2IFQB

Crystal structure of s-nitroso thioredoxin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ifqB00
3HJMA 4FIWA 1C72A 1SJ6A 3M8NA 4Q5QA 2VM2A 2BMXA 3O76A 4CHSA 1F3BA 2EC4A 3U6VA 3GSSA 4ZL7A 3ZMKA 1YZXA 4G10A 1FB6A 1F37A 5J41A 1TU7A 1EEJA 3KTBA 4MZCA 22GSA 1ZMAA 5ECQB 3E9JB 3QCPA 2O87A 1TRWA 2PN8A 5ENUA 1WPIA 2B6MA 4XIHA 2CV4A 3Q19A 5DDLA 4JRRA 1DE2A 1G6YA 2YZHA 2IIYA 2R37A 2HXKA 1U88A 3HVVA 3GUSA 2XBIA 2H73A 2IWTA 3KP8A 3PH9A 4HU9A 4PQIA 3LXTA 4EDYA 1XWAA 2GZZA 2N5AA 1TOFA 4YH2A 3CSJA 3KM6A 3EU3A 5ECHB 1V98A 2K6VA 1Q4JA 2B5XA 5FWGA 3A3TA 2NVLA 3MDKA 1SK0A 4NV5A 5C04A 2LJAA 3KIJA 2YWMA 2CQ9A 3LGCA 2FHEA 5ECNB 2VLTA 2VO4A 4RUVA 3GKMA 3DRNA 5JCWA 5D9VA 1ZYEA 3HJPA 3P90A 3UL3A 2LKUA 2FWFA 2C80A 3HZ8A 2WS2A 2LTKA 3LORA 1JZOA 4IVFA 3CSIA 2IN3A 3DGQA 3IK9A 4XTSA 1MDJA 2B5EA 4OCEA 5EPFA 3EYTA 1XW5A 2HZEB 1GSUA 2MMZA 4NAXA 1X5EA 1G7OA 1PKZA 4MPFA 5INYA 3FHKA 5AN1A 3VLNA 2VAFA 3DVWA 1TK8B 2OE3A 4PQHA 5D9WA 1EGOA 3W8SA 3UVTA 4GTUA 1B4QA 4KAEA 3FY7A 2V32A 5JCGA 2YCDA 2JL4A 1JFUA 2OJLA 2H0GA 3UOMA 4O32A 3WT2A 2ON7A 2A4VA 2H6XA 2J9HA 5ELAA 5CNWA 3GN3A 4YQVA 3DEXA 4GXZA 1B4PA 3F8UA 5E4WA 1OC9B 2F8AA 3CBUA 5LCZA 2N5FA 4EO3A 1N8JA 3J7Yk 3KMOA 2GT5A 2B5YA 4F9ZA 2ES7A 1R5AA 2PBJA 2I4AA 5AISA 3C71A 3EMXA 5D9XA 1LBKA 3OR5A 2WCIA 2VLVA 3F63A 2XBQA 5HFKA 4OWYA 5JWRB 3PINA 4ACSA 4XS4A 4XHMA 1T8EB 3ZRDA 1SKRB 3CXGA 2K8SA 1NHYA 3VWXA 1YF1A 2FD3A 1FOVA 2VL3A 2B1LA 3F9UA 1GLQA 2TIRA 2ZNMA 1BAYA 2MMOA 1ERWA 2IPAA 3KGKA 5CRWA 2DC5A 1F2EA 3JCML 4GSNA 4DSQA 2C0EA 4V2NA 3MSZA 3O6TA 5IO2A 4AJ6A 1A0FA 1M0UA 4KB3A 1F9MA 2FCHA 2KP1A 1PRXA 4TRXA 1K3YA 3G7JA 3VI5A 3ZIVA 4WXTA 2FWHA 4G9HA 1YJ6A 1OVNA 2DIYA 1AQXA 5B6MA 2H6YA 1DE1A 2KP2A 3GA4A 5D8IA 3AY8A 2H74A 3SWLA 2DMLA 2E2MA 5DAKA 4MDCA 4EVMA 1VF2A 2R6KA 1MD4A 1J0FA 4JBBA 2O89A 3BCKA 3L9SA 1YQ1A 3GH9A 3M9KA 2E7PA 5D73A 2DMMA 1K3OA 5ECRB 2EIRA 1M2DA 5B7CA 3IV4A 2DIZA 1OC3A 4MF5A 2CZ3A 2H1AA 2R5GA 3ZL5A 3A2VA 4I2TA 3N9JA 4KSMA 3ZFLA 1O8WA 1G0TA 2XC2A 2LNTA 1ST9A 1B9XC 4KCAA 2JADA 4HS1A 2H1GA 2BTOT 3TB2A 1VF3A 3A5WA 1QFNA 1RQMA 2PVOC 5H5SA 5IO0A 2GS3A 2H01A 2RLIA 3LSZA 4OFMA 3CRUA 3F0IA 4MK3A 1K0OA 1QMVA 3KXOA 3ERWA 5F8BA 2DJ3A 2B1KA 1U6TA 4V2LA 5CP1A 2YANA 12GSA 1EV9A 2C1YA 4IP6A 1Y6EA 2O7KA 3IRAA 4KA0A 3EVIA 5HFIA 4MCUA 2F8FA 3UIWA 4RQRA 3F4SA 2A2SA 2WRTA 2R2JA 1J08A 3GHAA 1KBNA 2H66A 4PNGA 1RK4A 2KLXA 4JR6A 5G31A 1HYUA 1ZYQB 2X64A 3IHQA 2CZ2A 3RAZA 2MMAA 3TJFA 1XVWA 5GZZB 2NTOA 10GSA 4Q5FA 3QAVA 1Z6NA 1FVKA 1Q98A 5IMVA 1FW1A 2LUSA 1Z9HA 4TXOA 3F6DA 4RQXA 1AUCA 3APOA 1G7EA 2GDRA 5L71A 2HRNA 2LQQA 4D73B 4IJ3A 4DSRA 3DXBA 1TDIA 4EDZA 1SK1A 1N2AA 3L9UA 4K7IA 4K9ZA 1K0CA 1GTAA 1A8YA 3RDWA 5H5QA 4KGIA 2BJXA 3C73A 1TI1A 2RUFA 3FK8A 1CQHA 1WWJA 4KSOA 2I81A 3MNGA 2NBSA 2MBTA 1OAZA 3GURA 4ZL9A 2LS5A 3ERFA 1G6WA 3TRPA 3G7IA 2QKEA 4IHUA 3TOUA 2P31A 3IXRA 3GV1A 2A2RA 5IPGA 4QL7A 1Z7PA 3IBHA 2YWOA 1GTIA 4ZXGA 2H1BA 2DBCA 4KDYA 1U3AA 2RM5A 3GL5A 2DLXA 2H8LA 1YDKA 2C0FA 2MYGA 4MH2A 4L5OA 4YQMA 5GSSA 4IS0A 4GLTA 5EY6A 4K0GA 3P8WA 4IW9A 3GH6A 1W4VA 1NSWA 1Z3EA 4I8BA 1V2AA 1FVJA 4TOPA 3ISOA 4NWYA 4HEA2 4O92A 2PUKC 1TTZA 3FR6A 3KP9A 5JCUA 2VOCA 1ZOFA 1J9BA 1USBA 1PKWA 2KUCA 1DUGA 1GULA 1V40A 4OO4A 4EUYA 4JU5A 5J4UA 1BX9A 1GL8A 1XWKA 2GSTA 1TK0B 3FEUA 5DQYA 1S3AA 2JU5A 3V1WA 3LXZA 5A5KA 1R7HA 2F51A 2FA8A 4OFNA 3GNJA 1PL2A 1SYRA 1TRUA 3VK9A 1B8XA 1S3DA 1GSEA 3TUEA 2VLUA 4K8MA 1YKAA 2VL2A 4HOJA 3DMLA 1XOBA 2YJ7A 5CREA 4FYBA 5CYYA 1A0RP 3GKXA 5HFGA 5HR3A 1ERTA 2OBKA 3WGXA 1HQOA 1XBSA 4OO5A 2CVKA 1BQ7A 3E0UA 4RI6A 4TR3A 2M80A 2V2GA 1M2BA 2HSHA 2GSQA 2DJ2A 2ZUPA 4GF0A 4DSSB 5KN1A 3VFIA 2XPEA 3RPPA 4WETA 3QOUA 2WB9A 3GTUB 2TRCP 2HZEA 3BD2A 1JLWA 3IC4A 1GUMA 1WRYA 3L0HA 5D93A 4NHWA 4MH3A 1QXHA 1E6BA 5KN0A 1SL2B 4ML1A 4PX1A 4F82A 1UVZA 4IELA 4K7NA 1GSSA 2GQLA 4WKWA 5EL8A 2HRFA 2CX3A 2P5QA 1XOAA 4HJ2A 3DVXA 3VWUA 1B48A 4H86A 1OYJA 3DYRA 6GSVA 2I3YA 4IP1A 1ZL9A 5IMZA 3FYGA 3DIEA 2OADA 2D2ZA 1M99A 2X8HA 4RI7A 1SL0B 2FWGA 4BA7A 2HNLA 3ZYWA 1VF4A 5GAPD 1GSFA 2CA8A 3ZZXA 3M9JA 4FYCA 5IIZA 4J2FA 1OC9A 2PPTA 3BOAA 5G1LA 5IQYA 2G0FA 5CRGA 3QD9A 1GTUA 1SD9A 2DJJA 3QFAC 1OE7A 4MJBA 3P2AA 1Z5YE 4ZL8A 4EF0A 4O7HA 5DALA 3TJGA 19GSA 2PWJA 4MA9A 3IR4A 1Y25A 2GZYA 3UJ1A 2DJKA 1R4WA 4QL9A 5IOXA 3VWVA 5KN2A 5IMDA 2PU9C 3KTLA 2REMA 5IM9A 3FR3A 2KOKA 1K0DA 1TP9A 2L4QA 3KZQA 2YWNA 4G19A 1IYHA 1BJXA 4Q5RA 1SKSB 5FHIA 1AIUA 5CAXA 1ILOA 1A8LA 1FG4A 2AB6A 1TXXA 1BG5A 3KMNA 1XFLA 1FB0A 4KNDA 3KEBA 2JSZA 2PVQA 2L57A 1SJIA 1RW1A 4PNFA 3CSHA 4WEYA 4POBA 1M9BA 3S9FA 1I9DA 4HQZA 2WZ9A 3QPMA 1X5CA 1QK8A 3VPQA 2JACA 3U5RE 5HQPA 1GNEA 3NIVA 2ALBA 3ZFBA 4PXOA 2LJRA 3QFBC 2GQMA 5ABRA 4ULXA 3FW2A 1XWCA 4I6XA 3CYNA 2AV4A 3EINA 2FA4A 5D9TA 4KH7A 4ZBAA 2FGXA 1THXA 1FHEA 1SL1B 1TRVA 2LJKA 4N0VA 3TKPA 1U87A 1ZCPA 4NHZA 4XS1A 3TCOA 5DBQA 4K0NA 4ZB8A 4JZQA 3GSTA 3UBKA 1OKTA 6GSXA 4CW9A 1O81A 1QGVA 5A4UA 4O5RA 4YAPA 2HE3A 3K8NA 3GX0A 3GMFA 4MPGA 1R5PA 3DD3A 1ML6A 1SD8A 2H76A 1OE8A 3D21A 1SYXA 1TI3A 4KE3A 5AIXA 3R2QA 1X9SB 1B9YC 3L78A 1MDIA 3P7XA 3US3A 3KH7A 2IFQA 5HR2A 1TJDA 5G2ZA 3H79A 4XRDA 4Q5NA 3EURA 3EE2A 2I1UA 1YKCA 2VIMA 4GQCA 1HNAA 2O85A 5JWQB 3TKQA 2IMKA 4GRFA 3ZVJD 3NZNA 4JE1A 1PN9A 2WDUA 5ECKB 3CMIA 3RHCA 3HKRA 5G5FA 1X0RA 2C3QA 2LEGA 2CT6A 5CRDA 3APQA 2IMEA 4MZWA 1PGTA 3HXSA 4MABA 1O7UA 4HUAA 2M46A 4BPYA 3C1SA 3GRXA 5IOWA 5AGYA 2YP6A 2XPDA 2YJHA 1GUKA 1ZGNA 1F6MC 2VM1A 3QMXA 5ECSA 5G30A 1FAAA 3TRXA 3ZITA 6GSTA 8GSSA 4YQUA 2AAWA 3LYPA 5ECLB 2L4CA 4TR1A 1T1VA 4K6XA 1EWXA 2GZPA 2LQOA 4HDEA 17GSA 5D96A 2L59A 3GIXA 2WULA 5DCHA 5KEJA 4ID0A 1H4OA 1XZOA 3G9BA 4V1Ag 4J56E 1HNBA 1JZWA 3GL3A 2R4VA 3F3RA 1ERUA 2WFCA 3IAS2 3M1GA 3APSA 2IMIA 5HR1A 4WF4A 1OKDA 2ZCTA 2HFDA 5DJLA 2CVBA 3HA9A 1UA5A 4MF7A 4XS6A 2C4JA 1ON4A 4F03A 2H30A 4ZBBA 1A2MA 2QC7A 1O73A 3TJBA 1K0BA 4AGSA 4EE0A 1GNWA 4IQAA 2VCWA 4LL4B 2C3TA 5B8AA 2YOIA 2VCXA 5J3RA 4KX4A 3N5OA 4KDUA 4K1FA 4I2UA 2IMFA 4WF5A 4ZILA 1KNGA 3QAGA 4POKA 3GKNA 2L5OA 1OC8A 5ID2B 2GVPA 3IAM2 2B3SA 4HZ4A 2C3NA 3TGZA 5DCGA 4PGTA 4V2MA 1QUWA 5A4WA 4TVEA 2B7KA 2H72A 4MF6A 4OFTA 3W8JA 2I9HA 6GSUA 4BVYA 4V1Ap 2RIIA 2Z9SA 3LFLA 4ZB9A 1SU9A 5ECMB 3EMPA 2N5BA 3LQ7A 2FWEA 2HSYA 1O85A 4L8EA 4MLYA 4AJ8A 4ECJA 4AJ7A 6GSSA 3G7YA 3I6AA 1KEBA 2H19A 2VCQA 3HHVA 3IOSA 3TKSC 2X8CA 1YF0A 3FZ5A 1W89A 2GLRA 3NOFA 1O8XA 4IN0A 3VURA 1V58A 3FZAA 4QQ7A 4LLRA 4GWRA 4DEJA 5DJMA 1MDKA 3F4TA 3LEFA 4LMWA 3ZLPA 4YAVA 3F3QA 11GSA 3D5JA 3ED3A 3I43A 2LSTA 5IMFA 2OBIA 1MTCA 4TKYA 1PL1A 4NPBA 2VD0A 4KDXA 4GSTA 3TRQA 1M7TA 2NPBA 2YZUA 5F05A 3H93A 3HY2A 1XXUA 2DJ0A 4DSSA 2VUPA 2EIQA 1TRSA 4K2DA 1WMJA 3GTUA 4ML6A 2GQKA 4ILFA 2VL9A 3TKRA 2IJYA 4OMVA 3TJJA 1GP1A 1M2AA 3TJKA 5G1KA 1WJKA 4BWQA 1YEXA 2G2QA 1GH2A 1SJZA 1WIKA 9GSSA 4MMMA 5J9CA 3IDVA 4ISDA 1WOUA 2OA7A 3RPNA 1PA3A 4HI7A 5KN3A 1NW2A 4I97A 5J9BA 2PMTA 4EKZA 1UN2A 1IYIA 13GSA 3BBYA 1E2YA 1XCCA 3HVSA 4GQFA 3FKFA 3M3MA 4NV2A 2VCZA 4WBJA 4ECIA 1X5DA 4MZBA 3DKSA 4OCFA 1AXDA 2YNXA 4XRAA 2JZRA 1YEPA 3D6IA 2MZCA 2GSSA 3EWLA 3A2XA 3VPTA 3D4TA 1QQ2A 4GCIA 4OD7A 4BL7A 2JSYA 4MJEA 3HZ4A 4X1UA 4GSSA 1JZDA 4BWSA 1LJRA 4NMUA 4TR0A 3EU4A 3ZIJA 5GAND 2GTUA 5IPHA 1A23A 1EV4A 1GSQA 3CTFA 2K8VA 2DSAA 4PUAA 1SENA 2J23A 3H4KA 4TXVA 5ECOB 2R3XA 1K0MA 3LJRA 4KUNA 1NHOA 4X43A 1SKWB 1K0AA 4TR4A 1XIYA 2F9SA 1YY7A 2L6CA 3KD0A 5F0GA 5DQSA 2X99A 2HT9A 1Z6MA 4ZIJA 2HLSA 3HJOA 3MWHA 1MEKA 1LU4A 2M72A 5FT3A 14GSA 3BJ5A 3F4RA 4JEDA 2LV3A 4EL1A 2NDOA 3QDNA 2B7JA 2E2GA 2CAIA 3HYPA 2LRCA 3L9VA 3H8QA 1EEMA 4KCEA 4IQ1A 5IMAA 1TK5B 6GSYA 3FZ9A 2AUVA 3QR6A 2EIOA 3HD5A 3CRTA 1ABAA 18GSA 2MMNA 4E8HA 1AC1A 3UMAA 3F6FA 5LNKe 3LYKA 16GSA 2F3MA 3RHBA 3WD6A 5DALB 3C8EA 4MJAA 3TKSA 4IGJA 2CX4A 5H5RA 1GTBA 3PGTA 3Q18A 1FO5A 2VCTA 1MD3A 2L5LA 4LL1B 2OACA 3LWAA 4WR5A 2P5RA 2AJQB 1HNCA 3I9V2 4EXJA 1PQNA 4P3YB 3TDGA 2L6DA 4ECBA 3FRCA 1DSBA 3J7Yb 4LMVA 3FR9A 4WBRD 2OE1A 1TU8A 5C00A 1A2LA 5G5EA 2YWIA 1GSYA 2HYXA 4FH8A 1AQWA 3DWVA 3E3EA 1EP8A 4XS4B 1AQVA 2JZSA 3HCZA 5B8BA 4BVXA 2DJ1A 1PD21 3WT1A 3IPZA 5HR0A 2FUG2 2ON5A 4E8EA 3ZREA 1AAZA 3HVXA 3KJYA 4KW6A 2GT6A 4N30A 3PR8A 2YV7A 4PQ1A 2RUEA 2TRXA 2O8VB 4Z7XA 1EGRA 2YV9A 3UVHA 3QAWA 1EOHA 1XWBA 1GWCA 2RM6A 2AHEA 1S3CA 2H75A 5DVBA 1XWGA 2QGVA 1NM3A 1PX7A 3I69A 1XW9A 2PGTA 3M0FA 2VL2C 1A24A 3W6GA 3IE3A 2H0IA 2IL3A 3Q6OA 1GSDA 4X0XA 1BYEA 2GSRA 2YN1A 3WGEA 2MBSA 1THOA 1H75A 4IJIA 3ZMLA 2JZTA 1Z7RA 5DAKB 3D4MA 3FZ4A 5A4VA 3GFKA 1JLVA 1WE0A 3IK7A 3WYWA 3ZTLA 3VWWA 3Q74A 1XPVA 3D0ZA 1EP7A 3O3TA 3H1NA 5JWOB 2H70A 2K18A 5F07A 1R26A 1K0NA 4ZBDA 2V1MA 2OE0A 1XVQA 2CVDA 2K9FA 1A2JA 7GSSA 2LRNA 2VCVA 4HJMA 1F3AA 1XW6A 4XCSA 4TN8A 4D73A 2HZFA 1T00A 1I5GA 2C0DA 4NXIA 2C0GA 1V9WA 1EZKA 2IFQB 3MAKA 2E0QA 1O6JA 2V6KA 4L5LA 3A2WA 3IA1A 1ZZYA 3GYKA 4K7OA 1T7PB 2GGTA 2H6ZA 4F0CA 4POMA 1HD2A 3D22A 3KH9A 3UARA 1U3IA 1TW9A 2FLSA 3KCMA 3TKSE 5AIVA 1VF1A 4MP4A 1GLPA 4F2IA 1UC7A 5GSTA 5ID2A 3ZVJA 2FNOA 3ME7A 3C1RA 6GSWA 4N11A 1TKDB 2WGRA 3HDCA 5IMCA 4N0ZA 1K3LA 2CAQA 5CO3A 3WGDA 4PUFC 2PERA 4IKHA 1PX6A 5F06A 3UAPA 4TW5A 2V41A 5ELGA 4POLA 4MJCA 1M9AA 1ACVA 4G2EA 1T4ZA 1AW9A 2YPMA 5ECPB 4TR1B 5J5NA 4AF2A 3TOTA 2WJUA 1ERVA 4N10A 4ECCA 1VGLA 3EC3A 1PSQA 3ERGA 4JR4A 2XHFA 1GRXA 4FO5A 5COHA 4I5QA 3C7MA 4PURA 3VI7A 2FY6A 2P0GA 4TXOB 3RBTA 1JZRA 3UEMA 2C8UA 1SK2A 3GKKA 2H71A 1X9WB 1EOGA 3LG6A 3L4NA 1WP0A 4HU7A 2LRTA 1URMA 2AYTA 1X9MB 2OKAA 4LA1A 4HQSA 1JHBA 3UBLA 4CDOA 4DVCA 2KHPA 3CTGA 5LD0A 1V57A 2QSIA 2H0HA 2HI7A 1T3BA 2LNSA 2H1DA 1GUHA 3ME8A 5EVOA 4L0UA 2IMDA 4L0WA 5B6NA 4IBPA 4F0BA 4WR4A 5E59A 1VRSD 4J57E 3BCIA 4HZ2A 3GX8A 1CQGA 4EC0A 5CRHA 2VD1A 4ZB6A 1PMTA 20GSA 5ECIB 1DBYA 1BEDA 2X8GA 1T4YA 3SBCA 1KTEA 4FYUA 2V6OA
