1Y25A

Structure of mycobacterial thiol peroxidase tpx
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
165
Chain Sequence
HSQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVSATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable thiol peroxidase
publication title Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 54
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2004-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1y25A00
4RI7A 2NDOA 3CSJA 3GFKA 3KM6A 3IR4A 3D4MA 3L4NA 1ON4A 1GSSA 4AF2A 2AUVA 2C4JA 5CNWA 4ZBAA 4QQ7A 3ZFBA 2Z9SA 3R2QA 2P5RA 3KMNA 4MZWA 1A2MA 5HR3A 4K7OA 2LTKA 3KXOA 2XBIA 1K3OA 3ZL5A 4TR1B 1OKDA 3F8UA 3QOUA 1XOBA 1AIUA 1PMTA 1OE8A 1OYJA 5ECIB 4PQIA 1O6JA 4YH2A 4HU7A 4TVEA 1U87A 1SJZA 2OA7A 4F2IA 1GL8A 5GAPD 2DJKA 2GQLA 2H1DA 2LUSA 1AW9A 8GSSA 4GRFA 2TRXA 5CYYA 2O7KA 3DD3A 1RQMA 3ZVJD 3D4TA 1SJIA 1V40A 5G5FA 2JZSA 3GL5A 3FR9A 1S3CA 3QPMA 3E9JB 4JZQA 1PKZA 3V1WA 3IE3A 1M2AA 1WJKA 4ACSA 2VL9A 4KCEA 5LCZA 5FWGA 5D73A 3W8SA 4MJBA 4BWQA 4ZBBA 5COHA 2DJ2A 3ERWA 4POKA 3GKNA 4RQRA 3DMLA 5JWQB 2AAWA 5JWRB 3Q74A 2H74A 2O87A 3I69A 19GSA 1E2YA 4XCSA 1HQOA 3GKMA 1I5GA 1WE0A 2H1GA 4PUFC 5IM9A 4O32A 1EZKA 3QFBC 3FHKA 5IMAA 5D93A 3ZITA 3TKSA 5G1LA 2CZ2A 3IAM2 4I8BA 2CQ9A 3TRQA 2X8HA 5CRGA 4HDEA 4K2DA 3RDWA 3KGKA 1Q98A 2HZEA 5CREA 1A23A 4PXOA 4GWRA 1TRSA 1GLPA 1UVZA 2L6DA 1PA3A 4AGSA 3GYKA 1BG5A 9GSSA 2OADA 5GSTA 3ZYWA 1YF0A 5A5KA 3EC3A 1CQHA 2CVBA 2LRNA 2I1UA 1AAZA 3D6IA 5DALB 1SENA 3F6DA 3G7JA 3Q6OA 2V2GA 3C1SA 3G7YA 4HZ4A 1RK4A 4QL9A 3QCPA 3E0UA 1M9BA 4J57E 1EOHA 2VCXA 1K0BA 5DQYA 1T8EB 2YV9A 4MK3A 3TJFA 3VLNA 2X8CA 2RUEA 2RM6A 3CRTA 3EYTA 1EEMA 1FW1A 5IQYA 3LGCA 4HJ2A 4KB3A 4KNDA 3IXRA 3UEMA 3W6GA 3FZAA 4JR4A 1A8YA 2I9HA 1TU7A 1GUHA 1A2LA 2F9SA 2L57A 3CRUA 2OJLA 2PWJA 1TDIA 5ECSA 2E2GA 1H4OA 1XVWA 1O81A 2HLSA 2L4QA 1F3BA 5KN1A 2TRCP 3HZ4A 2MMAA 4GF0A 1GTUA 3FZ9A 4EL1A 1A0FA 3DEXA 1U6TA 3KP8A 1ZYQB 2NPBA 5IOWA 4JBBA 2DJ0A 2H76A 4TR1A 2DBCA 1GUMA 5H5QA 1M99A 4RI6A 2VL2C 3HVXA 1THOA 4NPBA 3J7Yb 1BYEA 1FB0A 5D9WA 2MMNA 1XW6A 1X5EA 1I9DA 4LMVA 1GSYA 1TKDB 1ZZYA 3D21A 3VWUA 2VUPA 3UVHA 3TJGA 4K9ZA 1R5AA 4WBJA 2DLXA 3IHQA 4PURA 3DXBA 5D96A 2VCQA 1XW5A 4ECBA 2VCWA 3GUSA 5DVBA 2O85A 3H79A 1QK8A 4V1Ag 2PU9C 6GSXA 3MAKA 1Z6NA 4PX1A 2GS3A 2GVPA 4IJIA 1R26A 4KDXA 1U3AA 1XCCA 5A4WA 4KSMA 1K0CA 1DSBA 5GZZB 5D9XA 2IFQB 4WXTA 4GSSA 5KEJA 3WGEA 3GTUB 4ECCA 3J7Yk 3DWVA 2GSRA 2MZCA 5C00A 3LYPA 1M2DA 3ZTLA 2WFCA 1F9MA 2CVKA 2VLTA 2H73A 4PUAA 1YKCA 5DQSA 4XHMA 3I43A 2HSYA 4IP1A 4ULXA 3GKXA 3HKRA 1SD9A 2AHEA 3UVTA 3TGZA 3VURA 4TKYA 5DJLA 1PL1A 2VO4A 4ZB9A 5DALA 3F9UA 1S3DA 5F0GA 4BWSA 4XS4B 5FT3A 2K9FA 1IYHA 4HOJA 1VF2A 4ISDA 2HYXA 3VWWA 2NVLA 1ZL9A 2X8GA 4EXJA 3MDKA 2K8VA 3L78A 2B1KA 4DEJA 3F4RA 5G31A 3TKRA 3RPPA 2CV4A 5ECLB 5JCWA 2VAFA 4BA7A 2M72A 1YKAA 5ID2A 4HZ2A 2IMDA 2PUKC 2HE3A 1E6BA 1PGTA 3TRXA 2GQMA 3WD6A 1NSWA 1MD3A 4K7IA 1PQNA 4KDUA 3PR8A 5IPHA 3FZ5A 3G9BA 4XIHA 2E7PA 2PGTA 3DGQA 4G10A 5JWOB 3HXSA 4K6XA 4NV2A 2FWGA 1FB6A 1FG4A 3GX8A 1JZWA 2JZTA 2VCZA 3O6TA 5E59A 3CMIA 5JCGA 4EUYA 4TXOA 5B7CA 1SK2A 1A0RP 2C0FA 3M9KA 4ILFA 1XWGA 1GTBA 4OFTA 3H93A 4XRDA 1N2AA 2JU5A 2D2ZA 1SD8A 1B9XC 2H1BA 2RLIA 3VI5A 3O76A 5IMCA 5ECKB 2YZHA 1LJRA 1H75A 2IMKA 3M9JA 1MTCA 5DAKA 4ML1A 1SJ6A 4ZBDA 4N10A 5DDLA 1EP7A 2GLRA 4FO5A 2IMEA 4ZL8A 3HVSA 2AB6A 2B5XA 4I6XA 4POMA 1ABAA 3GL3A 2YANA 5G1KA 4DVCA 4DSSA 3G7IA 1TJDA 4MABA 4GSNA 1QGVA 4XRAA 1AQVA 2J23A 5HR0A 4F0CA 2ZUPA 1K0MA 2C3NA 3FR3A 2WCIA 4K8MA 2LNSA 3PH9A 3DVWA 4IJ3A 4L5LA 2WRTA 4V2NA 3ZRDA 1BAYA 1Z5YE 3BBYA 4BL7A 1IYIA 2ZCTA 3APOA 2M80A 1WMJA 2IFQA 2O89A 3DRNA 4XTSA 2KOKA 2LSTA 2VM1A 1F37A 3GTUA 2FD3A 4MZBA 4MCUA 5EL8A 1OAZA 3KIJA 3IBHA 3ME7A 2H6ZA 1GH2A 5EVOA 4CDOA 4K1FA 6GSSA 1GNEA 1XOAA 2OBKA 2B6MA 2BMXA 2A4VA 2N5BA 3DVXA 3BJ5A 13GSA 1XVQA 3TJKA 2YWIA 3QAVA 4EDYA 1XWAA 3HCZA 2IMIA 4BPYA 1B8XA 2GSSA 1MD4A 2XBQA 3FY7A 4PQ1A 2IPAA 4XS4A 22GSA 1VF1A 1TU8A 4I2TA 1TRUA 4HEA2 4FYUA 2YN1A 2ES7A 1EP8A 2G0FA 2H72A 5J5NA 1O7UA 4NMUA 3P2AA 2GSTA 3BCIA 3EURA 2C0GA 3TRPA 1T7PB 2O8VB 5IOXA 3F63A 4IP6A 4FYBA 2AJQB 4BVXA 3TKSE 1Z6MA 1EOGA 2JZRA 1EWXA 4OO4A 2NTOA 1X9SB 5G2ZA 4EKZA 3GSTA 1PL2A 4ECJA 4MPFA 5EPFA 4POBA 2ON5A 2EIOA 1AUCA 4HQZA 3U5RE 2DJ1A 3UAPA 1GSUA 3TKPA 3VI7A 1B4PA 1WWJA 1VF3A 2H71A 4RQXA 