMA A;  1K3O A;  3P7X A;  1TJD A;  4BVX A;  3FKF A;  5B6M A;  2NPB A;  3RBT A;  1VRS D;  3TGZ A;  4KGI A;  4ECC A;  2C0G A;  1K0D A;  5EPF A;  3I69 A;  10GS A;  1EWX A;  1ZYQ B;  3LYK A;  2WJU A;  3GHA A;  6GSS A;  3KP8 A;  4MK3 A;  3UIW A;  4TXV A;  4AGS A;  3Q19 A;  2VL3 A;  1SJZ A;  2HZE A;  2MMO A;  3GKK A;  1RQM A;  1H75 A;  2KLX A;  3GKX A;  3HVS A;  2R2J A;  3R2Q A;  4TKY A;  5BRT A;  2V2G A;  3P2A A;  2OBK A;  4IP1 A;  1FB6 A;  1M2D A;  4WKW A;  4MZB A;  1AUC A;  4K5S A;  5FHI A;  4QQ7 A;  4EVM A;  2HT9 A;  2FD3 A;  1EEM A;  2OKA A;  1XWA A;  22GS A;  5C04 A;  1S3D A;  3D5J A;  2H19 A;  4DEJ A;  3KH7 A;  1YY7 A;  4HDE A;  1X9S B;  2FHE A;  3GL3 A;  1HQO A;  4H86 A;  4FIW A;  1GLQ A;  4DSS A;  5IMA A;  8GSS A;  1SYR A;  1THO A;  3Q6O A;  1LBK A;  2DMM A;  2VO4 A;  4OO5 A;  1A8L A;  2R4V A;  3R3E A;  4F2I A;  3H93 A;  1G6W A;  1BED A;  4MH2 A;  2CV4 A;  4I97 A;  1BQ7 A;  2LS5 A;  4KCE A;  1J08 A;  2CVK A;  2PVQ A;  2IMF A;  2N5A A;  1TU7 A;  2HE3 A;  2LST A;  3Q18 A;  4JED A;  5AIS A;  1GTU A;  4DSR A;  2YWN A;  1KTE A;  3GST A;  4ECB A;  4EIQ A;  5KOW A;  3HVV A;  1PX7 A;  1B4P A;  3RHC A;  3QPM A;  1JZW A;  1N2A A;  3ZVJ A;  3D0Z A;  2P5R A;  3QAW A;  1A23 A;  2J9H A;  4V2L A;  5HQP A;  5EVO A;  4AJ8 A;  5ABR A;  4O5U A;  2EIO A;  1Q4J A;  1XWB A;  5FWG A;  5DCG A;  4V1A p;  3GKN A;  3VFI A;  2H73 A;  2IN3 A;  3LW9 A;  3C8E A;  2CAQ A;  3TB2 A;  5J4U A;  3N9J A;  3TOT A;  5F8B A;  5DDL A;  2HRA A;  4OO4 A;  4I5Q A;  3CSH A;  4EE0 A;  1ERU A;  1PL2 A;  4NHZ A;  4WF5 A;  3F4S A;  4HEA 2;  3A5W A;  2K8S A;  3IHQ A;  1X0R A;  3I6A A;  3CSI A;  4X4J A;  2B6M A;  2C3Q A;  3IOS A;  1WJK A;  3GL5 A;  1WMJ A;  5DCH A;  4TN8 A;  3CSJ A;  5A5K A;  2OAC A;  2IFQ A;  1GP1 A;  3M8N A;  1A2L A;  1GUL A;  2HSY A;  4NMU A;  1XW6 A;  3TKQ A;  4BA7 A;  4MLY A;  1PN0 A;  2V1M A;  3FK8 A;  4F82 A;  1A0F A;  3EUR A;  3FZ9 A;  2IL3 A;  2X49 A;  2H6Y A;  3PR8 A;  4CY8 A;  3GUR A;  1GUK A;  1ERT A;  1ON4 A;  1RW1 A;  3Q74 A;  1E2Y A;  3N5O A;  3CMI A;  1TU8 A;  4KCA A;  4EL1 A;  1GUH A;  5ECR B;  18GS A;  4RI6 A;  2FWG A;  4WET A;  2N5B A;  4TR1 B;  5IOW A;  5L71 A;  1ILO A;  3SWL A;  4ZIJ A;  1T4Y A;  4JR4 A;  4MP4 A;  5IMF A;  3DEX A;  3APS A;  2OJL A;  5B6N A;  2VL9 A;  2X8H A;  3GYK A;  3HD5 A;  2X64 A;  4J57 E;  1XWG A;  2MMA A;  1JLV A;  3IC4 A;  3CRT A;  5IIZ A;  5G2Z A;  2LQQ A;  4MMM A;  2GTU A;  2PU9 C;  1GTA A;  2A2P A;  3RDW A;  4L5L A;  3EU4 