chains in the Genus database with same CATH superfamily
3HJMA 4FQUA 4FIWA 1C72A 1SJ6A 3M8NA 4Q5QA 2VM2A 2BMXA 3O76A 4CHSA 1F3BA 2EC4A 3U6VA 3GSSA 4ZL7A 3ZMKA 1YZXA 4G10A 1FB6A 1F37A 5J41A 1TU7A 1EEJA 3KTBA 4MZCA 22GSA 1ZMAA 5ECQB 4Z2TA 3E9JB 3QCPA 2O87A 1TRWA 2PN8A 5ENUA 1WPIA 2B6MA 4XIHA 2CV4A 3Q19A 5DDLA 4JRRA 1DE2A 1G6YA 2YZHA 2IIYA 2R37A 2HXKA 1U88A 3HVVA 3GUSA 2XBIA 2H73A 2IWTA 3KP8A 3PH9A 4HU9A 4PQIA 3LXTA 4EDYA 1XWAA 2GZZA 2N5AA 1TOFA 4YH2A 3CSJA 3KM6A 3EU3A 5ECHB 1V98A 2K6VA 1Q4JA 2B5XA 5FWGA 3A3TA 2NVLA 3MDKA 1SK0A 4NV5A 5C04A 2LJAA 3KIJA 2YWMA 2CQ9A 3LGCA 2FHEA 2VO4A 2VLTA 5ECNB 4RUVA 3GKMA 3DRNA 5JCWA 5D9VA 1ZYEA 3HJPA 3P90A 3UL3A 2LKUA 2FWFA 2C80A 3HZ8A 2WS2A 2LTKA 3LORA 1JZOA 3MYDA 4IVFA 3CSIA 4MNNA 2IN3A 3DGQA 3IK9A 4XTSA 1MDJA 2B5EA 4OCEA 5EPFA 3EYTA 1XW5A 2HZEB 1GSUA 2MMZA 4NAXA 4CY6A 1X5EA 1G7OA 1PKZA 4MPFA 5INYA 3FHKA 5AN1A 3VLNA 2VAFA 3DVWA 1TK8B 2OE3A 4PQHA 3IC8A 5D9WA 1EGOA 3W8SA 3UVTA 4GTUA 1B4QA 4KAEA 3FY7A 2V32A 5JCGA 2YCDA 2JL4A 1JFUA 2OJLA 2H0GA 3UOMA 4O32A 3WT2A 2ON7A 2A4VA 2H6XA 2J9HA 5ELAA 5CNWA 3GN3A 4YQVA 3DEXA 4GXZA 1B4PA 3F8UA 5E4WA 1OC9B 2F8AA 3CBUA 5LCZA 2N5FA 4EO3A 1N8JA 3J7Yk 3KMOA 2GT5A 2B5YA 4F9ZA 2ES7A 1R5AA 2PBJA 2I4AA 5AISA 3C71A 3EMXA 5D9XA 1LBKA 3OR5A 2WCIA 2VLVA 3F63A 2XBQA 5HFKA 4OWYA 5JWRB 3PINA 4ACSA 4XS4A 2UZ8A 4XHMA 5KOXA 1T8EB 3ZRDA 1SKRB 3CXGA 2K8SA 1NHYA 3VWXA 1YF1A 2FD3A 1FOVA 2VL3A 2B1LA 3F9UA 1GLQA 2TIRA 2ZNMA 1BAYA 2MMOA 2A4HA 1ERWA 2IPAA 3KGKA 5CRWA 2DC5A 1F2EA 3JCML 4GSNA 4DSQA 2C0EA 4V2NA 3MSZA 4BIKA 3O6TA 5IO2A 4AJ6A 1A0FA 1M0UA 4KB3A 5BRTA 1F9MA 2FCHA 2KP1A 1PRXA 4TRXA 1K3YA 3G7JA 3VI5A 3ZIVA 4WXTA 2FWHA 4G9HA 1YJ6A 1OVNA 2DIYA 1AQXA 5B6MA 2H6YA 1DE1A 2KP2A 3GA4A 5D8IA 3AY8A 2H74A 3SWLA 2DMLA 1PFOA 2E2MA 5DAKA 4MDCA 4EVMA 1VF2A 2R6KA 1MD4A 4Z2RA 1J0FA 4JBBA 2O89A 3BCKA 3L9SA 1YQ1A 3GH9A 3M9KA 2E7PA 5D73A 2DMMA 1K3OA 5ECRB 2EIRA 1M2DA 5B7CA 3IV4A 2DIZA 1OC3A 4MF5A 2CZ3A 2H1AA 2R5GA 3ZL5A 3A2VA 4I2TA 3N9JA 4KSMA 3ZFLA 1O8WA 4O5UA 1G0TA 2XC2A 2LNTA 1ST9A 1B9XC 4KCAA 2JADA 4HS1A 2H1GA 2BTOT 3TB2A 1VF3A 3A5WA 1QFNA 1RQMA 3IHGA 2PVOC 5H5SA 5IO0A 2GS3A 2H01A 2RLIA 3LSZA 4OFMA 3CRUA 3F0IA 4MK3A 4G0IA 1K0OA 1QMVA 3KXOA 3ERWA 5F8BA 2DJ3A 2B1KA 1U6TA 4V2LA 5CP1A 2YANA 12GSA 1EV9A 2C1YA 4IP6A 1Y6EA 2O7KA 3IRAA 4HSCX 4KA0A 3EVIA 5HFIA 4MCUA 2F8FA 3UIWA 4RQRA 3F4SA 1S3RA 2A2SA 2WRTA 2R2JA 1J08A 3GHAA 1KBNA 2H66A 4PNGA 1RK4A 2KLXA 4JR6A 5G31A 1HYUA 1ZYQB 2X64A 3IHQA 2CZ2A 3RAZA 2MMAA 3TJFA 1XVWA 5GZZB 2NTOA 10GSA 4Q5FA 3QAVA 1Z6NA 1FVKA 1Q98A 5IMVA 1FW1A 2LUSA 1Z9HA 4TXOA 3F6DA 4RQXA 1AUCA 3APOA 1G7EA 2GDRA 5L71A 2HRNA 2LQQA 4D73B 4IJ3A 4DSRA 3DXBA 1TDIA 4EDZA 1SK1A 1N2AA 2X49A 3L9UA 4K7IA 4K9ZA 1K0CA 1GTAA 1A8YA 3RDWA 5H5QA 4KGIA 2BJXA 3C73A 1TI1A 2RUFA 3FK8A 1CQHA 1WWJA 4KSOA 2I81A 3MNGA 2NBSA 4KF9A 2MBTA 1OAZA 3GURA 4ZL9A 2LS5A 3ERFA 1G6WA 3TRPA 3G7IA 2QKEA 4IHUA 3TOUA 2P31A 3IXRA 3GV1A 2A2RA 5IPGA 4QL7A 1Z7PA 3IBHA 2YWOA 1GTIA 4ZXGA 2H1BA 2DBCA 4KDYA 1U3AA 2RM5A 3GL5A 2DLXA 2H8LA 1YDKA 2C0FA 2MYGA 4MH2A 4L5OA 4YQMA 5GSSA 4IS0A 4GLTA 5EY6A 4K0GA 3P8WA 4IW9A 3GH6A 1W4VA 1NSWA 1Z3EA 4I8BA 1V2AA 1FVJA 4TOPA 3ISOA 4NWYA 4HEA2 4O92A 2PUKC 1TTZA 3FR6A 3KP9A 5JCUA 4BVYB 2VOCA 1ZOFA 1J9BA 1USBA 1PKWA 2KUCA 1DUGA 1GULA 1V40A 4OO4A 4EUYA 4JU5A 5J4UA 1BX9A 1GL8A 1XWKA 2GSTA 1TK0B 2R0GA 3FEUA 5DQYA 1S3AA 4YKGA 2JU5A 3V1WA 3LXZA 5A5KA 1R7HA 2F51A 2FA8A 4OFNA 3GNJA 1PL2A 1SYRA 1TRUA 3VK9A 1B8XA 1S3DA 1GSEA 3TUEA 2VLUA 4K8MA 1YKAA 2VL2A 4HOJA 3DMLA 1XOBA 2HSMA 2YJ7A 5CREA 4FYBA 5CYYA 1A0RP 3GKXA 5HFGA 5HR3A 1ERTA 2OBKA 3R3EA 3WGXA 1HQOA 1XBSA 4OO5A 2CVKA 1BQ7A 3E0UA 4RI6A 4TR3A 2M80A 2V2GA 1M2BA 2HSHA 2GSQA 2DJ2A 2ZUPA 4GF0A 4DSSB 5KN1A 3VFIA 2XPEA 3LW9A 3RPPA 4WETA 3QOUA 2WB9A 3GTUB 2TRCP 2HZEA 3BD2A 1JLWA 3IC4A 1GUMA 1WRYA 3L0HA 5D93A 4NHWA 4MH3A 1QXHA 1E6BA 5KN0A 1SL2B 4ML1A 4PX1A 4F82A 1UVZA 4IELA 4K7NA 1GSSA 2GQLA 4WKWA 5EL8A 2HRFA 2CX3A 2P5QA 1XOAA 4HJ2A 3DVXA 3VWUA 1B48A 4H86A 1OYJA 3DYRA 6GSVA 2I3YA 4IP1A 1ZL9A 5IMZA 3FYGA 3DIEA 2OADA 1M3JA 2D2ZA 1M99A 2X8HA 4RI7A 1SL0B 2FWGA 4BA7A 2HNLA 3ZYWA 1VF4A 5GAPD 1GSFA 2CA8A 3ZZXA 3M9JA 4FYCA 5IIZA 4J2FA 1OC9A 2PPTA 3BOAA 5G1LA 5IQYA 2G0FA 5CRGA 3QD9A 1GTUA 1SD9A 2DJJA 4BL7B 3QFAC 1OE7A 4MJBA 3P2AA 1Z5YE 4ZL8A 4EF0A 4O7HA 5DALA 3TJGA 19GSA 2PWJA 4MA9A 3IR4A 1Y25A 2GZYA 3UJ1A 2DJKA 1R4WA 4QL9A 5IOXA 4ICYA 3VWVA 5KN2A 2HRKA 5IMDA 2PU9C 3KTLA 2REMA 5IM9A 3FR3A 2KOKA 1K0DA 4G0LA 1TP9A 2L4QA 3KZQA 2YWNA 4G19A 1IYHA 1BJXA 4Q5RA 1SKSB 2X4AA 5FHIA 1AIUA 5CAXA 1ILOA 1A8LA 1FG4A 2AB6A 1TXXA 1BG5A 3KMNA 1XFLA 1FB0A 4KNDA 3KEBA 2JSZA 2PVQA 2L57A 1SJIA 1RW1A 4PNFA 3CSHA 4WEYA 4POBA 1M9BA 3S9FA 1I9DA 4HQZA 2WZ9A 3QPMA 1X5CA 1QK8A 3VPQA 2JACA 3U5RE 5HQPA 1GNEA 3NIVA 2ALBA 3ZFBA 4PXOA 2LJRA 3QFBC 2GQMA 5ABRA 4ULXA 3FW2A 1XWCA 4I6XA 3CYNA 2AV4A 3EINA 2FA4A 5D9TA 4KH7A 4ZBAA 2FGXA 1THXA 1FHEA 1SL1B 1TRVA 2LJKA 4N0VA 1XG8A 3TKPA 1U87A 1ZCPA 4NHZA 4XS1A 3TCOA 5DBQA 4K0NA 4ZB8A 4JZQA 3GSTA 3UBKA 1OKTA 6GSXA 4CW9A 1O81A 1QGVA 5A4UA 4O5RA 4YAPA 2HE3A 3K8NA 3GX0A 3GMFA 4MPGA 1R5PA 3DD3A 1ML6A 1SD8A 2H76A 4K2XA 1OE8A 3D21A 1SYXA 1TI3A 4KE3A 5AIXA 3R2QA 1X9SB 1B9YC 3L78A 4BVXB 1MDIA 3P7XA 3US3A 3KH7A 2IFQA 5HR2A 1TJDA 5G2ZA 3H79A 4XRDA 4Q5NA 3EURA 3EE2A 2I1UA 1YKCA 2VIMA 4GQCA 1HNAA 2O85A 5JWQB 3TKQA 2IMKA 4GRFA 3ZVJD 3NZNA 4JE1A 1PN9A 2WDUA 5ECKB 3CMIA 3RHCA 3HKRA 5G5FA 1X0RA 3CQFA 2C3QA 2LEGA 2CT6A 5CRDA 3APQA 2IMEA 4MZWA 1PGTA 4K5SA 3HXSA 4MABA 1O7UA 4HUAA 2M46A 4BPYA 3C1SA 3GRXA 5IOWA 5AGYA 2YP6A 2XPDA 4Z2UA 2YJHA 1GUKA 1ZGNA 1F6MC 2VM1A 3QMXA 5ECSA 5G30A 1FAAA 3TRXA 3ZITA 6GSTA 4EIQA 8GSSA 4YQUA 2AAWA 3LYPA 5ECLB 2L4CA 4TR1A 1T1VA 4K6XA 1EWXA 5BMUA 2GZPA 2LQOA 4HDEA 17GSA 5D96A 2L59A 3GIXA 2WULA 5DCHA 5KEJA 4ID0A 1H4OA 1XZOA 3G9BA 4V1Ag 4J56E 1HNBA 1JZWA 3GL3A 2R4VA 3F3RA 1ERUA 2WFCA 3IAS2 3M1GA 3APSA 2IMIA 5HR1A 4WF4A 1OKDA 2ZCTA 2HFDA 5DJLA 2CVBA 3HA9A 1UA5A 4MF7A 4XS6A 2C4JA 1ON4A 4F03A 2H30A 4ZBBA 1A2MA 2QC7A 1O73A 3TJBA 1K0BA 4AGSA 4EE0A 1GNWA 4IQAA 2VCWA 4LL4B 2C3TA 5B8AA 2YOIA 2VCXA 5J3RA 4KX4A 3N5OA 4KDUA 4K1FA 4I2UA 2IMFA 4WF5A 4ZILA 1KNGA 3QAGA 4POKA 3GKNA 2L5OA 1OC8A 5ID2B 2GVPA 3IAM2 2B3SA 4HZ4A 2C3NA 3TGZA 5DCGA 4PGTA 4V2MA 1QUWA 5A4WA 4TVEA 2B7KA 2H72A 4MF6A 4OFTA 3W8JA 2I9HA 6GSUA 4BVYA 4V1Ap 2RIIA 2Z9SA 3LFLA 4ZB9A 1SU9A 5ECMB 3EMPA 2N5BA 3LQ7A 2FWEA 2HSYA 1O85A 4L8EA 4MLYA 4AJ8A 4ECJA 4AJ7A 6GSSA 3G7YA 3I6AA 1KEBA 2H19A 2VCQA 3HHVA 3IOSA 3TKSC 2X8CA 1YF0A 3FZ5A 1W89A 2GLRA 3NOFA 1O8XA 4IN0A 3VURA 1V58A 3FZAA 4QQ7A 4LLRA 4GWRA 4DEJA 5DJMA 1MDKA 3F4TA 3LEFA 4LMWA 3ZLPA 4YAVA 3F3QA 11GSA 3D5JA 3ED3A 3I43A 2LSTA 5IMFA 2OBIA 1MTCA 4TKYA 1PL1A 4NPBA 2VD0A 4EIPA 3FMWA 4KDXA 4GSTA 3TRQA 1M7TA 2NPBA 2YZUA 5F05A 3H93A 3HY2A 4O5QA 1XXUA 2DJ0A 4DSSA 1ZYPA 2VUPA 2EIQA 1TRSA 4K2DA 1WMJA 3GTUA 4ML6A 2GQKA 4ILFA 2VL9A 3TKRA 2IJYA 4OMVA 3TJJA 1GP1A 1M2AA 3TJKA 5G1KA 1WJKA 4BWQA 4K5RA 1YEXA 2G2QA 1GH2A 2QA1A 1SJZA 1WIKA 9GSSA 4MMMA 5J9CA 3IDVA 4ISDA 1WOUA 2OA7A 3RPNA 1PA3A 4HI7A 5KN3A 1NW2A 4I97A 5J9BA 2PMTA 4YKFA 4EKZA 1UN2A 1IYIA 13GSA 3BBYA 1E2YA 3EPTA 1XCCA 3HVSA 4GQFA 5KOWA 3FKFA 3M3MA 4NV2A 2VCZA 2R0CA 4WBJA 2DKHA 4ECIA 1X5DA 4MZBA 3DKSA 4OCFA 1AXDA 2YNXA 4XRAA 2JZRA 1YEPA 3D6IA 2MZCA 2GSSA 3EWLA 3A2XA 3VPTA 2DKIA 3A5IA 3D4TA 1QQ2A 4GCIA 4OD7A 4BL7A 2JSYA 4MJEA 3HZ4A 4X1UA 4GSSA 1JZDA 4BWSA 1LJRA 4NMUA 4TR0A 3EU4A 3ZIJA 5GAND 2GTUA 5IPHA 1A23A 1EV4A 1GSQA 3CTFA 2K8VA 2DSAA 4PUAA 1SENA 2J23A 3H4KA 4TXVA 5ECOB 2R3XA 1K0MA 3LJRA 1ZYNA 4KUNA 3PPUA 1NHOA 4USSA 4X43A 1SKWB 1K0AA 4TR4A 1XIYA 2F9SA 1YY7A 2L6CA 3KD0A 5F0GA 4G0KA 5DQSA 2X99A 2HT9A 1Z6MA 4ZIJA 2HLSA 3HJOA 3MWHA 1MEKA 1LU4A 2R0PA 2M72A 5FT3A 14GSA 3BJ5A 3F4RA 4JEDA 2LV3A 4EL1A 2NDOA 3QDNA 2B7JA 2E2GA 2CAIA 3HYPA 2LRCA 3L9VA 3H8QA 1EEMA 4KCEA 4IQ1A 5IMAA 1TK5B 6GSYA 3FZ9A 2AUVA 3QR6A 2EIOA 3HD5A 3CRTA 1ABAA 18GSA 2MMNA 4E8HA 1AC1A 3UMAA 3F6FA 1PN0A 5LNKe 3LYKA 4CY8A 16GSA 2F3MA 3RHBA 3WD6A 5DALB 3C8EA 4MJAA 2A2PA 3TKSA 4IGJA 2CX4A 5H5RA 1GTBA 3PGTA 3Q18A 1FO5A 2VCTA 1MD3A 2L5LA 4LL1B 2OACA 3LWAA 4WR5A 2P5RA 2AJQB 1HNCA 3I9V2 4EXJA 1PQNA 4P3YB 3TDGA 2L6DA 4ECBA 3FRCA 1DSBA 3J7Yb 4LMVA 3FR9A 4WBRD 2OE1A 1TU8A 5C00A 1A2LA 5G5EA 2YWIA 1GSYA 2HYXA 4FH8A 1AQWA 3DWVA 3E3EA 1EP8A 4XS4B 1AQVA 2JZSA 3HCZA 5B8BA 4BVXA 2DJ1A 1PD21 3WT1A 3IPZA 5HR0A 2FUG2 2ON5A 4E8EA 3ZREA 1AAZA 3HVXA 3KJYA 4KW6A 2GT6A 4N30A 3PR8A 2YV7A 4PQ1A 2RUEA 2TRXA 2O8VB 4Z7XA 1EGRA 2YV9A 3UVHA 3QAWA 3HVNA 1EOHA 1FOHA 1XWBA 1GWCA 2RM6A 2AHEA 1S3CA 2H75A 5DVBA 1XWGA 2QGVA 1NM3A 1PX7A 3I69A 1XW9A 2PGTA 3M0FA 2VL2C 1A24A 3W6GA 3IE3A 2H0IA 2IL3A 3Q6OA 1GSDA 4X0XA 1BYEA 2GSRA 2YN1A 3WGEA 2MBSA 1THOA 1H75A 4IJIA 3ZMLA 2JZTA 1M3IA 1Z7RA 5DAKB 3D4MA 3FZ4A 5A4VA 3GFKA 1JLVA 1WE0A 3IK7A 3WYWA 3ZTLA 3VWWA 3Q74A 1XPVA 3D0ZA 1EP7A 3O3TA 3H1NA 5JWOB 2H70A 2K18A 5F07A 1R26A 1K0NA 4ZBDA 2V1MA 2OE0A 1XVQA 2CVDA 2K9FA 1A2JA 7GSSA 2LRNA 2VCVA 4HJMA 1F3AA 1XW6A 4XCSA 4TN8A 4D73A 2HZFA 1T00A 1I5GA 2C0DA 4NXIA 2C0GA 1V9WA 1EZKA 2IFQB 3MAKA 2E0QA 1O6JA 2V6KA 4L5LA 3A2WA 3IA1A 1ZZYA 3GYKA 4K7OA 1T7PB 2GGTA 2H6ZA 4F0CA 4POMA 1HD2A 3D22A 3KH9A 3UARA 1U3IA 1TW9A 2FLSA 3KCMA 3TKSE 5AIVA 1VF1A 4MP4A 1GLPA 4F2IA 1UC7A 5GSTA 5ID2A 3ZVJA 3MIXA 2FNOA 3ME7A 2QA2A 3C1RA 6GSWA 4N11A 1TKDB 2WGRA 3HDCA 5IMCA 4N0ZA 1K3LA 2CAQA 5CO3A 4X4JA 3WGDA 4PUFC 2PERA 4IKHA 1PX6A 5F06A 3UAPA 4TW5A 2V41A 5ELGA 4POLA 4MJCA 1M9AA 1ACVA 4G2EA 1T4ZA 1AW9A 2YPMA 5ECPB 4TR1B 5J5NA 4AF2A 3TOTA 2WJUA 1ERVA 4N10A 4ECCA 1VGLA 3EC3A 1PSQA 3ERGA 4JR4A 2XHFA 1GRXA 4FO5A 5COHA 4I5QA 3C7MA 4PURA 3VI7A 2FY6A 2P0GA 4TXOB 3RBTA 1JZRA 3UEMA 2C8UA 1SK2A 3GKKA 2H71A 1X9WB 1EOGA 3LG6A 3L4NA 1WP0A 4HU7A 2LRTA 1URMA 2AYTA 1X9MB 2OKAA 4LA1A 4HQSA 4PTSA 1JHBA 3UBLA 4CDOA 4DVCA 2KHPA 3CTGA 5LD0A 1V57A 2QSIA 2H0HA 2HI7A 1T3BA 2LNSA 2H1DA 1GUHA 3ME8A 5EVOA 4L0UA 2IMDA 4L0WA 5B6NA 4IBPA 4F0BA 4A5PA 2HRAA 4WR4A 5E59A 1VRSD 4J57E 3BCIA 4HZ2A 3GX8A 1CQGA 4EC0A 5CRHA 2VD1A 4ZB6A 1PMTA 20GSA 5ECIB 1DBYA 1BEDA 2X8GA 1T4YA 3SBCA 1KTEA 4FYUA 2V6OA
