2HFDA

Nmr structure of protein hydrogenase-1 operon protein hyae from escherichia coli: northeast structural genomics consortium target er415
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
MSNDTPFDALWQRMLARGWTPVSESRLDDWLTQAPDGVVLLSSDPKRTPEVSDNPVMIGELLREFPDYTWQVAIADLEQSEAIGDRFGVFRFPATLVFTGGNYRGVLNGIHPWAELINLMRGLVEPQQERAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hydrogenase-1 operon protein hyaE
publication title Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical thioredoxin active site sequence motif.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hfdA00
1R7HA 1G6YA 5ELGA 5C04A 3QD9A 2VCWA 3KM6A 4JZQA 5HFKA 5FHIA 2VUPA 1OE8A 1HNAA 1PL2A 4ZBBA 2HZEA 3LFLA 3GNJA 1OC9A 5J9CA 2N5BA 5B8BA 2R6KA 3EMPA 2DJ1A 1SL1B 3ZMLA 1X0RA 3JCML 1G7OA 2H70A 5DJMA 1OE7A 6GSTA 1ZMAA 2CVKA 4I6XA 2ALBA 2HFDA 1K0CA 2YZUA 4ZXGA 1F37A 3UAPA 2H19A 3L9UA 3WD6A 4KDXA 1B4PA 2FUG2 3WGDA 2K9FA 1EV4A 4ECJA 2VM1A 2VCTA 1IYHA 1PX7A 3GH9A 3QAVA 4TOPA 1XWAA 1ML6A 4LL1B 1USBA 4MJBA 1T00A 4EL1A 1AIUA 3VWVA 5DJLA 2EIQA 4JBBA 1GSEA 4K1FA 1FHEA 2H1GA 5IMZA 1SJIA 2EIOA 2HZEB 1DE2A 2R3XA 3C1RA 1OC9B 1XWKA 4OO5A 1SK0A 1X9SB 2KHPA 4GTUA 3IPZA 8GSSA 2IMIA 4I5QA 2B5EA 4TKYA 2I1UA 1V2AA 4TR0A 4WR4A 1MDIA 3EE2A 1I5GA 1B48A 3DGQA 1Z3EA 1WIKA 1TRVA 4BVXA 3TUEA 2AV4A 3E3EA 5LNKe 5IO2A 3ZYWA 3G7JA 4K6XA 4ML1A 3D4TA 4V2LA 1XW5A 2M80A 3ERWA 1Y25A 1ZGNA 2CVDA 1TXXA 1TDIA 4PUFC 5J5NA 4AGSA 1S3AA 3PINA 1GL8A 3RPPA 3BCIA 2ON5A 3F4RA 3GKNA 3TB2A 4EDZA 5HQPA 4EE0A 3L9SA 1JHBA 12GSA 5GAND 4QQ7A 2GZZA 4OFTA 3TKSC 2ON7A 4MLYA 3KTLA 4N0ZA 4I8BA 2OE1A 1SKRB 2LS5A 2P31A 1MDJA 3KH7A 2LQQA 2F8FA 1VRSD 4XHMA 3PGTA 4IHUA 2WGRA 1ZOFA 4KW6A 5CRDA 1R26A 4HU9A 1A2MA 1BYEA 1NHOA 5ECSA 4K2DA 1A2LA 2BTOT 1TKDB 3FHKA 5LCZA 1M9AA 2HRNA 2DJKA 4YQMA 2IMEA 22GSA 2LRNA 1XOAA 1GRXA 4OWYA 1XZOA 4ML6A 1J9BA 4FYBA 1U87A 3GH6A 3O76A 4TRXA 4MJCA 3MDKA 2OKAA 1ACVA 3QAGA 3ERGA 3Q6OA 2H1DA 1VF2A 3TKSE 3Q18A 1DUGA 2GVPA 1ERVA 1U3IA 3F6FA 3P7XA 2PPTA 4NHZA 1WMJA 3FZ9A 1MTCA 3FZ4A 5IQYA 2C3QA 3HDCA 4F82A 1JZRA 4N30A 4F9ZA 3VI7A 3UL3A 1SU9A 2OA7A 4NPBA 1AAZA 2C3NA 1UA5A 3H93A 2H74A 5GSSA 2X8GA 5KN1A 5GSTA 1PMTA 1R5PA 3TRPA 4GQFA 2XBIA 1SYRA 2FY6A 3CBUA 4MF7A 1GSYA 3TKQA 5G31A 3BD2A 4K7NA 4RQRA 2OBIA 3IRAA 1GWCA 3A5WA 3E9JB 1GLQA 4CDOA 4P3YB 3F8UA 2WB9A 4LA1A 5KN0A 6GSYA 4RI6A 3VFIA 2YJHA 2B1KA 2VCVA 1BG5A 2L5LA 4YAVA 3EU4A 3ZLPA 5JWQB 5FT3A 1B8XA 2P5QA 1G0TA 2HXKA 4ECBA 5CAXA 3EYTA 1TU8A 2QKEA 1O6JA 1XW6A 2J23A 2KUCA 5ID2A 1GUMA 1VF3A 3GL5A 2M72A 1A23A 2FWEA 2JU5A 3TOTA 3KD0A 2JZSA 5IOWA 2B6MA 3GV1A 3TJGA 3NZNA 2FNOA 2C0FA 3DD3A 3D6IA 5ECLB 2VCQA 5ECMB 2L6DA 2V6KA 1QK8A 4WKWA 1K3LA 5G1LA 2WFCA 3KTBA 5D9VA 1SD8A 4HI7A 3HXSA 4O32A 3P90A 3UVHA 5GAPD 4MH3A 5ID2B 1HNCA 1S3CA 3F3QA 2RUFA 1DBYA 1XVWA 1W4VA 4OFNA 1F9MA 13GSA 2HNLA 4JEDA 4DEJA 2HZFA 4KUNA 2NTOA 3U6VA 2GLRA 1M2DA 4TR1A 1TTZA 4J57E 4ILFA 5KN2A 1GH2A 4POMA 4MJAA 3TKPA 4Q5QA 2MBSA 2BJXA 5A4VA 4IP6A 3QR6A 2RM6A 1F2EA 3UBLA 3KH9A 1GP1A 1PKWA 2VL9A 2H0HA 3IK7A 2LJKA 5DQSA 4NV5A 4KE3A 5D9TA 2YCDA 3CSIA 5D96A 5C00A 1G7EA 3FY7A 1XOBA 5J41A 3IV4A 2C0EA 2Z9SA 5G30A 1J08A 3D0ZA 1XXUA 4GSNA 2HI7A 1I9DA 1GUHA 5E59A 4RI7A 1U6TA 3CMIA 3EU3A 3CRUA 4EO3A 2X8CA 2H0IA 5CNWA 3QAWA 1WP0A 2H71A 2LUSA 3F4SA 3HJOA 4TR1B 5HR3A 4K0GA 2RUEA 1B9YC 1VF4A 1EEMA 1GNWA 3GSSA 2IWTA 4FO5A 1QFNA 5EPFA 2FD3A 3BJ5A 2G2QA 3FEUA 4BWQA 1EV9A 1OAZA 4V2MA 1O8XA 2XPDA 4PQHA 18GSA 1FB6A 1PSQA 5FWGA 2HRFA 4ZB8A 2N5AA 1OKTA 2JSZA 3KGKA 4GXZA 1XWBA 2PWJA 1THOA 4G10A 1PL1A 5JWRB 4YQUA 2FCHA 4WR5A 4GRFA 4G19A 3ZZXA 3IR4A 4E8HA 1SL0B 1ZYQB 2H72A 4PNFA 1E6BA 4G2EA 4OCEA 1M2AA 4MK3A 4JE1A 2IMKA 3LORA 3US3A 2MMZA 2VOCA 1GSQA 14GSA 2KP2A 2VL2C 3HKRA 5B7CA 4V1Ag 1TU7A 2EIRA 2OBKA 10GSA 3GKXA 4XCSA 1U3AA 3MNGA 4MA9A 3DEXA 1Z7RA 5DVBA 1T4YA 2H6ZA 4L8EA 2F8AA 3TJFA 3M8NA 5DDLA 2DLXA 4K7OA 1H75A 2YZHA 1JZOA 5H5QA 3D21A 4ZL7A 2LRTA 3FR9A 3F6DA 11GSA 4EC0A 1A0RP 4GLTA 5CRWA 2X8HA 1SJZA 3DKSA 1OVNA 3GA4A 1GNEA 1K3OA 4QL7A 4HQZA 3APOA 1YJ6A 5ENUA 1SD9A 2CQ9A 3LEFA 3O6TA 1T8EB 2FWHA 2CAIA 2MMNA 3LJRA 1PQNA 3WT2A 4XIHA 4ZL8A 1EWXA 1Z5YE 1M2BA 1YF0A 4HU7A 2B5YA 4ZBDA 1M0UA 5J9BA 1TP9A 2DMLA 4Q5RA 1TRSA 1AQWA 3G9BA 5F8BA 4JR4A 1O85A 2JL4A 2OE0A 4KSMA 2HT9A 1Z6NA 3RAZA 1IYIA 5HR2A 1K0MA 4LL4B 3ZITA 1XFLA 1PN9A 2GT5A 5CRHA 1HQOA 3A3TA 3J7Yk 1TW9A 2AJQB 2C3TA 17GSA 1FVJA 2KOKA 3I69A 2HYXA 4NV2A 2R37A 2XC2A 4IQ1A 1MDKA 5IM9A 2VM2A 4IW9A 4F0BA 2P0GA 2VAFA 4J2FA 3GMFA 1O8WA 2YWMA 5D9XA 1HD2A 2JZTA 4HZ2A 5CO3A 2H0GA 2FA8A 3M9KA 4O5RA 5IMVA 3U5RE 3I43A 5ABRA 3KP8A 3FRCA 3ME7A 4XTSA 4KA0A 3GUSA 4RUVA 1K0DA 2PERA 3HVVA 4ID0A 2B1LA 4CW9A 5AN1A 1GTUA 1JFUA 5B6MA 2H76A 4MABA 1EGRA 2XPEA 1SK2A 3TCOA 4PQ1A 4O7HA 2AAWA 5AIVA 2IIYA 1E2YA 4F03A 1VGLA 4KX4A 3CYNA 3KXOA 3IXRA 4OCFA 3F4TA 1JLWA 2DJ3A 2H8LA 5AIXA 1AUCA 1QQ2A 2LJAA 1ERWA 5IPGA 4AF2A 3HYPA 2C8UA 4KGIA 3GHAA 1JLVA 2JSYA 3TOUA 2HSHA 4KCAA 4NWYA 1YKCA 5JCWA 1YKAA 4NHWA 1PRXA 3OR5A 1TOFA 2L6CA 3S9FA 4HDEA 2X64A 2YNXA 3DVXA 3DWVA 1LU4A 2YWOA 2K8VA 2PN8A 1FO5A 5ELAA 5DCGA 5ECPB 4Z7XA 2V6OA 4YH2A 2YV7A 1LJRA 2ES7A 4FH8A 1AC1A 4ECIA 3IBHA 4E8EA 3A2VA 4WBJA 4PNGA 4DSRA 2OJLA 4BVYA 4HZ4A 2C1YA 5H5RA 3GN3A 2IJYA 4WEYA 5D9WA 5D93A 1UVZA 2FWGA 2H1AA 5LD0A 4HJ2A 2FLSA 2CT6A 4O92A 3UVTA 4HUAA 3HY2A 3ZIVA 2F9SA 1EEJA 4HEA2 4LMVA 1V98A 2R4VA 3LXZA 1BAYA 2V1MA 1MD3A 1JZDA 3EVIA 1AXDA 1ILOA 3N9JA 4IP1A 1ZCPA 1M9BA 4N0VA 2TIRA 1Y6EA 3R2QA 3RBTA 4CHSA 2CZ3A 3BBYA 2PVQA 3FR6A 1T3BA 4IJIA 2EC4A 1SKWB 3LWAA 5G2ZA 1FB0A 2GDRA 4GSSA 3WGEA 16GSA 2L5OA 4YAPA 2H6XA 4TXOB 3APSA 2IN3A 1K3YA 4YQVA 3CTFA 3LGCA 2DJ2A 4EKZA 2VD0A 5AISA 3IHQA 3HJMA 2CA8A 4IELA 1FAAA 2LV3A 6GSVA 2YWIA 1K0BA 2E2GA 1QMVA 1YZXA 2A4VA 1A0FA 3FZ5A 3IK9A 2PU9C 3M0FA 3VWUA 1OYJA 19GSA 1GLPA 3GTUA 3VWXA 2B3SA 2L57A 2WULA 1PD21 1QGVA 2MMAA 2QSIA 5GZZB 5IMDA 2C80A 4ZIJA 5AGYA 2LNSA 1FW1A 3KIJA 2HSYA 2YWNA 2YJ7A 1F6MC 2QC7A 5INYA 3UMAA 2M46A 3IAM2 1B9XC 3SBCA 2N5FA 3ZFLA 1V58A 4FYCA 2GZYA 1KBNA 1WOUA 2GSRA 3EMXA 3RHBA 2YANA 3QPMA 3ZTLA 1X5CA 4IGJA 1R5AA 2VO4A 4IN0A 2IMDA 1O73A 1H4OA 3GFKA 2TRCP 5IO0A 3MWHA 1DSBA 1X9WB 1AW9A 2ZNMA 4OFMA 3GTUB 4JU5A 3RDWA 3EWLA 3WT1A 3GRXA 3APQA 2YN1A 3PR8A 1A8LA 2WZ9A 2LSTA 2WDUA 4MZCA 4KNDA 4MMMA 1J0FA 1F3BA 1XBSA 5L71A 2GT6A 1EP8A 4AJ8A 4BPYA 3J7Yb 4RQXA 3GKMA 2L4QA 2FHEA 3QOUA 3QFAC 1GSDA 2IFQA 2KP1A 4N10A 3G7IA 4PURA 3HZ4A 3Q19A 3ZREA 2B7KA 5CYYA 1GTIA 4L5OA 1GTAA 2DSAA 2X99A 1TK8B 3BCKA 3GYKA 2NPBA 3HVSA 4HJMA 4OO4A 2C0GA 4IBPA 3IOSA 3M3MA 3VLNA 4XRAA 4KDUA 3O3TA 5G5FA 2B5XA 4IJ3A 5B8AA 6GSUA 3KZQA 3KMOA 2V41A 1F3AA 4IKHA 2P5RA 4XS1A 3P2AA 2I81A 3M1GA 3FR3A 3FZAA 2DMMA 1WE0A 5COHA 3DVWA 3N5OA 2PGTA 1GTBA 2VCZA 5F06A 3RHCA 1XPVA 2IFQB 2QGVA 2REMA 3GSTA 2GSTA 2AHEA 1CQGA 3PH9A 2MZCA 2J9HA 5CREA 4QL9A 2LQOA 3MAKA 2FWFA 2RM5A 5ECHB 3VURA 1K0OA 1QXHA 3LYKA 1ERUA 1R4WA 4ISDA 3QFBC 4X0XA 3AY8A 4KDYA 3IC4A 2WS2A 4MF5A 2PBJA 2GSSA 5EL8A 2C4JA 3D5JA 1ABAA 3EC3A 5CP1A 3TJKA 1C72A 2AYTA 2FGXA 5DBQA 3VWWA 1N8JA 3TJJA 2XBQA 1TRUA 2OACA 2VD1A 3C73A 1YEXA 1GSFA 2CVBA 3NIVA 1A8YA 2AB6A 3F63A 2H30A 2NDOA 3LYPA 2GQMA 1QUWA 5ECOB 4G9HA 1ZL9A 1SYXA 4MP4A 1OKDA 3EINA 2G0FA 3A2WA 2DJ0A 4HOJA 1WRYA 1RQMA 2E7PA 5DAKA 6GSWA 4ULXA 2F51A 2OE3A 1FOVA 5D73A 3V1WA 2YOIA 1Q4JA 4FIWA 3C71A 1V9WA 1OC3A 3HJPA 4GWRA 5JCGA 2AUVA 5DQYA 4I2UA 3GKKA 2MYGA 2K8SA 1FG4A 4DVCA 3F0IA 1GULA 2LEGA 5B6NA 1O7UA 9GSSA 3KMNA 1MEKA 4TR4A 3CSHA 2GSQA 2YPMA 4KCEA 3ZVJA 2IMFA 5HR0A 3QMXA 1SENA 2O8VB 2VCXA 1SK1A 1EGOA 2A2RA 2RLIA 4L0WA 1XWCA 2H01A 4D73A 1KNGA 1ZYEA 2LTKA 4DSQA 2LNTA 5DAKB 2KLXA 2YV9A 5ECQB 5IMCA 2H75A 1HNBA 2OADA 1ST9A 4MPGA 2H73A 4HQSA 1TK0B 4NMUA 4HS1A 4ZILA 1V57A 2IL3A 4XRDA 3G7YA 3LXTA 1LBKA 1YF1A 1OC8A 3RPNA 3F9UA 4AJ6A 4WETA 2B7JA 3ED3A 1AQXA 4TW5A 1KEBA 5HR1A 2K6VA 3H8QA 1A24A 1YEPA 3FW2A 2NVLA 1X5EA 2E0QA 4J56E 3W8SA 4GCIA 3L0HA 1B4QA 3VI5A 1HYUA 2FA4A 2K18A 5F05A 3DIEA 3TKSA 1SL2B 3ZFBA 3TGZA 4D73B 2E2MA 5G1KA 3CRTA 4EVMA 1EOGA 3DRNA 3GURA 2HE3A 4Q5NA 4TXVA 2H6YA 4XS4A 1M99A 2XHFA 4MZBA 3C7MA 4KB3A 6GSSA 1EP7A 3HZ8A 1T1VA 1T4ZA 4OD7A 1VF1A 2GTUA 3ZIJA 4ZBAA 3KJYA 3ISOA 1GSSA 4GF0A 2GZPA 1W89A 2WJUA 4BWSA 4WF5A 4EF0A 4Q5FA 3IA1A 1N2AA 5A4UA 1TI1A 2O85A 1Z7PA 4MH2A 3UJ1A 1NHYA 1TRWA 1WJKA 1GUKA 3W6GA 2DJJA 2VLTA 2A2SA 2CV4A 3E0UA 1TI3A 4MDCA 4TR3A 3IAS2 3KP9A 3TKRA 2ZCTA 2ZUPA 1URMA 2LKUA 1A2JA 4MF6A 4DSSA 2O89A 3I6AA 1YDKA 2JADA 2F3MA 3FKFA 3L4NA 4XS4B 5IMAA 3HVXA 3WGXA 3C1SA 3D4MA 2GGTA 4ECCA 2IPAA 2PVOC 2TRXA 4TXOA 2GQKA 2JZRA 2O87A 4PQIA 1TJDA 7GSSA 1XIYA 1NW2A 4F2IA 5ECKB 2I4AA 4POKA 3TDGA 4IVFA 4EDYA 3L9VA 3HD5A 5D8IA 1T7PB 5DALA 4MCUA 2DC5A 1XWGA 3FK8A 4WXTA 3TRQA 4KH7A 3IE3A 2VLUA 3LQ7A 3VPQA 4DSSB 1THXA 2I3YA 2CZ2A 1RW1A 3LSZA 4MJEA 4MZWA 4GSTA 3NOFA 2GS3A 4V2NA 4KAEA 1AQVA 3GL3A 3C8EA 2MBTA 5A5KA 1U88A 1XCCA 2HLSA 2YP6A 1WPIA 3DXBA 3UEMA 1XVQA 1YQ1A 1PGTA 3HA9A 3KEBA 3ERFA 1UN2A 4POBA 5E4WA 4WBRD 2GQLA 3CSJA 3HCZA 1BEDA 2R5GA 5HFIA 1FVKA 5DALB 2DIZA 4NAXA 5KN3A 3GX8A 1RK4A 3HHVA 4K0NA 5IIZA 4FYUA 4K8MA 3WYWA 1YY7A 3Q74A 5G5EA 4TVEA 2LJRA 3P8WA 4V1Ap 1CQHA 6GSXA 4PX1A 1SJ6A 1K0NA 3IDVA 4ZB9A 1WWJA 4I97A 2MMOA 4BA7A 1DE1A 3CTGA 4JRRA 3ZVJD 3D22A 2PMTA 4IQAA 1UC7A 2WCIA 2O7KA 2R2JA 3K8NA 1O81A 3UIWA 2LRCA 1SKSB 2V32A 4ACSA 4LLRA 1KTEA 2BMXA 4N11A 4LMWA 4XS6A 1BX9A 4I2TA 3W8JA 2L59A 1Z6MA 3UOMA 2CAQA 1Q98A 4H86A 3FYGA 4TN8A 1K0AA 5H5SA 2WRTA 1MD4A 3TJBA 2CX3A 1BJXA 3BOAA 3VK9A 5F07A 2VLVA 4ZB6A 4BL7A 3H79A 1EZKA 2L4CA 4K9ZA 5ECIB 2NBSA 1PA3A 1TK5B 4WF4A 2D2ZA 1V40A 3TRXA 3GIXA 3QCPA 3LG6A 1X5DA 5J3RA 4X43A 3H4KA 3H1NA 3UARA 3ME8A 3I9V2 4PXOA 3L78A 3ZL5A 3ZRDA 3EURA 2VL3A 2H1BA 2I9HA 4IS0A 5JCUA 4L0UA 4PUAA 4GQCA 3DYRA 5ECNB 5F0GA 3SWLA 5ECRB 3KCMA 2V2GA 1X9MB 2H66A 4JR6A 1NSWA 3MSZA 4L5LA 2CX4A 3QDNA 4KSOA 5EVOA 1S3DA 5KEJA 3UBKA 2PUKC 4OMVA 3DMLA 5JWOB 4NXIA 1PX6A 3A2XA 5EY6A 3VPTA 2DBCA 3M9JA 4MPFA 2JACA 4ZL9A 4K7IA 4X1UA 5IMFA 5IOXA 2C0DA 1GSUA 4POLA 4EXJA 1PKZA 5DCHA 4EUYA 20GSA 1ERTA 5HFGA 1EOHA 3ZMKA 1BQ7A 4F0CA 1NM3A 4AJ7A 1M7TA 2VL2A 5CRGA 5A4WA 1XW9A 3GX0A 2DIYA 1ON4A 5IPHA 2RIIA 1JZWA 3F3RA 1ZZYA 1Z9HA 4PGTA 3CXGA 2VIMA 5J4UA 1G6WA