2QSIA 1T4ZA 1R7HA 1YEXA 1YF1A 4KGIA 4RUVA 4EC0A 2GZPA 4MMMA 5H5SA 1NHOA 2P31A 2ON7A 1T00A 3GMFA 2HI7A 4IW9A 5EY6A 1WPIA 2LJAA 4Q5FA 4TN8A 3S9FA 1OC9B 3H8QA 3ED3A 3F0IA 1HNAA 3KCMA 1PSQA 4WR5A 3FEUA 2JADA 3TDGA 1T1VA 3EE2A 3ZIJA 4L0WA 2H6YA 5J9CA 1U3IA 3WT1A 1JLWA 3N9JA 5AIXA 5HR2A 3VK9A 4WEYA 2HFDA 5B6NA 16GSA 1SL1B 1Z7PA 5ECNB 1R4WA 3P7XA 2I4AA 3JCML 1J0FA 1EGRA 1NM3A 2YOIA 1A2JA 4HU9A 2N5FA 1TRWA 2XHFA 1K0AA 3U6VA 2REMA 5ELGA 1XBSA 1ERWA 2OE1A 3EMXA 2M46A 2H01A 3W8JA 2WS2A 3I9V2 4K0NA 2C3TA 3FK8A 2GZZA 2IN3A 3SWLA 3GNJA 2E2MA 1ZGNA 2LS5A 2JSYA 2AYTA 4KDYA 2R4VA 2FUG2 2A2SA 4Q5QA 3GN3A 2PN8A 3NZNA 1AC1A 4JRRA 3KD0A 3LQ7A 10GSA 4NWYA 1FVKA 1NW2A 4L5OA 2R2JA 4H86A 3F3QA 4MF6A 4HI7A 1SL2B 4AJ7A 1QQ2A 4JR6A 4BVYA 4AJ8A 4MH3A 2FLSA 5DCHA 1GSFA 1DUGA 3C8EA 1PN9A 2PVOC 4YAPA 4EDZA 5J9BA 3M0FA 3RPNA 1DE1A 4ZL9A 1JHBA 2B1LA 3Q19A 3ISOA 2YWOA 4J56E 2YV7A 4MF5A 2DMLA 3F3RA 1M7TA 2FA8A 5CRHA 1G6WA 2YJ7A 2G2QA 3O3TA 4HJMA 1GP1A 5HFKA 4MH2A 2LKUA 2WDUA 3KTBA 1SK0A 2DSAA 4I2UA 3QAGA 3M3MA 1GTAA 1QMVA 4G19A 3GV1A 2FNOA 5IPGA 1PKWA 3ZMKA 5IMDA 3NIVA 3GHAA 1XFLA 1OVNA 14GSA 4NXIA 4MZCA 5F05A 1B4QA 1ACVA 1JZRA 1ML6A 3QR6A 3C1RA 1OC8A 4NHZA 5CRWA 3RBTA 3M8NA 1TOFA 2C0DA 2L5OA 3ME8A 6GSVA 3US3A 3QAWA 4HS1A 2C80A 2XPEA 1K0OA 4X43A 2IL3A 4N11A 4EVMA 5KN3A 5D8IA 2K18A 2V6KA 3VPQA 4ZB6A 3OR5A 4GSTA 4OCFA 3IOSA 1EV9A 2FA4A 4FIWA 5KN2A 2AV4A 2MBTA 4LLRA 1OKTA 2R5GA 3LWAA 2KP1A 1HYUA 3PGTA 5J3RA 2V6OA 4OO5A 1J9BA 5D9VA 2CVDA 3F6FA 3HD5A 3TKSC 2B5YA 3GSSA 4IGJA 2RUFA 3D5JA 3FRCA 4LA1A 1HD2A 2QGVA 1SU9A 1OC9A 4Q5NA 1J08A 1G0TA 3QDNA 1YEPA 5HFGA 1A8LA 4POLA 1XWKA 2ALBA 4YQMA 1O8XA 4TOPA 2DIYA 2MYGA 4ZL7A 3IRAA 2CAQA 3C73A 1X0RA 2VLUA 2L4CA 4G9HA 3GH6A 5ECMB 2VIMA 2C3QA 4DSRA 3TUEA 1SYXA 4OFMA 2YWMA 5IMVA 1TTZA 3UMAA 3L9UA 2P0GA 1ST9A 3L9SA 1SKRB 3FKFA 4OCEA 4E8EA 1XXUA 1ZOFA 1X5DA 2FGXA 2R6KA 2EIQA 3HJMA 2I3YA 5INYA 1MEKA 3KJYA 4V2LA 3ZMLA 2QKEA 4L0UA 3VWVA 4OFNA 3WT2A 5CP1A 4IS0A 5HR1A 4MP4A 3D22A 1GSQA 4V1Ap 2MMOA 2DJ3A 4WR4A 2R37A 1XW9A 1OC3A 4PQHA 3RHBA 2V1MA 2E0QA 4V2MA 1Y25A 2YZUA 3KZQA 2VL3A 3EWLA 5KN0A 2FWEA 4ML6A 2CZ3A 2QC7A 2H30A 1M0UA 2H0IA 4LL4B 3P90A 1F6MC 2C0EA 1G7EA 1SL0B 2LNTA 4JEDA 1GSEA 1EEJA 4WBRD 3A2VA 1HNBA 2BTOT 5IO0A 2MBSA 4FH8A 3MNGA 4MA9A 1GWCA 5IMFA 3ZIVA 1XIYA 2VLVA 1USBA 1XWBA 5ECOB 2C1YA 1TI3A 1XZOA 1WP0A 4IQAA 1THXA 4ZIJA 1YDKA 5L71A 2N5AA 1SKWB 4NAXA 1Z3EA 2B7JA 3UBLA 1GULA 3GA4A 1XWCA 2KHPA 3MSZA 2VCTA 2X64A 3DYRA 1AQXA 1T3BA 4D73B 2J9HA 4OMVA 2DJJA 3AY8A 5CRDA 2HXKA 4KH7A 4TR4A 3GIXA 3GX0A 1TW9A 3FZ4A 1GUKA 2DC5A 3CXGA 4OD7A 2LRTA 4PGTA 2GT6A 1GLQA 1UA5A 1FO5A 1C72A 3UL3A 2VL2A 3UJ1A 4TR0A 4KX4A 3D0ZA 4MLYA 2H0GA 1PX7A 5B8BA 5IIZA 1B9YC 1BJXA 2IJYA 3TJJA 3EU4A 2OKAA 5ENUA 3HVVA 1TK5B 4ECIA 6GSUA 4TR3A 3CSIA 4YQUA 5ECHB 3CTGA 3GRXA 2H19A 1YJ6A 1VRSD 3UIWA 4KUNA 1T4YA 4GXZA 2JL4A 1V98A 5A4VA 3KTLA 3H1NA 3LEFA 3QMXA 2H8LA 3HZ8A 2MMZA 1BEDA 5C04A 2EC4A 3BD2A 2JSZA 2H0HA 2XPDA 5IO2A 3L9VA 2VD1A 1ERVA 3WGXA 5ECRB 3LYKA 1B48A 3WGDA 4YAVA 3KH9A 1EGOA 3IPZA 3CSHA 4TW5A 4DSQA 5CO3A 1LU4A 3IV4A 5F8BA 1F2EA 2H70A 1G7OA 1M2BA 2X99A 1A24A 2YNXA 4F82A 1K0NA 5B6MA 2IWTA 3WYWA 4ID0A 1YZXA 3TJBA 3TCOA 2PERA 3ERGA 1SK1A 1X9WB 1YQ1A 4OWYA 2RM5A 4WKWA 3K8NA 2CT6A 4KA0A 2OE3A 4FYCA 4ZXGA 5DBQA 6GSTA 2B7KA 2GQKA 4QL7A 3QD9A 4XS1A 2IIYA 5D9TA 4IELA 2OACA 2LV3A 2HT9A 2KLXA 2FHEA 4KCAA 4WF4A 3HDCA 6GSWA 1NHYA 1GTIA 2PVQA 2GDRA 2OE0A 2CA8A 1ERUA 2V41A 2I81A 5H5RA 1JZDA 3GURA 3UOMA 4KE3A 1FAAA 4CHSA 2B3SA 3VPTA 3TB2A 2H1AA 2HNLA 2F3MA 5AN1A 4F03A 3LSZA 2IMFA 2L59A 3ERFA 5LNKe 4JU5A 3LJRA 1KEBA 1QFNA 1TRVA 3IDVA 4IVFA 1TI1A 1V57A 2DIZA 3F4TA 2WGRA 3SBCA 1EV4A 3IK7A 3ZLPA 2GGTA 4MJAA 3FW2A 5JCUA 2F8AA 5AIVA 5G5EA 1PD21 1PX6A 1G6YA 1V9WA 1F3AA 1ZYEA 2F51A 1LBKA 3CYNA 5ELAA 1BX9A 1URMA 4IHUA 2NBSA 4K7NA 5A4UA 5G30A 4MJEA 4KW6A 1VF4A 1W4VA 2LRCA 3HY2A 3EVIA 3VFIA 3BOAA 2L6CA 1Q4JA 1FHEA 5ID2B 17GSA 1KNGA 4D73A 3GH9A 1Y6EA 1Z7RA 1JZOA 2B5EA 2HZFA 3KMOA 5ECPB 3ZZXA 12GSA 1AXDA 1ILOA 3APSA 2LQOA 3E3EA 1K3YA 2RIIA 1O73A 1X5CA 5LD0A 4HUAA 1N8JA 5HFIA 2LQQA 1WRYA 1WOUA 3GKKA 4X0XA 1ERTA 1QXHA 4O92A 4KSOA 3A3TA 2KP2A 2HRFA 4JE1A 4GQCA 5B8AA 4TXOB 2GT5A 1DBYA 2YCDA 4EE0A 11GSA 4I97A 1V58A 2PMTA 4PNGA 2FWFA 3H4KA 1PRXA 4G2EA 2FCHA 3IK9A 3ZREA 3C7MA 1CQGA 2YWNA 3M1GA 3HJPA 2GTUA 