chains in the Genus database with same CATH topology
3HJMA 4FQUA 4FIWA 1C72A 1SJ6A 3M8NA 4Q5QA 2VM2A 2BMXA 3O76A 4CHSA 1F3BA 2EC4A 3U6VA 3GSSA 4ZL7A 3ZMKA 1YZXA 4G10A 1FB6A 1F37A 5J41A 1TU7A 1EEJA 3KTBA 4MZCA 22GSA 1ZMAA 5ECQB 4Z2TA 3E9JB 3QCPA 2O87A 1TRWA 2PN8A 5ENUA 1WPIA 2B6MA 4XIHA 2CV4A 3Q19A 5DDLA 4JRRA 1DE2A 1G6YA 2YZHA 2IIYA 2R37A 2HXKA 1U88A 3HVVA 3GUSA 2XBIA 2H73A 2IWTA 3KP8A 3PH9A 4HU9A 4PQIA 3LXTA 4EDYA 1XWAA 2GZZA 2N5AA 1TOFA 4YH2A 3CSJA 3KM6A 3EU3A 5ECHB 1V98A 2K6VA 1Q4JA 2B5XA 5FWGA 3A3TA 2NVLA 3MDKA 1SK0A 4NV5A 5C04A 2LJAA 3KIJA 2YWMA 2CQ9A 3LGCA 2FHEA 2VO4A 2VLTA 5ECNB 4RUVA 3GKMA 3DRNA 5JCWA 5D9VA 1ZYEA 3HJPA 3P90A 3UL3A 2LKUA 2FWFA 2C80A 3HZ8A 2WS2A 2LTKA 3LORA 1JZOA 3MYDA 4IVFA 3CSIA 4MNNA 2IN3A 3DGQA 3IK9A 4XTSA 1MDJA 2B5EA 4OCEA 5EPFA 3EYTA 1XW5A 2HZEB 1GSUA 2MMZA 4NAXA 4CY6A 1X5EA 1G7OA 1PKZA 4MPFA 5INYA 3FHKA 5AN1A 3VLNA 2VAFA 3DVWA 1TK8B 2OE3A 4PQHA 3IC8A 5D9WA 1EGOA 3W8SA 3UVTA 4GTUA 1B4QA 4KAEA 3FY7A 2V32A 5JCGA 2YCDA 2JL4A 1JFUA 2OJLA 2H0GA 3UOMA 4O32A 3WT2A 2ON7A 2A4VA 2H6XA 2J9HA 5ELAA 5CNWA 3GN3A 4YQVA 3DEXA 4GXZA 1B4PA 3F8UA 5E4WA 1OC9B 2F8AA 3CBUA 5LCZA 2N5FA 4EO3A 1N8JA 3J7Yk 3KMOA 2GT5A 2B5YA 4F9ZA 2ES7A 1R5AA 2PBJA 2I4AA 5AISA 3C71A 3EMXA 5D9XA 1LBKA 3OR5A 2WCIA 2VLVA 3F63A 2XBQA 5HFKA 4OWYA 5JWRB 3PINA 4ACSA 4XS4A 2UZ8A 4XHMA 5KOXA 1T8EB 3ZRDA 1SKRB 3CXGA 2K8SA 1NHYA 3VWXA 1YF1A 2FD3A 1FOVA 2VL3A 2B1LA 3F9UA 1GLQA 2TIRA 2ZNMA 1BAYA 2MMOA 2A4HA 1ERWA 2IPAA 3KGKA 5CRWA 2DC5A 1F2EA 3JCML 4GSNA 4DSQA 2C0EA 4V2NA 3MSZA 3O6TA 5IO2A 4AJ6A 1A0FA 1M0UA 4KB3A 5BRTA 1F9MA 2FCHA 2KP1A 1PRXA 4TRXA 1K3YA 3G7JA 3VI5A 3ZIVA 4WXTA 2FWHA 4G9HA 1YJ6A 1OVNA 2DIYA 1AQXA 5B6MA 2H6YA 1DE1A 2KP2A 3GA4A 5D8IA 3AY8A 2H74A 3SWLA 2DMLA 2E2MA 5DAKA 4MDCA 4EVMA 1VF2A 2R6KA 1MD4A 4Z2RA 1J0FA 4JBBA 2O89A 3BCKA 3L9SA 1YQ1A 3GH9A 3M9KA 2E7PA 5D73A 2DMMA 1K3OA 5ECRB 2EIRA 1M2DA 5B7CA 3IV4A 2DIZA 1OC3A 4MF5A 2CZ3A 2H1AA 2R5GA 3ZL5A 3A2VA 4I2TA 3N9JA 4KSMA 3ZFLA 1O8WA 4O5UA 1G0TA 2XC2A 2LNTA 1ST9A 1B9XC 4KCAA 2JADA 4HS1A 2H1GA 2BTOT 3TB2A 1VF3A 3A5WA 1QFNA 1RQMA 3IHGA 2PVOC 5H5SA 5IO0A 2GS3A 2H01A 2RLIA 3LSZA 4OFMA 3CRUA 3F0IA 4MK3A 4G0IA 1K0OA 1QMVA 3KXOA 3ERWA 5F8BA 2DJ3A 2B1KA 1U6TA 4V2LA 5CP1A 2YANA 12GSA 1EV9A 2C1YA 4IP6A 1Y6EA 2O7KA 3IRAA 4KA0A 3EVIA 5HFIA 4MCUA 2F8FA 3UIWA 4RQRA 3F4SA 2A2SA 2WRTA 2R2JA 1J08A 3GHAA 1KBNA 2H66A 4PNGA 1RK4A 2KLXA 4JR6A 5G31A 1HYUA 1ZYQB 2X64A 3IHQA 2CZ2A 3RAZA 2MMAA 3TJFA 1XVWA 5GZZB 2NTOA 10GSA 4Q5FA 3QAVA 1Z6NA 1FVKA 1Q98A 5IMVA 1FW1A 2LUSA 1Z9HA 4TXOA 3F6DA 4RQXA 1AUCA 3APOA 1G7EA 2GDRA 5L71A 2HRNA 2LQQA 4D73B 4IJ3A 4DSRA 3DXBA 1TDIA 4EDZA 1SK1A 1N2AA 2X49A 3L9UA 4K7IA 4K9ZA 1K0CA 1GTAA 1A8YA 3RDWA 5H5QA 4KGIA 2BJXA 3C73A 1TI1A 2RUFA 3FK8A 1CQHA 1WWJA 4KSOA 2I81A 3MNGA 2NBSA 4KF9A 2MBTA 1OAZA 3GURA 4ZL9A 2LS5A 3ERFA 1G6WA 3TRPA 3G7IA 2QKEA 4IHUA 3TOUA 2P31A 3IXRA 3GV1A 2A2RA 5IPGA 4QL7A 1Z7PA 3IBHA 2YWOA 1GTIA 4ZXGA 2H1BA 2DBCA 4KDYA 1U3AA 2RM5A 3GL5A 2DLXA 2H8LA 1YDKA 2C0FA 2MYGA 4MH2A 4L5OA 4YQMA 5GSSA 4IS0A 4GLTA 5EY6A 4K0GA 3P8WA 4IW9A 3GH6A 1W4VA 1NSWA 1Z3EA 4I8BA 1V2AA 1FVJA 4TOPA 3ISOA 4NWYA 4HEA2 4O92A 2PUKC 1TTZA 3FR6A 3KP9A 5JCUA 4BVYB 2VOCA 1ZOFA 1J9BA 1USBA 1PKWA 2KUCA 1DUGA 1GULA 1V40A 4OO4A 4EUYA 4JU5A 5J4UA 1BX9A 1GL8A 1XWKA 2GSTA 1TK0B 2R0GA 3FEUA 5DQYA 1S3AA 4YKGA 2JU5A 3V1WA 3LXZA 5A5KA 1R7HA 2F51A 2FA8A 4OFNA 3GNJA 1PL2A 1SYRA 1TRUA 3VK9A 1B8XA 1S3DA 1GSEA 3TUEA 2VLUA 4K8MA 1YKAA 2VL2A 4HOJA 3DMLA 1XOBA 2HSMA 2YJ7A 5CREA 4FYBA 5CYYA 1A0RP 3GKXA 5HFGA 5HR3A 1ERTA 2OBKA 3R3EA 3WGXA 1HQOA 1XBSA 4OO5A 2CVKA 1BQ7A 3E0UA 4RI6A 4TR3A 2M80A 2V2GA 1M2BA 2HSHA 2GSQA 2DJ2A 2ZUPA 4GF0A 4DSSB 5KN1A 3VFIA 2XPEA 3LW9A 3RPPA 4WETA 3QOUA 2WB9A 3GTUB 2TRCP 2HZEA 3BD2A 1JLWA 3IC4A 1GUMA 1WRYA 3L0HA 5D93A 4NHWA 4MH3A 1QXHA 1E6BA 5KN0A 1SL2B 4ML1A 4PX1A 4F82A 1UVZA 4IELA 4K7NA 1GSSA 2GQLA 4WKWA 5EL8A 2HRFA 2CX3A 2P5QA 1XOAA 4HJ2A 3DVXA 3VWUA 1B48A 4H86A 1OYJA 3DYRA 6GSVA 2I3YA 4IP1A 1ZL9A 5IMZA 3FYGA 3DIEA 2OADA 2D2ZA 1M99A 2X8HA 4RI7A 1SL0B 2FWGA 4BA7A 2HNLA 3ZYWA 1VF4A 5GAPD 1GSFA 2CA8A 3ZZXA 3M9JA 4FYCA 5IIZA 4J2FA 1OC9A 2PPTA 3BOAA 5G1LA 5IQYA 2G0FA 5CRGA 3QD9A 1GTUA 1SD9A 2DJJA 4BL7B 3QFAC 1OE7A 4MJBA 3P2AA 1Z5YE 4ZL8A 4EF0A 4O7HA 5DALA 3TJGA 19GSA 2PWJA 4MA9A 3IR4A 1Y25A 2GZYA 3UJ1A 2DJKA 1R4WA 4QL9A 5IOXA 4ICYA 3VWVA 5KN2A 2HRKA 5IMDA 2PU9C 3KTLA 2REMA 5IM9A 3FR3A 2KOKA 1K0DA 4G0LA 1TP9A 2L4QA 3KZQA 2YWNA 4G19A 1IYHA 1BJXA 4Q5RA 1SKSB 2X4AA 5FHIA 1AIUA 5CAXA 1ILOA 1A8LA 1FG4A 2AB6A 1TXXA 1BG5A 3KMNA 1XFLA 1FB0A 4KNDA 3KEBA 2JSZA 2PVQA 2L57A 1SJIA 1RW1A 4PNFA 3CSHA 4WEYA 4POBA 1M9BA 3S9FA 1I9DA 4HQZA 2WZ9A 3QPMA 1X5CA 1QK8A 3VPQA 2JACA 3U5RE 5HQPA 1GNEA 3NIVA 2ALBA 3ZFBA 4PXOA 2LJRA 3QFBC 2GQMA 5ABRA 4ULXA 3FW2A 1XWCA 4I6XA 3CYNA 2AV4A 3EINA 2FA4A 5D9TA 4KH7A 4ZBAA 2FGXA 1THXA 1FHEA 1SL1B 1TRVA 2LJKA 4N0VA 3TKPA 1U87A 1ZCPA 4NHZA 4XS1A 3TCOA 5DBQA 4K0NA 4ZB8A 4JZQA 3GSTA 3UBKA 1OKTA 6GSXA 4CW9A 1O81A 1QGVA 5A4UA 4O5RA 4YAPA 2HE3A 3K8NA 3GX0A 3GMFA 4MPGA 1R5PA 3DD3A 1ML6A 1SD8A 2H76A 4K2XA 1OE8A 3D21A 1SYXA 1TI3A 4KE3A 5AIXA 3R2QA 1X9SB 1B9YC 3L78A 4BVXB 1MDIA 3P7XA 3US3A 3KH7A 2IFQA 5HR2A 1TJDA 5G2ZA 3H79A 4XRDA 4Q5NA 3EURA 3EE2A 2I1UA 1YKCA 2VIMA 4GQCA 1HNAA 2O85A 5JWQB 3TKQA 2IMKA 4GRFA 3ZVJD 3NZNA 4JE1A 1PN9A 2WDUA 5ECKB 3CMIA 3RHCA 3HKRA 5G5FA 1X0RA 2C3QA 2LEGA 2CT6A 5CRDA 3APQA 2IMEA 4MZWA 1PGTA 4K5SA 3HXSA 4MABA 1O7UA 4HUAA 2M46A 4BPYA 3C1SA 3GRXA 5IOWA 5AGYA 2YP6A 2XPDA 4Z2UA 2YJHA 1GUKA 1ZGNA 1F6MC 2VM1A 3QMXA 5ECSA 5G30A 1FAAA 3TRXA 3ZITA 6GSTA 4EIQA 8GSSA 4YQUA 2AAWA 3LYPA 5ECLB 2L4CA 4TR1A 1T1VA 4K6XA 1EWXA 5BMUA 2GZPA 2LQOA 4HDEA 17GSA 5D96A 2L59A 3GIXA 2WULA 5DCHA 5KEJA 4ID0A 1H4OA 1XZOA 3G9BA 4V1Ag 4J56E 1HNBA 1JZWA 3GL3A 2R4VA 3F3RA 1ERUA 2WFCA 3IAS2 3M1GA 3APSA 2IMIA 5HR1A 4WF4A 1OKDA 2ZCTA 2HFDA 5DJLA 2CVBA 3HA9A 1UA5A 4MF7A 4XS6A 2C4JA 1ON4A 4F03A 2H30A 4ZBBA 1A2MA 2QC7A 1O73A 3TJBA 1K0BA 4AGSA 4EE0A 1GNWA 4IQAA 2VCWA 4LL4B 2C3TA 5B8AA 2YOIA 2VCXA 5J3RA 4KX4A 3N5OA 4KDUA 4K1FA 4I2UA 2IMFA 4WF5A 4ZILA 1KNGA 3QAGA 4POKA 3GKNA 2L5OA 1OC8A 5ID2B 2GVPA 3IAM2 2B3SA 4HZ4A 2C3NA 3TGZA 5DCGA 4PGTA 4V2MA 1QUWA 5A4WA 4TVEA 2B7KA 2H72A 4MF6A 4OFTA 3W8JA 2I9HA 6GSUA 4BVYA 4V1Ap 2RIIA 2Z9SA 3LFLA 4ZB9A 1SU9A 5ECMB 3EMPA 2N5BA 3LQ7A 2FWEA 2HSYA 1O85A 4L8EA 4MLYA 4AJ8A 4ECJA 4AJ7A 6GSSA 3G7YA 3I6AA 1KEBA 2H19A 2VCQA 3HHVA 3IOSA 3TKSC 2X8CA 1YF0A 3FZ5A 1W89A 2GLRA 3NOFA 1O8XA 4IN0A 3VURA 1V58A 3FZAA 4QQ7A 4LLRA 4GWRA 4DEJA 5DJMA 1MDKA 3F4TA 3LEFA 4LMWA 3ZLPA 4YAVA 3F3QA 11GSA 3D5JA 3ED3A 3I43A 2LSTA 5IMFA 2OBIA 1MTCA 4TKYA 1PL1A 4NPBA 2VD0A 4EIPA 3FMWA 4KDXA 4GSTA 3TRQA 1M7TA 2NPBA 2YZUA 5F05A 3H93A 3HY2A 4O5QA 1XXUA 2DJ0A 4DSSA 1ZYPA 2VUPA 2EIQA 1TRSA 4K2DA 1WMJA 3GTUA 4ML6A 2GQKA 4ILFA 2VL9A 3TKRA 2IJYA 4OMVA 3TJJA 1GP1A 1M2AA 3TJKA 5G1KA 1WJKA 4BWQA 4K5RA 1YEXA 2G2QA 1GH2A 2QA1A 1SJZA 1WIKA 9GSSA 4MMMA 5J9CA 3IDVA 4ISDA 1WOUA 2OA7A 3RPNA 1PA3A 4HI7A 5KN3A 1NW2A 4I97A 5J9BA 2PMTA 4YKFA 4EKZA 1UN2A 1IYIA 13GSA 3BBYA 1E2YA 3EPTA 1XCCA 3HVSA 4GQFA 5KOWA 3FKFA 3M3MA 4NV2A 2VCZA 2R0CA 4WBJA 2DKHA 4ECIA 1X5DA 4MZBA 3DKSA 4OCFA 1AXDA 2YNXA 4XRAA 2JZRA 1YEPA 3D6IA 2MZCA 2GSSA 3EWLA 3A2XA 3VPTA 2DKIA 3A5IA 3D4TA 1QQ2A 4GCIA 4OD7A 4BL7A 2JSYA 4MJEA 3HZ4A 4X1UA 4GSSA 1JZDA 4BWSA 1LJRA 4NMUA 4TR0A 3EU4A 3ZIJA 5GAND 2GTUA 5IPHA 1A23A 1EV4A 1GSQA 3CTFA 2K8VA 2DSAA 4PUAA 1SENA 2J23A 3H4KA 4TXVA 5ECOB 2R3XA 1K0MA 3LJRA 1ZYNA 4KUNA 3PPUA 1NHOA 4USSA 4X43A 1SKWB 1K0AA 4TR4A 1XIYA 2F9SA 1YY7A 2L6CA 3KD0A 5F0GA 4G0KA 5DQSA 2X99A 2HT9A 1Z6MA 4ZIJA 2HLSA 3HJOA 3MWHA 1MEKA 1LU4A 2R0PA 2M72A 5FT3A 14GSA 3BJ5A 3F4RA 4JEDA 2LV3A 4EL1A 2NDOA 3QDNA 2B7JA 2E2GA 2CAIA 3HYPA 2LRCA 3L9VA 3H8QA 1EEMA 4KCEA 4IQ1A 5IMAA 1TK5B 6GSYA 3FZ9A 2AUVA 3QR6A 2EIOA 3HD5A 3CRTA 1ABAA 18GSA 2MMNA 4E8HA 1AC1A 3UMAA 3F6FA 1PN0A 5LNKe 3LYKA 4CY8A 16GSA 2F3MA 3RHBA 3WD6A 5DALB 3C8EA 4MJAA 2A2PA 3TKSA 4IGJA 2CX4A 5H5RA 1GTBA 3PGTA 3Q18A 1FO5A 2VCTA 1MD3A 2L5LA 4LL1B 2OACA 3LWAA 4WR5A 2P5RA 2AJQB 1HNCA 3I9V2 4EXJA 1PQNA 