chains in the Genus database with same CATH superfamily
1R7HA 1G6YA 5ELGA 5C04A 2A4HA 3QD9A 2VCWA 3KM6A 4JZQA 5HFKA 5FHIA 2VUPA 1OE8A 1HNAA 1PL2A 4ZBBA 2HZEA 3LFLA 3GNJA 1OC9A 5J9CA 2N5BA 5B8BA 2R6KA 3EMPA 2DJ1A 1SL1B 3ZMLA 1X0RA 3JCML 1G7OA 2H70A 5DJMA 1OE7A 6GSTA 1ZMAA 2CVKA 4I6XA 2ALBA 2HFDA 1K0CA 2YZUA 4ZXGA 1F37A 3UAPA 2H19A 3L9UA 3WD6A 4KDXA 1B4PA 2FUG2 3WGDA 2K9FA 1EV4A 4ECJA 2VM1A 2VCTA 1IYHA 1PX7A 3GH9A 3QAVA 4TOPA 1XWAA 1ML6A 4LL1B 1USBA 4MJBA 1T00A 4EL1A 1AIUA 3VWVA 5DJLA 2EIQA 4JBBA 1GSEA 4K1FA 1FHEA 2H1GA 5IMZA 3LW9A 1SJIA 2EIOA 2HZEB 1DE2A 2R3XA 3C1RA 1OC9B 1XWKA 4OO5A 1SK0A 1X9SB 1XG8A 2DKIA 2KHPA 4GTUA 3IPZA 5KOWA 1ZYNA 2IMIA 8GSSA 4I5QA 2B5EA 4TKYA 2I1UA 1V2AA 4TR0A 4WR4A 1MDIA 3EE2A 3MIXA 1I5GA 1B48A 3DGQA 1Z3EA 1WIKA 1TRVA 4BVXA 3TUEA 2AV4A 3E3EA 5LNKe 5IO2A 3ZYWA 3G7JA 4K6XA 4ML1A 3D4TA 4V2LA 1XW5A 2M80A 3ERWA 1Y25A 1ZGNA 2CVDA 1TXXA 1TDIA 4PUFC 5J5NA 4AGSA 1S3AA 3PINA 1GL8A 3RPPA 3BCIA 2ON5A 3F4RA 3GKNA 3TB2A 4EDZA 5HQPA 4EE0A 3L9SA 1JHBA 12GSA 4Z2RA 5GAND 4QQ7A 2GZZA 4OFTA 3TKSC 2ON7A 4MLYA 3KTLA 4N0ZA 4I8BA 2OE1A 1SKRB 2LS5A 2P31A 1MDJA 3KH7A 4BVXB 2LQQA 2F8FA 1VRSD 4XHMA 3PGTA 4IHUA 2WGRA 1ZOFA 4KW6A 5CRDA 1R26A 4HU9A 1A2MA 1BYEA 1NHOA 5ECSA 4K2DA 1A2LA 2BTOT 1TKDB 3FHKA 5LCZA 1M9AA 2HRNA 2DJKA 2IMEA 4YQMA 22GSA 2LRNA 1XOAA 1GRXA 4OWYA 1XZOA 4ML6A 1J9BA 4FYBA 1U87A 3GH6A 3O76A 4TRXA 4MJCA 3MDKA 2OKAA 1ACVA 3QAGA 3ERGA 3Q6OA 2H1DA 1VF2A 3TKSE 3Q18A 1DUGA 2GVPA 1ERVA 1U3IA 3F6FA 3P7XA 2PPTA 4NHZA 1WMJA 3FZ9A 1MTCA 3FZ4A 5IQYA 2C3QA 3HDCA 4F82A 1JZRA 4N30A 4F9ZA 3VI7A 3UL3A 1SU9A 2OA7A 4NPBA 1AAZA 2C3NA 1UA5A 3H93A 2H74A 5GSSA 2X8GA 5KN1A 5GSTA 1PMTA 1R5PA 3TRPA 4GQFA 2XBIA 1SYRA 2FY6A 3CBUA 4MF7A 1GSYA 3TKQA 5G31A 3BD2A 4K7NA 4RQRA 2OBIA 3IRAA 1GWCA 3A5WA 3E9JB 1GLQA 4CDOA 4P3YB 3F8UA 2WB9A 4LA1A 5KN0A 6GSYA 4RI6A 3VFIA 2YJHA 2B1KA 2VCVA 1BG5A 2L5LA 4YAVA 3EU4A 3ZLPA 5JWQB 5FT3A 1B8XA 2P5QA 1G0TA 2HXKA 4ECBA 5CAXA 3EYTA 1TU8A 2QKEA 1O6JA 1XW6A 2J23A 2KUCA 5ID2A 1GUMA 1VF3A 3GL5A 2M72A 1A23A 2FWEA 2JU5A 3TOTA 3KD0A 2JZSA 5IOWA 2B6MA 1M3IA 3GV1A 3TJGA 3NZNA 2FNOA 2C0FA 3DD3A 3D6IA 5ECLB 2VCQA 5ECMB 2L6DA 2V6KA 1QK8A 4WKWA 1K3LA 5G1LA 2WFCA 3KTBA 5D9VA 1SD8A 4HI7A 3HXSA 4O32A 3P90A 3PPUA 3UVHA 5GAPD 4MH3A 5ID2B 1HNCA 1S3CA 3F3QA 2RUFA 1DBYA 1XVWA 1W4VA 4OFNA 1F9MA 13GSA 2HNLA 4JEDA 4DEJA 2HZFA 4KUNA 2NTOA 3U6VA 2GLRA 1M2DA 4TR1A 1TTZA 4J57E 4ILFA 5KN2A 1GH2A 4POMA 4MJAA 3TKPA 4Q5QA 2MBSA 2BJXA 5A4VA 4IP6A 3QR6A 2RM6A 1F2EA 3UBLA 3KH9A 4EIQA 1GP1A 1PKWA 2VL9A 2H0HA 3IK7A 2LJKA 5DQSA 4NV5A 4KE3A 5D9TA 2YCDA 3CSIA 5D96A 5C00A 1G7EA 3FY7A 1XOBA 4O5QA 5J41A 3IV4A 2C0EA 2Z9SA 5G30A 1J08A 3D0ZA 4X4JA 1XXUA 4GSNA 2HI7A 1I9DA 1GUHA 5E59A 4RI7A 1U6TA 3CMIA 3EU3A 3CRUA 4EO3A 2X8CA 2H0IA 5CNWA 3QAWA 1WP0A 2H71A 2LUSA 3F4SA 3HJOA 4TR1B 5HR3A 4K0GA 2RUEA 1B9YC 4Z2UA 1VF4A 1EEMA 1GNWA 3GSSA 2IWTA 4FO5A 1QFNA 5EPFA 2FD3A 3BJ5A 2G2QA 3FEUA 4BWQA 1EV9A 1OAZA 4V2MA 1O8XA 2XPDA 4PQHA 18GSA 1FB6A 1PSQA 5FWGA 2HRFA 4ZB8A 2N5AA 2DKHA 1OKTA 2JSZA 3KGKA 4GXZA 1XWBA 2PWJA 1THOA 4G10A 5KOXA 1PL1A 5JWRB 4YQUA 2FCHA 4WR5A 4GRFA 4G19A 3ZZXA 3IR4A 4E8HA 1SL0B 1ZYQB 2H72A 4PNFA 1E6BA 4G2EA 4OCEA 1M2AA 4MK3A 4EIPA 4JE1A 2IMKA 3LORA 3US3A 2MMZA 2VOCA 1GSQA 14GSA 2KP2A 2VL2C 3HKRA 5B7CA 4V1Ag 1TU7A 2EIRA 2OBKA 10GSA 3GKXA 4XCSA 1U3AA 4HSCX 3MNGA 4MA9A 3DEXA 1Z7RA 5DVBA 1T4YA 2H6ZA 4L8EA 2F8AA 3TJFA 3CQFA 3M8NA 5DDLA 2DLXA 4K7OA 1H75A 2YZHA 1JZOA 5H5QA 3D21A 4ZL7A 2LRTA 3FR9A 3F6DA 11GSA 4EC0A 1A0RP 4GLTA 5CRWA 2X8HA 1SJZA 3DKSA 1OVNA 3GA4A 4K5SA 1GNEA 1K3OA 4QL7A 4HQZA 3APOA 1YJ6A 5ENUA 1SD9A 2CQ9A 3LEFA 3O6TA 1T8EB 2FWHA 2CAIA 2MMNA 3LJRA 1PQNA 3WT2A 4XIHA 4ZL8A 1EWXA 1Z5YE 1M2BA 1YF0A 4HU7A 2B5YA 4ZBDA 1M0UA 5J9BA 1TP9A 2DMLA 4Q5RA 1TRSA 1AQWA 3G9BA 5F8BA 4JR4A 1O85A 4G0KA 2JL4A 2OE0A 4KSMA 2HT9A 1Z6NA 3RAZA 1IYIA 5HR2A 1K0MA 4LL4B 3ZITA 1XFLA 1PN9A 2GT5A 5CRHA 1HQOA 3A3TA 3J7Yk 1TW9A 4MNNA 2AJQB 2C3TA 17GSA 1FVJA 2KOKA 3I69A 2HYXA 4NV2A 2R37A 2XC2A 4IQ1A 1MDKA 5IM9A 2VM2A 4IW9A 4F0BA 2P0GA 1M3JA 2VAFA 4J2FA 3GMFA 1O8WA 2YWMA 5D9XA 1HD2A 2JZTA 4HZ2A 5CO3A 2H0GA 2FA8A 3M9KA 4O5RA 5IMVA 3U5RE 3I43A 4CY6A 4ICYA 5ABRA 3KP8A 3FRCA 3ME7A 4XTSA 4KA0A 3GUSA 4RUVA 1K0DA 2PERA 3HVVA 4ID0A 2B1LA 4CW9A 5AN1A 1GTUA 1JFUA 5B6MA 2H76A 4MABA 1EGRA 2XPEA 1SK2A 3TCOA 4PQ1A 4O7HA 2AAWA 5AIVA 2IIYA 1E2YA 4F03A 1VGLA 4KX4A 3CYNA 3KXOA 3IXRA 4OCFA 3F4TA 1JLWA 2DJ3A 2H8LA 5AIXA 1AUCA 1QQ2A 2LJAA 1ERWA 5IPGA 4AF2A 3HYPA 2C8UA 4KGIA 3GHAA 1JLVA 2R0GA 4G0IA 2JSYA 3TOUA 2HSHA 4BIKA 4KCAA 4NWYA 1PFOA 1YKCA 5JCWA 1YKAA 4NHWA 1PRXA 3OR5A 1TOFA 2L6CA 4CY8A 3S9FA 4HDEA 2X64A 2YNXA 3DVXA 3DWVA 1LU4A 2YWOA 2K8VA 2PN8A 1FO5A 5ELAA 5DCGA 5ECPB 4Z7XA 2V6OA 4YH2A 2YV7A 1LJRA 2ES7A 4FH8A 1AC1A 4ECIA 3IBHA 4E8EA 3A2VA 4WBJA 4PNGA 4DSRA 2OJLA 1ZYPA 4BVYA 4HZ4A 2C1YA 2HSMA 3GN3A 5H5RA 2IJYA 4WEYA 5D9WA 5D93A 1UVZA 2FWGA 2H1AA 5LD0A 4HJ2A 2FLSA 2CT6A 4O92A 3UVTA 4HUAA 3HY2A 3ZIVA 2F9SA 1EEJA 4HEA2 4LMVA 1V98A 2R4VA 3LXZA 1BAYA 2V1MA 1MD3A 1JZDA 3EVIA 1AXDA 1ILOA 3N9JA 4IP1A 1ZCPA 1M9BA 4N0VA 2TIRA 1Y6EA 3R2QA 3RBTA 4CHSA 2CZ3A 3BBYA 2PVQA 2R0CA 3FR6A 1T3BA 4IJIA 2EC4A 1SKWB 3LWAA 5G2ZA 1FB0A 2GDRA 4GSSA 3IC8A 3WGEA 16GSA 2L5OA 4YAPA 2H6XA 4TXOB 4BVYB 3APSA 2IN3A 1K3YA 4YQVA 3CTFA 3LGCA 2DJ2A 4EKZA 2VD0A 5AISA 3IHQA 3HJMA 2CA8A 4IELA 1FAAA 2LV3A 6GSVA 2YWIA 1K0BA 2E2GA 4USSA 1QMVA 1YZXA 2A4VA 1A0FA 3FZ5A 3IK9A 2PU9C 3M0FA 3VWUA 1OYJA 19GSA 1GLPA 3GTUA 3VWXA 2B3SA 2L57A 2WULA 1PD21 1QGVA 2MMAA 2QSIA 5GZZB 5IMDA 2A2PA 2C80A 4ZIJA 5AGYA 2LNSA 1FW1A 3KIJA 2HSYA 2YWNA 2YJ7A 1F6MC 2QC7A 5INYA 3UMAA 2M46A 4YKFA 3IAM2 1FOHA 1B9XC 3SBCA 2N5FA 3ZFLA 1V58A 4FYCA 2GZYA 1KBNA 1WOUA 2GSRA 3EMXA 3RHBA 2YANA 3QPMA 3ZTLA 1X5CA 4IGJA 1R5AA 2VO4A 4IN0A 2IMDA 3FMWA 1O73A 1H4OA 3GFKA 2TRCP 5IO0A 3MWHA 1DSBA 1X9WB 1AW9A 2ZNMA 4OFMA 3GTUB 4JU5A 3RDWA 3EWLA 3WT1A 3GRXA 3APQA 2YN1A 3PR8A 1A8LA 2QA2A 2WZ9A 2LSTA 2WDUA 4MZCA 4KNDA 4MMMA 1J0FA 1F3BA 1XBSA 5L71A 2GT6A 1EP8A 4AJ8A 4BPYA 3J7Yb 4RQXA 3GKMA 2L4QA 2FHEA 3QOUA 3QFAC 1GSDA 2IFQA 2KP1A 4N10A 3G7IA 4PURA 3HZ4A 3Q19A 3ZREA 2B7KA 5CYYA 1GTIA 4L5OA 1GTAA 2DSAA 2X99A 1TK8B 3BCKA 3GYKA 2NPBA 3HVSA 4HJMA 4OO4A 2C0GA 4IBPA 3IOSA 3M3MA 3VLNA 4XRAA 4KDUA 3O3TA 5G5FA 4YKGA 2B5XA 4IJ3A 5B8AA 6GSUA 3KZQA 3KMOA 2R0PA 2V41A 1F3AA 4IKHA 2P5RA 4XS1A 3P2AA 2I81A 3M1GA 3FR3A 3FZAA 2DMMA 1WE0A 5COHA 4K5RA 3DVWA 3N5OA 2HRAA 2PGTA 1GTBA 2VCZA 5F06A 3RHCA 1XPVA 2IFQB 2QGVA 2REMA 2UZ8A 3GSTA 2GSTA 2AHEA 1CQGA 3PH9A 2MZCA 2J9HA 5CREA 4QL9A 2LQOA 3MAKA 2FWFA 2RM5A 5ECHB 3VURA 1K0OA 1QXHA 3LYKA 1ERUA 1R4WA 4ISDA 3QFBC 4X0XA 3AY8A 4KDYA 3IC4A 2WS2A 4MF5A 2PBJA 2GSSA 5EL8A 2C4JA 3D5JA 1ABAA 3EC3A 4O5UA 5CP1A 3TJKA 1C72A 2AYTA 2FGXA 5DBQA 3VWWA 1N8JA 3TJJA 2XBQA 1TRUA 2OACA 2VD1A 3C73A 1YEXA 1GSFA 2CVBA 3NIVA 1A8YA 2AB6A 3F63A 3HVNA 2H30A 2NDOA 3LYPA 4FQUA 2GQMA 1QUWA 5ECOB 4G9HA 1ZL9A 1SYXA 4MP4A 1OKDA 3EINA 2G0FA 3A2WA 2DJ0A 2X49A 4HOJA 1WRYA 1RQMA 2E7PA 5DAKA 6GSWA 4ULXA 2F51A 2OE3A 1FOVA 5D73A 3V1WA 2YOIA 1Q4JA 4FIWA 3C71A 1V9WA 1OC3A 3HJPA 4GWRA 5JCGA 2AUVA 5DQYA 4I2UA 3GKKA 2MYGA 2K8SA 1FG4A 4DVCA 3F0IA 1GULA 2LEGA 5B6NA 1O7UA 9GSSA 3KMNA 1MEKA 4K2XA 4TR4A 3CSHA 2GSQA 2YPMA 4KCEA 3ZVJA 2IMFA 5HR0A 3QMXA 1SENA 2O8VB 2VCXA 1SK1A 1EGOA 2A2RA 2RLIA 4L0WA 1XWCA 2H01A 4D73A 1KNGA 1ZYEA 2LTKA 4DSQA 2LNTA 5DAKB 2KLXA 2YV9A 5ECQB 5IMCA 2H75A 1HNBA 2OADA 1ST9A 4MPGA 2H73A 4HQSA 4PTSA 1TK0B 4NMUA 4HS1A 4A5PA 4ZILA 1V57A 2IL3A 4XRDA 3G7YA 3LXTA 1LBKA 1YF1A 1OC8A 3RPNA 3F9UA 4AJ6A 4KF9A 4WETA 2B7JA 3ED3A 1AQXA 4TW5A 1KEBA 5HR1A 2K6VA 3H8QA 1A24A 1YEPA 3FW2A 2NVLA 1X5EA 2E0QA 4J56E 3W8SA 4GCIA 3L0HA 1B4QA 3VI5A 1HYUA 2FA4A 2K18A 5F05A 3DIEA 3TKSA 1SL2B 3ZFBA 3TGZA 4D73B 2E2MA 5G1KA 3CRTA 4EVMA 1EOGA 3DRNA 3GURA 2HE3A 4Q5NA 4TXVA 2H6YA 4XS4A 1M99A 2XHFA 4MZBA 3C7MA 4KB3A 6GSSA 1EP7A 3HZ8A 1T1VA 1T4ZA 4OD7A 1VF1A 2GTUA 3ZIJA 4ZBAA 3KJYA 3ISOA 1GSSA 4GF0A 2GZPA 1W89A 2WJUA 4BWSA 4WF5A 4EF0A 4Q5FA 3IA1A 1N2AA 5A4UA 2X4AA 1TI1A 2O85A 1Z7PA 4MH2A 3UJ1A 1NHYA 1TRWA 1WJKA 1GUKA 3W6GA 2DJJA 2VLTA 2A2SA 2CV4A 3E0UA 1TI3A 4MDCA 4TR3A 3IAS2 3KP9A 3TKRA 2ZCTA 2ZUPA 1URMA 2LKUA 1S3RA 1A2JA 4MF6A 4DSSA 2O89A 3I6AA 1YDKA 2JADA 2F3MA 3FKFA 3L4NA 4XS4B 5IMAA 3HVXA 3WGXA 3C1SA 3D4MA 2GGTA 2HRKA 4ECCA 2IPAA 2PVOC 2TRXA 4TXOA 2GQKA 2JZRA 2O87A 4PQIA 1TJDA 7GSSA 1XIYA 1NW2A 4F2IA 5ECKB 2I4AA 4POKA 3TDGA 4IVFA 4EDYA 3L9VA 3HD5A 5D8IA 1T7PB 5DALA 4MCUA 2DC5A 1XWGA 3FK8A 4WXTA 3TRQA 