4IN0A 2R3XA 7GSSA 5IMZA 2DMMA 5DAKB 5AGYA 2LJRA 1GNWA 4HQSA 3TKQA 3EU3A 4N30A 1FOVA 2V32A 4MDCA 1HNCA 1KBNA 2KUCA 3FYGA 3C71A 4YQVA 5HQPA 4IBPA 2A2RA 4DSSB 5DCGA 2P5QA 4O5RA 4CW9A 1U88A 4IQ1A 1GSDA 3FR6A 3LORA 2PBJA 4NV5A 4KAEA 2YPMA 4N0VA 4TRXA 1ZMAA 20GSA 2WULA 5E4WA 5ABRA 4IKHA 2BJXA 3HA9A 4X1UA 3UBKA 1V2AA 1TK0B 3KEBA 3UARA 4NHWA 4MPGA 1O8WA 3VWXA 3A2XA 4MJCA 2C8UA 5ECQB 2VCVA 4K0GA 3L0HA 3TOTA 4PNFA 3LXTA 4I5QA 3KP9A 2H6XA 2LJKA 3CBUA 4J2FA 2LEGA 3APQA 2PPTA 4LL1B 4N0ZA 2K6VA 1UC7A 1QUWA 3IAS2 2FY6A 5J4UA 2HRNA 3MWHA 3EINA 2EIRA 2VM2A 3F4SA 2JACA 2GZYA 3NOFA 1O85A 2VD0A 2ZNMA 4ZB8A 6GSYA 3P8WA 1ZCPA 1MDJA 1TK8B 1MDKA 3Q18A 2TIRA 1S3AA 1BQ7A 4WF5A 3LXZA 5FHIA 18GSA 2WB9A 2YJHA 1RW1A 2HZEB 2WZ9A 2H75A 5DJMA 1TP9A 1YY7A 3N5OA 1XPVA 2CX4A 4P3YB 3RHCA 1K0DA 5F06A 4GCIA 4XS6A 3KH7A 1M9AA 3A2WA 4ZILA 1WIKA 2XC2A 3QFAC 4GLTA 3A5WA 2OBIA 4TXVA 3ZVJA 1KTEA 4EO3A 2YP6A 2WJUA 2FWHA 1DE2A 1SYRA 5AISA 3PINA 1Z9HA 5CAXA 2HSHA 4F0BA 4MF7A 4E8HA 3DKSA 5GAND 4O7HA 1VGLA 1SKSB 2H66A 4WETA 4F9ZA 3LFLA 3TOUA 3I6AA 1AQWA 2CX3A 1JLVA 4GQFA 3HJOA 2CAIA 4GTUA 4Q5RA 2GSQA 4L8EA 1K3LA 1GRXA 3DIEA 1X9MB 3HHVA 4EF0A 1JFUA 3LG6A 1FVJA 3IC4A 4AJ6A 1TXXA 5F07A 1UN2A 2VOCA 3BCKA 2F8FA 5J41A 3HYPA 4Z7XA 3CTFA 1W89A 1R5PA 1MDIA 2L5LA 3EMPA 1OE7A 5GSSA 4LMWA 2K8SA 3RAZA 3IA1A 3ZFLA
chains in the Genus database with same CATH superfamily
4RI7A 2NDOA 3CSJA 3GFKA 3KM6A 3IR4A 3D4MA 3L4NA 1ON4A 1GSSA 4AF2A 2AUVA 2C4JA 5CNWA 4ZBAA 4QQ7A 3A5IA 3ZFBA 2Z9SA 3R2QA 2P5RA 3KMNA 4MZWA 1A2MA 5HR3A 4K7OA 2LTKA 3KXOA 2XBIA 1K3OA 3ZL5A 4TR1B 1OKDA 3F8UA 3QOUA 1XOBA 1AIUA 1PMTA 1OE8A 1OYJA 5ECIB 4PQIA 1O6JA 4YH2A 4HU7A 4TVEA 1U87A 1SJZA 2OA7A 4F2IA 1GL8A 5GAPD 2DJKA 2GQLA 2H1DA 2LUSA 1AW9A 8GSSA 4GRFA 2TRXA 2O7KA 3DD3A 1RQMA 5CYYA 3ZVJD 3D4TA 5KOXA 1SJIA 1V40A 5G5FA 2JZSA 3GL5A 3FR9A 2HRKA 1S3CA 3QPMA 1ZYNA 3E9JB 4JZQA 1PKZA 3V1WA 3IE3A 1M2AA 1WJKA 4ACSA 2DKHA 2VL9A 4KCEA 5LCZA 5FWGA 5D73A 3W8SA 4MJBA 4BWQA 4ZBBA 5COHA 2DJ2A 3ERWA 4POKA 3GKNA 4RQRA 3DMLA 5JWQB 2AAWA 5JWRB 3Q74A 2H74A 2O87A 3I69A 19GSA 1E2YA 4XCSA 1HQOA 3GKMA 1I5GA 1WE0A 2H1GA 4PUFC 5IM9A 4O32A 1EZKA 3QFBC 3FHKA 5IMAA 5D93A 3ZITA 3TKSA 5G1LA 2CZ2A 3IAM2 4I8BA 2CQ9A 3TRQA 2X8HA 5CRGA 4HDEA 4K2DA 3RDWA 3KGKA 1Q98A 2HZEA 5CREA 1A23A 4PXOA 4GWRA 1TRSA 1GLPA 2A2PA 1UVZA 2L6DA 1PA3A 4AGSA 3GYKA 1BG5A 9GSSA 2OADA 5GSTA 3ZYWA 1YF0A 5A5KA 3EC3A 1CQHA 2CVBA 2LRNA 2I1UA 1AAZA 3D6IA 5DALB 1SENA 3F6DA 3G7JA 3Q6OA 2V2GA 3C1SA 3G7YA 4K2XA 4HZ4A 1RK4A 4QL9A 3QCPA 3E0UA 1M9BA 4J57E 1EOHA 2VCXA 1K0BA 5DQYA 1T8EB 2YV9A 4MK3A 3TJFA 3VLNA 2X8CA 2RUEA 2RM6A 3CRTA 3EYTA 1EEMA 1FW1A 5IQYA 3LGCA 4HJ2A 4KB3A 4KNDA 3IXRA 3UEMA 3W6GA 3FZAA 4JR4A 1A8YA 2I9HA 1TU7A 1GUHA 1A2LA 2F9SA 2L57A 3CRUA 2OJLA 2PWJA 1TDIA 5ECSA 2E2GA 1H4OA 1XVWA 1O81A 2HLSA 2L4QA 3HVNA 1F3BA 5KN1A 2TRCP 4YKGA 3HZ4A 2MMAA 4GF0A 1GTUA 3FZ9A 4EL1A 4FQUA 1A0FA 3DEXA 1U6TA 3KP8A 1ZYQB 2NPBA 5IOWA 4JBBA 2DJ0A 2H76A 4TR1A 2DBCA 1GUMA 5H5QA 1M99A 4RI6A 2VL2C 3HVXA 1THOA 4NPBA 3J7Yb 1BYEA 1FB0A 5D9WA 2MMNA 1XW6A 1X5EA 1I9DA 4LMVA 1GSYA 1TKDB 1ZZYA 3D21A 3VWUA 2VUPA 3UVHA 3TJGA 4K9ZA 1R5AA 4WBJA 2DLXA 3IHQA 4PURA 3DXBA 5D96A 2VCQA 1XW5A 4ECBA 2VCWA 3GUSA 5DVBA 2O85A 3H79A 1QK8A 4V1Ag 2PU9C 6GSXA 3MAKA 1Z6NA 4PX1A 3R3EA 2GS3A 2GVPA 4IJIA 1R26A 4KDXA 1U3AA 1XCCA 5A4WA 4BL7B 4KSMA 1K0CA 1DSBA 5GZZB 5D9XA 2IFQB 4WXTA 4GSSA 5KEJA 3WGEA 3GTUB 4ECCA 3J7Yk 1XG8A 3DWVA 2GSRA 2MZCA 5C00A 3LYPA 1M2DA 3ZTLA 2WFCA 1F9MA 2CVKA 2VLTA 2H73A 4PUAA 2A4HA 1YKCA 5DQSA 4XHMA 3I43A 2HSYA 4IP1A 4ULXA 3GKXA 3HKRA 1SD9A 2AHEA 3UVTA 3TGZA 3VURA 4TKYA 5DJLA 1PL1A 2VO4A 4ZB9A 5DALA 3F9UA 1S3DA 5F0GA 4BWSA 4XS4B 5FT3A 2K9FA 1IYHA 4HOJA 1VF2A 4ISDA 2HYXA 3VWWA 2NVLA 1ZL9A 2X8GA 4EXJA 4G0IA 3MDKA 2K8VA 3L78A 2B1KA 3CQFA 4MNNA 4DEJA 3F4RA 5G31A 3TKRA 3RPPA 2CV4A 5ECLB 5JCWA 2VAFA 4BA7A 2M72A 1YKAA 4BVXB 5ID2A 4HZ2A 2IMDA 2PUKC 2HE3A 1E6BA 1PGTA 3TRXA 2GQMA 4K5SA 3WD6A 1NSWA 1MD3A 1PFOA 4K7IA 1PQNA 4KDUA 3PR8A 5IPHA 3FZ5A 3MYDA 3G9BA 4XIHA 2E7PA 2PGTA 3DGQA 4G10A 5JWOB 1FOHA 3HXSA 4K6XA 4NV2A 2FWGA 1FB6A 1FG4A 3GX8A 1JZWA 2JZTA 2VCZA 3O6TA 5E59A 3CMIA 5JCGA 4EUYA 4TXOA 5B7CA 1SK2A 1A0RP 2C0FA 3M9KA 4ILFA 1XWGA 1GTBA 4OFTA 3H93A 4XRDA 1N2AA 2JU5A 2D2ZA 1SD8A 1B9XC 2H1BA 2RLIA 3VI5A 3O76A 5IMCA 5ECKB 2YZHA 1LJRA 1H75A 