4P3YB 3TDGA 2L6DA 4ECBA 3FRCA 1DSBA 3J7Yb 4LMVA 3FR9A 4WBRD 2OE1A 1TU8A 5C00A 1A2LA 5G5EA 2YWIA 1GSYA 2HYXA 4FH8A 1AQWA 3DWVA 3E3EA 1EP8A 4XS4B 1AQVA 2JZSA 3HCZA 5B8BA 4BVXA 2DJ1A 1PD21 3WT1A 3IPZA 5HR0A 2FUG2 2ON5A 4E8EA 3ZREA 1AAZA 3HVXA 3KJYA 4KW6A 2GT6A 4N30A 3PR8A 2YV7A 4PQ1A 2RUEA 2TRXA 2O8VB 4Z7XA 1EGRA 2YV9A 3UVHA 3QAWA 1EOHA 1FOHA 1XWBA 1GWCA 2RM6A 2AHEA 1S3CA 2H75A 5DVBA 1XWGA 2QGVA 1NM3A 1PX7A 3I69A 1XW9A 2PGTA 3M0FA 2VL2C 1A24A 3W6GA 3IE3A 2H0IA 2IL3A 3Q6OA 1GSDA 4X0XA 1BYEA 2GSRA 2YN1A 3WGEA 2MBSA 1THOA 1H75A 4IJIA 3ZMLA 2JZTA 1Z7RA 5DAKB 3D4MA 3FZ4A 5A4VA 3GFKA 1JLVA 1WE0A 3IK7A 3WYWA 3ZTLA 3VWWA 3Q74A 1XPVA 3D0ZA 1EP7A 3O3TA 3H1NA 5JWOB 2H70A 2K18A 5F07A 1R26A 1K0NA 4ZBDA 2V1MA 2OE0A 1XVQA 2CVDA 2K9FA 1A2JA 7GSSA 2LRNA 2VCVA 4HJMA 1F3AA 1XW6A 4XCSA 4TN8A 4D73A 2HZFA 1T00A 1I5GA 2C0DA 4NXIA 2C0GA 1V9WA 1EZKA 2IFQB 3MAKA 2E0QA 1O6JA 2V6KA 4L5LA 3A2WA 3IA1A 1ZZYA 3GYKA 4K7OA 1T7PB 2GGTA 2H6ZA 4F0CA 4POMA 1HD2A 3D22A 3KH9A 3UARA 1U3IA 1TW9A 2FLSA 3KCMA 3TKSE 5AIVA 1VF1A 4MP4A 1GLPA 4F2IA 1UC7A 5GSTA 5ID2A 3ZVJA 3MIXA 2FNOA 3ME7A 2QA2A 3C1RA 6GSWA 4N11A 1TKDB 2WGRA 3HDCA 5IMCA 4N0ZA 1K3LA 2CAQA 5CO3A 4X4JA 3WGDA 4PUFC 2PERA 4IKHA 1PX6A 5F06A 3UAPA 4TW5A 2V41A 5ELGA 4POLA 4MJCA 1M9AA 1ACVA 4G2EA 1T4ZA 1AW9A 2YPMA 5ECPB 4TR1B 5J5NA 4AF2A 3TOTA 2WJUA 1ERVA 4N10A 4ECCA 1VGLA 3EC3A 1PSQA 3ERGA 4JR4A 2XHFA 1GRXA 4FO5A 5COHA 4I5QA 3C7MA 4PURA 3VI7A 2FY6A 2P0GA 4TXOB 3RBTA 1JZRA 3UEMA 2C8UA 1SK2A 3GKKA 2H71A 1X9WB 1EOGA 3LG6A 3L4NA 1WP0A 4HU7A 2LRTA 1URMA 2AYTA 1X9MB 2OKAA 4LA1A 4HQSA 4PTSA 1JHBA 3UBLA 4CDOA 4DVCA 2KHPA 3CTGA 5LD0A 1V57A 2QSIA 2H0HA 2HI7A 1T3BA 2LNSA 2H1DA 1GUHA 3ME8A 5EVOA 4L0UA 2IMDA 4L0WA 5B6NA 4IBPA 4F0BA 4A5PA 2HRAA 4WR4A 5E59A 1VRSD 4J57E 3BCIA 4HZ2A 3GX8A 1CQGA 4EC0A 5CRHA 2VD1A 4ZB6A 1PMTA 20GSA 5ECIB 1DBYA 1BEDA 2X8GA 1T4YA 3SBCA 1KTEA 4FYUA 2V6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJM A;  4FIW A;  1C72 A;  1SJ6 A;  3M8N A;  4Q5Q A;  2VM2 A;  2BMX A;  3O76 A;  4CHS A;  1F3B A;  2EC4 A;  3U6V A;  3GSS A;  4ZL7 A;  3ZMK A;  1YZX A;  4G10 A;  1FB6 A;  1F37 A;  5J41 A;  1TU7 A;  1EEJ A;  3KTB A;  4MZC A;  22GS A;  1ZMA A;  5ECQ B;  3E9J B;  3QCP A;  2O87 A;  1TRW A;  2PN8 A;  5ENU A;  1WPI A;  2B6M A;  4XIH A;  2CV4 A;  3Q19 A;  5DDL A;  4JRR A;  1DE2 A;  1G6Y A;  2YZH A;  2IIY A;  2R37 A;  2HXK A;  1U88 A;  3HVV A;  3GUS A;  2XBI A;  2H73 A;  2IWT A;  3KP8 A;  3PH9 A;  4HU9 A;  4PQI A;  3LXT A;  4EDY A;  1XWA A;  2GZZ A;  2N5A A;  1TOF A;  4YH2 A;  3CSJ A;  3KM6 A;  3EU3 A;  5ECH B;  1V98 A;  2K6V A;  1Q4J A;  2B5X A;  5FWG A;  3A3T A;  2NVL A;  3MDK A;  1SK0 A;  4NV5 A;  5C04 A;  2LJA A;  3KIJ A;  2YWM A;  2CQ9 A;  3LGC A;  2FHE A;  5ECN B;  2VLT A;  2VO4 A;  4RUV A;  3GKM A;  3DRN A;  5JCW A;  5D9V A;  1ZYE A;  3HJP A;  3P90 A;  3UL3 A;  2LKU A;  2FWF A;  2C80 A;  3HZ8 A;  2WS2 A;  2LTK A;  3LOR A;  1JZO A;  4IVF A;  3CSI A;  2IN3 A;  3DGQ A;  3IK9 A;  4XTS A;  1MDJ A;  2B5E A;  4OCE A;  5EPF A;  3EYT A;  1XW5 A;  2HZE B;  1GSU A;  2MMZ A;  4NAX A;  1X5E A;  1G7O A;  1PKZ A;  4MPF A;  5INY A;  3FHK A;  5AN1 A;  3VLN A;  2VAF A;  3DVW A;  1TK8 B;  2OE3 A;  4PQH A;  5D9W A;  1EGO A;  3W8S A;  3UVT A;  4GTU A;  1B4Q A;  4KAE A;  3FY7 A;  2V32 A;  5JCG A;  2YCD A;  2JL4 A;  1JFU A;  2OJL A;  2H0G A;  3UOM A;  4O32 A;  3WT2 A;  2ON7 A;  2A4V A;  2H6X A;  2J9H A;  5ELA A;  5CNW A;  3GN3 A;  4YQV A;  3DEX A;  4GXZ A;  1B4P A;  3F8U A;  5E4W A;  1OC9 B;  2F8A A;  3CBU A;  5LCZ A;  2N5F A;  4EO3 A;  1N8J A;  3J7Y k;  3KMO A;  2GT5 A;  2B5Y A;  4F9Z A;  2ES7 A;  1R5A A;  2PBJ A;  2I4A A;  5AIS A;  3C71 A;  3EMX A;  5D9X A;  1LBK A;  3OR5 A;  2WCI A;  2VLV A;  3F63 A;  2XBQ A;  5HFK A;  4OWY A;  5JWR B;  3PIN A;  4ACS A;  4XS4 A;  4XHM A;  1T8E B;  3ZRD A;  1SKR B;  3CXG A;  2K8S A;  1NHY A;  3VWX A;  1YF1 A;  2FD3 A;  1FOV A;  2VL3 A;  2B1L A;  3F9U A;  1GLQ A;  2TIR A;  2ZNM A;  1BAY A;  2MMO A;  1ERW A;  2IPA A;  3KGK A;  5CRW A;  2DC5 A;  1F2E A;  3JCM L;  4GSN A;  4DSQ A;  2C0E A;  4V2N A;  3MSZ A;  3O6T A;  5IO2 A;  4AJ6 A;  1A0F A;  1M0U A;  4KB3 A;  1F9M A;  2FCH A;  2KP1 A;  1PRX A;  4TRX A;  1K3Y A;  3G7J A;  3VI5 A;  3ZIV A;  4WXT A;  2FWH A;  4G9H A;  1YJ6 A;  1OVN A;  2DIY A;  1AQX A;  5B6M A;  2H6Y A;  1DE1 A;  2KP2 A;  3GA4 A;  5D8I A;  3AY8 A;  2H74 A;  3SWL A;  2DML A;  2E2M A;  5DAK A;  4MDC A;  4EVM A;  1VF2 A;  2R6K A;  1MD4 A;  1J0F A;  4JBB A;  2O89 A;  3BCK A;  3L9S A;  1YQ1 A;  3GH9 A;  3M9K A;  2E7P A;  5D73 A;  2DMM A;  1K3O A;  5ECR B;  2EIR A;  1M2D A;  5B7C A;  3IV4 A;  2DIZ A;  1OC3 A;  4MF5 A;  2CZ3 A;  2H1A A;  2R5G A;  3ZL5 A;  3A2V A;  4I2T A;  3N9J A;  4KSM A;  3ZFL A;  1O8W A;  1G0T A;  2XC2 A;  2LNT A;  1ST9 A;  1B9X C;  4KCA A;  2JAD A;  4HS1 A;  2H1G A;  2BTO T;  3TB2 A;  1VF3 A;  3A5W A;  1QFN A;  1RQM A;  2PVO C;  5H5S A;  5IO0 A;  2GS3 A;  2H01 A;  2RLI A;  3LSZ A;  4OFM A;  3CRU A;  3F0I A;  4MK3 A;  1K0O A;  1QMV A;  3KXO A;  3ERW A;  5F8B A;  2DJ3 A;  2B1K A;  1U6T A;  4V2L A;  5CP1 A;  2YAN A;  12GS A;  1EV9 A;  2C1Y A;  4IP6 A;  1Y6E A;  2O7K A;  3IRA A;  4KA0 A;  3EVI A;  5HFI A;  4MCU A;  2F8F A;  3UIW A;  4RQR A;  3F4S A;  2A2S A;  2WRT A;  2R2J A;  1J08 A;  3GHA A;  1KBN A;  2H66 A;  4PNG A;  1RK4 A;  2KLX A;  4JR6 A;  5G31 A;  1HYU A;  1ZYQ B;  2X64 A;  3IHQ A;  2CZ2 A;  3RAZ A;  2MMA A;  3TJF A;  1XVW A;  5GZZ B;  2NTO A;  10GS A;  4Q5F A;  3QAV A;  1Z6N A;  1FVK A;  1Q98 A;  5IMV A;  1FW1 A;  2LUS A;  1Z9H A;  4TXO A;  3F6D A;  4RQX A;  1AUC A;  3APO A;  1G7E A;  2GDR A;  5L71 A;  2HRN A;  2LQQ A;  4D73 B;  4IJ3 A;  4DSR A;  3DXB A;  1TDI A;  4EDZ A;  1SK1 A;  1N2A A;  3L9U A;  4K7I A;  4K9Z A;  1K0C A;  1GTA A;  1A8Y A;  3RDW A;  5H5Q A;  4KGI A;  2BJX A;  3C73 A;  1TI1 A;  2RUF A;  3FK8 A;  1CQH A;  1WWJ A;  4KSO A;  2I81 A;  3MNG A;  2NBS A;  2MBT A;  1OAZ A;  3GUR A;  4ZL9 A;  2LS5 A;  3ERF A;  1G6W A;  3TRP A;  3G7I A;  2QKE A;  4IHU A;  3TOU A;  2P31 A;  3IXR A;  3GV1 A;  2A2R A;  5IPG A;  4QL7 A;  1Z7P A;  3IBH A;  2YWO A;  1GTI A;  4ZXG A;  2H1B A;  2DBC A;  4KDY A;  1U3A A;  2RM5 A;  3GL5 A;  2DLX A;  2H8L A;  1YDK A;  2C0F A;  2MYG A;  4MH2 A;  4L5O A;  4YQM A;  5GSS A;  4IS0 A;  4GLT A;  5EY6 A;  4K0G A;  3P8W A;  4IW9 A;  3GH6 A;  1W4V A;  1NSW A;  1Z3E A;  4I8B A;  1V2A A;  1FVJ A;  4TOP A;  3ISO A;  4NWY A;  4HEA 2;  4O92 A;  2PUK C;  1TTZ A;  3FR6 A;  3KP9 A;  5JCU A;  2VOC A;  1ZOF A;  1J9B A;  1USB A;  1PKW A;  2KUC A;  1DUG A;  1GUL A;  1V40 A;  4OO4 A;  4EUY A;  4JU5 A;  5J4U A;  1BX9 A;  1GL8 A;  1XWK A;  2GST A;  1TK0 B;  3FEU A;  5DQY A;  1S3A A;  2JU5 A;  3V1W A;  3LXZ A;  5A5K A;  1R7H A;  2F51 A;  2FA8 A;  4OFN A;  3GNJ A;  1PL2 A;  1SYR A;  1TRU A;  3VK9 A;  1B8X A;  1S3D A;  1GSE A;  3TUE A;  2VLU A;  4K8M A;  1YKA A;  2VL2 A;  4HOJ A;  3DML A;  1XOB A;  2YJ7 A;  5CRE A;  4FYB A;  5CYY A;  1A0R P;  3GKX A;  5HFG A;  5HR3 A;  1ERT A;  2OBK A;  3WGX A;  1HQO A;  1XBS A;  4OO5 A;  2CVK A;  1BQ7 A;  3E0U A;  4RI6 A;  4TR3 A;  2M80 A;  2V2G A;  1M2B A;  2HSH A;  2GSQ A;  2DJ2 A;  2ZUP A;  4GF0 A;  4DSS B;  5KN1 A;  3VFI A;  2XPE A;  3RPP A;  4WET A;  3QOU A;  2WB9 A;  3GTU B;  2TRC P;  2HZE A;  3BD2 A;  1JLW A;  3IC4 A;  1GUM A;  1WRY A;  3L0H A;  5D93 A;  4NHW A;  4MH3 A;  1QXH A;  1E6B A;  5KN0 A;  1SL2 B;  4ML1 A;  4PX1 A;  4F82 A;  1UVZ A;  4IEL A;  4K7N A;  1GSS A;  2GQL A;  4WKW A;  5EL8 A;  2HRF A;  2CX3 A;  2P5Q A;  1XOA A;  4HJ2 A;  3DVX A;  3VWU A;  1B48 A;  4H86 A;  1OYJ A;  3DYR A;  6GSV A;  2I3Y A;  4IP1 A;  1ZL9 A;  5IMZ A;  3FYG A;  3DIE A;  2OAD A;  2D2Z A;  1M99 A;  2X8H A;  4RI7 A;  1SL0 B;  2FWG A;  4BA7 A;  2HNL A;  3ZYW A;  1VF4 A;  5GAP D;  1GSF A;  2CA8 A;  3ZZX A;  3M9J A;  4FYC A;  5IIZ A;  4J2F A;  1OC9 A;  2PPT A;  3BOA A;  5G1L A;  5IQY A;  2G0F A;  5CRG A;  3QD9 A;  1GTU A;  1SD9 A;  2DJJ A;  3QFA C;  1OE7 A;  4MJB A;  3P2A A;  1Z5Y E;  4ZL8 A;  4EF0 A;  4O7H A;  5DAL A;  3TJG A;  19GS A;  2PWJ A;  4MA9 A;  3IR4 A;  1Y25 A;  2GZY A;  3UJ1 A;  2DJK A;  1R4W A;  4QL9 A;  5IOX A;  3VWV A;  5KN2 A;  5IMD A;  2PU9 C;  3KTL A;  2REM A;  5IM9 A;  3FR3 A;  2KOK A;  1K0D A;  1TP9 A;  2L4Q A;  3KZQ A;  2YWN A;  4G19 A;  1IYH A;  1BJX A;  4Q5R A;  1SKS B;  5FHI A;  1AIU A;  5CAX A;  1ILO A;  1A8L A;  1FG4 A;  2AB6 A;  1TXX A;  1BG5 A;  3KMN A;  1XFL A;  1FB0 A;  4KND A;  3KEB A;  2JSZ A;  2PVQ A;  2L57 A;  1SJI A;  1RW1 A;  4PNF A;  3CSH A;  4WEY A;  4POB A;  1M9B A;  3S9F A;  1I9D A;  4HQZ A;  2WZ9 A;  3QPM A;  1X5C A;  1QK8 A;  3VPQ A;  2JAC A;  3U5R E;  5HQP A;  1GNE A;  3NIV A;  2ALB A;  3ZFB A;  4PXO A;  2LJR A;  3QFB C;  2GQM A;  5ABR A;  4ULX A;  3FW2 A;  1XWC A;  4I6X A;  3CYN A;  2AV4 A;  3EIN A;  2FA4 A;  5D9T A;  4KH7 A;  4ZBA A;  2FGX A;  1THX A;  1FHE A;  1SL1 B;  1TRV A;  2LJK A;  4N0V A;  3TKP A;  1U87 A;  1ZCP A;  4NHZ A;  4XS1 A;  3TCO A;  5DBQ A;  4K0N A;  4ZB8 A;  4JZQ A;  3GST A;  3UBK A;  1OKT A;  6GSX A;  4CW9 A;  1O81 A;  1QGV A;  5A4U A;  4O5R A;  4YAP A;  2HE3 A;  3K8N A;  3GX0 A;  3GMF A;  4MPG A;  1R5P A;  3DD3 A;  1ML6 A;  1SD8 A;  2H76 A;  1OE8 A;  3D21 A;  1SYX A;  