4KH7A 3IE3A 2VLUA 3LQ7A 3VPQA 4DSSB 1THXA 2I3YA 2CZ2A 1RW1A 3LSZA 4MJEA 4MZWA 4GSTA 3NOFA 2GS3A 4V2NA 5BRTA 4KAEA 1AQVA 3GL3A 3C8EA 2MBTA 5A5KA 1U88A 1XCCA 2HLSA 2YP6A 1WPIA 3DXBA 3UEMA 3MYDA 1XVQA 1YQ1A 1PGTA 3HA9A 3KEBA 3ERFA 1UN2A 4POBA 5E4WA 4WBRD 2GQLA 3CSJA 3HCZA 1BEDA 2R5GA 5HFIA 1FVKA 5DALB 2DIZA 4NAXA 5KN3A 3GX8A 1RK4A 3HHVA 4K0NA 5IIZA 4FYUA 4K8MA 3WYWA 1YY7A 3Q74A 3IHGA 5G5EA 4TVEA 2LJRA 3P8WA 4V1Ap 1CQHA 6GSXA 4PX1A 1SJ6A 1K0NA 3IDVA 4ZB9A 1WWJA 4I97A 2MMOA 4BA7A 1DE1A 3CTGA 4JRRA 3ZVJD 3D22A 2PMTA 4IQAA 1UC7A 2WCIA 2O7KA 2R2JA 3K8NA 1O81A 3UIWA 2LRCA 3R3EA 1SKSB 2V32A 4ACSA 4LLRA 1KTEA 2BMXA 4N11A 4LMWA 4XS6A 1BX9A 4I2TA 3W8JA 2L59A 1Z6MA 3UOMA 2CAQA 1Q98A 4H86A 3FYGA 4TN8A 1K0AA 5H5SA 2WRTA 1MD4A 3TJBA 2CX3A 4Z2TA 1BJXA 3BOAA 3VK9A 5F07A 2VLVA 4ZB6A 4BL7A 3H79A 1EZKA 3EPTA 2L4CA 4K9ZA 2NBSA 5ECIB 1PA3A 1TK5B 4WF4A 2D2ZA 1V40A 3TRXA 3GIXA 3QCPA 3LG6A 1X5DA 5J3RA 4X43A 3H4KA 3H1NA 3UARA 3ME8A 3I9V2 2QA1A 4PXOA 3L78A 3ZL5A 3ZRDA 3EURA 2VL3A 2H1BA 2I9HA 4IS0A 5JCUA 4L0UA 5BMUA 4PUAA 4GQCA 3A5IA 3DYRA 5ECNB 5F0GA 3SWLA 5ECRB 3KCMA 4G0LA 2V2GA 1X9MB 2H66A 4JR6A 1NSWA 3MSZA 4BL7B 4L5LA 2CX4A 3QDNA 4KSOA 5EVOA 1S3DA 5KEJA 3UBKA 2PUKC 4OMVA 3DMLA 5JWOB 4NXIA 1PX6A 3A2XA 5EY6A 3VPTA 2DBCA 3M9JA 4MPFA 2JACA 4ZL9A 4K7IA 4X1UA 5IMFA 5IOXA 2C0DA 1GSUA 1PN0A 4POLA 4EXJA 1PKZA 5DCHA 4EUYA 20GSA 1ERTA 5HFGA 1EOHA 3ZMKA 1BQ7A 4F0CA 1NM3A 4AJ7A 1M7TA 2VL2A 5CRGA 5A4WA 1XW9A 3GX0A 2DIYA 1ON4A 5IPHA 2RIIA 1JZWA 3F3RA 1ZZYA 1Z9HA 4PGTA 3CXGA 2VIMA 5J4UA 1G6WA
chains in the Genus database with same CATH topology
1R7HA 1G6YA 5ELGA 5C04A 2A4HA 3QD9A 2VCWA 3KM6A 4JZQA 5HFKA 5FHIA 2VUPA 1OE8A 1HNAA 1PL2A 4ZBBA 2HZEA 3LFLA 3GNJA 1OC9A 5J9CA 2N5BA 5B8BA 2R6KA 3EMPA 2DJ1A 1SL1B 3ZMLA 1X0RA 3JCML 1G7OA 2H70A 5DJMA 1OE7A 6GSTA 1ZMAA 2CVKA 4I6XA 2ALBA 2HFDA 1K0CA 2YZUA 4ZXGA 1F37A 3UAPA 2H19A 3L9UA 3WD6A 4KDXA 1B4PA 2FUG2 3WGDA 2K9FA 1EV4A 4ECJA 2VM1A 2VCTA 1IYHA 1PX7A 3GH9A 3QAVA 4TOPA 1XWAA 1ML6A 4LL1B 1USBA 4MJBA 1T00A 4EL1A 1AIUA 3VWVA 5DJLA 2EIQA 4JBBA 1GSEA 4K1FA 1FHEA 2H1GA 5IMZA 3LW9A 1SJIA 2EIOA 2HZEB 1DE2A 2R3XA 3C1RA 1OC9B 1XWKA 4OO5A 1SK0A 1X9SB 2DKIA 2KHPA 4GTUA 3IPZA 5KOWA 1ZYNA 2IMIA 8GSSA 4I5QA 2B5EA 4TKYA 2I1UA 1V2AA 4TR0A 4WR4A 1MDIA 3EE2A 3MIXA 1I5GA 1B48A 3DGQA 1Z3EA 1WIKA 1TRVA 4BVXA 3TUEA 2AV4A 3E3EA 5LNKe 5IO2A 3ZYWA 3G7JA 4K6XA 4ML1A 3D4TA 4V2LA 1XW5A 2M80A 3ERWA 1Y25A 1ZGNA 2CVDA 1TXXA 1TDIA 4PUFC 5J5NA 4AGSA 1S3AA 3PINA 1GL8A 3RPPA 3BCIA 2ON5A 3F4RA 3GKNA 3TB2A 4EDZA 5HQPA 4EE0A 3L9SA 1JHBA 12GSA 4Z2RA 5GAND 4QQ7A 2GZZA 4OFTA 3TKSC 2ON7A 4MLYA 3KTLA 4N0ZA 4I8BA 2OE1A 1SKRB 2LS5A 2P31A 1MDJA 3KH7A 4BVXB 2LQQA 2F8FA 1VRSD 4XHMA 3PGTA 4IHUA 2WGRA 1ZOFA 4KW6A 5CRDA 1R26A 4HU9A 1A2MA 1BYEA 1NHOA 5ECSA 4K2DA 1A2LA 2BTOT 1TKDB 3FHKA 5LCZA 1M9AA 2HRNA 2DJKA 4YQMA 2IMEA 22GSA 2LRNA 1XOAA 1GRXA 4OWYA 1XZOA 4ML6A 1J9BA 4FYBA 1U87A 3GH6A 3O76A 4TRXA 4MJCA 3MDKA 2OKAA 1ACVA 3QAGA 3ERGA 3Q6OA 2H1DA 1VF2A 3TKSE 3Q18A 1DUGA 2GVPA 1ERVA 1U3IA 3F6FA 3P7XA 2PPTA 4NHZA 1WMJA 3FZ9A 1MTCA 3FZ4A 5IQYA 2C3QA 3HDCA 4F82A 1JZRA 4N30A 4F9ZA 3VI7A 3UL3A 1SU9A 2OA7A 4NPBA 1AAZA 2C3NA 1UA5A 3H93A 2H74A 5GSSA 2X8GA 5KN1A 5GSTA 1PMTA 1R5PA 3TRPA 4GQFA 2XBIA 1SYRA 2FY6A 3CBUA 4MF7A 1GSYA 3TKQA 5G31A 3BD2A 4K7NA 4RQRA 2OBIA 3IRAA 1GWCA 3A5WA 3E9JB 1GLQA 4CDOA 4P3YB 3F8UA 2WB9A 4LA1A 5KN0A 6GSYA 4RI6A 3VFIA 2YJHA 2B1KA 2VCVA 1BG5A 2L5LA 4YAVA 3EU4A 3ZLPA 5JWQB 5FT3A 1B8XA 2P5QA 1G0TA 2HXKA 4ECBA 5CAXA 3EYTA 1TU8A 2QKEA 1O6JA 1XW6A 2J23A 2KUCA 5ID2A 1GUMA 1VF3A 3GL5A 2M72A 1A23A 2FWEA 2JU5A 3TOTA 3KD0A 2JZSA 5IOWA 2B6MA 3GV1A 3TJGA 3NZNA 2FNOA 2C0FA 3DD3A 3D6IA 5ECLB 2VCQA 5ECMB 2L6DA 2V6KA 1QK8A 4WKWA 1K3LA 5G1LA 2WFCA 3KTBA 5D9VA 1SD8A 4HI7A 3HXSA 4O32A 3P90A 3PPUA 3UVHA 5GAPD 4MH3A 5ID2B 1HNCA 1S3CA 3F3QA 2RUFA 1DBYA 1XVWA 1W4VA 4OFNA 1F9MA 13GSA 2HNLA 4JEDA 4DEJA 2HZFA 4KUNA 2NTOA 3U6VA 2GLRA 1M2DA 4TR1A 1TTZA 4J57E 4ILFA 5KN2A 1GH2A 4POMA 4MJAA 3TKPA 4Q5QA 2MBSA 2BJXA 5A4VA 4IP6A 3QR6A 2RM6A 1F2EA 3UBLA 3KH9A 4EIQA 1GP1A 1PKWA 2VL9A 2H0HA 3IK7A 2LJKA 5DQSA 4NV5A 4KE3A 5D9TA 2YCDA 3CSIA 5D96A 5C00A 1G7EA 3FY7A 1XOBA 4O5QA 5J41A 3IV4A 2C0EA 2Z9SA 5G30A 1J08A 3D0ZA 4X4JA 1XXUA 4GSNA 2HI7A 1I9DA 1GUHA 5E59A 4RI7A 1U6TA 3CMIA 3EU3A 3CRUA 4EO3A 2X8CA 2H0IA 5CNWA 3QAWA 1WP0A 2H71A 2LUSA 3F4SA 3HJOA 4TR1B 5HR3A 4K0GA 2RUEA 1B9YC 4Z2UA 1VF4A 1EEMA 1GNWA 3GSSA 2IWTA 4FO5A 1QFNA 5EPFA 2FD3A 3BJ5A 2G2QA 3FEUA 4BWQA 1EV9A 1OAZA 4V2MA 1O8XA 2XPDA 4PQHA 18GSA 1FB6A 1PSQA 5FWGA 2HRFA 4ZB8A 2N5AA 2DKHA 1OKTA 2JSZA 3KGKA 4GXZA 1XWBA 2PWJA 1THOA 4G10A 5KOXA 1PL1A 5JWRB 4YQUA 2FCHA 4WR5A 4GRFA 4G19A 3ZZXA 3IR4A 4E8HA 1SL0B 1ZYQB 2H72A 4PNFA 1E6BA 4G2EA 4OCEA 1M2AA 4MK3A 4EIPA 4JE1A 2IMKA 3LORA 3US3A 2MMZA 2VOCA 1GSQA 14GSA 2KP2A 2VL2C 3HKRA 5B7CA 4V1Ag 1TU7A 2EIRA 2OBKA 10GSA 3GKXA 4XCSA 1U3AA 3MNGA 4MA9A 3DEXA 1Z7RA 5DVBA 1T4YA 2H6ZA 4L8EA 2F8AA 3TJFA 3M8NA 5DDLA 2DLXA 4K7OA 1H75A 2YZHA 1JZOA 5H5QA 3D21A 4ZL7A 2LRTA 3FR9A 3F6DA 11GSA 4EC0A 1A0RP 4GLTA 5CRWA 2X8HA 1SJZA 3DKSA 1OVNA 3GA4A 4K5SA 1GNEA 1K3OA 4QL7A 4HQZA 3APOA 1YJ6A 5ENUA 1SD9A 2CQ9A 3LEFA 3O6TA 1T8EB 2FWHA 2CAIA 2MMNA 3LJRA 1PQNA 3WT2A 4XIHA 4ZL8A 1EWXA 1Z5YE 1M2BA 1YF0A 4HU7A 2B5YA 4ZBDA 1M0UA 5J9BA 1TP9A 2DMLA 4Q5RA 1TRSA 1AQWA 3G9BA 5F8BA 4JR4A 1O85A 4G0KA 2JL4A 2OE0A 4KSMA 2HT9A 1Z6NA 3RAZA 1IYIA 5HR2A 1K0MA 4LL4B 3ZITA 1XFLA 1PN9A 2GT5A 5CRHA 1HQOA 3A3TA 3J7Yk 1TW9A 4MNNA 2AJQB 2C3TA 17GSA 1FVJA 2KOKA 3I69A 2HYXA 4NV2A 2R37A 2XC2A 4IQ1A 1MDKA 5IM9A 2VM2A 4IW9A 4F0BA 2P0GA 2VAFA 4J2FA 3GMFA 1O8WA 2YWMA 5D9XA 1HD2A 2JZTA 4HZ2A 5CO3A 2H0GA 2FA8A 3M9KA 4O5RA 5IMVA 3U5RE 3I43A 4CY6A 4ICYA 5ABRA 3KP8A 3FRCA 3ME7A 4XTSA 4KA0A 3GUSA 4RUVA 1K0DA 2PERA 3HVVA 4ID0A 2B1LA 4CW9A 5AN1A 1GTUA 1JFUA 5B6MA 2H76A 4MABA 1EGRA 2XPEA 1SK2A 3TCOA 4PQ1A 4O7HA 2AAWA 5AIVA 2IIYA 1E2YA 4F03A 1VGLA 4KX4A 3CYNA 3KXOA 3IXRA 4OCFA 3F4TA 1JLWA 2DJ3A 2H8LA 5AIXA 1AUCA 1QQ2A 2LJAA 1ERWA 5IPGA 4AF2A 3HYPA 2C8UA 4KGIA 3GHAA 1JLVA 2R0GA 4G0IA 2JSYA 3TOUA 2HSHA 4KCAA 4NWYA 1YKCA 5JCWA 1YKAA 4NHWA 1PRXA 3OR5A 1TOFA 2L6CA 4CY8A 3S9FA 4HDEA 2X64A 2YNXA 3DVXA 3DWVA 1LU4A 2YWOA 2K8VA 2PN8A 1FO5A 5ELAA 5DCGA 5ECPB 4Z7XA 2V6OA 4YH2A 2YV7A 1LJRA 2ES7A 4FH8A 1AC1A 4ECIA 3IBHA 4E8EA 3A2VA 4WBJA 4PNGA 4DSRA 2OJLA 1ZYPA 4BVYA 4HZ4A 2C1YA 2HSMA 3GN3A 5H5RA 2IJYA 4WEYA 5D9WA 5D93A 1UVZA 2FWGA 2H1AA 5LD0A 4HJ2A 2FLSA 2CT6A 4O92A 3UVTA 4HUAA 3HY2A 3ZIVA 2F9SA 1EEJA 4HEA2 4LMVA 1V98A 2R4VA 3LXZA 1BAYA 2V1MA 1MD3A 1JZDA 3EVIA 1AXDA 1ILOA 3N9JA 4IP1A 1ZCPA 1M9BA 4N0VA 2TIRA 1Y6EA 3R2QA 3RBTA 4CHSA 2CZ3A 3BBYA 2PVQA 2R0CA 3FR6A 1T3BA 4IJIA 2EC4A 1SKWB 3LWAA 5G2ZA 1FB0A 2GDRA 4GSSA 3IC8A 3WGEA 16GSA 2L5OA 4YAPA 2H6XA 4TXOB 4BVYB 3APSA 2IN3A 1K3YA 4YQVA 3CTFA 3LGCA 2DJ2A 4EKZA 2VD0A 5AISA 3IHQA 3HJMA 2CA8A 4IELA 1FAAA 2LV3A 6GSVA 2YWIA 1K0BA 2E2GA 4USSA 1QMVA 1YZXA 2A4VA 1A0FA 3FZ5A 3IK9A 2PU9C 3M0FA 3VWUA 1OYJA 19GSA 1GLPA 3GTUA 3VWXA 2B3SA 2L57A 2WULA 1PD21 1QGVA 2MMAA 2QSIA 5GZZB 5IMDA 2A2PA 2C80A 4ZIJA 5AGYA 2LNSA 1FW1A 3KIJA 2HSYA 2YWNA 2YJ7A 1F6MC 2QC7A 5INYA 3UMAA 2M46A 4YKFA 3IAM2 1FOHA 1B9XC 3SBCA 2N5FA 3ZFLA 1V58A 4FYCA 2GZYA 1KBNA 1WOUA 2GSRA 3EMXA 3RHBA 2YANA 3QPMA 3ZTLA 1X5CA 4IGJA 1R5AA 2VO4A 4IN0A 2IMDA 3FMWA 1O73A 1H4OA 3GFKA 2TRCP 5IO0A 3MWHA 1DSBA 1X9WB 1AW9A 2ZNMA 4OFMA 3GTUB 4JU5A 3RDWA 3EWLA 3WT1A 3GRXA 3APQA 2YN1A 3PR8A 1A8LA 2QA2A 2WZ9A 2LSTA 2WDUA 4MZCA 4KNDA 4MMMA 1J0FA 1F3BA 1XBSA 5L71A 2GT6A 1EP8A 4AJ8A 4BPYA 3J7Yb 4RQXA 3GKMA 2L4QA 2FHEA 3QOUA 3QFAC 1GSDA 2IFQA 2KP1A 4N10A 3G7IA 4PURA 3HZ4A 3Q19A 3ZREA 2B7KA 5CYYA 1GTIA 4L5OA 1GTAA 2DSAA 2X99A 1TK8B 3BCKA 3GYKA 2NPBA 3HVSA 4HJMA 4OO4A 2C0GA 4IBPA 3IOSA 3M3MA 3VLNA 4XRAA 4KDUA 3O3TA 5G5FA 4YKGA 2B5XA 4IJ3A 5B8AA 6GSUA 3KZQA 3KMOA 2R0PA 2V41A 1F3AA 4IKHA 2P5RA 4XS1A 3P2AA 2I81A 3M1GA 3FR3A 3FZAA 2DMMA 1WE0A 5COHA 4K5RA 3DVWA 3N5OA 2HRAA 2PGTA 1GTBA 2VCZA 5F06A 3RHCA 1XPVA 2IFQB 2QGVA 2REMA 2UZ8A 3GSTA 2GSTA 2AHEA 1CQGA 3PH9A 2MZCA 2J9HA 5CREA 4QL9A 2LQOA 3MAKA 2FWFA 2RM5A 5ECHB 3VURA 1K0OA 1QXHA 3LYKA 1ERUA 1R4WA 4ISDA 3QFBC 4X0XA 3AY8A 4KDYA 3IC4A 2WS2A 4MF5A 2PBJA 2GSSA 5EL8A 2C4JA 3D5JA 1ABAA 3EC3A 4O5UA 5CP1A 3TJKA 1C72A 2AYTA 2FGXA 5DBQA 3VWWA 1N8JA 3TJJA 2XBQA 1TRUA 2OACA 2VD1A 3C73A 1YEXA 1GSFA 2CVBA 3NIVA 1A8YA 2AB6A 3F63A 2H30A 2NDOA 3LYPA 4FQUA 2GQMA 1QUWA 5ECOB 4G9HA 1ZL9A 1SYXA 4MP4A 1OKDA 3EINA 2G0FA 3A2WA 2DJ0A 2X49A 4HOJA 1WRYA 1RQMA 2E7PA 5DAKA 6GSWA 4ULXA 2F51A 2OE3A 1FOVA 5D73A 3V1WA 2YOIA 1Q4JA 4FIWA 3C71A 1V9WA 1OC3A 3HJPA 4GWRA 5JCGA 2AUVA 5DQYA 4I2UA 3GKKA 2MYGA 2K8SA 1FG4A 4DVCA 3F0IA 1GULA 2LEGA 5B6NA 1O7UA 9GSSA 3KMNA 1MEKA 4K2XA 4TR4A 3CSHA 2GSQA 2YPMA 4KCEA 3ZVJA 2IMFA 5HR0A 3QMXA 1SENA 2O8VB 2VCXA 1SK1A 1EGOA 2A2RA 2RLIA 4L0WA 1XWCA 2H01A 4D73A 1KNGA 1ZYEA 2LTKA 4DSQA 2LNTA 5DAKB 2KLXA 2YV9A 5ECQB 5IMCA 2H75A 1HNBA 2OADA 1ST9A 4MPGA 2H73A 4HQSA 4PTSA 1TK0B 4NMUA 4HS1A 4A5PA 4ZILA 1V57A 2IL3A 4XRDA 3G7YA 3LXTA 1LBKA 1YF1A 1OC8A 3RPNA 3F9UA 4AJ6A 4KF9A 4WETA 2B7JA 3ED3A 1AQXA 4TW5A 1KEBA 5HR1A 2K6VA 3H8QA 1A24A 1YEPA 3FW2A 2NVLA 1X5EA 2E0QA 4J56E 3W8SA 4GCIA 3L0HA 1B4QA 3VI5A 1HYUA 2FA4A 2K18A 5F05A 3DIEA 3TKSA 1SL2B 3ZFBA 3TGZA 4D73B 2E2MA 5G1KA 3CRTA 4EVMA 1EOGA 3DRNA 3GURA 2HE3A 4Q5NA 4TXVA 2H6YA 