2IMKA 3M9JA 1MTCA 5DAKA 4ML1A 1SJ6A 4ZBDA 4N10A 5DDLA 1EP7A 2GLRA 4FO5A 2IMEA 4ZL8A 3HVSA 2AB6A 2B5XA 4I6XA 4POMA 1ABAA 3GL3A 2YANA 5G1KA 4DVCA 4DSSA 3G7IA 1TJDA 4MABA 4G0KA 4GSNA 1QGVA 4XRAA 4ICYA 1AQVA 2J23A 5HR0A 4F0CA 2ZUPA 1K0MA 2C3NA 3FR3A 2WCIA 4K8MA 2LNSA 3PH9A 3DVWA 4IJ3A 4L5LA 2WRTA 4V2NA 3ZRDA 1BAYA 1Z5YE 3BBYA 4BL7A 1IYIA 2ZCTA 3APOA 2M80A 1WMJA 2IFQA 2O89A 3DRNA 4XTSA 2KOKA 2LSTA 2VM1A 1F37A 3GTUA 2FD3A 4MZBA 4MCUA 5EL8A 1OAZA 3KIJA 3IBHA 3ME7A 2H6ZA 1GH2A 4BVYB 5EVOA 4CDOA 4K1FA 6GSSA 1GNEA 1XOAA 2OBKA 2B6MA 2BMXA 2A4VA 2N5BA 3DVXA 3BJ5A 13GSA 1XVQA 3TJKA 2YWIA 3QAVA 4EDYA 1XWAA 3HCZA 2IMIA 4BPYA 1B8XA 2GSSA 1MD4A 2XBQA 3FY7A 4PQ1A 2IPAA 4A5PA 4XS4A 22GSA 1VF1A 1TU8A 4I2TA 1TRUA 4HEA2 4FYUA 2YN1A 2ES7A 1EP8A 2G0FA 2H72A 5J5NA 1O7UA 4NMUA 3P2AA 2GSTA 3BCIA 3EURA 2C0GA 3TRPA 1T7PB 2O8VB 5IOXA 3F63A 4IP6A 4FYBA 2AJQB 4BVXA 3TKSE 3IHGA 1Z6MA 1EOGA 2JZRA 1EWXA 4OO4A 2NTOA 1X9SB 5G2ZA 4EKZA 3GSTA 1PL2A 4ECJA 4MPFA 5EPFA 4POBA 2ON5A 2EIOA 1AUCA 4Z2RA 4HQZA 3U5RE 2DJ1A 3UAPA 1GSUA 3TKPA 3VI7A 1B4PA 1WWJA 4BIKA 1VF3A 2H71A 4RQXA 2QSIA 1T4ZA 4Z2TA 1R7HA 1YEXA 1YF1A 4KGIA 4RUVA 4EC0A 2GZPA 4MMMA 5H5SA 1NHOA 2P31A 2ON7A 1T00A 3GMFA 2HI7A 4IW9A 5EY6A 1WPIA 2LJAA 4Q5FA 4TN8A 4CY6A 3S9FA 1OC9B 3H8QA 3ED3A 3F0IA 1HNAA 3KCMA 1PSQA 4WR5A 3FEUA 2JADA 3TDGA 1T1VA 3EE2A 4EIQA 3ZIJA 4L0WA 2H6YA 5J9CA 1U3IA 3WT1A 1JLWA 3N9JA 5AIXA 5HR2A 3VK9A 4WEYA 2HFDA 5B6NA 16GSA 1SL1B 1Z7PA 5ECNB 1R4WA 3P7XA 2I4AA 3JCML 1J0FA 1EGRA 1NM3A 2YOIA 1A2JA 4HU9A 2N5FA 1TRWA 2XHFA 1K0AA 3U6VA 2REMA 5ELGA 1XBSA 1ERWA 2OE1A 3EMXA 2M46A 2H01A 3W8JA 2WS2A 3I9V2 4K0NA 2C3TA 3FK8A 2GZZA 2IN3A 3SWLA 3GNJA 2E2MA 1ZGNA 2LS5A 2JSYA 2AYTA 4KDYA 2R4VA 2FUG2 2A2SA 4Q5QA 3GN3A 2PN8A 3NZNA 1AC1A 4JRRA 3KD0A 3LQ7A 10GSA 4NWYA 1FVKA 1NW2A 4L5OA 2R2JA 4H86A 3F3QA 4MF6A 4HI7A 1SL2B 4AJ7A 1QQ2A 4JR6A 4BVYA 4AJ8A 4MH3A 2FLSA 5DCHA 1GSFA 1DUGA 3C8EA 1PN9A 2PVOC 4YAPA 4EDZA 5J9BA 4K5RA 3M0FA 3RPNA 1DE1A 4ZL9A 1JHBA 2B1LA 3Q19A 3ISOA 2YWOA 4J56E 2YV7A 4MF5A 2X49A 2DMLA 3F3RA 1M7TA 2FA8A 5CRHA 1G6WA 2YJ7A 2G2QA 3O3TA 4HJMA 1GP1A 5HFKA 4MH2A 2LKUA 2WDUA 3KTBA 1SK0A 2DSAA 2UZ8A 4I2UA 3QAGA 3M3MA 1GTAA 1QMVA 4G19A 3GV1A 2FNOA 5IPGA 4KF9A 1PKWA 3ZMKA 5IMDA 3NIVA 3GHAA 1XFLA 1OVNA 14GSA 4NXIA 4MZCA 5F05A 1B4QA 1ACVA 1JZRA 1M3IA 1ML6A 3QR6A 3C1RA 1OC8A 4NHZA 5CRWA 2R0GA 3RBTA 3M8NA 1TOFA 2C0DA 2L5OA 3ME8A 6GSVA 3US3A 3QAWA 4HS1A 2C80A 2XPEA 1K0OA 4X43A 2IL3A 4N11A 4EVMA 5KN3A 5D8IA 2K18A 2V6KA 3VPQA 4ZB6A 3OR5A 4GSTA 4OCFA 3IOSA 1EV9A 2FA4A 4FIWA 5KN2A 2AV4A 2MBTA 4LLRA 1OKTA 2R5GA 3LWAA 2KP1A 1HYUA 3PGTA 5J3RA 2V6OA 4OO5A 1J9BA 5D9VA 2CVDA 3F6FA 3HD5A 3TKSC 2B5YA 3GSSA 4IGJA 2RUFA 3D5JA 3FRCA 4LA1A 1HD2A 2QGVA 1SU9A 1OC9A 4Q5NA 1J08A 1G0TA 3QDNA 1YEPA 5HFGA 1A8LA 4POLA 1XWKA 2ALBA 4YQMA 1O8XA 4TOPA 4USSA 2DIYA 2MYGA 3FMWA 4ZL7A 3IRAA 2CAQA 3C73A 1X0RA 2VLUA 2L4CA 4G9HA 3GH6A 5ECMB 2VIMA 2C3QA 4DSRA 3TUEA 1SYXA 4OFMA 2YWMA 5IMVA 1TTZA 4O5UA 3UMAA 3L9UA 2P0GA 1ST9A 3L9SA 1SKRB 3FKFA 4OCEA 4E8EA 1XXUA 1ZOFA 1X5DA 2FGXA 2R6KA 2EIQA 3HJMA 2I3YA 5INYA 1MEKA 3KJYA 4V2LA 3ZMLA 2QKEA 4L0UA 3VWVA 4OFNA 3WT2A 5CP1A 4IS0A 5HR1A 4MP4A 3D22A 1GSQA 4V1Ap 2MMOA 2DJ3A 4WR4A 2R37A 1XW9A 1OC3A 2HRAA 4PQHA 3RHBA 2V1MA 2E0QA 4V2MA 1Y25A 2YZUA 3KZQA 2VL3A 3EWLA 5KN0A 2FWEA 4ML6A 2CZ3A 2QC7A 2H30A 1M0UA 2H0IA 4LL4B 3P90A 1F6MC 2C0EA 1G7EA 1SL0B 2LNTA 4JEDA 1GSEA 1EEJA 4WBRD 3A2VA 1HNBA 2BTOT 5IO0A 2MBSA 4FH8A 3MNGA 4MA9A 1GWCA 3PPUA 5IMFA 3ZIVA 1XIYA 2VLVA 1USBA 1XWBA 5ECOB 2C1YA 1TI3A 1XZOA 1WP0A 4IQAA 1THXA 4ZIJA 1YDKA 5L71A 2N5AA 1SKWB 4NAXA 1Z3EA 2B7JA 3UBLA 1GULA 3GA4A 1XWCA 3DYRA 3MSZA 2KHPA 2R0PA 2VCTA 2X64A 1AQXA 1T3BA 2J9HA 4D73B 4OMVA 2DJJA 3AY8A 5CRDA 2HXKA 4KH7A 4TR4A 3GIXA 3EPTA 3GX0A 1TW9A 3FZ4A 1GUKA 2DC5A 3CXGA 4OD7A 2LRTA 4PGTA 2GT6A 1GLQA 1UA5A 2R0CA 1FO5A 1C72A 3UL3A 2VL2A 3UJ1A 4TR0A 4KX4A 3D0ZA 4MLYA 2H0GA 1PX7A 5B8BA 5IIZA 1B9YC 1BJXA 2IJYA 3TJJA 3EU4A 2OKAA 5ENUA 3HVVA 1TK5B 4ECIA 6GSUA 4TR3A 3CSIA 4YQUA 5ECHB 3CTGA 3GRXA 2H19A 1YJ6A 1VRSD 3UIWA 4KUNA 1T4YA 4GXZA 2HSMA 2JL4A 1V98A 5A4VA 3KTLA 3H1NA 3LEFA 3QMXA 2H8LA 3HZ8A 2MMZA 1BEDA 5C04A 2EC4A 3BD2A 2JSZA 2H0HA 2XPDA 5IO2A 3L9VA 2VD1A 1ERVA 3WGXA 5ECRB 3LYKA 1B48A 3WGDA 4YAVA 3KH9A 1EGOA 3IPZA 3CSHA 4TW5A 4DSQA 5CO3A 1LU4A 3IV4A 5F8BA 1F2EA 2H70A 