1TI3 A;  4KE3 A;  5AIX A;  3R2Q A;  1X9S B;  1B9Y C;  3L78 A;  1MDI A;  3P7X A;  3US3 A;  3KH7 A;  2IFQ A;  5HR2 A;  1TJD A;  5G2Z A;  3H79 A;  4XRD A;  4Q5N A;  3EUR A;  3EE2 A;  2I1U A;  1YKC A;  2VIM A;  4GQC A;  1HNA A;  2O85 A;  5JWQ B;  3TKQ A;  2IMK A;  4GRF A;  3ZVJ D;  3NZN A;  4JE1 A;  1PN9 A;  2WDU A;  5ECK B;  3CMI A;  3RHC A;  3HKR A;  5G5F A;  1X0R A;  2C3Q A;  2LEG A;  2CT6 A;  5CRD A;  3APQ A;  2IME A;  4MZW A;  1PGT A;  3HXS A;  4MAB A;  1O7U A;  4HUA A;  2M46 A;  4BPY A;  3C1S A;  3GRX A;  5IOW A;  5AGY A;  2YP6 A;  2XPD A;  2YJH A;  1GUK A;  1ZGN A;  1F6M C;  2VM1 A;  3QMX A;  5ECS A;  5G30 A;  1FAA A;  3TRX A;  3ZIT A;  6GST A;  8GSS A;  4YQU A;  2AAW A;  3LYP A;  5ECL B;  2L4C A;  4TR1 A;  1T1V A;  4K6X A;  1EWX A;  2GZP A;  2LQO A;  4HDE A;  17GS A;  5D96 A;  2L59 A;  3GIX A;  2WUL A;  5DCH A;  5KEJ A;  4ID0 A;  1H4O A;  1XZO A;  3G9B A;  4V1A g;  4J56 E;  1HNB A;  1JZW A;  3GL3 A;  2R4V A;  3F3R A;  1ERU A;  2WFC A;  3IAS 2;  3M1G A;  3APS A;  2IMI A;  5HR1 A;  4WF4 A;  1OKD A;  2ZCT A;  2HFD A;  5DJL A;  2CVB A;  3HA9 A;  1UA5 A;  4MF7 A;  4XS6 A;  2C4J A;  1ON4 A;  4F03 A;  2H30 A;  4ZBB A;  1A2M A;  2QC7 A;  1O73 A;  3TJB A;  1K0B A;  4AGS A;  4EE0 A;  1GNW A;  4IQA A;  2VCW A;  4LL4 B;  2C3T A;  5B8A A;  2YOI A;  2VCX A;  5J3R A;  4KX4 A;  3N5O A;  4KDU A;  4K1F A;  4I2U A;  2IMF A;  4WF5 A;  4ZIL A;  1KNG A;  3QAG A;  4POK A;  3GKN A;  2L5O A;  1OC8 A;  5ID2 B;  2GVP A;  3IAM 2;  2B3S A;  4HZ4 A;  2C3N A;  3TGZ A;  5DCG A;  4PGT A;  4V2M A;  1QUW A;  5A4W A;  4TVE A;  2B7K A;  2H72 A;  4MF6 A;  4OFT A;  3W8J A;  2I9H A;  6GSU A;  4BVY A;  4V1A p;  2RII A;  2Z9S A;  3LFL A;  4ZB9 A;  1SU9 A;  5ECM B;  3EMP A;  2N5B A;  3LQ7 A;  2FWE A;  2HSY A;  1O85 A;  4L8E A;  4MLY A;  4AJ8 A;  4ECJ A;  4AJ7 A;  6GSS A;  3G7Y A;  3I6A A;  1KEB A;  2H19 A;  2VCQ A;  3HHV A;  3IOS A;  3TKS C;  2X8C A;  1YF0 A;  3FZ5 A;  1W89 A;  2GLR A;  3NOF A;  1O8X A;  4IN0 A;  3VUR A;  1V58 A;  3FZA A;  4QQ7 A;  4LLR A;  4GWR A;  4DEJ A;  5DJM A;  1MDK A;  3F4T A;  3LEF A;  4LMW A;  3ZLP A;  4YAV A;  3F3Q A;  11GS A;  3D5J A;  3ED3 A;  3I43 A;  2LST A;  5IMF A;  2OBI A;  1MTC A;  4TKY A;  1PL1 A;  4NPB A;  2VD0 A;  4KDX A;  4GST A;  3TRQ A;  1M7T A;  2NPB A;  2YZU A;  5F05 A;  3H93 A;  3HY2 A;  1XXU A;  2DJ0 A;  4DSS A;  2VUP A;  2EIQ A;  1TRS A;  4K2D A;  1WMJ A;  3GTU A;  4ML6 A;  2GQK A;  4ILF A;  2VL9 A;  3TKR A;  2IJY A;  4OMV A;  3TJJ A;  1GP1 A;  1M2A A;  3TJK A;  5G1K A;  1WJK A;  4BWQ A;  1YEX A;  2G2Q A;  1GH2 A;  1SJZ A;  1WIK A;  9GSS A;  4MMM A;  5J9C A;  3IDV A;  4ISD A;  1WOU A;  2OA7 A;  3RPN A;  1PA3 A;  4HI7 A;  5KN3 A;  1NW2 A;  4I97 A;  5J9B A;  2PMT A;  4EKZ A;  1UN2 A;  1IYI A;  13GS A;  3BBY A;  1E2Y A;  1XCC A;  3HVS A;  4GQF A;  3FKF A;  3M3M A;  4NV2 A;  2VCZ A;  4WBJ A;  4ECI A;  1X5D A;  4MZB A;  3DKS A;  4OCF A;  1AXD A;  2YNX A;  4XRA A;  2JZR A;  1YEP A;  3D6I A;  2MZC A;  2GSS A;  3EWL A;  3A2X A;  3VPT A;  3D4T A;  1QQ2 A;  4GCI A;  4OD7 A;  4BL7 A;  2JSY A;  4MJE A;  3HZ4 A;  4X1U A;  4GSS A;  1JZD A;  4BWS A;  1LJR A;  4NMU A;  4TR0 A;  3EU4 A;  3ZIJ A;  5GAN D;  2GTU A;  5IPH A;  1A23 A;  1EV4 A;  1GSQ A;  3CTF A;  2K8V A;  2DSA A;  4PUA A;  1SEN A;  2J23 A;  3H4K A;  4TXV A;  5ECO B;  2R3X A;  1K0M A;  3LJR A;  4KUN A;  1NHO A;  4X43 A;  1SKW B;  1K0A A;  4TR4 A;  1XIY A;  2F9S A;  1YY7 A;  2L6C A;  3KD0 A;  5F0G A;  5DQS A;  2X99 A;  2HT9 A;  1Z6M A;  4ZIJ A;  2HLS A;  3HJO A;  3MWH A;  1MEK A;  1LU4 A;  2M72 A;  5FT3 A;  14GS A;  3BJ5 A;  3F4R A;  4JED A;  2LV3 A;  4EL1 A;  2NDO A;  3QDN A;  2B7J A;  2E2G A;  2CAI A;  3HYP A;  2LRC A;  3L9V A;  3H8Q A;  1EEM A;  4KCE A;  4IQ1 A;  5IMA A;  1TK5 B;  6GSY A;  3FZ9 A;  2AUV A;  3QR6 A;  2EIO A;  3HD5 A;  3CRT A;  1ABA A;  18GS A;  2MMN A;  4E8H A;  1AC1 A;  3UMA A;  3F6F A;  5LNK e;  3LYK A;  16GS A;  2F3M A;  3RHB A;  3WD6 A;  5DAL B;  3C8E A;  4MJA A;  3TKS A;  4IGJ A;  2CX4 A;  5H5R A;  1GTB A;  3PGT A;  3Q18 A;  1FO5 A;  2VCT A;  1MD3 A;  2L5L A;  4LL1 B;  2OAC A;  3LWA A;  4WR5 A;  2P5R A;  2AJQ B;  1HNC A;  3I9V 2;  4EXJ A;  1PQN A;  4P3Y B;  3TDG A;  2L6D A;  4ECB A;  3FRC A;  1DSB A;  3J7Y b;  4LMV A;  3FR9 A;  4WBR D;  2OE1 A;  1TU8 A;  5C00 A;  1A2L A;  5G5E A;  2YWI A;  1GSY A;  2HYX A;  4FH8 A;  1AQW A;  3DWV A;  3E3E A;  1EP8 A;  4XS4 B;  1AQV A;  2JZS A;  3HCZ A;  5B8B A;  4BVX A;  2DJ1 A;  1PD2 1;  3WT1 A;  3IPZ A;  5HR0 A;  2FUG 2;  2ON5 A;  4E8E A;  3ZRE A;  1AAZ A;  3HVX A;  3KJY A;  4KW6 A;  2GT6 A;  4N30 A;  3PR8 A;  2YV7 A;  4PQ1 A;  2RUE A;  2TRX A;  2O8V B;  4Z7X A;  1EGR A;  2YV9 A;  3UVH A;  3QAW A;  1EOH A;  1XWB A;  1GWC A;  2RM6 A;  2AHE A;  1S3C A;  2H75 A;  5DVB A;  1XWG A;  2QGV A;  1NM3 A;  1PX7 A;  3I69 A;  1XW9 A;  2PGT A;  3M0F A;  2VL2 C;  1A24 A;  3W6G A;  3IE3 A;  2H0I A;  2IL3 A;  3Q6O A;  1GSD A;  4X0X A;  1BYE A;  2GSR A;  2YN1 A;  3WGE A;  2MBS A;  1THO A;  1H75 A;  4IJI A;  3ZML A;  2JZT A;  1Z7R A;  5DAK B;  3D4M A;  3FZ4 A;  5A4V A;  3GFK A;  1JLV A;  1WE0 A;  3IK7 A;  3WYW A;  3ZTL A;  3VWW A;  3Q74 A;  1XPV A;  3D0Z A;  1EP7 A;  3O3T A;  3H1N A;  5JWO B;  2H70 A;  2K18 A;  5F07 A;  1R26 A;  1K0N A;  4ZBD A;  2V1M A;  2OE0 A;  1XVQ A;  2CVD A;  2K9F A;  1A2J A;  7GSS A;  2LRN A;  2VCV A;  4HJM A;  1F3A A;  1XW6 A;  4XCS A;  4TN8 A;  4D73 A;  2HZF A;  1T00 A;  1I5G A;  2C0D A;  4NXI A;  2C0G A;  1V9W A;  1EZK A;  2IFQ B;  3MAK A;  2E0Q A;  1O6J A;  2V6K A;  4L5L A;  3A2W A;  3IA1 A;  1ZZY A;  3GYK A;  4K7O A;  1T7P B;  2GGT A;  2H6Z A;  4F0C A;  4POM A;  1HD2 A;  3D22 A;  3KH9 A;  3UAR A;  1U3I A;  1TW9 A;  2FLS A;  3KCM A;  3TKS E;  5AIV A;  1VF1 A;  4MP4 A;  1GLP A;  4F2I A;  1UC7 A;  5GST A;  5ID2 A;  3ZVJ A;  2FNO A;  3ME7 A;  3C1R A;  6GSW A;  4N11 A;  1TKD B;  2WGR A;  3HDC A;  5IMC A;  4N0Z A;  1K3L A;  2CAQ A;  5CO3 A;  3WGD A;  4PUF C;  2PER A;  4IKH A;  1PX6 A;  5F06 A;  3UAP A;  4TW5 A;  2V41 A;  5ELG A;  4POL A;  4MJC A;  1M9A A;  1ACV A;  4G2E A;  1T4Z A;  1AW9 A;  2YPM A;  5ECP B;  4TR1 B;  5J5N A;  4AF2 A;  3TOT A;  2WJU A;  1ERV A;  4N10 A;  4ECC A;  1VGL A;  3EC3 A;  1PSQ A;  3ERG A;  4JR4 A;  2XHF A;  1GRX A;  4FO5 A;  5COH A;  4I5Q A;  3C7M A;  4PUR A;  3VI7 A;  2FY6 A;  2P0G A;  4TXO B;  3RBT A;  1JZR A;  3UEM A;  2C8U A;  1SK2 A;  3GKK A;  2H71 A;  1X9W B;  1EOG A;  3LG6 A;  3L4N A;  1WP0 A;  4HU7 A;  2LRT A;  1URM A;  2AYT A;  1X9M B;  2OKA A;  4LA1 A;  4HQS A;  1JHB A;  3UBL A;  4CDO A;  4DVC A;  2KHP A;  3CTG A;  5LD0 A;  1V57 A;  2QSI A;  2H0H A;  2HI7 A;  1T3B A;  2LNS A;  2H1D A;  1GUH A;  3ME8 A;  5EVO A;  4L0U A;  2IMD A;  4L0W A;  5B6N A;  4IBP A;  4F0B A;  4WR4 A;  5E59 A;  1VRS D;  4J57 E;  3BCI A;  4HZ2 A;  3GX8 A;  1CQG A;  4EC0 A;  5CRH A;  2VD1 A;  4ZB6 A;  1PMT A;  20GS A;  5ECI B;  1DBY A;  1BED A;  2X8G A;  1T4Y A;  3SBC A;  1KTE A;  4FYU A;  2V6O A; 
#chains in the Genus database with same CATH topology
 3HJM A;  4FQU A;  4FIW A;  1C72 A;  1SJ6 A;  3M8N A;  4Q5Q A;  2VM2 A;  2BMX A;  3O76 A;  4CHS A;  1F3B A;  2EC4 A;  3U6V A;  3GSS A;  4ZL7 A;  3ZMK A;  1YZX A;  4G10 A;  1FB6 A;  1F37 A;  5J41 A;  1TU7 A;  1EEJ A;  3KTB A;  4MZC A;  22GS A;  1ZMA A;  5ECQ B;  4Z2T A;  3E9J B;  3QCP A;  2O87 A;  1TRW A;  2PN8 A;  5ENU A;  1WPI A;  2B6M A;  4XIH A;  2CV4 A;  3Q19 A;  5DDL A;  4JRR A;  1DE2 A;  1G6Y A;  2YZH A;  2IIY A;  2R37 A;  2HXK A;  1U88 A;  3HVV A;  3GUS A;  2XBI A;  2H73 A;  2IWT A;  3KP8 A;  3PH9 A;  4HU9 A;  4PQI A;  3LXT A;  4EDY A;  1XWA A;  2GZZ A;  2N5A A;  1TOF A;  4YH2 A;  3CSJ A;  3KM6 A;  3EU3 A;  5ECH B;  1V98 A;  2K6V A;  1Q4J A;  2B5X A;  5FWG A;  3A3T A;  2NVL A;  3MDK A;  1SK0 A;  4NV5 A;  5C04 A;  2LJA A;  3KIJ A;  2YWM A;  2CQ9 A;  3LGC A;  2FHE A;  2VO4 A;  2VLT A;  5ECN B;  4RUV A;  3GKM A;  3DRN A;  5JCW A;  5D9V A;  1ZYE A;  3HJP A;  3P90 A;  3UL3 A;  2LKU A;  2FWF A;  2C80 A;  3HZ8 A;  2WS2 A;  2LTK A;  3LOR A;  1JZO A;  3MYD A;  4IVF A;  3CSI A;  4MNN A;  2IN3 A;  3DGQ A;  3IK9 A;  4XTS A;  1MDJ A;  2B5E A;  4OCE A;  5EPF A;  3EYT A;  1XW5 A;  2HZE B;  1GSU A;  2MMZ A;  4NAX A;  4CY6 A;  1X5E A;  1G7O A;  1PKZ A;  4MPF A;  5INY A;  3FHK A;  5AN1 A;  3VLN A;  2VAF A;  3DVW A;  1TK8 B;  2OE3 A;  4PQH A;  3IC8 A;  5D9W A;  1EGO A;  3W8S A;  3UVT A;  4GTU A;  1B4Q A;  4KAE A;  3FY7 A;  2V32 A;  5JCG A;  2YCD A;  2JL4 A;  1JFU A;  2OJL A;  2H0G A;  3UOM A;  4O32 A;  3WT2 A;  2ON7 A;  2A4V A;  2H6X A;  2J9H A;  5ELA A;  5CNW A;  3GN3 A;  4YQV A;  3DEX A;  4GXZ A;  1B4P A;  3F8U A;  5E4W A;  1OC9 B;  2F8A A;  3CBU A;  5LCZ A;  2N5F A;  4EO3 A;  1N8J A;  3J7Y k;  3KMO A;  2GT5 A;  2B5Y A;  4F9Z A;  2ES7 A;  1R5A A;  2PBJ A;  2I4A A;  5AIS A;  3C71 A;  3EMX A;  5D9X A;  1LBK A;  3OR5 A;  2WCI A;  2VLV A;  3F63 A;  2XBQ A;  5HFK A;  4OWY A;  5JWR B;  3PIN A;  4ACS A;  4XS4 A;  2UZ8 A;  4XHM A;  5KOX A;  1T8E B;  3ZRD A;  1SKR B;  3CXG A;  2K8S A;  1NHY A;  3VWX A;  1YF1 A;  2FD3 A;  1FOV A;  2VL3 A;  2B1L A;  3F9U A;  1GLQ A;  2TIR A;  2ZNM A;  1BAY A;  2MMO A;  2A4H A;  1ERW A;  2IPA A;  3KGK A;  5CRW A;  2DC5 A;  1F2E A;  3JCM