4XS4A 1M99A 2XHFA 4MZBA 3C7MA 4KB3A 6GSSA 1EP7A 3HZ8A 1T1VA 1T4ZA 4OD7A 1VF1A 2GTUA 3ZIJA 4ZBAA 3KJYA 3ISOA 1GSSA 4GF0A 2GZPA 1W89A 2WJUA 4BWSA 4WF5A 4EF0A 4Q5FA 3IA1A 1N2AA 5A4UA 2X4AA 1TI1A 2O85A 1Z7PA 4MH2A 3UJ1A 1NHYA 1TRWA 1WJKA 1GUKA 3W6GA 2DJJA 2VLTA 2A2SA 2CV4A 3E0UA 1TI3A 4MDCA 4TR3A 3IAS2 3KP9A 3TKRA 2ZCTA 2ZUPA 1URMA 2LKUA 1A2JA 4MF6A 4DSSA 2O89A 3I6AA 1YDKA 2JADA 2F3MA 3FKFA 3L4NA 4XS4B 5IMAA 3HVXA 3WGXA 3C1SA 3D4MA 2GGTA 2HRKA 4ECCA 2IPAA 2PVOC 2TRXA 4TXOA 2GQKA 2JZRA 2O87A 4PQIA 1TJDA 7GSSA 1XIYA 1NW2A 4F2IA 5ECKB 2I4AA 4POKA 3TDGA 4IVFA 4EDYA 3L9VA 3HD5A 5D8IA 1T7PB 5DALA 4MCUA 2DC5A 1XWGA 3FK8A 4WXTA 3TRQA 4KH7A 3IE3A 2VLUA 3LQ7A 3VPQA 4DSSB 1THXA 2I3YA 2CZ2A 1RW1A 3LSZA 4MJEA 4MZWA 4GSTA 3NOFA 2GS3A 4V2NA 5BRTA 4KAEA 1AQVA 3GL3A 3C8EA 2MBTA 5A5KA 1U88A 1XCCA 2HLSA 2YP6A 1WPIA 3DXBA 3UEMA 3MYDA 1XVQA 1YQ1A 1PGTA 3HA9A 3KEBA 3ERFA 1UN2A 4POBA 5E4WA 4WBRD 2GQLA 3CSJA 3HCZA 1BEDA 2R5GA 5HFIA 1FVKA 5DALB 2DIZA 4NAXA 5KN3A 3GX8A 1RK4A 3HHVA 4K0NA 5IIZA 4FYUA 4K8MA 3WYWA 1YY7A 3Q74A 3IHGA 5G5EA 4TVEA 2LJRA 3P8WA 4V1Ap 1CQHA 6GSXA 4PX1A 1SJ6A 1K0NA 3IDVA 4ZB9A 1WWJA 4I97A 2MMOA 4BA7A 1DE1A 3CTGA 4JRRA 3ZVJD 3D22A 2PMTA 4IQAA 1UC7A 2WCIA 2O7KA 2R2JA 3K8NA 1O81A 3UIWA 2LRCA 3R3EA 1SKSB 2V32A 4ACSA 4LLRA 1KTEA 2BMXA 4N11A 4LMWA 4XS6A 1BX9A 4I2TA 3W8JA 2L59A 1Z6MA 3UOMA 2CAQA 1Q98A 4H86A 3FYGA 4TN8A 1K0AA 5H5SA 2WRTA 1MD4A 3TJBA 2CX3A 4Z2TA 1BJXA 3BOAA 3VK9A 5F07A 2VLVA 4ZB6A 4BL7A 3H79A 1EZKA 3EPTA 2L4CA 4K9ZA 2NBSA 5ECIB 1PA3A 1TK5B 4WF4A 2D2ZA 1V40A 3TRXA 3GIXA 3QCPA 3LG6A 1X5DA 5J3RA 4X43A 3H4KA 3H1NA 3UARA 3ME8A 3I9V2 2QA1A 4PXOA 3L78A 3ZL5A 3ZRDA 3EURA 2VL3A 2H1BA 2I9HA 4IS0A 5JCUA 4L0UA 5BMUA 4PUAA 4GQCA 3A5IA 3DYRA 5ECNB 5F0GA 3SWLA 5ECRB 3KCMA 4G0LA 2V2GA 1X9MB 2H66A 4JR6A 1NSWA 3MSZA 4BL7B 4L5LA 2CX4A 3QDNA 4KSOA 5EVOA 1S3DA 5KEJA 3UBKA 2PUKC 4OMVA 3DMLA 5JWOB 4NXIA 1PX6A 3A2XA 5EY6A 3VPTA 2DBCA 3M9JA 4MPFA 2JACA 4ZL9A 4K7IA 4X1UA 5IMFA 5IOXA 2C0DA 1GSUA 1PN0A 4POLA 4EXJA 1PKZA 5DCHA 4EUYA 20GSA 1ERTA 5HFGA 1EOHA 3ZMKA 1BQ7A 4F0CA 1NM3A 4AJ7A 1M7TA 2VL2A 5CRGA 5A4WA 1XW9A 3GX0A 2DIYA 1ON4A 5IPHA 2RIIA 1JZWA 3F3RA 1ZZYA 1Z9HA 4PGTA 3CXGA 2VIMA 5J4UA 1G6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7H A;  1G6Y A;  5ELG A;  5C04 A;  3QD9 A;  2VCW A;  3KM6 A;  4JZQ A;  5HFK A;  5FHI A;  2VUP A;  1OE8 A;  1HNA A;  1PL2 A;  4ZBB A;  2HZE A;  3LFL A;  3GNJ A;  1OC9 A;  5J9C A;  2N5B A;  5B8B A;  2R6K A;  3EMP A;  2DJ1 A;  1SL1 B;  3ZML A;  1X0R A;  3JCM L;  1G7O A;  2H70 A;  5DJM A;  1OE7 A;  6GST A;  1ZMA A;  2CVK A;  4I6X A;  2ALB A;  2HFD A;  1K0C A;  2YZU A;  4ZXG A;  1F37 A;  3UAP A;  2H19 A;  3L9U A;  3WD6 A;  4KDX A;  1B4P A;  2FUG 2;  3WGD A;  2K9F A;  1EV4 A;  4ECJ A;  2VM1 A;  2VCT A;  1IYH A;  1PX7 A;  3GH9 A;  3QAV A;  4TOP A;  1XWA A;  1ML6 A;  4LL1 B;  1USB A;  4MJB A;  1T00 A;  4EL1 A;  1AIU A;  3VWV A;  5DJL A;  2EIQ A;  4JBB A;  1GSE A;  4K1F A;  1FHE A;  2H1G A;  5IMZ A;  1SJI A;  2EIO A;  2HZE B;  1DE2 A;  2R3X A;  3C1R A;  1OC9 B;  1XWK A;  4OO5 A;  1SK0 A;  1X9S B;  2KHP A;  4GTU A;  3IPZ A;  8GSS A;  2IMI A;  4I5Q A;  2B5E A;  4TKY A;  2I1U A;  1V2A A;  4TR0 A;  4WR4 A;  1MDI A;  3EE2 A;  1I5G A;  1B48 A;  3DGQ A;  1Z3E A;  1WIK A;  1TRV A;  4BVX A;  3TUE A;  2AV4 A;  3E3E A;  5LNK e;  5IO2 A;  3ZYW A;  3G7J A;  4K6X A;  4ML1 A;  3D4T A;  4V2L A;  1XW5 A;  2M80 A;  3ERW A;  1Y25 A;  1ZGN A;  2CVD A;  1TXX A;  1TDI A;  4PUF C;  5J5N A;  4AGS A;  1S3A A;  3PIN A;  1GL8 A;  3RPP A;  3BCI A;  2ON5 A;  3F4R A;  3GKN A;  3TB2 A;  4EDZ A;  5HQP A;  4EE0 A;  3L9S A;  1JHB A;  12GS A;  5GAN D;  4QQ7 A;  2GZZ A;  4OFT A;  3TKS C;  2ON7 A;  4MLY A;  3KTL A;  4N0Z A;  4I8B A;  2OE1 A;  1SKR B;  2LS5 A;  2P31 A;  1MDJ A;  3KH7 A;  2LQQ A;  2F8F A;  1VRS D;  4XHM A;  3PGT A;  4IHU A;  2WGR A;  1ZOF A;  4KW6 A;  5CRD A;  1R26 A;  4HU9 A;  1A2M A;  1BYE A;  1NHO A;  5ECS A;  4K2D A;  1A2L A;  2BTO T;  1TKD B;  3FHK A;  5LCZ A;  1M9A A;  2HRN A;  2DJK A;  4YQM A;  2IME A;  22GS A;  2LRN A;  1XOA A;  1GRX A;  4OWY A;  1XZO A;  4ML6 A;  1J9B A;  4FYB A;  1U87 A;  3GH6 A;  3O76 A;  4TRX A;  4MJC A;  3MDK A;  2OKA A;  1ACV A;  3QAG A;  3ERG A;  3Q6O A;  2H1D A;  1VF2 A;  3TKS E;  3Q18 A;  1DUG A;  2GVP A;  1ERV A;  1U3I A;  3F6F A;  3P7X A;  2PPT A;  4NHZ A;  1WMJ A;  3FZ9 A;  1MTC A;  3FZ4 A;  5IQY A;  2C3Q A;  3HDC A;  4F82 A;  1JZR A;  4N30 A;  4F9Z A;  3VI7 A;  3UL3 A;  1SU9 A;  2OA7 A;  4NPB A;  1AAZ A;  2C3N A;  1UA5 A;  3H93 A;  2H74 A;  5GSS A;  2X8G A;  5KN1 A;  5GST A;  1PMT A;  1R5P A;  3TRP A;  4GQF A;  2XBI A;  1SYR A;  2FY6 A;  3CBU A;  4MF7 A;  1GSY A;  3TKQ A;  5G31 A;  3BD2 A;  4K7N A;  4RQR A;  2OBI A;  3IRA A;  1GWC A;  3A5W A;  3E9J B;  1GLQ A;  4CDO A;  4P3Y B;  3F8U A;  2WB9 A;  4LA1 A;  5KN0 A;  6GSY A;  4RI6 A;  3VFI A;  2YJH A;  2B1K A;  2VCV A;  1BG5 A;  2L5L A;  4YAV A;  3EU4 A;  3ZLP A;  5JWQ B;  5FT3 A;  1B8X A;  2P5Q A;  1G0T A;  2HXK A;  4ECB A;  5CAX A;  3EYT A;  1TU8 A;  2QKE A;  1O6J A;  1XW6 A;  2J23 A;  2KUC A;  5ID2 A;  1GUM A;  1VF3 A;  3GL5 A;  2M72 A;  1A23 A;  2FWE A;  2JU5 A;  3TOT A;  3KD0 A;  2JZS A;  5IOW A;  2B6M A;  3GV1 A;  3TJG A;  3NZN A;  2FNO A;  2C0F A;  3DD3 A;  3D6I A;  5ECL B;  2VCQ A;  5ECM B;  2L6D A;  2V6K A;  1QK8 A;  4WKW A;  1K3L A;  5G1L A;  2WFC A;  3KTB A;  5D9V A;  1SD8 A;  4HI7 A;  3HXS A;  4O32 A;  3P90 A;  3UVH A;  5GAP D;  4MH3 A;  5ID2 B;  1HNC A;  1S3C A;  3F3Q A;  2RUF A;  1DBY A;  1XVW A;  1W4V A;  4OFN A;  1F9M A;  13GS A;  2HNL A;  4JED A;  4DEJ A;  2HZF A;  4KUN A;  2NTO A;  3U6V A;  2GLR A;  1M2D A;  4TR1 A;  1TTZ A;  4J57 E;  4ILF A;  5KN2 A;  1GH2 A;  4POM A;  4MJA A;  3TKP A;  4Q5Q A;  2MBS A;  2BJX A;  5A4V A;  4IP6 A;  3QR6 A;  2RM6 A;  1F2E A;  3UBL A;  3KH9 A;  1GP1 A;  1PKW A;  2VL9 A;  2H0H A;  3IK7 A;  2LJK A;  5DQS A;  4NV5 A;  4KE3 A;  5D9T A;  2YCD A;  3CSI A;  5D96 A;  5C00 A;  1G7E A;  3FY7 A;  1XOB A;  5J41 A;  3IV4 A;  2C0E A;  2Z9S A;  5G30 A;  1J08 A;  3D0Z A;  1XXU A;  4GSN A;  2HI7 A;  1I9D A;  1GUH A;  5E59 A;  4RI7 A;  1U6T A;  3CMI A;  3EU3 A;  3CRU A;  4EO3 A;  2X8C A;  2H0I A;  5CNW A;  3QAW A;  1WP0 A;  2H71 A;  2LUS A;  3F4S A;  3HJO A;  4TR1 B;  5HR3 A;  4K0G A;  2RUE A;  1B9Y C;  1VF4 A;  1EEM A;  1GNW A;  3GSS A;  2IWT A;  4FO5 A;  1QFN A;  5EPF A;  2FD3 A;  3BJ5 A;  2G2Q A;  3FEU A;  4BWQ A;  1EV9 A;  1OAZ A;  4V2M A;  1O8X A;  2XPD A;  4PQH A;  18GS A;  1FB6 A;  1PSQ A;  5FWG A;  2HRF A;  4ZB8 A;  2N5A A;  1OKT A;  2JSZ A;  3KGK A;  4GXZ A;  1XWB A;  2PWJ A;  1THO A;  4G10 A;  1PL1 A;  5JWR B;  4YQU A;  2FCH A;  4WR5 A;  4GRF A;  4G19 A;  3ZZX A;  3IR4 A;  4E8H A;  1SL0 B;  1ZYQ B;  2H72 A;  4PNF A;  1E6B A;  4G2E A;  4OCE A;  1M2A A;  4MK3 A;  4JE1 A;  2IMK A;  3LOR A;  3US3 A;  2MMZ A;  2VOC A;  1GSQ A;  14GS A;  2KP2 A;  2VL2 C;  3HKR A;  5B7C A;  4V1A g;  1TU7 A;  2EIR A;  2OBK A;  10GS A;  3GKX A;  4XCS A;  1U3A A;  3MNG A;  4MA9 A;  3DEX A;  1Z7R A;  5DVB A;  1T4Y A;  2H6Z A;  4L8E A;  2F8A A;  3TJF A;  3M8N A;  5DDL A;  2DLX A;  4K7O A;  1H75 A;  2YZH A;  1JZO A;  5H5Q A;  3D21 A;  4ZL7 A;  2LRT A;  3FR9 A;  3F6D A;  11GS A;  4EC0 A;  1A0R P;  4GLT A;  5CRW A;  2X8H A;  1SJZ A;  3DKS A;  1OVN A;  3GA4 A;  1GNE A;  1K3O A;  4QL7 A;  4HQZ A;  3APO A;  1YJ6 A;  5ENU A;  1SD9 A;  2CQ9 A;  3LEF A;  3O6T A;  1T8E B;  2FWH A;  2CAI A;  2MMN A;  3LJR A;  1PQN A;  3WT2 A;  4XIH A;  4ZL8 A;  1EWX A;  1Z5Y E;  1M2B A;  1YF0 A;  4HU7 A;  2B5Y A;  4ZBD A;  1M0U A;  5J9B A;  1TP9 A;  2DML A;  4Q5R A;  1TRS A;  1AQW A;  3G9B A;  5F8B A;  4JR4 A;  1O85 A;  2JL4 A;  2OE0 A;  4KSM A;  2HT9 A;  1Z6N A;  3RAZ A;  1IYI A;  5HR2 A;  1K0M A;  4LL4 B;  3ZIT A;  1XFL A;  1PN9 A;  2GT5 A;  5CRH A;  1HQO A;  3A3T A;  3J7Y k;  1TW9 A;  2AJQ B;  2C3T A;  17GS A;  1FVJ A;  2KOK A;  3I69 A;  2HYX A;  4NV2 A;  2R37 A;  2XC2 A;  4IQ1 A;  1MDK A;  5IM9 A;  2VM2 A;  4IW9 A;  4F0B A;  2P0G A;  2VAF A;  4J2F A;  3GMF A;  1O8W A;  2YWM A;  5D9X A;  1HD2 A;  2JZT A;  4HZ2 A;  5CO3 A;  2H0G A;  2FA8 A;  3M9K A;  4O5R A;  5IMV A;  3U5R E;  3I43 A;  5ABR A;  3KP8 A;  3FRC A;  3ME7 A;  4XTS A;  4KA0 A;  3GUS A;  4RUV A;  1K0D A;  2PER A;  3HVV A;  4ID0 A;  2B1L A;  4CW9 A;  5AN1 A;  1GTU A;  1JFU A;  5B6M A;  2H76 A;  4MAB A;  1EGR A;  2XPE A;  1SK2 A;  3TCO A;  4PQ1 A;  4O7H A;  2AAW A;  5AIV A;  2IIY A;  1E2Y A;  4F03 A;  1VGL A;  4KX4 A;  3CYN A;  3KXO A;  3IXR A;  4OCF A;  3F4T A;  1JLW A;  2DJ3 A;  2H8L A;  5AIX A;  1AUC A;  1QQ2 A;  2LJA A;  1ERW A;  5IPG A;  4AF2 A;  3HYP A;  2C8U A;  4KGI A;  3GHA A;  1JLV A;  2JSY A;  3TOU A;  2HSH A;  4KCA A;  4NWY A;  1YKC A;  5JCW A;  1YKA A;  4NHW A;  1PRX A;  3OR5 A;  1TOF A;  2L6C A;  3S9F A;  4HDE A;  2X64 A;  2YNX A;  3DVX A;  3DWV A;  1LU4 A;  2YWO A;  2K8V A;  2PN8 A;  1FO5 A;  5ELA A;  5DCG A;  5ECP B;  4Z7X A;  2V6O A;  4YH2 A;  2YV7 A;  1LJR A;  2ES7 A;  4FH8 A;  1AC1 A;  4ECI A;  3IBH A;  4E8E A;  3A2V A;  4WBJ A;  4PNG A;  4DSR A;  2OJL A;  4BVY A;  4HZ4 A;  2C1Y A;  5H5R A;  3GN3 A;  2IJY A;  4WEY A;  5D9W A;  5D93 A;  1UVZ A;  2FWG A;  2H1A A;  5LD0 A;  4HJ2 A;  2FLS A;  2CT6 A;  4O92 A;  3UVT A;  4HUA A;  3HY2 A;  3ZIV A;  