1G7OA 1M2BA 2X99A 1A24A 2YNXA 4F82A 1K0NA 5B6MA 2IWTA 3WYWA 4ID0A 1YZXA 3TJBA 3TCOA 2PERA 3ERGA 1SK1A 1X9WB 1YQ1A 4OWYA 2RM5A 4WKWA 3K8NA 2CT6A 4KA0A 2OE3A 4FYCA 4PTSA 4ZXGA 5DBQA 6GSTA 2B7KA 2GQKA 4QL7A 3QD9A 4XS1A 2IIYA 5D9TA 4IELA 2OACA 2LV3A 2HT9A 2KLXA 2FHEA 4WF4A 4KCAA 3HDCA 6GSWA 1NHYA 1GTIA 2PVQA 2GDRA 2OE0A 2CA8A 1ERUA 2V41A 2I81A 5H5RA 1JZDA 3GURA 3UOMA 4KE3A 1FAAA 4EIPA 4CHSA 2B3SA 3VPTA 3TB2A 2H1AA 2HNLA 2F3MA 5AN1A 4F03A 3LSZA 2IMFA 2L59A 3ERFA 5LNKe 4JU5A 3LJRA 1KEBA 1QFNA 1TRVA 3IDVA 4IVFA 1TI1A 1V57A 2DIZA 3F4TA 1PN0A 2QA2A 2WGRA 3SBCA 1EV4A 3IK7A 3ZLPA 2GGTA 4MJAA 3FW2A 5JCUA 2F8AA 5AIVA 5G5EA 1PD21 1PX6A 1G6YA 1V9WA 1F3AA 1ZYEA 2F51A 1LBKA 3CYNA 5ELAA 1BX9A 1URMA 4IHUA 4CY8A 2NBSA 4K7NA 5A4UA 5G30A 4MJEA 4KW6A 1VF4A 1W4VA 2LRCA 3HY2A 3EVIA 3VFIA 3BOAA 2L6CA 1Q4JA 1FHEA 5ID2B 17GSA 1KNGA 4D73A 3GH9A 1Y6EA 1Z7RA 1JZOA 2B5EA 2HZFA 3KMOA 5ECPB 3ZZXA 12GSA 1AXDA 1ILOA 3APSA 2LQOA 3E3EA 1K3YA 2RIIA 1O73A 1X5CA 5LD0A 4HUAA 2QA1A 1N8JA 5HFIA 2LQQA 1WRYA 1WOUA 3GKKA 5KOWA 4X0XA 1ERTA 1QXHA 4O92A 4KSOA 3A3TA 1M3JA 2HRFA 2KP2A 4JE1A 4GQCA 1ZYPA 5B8AA 4TXOB 2GT5A 1DBYA 2YCDA 4EE0A 11GSA 4I97A 1V58A 2PMTA 4PNGA 2FWFA 3H4KA 1PRXA 4G2EA 2FCHA 3IK9A 3ZREA 3C7MA 1CQGA 2YWNA 3M1GA 3HJPA 2GTUA 4IN0A 2R3XA 7GSSA 5IMZA 2DMMA 5DAKB 5AGYA 2LJRA 1GNWA 4HQSA 3TKQA 3EU3A 4N30A 1FOVA 2V32A 4MDCA 1HNCA 3MIXA 1KBNA 2KUCA 3FYGA 3C71A 4YQVA 5HQPA 4IBPA 2A2RA 4DSSB 5DCGA 2P5QA 4Z2UA 4O5RA 4CW9A 5BRTA 1U88A 4IQ1A 1GSDA 3FR6A 3LORA 2PBJA 4NV5A 4KAEA 2YPMA 4N0VA 4TRXA 1ZMAA 20GSA 2WULA 5E4WA 5ABRA 4IKHA 2BJXA 3HA9A 2X4AA 4X1UA 3UBKA 1V2AA 1TK0B 3KEBA 4YKFA 3UARA 4NHWA 4MPGA 1O8WA 3VWXA 3A2XA 4G0LA 4MJCA 2C8UA 5ECQB 2VCVA 4K0GA 3L0HA 3TOTA 4PNFA 3LXTA 4I5QA 3KP9A 2H6XA 2LJKA 3CBUA 4J2FA 2LEGA 3APQA 2PPTA 1S3RA 4LL1B 4N0ZA 2K6VA 1UC7A 1QUWA 3IAS2 2FY6A 5J4UA 2HRNA 3MWHA 3EINA 2EIRA 2VM2A 4X4JA 3F4SA 2JACA 4O5QA 2GZYA 3NOFA 1O85A 2VD0A 2ZNMA 4ZB8A 6GSYA 3P8WA 1ZCPA 1MDJA 1TK8B 1MDKA 3Q18A 2TIRA 1S3AA 1BQ7A 4WF5A 3LXZA 5FHIA 18GSA 2WB9A 2YJHA 1RW1A 2HZEB 2WZ9A 2H75A 5DJMA 1TP9A 1YY7A 3N5OA 1XPVA 2CX4A 4P3YB 3RHCA 1K0DA 5F06A 4GCIA 4XS6A 3KH7A 1M9AA 3A2WA 4ZILA 1WIKA 2XC2A 3QFAC 4GLTA 3A5WA 2OBIA 4TXVA 3ZVJA 1KTEA 4EO3A 2YP6A 2WJUA 2FWHA 1DE2A 1SYRA 5AISA 5BMUA 3PINA 1Z9HA 5CAXA 2HSHA 4F0BA 4HSCX 4MF7A 4E8HA 3DKSA 5GAND 4O7HA 2DKIA 1VGLA 1SKSB 2H66A 4WETA 4F9ZA 3LFLA 3TOUA 3I6AA 1AQWA 2CX3A 1JLVA 4GQFA 3HJOA 2CAIA 4GTUA 4Q5RA 2GSQA 4L8EA 1K3LA 3IC8A 1GRXA 3DIEA 1X9MB 3HHVA 4EF0A 1JFUA 3LG6A 1FVJA 3IC4A 4AJ6A 1TXXA 1UN2A 5F07A 2VOCA 3BCKA 2F8FA 5J41A 3HYPA 4Z7XA 3CTFA 1W89A 1R5PA 3LW9A 1MDIA 2L5LA 3EMPA 1OE7A 5GSSA 4LMWA 2K8SA 3RAZA 3IA1A 3ZFLA
chains in the Genus database with same CATH topology
4RI7A 2NDOA 3CSJA 3GFKA 3KM6A 3IR4A 3D4MA 3L4NA 1ON4A 1GSSA 4AF2A 2AUVA 2C4JA 5CNWA 4ZBAA 4QQ7A 3A5IA 3ZFBA 2Z9SA 3R2QA 2P5RA 3KMNA 4MZWA 1A2MA 5HR3A 4K7OA 2LTKA 3KXOA 2XBIA 1K3OA 3ZL5A 4TR1B 1OKDA 3F8UA 3QOUA 1XOBA 1AIUA 1PMTA 1OE8A 1OYJA 5ECIB 4PQIA 1O6JA 4YH2A 4HU7A 4TVEA 1U87A 1SJZA 2OA7A 4F2IA 1GL8A 5GAPD 2DJKA 2GQLA 2H1DA 2LUSA 1AW9A 8GSSA 4GRFA 2TRXA 5CYYA 2O7KA 3DD3A 1RQMA 3ZVJD 3D4TA 5KOXA 1SJIA 1V40A 5G5FA 2JZSA 3GL5A 3FR9A 2HRKA 1S3CA 3QPMA 1ZYNA 3E9JB 4JZQA 1PKZA 3V1WA 3IE3A 1M2AA 1WJKA 4ACSA 2DKHA 2VL9A 4KCEA 5LCZA 5FWGA 5D73A 3W8SA 4MJBA 4BWQA 4ZBBA 5COHA 2DJ2A 3ERWA 4POKA 3GKNA 4RQRA 3DMLA 5JWQB 2AAWA 5JWRB 3Q74A 2H74A 2O87A 3I69A 19GSA 1E2YA 4XCSA 1HQOA 3GKMA 1I5GA 1WE0A 2H1GA 4PUFC 5IM9A 4O32A 1EZKA 3QFBC 3FHKA 5IMAA 5D93A 3ZITA 3TKSA 5G1LA 2CZ2A 3IAM2 4I8BA 2CQ9A 3TRQA 2X8HA 5CRGA 4HDEA 4K2DA 3RDWA 3KGKA 1Q98A 2HZEA 5CREA 1A23A 4PXOA 4GWRA 1TRSA 1GLPA 2A2PA 1UVZA 2L6DA 1PA3A 4AGSA 3GYKA 1BG5A 9GSSA 2OADA 5GSTA 3ZYWA 1YF0A 5A5KA 3EC3A 1CQHA 2CVBA 2LRNA 2I1UA 1AAZA 3D6IA 5DALB 1SENA 3F6DA 3G7JA 3Q6OA 2V2GA 3C1SA 3G7YA 4K2XA 4HZ4A 1RK4A 4QL9A 3QCPA 3E0UA 1M9BA 4J57E 1EOHA 2VCXA 1K0BA 5DQYA 1T8EB 2YV9A 4MK3A 3TJFA 3VLNA 2X8CA 2RUEA 2RM6A 3CRTA 3EYTA 1EEMA 1FW1A 5IQYA 3LGCA 4HJ2A 4KB3A 4KNDA 3IXRA 3UEMA 3W6GA 3FZAA 4JR4A 1A8YA 2I9HA 1TU7A 1GUHA 1A2LA 2F9SA 2L57A 3CRUA 2OJLA 2PWJA 1TDIA 5ECSA 2E2GA 1H4OA 1XVWA 1O81A 2HLSA 2L4QA 1F3BA 5KN1A 2TRCP 4YKGA 3HZ4A 2MMAA 4GF0A 1GTUA 3FZ9A 4EL1A 4FQUA 1A0FA 3DEXA 1U6TA 3KP8A 1ZYQB 2NPBA 5IOWA 4JBBA 2DJ0A 2H76A 4TR1A 