L;  4GSN A;  4DSQ A;  2C0E A;  4V2N A;  3MSZ A;  4BIK A;  3O6T A;  5IO2 A;  4AJ6 A;  1A0F A;  1M0U A;  4KB3 A;  5BRT A;  1F9M A;  2FCH A;  2KP1 A;  1PRX A;  4TRX A;  1K3Y A;  3G7J A;  3VI5 A;  3ZIV A;  4WXT A;  2FWH A;  4G9H A;  1YJ6 A;  1OVN A;  2DIY A;  1AQX A;  5B6M A;  2H6Y A;  1DE1 A;  2KP2 A;  3GA4 A;  5D8I A;  3AY8 A;  2H74 A;  3SWL A;  2DML A;  1PFO A;  2E2M A;  5DAK A;  4MDC A;  4EVM A;  1VF2 A;  2R6K A;  1MD4 A;  4Z2R A;  1J0F A;  4JBB A;  2O89 A;  3BCK A;  3L9S A;  1YQ1 A;  3GH9 A;  3M9K A;  2E7P A;  5D73 A;  2DMM A;  1K3O A;  5ECR B;  2EIR A;  1M2D A;  5B7C A;  3IV4 A;  2DIZ A;  1OC3 A;  4MF5 A;  2CZ3 A;  2H1A A;  2R5G A;  3ZL5 A;  3A2V A;  4I2T A;  3N9J A;  4KSM A;  3ZFL A;  1O8W A;  4O5U A;  1G0T A;  2XC2 A;  2LNT A;  1ST9 A;  1B9X C;  4KCA A;  2JAD A;  4HS1 A;  2H1G A;  2BTO T;  3TB2 A;  1VF3 A;  3A5W A;  1QFN A;  1RQM A;  3IHG A;  2PVO C;  5H5S A;  5IO0 A;  2GS3 A;  2H01 A;  2RLI A;  3LSZ A;  4OFM A;  3CRU A;  3F0I A;  4MK3 A;  4G0I A;  1K0O A;  1QMV A;  3KXO A;  3ERW A;  5F8B A;  2DJ3 A;  2B1K A;  1U6T A;  4V2L A;  5CP1 A;  2YAN A;  12GS A;  1EV9 A;  2C1Y A;  4IP6 A;  1Y6E A;  2O7K A;  3IRA A;  4HSC X;  4KA0 A;  3EVI A;  5HFI A;  4MCU A;  2F8F A;  3UIW A;  4RQR A;  3F4S A;  1S3R A;  2A2S A;  2WRT A;  2R2J A;  1J08 A;  3GHA A;  1KBN A;  2H66 A;  4PNG A;  1RK4 A;  2KLX A;  4JR6 A;  5G31 A;  1HYU A;  1ZYQ B;  2X64 A;  3IHQ A;  2CZ2 A;  3RAZ A;  2MMA A;  3TJF A;  1XVW A;  5GZZ B;  2NTO A;  10GS A;  4Q5F A;  3QAV A;  1Z6N A;  1FVK A;  1Q98 A;  5IMV A;  1FW1 A;  2LUS A;  1Z9H A;  4TXO A;  3F6D A;  4RQX A;  1AUC A;  3APO A;  1G7E A;  2GDR A;  5L71 A;  2HRN A;  2LQQ A;  4D73 B;  4IJ3 A;  4DSR A;  3DXB A;  1TDI A;  4EDZ A;  1SK1 A;  1N2A A;  2X49 A;  3L9U A;  4K7I A;  4K9Z A;  1K0C A;  1GTA A;  1A8Y A;  3RDW A;  5H5Q A;  4KGI A;  2BJX A;  3C73 A;  1TI1 A;  2RUF A;  3FK8 A;  1CQH A;  1WWJ A;  4KSO A;  2I81 A;  3MNG A;  2NBS A;  4KF9 A;  2MBT A;  1OAZ A;  3GUR A;  4ZL9 A;  2LS5 A;  3ERF A;  1G6W A;  3TRP A;  3G7I A;  2QKE A;  4IHU A;  3TOU A;  2P31 A;  3IXR A;  3GV1 A;  2A2R A;  5IPG A;  4QL7 A;  1Z7P A;  3IBH A;  2YWO A;  1GTI A;  4ZXG A;  2H1B A;  2DBC A;  4KDY A;  1U3A A;  2RM5 A;  3GL5 A;  2DLX A;  2H8L A;  1YDK A;  2C0F A;  2MYG A;  4MH2 A;  4L5O A;  4YQM A;  5GSS A;  4IS0 A;  4GLT A;  5EY6 A;  4K0G A;  3P8W A;  4IW9 A;  3GH6 A;  1W4V A;  1NSW A;  1Z3E A;  4I8B A;  1V2A A;  1FVJ A;  4TOP A;  3ISO A;  4NWY A;  4HEA 2;  4O92 A;  2PUK C;  1TTZ A;  3FR6 A;  3KP9 A;  5JCU A;  4BVY B;  2VOC A;  1ZOF A;  1J9B A;  1USB A;  1PKW A;  2KUC A;  1DUG A;  1GUL A;  1V40 A;  4OO4 A;  4EUY A;  4JU5 A;  5J4U A;  1BX9 A;  1GL8 A;  1XWK A;  2GST A;  1TK0 B;  2R0G A;  3FEU A;  5DQY A;  1S3A A;  4YKG A;  2JU5 A;  3V1W A;  3LXZ A;  5A5K A;  1R7H A;  2F51 A;  2FA8 A;  4OFN A;  3GNJ A;  1PL2 A;  1SYR A;  1TRU A;  3VK9 A;  1B8X A;  1S3D A;  1GSE A;  3TUE A;  2VLU A;  4K8M A;  1YKA A;  2VL2 A;  4HOJ A;  3DML A;  1XOB A;  2HSM A;  2YJ7 A;  5CRE A;  4FYB A;  5CYY A;  1A0R P;  3GKX A;  5HFG A;  5HR3 A;  1ERT A;  2OBK A;  3R3E A;  3WGX A;  1HQO A;  1XBS A;  4OO5 A;  2CVK A;  1BQ7 A;  3E0U A;  4RI6 A;  4TR3 A;  2M80 A;  2V2G A;  1M2B A;  2HSH A;  2GSQ A;  2DJ2 A;  2ZUP A;  4GF0 A;  4DSS B;  5KN1 A;  3VFI A;  2XPE A;  3LW9 A;  3RPP A;  4WET A;  3QOU A;  2WB9 A;  3GTU B;  2TRC P;  2HZE A;  3BD2 A;  1JLW A;  3IC4 A;  1GUM A;  1WRY A;  3L0H A;  5D93 A;  4NHW A;  4MH3 A;  1QXH A;  1E6B A;  5KN0 A;  1SL2 B;  4ML1 A;  4PX1 A;  4F82 A;  1UVZ A;  4IEL A;  4K7N A;  1GSS A;  2GQL A;  4WKW A;  5EL8 A;  2HRF A;  2CX3 A;  2P5Q A;  1XOA A;  4HJ2 A;  3DVX A;  3VWU A;  1B48 A;  4H86 A;  1OYJ A;  3DYR A;  6GSV A;  2I3Y A;  4IP1 A;  1ZL9 A;  5IMZ A;  3FYG A;  3DIE A;  2OAD A;  1M3J A;  2D2Z A;  1M99 A;  2X8H A;  4RI7 A;  1SL0 B;  2FWG A;  4BA7 A;  2HNL A;  3ZYW A;  1VF4 A;  5GAP D;  1GSF A;  2CA8 A;  3ZZX A;  3M9J A;  4FYC A;  5IIZ A;  4J2F A;  1OC9 A;  2PPT A;  3BOA A;  5G1L A;  5IQY A;  2G0F A;  5CRG A;  3QD9 A;  1GTU A;  1SD9 A;  2DJJ A;  4BL7 B;  3QFA C;  1OE7 A;  4MJB A;  3P2A A;  1Z5Y E;  4ZL8 A;  4EF0 A;  4O7H A;  5DAL A;  3TJG A;  19GS A;  2PWJ A;  4MA9 A;  3IR4 A;  1Y25 A;  2GZY A;  3UJ1 A;  2DJK A;  1R4W A;  4QL9 A;  5IOX A;  4ICY A;  3VWV A;  5KN2 A;  2HRK A;  5IMD A;  2PU9 C;  3KTL A;  2REM A;  5IM9 A;  3FR3 A;  2KOK A;  1K0D A;  4G0L A;  1TP9 A;  2L4Q A;  3KZQ A;  2YWN A;  4G19 A;  1IYH A;  1BJX A;  4Q5R A;  1SKS B;  2X4A A;  5FHI A;  1AIU A;  5CAX A;  1ILO A;  1A8L A;  1FG4 A;  2AB6 A;  1TXX A;  1BG5 A;  3KMN A;  1XFL A;  1FB0 A;  4KND A;  3KEB A;  2JSZ A;  2PVQ A;  2L57 A;  1SJI A;  1RW1 A;  4PNF A;  3CSH A;  4WEY A;  4POB A;  1M9B A;  3S9F A;  1I9D A;  4HQZ A;  2WZ9 A;  3QPM A;  1X5C A;  1QK8 A;  3VPQ A;  2JAC A;  3U5R E;  5HQP A;  1GNE A;  3NIV A;  2ALB A;  3ZFB A;  4PXO A;  2LJR A;  3QFB C;  2GQM A;  5ABR A;  4ULX A;  3FW2 A;  1XWC A;  4I6X A;  3CYN A;  2AV4 A;  3EIN A;  2FA4 A;  5D9T A;  4KH7 A;  4ZBA A;  2FGX A;  1THX A;  1FHE A;  1SL1 B;  1TRV A;  2LJK A;  4N0V A;  1XG8 A;  3TKP A;  1U87 A;  1ZCP A;  4NHZ A;  4XS1 A;  3TCO A;  5DBQ A;  4K0N A;  4ZB8 A;  4JZQ A;  3GST A;  3UBK A;  1OKT A;  6GSX A;  4CW9 A;  1O81 A;  1QGV A;  5A4U A;  4O5R A;  4YAP A;  2HE3 A;  3K8N A;  3GX0 A;  3GMF A;  4MPG A;  1R5P A;  3DD3 A;  1ML6 A;  1SD8 A;  2H76 A;  4K2X A;  1OE8 A;  3D21 A;  1SYX A;  1TI3 A;  4KE3 A;  5AIX A;  3R2Q A;  1X9S B;  1B9Y C;  3L78 A;  4BVX B;  1MDI A;  3P7X A;  3US3 A;  3KH7 A;  2IFQ A;  5HR2 A;  1TJD A;  5G2Z A;  3H79 A;  4XRD A;  4Q5N A;  3EUR A;  3EE2 A;  2I1U A;  1YKC A;  2VIM A;  4GQC A;  1HNA A;  2O85 A;  5JWQ B;  3TKQ A;  2IMK A;  4GRF A;  3ZVJ D;  3NZN A;  4JE1 A;  1PN9 A;  2WDU A;  5ECK B;  3CMI A;  3RHC A;  3HKR A;  5G5F A;  1X0R A;  3CQF A;  2C3Q A;  2LEG A;  2CT6 A;  5CRD A;  3APQ A;  2IME A;  4MZW A;  1PGT A;  4K5S A;  3HXS A;  4MAB A;  1O7U A;  4HUA A;  2M46 A;  4BPY A;  3C1S A;  3GRX A;  5IOW A;  5AGY A;  2YP6 A;  2XPD A;  4Z2U A;  2YJH A;  1GUK A;  1ZGN A;  1F6M C;  2VM1 A;  3QMX A;  5ECS A;  5G30 A;  1FAA A;  3TRX A;  3ZIT A;  6GST A;  4EIQ A;  8GSS A;  4YQU A;  2AAW A;  3LYP A;  5ECL B;  2L4C A;  4TR1 A;  1T1V A;  4K6X A;  1EWX A;  5BMU A;  2GZP A;  2LQO A;  4HDE A;  17GS A;  5D96 A;  2L59 A;  3GIX A;  2WUL A;  5DCH A;  5KEJ A;  4ID0 A;  1H4O A;  1XZO A;  3G9B A;  4V1A g;  4J56 E;  1HNB A;  1JZW A;  3GL3 A;  2R4V A;  3F3R A;  1ERU A;  2WFC A;  3IAS 2;  3M1G A;  3APS A;  2IMI A;  5HR1 A;  4WF4 A;  1OKD A;  2ZCT A;  2HFD A;  5DJL A;  2CVB A;  3HA9 A;  1UA5 A;  4MF7 A;  4XS6 A;  2C4J A;  1ON4 A;  4F03 A;  2H30 A;  4ZBB A;  1A2M A;  2QC7 A;  1O73 A;  3TJB A;  1K0B A;  4AGS A;  4EE0 A;  1GNW A;  4IQA A;  2VCW A;  4LL4 B;  2C3T A;  5B8A A;  2YOI A;  2VCX A;  5J3R A;  4KX4 A;  3N5O A;  4KDU A;  4K1F A;  4I2U A;  2IMF A;  4WF5 A;  4ZIL A;  1KNG A;  3QAG A;  4POK A;  3GKN A;  2L5O A;  1OC8 A;  5ID2 B;  2GVP A;  3IAM 2;  2B3S A;  4HZ4 A;  2C3N A;  3TGZ A;  5DCG A;  4PGT A;  4V2M A;  1QUW A;  5A4W A;  4TVE A;  2B7K A;  2H72 A;  4MF6 A;  4OFT A;  3W8J A;  2I9H A;  6GSU A;  4BVY A;  4V1A p;  2RII A;  2Z9S A;  3LFL A;  4ZB9 A;  1SU9 A;  5ECM B;  3EMP A;  2N5B A;  3LQ7 A;  2FWE A;  2HSY A;  1O85 A;  4L8E A;  4MLY A;  4AJ8 A;  4ECJ A;  4AJ7 A;  6GSS A;  3G7Y A;  3I6A A;  1KEB A;  2H19 A;  2VCQ A;  3HHV A;  3IOS A;  3TKS C;  2X8C A;  1YF0 A;  3FZ5 A;  1W89 A;  2GLR A;  3NOF A;  1O8X A;  4IN0 A;  3VUR A;  1V58 A;  3FZA A;  4QQ7 A;  4LLR A;  4GWR A;  4DEJ A;  5DJM A;  1MDK A;  3F4T A;  3LEF A;  4LMW A;  3ZLP A;  4YAV A;  3F3Q A;  11GS A;  3D5J A;  3ED3 A;  3I43 A;  2LST A;  5IMF A;  2OBI A;  1MTC A;  4TKY A;  1PL1 A;  4NPB A;  2VD0 A;  4EIP A;  3FMW A;  4KDX A;  4GST A;  3TRQ A;  1M7T A;  2NPB A;  2YZU A;  5F05 A;  3H93 A;  3HY2 A;  4O5Q A;  1XXU A;  2DJ0 A;  4DSS A;  1ZYP A;  2VUP A;  2EIQ A;  1TRS A;  4K2D A;  1WMJ A;  3GTU A;  4ML6 A;  2GQK A;  4ILF A;  2VL9 A;  3TKR A;  2IJY A;  4OMV A;  3TJJ A;  1GP1 A;  1M2A A;  3TJK A;  5G1K A;  1WJK A;  4BWQ A;  4K5R A;  1YEX A;  2G2Q A;  1GH2 A;  2QA1 A;  1SJZ A;  1WIK A;  9GSS A;  4MMM A;  5J9C A;  3IDV A;  4ISD A;  1WOU A;  2OA7 A;  3RPN A;  1PA3 A;  4HI7 A;  5KN3 A;  1NW2 A;  4I97 A;  5J9B A;  2PMT A;  4YKF A;  4EKZ A;  1UN2 A;  1IYI A;  13GS A;  3BBY A;  1E2Y A;  3EPT A;  1XCC A;  3HVS A;  4GQF A;  5KOW A;  3FKF A;  3M3M A;  4NV2 A;  2VCZ A;  2R0C A;  4WBJ A;  2DKH A;  4ECI A;  1X5D A;  4MZB A;  3DKS A;  4OCF A;  1AXD A;  2YNX A;  4XRA A;  2JZR A;  1YEP A;  3D6I A;  2MZC A;  2GSS A;  3EWL A;  3A2X A;  3VPT A;  2DKI A;  3A5I A;  3D4T A;  1QQ2 A;  4GCI A;  4OD7 A;  4BL7 A;  2JSY A;  4MJE A;  3HZ4 A;  4X1U A;  4GSS A;  1JZD A;  4BWS A;  1LJR A;  4NMU A;  4TR0 A;  3EU4 A;  3ZIJ A;  5GAN D;  2GTU A;  5IPH A;  1A23 A;  1EV4 A;  1GSQ A;  3CTF A;  2K8V A;  2DSA A;  4PUA A;  1SEN A;  2J23 A;  3H4K A;  4TXV A;  5ECO B;  2R3X A;  1K0M A;  3LJR A;  1ZYN A;  4KUN A;  3PPU A;  1NHO A;  4USS A;  4X43 A;  1SKW B;  1K0A A;  4TR4 A;  1XIY A;  2F9S A;  1YY7 A;  2L6C A;  3KD0 A;  5F0G A;  4G0K A;  5DQS A;  2X99 A;  2HT9 A;  1Z6M A;  4ZIJ A;  2HLS A;  3HJO A;  3MWH A;  1MEK A;  1LU4 A;  2R0P A;  2M72 A;  