2F9S A;  1EEJ A;  4HEA 2;  4LMV A;  1V98 A;  2R4V A;  3LXZ A;  1BAY A;  2V1M A;  1MD3 A;  1JZD A;  3EVI A;  1AXD A;  1ILO A;  3N9J A;  4IP1 A;  1ZCP A;  1M9B A;  4N0V A;  2TIR A;  1Y6E A;  3R2Q A;  3RBT A;  4CHS A;  2CZ3 A;  3BBY A;  2PVQ A;  3FR6 A;  1T3B A;  4IJI A;  2EC4 A;  1SKW B;  3LWA A;  5G2Z A;  1FB0 A;  2GDR A;  4GSS A;  3WGE A;  16GS A;  2L5O A;  4YAP A;  2H6X A;  4TXO B;  3APS A;  2IN3 A;  1K3Y A;  4YQV A;  3CTF A;  3LGC A;  2DJ2 A;  4EKZ A;  2VD0 A;  5AIS A;  3IHQ A;  3HJM A;  2CA8 A;  4IEL A;  1FAA A;  2LV3 A;  6GSV A;  2YWI A;  1K0B A;  2E2G A;  1QMV A;  1YZX A;  2A4V A;  1A0F A;  3FZ5 A;  3IK9 A;  2PU9 C;  3M0F A;  3VWU A;  1OYJ A;  19GS A;  1GLP A;  3GTU A;  3VWX A;  2B3S A;  2L57 A;  2WUL A;  1PD2 1;  1QGV A;  2MMA A;  2QSI A;  5GZZ B;  5IMD A;  2C80 A;  4ZIJ A;  5AGY A;  2LNS A;  1FW1 A;  3KIJ A;  2HSY A;  2YWN A;  2YJ7 A;  1F6M C;  2QC7 A;  5INY A;  3UMA A;  2M46 A;  3IAM 2;  1B9X C;  3SBC A;  2N5F A;  3ZFL A;  1V58 A;  4FYC A;  2GZY A;  1KBN A;  1WOU A;  2GSR A;  3EMX A;  3RHB A;  2YAN A;  3QPM A;  3ZTL A;  1X5C A;  4IGJ A;  1R5A A;  2VO4 A;  4IN0 A;  2IMD A;  1O73 A;  1H4O A;  3GFK A;  2TRC P;  5IO0 A;  3MWH A;  1DSB A;  1X9W B;  1AW9 A;  2ZNM A;  4OFM A;  3GTU B;  4JU5 A;  3RDW A;  3EWL A;  3WT1 A;  3GRX A;  3APQ A;  2YN1 A;  3PR8 A;  1A8L A;  2WZ9 A;  2LST A;  2WDU A;  4MZC A;  4KND A;  4MMM A;  1J0F A;  1F3B A;  1XBS A;  5L71 A;  2GT6 A;  1EP8 A;  4AJ8 A;  4BPY A;  3J7Y b;  4RQX A;  3GKM A;  2L4Q A;  2FHE A;  3QOU A;  3QFA C;  1GSD A;  2IFQ A;  2KP1 A;  4N10 A;  3G7I A;  4PUR A;  3HZ4 A;  3Q19 A;  3ZRE A;  2B7K A;  5CYY A;  1GTI A;  4L5O A;  1GTA A;  2DSA A;  2X99 A;  1TK8 B;  3BCK A;  3GYK A;  2NPB A;  3HVS A;  4HJM A;  4OO4 A;  2C0G A;  4IBP A;  3IOS A;  3M3M A;  3VLN A;  4XRA A;  4KDU A;  3O3T A;  5G5F A;  2B5X A;  4IJ3 A;  5B8A A;  6GSU A;  3KZQ A;  3KMO A;  2V41 A;  1F3A A;  4IKH A;  2P5R A;  4XS1 A;  3P2A A;  2I81 A;  3M1G A;  3FR3 A;  3FZA A;  2DMM A;  1WE0 A;  5COH A;  3DVW A;  3N5O A;  2PGT A;  1GTB A;  2VCZ A;  5F06 A;  3RHC A;  1XPV A;  2IFQ B;  2QGV A;  2REM A;  3GST A;  2GST A;  2AHE A;  1CQG A;  3PH9 A;  2MZC A;  2J9H A;  5CRE A;  4QL9 A;  2LQO A;  3MAK A;  2FWF A;  2RM5 A;  5ECH B;  3VUR A;  1K0O A;  1QXH A;  3LYK A;  1ERU A;  1R4W A;  4ISD A;  3QFB C;  4X0X A;  3AY8 A;  4KDY A;  3IC4 A;  2WS2 A;  4MF5 A;  2PBJ A;  2GSS A;  5EL8 A;  2C4J A;  3D5J A;  1ABA A;  3EC3 A;  5CP1 A;  3TJK A;  1C72 A;  2AYT A;  2FGX A;  5DBQ A;  3VWW A;  1N8J A;  3TJJ A;  2XBQ A;  1TRU A;  2OAC A;  2VD1 A;  3C73 A;  1YEX A;  1GSF A;  2CVB A;  3NIV A;  1A8Y A;  2AB6 A;  3F63 A;  2H30 A;  2NDO A;  3LYP A;  2GQM A;  1QUW A;  5ECO B;  4G9H A;  1ZL9 A;  1SYX A;  4MP4 A;  1OKD A;  3EIN A;  2G0F A;  3A2W A;  2DJ0 A;  4HOJ A;  1WRY A;  1RQM A;  2E7P A;  5DAK A;  6GSW A;  4ULX A;  2F51 A;  2OE3 A;  1FOV A;  5D73 A;  3V1W A;  2YOI A;  1Q4J A;  4FIW A;  3C71 A;  1V9W A;  1OC3 A;  3HJP A;  4GWR A;  5JCG A;  2AUV A;  5DQY A;  4I2U A;  3GKK A;  2MYG A;  2K8S A;  1FG4 A;  4DVC A;  3F0I A;  1GUL A;  2LEG A;  5B6N A;  1O7U A;  9GSS A;  3KMN A;  1MEK A;  4TR4 A;  3CSH A;  2GSQ A;  2YPM A;  4KCE A;  3ZVJ A;  2IMF A;  5HR0 A;  3QMX A;  1SEN A;  2O8V B;  2VCX A;  1SK1 A;  1EGO A;  2A2R A;  2RLI A;  4L0W A;  1XWC A;  2H01 A;  4D73 A;  1KNG A;  1ZYE A;  2LTK A;  4DSQ A;  2LNT A;  5DAK B;  2KLX A;  2YV9 A;  5ECQ B;  5IMC A;  2H75 A;  1HNB A;  2OAD A;  1ST9 A;  4MPG A;  2H73 A;  4HQS A;  1TK0 B;  4NMU A;  4HS1 A;  4ZIL A;  1V57 A;  2IL3 A;  4XRD A;  3G7Y A;  3LXT A;  1LBK A;  1YF1 A;  1OC8 A;  3RPN A;  3F9U A;  4AJ6 A;  4WET A;  2B7J A;  3ED3 A;  1AQX A;  4TW5 A;  1KEB A;  5HR1 A;  2K6V A;  3H8Q A;  1A24 A;  1YEP A;  3FW2 A;  2NVL A;  1X5E A;  2E0Q A;  4J56 E;  3W8S A;  4GCI A;  3L0H A;  1B4Q A;  3VI5 A;  1HYU A;  2FA4 A;  2K18 A;  5F05 A;  3DIE A;  3TKS A;  1SL2 B;  3ZFB A;  3TGZ A;  4D73 B;  2E2M A;  5G1K A;  3CRT A;  4EVM A;  1EOG A;  3DRN A;  3GUR A;  2HE3 A;  4Q5N A;  4TXV A;  2H6Y A;  4XS4 A;  1M99 A;  2XHF A;  4MZB A;  3C7M A;  4KB3 A;  6GSS A;  1EP7 A;  3HZ8 A;  1T1V A;  1T4Z A;  4OD7 A;  1VF1 A;  2GTU A;  3ZIJ A;  4ZBA A;  3KJY A;  3ISO A;  1GSS A;  4GF0 A;  2GZP A;  1W89 A;  2WJU A;  4BWS A;  4WF5 A;  4EF0 A;  4Q5F A;  3IA1 A;  1N2A A;  5A4U A;  1TI1 A;  2O85 A;  1Z7P A;  4MH2 A;  3UJ1 A;  1NHY A;  1TRW A;  1WJK A;  1GUK A;  3W6G A;  2DJJ A;  2VLT A;  2A2S A;  2CV4 A;  3E0U A;  1TI3 A;  4MDC A;  4TR3 A;  3IAS 2;  3KP9 A;  3TKR A;  2ZCT A;  2ZUP A;  1URM A;  2LKU A;  1A2J A;  4MF6 A;  4DSS A;  2O89 A;  3I6A A;  1YDK A;  2JAD A;  2F3M A;  3FKF A;  3L4N A;  4XS4 B;  5IMA A;  3HVX A;  3WGX A;  3C1S A;  3D4M A;  2GGT A;  4ECC A;  2IPA A;  2PVO C;  2TRX A;  4TXO A;  2GQK A;  2JZR A;  2O87 A;  4PQI A;  1TJD A;  7GSS A;  1XIY A;  1NW2 A;  4F2I A;  5ECK B;  2I4A A;  4POK A;  3TDG A;  4IVF A;  4EDY A;  3L9V A;  3HD5 A;  5D8I A;  1T7P B;  5DAL A;  4MCU A;  2DC5 A;  1XWG A;  3FK8 A;  4WXT A;  3TRQ A;  4KH7 A;  3IE3 A;  2VLU A;  3LQ7 A;  3VPQ A;  4DSS B;  1THX A;  2I3Y A;  2CZ2 A;  1RW1 A;  3LSZ A;  4MJE A;  4MZW A;  4GST A;  3NOF A;  2GS3 A;  4V2N A;  4KAE A;  1AQV A;  3GL3 A;  3C8E A;  2MBT A;  5A5K A;  1U88 A;  1XCC A;  2HLS A;  2YP6 A;  1WPI A;  3DXB A;  3UEM A;  1XVQ A;  1YQ1 A;  1PGT A;  3HA9 A;  3KEB A;  3ERF A;  1UN2 A;  4POB A;  5E4W A;  4WBR D;  2GQL A;  3CSJ A;  3HCZ A;  1BED A;  2R5G A;  5HFI A;  1FVK A;  5DAL B;  2DIZ A;  4NAX A;  5KN3 A;  3GX8 A;  1RK4 A;  3HHV A;  4K0N A;  5IIZ A;  4FYU A;  4K8M A;  3WYW A;  1YY7 A;  3Q74 A;  5G5E A;  4TVE A;  2LJR A;  3P8W A;  4V1A p;  1CQH A;  6GSX A;  4PX1 A;  1SJ6 A;  1K0N A;  3IDV A;  4ZB9 A;  1WWJ A;  4I97 A;  2MMO A;  4BA7 A;  1DE1 A;  3CTG A;  4JRR A;  3ZVJ D;  3D22 A;  2PMT A;  4IQA A;  1UC7 A;  2WCI A;  2O7K A;  2R2J A;  3K8N A;  1O81 A;  3UIW A;  2LRC A;  1SKS B;  2V32 A;  4ACS A;  4LLR A;  1KTE A;  2BMX A;  4N11 A;  4LMW A;  4XS6 A;  1BX9 A;  4I2T A;  3W8J A;  2L59 A;  1Z6M A;  3UOM A;  2CAQ A;  1Q98 A;  4H86 A;  3FYG A;  4TN8 A;  1K0A A;  5H5S A;  2WRT A;  1MD4 A;  3TJB A;  2CX3 A;  1BJX A;  3BOA A;  3VK9 A;  5F07 A;  2VLV A;  4ZB6 A;  4BL7 A;  3H79 A;  1EZK A;  2L4C A;  4K9Z A;  5ECI B;  2NBS A;  1PA3 A;  1TK5 B;  4WF4 A;  2D2Z A;  1V40 A;  3TRX A;  3GIX A;  3QCP A;  3LG6 A;  1X5D A;  5J3R A;  4X43 A;  3H4K A;  3H1N A;  3UAR A;  3ME8 A;  3I9V 2;  4PXO A;  3L78 A;  3ZL5 A;  3ZRD A;  3EUR A;  2VL3 A;  2H1B A;  2I9H A;  4IS0 A;  5JCU A;  4L0U A;  4PUA A;  4GQC A;  3DYR A;  5ECN B;  5F0G A;  3SWL A;  5ECR B;  3KCM A;  2V2G A;  1X9M B;  2H66 A;  4JR6 A;  1NSW A;  3MSZ A;  4L5L A;  2CX4 A;  3QDN A;  4KSO A;  5EVO A;  1S3D A;  5KEJ A;  3UBK A;  2PUK C;  4OMV A;  3DML A;  5JWO B;  4NXI A;  1PX6 A;  3A2X A;  5EY6 A;  3VPT A;  2DBC A;  3M9J A;  4MPF A;  2JAC A;  4ZL9 A;  4K7I A;  4X1U A;  5IMF A;  5IOX A;  2C0D A;  1GSU A;  4POL A;  4EXJ A;  1PKZ A;  5DCH A;  4EUY A;  20GS A;  1ERT A;  5HFG A;  1EOH A;  3ZMK A;  1BQ7 A;  4F0C A;  1NM3 A;  4AJ7 A;  1M7T A;  2VL2 A;  5CRG A;  5A4W A;  1XW9 A;  3GX0 A;  2DIY A;  1ON4 A;  5IPH A;  2RII A;  1JZW A;  3F3R A;  1ZZY A;  1Z9H A;  4PGT A;  3CXG A;  2VIM A;  5J4U A;  1G6W A; 
#chains in the Genus database with same CATH topology
 1R7H A;  1G6Y A;  5ELG A;  5C04 A;  2A4H A;  3QD9 A;  2VCW A;  3KM6 A;  4JZQ A;  5HFK A;  5FHI A;  2VUP A;  1OE8 A;  1HNA A;  1PL2 A;  4ZBB A;  2HZE A;  3LFL A;  3GNJ A;  1OC9 A;  5J9C A;  2N5B A;  5B8B A;  2R6K A;  3EMP A;  2DJ1 A;  1SL1 B;  3ZML A;  1X0R A;  3JCM L;  1G7O A;  2H70 A;  5DJM A;  1OE7 A;  6GST A;  1ZMA A;  2CVK A;  4I6X A;  2ALB A;  2HFD A;  1K0C A;  2YZU A;  4ZXG A;  1F37 A;  3UAP A;  2H19 A;  3L9U A;  3WD6 A;  4KDX A;  1B4P A;  2FUG 2;  3WGD A;  2K9F A;  1EV4 A;  4ECJ A;  2VM1 A;  2VCT A;  1IYH A;  1PX7 A;  3GH9 A;  3QAV A;  4TOP A;  1XWA A;  1ML6 A;  4LL1 B;  1USB A;  4MJB A;  1T00 A;  4EL1 A;  1AIU A;  3VWV A;  5DJL A;  2EIQ A;  4JBB A;  1GSE A;  4K1F A;  1FHE A;  2H1G A;  5IMZ A;  3LW9 A;  1SJI A;  2EIO A;  2HZE B;  1DE2 A;  2R3X A;  3C1R A;  1OC9 B;  1XWK A;  4OO5 A;  1SK0 A;  1X9S B;  1XG8 A;  2DKI A;  2KHP A;  4GTU A;  3IPZ A;  5KOW A;  1ZYN A;  2IMI A;  8GSS A;  4I5Q A;  2B5E A;  4TKY A;  2I1U A;  1V2A A;  4TR0 A;  4WR4 A;  1MDI A;  3EE2 A;  3MIX A;  1I5G A;  1B48 A;  3DGQ A;  1Z3E A;  1WIK A;  1TRV A;  4BVX A;  3TUE A;  2AV4 A;  3E3E A;  5LNK e;  5IO2 A;  3ZYW A;  3G7J A;  4K6X A;  4ML1 A;  3D4T A;  4V2L A;  1XW5 A;  2M80 A;  3ERW A;  1Y25 A;  1ZGN A;  2CVD A;  1TXX A;  1TDI A;  4PUF C;  5J5N A;  4AGS A;  1S3A A;  3PIN A;  1GL8 A;  3RPP A;  3BCI A;  2ON5 A;  3F4R A;  3GKN A;  3TB2 A;  4EDZ A;  5HQP A;  4EE0 A;  3L9S A;  1JHB A;  12GS A;  4Z2R A;  5GAN D;  4QQ7 A;  2GZZ A;  4OFT A;  3TKS C;  2ON7 A;  4MLY A;  3KTL A;  4N0Z A;  4I8B A;  2OE1 A;  1SKR B;  2LS5 A;  2P31 A;  1MDJ A;  3KH7 A;  4BVX B;  2LQQ A;  2F8F A;  1VRS D;  4XHM A;  3PGT A;  4IHU A;  2WGR A;  1ZOF A;  4KW6 A;  5CRD A;  1R26 A;  4HU9 A;  1A2M A;  1BYE A;  1NHO A;  5ECS A;  4K2D A;  1A2L A;  2BTO T;  1TKD B;  3FHK A;  5LCZ A;  1M9A A;  2HRN A;  2DJK A;  2IME A;  4YQM A;  22GS A;  2LRN A;  1XOA A;  1GRX A;  4OWY A;  1XZO A;  4ML6 A;  1J9B A;  4FYB A;  1U87 A;  3GH6 A;  3O76 A;  4TRX