2DBCA 1GUMA 5H5QA 1M99A 4RI6A 2VL2C 3HVXA 1THOA 4NPBA 3J7Yb 1BYEA 1FB0A 5D9WA 2MMNA 1XW6A 1X5EA 1I9DA 4LMVA 1GSYA 1TKDB 1ZZYA 3D21A 3VWUA 2VUPA 3UVHA 3TJGA 4K9ZA 1R5AA 4WBJA 2DLXA 3IHQA 4PURA 3DXBA 5D96A 2VCQA 1XW5A 4ECBA 2VCWA 3GUSA 5DVBA 2O85A 3H79A 1QK8A 4V1Ag 2PU9C 6GSXA 3MAKA 1Z6NA 4PX1A 3R3EA 2GS3A 2GVPA 4IJIA 1R26A 4KDXA 1U3AA 1XCCA 5A4WA 4BL7B 4KSMA 1K0CA 1DSBA 5GZZB 5D9XA 2IFQB 4WXTA 4GSSA 5KEJA 3WGEA 3GTUB 4ECCA 3J7Yk 3DWVA 2GSRA 2MZCA 5C00A 3LYPA 1M2DA 3ZTLA 2WFCA 1F9MA 2CVKA 2VLTA 2H73A 4PUAA 2A4HA 1YKCA 5DQSA 4XHMA 3I43A 2HSYA 4IP1A 4ULXA 3GKXA 3HKRA 1SD9A 2AHEA 3UVTA 3TGZA 3VURA 4TKYA 5DJLA 1PL1A 2VO4A 4ZB9A 5DALA 3F9UA 1S3DA 5F0GA 4BWSA 4XS4B 5FT3A 2K9FA 1IYHA 4HOJA 1VF2A 4ISDA 2HYXA 3VWWA 2NVLA 1ZL9A 2X8GA 4EXJA 4G0IA 3MDKA 2K8VA 3L78A 2B1KA 4DEJA 4MNNA 3F4RA 5G31A 3TKRA 3RPPA 2CV4A 5ECLB 5JCWA 2VAFA 4BA7A 2M72A 1YKAA 4BVXB 5ID2A 4HZ2A 2IMDA 2PUKC 2HE3A 1E6BA 1PGTA 3TRXA 2GQMA 4K5SA 3WD6A 1NSWA 1MD3A 4K7IA 1PQNA 4KDUA 3PR8A 5IPHA 3FZ5A 3MYDA 3G9BA 4XIHA 2E7PA 2PGTA 3DGQA 4G10A 5JWOB 1FOHA 3HXSA 4K6XA 4NV2A 2FWGA 1FB6A 1FG4A 3GX8A 1JZWA 2JZTA 2VCZA 3O6TA 5E59A 3CMIA 5JCGA 4EUYA 4TXOA 5B7CA 1SK2A 1A0RP 2C0FA 3M9KA 4ILFA 1XWGA 1GTBA 4OFTA 3H93A 4XRDA 1N2AA 2JU5A 2D2ZA 1SD8A 1B9XC 2H1BA 2RLIA 3VI5A 3O76A 5IMCA 5ECKB 2YZHA 1LJRA 1H75A 2IMKA 3M9JA 1MTCA 5DAKA 4ML1A 1SJ6A 4ZBDA 4N10A 5DDLA 1EP7A 2GLRA 4FO5A 2IMEA 4ZL8A 3HVSA 2AB6A 2B5XA 4I6XA 4POMA 1ABAA 3GL3A 2YANA 5G1KA 4DVCA 4DSSA 3G7IA 1TJDA 4MABA 4G0KA 4GSNA 1QGVA 4XRAA 4ICYA 1AQVA 2J23A 5HR0A 4F0CA 2ZUPA 1K0MA 2C3NA 3FR3A 2WCIA 4K8MA 2LNSA 3PH9A 3DVWA 4IJ3A 4L5LA 2WRTA 4V2NA 3ZRDA 1BAYA 1Z5YE 3BBYA 4BL7A 1IYIA 2ZCTA 3APOA 2M80A 1WMJA 2IFQA 2O89A 3DRNA 4XTSA 2KOKA 2LSTA 2VM1A 1F37A 3GTUA 2FD3A 4MZBA 4MCUA 5EL8A 1OAZA 3KIJA 3IBHA 3ME7A 2H6ZA 1GH2A 4BVYB 5EVOA 4CDOA 4K1FA 6GSSA 1GNEA 1XOAA 2OBKA 2B6MA 2BMXA 2A4VA 2N5BA 3DVXA 3BJ5A 13GSA 1XVQA 3TJKA 2YWIA 3QAVA 4EDYA 1XWAA 3HCZA 2IMIA 4BPYA 1B8XA 2GSSA 1MD4A 2XBQA 3FY7A 4PQ1A 2IPAA 4A5PA 4XS4A 22GSA 1VF1A 1TU8A 4I2TA 1TRUA 4HEA2 4FYUA 2YN1A 2ES7A 1EP8A 2G0FA 2H72A 5J5NA 1O7UA 4NMUA 3P2AA 2GSTA 3BCIA 3EURA 2C0GA 3TRPA 1T7PB 2O8VB 5IOXA 3F63A 4IP6A 4FYBA 2AJQB 4BVXA 3TKSE 3IHGA 1Z6MA 1EOGA 2JZRA 1EWXA 4OO4A 2NTOA 1X9SB 5G2ZA 4EKZA 3GSTA 1PL2A 4ECJA 4MPFA 5EPFA 4POBA 2ON5A 2EIOA 1AUCA 4Z2RA 4HQZA 3U5RE 2DJ1A 3UAPA 1GSUA 3TKPA 3VI7A 1B4PA 1WWJA 1VF3A 2H71A 4RQXA 2QSIA 1T4ZA 4Z2TA 1R7HA 1YEXA 1YF1A 4KGIA 4RUVA 4EC0A 2GZPA 4MMMA 5H5SA 1NHOA 2P31A 2ON7A 1T00A 3GMFA 2HI7A 4IW9A 5EY6A 1WPIA 2LJAA 4Q5FA 4TN8A 4CY6A 3S9FA 1OC9B 3H8QA 3ED3A 3F0IA 1HNAA 3KCMA 1PSQA 4WR5A 3FEUA 2JADA 3TDGA 1T1VA 3EE2A 4EIQA 3ZIJA 4L0WA 2H6YA 5J9CA 1U3IA 3WT1A 1JLWA 3N9JA 5AIXA 5HR2A 3VK9A 4WEYA 2HFDA 5B6NA 16GSA 1SL1B 1Z7PA 5ECNB 1R4WA 3P7XA 2I4AA 3JCML 1J0FA 1EGRA 1NM3A 2YOIA 1A2JA 4HU9A 2N5FA 1TRWA 2XHFA 1K0AA 3U6VA 2REMA 5ELGA 1XBSA 1ERWA 2OE1A 3EMXA 2M46A 2H01A 3W8JA 2WS2A 3I9V2 4K0NA 2C3TA 3FK8A 2GZZA 2IN3A 3SWLA 3GNJA 2E2MA 1ZGNA 2LS5A 2JSYA 2AYTA 4KDYA 2R4VA 2FUG2 2A2SA 4Q5QA 3GN3A 2PN8A 3NZNA 1AC1A 4JRRA 3KD0A 3LQ7A 10GSA 4NWYA 1FVKA 1NW2A 4L5OA 2R2JA 4H86A 3F3QA 4MF6A 4HI7A 1SL2B 4AJ7A 1QQ2A 4JR6A 4BVYA 4AJ8A 4MH3A 2FLSA 5DCHA 1GSFA 1DUGA 3C8EA 1PN9A 2PVOC 4YAPA 4EDZA 5J9BA 4K5RA 3M0FA 3RPNA 1DE1A 4ZL9A 1JHBA 2B1LA 3Q19A 3ISOA 2YWOA 4J56E 2YV7A 4MF5A 2X49A 2DMLA 3F3RA 1M7TA 2FA8A 5CRHA 1G6WA 2YJ7A 2G2QA 3O3TA 4HJMA 1GP1A 5HFKA 4MH2A 2LKUA 2WDUA 3KTBA 1SK0A 2DSAA 2UZ8A 4I2UA 3QAGA 3M3MA 1GTAA 1QMVA 4G19A 3GV1A 2FNOA 5IPGA 4KF9A 1PKWA 3ZMKA 5IMDA 3NIVA 3GHAA 1XFLA 1OVNA 14GSA 4NXIA 4MZCA 5F05A 1B4QA 1ACVA 1JZRA 1ML6A 3QR6A 3C1RA 1OC8A 4NHZA 5CRWA 2R0GA 3RBTA 3M8NA 1TOFA 2C0DA 2L5OA 3ME8A 6GSVA 3US3A 3QAWA 4HS1A 2C80A 2XPEA 1K0OA 4X43A 2IL3A 4N11A 4EVMA 5KN3A 5D8IA 2K18A 2V6KA 3VPQA 4ZB6A 3OR5A 4GSTA 4OCFA 3IOSA 1EV9A 2FA4A 4FIWA 5KN2A 2AV4A 2MBTA 4LLRA 1OKTA 2R5GA 3LWAA 2KP1A 1HYUA 3PGTA 5J3RA 2V6OA 4OO5A 1J9BA 5D9VA 2CVDA 3F6FA 3HD5A 3TKSC 2B5YA 3GSSA 4IGJA 2RUFA 3D5JA 3FRCA 4LA1A 1HD2A 2QGVA 1SU9A 1OC9A 4Q5NA 1J08A 1G0TA 3QDNA 1YEPA 5HFGA 1A8LA 4POLA 1XWKA 2ALBA 4YQMA 1O8XA 4TOPA 4USSA 2DIYA 2MYGA 3FMWA 4ZL7A 3IRAA 2CAQA 3C73A 1X0RA 2VLUA 2L4CA 4G9HA 3GH6A 5ECMB 2VIMA 2C3QA 4DSRA 3TUEA 1SYXA 4OFMA 2YWMA 5IMVA 1TTZA 4O5UA 3UMAA 3L9UA 2P0GA 1ST9A 3L9SA 