5FT3 A;  14GS A;  3BJ5 A;  3F4R A;  4JED A;  2LV3 A;  4EL1 A;  2NDO A;  3QDN A;  2B7J A;  2E2G A;  2CAI A;  3HYP A;  2LRC A;  3L9V A;  3H8Q A;  1EEM A;  4KCE A;  4IQ1 A;  5IMA A;  1TK5 B;  6GSY A;  3FZ9 A;  2AUV A;  3QR6 A;  2EIO A;  3HD5 A;  3CRT A;  1ABA A;  18GS A;  2MMN A;  4E8H A;  1AC1 A;  3UMA A;  3F6F A;  1PN0 A;  5LNK e;  3LYK A;  4CY8 A;  16GS A;  2F3M A;  3RHB A;  3WD6 A;  5DAL B;  3C8E A;  4MJA A;  2A2P A;  3TKS A;  4IGJ A;  2CX4 A;  5H5R A;  1GTB A;  3PGT A;  3Q18 A;  1FO5 A;  2VCT A;  1MD3 A;  2L5L A;  4LL1 B;  2OAC A;  3LWA A;  4WR5 A;  2P5R A;  2AJQ B;  1HNC A;  3I9V 2;  4EXJ A;  1PQN A;  4P3Y B;  3TDG A;  2L6D A;  4ECB A;  3FRC A;  1DSB A;  3J7Y b;  4LMV A;  3FR9 A;  4WBR D;  2OE1 A;  1TU8 A;  5C00 A;  1A2L A;  5G5E A;  2YWI A;  1GSY A;  2HYX A;  4FH8 A;  1AQW A;  3DWV A;  3E3E A;  1EP8 A;  4XS4 B;  1AQV A;  2JZS A;  3HCZ A;  5B8B A;  4BVX A;  2DJ1 A;  1PD2 1;  3WT1 A;  3IPZ A;  5HR0 A;  2FUG 2;  2ON5 A;  4E8E A;  3ZRE A;  1AAZ A;  3HVX A;  3KJY A;  4KW6 A;  2GT6 A;  4N30 A;  3PR8 A;  2YV7 A;  4PQ1 A;  2RUE A;  2TRX A;  2O8V B;  4Z7X A;  1EGR A;  2YV9 A;  3UVH A;  3QAW A;  3HVN A;  1EOH A;  1FOH A;  1XWB A;  1GWC A;  2RM6 A;  2AHE A;  1S3C A;  2H75 A;  5DVB A;  1XWG A;  2QGV A;  1NM3 A;  1PX7 A;  3I69 A;  1XW9 A;  2PGT A;  3M0F A;  2VL2 C;  1A24 A;  3W6G A;  3IE3 A;  2H0I A;  2IL3 A;  3Q6O A;  1GSD A;  4X0X A;  1BYE A;  2GSR A;  2YN1 A;  3WGE A;  2MBS A;  1THO A;  1H75 A;  4IJI A;  3ZML A;  2JZT A;  1M3I A;  1Z7R A;  5DAK B;  3D4M A;  3FZ4 A;  5A4V A;  3GFK A;  1JLV A;  1WE0 A;  3IK7 A;  3WYW A;  3ZTL A;  3VWW A;  3Q74 A;  1XPV A;  3D0Z A;  1EP7 A;  3O3T A;  3H1N A;  5JWO B;  2H70 A;  2K18 A;  5F07 A;  1R26 A;  1K0N A;  4ZBD A;  2V1M A;  2OE0 A;  1XVQ A;  2CVD A;  2K9F A;  1A2J A;  7GSS A;  2LRN A;  2VCV A;  4HJM A;  1F3A A;  1XW6 A;  4XCS A;  4TN8 A;  4D73 A;  2HZF A;  1T00 A;  1I5G A;  2C0D A;  4NXI A;  2C0G A;  1V9W A;  1EZK A;  2IFQ B;  3MAK A;  2E0Q A;  1O6J A;  2V6K A;  4L5L A;  3A2W A;  3IA1 A;  1ZZY A;  3GYK A;  4K7O A;  1T7P B;  2GGT A;  2H6Z A;  4F0C A;  4POM A;  1HD2 A;  3D22 A;  3KH9 A;  3UAR A;  1U3I A;  1TW9 A;  2FLS A;  3KCM A;  3TKS E;  5AIV A;  1VF1 A;  4MP4 A;  1GLP A;  4F2I A;  1UC7 A;  5GST A;  5ID2 A;  3ZVJ A;  3MIX A;  2FNO A;  3ME7 A;  2QA2 A;  3C1R A;  6GSW A;  4N11 A;  1TKD B;  2WGR A;  3HDC A;  5IMC A;  4N0Z A;  1K3L A;  2CAQ A;  5CO3 A;  4X4J A;  3WGD A;  4PUF C;  2PER A;  4IKH A;  1PX6 A;  5F06 A;  3UAP A;  4TW5 A;  2V41 A;  5ELG A;  4POL A;  4MJC A;  1M9A A;  1ACV A;  4G2E A;  1T4Z A;  1AW9 A;  2YPM A;  5ECP B;  4TR1 B;  5J5N A;  4AF2 A;  3TOT A;  2WJU A;  1ERV A;  4N10 A;  4ECC A;  1VGL A;  3EC3 A;  1PSQ A;  3ERG A;  4JR4 A;  2XHF A;  1GRX A;  4FO5 A;  5COH A;  4I5Q A;  3C7M A;  4PUR A;  3VI7 A;  2FY6 A;  2P0G A;  4TXO B;  3RBT A;  1JZR A;  3UEM A;  2C8U A;  1SK2 A;  3GKK A;  2H71 A;  1X9W B;  1EOG A;  3LG6 A;  3L4N A;  1WP0 A;  4HU7 A;  2LRT A;  1URM A;  2AYT A;  1X9M B;  2OKA A;  4LA1 A;  4HQS A;  4PTS A;  1JHB A;  3UBL A;  4CDO A;  4DVC A;  2KHP A;  3CTG A;  5LD0 A;  1V57 A;  2QSI A;  2H0H A;  2HI7 A;  1T3B A;  2LNS A;  2H1D A;  1GUH A;  3ME8 A;  5EVO A;  4L0U A;  2IMD A;  4L0W A;  5B6N A;  4IBP A;  4F0B A;  4A5P A;  2HRA A;  4WR4 A;  5E59 A;  1VRS D;  4J57 E;  3BCI A;  4HZ2 A;  3GX8 A;  1CQG A;  4EC0 A;  5CRH A;  2VD1 A;  4ZB6 A;  1PMT A;  20GS A;  5ECI B;  1DBY A;  1BED A;  2X8G A;  1T4Y A;  3SBC A;  1KTE A;  4FYU A;  2V6O A; 
#chains in the Genus database with same CATH homology
 3HJM A;  4FQU A;  4FIW A;  1C72 A;  1SJ6 A;  3M8N A;  4Q5Q A;  2VM2 A;  2BMX A;  3O76 A;  4CHS A;  1F3B A;  2EC4 A;  3U6V A;  3GSS A;  4ZL7 A;  3ZMK A;  1YZX A;  4G10 A;  1FB6 A;  1F37 A;  5J41 A;  1TU7 A;  1EEJ A;  3KTB A;  4MZC A;  22GS A;  1ZMA A;  5ECQ B;  4Z2T A;  3E9J B;  3QCP A;  2O87 A;  1TRW A;  2PN8 A;  5ENU A;  1WPI A;  2B6M A;  4XIH A;  2CV4 A;  3Q19 A;  5DDL A;  4JRR A;  1DE2 A;  1G6Y A;  2YZH A;  2IIY A;  2R37 A;  2HXK A;  1U88 A;  3HVV A;  3GUS A;  2XBI A;  2H73 A;  2IWT A;  3KP8 A;  3PH9 A;  4HU9 A;  4PQI A;  3LXT A;  4EDY A;  1XWA A;  2GZZ A;  2N5A A;  1TOF A;  4YH2 A;  3CSJ A;  3KM6 A;  3EU3 A;  5ECH B;  1V98 A;  2K6V A;  1Q4J A;  2B5X A;  5FWG A;  3A3T A;  2NVL A;  3MDK A;  1SK0 A;  4NV5 A;  5C04 A;  2LJA A;  3KIJ A;  2YWM A;  2CQ9 A;  3LGC A;  2FHE A;  2VO4 A;  2VLT A;  5ECN B;  4RUV A;  3GKM A;  3DRN A;  5JCW A;  5D9V A;  1ZYE A;  3HJP A;  3P90 A;  3UL3 A;  2LKU A;  2FWF A;  2C80 A;  3HZ8 A;  2WS2 A;  2LTK A;  3LOR A;  1JZO A;  3MYD A;  4IVF A;  3CSI A;  4MNN A;  2IN3 A;  3DGQ A;  3IK9 A;  4XTS A;  1MDJ A;  2B5E A;  4OCE A;  5EPF A;  3EYT A;  1XW5 A;  2HZE B;  1GSU A;  2MMZ A;  4NAX A;  4CY6 A;  1X5E A;  1G7O A;  1PKZ A;  4MPF A;  5INY A;  3FHK A;  5AN1 A;  3VLN A;  2VAF A;  3DVW A;  1TK8 B;  2OE3 A;  4PQH A;  3IC8 A;  5D9W A;  1EGO A;  3W8S A;  3UVT A;  4GTU A;  1B4Q A;  4KAE A;  3FY7 A;  2V32 A;  5JCG A;  2YCD A;  2JL4 A;  1JFU A;  2OJL A;  2H0G A;  3UOM A;  4O32 A;  3WT2 A;  2ON7 A;  2A4V A;  2H6X A;  2J9H A;  5ELA A;  5CNW A;  3GN3 A;  4YQV A;  3DEX A;  4GXZ A;  1B4P A;  3F8U A;  5E4W A;  1OC9 B;  2F8A A;  3CBU A;  5LCZ A;  2N5F A;  4EO3 A;  1N8J A;  3J7Y k;  3KMO A;  2GT5 A;  2B5Y A;  4F9Z A;  2ES7 A;  1R5A A;  2PBJ A;  2I4A A;  5AIS A;  3C71 A;  3EMX A;  5D9X A;  1LBK A;  3OR5 A;  2WCI A;  2VLV A;  3F63 A;  2XBQ A;  5HFK A;  4OWY A;  5JWR B;  3PIN A;  4ACS A;  4XS4 A;  2UZ8 A;  4XHM A;  5KOX A;  1T8E B;  3ZRD A;  1SKR B;  3CXG A;  2K8S A;  1NHY A;  3VWX A;  1YF1 A;  2FD3 A;  1FOV A;  2VL3 A;  2B1L A;  3F9U A;  1GLQ A;  2TIR A;  2ZNM A;  1BAY A;  2MMO A;  2A4H A;  1ERW A;  2IPA A;  3KGK A;  5CRW A;  2DC5 A;  1F2E A;  3JCM L;  4GSN A;  4DSQ A;  2C0E A;  4V2N A;  3MSZ A;  3O6T A;  5IO2 A;  4AJ6 A;  1A0F A;  1M0U A;  4KB3 A;  5BRT A;  1F9M A;  2FCH A;  2KP1 A;  1PRX A;  4TRX A;  1K3Y A;  3G7J A;  3VI5 A;  3ZIV A;  4WXT A;  2FWH A;  4G9H A;  1YJ6 A;  1OVN A;  2DIY A;  1AQX A;  5B6M A;  2H6Y A;  1DE1 A;  2KP2 A;  3GA4 A;  5D8I A;  3AY8 A;  2H74 A;  3SWL A;  2DML A;  2E2M A;  5DAK A;  4MDC A;  4EVM A;  1VF2 A;  2R6K A;  1MD4 A;  4Z2R A;  1J0F A;  4JBB A;  2O89 A;  3BCK A;  3L9S A;  1YQ1 A;  3GH9 A;  3M9K A;  2E7P A;  5D73 A;  2DMM A;  1K3O A;  5ECR B;  2EIR A;  1M2D A;  5B7C A;  3IV4 A;  2DIZ A;  1OC3 A;  4MF5 A;  2CZ3 A;  2H1A A;  2R5G A;  3ZL5 A;  3A2V A;  4I2T A;  3N9J A;  4KSM A;  3ZFL A;  1O8W A;  4O5U A;  1G0T A;  2XC2 A;  2LNT A;  1ST9 A;  1B9X C;  4KCA A;  2JAD A;  4HS1 A;  2H1G A;  2BTO T;  3TB2 A;  1VF3 A;  3A5W A;  1QFN A;  1RQM A;  3IHG A;  2PVO C;  5H5S A;  5IO0 A;  2GS3 A;  2H01 A;  2RLI A;  3LSZ A;  4OFM A;  3CRU A;  3F0I A;  4MK3 A;  4G0I A;  1K0O A;  1QMV A;  3KXO A;  3ERW A;  5F8B A;  2DJ3 A;  2B1K A;  1U6T A;  4V2L A;  5CP1 A;  2YAN A;  12GS A;  1EV9 A;  2C1Y A;  4IP6 A;  1Y6E A;  2O7K A;  3IRA A;  4KA0 A;  3EVI A;  5HFI A;  4MCU A;  2F8F A;  3UIW A;  4RQR A;  3F4S A;  2A2S A;  2WRT A;  2R2J A;  1J08 A;  3GHA A;  1KBN A;  2H66 A;  4PNG A;  1RK4 A;  2KLX A;  4JR6 A;  5G31 A;  1HYU A;  1ZYQ B;  2X64 A;  3IHQ A;  2CZ2 A;  3RAZ A;  2MMA A;  3TJF A;  1XVW A;  5GZZ B;  2NTO A;  10GS A;  4Q5F A;  3QAV A;  1Z6N A;  1FVK A;  1Q98 A;  5IMV A;  1FW1 A;  2LUS A;  1Z9H A;  4TXO A;  3F6D A;  4RQX A;  1AUC A;  3APO A;  1G7E A;  2GDR A;  5L71 A;  2HRN A;  2LQQ A;  4D73 B;  4IJ3 A;  4DSR A;  3DXB A;  1TDI A;  4EDZ A;  1SK1 A;  1N2A A;  2X49 A;  3L9U A;  4K7I A;  4K9Z A;  1K0C A;  1GTA A;  1A8Y A;  3RDW A;  5H5Q A;  4KGI A;  2BJX A;  3C73 A;  1TI1 A;  2RUF A;  3FK8 A;  1CQH A;  1WWJ A;  4KSO A;  2I81 A;  3MNG A;  2NBS A;  4KF9 A;  2MBT A;  1OAZ A;  3GUR A;  4ZL9 A;  2LS5 A;  3ERF A;  1G6W A;  3TRP A;  3G7I A;  2QKE A;  4IHU A;  3TOU A;  2P31 A;  3IXR A;  3GV1 A;  2A2R A;  5IPG A;  4QL7 A;  1Z7P A;  3IBH A;  2YWO A;  1GTI A;  4ZXG A;  2H1B A;  2DBC A;  4KDY A;  1U3A A;  2RM5 A;  3GL5 A;  2DLX A;  2H8L A;  1YDK A;  2C0F A;  2MYG A;  4MH2 A;  4L5O A;  4YQM A;  5GSS A;  4IS0 A;  4GLT A;  5EY6 A;  4K0G A;  3P8W A;  4IW9 A;  3GH6 A;  1W4V A;  1NSW A;  1Z3E A;  4I8B A;  1V2A A;  1FVJ A;  4TOP A;  3ISO A;  4NWY A;  4HEA 2;  4O92 A;  2PUK C;  1TTZ A;  3FR6 A;  3KP9 A;  5JCU A;  4BVY B;  2VOC A;  1ZOF A;  1J9B A;  1USB A;  1PKW A;  2KUC A;  1DUG A;  1GUL A;  1V40 A;  4OO4 A;  4EUY A;  4JU5 A;  5J4U A;  1BX9 A;  1GL8 A;  1XWK A;  2GST A;  1TK0 B;  2R0G A;  3FEU A;  5DQY A;  1S3A A;  4YKG A;  2JU5 A;  3V1W A;  3LXZ A;  5A5K A;  1R7H A;  2F51 A;  2FA8 A;  4OFN A;  3GNJ A;  1PL2 A;  1SYR A;  1TRU A;  3VK9 A;  1B8X A;  1S3D A;  1GSE A;  3TUE A;  2VLU A;  4K8M A;  1YKA A;  2VL2 A;  4HOJ A;  3DML A;  1XOB A;  2HSM A;  2YJ7 A;  5CRE A;  4FYB A;  5CYY A;  1A0R P;  3GKX A;  5HFG A;  5HR3 A;  1ERT A;  2OBK A;  3R3E A;  3WGX A;  1HQO A;  1XBS A;  4OO5 A;  2CVK A;  1BQ7 A;  3E0U A;  4RI6 A;  4TR3 A;  2M80 A;  2V2G A;  1M2B A;  2HSH A;  2GSQ A;  2DJ2 A;  2ZUP A;  4GF0 A;  4DSS B;  5KN1 A;  3VFI A;  2XPE A;  3LW9 A;  3RPP A;  4WET A;  3QOU A;  2WB9 A;  3GTU B;  2TRC P;  2HZE A;  3BD2 A;  1JLW A;  3IC4 A;  1GUM A;  1WRY A;  3L0H A;  5D93 A;  4NHW A;  4MH3 A;  1QXH A;  1E6B A;  5KN0 A;  1SL2 B;  