A;  4MJC A;  3MDK A;  2OKA A;  1ACV A;  3QAG A;  3ERG A;  3Q6O A;  2H1D A;  1VF2 A;  3TKS E;  3Q18 A;  1DUG A;  2GVP A;  1ERV A;  1U3I A;  3F6F A;  3P7X A;  2PPT A;  4NHZ A;  1WMJ A;  3FZ9 A;  1MTC A;  3FZ4 A;  5IQY A;  2C3Q A;  3HDC A;  4F82 A;  1JZR A;  4N30 A;  4F9Z A;  3VI7 A;  3UL3 A;  1SU9 A;  2OA7 A;  4NPB A;  1AAZ A;  2C3N A;  1UA5 A;  3H93 A;  2H74 A;  5GSS A;  2X8G A;  5KN1 A;  5GST A;  1PMT A;  1R5P A;  3TRP A;  4GQF A;  2XBI A;  1SYR A;  2FY6 A;  3CBU A;  4MF7 A;  1GSY A;  3TKQ A;  5G31 A;  3BD2 A;  4K7N A;  4RQR A;  2OBI A;  3IRA A;  1GWC A;  3A5W A;  3E9J B;  1GLQ A;  4CDO A;  4P3Y B;  3F8U A;  2WB9 A;  4LA1 A;  5KN0 A;  6GSY A;  4RI6 A;  3VFI A;  2YJH A;  2B1K A;  2VCV A;  1BG5 A;  2L5L A;  4YAV A;  3EU4 A;  3ZLP A;  5JWQ B;  5FT3 A;  1B8X A;  2P5Q A;  1G0T A;  2HXK A;  4ECB A;  5CAX A;  3EYT A;  1TU8 A;  2QKE A;  1O6J A;  1XW6 A;  2J23 A;  2KUC A;  5ID2 A;  1GUM A;  1VF3 A;  3GL5 A;  2M72 A;  1A23 A;  2FWE A;  2JU5 A;  3TOT A;  3KD0 A;  2JZS A;  5IOW A;  2B6M A;  1M3I A;  3GV1 A;  3TJG A;  3NZN A;  2FNO A;  2C0F A;  3DD3 A;  3D6I A;  5ECL B;  2VCQ A;  5ECM B;  2L6D A;  2V6K A;  1QK8 A;  4WKW A;  1K3L A;  5G1L A;  2WFC A;  3KTB A;  5D9V A;  1SD8 A;  4HI7 A;  3HXS A;  4O32 A;  3P90 A;  3PPU A;  3UVH A;  5GAP D;  4MH3 A;  5ID2 B;  1HNC A;  1S3C A;  3F3Q A;  2RUF A;  1DBY A;  1XVW A;  1W4V A;  4OFN A;  1F9M A;  13GS A;  2HNL A;  4JED A;  4DEJ A;  2HZF A;  4KUN A;  2NTO A;  3U6V A;  2GLR A;  1M2D A;  4TR1 A;  1TTZ A;  4J57 E;  4ILF A;  5KN2 A;  1GH2 A;  4POM A;  4MJA A;  3TKP A;  4Q5Q A;  2MBS A;  2BJX A;  5A4V A;  4IP6 A;  3QR6 A;  2RM6 A;  1F2E A;  3UBL A;  3KH9 A;  4EIQ A;  1GP1 A;  1PKW A;  2VL9 A;  2H0H A;  3IK7 A;  2LJK A;  5DQS A;  4NV5 A;  4KE3 A;  5D9T A;  2YCD A;  3CSI A;  5D96 A;  5C00 A;  1G7E A;  3FY7 A;  1XOB A;  4O5Q A;  5J41 A;  3IV4 A;  2C0E A;  2Z9S A;  5G30 A;  1J08 A;  3D0Z A;  4X4J A;  1XXU A;  4GSN A;  2HI7 A;  1I9D A;  1GUH A;  5E59 A;  4RI7 A;  1U6T A;  3CMI A;  3EU3 A;  3CRU A;  4EO3 A;  2X8C A;  2H0I A;  5CNW A;  3QAW A;  1WP0 A;  2H71 A;  2LUS A;  3F4S A;  3HJO A;  4TR1 B;  5HR3 A;  4K0G A;  2RUE A;  1B9Y C;  4Z2U A;  1VF4 A;  1EEM A;  1GNW A;  3GSS A;  2IWT A;  4FO5 A;  1QFN A;  5EPF A;  2FD3 A;  3BJ5 A;  2G2Q A;  3FEU A;  4BWQ A;  1EV9 A;  1OAZ A;  4V2M A;  1O8X A;  2XPD A;  4PQH A;  18GS A;  1FB6 A;  1PSQ A;  5FWG A;  2HRF A;  4ZB8 A;  2N5A A;  2DKH A;  1OKT A;  2JSZ A;  3KGK A;  4GXZ A;  1XWB A;  2PWJ A;  1THO A;  4G10 A;  5KOX A;  1PL1 A;  5JWR B;  4YQU A;  2FCH A;  4WR5 A;  4GRF A;  4G19 A;  3ZZX A;  3IR4 A;  4E8H A;  1SL0 B;  1ZYQ B;  2H72 A;  4PNF A;  1E6B A;  4G2E A;  4OCE A;  1M2A A;  4MK3 A;  4EIP A;  4JE1 A;  2IMK A;  3LOR A;  3US3 A;  2MMZ A;  2VOC A;  1GSQ A;  14GS A;  2KP2 A;  2VL2 C;  3HKR A;  5B7C A;  4V1A g;  1TU7 A;  2EIR A;  2OBK A;  10GS A;  3GKX A;  4XCS A;  1U3A A;  4HSC X;  3MNG A;  4MA9 A;  3DEX A;  1Z7R A;  5DVB A;  1T4Y A;  2H6Z A;  4L8E A;  2F8A A;  3TJF A;  3CQF A;  3M8N A;  5DDL A;  2DLX A;  4K7O A;  1H75 A;  2YZH A;  1JZO A;  5H5Q A;  3D21 A;  4ZL7 A;  2LRT A;  3FR9 A;  3F6D A;  11GS A;  4EC0 A;  1A0R P;  4GLT A;  5CRW A;  2X8H A;  1SJZ A;  3DKS A;  1OVN A;  3GA4 A;  4K5S A;  1GNE A;  1K3O A;  4QL7 A;  4HQZ A;  3APO A;  1YJ6 A;  5ENU A;  1SD9 A;  2CQ9 A;  3LEF A;  3O6T A;  1T8E B;  2FWH A;  2CAI A;  2MMN A;  3LJR A;  1PQN A;  3WT2 A;  4XIH A;  4ZL8 A;  1EWX A;  1Z5Y E;  1M2B A;  1YF0 A;  4HU7 A;  2B5Y A;  4ZBD A;  1M0U A;  5J9B A;  1TP9 A;  2DML A;  4Q5R A;  1TRS A;  1AQW A;  3G9B A;  5F8B A;  4JR4 A;  1O85 A;  4G0K A;  2JL4 A;  2OE0 A;  4KSM A;  2HT9 A;  1Z6N A;  3RAZ A;  1IYI A;  5HR2 A;  1K0M A;  4LL4 B;  3ZIT A;  1XFL A;  1PN9 A;  2GT5 A;  5CRH A;  1HQO A;  3A3T A;  3J7Y k;  1TW9 A;  4MNN A;  2AJQ B;  2C3T A;  17GS A;  1FVJ A;  2KOK A;  3I69 A;  2HYX A;  4NV2 A;  2R37 A;  2XC2 A;  4IQ1 A;  1MDK A;  5IM9 A;  2VM2 A;  4IW9 A;  4F0B A;  2P0G A;  1M3J A;  2VAF A;  4J2F A;  3GMF A;  1O8W A;  2YWM A;  5D9X A;  1HD2 A;  2JZT A;  4HZ2 A;  5CO3 A;  2H0G A;  2FA8 A;  3M9K A;  4O5R A;  5IMV A;  3U5R E;  3I43 A;  4CY6 A;  4ICY A;  5ABR A;  3KP8 A;  3FRC A;  3ME7 A;  4XTS A;  4KA0 A;  3GUS A;  4RUV A;  1K0D A;  2PER A;  3HVV A;  4ID0 A;  2B1L A;  4CW9 A;  5AN1 A;  1GTU A;  1JFU A;  5B6M A;  2H76 A;  4MAB A;  1EGR A;  2XPE A;  1SK2 A;  3TCO A;  4PQ1 A;  4O7H A;  2AAW A;  5AIV A;  2IIY A;  1E2Y A;  4F03 A;  1VGL A;  4KX4 A;  3CYN A;  3KXO A;  3IXR A;  4OCF A;  3F4T A;  1JLW A;  2DJ3 A;  2H8L A;  5AIX A;  1AUC A;  1QQ2 A;  2LJA A;  1ERW A;  5IPG A;  4AF2 A;  3HYP A;  2C8U A;  4KGI A;  3GHA A;  1JLV A;  2R0G A;  4G0I A;  2JSY A;  3TOU A;  2HSH A;  4BIK A;  4KCA A;  4NWY A;  1PFO A;  1YKC A;  5JCW A;  1YKA A;  4NHW A;  1PRX A;  3OR5 A;  1TOF A;  2L6C A;  4CY8 A;  3S9F A;  4HDE A;  2X64 A;  2YNX A;  3DVX A;  3DWV A;  1LU4 A;  2YWO A;  2K8V A;  2PN8 A;  1FO5 A;  5ELA A;  5DCG A;  5ECP B;  4Z7X A;  2V6O A;  4YH2 A;  2YV7 A;  1LJR A;  2ES7 A;  4FH8 A;  1AC1 A;  4ECI A;  3IBH A;  4E8E A;  3A2V A;  4WBJ A;  4PNG A;  4DSR A;  2OJL A;  1ZYP A;  4BVY A;  4HZ4 A;  2C1Y A;  2HSM A;  3GN3 A;  5H5R A;  2IJY A;  4WEY A;  5D9W A;  5D93 A;  1UVZ A;  2FWG A;  2H1A A;  5LD0 A;  4HJ2 A;  2FLS A;  2CT6 A;  4O92 A;  3UVT A;  4HUA A;  3HY2 A;  3ZIV A;  2F9S A;  1EEJ A;  4HEA 2;  4LMV A;  1V98 A;  2R4V A;  3LXZ A;  1BAY A;  2V1M A;  1MD3 A;  1JZD A;  3EVI A;  1AXD A;  1ILO A;  3N9J A;  4IP1 A;  1ZCP A;  1M9B A;  4N0V A;  2TIR A;  1Y6E A;  3R2Q A;  3RBT A;  4CHS A;  2CZ3 A;  3BBY A;  2PVQ A;  2R0C A;  3FR6 A;  1T3B A;  4IJI A;  2EC4 A;  1SKW B;  3LWA A;  5G2Z A;  1FB0 A;  2GDR A;  4GSS A;  3IC8 A;  3WGE A;  16GS A;  2L5O A;  4YAP A;  2H6X A;  4TXO B;  4BVY B;  3APS A;  2IN3 A;  1K3Y A;  4YQV A;  3CTF A;  3LGC A;  2DJ2 A;  4EKZ A;  2VD0 A;  5AIS A;  3IHQ A;  3HJM A;  2CA8 A;  4IEL A;  1FAA A;  2LV3 A;  6GSV A;  2YWI A;  1K0B A;  2E2G A;  4USS A;  1QMV A;  1YZX A;  2A4V A;  1A0F A;  3FZ5 A;  3IK9 A;  2PU9 C;  3M0F A;  3VWU A;  1OYJ A;  19GS A;  1GLP A;  3GTU A;  3VWX A;  2B3S A;  2L57 A;  2WUL A;  1PD2 1;  1QGV A;  2MMA A;  2QSI A;  5GZZ B;  5IMD A;  2A2P A;  2C80 A;  4ZIJ A;  5AGY A;  2LNS A;  1FW1 A;  3KIJ A;  2HSY A;  2YWN A;  2YJ7 A;  1F6M C;  2QC7 A;  5INY A;  3UMA A;  2M46 A;  4YKF A;  3IAM 2;  1FOH A;  1B9X C;  3SBC A;  2N5F A;  3ZFL A;  1V58 A;  4FYC A;  2GZY A;  1KBN A;  1WOU A;  2GSR A;  3EMX A;  3RHB A;  2YAN A;  3QPM A;  3ZTL A;  1X5C A;  4IGJ A;  1R5A A;  2VO4 A;  4IN0 A;  2IMD A;  3FMW A;  1O73 A;  1H4O A;  3GFK A;  2TRC P;  5IO0 A;  3MWH A;  1DSB A;  1X9W B;  1AW9 A;  2ZNM A;  4OFM A;  3GTU B;  4JU5 A;  3RDW A;  3EWL A;  3WT1 A;  3GRX A;  3APQ A;  2YN1 A;  3PR8 A;  1A8L A;  2QA2 A;  2WZ9 A;  2LST A;  2WDU A;  4MZC A;  4KND A;  4MMM A;  1J0F A;  1F3B A;  1XBS A;  5L71 A;  2GT6 A;  1EP8 A;  4AJ8 A;  4BPY A;  3J7Y b;  4RQX A;  3GKM A;  2L4Q A;  2FHE A;  3QOU A;  3QFA C;  1GSD A;  2IFQ A;  2KP1 A;  4N10 A;  3G7I A;  4PUR A;  3HZ4 A;  3Q19 A;  3ZRE A;  2B7K A;  5CYY A;  1GTI A;  4L5O A;  1GTA A;  2DSA A;  2X99 A;  1TK8 B;  3BCK A;  3GYK A;  2NPB A;  3HVS A;  4HJM A;  4OO4 A;  2C0G A;  4IBP A;  3IOS A;  3M3M A;  3VLN A;  4XRA A;  4KDU A;  3O3T A;  5G5F A;  4YKG A;  2B5X A;  4IJ3 A;  5B8A A;  6GSU A;  3KZQ A;  3KMO A;  2R0P A;  2V41 A;  1F3A A;  4IKH A;  2P5R A;  4XS1 A;  3P2A A;  2I81 A;  3M1G A;  3FR3 A;  3FZA A;  2DMM A;  1WE0 A;  5COH A;  4K5R A;  3DVW A;  3N5O A;  2HRA A;  2PGT A;  1GTB A;  2VCZ A;  5F06 A;  3RHC A;  1XPV A;  2IFQ B;  2QGV A;  2REM A;  2UZ8 A;  3GST A;  2GST A;  2AHE A;  1CQG A;  3PH9 A;  2MZC A;  2J9H A;  5CRE A;  4QL9 A;  2LQO A;  3MAK A;  2FWF A;  2RM5 A;  5ECH B;  3VUR A;  1K0O A;  1QXH A;  3LYK A;  1ERU A;  1R4W A;  4ISD A;  3QFB C;  4X0X A;  3AY8 A;  4KDY A;  3IC4 A;  2WS2 A;  4MF5 A;  2PBJ A;  2GSS A;  5EL8 A;  2C4J A;  3D5J A;  1ABA A;  3EC3 A;  4O5U A;  5CP1 A;  3TJK A;  1C72 A;  2AYT A;  2FGX A;  5DBQ A;  3VWW A;  1N8J A;  3TJJ A;  2XBQ A;  1TRU A;  2OAC A;  2VD1 A;  3C73 A;  1YEX A;  1GSF A;  2CVB A;  3NIV A;  1A8Y A;  2AB6 A;  3F63 A;  3HVN A;  2H30 A;  2NDO A;  3LYP A;  4FQU A;  2GQM A;  1QUW A;  5ECO B;  4G9H A;  1ZL9 A;  1SYX A;  4MP4 A;  1OKD A;  3EIN A;  2G0F A;  3A2W A;  2DJ0 A;  2X49 A;  4HOJ A;  1WRY A;  1RQM A;  2E7P A;  5DAK A;  6GSW A;  4ULX A;  2F51 A;  2OE3 A;  1FOV A;  5D73 A;  3V1W A;  2YOI A;  1Q4J A;  4FIW A;  3C71 A;  1V9W A;  1OC3 A;  3HJP A;  4GWR A;  5JCG A;  2AUV A;  5DQY A;  4I2U A;  3GKK A;  2MYG A;  2K8S A;  1FG4 A;  4DVC A;  3F0I A;  1GUL A;  2LEG A;  5B6N A;  1O7U A;  9GSS A;  3KMN A;  1MEK A;  4K2X A;  4TR4 A;  3CSH A;  2GSQ A;  2YPM A;  4KCE A;  3ZVJ A;  2IMF A;  5HR0 A;  3QMX A;  1SEN A;  2O8V B;  2VCX A;  1SK1 A;  1EGO A;  2A2R A;  2RLI A;  4L0W A;  1XWC A;  2H01 A;  4D73 A;  1KNG A;  1ZYE A;  2LTK A;  4DSQ A;  2LNT A;  5DAK B;  2KLX A;  2YV9 A;  5ECQ B;  5IMC A;  2H75 A;  1HNB A;  2OAD A;  1ST9 A;  4MPG A;  2H73 A;  4HQS A;  4PTS A;  1TK0 B;  4NMU A;  4HS1 A;  4A5P A;  4ZIL A;  1V57 A;  2IL3 A;  4XRD A;  3G7Y A;  3LXT A;  1LBK A;  1YF1 A;  1OC8 A;  3RPN A;  3F9U A;  4AJ6 A;  4KF9 A;  4WET A;  2B7J A;  3ED3 A;  1AQX A;  4TW5 A;  1KEB A;  5HR1 A;  2K6V A;  3H8Q A;  1A24 A;  