1SKRB 3FKFA 4OCEA 4E8EA 1XXUA 1ZOFA 1X5DA 2FGXA 2R6KA 2EIQA 3HJMA 2I3YA 5INYA 1MEKA 3KJYA 4V2LA 3ZMLA 2QKEA 4L0UA 3VWVA 4OFNA 3WT2A 5CP1A 4IS0A 5HR1A 4MP4A 3D22A 1GSQA 4V1Ap 2MMOA 2DJ3A 4WR4A 2R37A 1XW9A 1OC3A 2HRAA 4PQHA 3RHBA 2V1MA 2E0QA 4V2MA 1Y25A 2YZUA 3KZQA 2VL3A 3EWLA 5KN0A 2FWEA 4ML6A 2CZ3A 2QC7A 2H30A 1M0UA 2H0IA 4LL4B 3P90A 1F6MC 2C0EA 1G7EA 1SL0B 2LNTA 4JEDA 1GSEA 1EEJA 4WBRD 3A2VA 1HNBA 2BTOT 5IO0A 2MBSA 4FH8A 3MNGA 4MA9A 1GWCA 3PPUA 5IMFA 3ZIVA 1XIYA 2VLVA 1USBA 1XWBA 5ECOB 2C1YA 1TI3A 1XZOA 1WP0A 4IQAA 1THXA 4ZIJA 1YDKA 5L71A 2N5AA 1SKWB 4NAXA 1Z3EA 2B7JA 3UBLA 1GULA 3GA4A 1XWCA 3DYRA 3MSZA 2KHPA 2R0PA 2VCTA 2X64A 1AQXA 1T3BA 2J9HA 4D73B 4OMVA 2DJJA 3AY8A 5CRDA 2HXKA 4KH7A 4TR4A 3GIXA 3EPTA 3GX0A 1TW9A 3FZ4A 1GUKA 2DC5A 3CXGA 4OD7A 2LRTA 4PGTA 2GT6A 1GLQA 1UA5A 2R0CA 1FO5A 1C72A 3UL3A 2VL2A 3UJ1A 4TR0A 4KX4A 3D0ZA 4MLYA 2H0GA 1PX7A 5B8BA 5IIZA 1B9YC 1BJXA 2IJYA 3TJJA 3EU4A 2OKAA 5ENUA 3HVVA 1TK5B 4ECIA 6GSUA 4TR3A 3CSIA 4YQUA 5ECHB 3CTGA 3GRXA 2H19A 1YJ6A 1VRSD 3UIWA 4KUNA 1T4YA 4GXZA 2HSMA 2JL4A 1V98A 5A4VA 3KTLA 3H1NA 3LEFA 3QMXA 2H8LA 3HZ8A 2MMZA 1BEDA 5C04A 2EC4A 3BD2A 2JSZA 2H0HA 2XPDA 5IO2A 3L9VA 2VD1A 1ERVA 3WGXA 5ECRB 3LYKA 1B48A 3WGDA 4YAVA 3KH9A 1EGOA 3IPZA 3CSHA 4TW5A 4DSQA 5CO3A 1LU4A 3IV4A 5F8BA 1F2EA 2H70A 1G7OA 1M2BA 2X99A 1A24A 2YNXA 4F82A 1K0NA 5B6MA 2IWTA 3WYWA 4ID0A 1YZXA 3TJBA 3TCOA 2PERA 3ERGA 1SK1A 1X9WB 1YQ1A 4OWYA 2RM5A 4WKWA 3K8NA 2CT6A 4KA0A 2OE3A 4FYCA 4PTSA 4ZXGA 5DBQA 6GSTA 2B7KA 2GQKA 4QL7A 3QD9A 4XS1A 2IIYA 5D9TA 4IELA 2OACA 2LV3A 2HT9A 2KLXA 2FHEA 4KCAA 4WF4A 3HDCA 6GSWA 1NHYA 1GTIA 2PVQA 2GDRA 2OE0A 2CA8A 1ERUA 2V41A 2I81A 5H5RA 1JZDA 3GURA 3UOMA 4KE3A 1FAAA 4EIPA 4CHSA 2B3SA 3VPTA 3TB2A 2H1AA 2HNLA 2F3MA 5AN1A 4F03A 3LSZA 2IMFA 2L59A 3ERFA 5LNKe 4JU5A 3LJRA 1KEBA 1QFNA 1TRVA 3IDVA 4IVFA 1TI1A 1V57A 2DIZA 3F4TA 1PN0A 2QA2A 2WGRA 3SBCA 1EV4A 3IK7A 3ZLPA 2GGTA 4MJAA 3FW2A 5JCUA 2F8AA 5AIVA 5G5EA 1PD21 1PX6A 1G6YA 1V9WA 1F3AA 1ZYEA 2F51A 1LBKA 3CYNA 5ELAA 1BX9A 1URMA 4IHUA 4CY8A 2NBSA 4K7NA 5A4UA 5G30A 4MJEA 4KW6A 1VF4A 1W4VA 2LRCA 3HY2A 3EVIA 3VFIA 3BOAA 2L6CA 1Q4JA 1FHEA 5ID2B 17GSA 1KNGA 4D73A 3GH9A 1Y6EA 1Z7RA 1JZOA 2B5EA 2HZFA 3KMOA 5ECPB 3ZZXA 12GSA 1AXDA 1ILOA 3APSA 2LQOA 3E3EA 1K3YA 2RIIA 1O73A 1X5CA 5LD0A 4HUAA 2QA1A 1N8JA 5HFIA 2LQQA 1WRYA 1WOUA 3GKKA 5KOWA 4X0XA 1ERTA 1QXHA 4O92A 4KSOA 3A3TA 2KP2A 2HRFA 4JE1A 4GQCA 1ZYPA 5B8AA 4TXOB 2GT5A 1DBYA 2YCDA 4EE0A 11GSA 4I97A 1V58A 2PMTA 4PNGA 2FWFA 3H4KA 1PRXA 4G2EA 2FCHA 3IK9A 3ZREA 3C7MA 1CQGA 2YWNA 3M1GA 3HJPA 2GTUA 4IN0A 2R3XA 7GSSA 5IMZA 2DMMA 5DAKB 5AGYA 2LJRA 1GNWA 4HQSA 3TKQA 3EU3A 4N30A 1FOVA 2V32A 4MDCA 1HNCA 3MIXA 1KBNA 2KUCA 3FYGA 3C71A 4YQVA 5HQPA 4IBPA 2A2RA 4DSSB 5DCGA 2P5QA 4Z2UA 4O5RA 4CW9A 5BRTA 1U88A 4IQ1A 1GSDA 3FR6A 3LORA 2PBJA 4NV5A 4KAEA 2YPMA 4N0VA 4TRXA 1ZMAA 20GSA 2WULA 5E4WA 5ABRA 4IKHA 2BJXA 3HA9A 2X4AA 4X1UA 3UBKA 1V2AA 1TK0B 3KEBA 4YKFA 3UARA 4NHWA 4MPGA 1O8WA 3VWXA 3A2XA 4G0LA 4MJCA 2C8UA 5ECQB 2VCVA 4K0GA 3L0HA 3TOTA 4PNFA 3LXTA 4I5QA 3KP9A 2H6XA 2LJKA 3CBUA 4J2FA 2LEGA 3APQA 2PPTA 4LL1B 4N0ZA 2K6VA 1UC7A 1QUWA 3IAS2 2FY6A 5J4UA 2HRNA 3MWHA 3EINA 2EIRA 2VM2A 4X4JA 3F4SA 2JACA 4O5QA 2GZYA 3NOFA 1O85A 2VD0A 2ZNMA 4ZB8A 6GSYA 3P8WA 1ZCPA 1MDJA 1TK8B 1MDKA 3Q18A 2TIRA 1S3AA 1BQ7A 4WF5A 3LXZA 5FHIA 18GSA 2WB9A 2YJHA 1RW1A 2HZEB 2WZ9A 2H75A 5DJMA 1TP9A 1YY7A 3N5OA 1XPVA 2CX4A 4P3YB 3RHCA 1K0DA 5F06A 4GCIA 4XS6A 3KH7A 1M9AA 3A2WA 4ZILA 1WIKA 2XC2A 3QFAC 4GLTA 3A5WA 2OBIA 4TXVA 3ZVJA 1KTEA 4EO3A 2YP6A 2WJUA 2FWHA 1DE2A 1SYRA 5AISA 5BMUA 3PINA 1Z9HA 5CAXA 2HSHA 4F0BA 4MF7A 4E8HA 3DKSA 5GAND 4O7HA 2DKIA 1VGLA 1SKSB 2H66A 4WETA 4F9ZA 3LFLA 3TOUA 3I6AA 1AQWA 2CX3A 1JLVA 4GQFA 3HJOA 2CAIA 4GTUA 4Q5RA 2GSQA 4L8EA 1K3LA 3IC8A 1GRXA 3DIEA 1X9MB 3HHVA 4EF0A 1JFUA 3LG6A 1FVJA 3IC4A 4AJ6A 1TXXA 1UN2A 5F07A 2VOCA 3BCKA 2F8FA 5J41A 3HYPA 4Z7XA 3CTFA 1W89A 1R5PA 3LW9A 1MDIA 2L5LA 3EMPA 1OE7A 5GSSA 4LMWA 2K8SA 3RAZA 3IA1A 3ZFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RI7 A;  2NDO A;  3CSJ A;  3GFK A;  3KM6 A;  3IR4 A;  3D4M A;  3L4N A;  1ON4 A;  1GSS A;  4AF2 A;  2AUV A;  2C4J A;  5CNW A;  4ZBA A;  4QQ7 A;  3ZFB A;  2Z9S A;  3R2Q A;  2P5R A;  3KMN A;  4MZW A;  1A2M A;  5HR3 A;  4K7O A;  2LTK A;  3KXO A;  2XBI A;  1K3O A;  3ZL5 