A;  2C0F A;  2L4C A;  2CX3 A;  2C1Y A;  3IAM 2;  4NV2 A;  4HQZ A;  3GNJ A;  1LU4 A;  4POB A;  4O5Q A;  3L9S A;  2M80 A;  3KMN A;  1MD3 A;  2GGT A;  3UAR A;  2WS2 A;  3HKR A;  3DKS A;  4WXT A;  2CVD A;  2WRT A;  4GCI A;  2WFC A;  2YP6 A;  2AAW A;  3P90 A;  4L5O A;  1XOA A;  1B48 A;  2VCZ A;  4CHS A;  3FR6 A;  4IKH A;  3KGK A;  2JAD A;  3F6F A;  1GSD A;  4RUV A;  1UC7 A;  5F05 A;  5INY A;  5LCZ A;  3HZ4 A;  2A2R A;  2VL2 A;  4V2M A;  5G30 A;  3HA9 A;  4OWY A;  3H79 A;  2JAC A;  4WR4 A;  3F8U A;  3O3T A;  2R5G A;  2GT6 A;  2CX4 A;  2H1B A;  4LMV A;  5GZZ B;  2HSH A;  5CAX A;  1OC9 A;  4XS4 A;  1PKW A;  1MDJ A;  1OC3 A;  3HJM A;  1U88 A;  2HNL A;  5KN2 A;  4TXO B;  2YV7 A;  2QSI A;  4MCU A;  5ENU A;  5LD0 A;  5IMD A;  2R0C A;  2F8A A;  4V1A g;  3RPP A;  2QA1 A;  2G2Q A;  1TK8 B;  5AIV A;  1GSQ A;  3VI7 A;  1TRS A;  4L0U A;  2DIZ A;  2OE1 A;  2PWJ A;  2P31 A;  2HRF A;  2AYT A;  5D73 A;  2ON5 A;  3IA1 A;  4I2U A;  2O7K A;  4QL7 A;  1N8J A;  4ZBD A;  2OAD A;  3L9U A;  4XTS A;  1VF3 A;  1DE2 A;  1AQW A;  3C71 A;  1Z9H A;  4X43 A;  3TJF A;  4K5R A;  1TTZ A;  4JBB A;  3LFL A;  2H66 A;  1GSS A;  2LRT A;  4MPG A;  5EY6 A;  3ED3 A;  3FW2 A;  3KP9 A;  1AQX A;  3LOR A;  3TJB A;  3TKS A;  1UN2 A;  4HOJ A;  1X5E A;  6GSU A;  4PUR A;  1EOG A;  1V40 A;  4IW9 A;  2OE3 A;  3HVX A;  4ID0 A;  5A4U A;  4L8E A;  4G19 A;  1AW9 A;  1V2A A;  1OKD A;  4PNG A;  2BTO T;  2H8L A;  3DWV A;  3F4R A;  5HFI A;  2KUC A;  1PD2 1;  2P0G A;  3ZFB A;  3L0H A;  5ID2 A;  1WIK A;  4YQU A;  5IMC A;  3IE3 A;  4KW6 A;  4TW5 A;  4RI7 A;  1KEB A;  4HZ2 A;  1QUW A;  2WZ9 A;  2ALB A;  5AN1 A;  4KDU A;  1YEP A;  2LRN A;  1OKT A;  1Y25 A;  4G9H A;  4ZL9 A;  1PN9 A;  3WGD A;  3KZQ A;  3KTL A;  2V41 A;  5JWQ B;  1R26 A;  1TKD B;  2CVB A;  3QAV A;  5KN1 A;  4MPF A;  2YWO A;  2HRK A;  4KF9 A;  4XRA A;  3GTU A;  4MJC A;  1W89 A;  4F9Z A;  2YV9 A;  4JE1 A;  4TR3 A;  4D73 B;  2LNT A;  5DQS A;  1GUM A;  3UJ1 A;  1ZCP A;  2JZS A;  4K1F A;  4IS0 A;  3U6V A;  2VM2 A;  1YF0 A;  3I9V 2;  2IMD A;  2YZU A;  3ZIJ A;  2MBS A;  1F3B A;  4DSQ A;  4BVY A;  2O85 A;  4CY6 A;  2H1G A;  3M9K A;  4YQV A;  1XXU A;  3KTB A;  1R5A A;  4G2E A;  4ZB8 A;  1EZK A;  3NIV A;  5J9C A;  4GRF A;  1WWJ A;  5ELA A;  2C80 A;  1O6J A;  2RUF A;  1J9B A;  2AUV A;  3UAP A;  1MEK A;  2I4A A;  4WEY A;  1S3A A;  3GSS A;  4GSS A;  1YQ1 A;  2HLS A;  5IQY A;  1GSU A;  5CRH A;  4FO5 A;  1FB0 A;  5D9T A;  4MZW A;  3EMX A;  4USS A;  1M2B