1YEP A;  3FW2 A;  2NVL A;  1X5E A;  2E0Q A;  4J56 E;  3W8S A;  4GCI A;  3L0H A;  1B4Q A;  3VI5 A;  1HYU A;  2FA4 A;  2K18 A;  5F05 A;  3DIE A;  3TKS A;  1SL2 B;  3ZFB A;  3TGZ A;  4D73 B;  2E2M A;  5G1K A;  3CRT A;  4EVM A;  1EOG A;  3DRN A;  3GUR A;  2HE3 A;  4Q5N A;  4TXV A;  2H6Y A;  4XS4 A;  1M99 A;  2XHF A;  4MZB A;  3C7M A;  4KB3 A;  6GSS A;  1EP7 A;  3HZ8 A;  1T1V A;  1T4Z A;  4OD7 A;  1VF1 A;  2GTU A;  3ZIJ A;  4ZBA A;  3KJY A;  3ISO A;  1GSS A;  4GF0 A;  2GZP A;  1W89 A;  2WJU A;  4BWS A;  4WF5 A;  4EF0 A;  4Q5F A;  3IA1 A;  1N2A A;  5A4U A;  2X4A A;  1TI1 A;  2O85 A;  1Z7P A;  4MH2 A;  3UJ1 A;  1NHY A;  1TRW A;  1WJK A;  1GUK A;  3W6G A;  2DJJ A;  2VLT A;  2A2S A;  2CV4 A;  3E0U A;  1TI3 A;  4MDC A;  4TR3 A;  3IAS 2;  3KP9 A;  3TKR A;  2ZCT A;  2ZUP A;  1URM A;  2LKU A;  1S3R A;  1A2J A;  4MF6 A;  4DSS A;  2O89 A;  3I6A A;  1YDK A;  2JAD A;  2F3M A;  3FKF A;  3L4N A;  4XS4 B;  5IMA A;  3HVX A;  3WGX A;  3C1S A;  3D4M A;  2GGT A;  2HRK A;  4ECC A;  2IPA A;  2PVO C;  2TRX A;  4TXO A;  2GQK A;  2JZR A;  2O87 A;  4PQI A;  1TJD A;  7GSS A;  1XIY A;  1NW2 A;  4F2I A;  5ECK B;  2I4A A;  4POK A;  3TDG A;  4IVF A;  4EDY A;  3L9V A;  3HD5 A;  5D8I A;  1T7P B;  5DAL A;  4MCU A;  2DC5 A;  1XWG A;  3FK8 A;  4WXT A;  3TRQ A;  4KH7 A;  3IE3 A;  2VLU A;  3LQ7 A;  3VPQ A;  4DSS B;  1THX A;  2I3Y A;  2CZ2 A;  1RW1 A;  3LSZ A;  4MJE A;  4MZW A;  4GST A;  3NOF A;  2GS3 A;  4V2N A;  5BRT A;  4KAE A;  1AQV A;  3GL3 A;  3C8E A;  2MBT A;  5A5K A;  1U88 A;  1XCC A;  2HLS A;  2YP6 A;  1WPI A;  3DXB A;  3UEM A;  3MYD A;  1XVQ A;  1YQ1 A;  1PGT A;  3HA9 A;  3KEB A;  3ERF A;  1UN2 A;  4POB A;  5E4W A;  4WBR D;  2GQL A;  3CSJ A;  3HCZ A;  1BED A;  2R5G A;  5HFI A;  1FVK A;  5DAL B;  2DIZ A;  4NAX A;  5KN3 A;  3GX8 A;  1RK4 A;  3HHV A;  4K0N A;  5IIZ A;  4FYU A;  4K8M A;  3WYW A;  1YY7 A;  3Q74 A;  3IHG A;  5G5E A;  4TVE A;  2LJR A;  3P8W A;  4V1A p;  1CQH A;  6GSX A;  4PX1 A;  1SJ6 A;  1K0N A;  3IDV A;  4ZB9 A;  1WWJ A;  4I97 A;  2MMO A;  4BA7 A;  1DE1 A;  3CTG A;  4JRR A;  3ZVJ D;  3D22 A;  2PMT A;  4IQA A;  1UC7 A;  2WCI A;  2O7K A;  2R2J A;  3K8N A;  1O81 A;  3UIW A;  2LRC A;  3R3E A;  1SKS B;  2V32 A;  4ACS A;  4LLR A;  1KTE A;  2BMX A;  4N11 A;  4LMW A;  4XS6 A;  1BX9 A;  4I2T A;  3W8J A;  2L59 A;  1Z6M A;  3UOM A;  2CAQ A;  1Q98 A;  4H86 A;  3FYG A;  4TN8 A;  1K0A A;  5H5S A;  2WRT A;  1MD4 A;  3TJB A;  2CX3 A;  4Z2T A;  1BJX A;  3BOA A;  3VK9 A;  5F07 A;  2VLV A;  4ZB6 A;  4BL7 A;  3H79 A;  1EZK A;  3EPT A;  2L4C A;  4K9Z A;  2NBS A;  5ECI B;  1PA3 A;  1TK5 B;  4WF4 A;  2D2Z A;  1V40 A;  3TRX A;  3GIX A;  3QCP A;  3LG6 A;  1X5D A;  5J3R A;  4X43 A;  3H4K A;  3H1N A;  3UAR A;  3ME8 A;  3I9V 2;  2QA1 A;  4PXO A;  3L78 A;  3ZL5 A;  3ZRD A;  3EUR A;  2VL3 A;  2H1B A;  2I9H A;  4IS0 A;  5JCU A;  4L0U A;  5BMU A;  4PUA A;  4GQC A;  3A5I A;  3DYR A;  5ECN B;  5F0G A;  3SWL A;  5ECR B;  3KCM A;  4G0L A;  2V2G A;  1X9M B;  2H66 A;  4JR6 A;  1NSW A;  3MSZ A;  4BL7 B;  4L5L A;  2CX4 A;  3QDN A;  4KSO A;  5EVO A;  1S3D A;  5KEJ A;  3UBK A;  2PUK C;  4OMV A;  3DML A;  5JWO B;  4NXI A;  1PX6 A;  3A2X A;  5EY6 A;  3VPT A;  2DBC A;  3M9J A;  4MPF A;  2JAC A;  4ZL9 A;  4K7I A;  4X1U A;  5IMF A;  5IOX A;  2C0D A;  1GSU A;  1PN0 A;  4POL A;  4EXJ A;  1PKZ A;  5DCH A;  4EUY A;  20GS A;  1ERT A;  5HFG A;  1EOH A;  3ZMK A;  1BQ7 A;  4F0C A;  1NM3 A;  4AJ7 A;  1M7T A;  2VL2 A;  5CRG A;  5A4W A;  1XW9 A;  3GX0 A;  2DIY A;  1ON4 A;  5IPH A;  2RII A;  1JZW A;  3F3R A;  1ZZY A;  1Z9H A;  4PGT A;  3CXG A;  2VIM A;  5J4U A;  1G6W A; 
#chains in the Genus database with same CATH homology
 1R7H A;  1G6Y A;  5ELG A;  5C04 A;  2A4H A;  3QD9 A;  2VCW A;  3KM6 A;  4JZQ A;  5HFK A;  5FHI A;  2VUP A;  1OE8 A;  1HNA A;  1PL2 A;  4ZBB A;  2HZE A;  3LFL A;  3GNJ A;  1OC9 A;  5J9C A;  2N5B A;  5B8B A;  2R6K A;  3EMP A;  2DJ1 A;  1SL1 B;  3ZML A;  1X0R A;  3JCM L;  1G7O A;  2H70 A;  5DJM A;  1OE7 A;  6GST A;  1ZMA A;  2CVK A;  4I6X A;  2ALB A;  2HFD A;  1K0C A;  2YZU A;  4ZXG A;  1F37 A;  3UAP A;  2H19 A;  3L9U A;  3WD6 A;  4KDX A;  1B4P A;  2FUG 2;  3WGD A;  2K9F A;  1EV4 A;  4ECJ A;  2VM1 A;  2VCT A;  1IYH A;  1PX7 A;  3GH9 A;  3QAV A;  4TOP A;  1XWA A;  1ML6 A;  4LL1 B;  1USB A;  4MJB A;  1T00 A;  4EL1 A;  1AIU A;  3VWV A;  5DJL A;  2EIQ A;  4JBB A;  1GSE A;  4K1F A;  1FHE A;  2H1G A;  5IMZ A;  3LW9 A;  1SJI A;  2EIO A;  2HZE B;  1DE2 A;  2R3X A;  3C1R A;  1OC9 B;  1XWK A;  4OO5 A;  1SK0 A;  1X9S B;  2DKI A;  2KHP A;  4GTU A;  3IPZ A;  5KOW A;  1ZYN A;  2IMI A;  8GSS A;  4I5Q A;  2B5E A;  4TKY A;  2I1U A;  1V2A A;  4TR0 A;  4WR4 A;  1MDI A;  3EE2 A;  3MIX A;  1I5G A;  1B48 A;  3DGQ A;  1Z3E A;  1WIK A;  1TRV A;  4BVX A;  3TUE A;  2AV4 A;  3E3E A;  5LNK e;  5IO2 A;  3ZYW A;  3G7J A;  4K6X A;  4ML1 A;  3D4T A;  4V2L A;  1XW5 A;  2M80 A;  3ERW A;  1Y25 A;  1ZGN A;  2CVD A;  1TXX A;  1TDI A;  4PUF C;  5J5N A;  4AGS A;  1S3A A;  3PIN A;  1GL8 A;  3RPP A;  3BCI A;  2ON5 A;  3F4R A;  3GKN A;  3TB2 A;  4EDZ A;  5HQP A;  4EE0 A;  3L9S A;  1JHB A;  12GS A;  4Z2R A;  5GAN D;  4QQ7 A;  2GZZ A;  4OFT A;  3TKS C;  2ON7 A;  4MLY A;  3KTL A;  4N0Z A;  4I8B A;  2OE1 A;  1SKR B;  2LS5 A;  2P31 A;  1MDJ A;  3KH7 A;  4BVX B;  2LQQ A;  2F8F A;  1VRS D;  4XHM A;  3PGT A;  4IHU A;  2WGR A;  1ZOF A;  4KW6 A;  5CRD A;  1R26 A;  4HU9 A;  1A2M A;  1BYE A;  1NHO A;  5ECS A;  4K2D A;  1A2L A;  2BTO T;  1TKD B;  3FHK A;  5LCZ A;  1M9A A;  2HRN A;  2DJK A;  4YQM A;  2IME A;  22GS A;  2LRN A;  1XOA A;  1GRX A;  4OWY A;  1XZO A;  4ML6 A;  1J9B A;  4FYB A;  1U87 A;  3GH6 A;  3O76 A;  4TRX A;  4MJC A;  3MDK A;  2OKA A;  1ACV A;  3QAG A;  3ERG A;  3Q6O A;  2H1D A;  1VF2 A;  3TKS E;  3Q18 A;  1DUG A;  2GVP A;  1ERV A;  1U3I A;  3F6F A;  3P7X A;  2PPT A;  4NHZ A;  1WMJ A;  3FZ9 A;  1MTC A;  3FZ4 A;  5IQY A;  2C3Q A;  3HDC A;  4F82 A;  1JZR A;  4N30 A;  4F9Z A;  3VI7 A;  3UL3 A;  1SU9 A;  2OA7 A;  4NPB A;  1AAZ A;  2C3N A;  1UA5 A;  3H93 A;  2H74 A;  5GSS A;  2X8G A;  5KN1 A;  5GST A;  1PMT A;  1R5P A;  3TRP A;  4GQF A;  2XBI A;  1SYR A;  2FY6 A;  3CBU A;  4MF7 A;  1GSY A;  3TKQ A;  5G31 A;  3BD2 A;  4K7N A;  4RQR A;  2OBI A;  3IRA A;  1GWC A;  3A5W A;  3E9J B;  1GLQ A;  4CDO A;  4P3Y B;  3F8U A;  2WB9 A;  4LA1 A;  5KN0 A;  6GSY A;  4RI6 A;  3VFI A;  2YJH A;  2B1K A;  2VCV A;  1BG5 A;  2L5L A;  4YAV A;  3EU4 A;  3ZLP A;  5JWQ B;  5FT3 A;  1B8X A;  2P5Q A;  1G0T A;  2HXK A;  4ECB A;  5CAX A;  3EYT A;  1TU8 A;  2QKE A;  1O6J A;  1XW6 A;  2J23 A;  2KUC A;  5ID2 A;  1GUM A;  1VF3 A;  3GL5 A;  2M72 A;  1A23 A;  2FWE A;  2JU5 A;  3TOT A;  3KD0 A;  2JZS A;  5IOW A;  2B6M A;  3GV1 A;  3TJG A;  3NZN A;  2FNO A;  2C0F A;  3DD3 A;  3D6I A;  5ECL B;  2VCQ A;  5ECM B;  2L6D A;  2V6K A;  1QK8 A;  4WKW A;  1K3L A;  5G1L A;  2WFC A;  3KTB A;  5D9V A;  1SD8 A;  4HI7 A;  3HXS A;  4O32 A;  3P90 A;  3PPU A;  3UVH A;  5GAP D;  4MH3 A;  5ID2 B;  1HNC A;  1S3C A;  3F3Q A;  2RUF A;  1DBY A;  1XVW A;  1W4V A;  4OFN A;  1F9M A;  13GS A;  2HNL A;  4JED A;  4DEJ A;  2HZF A;  4KUN A;  2NTO A;  3U6V A;  2GLR A;  1M2D A;  4TR1 A;  1TTZ A;  4J57 E;  4ILF A;  5KN2 A;  1GH2 A;  4POM A;  4MJA A;  3TKP A;  4Q5Q A;  2MBS A;  2BJX A;  5A4V A;  4IP6 A;  3QR6 A;  2RM6 A;  1F2E A;  3UBL A;  3KH9 A;  4EIQ A;  1GP1 A;  1PKW A;  2VL9 A;  2H0H A;  3IK7 A;  2LJK A;  5DQS A;  4NV5 A;  4KE3 A;  5D9T A;  2YCD A;  3CSI A;  5D96 A;  5C00 A;  1G7E A;  3FY7 A;  1XOB A;  4O5Q A;  5J41 A;  3IV4 A;  2C0E A;  2Z9S A;  5G30 A;  1J08 A;  3D0Z A;  4X4J A;  1XXU A;  4GSN A;  2HI7 A;  1I9D A;  1GUH A;  5E59 A;  4RI7 A;  1U6T A;  3CMI A;  3EU3 A;  3CRU A;  4EO3 A;  2X8C A;  2H0I A;  5CNW A;  3QAW A;  1WP0 A;  2H71 A;  2LUS A;  3F4S A;  3HJO A;  4TR1 B;  5HR3 A;  4K0G A;  2RUE A;  1B9Y C;  4Z2U A;  1VF4 A;  1EEM A;  1GNW A;  3GSS A;  2IWT A;  4FO5 A;  1QFN A;  5EPF A;  2FD3 A;  3BJ5 A;  2G2Q A;  3FEU A;  4BWQ A;  1EV9 A;  1OAZ A;  4V2M A;  1O8X A;  2XPD A;  4PQH A;  18GS A;  1FB6 A;  1PSQ A;  5FWG A;  2HRF A;  4ZB8 A;  2N5A A;  2DKH A;  1OKT A;  2JSZ A;  3KGK A;  4GXZ A;  1XWB A;  2PWJ A;  1THO A;  4G10 A;  5KOX A;  1PL1 A;  5JWR B;  4YQU A;  2FCH A;  4WR5 A;  4GRF A;  4G19 A;  3ZZX A;  3IR4 A;  4E8H A;  1SL0 B;  1ZYQ B;  2H72 A;  4PNF A;  1E6B A;  4G2E A;  4OCE A;  1M2A A;  4MK3 A;  4EIP A;  4JE1 A;  2IMK A;  3LOR A;  3US3 A;  2MMZ A;  2VOC A;  1GSQ A;  14GS A;  2KP2 A;  2VL2 C;  3HKR A;  5B7C A;  4V1A g;  1TU7 A;  2EIR A;  2OBK A;  10GS A;  3GKX A;  4XCS A;  1U3A A;  3MNG A;  4MA9 A;  3DEX A;  1Z7R A;  5DVB A;  1T4Y A;  2H6Z A;  4L8E A;  2F8A A;  3TJF A;  3M8N A;  5DDL A;  2DLX A;  4K7O A;  1H75 A;  2YZH A;  1JZO A;  5H5Q A;  3D21 A;  4ZL7 A;  2LRT A;  3FR9 A;  3F6D A;  11GS A;  4EC0 A;  1A0R P;  4GLT A;  5CRW A;  2X8H A;  1SJZ A;  3DKS A;  1OVN A;  3GA4 A;  4K5S A;  1GNE A;  1K3O A;  4QL7 A;  4HQZ A;  3APO A;  1YJ6 A;  5ENU A;  1SD9 A;  2CQ9 A;  3LEF A;  3O6T A;  1T8E B;  2FWH A;  2CAI A;  2MMN A;  3LJR A;  1PQN A;  3WT2 A;  4XIH A;  4ZL8 A;  1EWX A;  1Z5Y E;  1M2B A;  1YF0 A;  4HU7 A;  2B5Y A;  4ZBD A;  1M0U A;  5J9B A;  1TP9 A;  2DML A;  4Q5R A;  1TRS A;  1AQW A;  3G9B A;  5F8B A;  4JR4 A;  1O85 A;  4G0K A;  2JL4 A;  