4ML1 A;  4PX1 A;  4F82 A;  1UVZ A;  4IEL A;  4K7N A;  1GSS A;  2GQL A;  4WKW A;  5EL8 A;  2HRF A;  2CX3 A;  2P5Q A;  1XOA A;  4HJ2 A;  3DVX A;  3VWU A;  1B48 A;  4H86 A;  1OYJ A;  3DYR A;  6GSV A;  2I3Y A;  4IP1 A;  1ZL9 A;  5IMZ A;  3FYG A;  3DIE A;  2OAD A;  2D2Z A;  1M99 A;  2X8H A;  4RI7 A;  1SL0 B;  2FWG A;  4BA7 A;  2HNL A;  3ZYW A;  1VF4 A;  5GAP D;  1GSF A;  2CA8 A;  3ZZX A;  3M9J A;  4FYC A;  5IIZ A;  4J2F A;  1OC9 A;  2PPT A;  3BOA A;  5G1L A;  5IQY A;  2G0F A;  5CRG A;  3QD9 A;  1GTU A;  1SD9 A;  2DJJ A;  4BL7 B;  3QFA C;  1OE7 A;  4MJB A;  3P2A A;  1Z5Y E;  4ZL8 A;  4EF0 A;  4O7H A;  5DAL A;  3TJG A;  19GS A;  2PWJ A;  4MA9 A;  3IR4 A;  1Y25 A;  2GZY A;  3UJ1 A;  2DJK A;  1R4W A;  4QL9 A;  5IOX A;  4ICY A;  3VWV A;  5KN2 A;  2HRK A;  5IMD A;  2PU9 C;  3KTL A;  2REM A;  5IM9 A;  3FR3 A;  2KOK A;  1K0D A;  4G0L A;  1TP9 A;  2L4Q A;  3KZQ A;  2YWN A;  4G19 A;  1IYH A;  1BJX A;  4Q5R A;  1SKS B;  2X4A A;  5FHI A;  1AIU A;  5CAX A;  1ILO A;  1A8L A;  1FG4 A;  2AB6 A;  1TXX A;  1BG5 A;  3KMN A;  1XFL A;  1FB0 A;  4KND A;  3KEB A;  2JSZ A;  2PVQ A;  2L57 A;  1SJI A;  1RW1 A;  4PNF A;  3CSH A;  4WEY A;  4POB A;  1M9B A;  3S9F A;  1I9D A;  4HQZ A;  2WZ9 A;  3QPM A;  1X5C A;  1QK8 A;  3VPQ A;  2JAC A;  3U5R E;  5HQP A;  1GNE A;  3NIV A;  2ALB A;  3ZFB A;  4PXO A;  2LJR A;  3QFB C;  2GQM A;  5ABR A;  4ULX A;  3FW2 A;  1XWC A;  4I6X A;  3CYN A;  2AV4 A;  3EIN A;  2FA4 A;  5D9T A;  4KH7 A;  4ZBA A;  2FGX A;  1THX A;  1FHE A;  1SL1 B;  1TRV A;  2LJK A;  4N0V A;  3TKP A;  1U87 A;  1ZCP A;  4NHZ A;  4XS1 A;  3TCO A;  5DBQ A;  4K0N A;  4ZB8 A;  4JZQ A;  3GST A;  3UBK A;  1OKT A;  6GSX A;  4CW9 A;  1O81 A;  1QGV A;  5A4U A;  4O5R A;  4YAP A;  2HE3 A;  3K8N A;  3GX0 A;  3GMF A;  4MPG A;  1R5P A;  3DD3 A;  1ML6 A;  1SD8 A;  2H76 A;  4K2X A;  1OE8 A;  3D21 A;  1SYX A;  1TI3 A;  4KE3 A;  5AIX A;  3R2Q A;  1X9S B;  1B9Y C;  3L78 A;  4BVX B;  1MDI A;  3P7X A;  3US3 A;  3KH7 A;  2IFQ A;  5HR2 A;  1TJD A;  5G2Z A;  3H79 A;  4XRD A;  4Q5N A;  3EUR A;  3EE2 A;  2I1U A;  1YKC A;  2VIM A;  4GQC A;  1HNA A;  2O85 A;  5JWQ B;  3TKQ A;  2IMK A;  4GRF A;  3ZVJ D;  3NZN A;  4JE1 A;  1PN9 A;  2WDU A;  5ECK B;  3CMI A;  3RHC A;  3HKR A;  5G5F A;  1X0R A;  2C3Q A;  2LEG A;  2CT6 A;  5CRD A;  3APQ A;  2IME A;  4MZW A;  1PGT A;  4K5S A;  3HXS A;  4MAB A;  1O7U A;  4HUA A;  2M46 A;  4BPY A;  3C1S A;  3GRX A;  5IOW A;  5AGY A;  2YP6 A;  2XPD A;  4Z2U A;  2YJH A;  1GUK A;  1ZGN A;  1F6M C;  2VM1 A;  3QMX A;  5ECS A;  5G30 A;  1FAA A;  3TRX A;  3ZIT A;  6GST A;  4EIQ A;  8GSS A;  4YQU A;  2AAW A;  3LYP A;  5ECL B;  2L4C A;  4TR1 A;  1T1V A;  4K6X A;  1EWX A;  5BMU A;  2GZP A;  2LQO A;  4HDE A;  17GS A;  5D96 A;  2L59 A;  3GIX A;  2WUL A;  5DCH A;  5KEJ A;  4ID0 A;  1H4O A;  1XZO A;  3G9B A;  4V1A g;  4J56 E;  1HNB A;  1JZW A;  3GL3 A;  2R4V A;  3F3R A;  1ERU A;  2WFC A;  3IAS 2;  3M1G A;  3APS A;  2IMI A;  5HR1 A;  4WF4 A;  1OKD A;  2ZCT A;  2HFD A;  5DJL A;  2CVB A;  3HA9 A;  1UA5 A;  4MF7 A;  4XS6 A;  2C4J A;  1ON4 A;  4F03 A;  2H30 A;  4ZBB A;  1A2M A;  2QC7 A;  1O73 A;  3TJB A;  1K0B A;  4AGS A;  4EE0 A;  1GNW A;  4IQA A;  2VCW A;  4LL4 B;  2C3T A;  5B8A A;  2YOI A;  2VCX A;  5J3R A;  4KX4 A;  3N5O A;  4KDU A;  4K1F A;  4I2U A;  2IMF A;  4WF5 A;  4ZIL A;  1KNG A;  3QAG A;  4POK A;  3GKN A;  2L5O A;  1OC8 A;  5ID2 B;  2GVP A;  3IAM 2;  2B3S A;  4HZ4 A;  2C3N A;  3TGZ A;  5DCG A;  4PGT A;  4V2M A;  1QUW A;  5A4W A;  4TVE A;  2B7K A;  2H72 A;  4MF6 A;  4OFT A;  3W8J A;  2I9H A;  6GSU A;  4BVY A;  4V1A p;  2RII A;  2Z9S A;  3LFL A;  4ZB9 A;  1SU9 A;  5ECM B;  3EMP A;  2N5B A;  3LQ7 A;  2FWE A;  2HSY A;  1O85 A;  4L8E A;  4MLY A;  4AJ8 A;  4ECJ A;  4AJ7 A;  6GSS A;  3G7Y A;  3I6A A;  1KEB A;  2H19 A;  2VCQ A;  3HHV A;  3IOS A;  3TKS C;  2X8C A;  1YF0 A;  3FZ5 A;  1W89 A;  2GLR A;  3NOF A;  1O8X A;  4IN0 A;  3VUR A;  1V58 A;  3FZA A;  4QQ7 A;  4LLR A;  4GWR A;  4DEJ A;  5DJM A;  1MDK A;  3F4T A;  3LEF A;  4LMW A;  3ZLP A;  4YAV A;  3F3Q A;  11GS A;  3D5J A;  3ED3 A;  3I43 A;  2LST A;  5IMF A;  2OBI A;  1MTC A;  4TKY A;  1PL1 A;  4NPB A;  2VD0 A;  4EIP A;  3FMW A;  4KDX A;  4GST A;  3TRQ A;  1M7T A;  2NPB A;  2YZU A;  5F05 A;  3H93 A;  3HY2 A;  4O5Q A;  1XXU A;  2DJ0 A;  4DSS A;  1ZYP A;  2VUP A;  2EIQ A;  1TRS A;  4K2D A;  1WMJ A;  3GTU A;  4ML6 A;  2GQK A;  4ILF A;  2VL9 A;  3TKR A;  2IJY A;  4OMV A;  3TJJ A;  1GP1 A;  1M2A A;  3TJK A;  5G1K A;  1WJK A;  4BWQ A;  4K5R A;  1YEX A;  2G2Q A;  1GH2 A;  2QA1 A;  1SJZ A;  1WIK A;  9GSS A;  4MMM A;  5J9C A;  3IDV A;  4ISD A;  1WOU A;  2OA7 A;  3RPN A;  1PA3 A;  4HI7 A;  5KN3 A;  1NW2 A;  4I97 A;  5J9B A;  2PMT A;  4YKF A;  4EKZ A;  1UN2 A;  1IYI A;  13GS A;  3BBY A;  1E2Y A;  3EPT A;  1XCC A;  3HVS A;  4GQF A;  5KOW A;  3FKF A;  3M3M A;  4NV2 A;  2VCZ A;  2R0C A;  4WBJ A;  2DKH A;  4ECI A;  1X5D A;  4MZB A;  3DKS A;  4OCF A;  1AXD A;  2YNX A;  4XRA A;  2JZR A;  1YEP A;  3D6I A;  2MZC A;  2GSS A;  3EWL A;  3A2X A;  3VPT A;  2DKI A;  3A5I A;  3D4T A;  1QQ2 A;  4GCI A;  4OD7 A;  4BL7 A;  2JSY A;  4MJE A;  3HZ4 A;  4X1U A;  4GSS A;  1JZD A;  4BWS A;  1LJR A;  4NMU A;  4TR0 A;  3EU4 A;  3ZIJ A;  5GAN D;  2GTU A;  5IPH A;  1A23 A;  1EV4 A;  1GSQ A;  3CTF A;  2K8V A;  2DSA A;  4PUA A;  1SEN A;  2J23 A;  3H4K A;  4TXV A;  5ECO B;  2R3X A;  1K0M A;  3LJR A;  1ZYN A;  4KUN A;  3PPU A;  1NHO A;  4USS A;  4X43 A;  1SKW B;  1K0A A;  4TR4 A;  1XIY A;  2F9S A;  1YY7 A;  2L6C A;  3KD0 A;  5F0G A;  4G0K A;  5DQS A;  2X99 A;  2HT9 A;  1Z6M A;  4ZIJ A;  2HLS A;  3HJO A;  3MWH A;  1MEK A;  1LU4 A;  2R0P A;  2M72 A;  5FT3 A;  14GS A;  3BJ5 A;  3F4R A;  4JED A;  2LV3 A;  4EL1 A;  2NDO A;  3QDN A;  2B7J A;  2E2G A;  2CAI A;  3HYP A;  2LRC A;  3L9V A;  3H8Q A;  1EEM A;  4KCE A;  4IQ1 A;  5IMA A;  1TK5 B;  6GSY A;  3FZ9 A;  2AUV A;  3QR6 A;  2EIO A;  3HD5 A;  3CRT A;  1ABA A;  18GS A;  2MMN A;  4E8H A;  1AC1 A;  3UMA A;  3F6F A;  1PN0 A;  5LNK e;  3LYK A;  4CY8 A;  16GS A;  2F3M A;  3RHB A;  3WD6 A;  5DAL B;  3C8E A;  4MJA A;  2A2P A;  3TKS A;  4IGJ A;  2CX4 A;  5H5R A;  1GTB A;  3PGT A;  3Q18 A;  1FO5 A;  2VCT A;  1MD3 A;  2L5L A;  4LL1 B;  2OAC A;  3LWA A;  4WR5 A;  2P5R A;  2AJQ B;  1HNC A;  3I9V 2;  4EXJ A;  1PQN A;  4P3Y B;  3TDG A;  2L6D A;  4ECB A;  3FRC A;  1DSB A;  3J7Y b;  4LMV A;  3FR9 A;  4WBR D;  2OE1 A;  1TU8 A;  5C00 A;  1A2L A;  5G5E A;  2YWI A;  1GSY A;  2HYX A;  4FH8 A;  1AQW A;  3DWV A;  3E3E A;  1EP8 A;  4XS4 B;  1AQV A;  2JZS A;  3HCZ A;  5B8B A;  4BVX A;  2DJ1 A;  1PD2 1;  3WT1 A;  3IPZ A;  5HR0 A;  2FUG 2;  2ON5 A;  4E8E A;  3ZRE A;  1AAZ A;  3HVX A;  3KJY A;  4KW6 A;  2GT6 A;  4N30 A;  3PR8 A;  2YV7 A;  4PQ1 A;  2RUE A;  2TRX A;  2O8V B;  4Z7X A;  1EGR A;  2YV9 A;  3UVH A;  3QAW A;  1EOH A;  1FOH A;  1XWB A;  1GWC A;  2RM6 A;  2AHE A;  1S3C A;  2H75 A;  5DVB A;  1XWG A;  2QGV A;  1NM3 A;  1PX7 A;  3I69 A;  1XW9 A;  2PGT A;  3M0F A;  2VL2 C;  1A24 A;  3W6G A;  3IE3 A;  2H0I A;  2IL3 A;  3Q6O A;  1GSD A;  4X0X A;  1BYE A;  2GSR A;  2YN1 A;  3WGE A;  2MBS A;  1THO A;  1H75 A;  4IJI A;  3ZML A;  2JZT A;  1Z7R A;  5DAK B;  3D4M A;  3FZ4 A;  5A4V A;  3GFK A;  1JLV A;  1WE0 A;  3IK7 A;  3WYW A;  3ZTL A;  3VWW A;  3Q74 A;  1XPV A;  3D0Z A;  1EP7 A;  3O3T A;  3H1N A;  5JWO B;  2H70 A;  2K18 A;  5F07 A;  1R26 A;  1K0N A;  4ZBD A;  2V1M A;  2OE0 A;  1XVQ A;  2CVD A;  2K9F A;  1A2J A;  7GSS A;  2LRN A;  2VCV A;  4HJM A;  1F3A A;  1XW6 A;  4XCS A;  4TN8 A;  4D73 A;  2HZF A;  1T00 A;  1I5G A;  2C0D A;  4NXI A;  2C0G A;  1V9W A;  1EZK A;  2IFQ B;  3MAK A;  2E0Q A;  1O6J A;  2V6K A;  4L5L A;  3A2W A;  3IA1 A;  1ZZY A;  3GYK A;  4K7O A;  1T7P B;  2GGT A;  2H6Z A;  4F0C A;  4POM A;  1HD2 A;  3D22 A;  3KH9 A;  3UAR A;  1U3I A;  1TW9 A;  2FLS A;  3KCM A;  3TKS E;  5AIV A;  1VF1 A;  4MP4 A;  1GLP A;  4F2I A;  1UC7 A;  5GST A;  5ID2 A;  3ZVJ A;  3MIX A;  2FNO A;  3ME7 A;  2QA2 A;  3C1R A;  6GSW A;  4N11 A;  1TKD B;  2WGR A;  3HDC A;  5IMC A;  4N0Z A;  1K3L A;  2CAQ A;  5CO3 A;  4X4J A;  3WGD A;  4PUF C;  2PER A;  4IKH A;  1PX6 A;  5F06 A;  3UAP A;  4TW5 A;  2V41 A;  5ELG A;  4POL A;  4MJC A;  1M9A A;  1ACV A;  4G2E A;  1T4Z A;  1AW9 A;  2YPM A;  5ECP B;  4TR1 B;  5J5N A;  4AF2 A;  3TOT A;  2WJU A;  1ERV A;  4N10 A;  4ECC A;  1VGL A;  3EC3 A;  1PSQ A;  3ERG A;  4JR4 A;  2XHF A;  1GRX A;  4FO5 A;  5COH A;  4I5Q A;  3C7M A;  4PUR A;  3VI7 A;  2FY6 A;  2P0G A;  4TXO B;  3RBT A;  1JZR A;  3UEM A;  2C8U A;  1SK2 A;  3GKK A;  2H71 A;  1X9W B;  1EOG A;  3LG6 A;  3L4N A;  1WP0 A;  4HU7 A;  2LRT A;  1URM A;  2AYT A;  1X9M B;  2OKA A;  4LA1 A;  4HQS A;  4PTS A;  1JHB A;  3UBL A;  4CDO A;  4DVC A;  2KHP A;  3CTG A;  5LD0 A;  1V57 A;  2QSI A;  2H0H A;  2HI7 A;  1T3B A;  2LNS A;  2H1D A;  1GUH A;  3ME8 A;  5EVO A;  4L0U A;  2IMD A;  4L0W A;  5B6N A;  4IBP A;  4F0B A;  4A5P A;  2HRA A;  4WR4 A;  5E59 A;  1VRS D;  4J57 E;  3BCI A;  4HZ2 A;  3GX8 A;  1CQG A;  4EC0 A;  5CRH A;  2VD1 A;  4ZB6 A;  1PMT A;  20GS A;  5ECI B;  1DBY A;  1BED A;  2X8G A;  1T4Y A;  3SBC A;  1KTE A;  4FYU A;  2V6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...