A;  13GS A;  1EP8 A;  3IK7 A;  1PL1 A;  1ZYN A;  4KND A;  1RK4 A;  2KP2 A;  1J0F A;  2H01 A;  1QK8 A;  1QXH A;  3TJG A;  2DIY A;  2JZR A;  4IJI A;  4Q5Q A;  5G1K A;  1OE7 A;  3TUE A;  3WT2 A;  3APQ A;  4OD7 A;  3UVT A;  3DRN A;  2OA7 A;  4ACS A;  1XFL A;  2C3T A;  5IPG A;  1BX9 A;  2MYG A;  3UEM A;  1NM3 A;  3A2V A;  1CQH A;  2VAF A;  1V57 A;  5HFK A;  3HYP A;  3GX8 A;  1FW1 A;  4XS6 A;  5IM9 A;  1OYJ A;  1YZX A;  3RAZ A;  3HXS A;  4EC0 A;  1YKC A;  3D4M A;  5A4W A;  3CBU A;  2BMX A;  3FY7 A;  3ZIT A;  2L5L A;  5E59 A;  3EWL A;  1AAZ A;  3A2W A;  4FYB A;  4YQM A;  3S9F A;  3GFK A;  1M99 A;  1DBY A;  4HS1 A;  4IHU A;  3A5I A;  1SL1 B;  4GTU A;  2RM5 A;  2IPA A;  1EP7 A;  4O7H A;  3DVW A;  4YAV A;  3O76 A;  1TW9 A;  1QFN A;  1NHO A;  1FAA A;  1XPV A;  3L4N A;  2X99 A;  4Z2U A;  3CXG A;  1SL0 B;  1GTI A;  2MZC A;  2XPD A;  1K0A A;  1XBS A;  2VCT A;  2IMK A;  3QDN A;  4NHW A;  3HCZ A;  1BAY A;  1LJR A;  2DC5 A;  2CQ9 A;  2HXK A;  3MDK A;  3IXR A;  1ERW A;  14GS A;  2R37 A;  1F3A A;  1FVJ A;  4KAE A;  2DJ3 A;  4G10 A;  4HU9 A;  4G0K A;  5JCW A;  1M9B A;  3UMA A;  3J7Y k;  4GST A;  3PH9 A;  1YJ6 A;  4KE3 A;  4TR0 A;  2PMT A;  3C1S A;  3UBK A;  2EIQ A;  3G7Y A;  4EXJ A;  2REM A;  3LQ7 A;  1O81 A;  4ZB6 A;  3ME8 A;  3LJR A;  4Q5R A;  4N10 A;  1SJ6 A;  3FMW A;  3TJJ A;  4ZXG A;  2GT5 A;  5ECO B;  2E2M A;  3F63 A;  2DLX A;  1VGL A;  3ZL5 A;  2TRC P;  1SK0 A;  3HJP A;  4KB3 A;  1GSF A;  3FZA A;  4LA1 A;  2VD1 A;  2DKI A;  3BOA A;  7GSS A;  4XS1 A;  3US3 A;  2GZY A;  3GH6 A;  1TRU A;  2B7K A;  2V6O A;  5ECK B;  3AY8 A;  1U3A A;  1S3C A;  3GRX A;  3DML A;  3NZN A;  1O73 A;  3L78 A;  1ZYP A;  20GS A;  1IYI A;  5G5E A;  4YH2 A;  2LEG A;  4WBJ A;  2DJ1 A;  3GA4 A;  4A5P A;  3H1N A;  1GLP A;  2DJ2 A;  3M9J A;  1KNG A;  2LKU A;  3I43 A;  2XBI A;  3ZZX A;  1EOH A;  3HZ8 A;  2GQL A;  3MYD A;  4IBP A;  4OMV A;  1SJI A;  2KP1 A;  5ECP B;  4POM A;  2JL4 A;  1R5P A;  16GS A;  1THX A;  2AV4 A;  2WB9 A;  2FLS A;  1ACV A;  2LNS A;  3DD3 A;  4OFN A;  2VLV A;  5B8A A;  1GTB A;  4G0L A;  5KN3 A;  2JZT A;  4GQC A;  4MDC A;  4FYU A;  2C0E A;  2B7J A;  2RII A;  2ZUP A;  3BCI A;  1OVN A;  1GL8 A;  4MH3 A;  2K9F A;  3NOF A;  2YCD A;  4L0W A;  1B9X C;  3A3T A;  2QC7 A;  4WR5 A;  5B7C A;  3FRC A;  6GSY A;  2VCV A;  2Z9S A;  1VF2 A;  4Z2T A;  4JRR A;  2RM6 A;  1M2A A;  3VWX A;  1XWC A;  1KBN A;  3QCP A;  3W8S A;  3EPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...