2OE0 A;  4KSM A;  2HT9 A;  1Z6N A;  3RAZ A;  1IYI A;  5HR2 A;  1K0M A;  4LL4 B;  3ZIT A;  1XFL A;  1PN9 A;  2GT5 A;  5CRH A;  1HQO A;  3A3T A;  3J7Y k;  1TW9 A;  4MNN A;  2AJQ B;  2C3T A;  17GS A;  1FVJ A;  2KOK A;  3I69 A;  2HYX A;  4NV2 A;  2R37 A;  2XC2 A;  4IQ1 A;  1MDK A;  5IM9 A;  2VM2 A;  4IW9 A;  4F0B A;  2P0G A;  2VAF A;  4J2F A;  3GMF A;  1O8W A;  2YWM A;  5D9X A;  1HD2 A;  2JZT A;  4HZ2 A;  5CO3 A;  2H0G A;  2FA8 A;  3M9K A;  4O5R A;  5IMV A;  3U5R E;  3I43 A;  4CY6 A;  4ICY A;  5ABR A;  3KP8 A;  3FRC A;  3ME7 A;  4XTS A;  4KA0 A;  3GUS A;  4RUV A;  1K0D A;  2PER A;  3HVV A;  4ID0 A;  2B1L A;  4CW9 A;  5AN1 A;  1GTU A;  1JFU A;  5B6M A;  2H76 A;  4MAB A;  1EGR A;  2XPE A;  1SK2 A;  3TCO A;  4PQ1 A;  4O7H A;  2AAW A;  5AIV A;  2IIY A;  1E2Y A;  4F03 A;  1VGL A;  4KX4 A;  3CYN A;  3KXO A;  3IXR A;  4OCF A;  3F4T A;  1JLW A;  2DJ3 A;  2H8L A;  5AIX A;  1AUC A;  1QQ2 A;  2LJA A;  1ERW A;  5IPG A;  4AF2 A;  3HYP A;  2C8U A;  4KGI A;  3GHA A;  1JLV A;  2R0G A;  4G0I A;  2JSY A;  3TOU A;  2HSH A;  4KCA A;  4NWY A;  1YKC A;  5JCW A;  1YKA A;  4NHW A;  1PRX A;  3OR5 A;  1TOF A;  2L6C A;  4CY8 A;  3S9F A;  4HDE A;  2X64 A;  2YNX A;  3DVX A;  3DWV A;  1LU4 A;  2YWO A;  2K8V A;  2PN8 A;  1FO5 A;  5ELA A;  5DCG A;  5ECP B;  4Z7X A;  2V6O A;  4YH2 A;  2YV7 A;  1LJR A;  2ES7 A;  4FH8 A;  1AC1 A;  4ECI A;  3IBH A;  4E8E A;  3A2V A;  4WBJ A;  4PNG A;  4DSR A;  2OJL A;  1ZYP A;  4BVY A;  4HZ4 A;  2C1Y A;  2HSM A;  3GN3 A;  5H5R A;  2IJY A;  4WEY A;  5D9W A;  5D93 A;  1UVZ A;  2FWG A;  2H1A A;  5LD0 A;  4HJ2 A;  2FLS A;  2CT6 A;  4O92 A;  3UVT A;  4HUA A;  3HY2 A;  3ZIV A;  2F9S A;  1EEJ A;  4HEA 2;  4LMV A;  1V98 A;  2R4V A;  3LXZ A;  1BAY A;  2V1M A;  1MD3 A;  1JZD A;  3EVI A;  1AXD A;  1ILO A;  3N9J A;  4IP1 A;  1ZCP A;  1M9B A;  4N0V A;  2TIR A;  1Y6E A;  3R2Q A;  3RBT A;  4CHS A;  2CZ3 A;  3BBY A;  2PVQ A;  2R0C A;  3FR6 A;  1T3B A;  4IJI A;  2EC4 A;  1SKW B;  3LWA A;  5G2Z A;  1FB0 A;  2GDR A;  4GSS A;  3IC8 A;  3WGE A;  16GS A;  2L5O A;  4YAP A;  2H6X A;  4TXO B;  4BVY B;  3APS A;  2IN3 A;  1K3Y A;  4YQV A;  3CTF A;  3LGC A;  2DJ2 A;  4EKZ A;  2VD0 A;  5AIS A;  3IHQ A;  3HJM A;  2CA8 A;  4IEL A;  1FAA A;  2LV3 A;  6GSV A;  2YWI A;  1K0B A;  2E2G A;  4USS A;  1QMV A;  1YZX A;  2A4V A;  1A0F A;  3FZ5 A;  3IK9 A;  2PU9 C;  3M0F A;  3VWU A;  1OYJ A;  19GS A;  1GLP A;  3GTU A;  3VWX A;  2B3S A;  2L57 A;  2WUL A;  1PD2 1;  1QGV A;  2MMA A;  2QSI A;  5GZZ B;  5IMD A;  2A2P A;  2C80 A;  4ZIJ A;  5AGY A;  2LNS A;  1FW1 A;  3KIJ A;  2HSY A;  2YWN A;  2YJ7 A;  1F6M C;  2QC7 A;  5INY A;  3UMA A;  2M46 A;  4YKF A;  3IAM 2;  1FOH A;  1B9X C;  3SBC A;  2N5F A;  3ZFL A;  1V58 A;  4FYC A;  2GZY A;  1KBN A;  1WOU A;  2GSR A;  3EMX A;  3RHB A;  2YAN A;  3QPM A;  3ZTL A;  1X5C A;  4IGJ A;  1R5A A;  2VO4 A;  4IN0 A;  2IMD A;  3FMW A;  1O73 A;  1H4O A;  3GFK A;  2TRC P;  5IO0 A;  3MWH A;  1DSB A;  1X9W B;  1AW9 A;  2ZNM A;  4OFM A;  3GTU B;  4JU5 A;  3RDW A;  3EWL A;  3WT1 A;  3GRX A;  3APQ A;  2YN1 A;  3PR8 A;  1A8L A;  2QA2 A;  2WZ9 A;  2LST A;  2WDU A;  4MZC A;  4KND A;  4MMM A;  1J0F A;  1F3B A;  1XBS A;  5L71 A;  2GT6 A;  1EP8 A;  4AJ8 A;  4BPY A;  3J7Y b;  4RQX A;  3GKM A;  2L4Q A;  2FHE A;  3QOU A;  3QFA C;  1GSD A;  2IFQ A;  2KP1 A;  4N10 A;  3G7I A;  4PUR A;  3HZ4 A;  3Q19 A;  3ZRE A;  2B7K A;  5CYY A;  1GTI A;  4L5O A;  1GTA A;  2DSA A;  2X99 A;  1TK8 B;  3BCK A;  3GYK A;  2NPB A;  3HVS A;  4HJM A;  4OO4 A;  2C0G A;  4IBP A;  3IOS A;  3M3M A;  3VLN A;  4XRA A;  4KDU A;  3O3T A;  5G5F A;  4YKG A;  2B5X A;  4IJ3 A;  5B8A A;  6GSU A;  3KZQ A;  3KMO A;  2R0P A;  2V41 A;  1F3A A;  4IKH A;  2P5R A;  4XS1 A;  3P2A A;  2I81 A;  3M1G A;  3FR3 A;  3FZA A;  2DMM A;  1WE0 A;  5COH A;  4K5R A;  3DVW A;  3N5O A;  2HRA A;  2PGT A;  1GTB A;  2VCZ A;  5F06 A;  3RHC A;  1XPV A;  2IFQ B;  2QGV A;  2REM A;  2UZ8 A;  3GST A;  2GST A;  2AHE A;  1CQG A;  3PH9 A;  2MZC A;  2J9H A;  5CRE A;  4QL9 A;  2LQO A;  3MAK A;  2FWF A;  2RM5 A;  5ECH B;  3VUR A;  1K0O A;  1QXH A;  3LYK A;  1ERU A;  1R4W A;  4ISD A;  3QFB C;  4X0X A;  3AY8 A;  4KDY A;  3IC4 A;  2WS2 A;  4MF5 A;  2PBJ A;  2GSS A;  5EL8 A;  2C4J A;  3D5J A;  1ABA A;  3EC3 A;  4O5U A;  5CP1 A;  3TJK A;  1C72 A;  2AYT A;  2FGX A;  5DBQ A;  3VWW A;  1N8J A;  3TJJ A;  2XBQ A;  1TRU A;  2OAC A;  2VD1 A;  3C73 A;  1YEX A;  1GSF A;  2CVB A;  3NIV A;  1A8Y A;  2AB6 A;  3F63 A;  2H30 A;  2NDO A;  3LYP A;  4FQU A;  2GQM A;  1QUW A;  5ECO B;  4G9H A;  1ZL9 A;  1SYX A;  4MP4 A;  1OKD A;  3EIN A;  2G0F A;  3A2W A;  2DJ0 A;  2X49 A;  4HOJ A;  1WRY A;  1RQM A;  2E7P A;  5DAK A;  6GSW A;  4ULX A;  2F51 A;  2OE3 A;  1FOV A;  5D73 A;  3V1W A;  2YOI A;  1Q4J A;  4FIW A;  3C71 A;  1V9W A;  1OC3 A;  3HJP A;  4GWR A;  5JCG A;  2AUV A;  5DQY A;  4I2U A;  3GKK A;  2MYG A;  2K8S A;  1FG4 A;  4DVC A;  3F0I A;  1GUL A;  2LEG A;  5B6N A;  1O7U A;  9GSS A;  3KMN A;  1MEK A;  4K2X A;  4TR4 A;  3CSH A;  2GSQ A;  2YPM A;  4KCE A;  3ZVJ A;  2IMF A;  5HR0 A;  3QMX A;  1SEN A;  2O8V B;  2VCX A;  1SK1 A;  1EGO A;  2A2R A;  2RLI A;  4L0W A;  1XWC A;  2H01 A;  4D73 A;  1KNG A;  1ZYE A;  2LTK A;  4DSQ A;  2LNT A;  5DAK B;  2KLX A;  2YV9 A;  5ECQ B;  5IMC A;  2H75 A;  1HNB A;  2OAD A;  1ST9 A;  4MPG A;  2H73 A;  4HQS A;  4PTS A;  1TK0 B;  4NMU A;  4HS1 A;  4A5P A;  4ZIL A;  1V57 A;  2IL3 A;  4XRD A;  3G7Y A;  3LXT A;  1LBK A;  1YF1 A;  1OC8 A;  3RPN A;  3F9U A;  4AJ6 A;  4KF9 A;  4WET A;  2B7J A;  3ED3 A;  1AQX A;  4TW5 A;  1KEB A;  5HR1 A;  2K6V A;  3H8Q A;  1A24 A;  1YEP A;  3FW2 A;  2NVL A;  1X5E A;  2E0Q A;  4J56 E;  3W8S A;  4GCI A;  3L0H A;  1B4Q A;  3VI5 A;  1HYU A;  2FA4 A;  2K18 A;  5F05 A;  3DIE A;  3TKS A;  1SL2 B;  3ZFB A;  3TGZ A;  4D73 B;  2E2M A;  5G1K A;  3CRT A;  4EVM A;  1EOG A;  3DRN A;  3GUR A;  2HE3 A;  4Q5N A;  4TXV A;  2H6Y A;  4XS4 A;  1M99 A;  2XHF A;  4MZB A;  3C7M A;  4KB3 A;  6GSS A;  1EP7 A;  3HZ8 A;  1T1V A;  1T4Z A;  4OD7 A;  1VF1 A;  2GTU A;  3ZIJ A;  4ZBA A;  3KJY A;  3ISO A;  1GSS A;  4GF0 A;  2GZP A;  1W89 A;  2WJU A;  4BWS A;  4WF5 A;  4EF0 A;  4Q5F A;  3IA1 A;  1N2A A;  5A4U A;  2X4A A;  1TI1 A;  2O85 A;  1Z7P A;  4MH2 A;  3UJ1 A;  1NHY A;  1TRW A;  1WJK A;  1GUK A;  3W6G A;  2DJJ A;  2VLT A;  2A2S A;  2CV4 A;  3E0U A;  1TI3 A;  4MDC A;  4TR3 A;  3IAS 2;  3KP9 A;  3TKR A;  2ZCT A;  2ZUP A;  1URM A;  2LKU A;  1A2J A;  4MF6 A;  4DSS A;  2O89 A;  3I6A A;  1YDK A;  2JAD A;  2F3M A;  3FKF A;  3L4N A;  4XS4 B;  5IMA A;  3HVX A;  3WGX A;  3C1S A;  3D4M A;  2GGT A;  2HRK A;  4ECC A;  2IPA A;  2PVO C;  2TRX A;  4TXO A;  2GQK A;  2JZR A;  2O87 A;  4PQI A;  1TJD A;  7GSS A;  1XIY A;  1NW2 A;  4F2I A;  5ECK B;  2I4A A;  4POK A;  3TDG A;  4IVF A;  4EDY A;  3L9V A;  3HD5 A;  5D8I A;  1T7P B;  5DAL A;  4MCU A;  2DC5 A;  1XWG A;  3FK8 A;  4WXT A;  3TRQ A;  4KH7 A;  3IE3 A;  2VLU A;  3LQ7 A;  3VPQ A;  4DSS B;  1THX A;  2I3Y A;  2CZ2 A;  1RW1 A;  3LSZ A;  4MJE A;  4MZW A;  4GST A;  3NOF A;  2GS3 A;  4V2N A;  5BRT A;  4KAE A;  1AQV A;  3GL3 A;  3C8E A;  2MBT A;  5A5K A;  1U88 A;  1XCC A;  2HLS A;  2YP6 A;  1WPI A;  3DXB A;  3UEM A;  3MYD A;  1XVQ A;  1YQ1 A;  1PGT A;  3HA9 A;  3KEB A;  3ERF A;  1UN2 A;  4POB A;  5E4W A;  4WBR D;  2GQL A;  3CSJ A;  3HCZ A;  1BED A;  2R5G A;  5HFI A;  1FVK A;  5DAL B;  2DIZ A;  4NAX A;  5KN3 A;  3GX8 A;  1RK4 A;  3HHV A;  4K0N A;  5IIZ A;  4FYU A;  4K8M A;  3WYW A;  1YY7 A;  3Q74 A;  3IHG A;  5G5E A;  4TVE A;  2LJR A;  3P8W A;  4V1A p;  1CQH A;  6GSX A;  4PX1 A;  1SJ6 A;  1K0N A;  3IDV A;  4ZB9 A;  1WWJ A;  4I97 A;  2MMO A;  4BA7 A;  1DE1 A;  3CTG A;  4JRR A;  3ZVJ D;  3D22 A;  2PMT A;  4IQA A;  1UC7 A;  2WCI A;  2O7K A;  2R2J A;  3K8N A;  1O81 A;  3UIW A;  2LRC A;  3R3E A;  1SKS B;  2V32 A;  4ACS A;  4LLR A;  1KTE A;  2BMX A;  4N11 A;  4LMW A;  4XS6 A;  1BX9 A;  4I2T A;  3W8J A;  2L59 A;  1Z6M A;  3UOM A;  2CAQ A;  1Q98 A;  4H86 A;  3FYG A;  4TN8 A;  1K0A A;  5H5S A;  2WRT A;  1MD4 A;  3TJB A;  2CX3 A;  4Z2T A;  1BJX A;  3BOA A;  3VK9 A;  5F07 A;  2VLV A;  4ZB6 A;  4BL7 A;  3H79 A;  1EZK A;  3EPT A;  2L4C A;  4K9Z A;  2NBS A;  5ECI B;  1PA3 A;  1TK5 B;  4WF4 A;  2D2Z A;  1V40 A;  3TRX A;  3GIX A;  3QCP A;  3LG6 A;  1X5D A;  5J3R A;  4X43 A;  3H4K A;  3H1N A;  3UAR A;  3ME8 A;  3I9V 2;  2QA1 A;  4PXO A;  3L78 A;  3ZL5 A;  3ZRD A;  3EUR A;  2VL3 A;  2H1B A;  2I9H A;  4IS0 A;  5JCU A;  4L0U A;  5BMU A;  4PUA A;  4GQC A;  3A5I A;  3DYR A;  5ECN B;  5F0G A;  3SWL A;  5ECR B;  3KCM A;  4G0L A;  2V2G A;  1X9M B;  2H66 A;  4JR6 A;  1NSW A;  3MSZ A;  4BL7 B;  4L5L A;  2CX4 A;  3QDN A;  4KSO A;  5EVO A;  1S3D A;  5KEJ A;  3UBK A;  2PUK C;  4OMV A;  3DML A;  5JWO B;  4NXI A;  1PX6 A;  3A2X A;  5EY6 A;  3VPT A;  2DBC A;  3M9J A;  4MPF A;  2JAC A;  4ZL9 A;  4K7I A;  4X1U A;  5IMF A;  5IOX A;  2C0D A;  1GSU A;  1PN0 A;  4POL A;  4EXJ A;  1PKZ A;  5DCH A;  4EUY A;  20GS A;  1ERT A;  5HFG A;  1EOH A;  3ZMK A;  1BQ7 A;  4F0C A;  1NM3 A;  4AJ7 A;  1M7T A;  2VL2 A;  5CRG A;  5A4W A;  1XW9 A;  3GX0 A;  2DIY A;  1ON4 A;  5IPH A;  2RII A;  1JZW A;  3F3R A;  1ZZY A;  1Z9H A;  4PGT A;  3CXG A;  2VIM A;  5J4U A;  1G6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...