A;  4TR1 B;  1OKD A;  3F8U A;  3QOU A;  1XOB A;  1AIU A;  1PMT A;  1OE8 A;  1OYJ A;  5ECI B;  4PQI A;  1O6J A;  4YH2 A;  4HU7 A;  4TVE A;  1U87 A;  1SJZ A;  2OA7 A;  4F2I A;  1GL8 A;  5GAP D;  2DJK A;  2GQL A;  2H1D A;  2LUS A;  1AW9 A;  8GSS A;  4GRF A;  2TRX A;  5CYY A;  2O7K A;  3DD3 A;  1RQM A;  3ZVJ D;  3D4T A;  1SJI A;  1V40 A;  5G5F A;  2JZS A;  3GL5 A;  3FR9 A;  1S3C A;  3QPM A;  3E9J B;  4JZQ A;  1PKZ A;  3V1W A;  3IE3 A;  1M2A A;  1WJK A;  4ACS A;  2VL9 A;  4KCE A;  5LCZ A;  5FWG A;  5D73 A;  3W8S A;  4MJB A;  4BWQ A;  4ZBB A;  5COH A;  2DJ2 A;  3ERW A;  4POK A;  3GKN A;  4RQR A;  3DML A;  5JWQ B;  2AAW A;  5JWR B;  3Q74 A;  2H74 A;  2O87 A;  3I69 A;  19GS A;  1E2Y A;  4XCS A;  1HQO A;  3GKM A;  1I5G A;  1WE0 A;  2H1G A;  4PUF C;  5IM9 A;  4O32 A;  1EZK A;  3QFB C;  3FHK A;  5IMA A;  5D93 A;  3ZIT A;  3TKS A;  5G1L A;  2CZ2 A;  3IAM 2;  4I8B A;  2CQ9 A;  3TRQ A;  2X8H A;  5CRG A;  4HDE A;  4K2D A;  3RDW A;  3KGK A;  1Q98 A;  2HZE A;  5CRE A;  1A23 A;  4PXO A;  4GWR A;  1TRS A;  1GLP A;  1UVZ A;  2L6D A;  1PA3 A;  4AGS A;  3GYK A;  1BG5 A;  9GSS A;  2OAD A;  5GST A;  3ZYW A;  1YF0 A;  5A5K A;  3EC3 A;  1CQH A;  2CVB A;  2LRN A;  2I1U A;  1AAZ A;  3D6I A;  5DAL B;  1SEN A;  3F6D A;  3G7J A;  3Q6O A;  2V2G A;  3C1S A;  3G7Y A;  4HZ4 A;  1RK4 A;  4QL9 A;  3QCP A;  3E0U A;  1M9B A;  4J57 E;  1EOH A;  2VCX A;  1K0B A;  5DQY A;  1T8E B;  2YV9 A;  4MK3 A;  3TJF A;  3VLN A;  2X8C A;  2RUE A;  2RM6 A;  3CRT A;  3EYT A;  1EEM A;  1FW1 A;  5IQY A;  3LGC A;  4HJ2 A;  4KB3 A;  4KND A;  3IXR A;  3UEM A;  3W6G A;  3FZA A;  4JR4 A;  1A8Y A;  2I9H A;  1TU7 A;  1GUH A;  1A2L A;  2F9S A;  2L57 A;  3CRU A;  2OJL A;  2PWJ A;  1TDI A;  5ECS A;  2E2G A;  1H4O A;  1XVW A;  1O81 A;  2HLS A;  2L4Q A;  1F3B A;  5KN1 A;  2TRC P;  3HZ4 A;  2MMA A;  4GF0 A;  1GTU A;  3FZ9 A;  4EL1 A;  1A0F A;  3DEX A;  1U6T A;  3KP8 A;  1ZYQ B;  2NPB A;  5IOW A;  4JBB A;  2DJ0 A;  2H76 A;  4TR1 A;  2DBC A;  1GUM A;  5H5Q A;  1M99 A;  4RI6 A;  2VL2 C;  3HVX A;  1THO A;  4NPB A;  3J7Y b;  1BYE A;  1FB0 A;  5D9W A;  2MMN A;  1XW6 A;  1X5E A;  1I9D A;  4LMV A;  1GSY A;  1TKD B;  1ZZY A;  3D21 A;  3VWU A;  2VUP A;  3UVH A;  3TJG A;  4K9Z A;  1R5A A;  4WBJ A;  2DLX A;  3IHQ A;  4PUR A;  3DXB A;  5D96 A;  2VCQ A;  1XW5 A;  4ECB A;  2VCW A;  3GUS A;  5DVB A;  2O85 A;  3H79 A;  1QK8 A;  4V1A g;  2PU9 C;  6GSX A;  3MAK A;  1Z6N A;  4PX1 A;  2GS3 A;  2GVP A;  4IJI A;  1R26 A;  4KDX A;  1U3A A;  1XCC A;  5A4W A;  4KSM A;  1K0C A;  1DSB A;  5GZZ B;  5D9X A;  2IFQ B;  4WXT A;  4GSS A;  5KEJ A;  3WGE A;  3GTU B;  4ECC A;  3J7Y k;  3DWV A;  2GSR A;  2MZC A;  5C00 A;  3LYP A;  1M2D A;  3ZTL A;  2WFC A;  1F9M A;  2CVK A;  2VLT A;  2H73 A;  4PUA A;  1YKC A;  5DQS A;  4XHM A;  3I43 A;  2HSY A;  4IP1 A;  4ULX A;  3GKX A;  3HKR A;  1SD9 A;  2AHE A;  3UVT A;  3TGZ A;  3VUR A;  4TKY A;  5DJL A;  1PL1 A;  2VO4 A;  4ZB9 A;  5DAL A;  3F9U A;  1S3D A;  5F0G A;  4BWS A;  4XS4 B;  5FT3 A;  2K9F A;  1IYH A;  4HOJ A;  1VF2 A;  4ISD A;  2HYX A;  3VWW A;  2NVL A;  1ZL9 A;  2X8G A;  4EXJ A;  3MDK A;  2K8V A;  3L78 A;  2B1K A;  4DEJ A;  3F4R A;  5G31 A;  3TKR A;  3RPP A;  2CV4 A;  5ECL B;  5JCW A;  2VAF A;  4BA7 A;  2M72 A;  1YKA A;  5ID2 A;  4HZ2 A;  2IMD A;  2PUK C;  2HE3 A;  1E6B A;  1PGT A;  3TRX A;  2GQM A;  3WD6 A;  1NSW A;  1MD3 A;  4K7I A;  1PQN A;  4KDU A;  3PR8 A;  5IPH A;  3FZ5 A;  3G9B A;  4XIH A;  2E7P A;  2PGT A;  3DGQ A;  4G10 A;  5JWO B;  3HXS A;  4K6X A;  4NV2 A;  2FWG A;  1FB6 A;  1FG4 A;  3GX8 A;  1JZW A;  2JZT A;  2VCZ A;  3O6T A;  5E59 A;  3CMI A;  5JCG A;  4EUY A;  4TXO A;  5B7C A;  1SK2 A;  1A0R P;  2C0F A;  3M9K A;  4ILF A;  1XWG A;  1GTB A;  4OFT A;  3H93 A;  4XRD A;  1N2A A;  2JU5 A;  2D2Z A;  1SD8 A;  1B9X C;  2H1B A;  2RLI A;  3VI5 A;  3O76 A;  5IMC A;  5ECK B;  2YZH A;  1LJR A;  1H75 A;  2IMK A;  3M9J A;  1MTC A;  5DAK A;  4ML1 A;  1SJ6 A;  4ZBD A;  4N10 A;  5DDL A;  1EP7 A;  2GLR A;  4FO5 A;  2IME A;  4ZL8 A;  3HVS A;  2AB6 A;  2B5X A;  4I6X A;  4POM A;  1ABA A;  3GL3 A;  2YAN A;  5G1K A;  4DVC A;  4DSS A;  3G7I A;  1TJD A;  4MAB A;  4GSN A;  1QGV A;  4XRA A;  1AQV A;  2J23 A;  5HR0 A;  4F0C A;  2ZUP A;  1K0M A;  2C3N A;  3FR3 A;  2WCI A;  4K8M A;  2LNS A;  3PH9 A;  3DVW A;  4IJ3 A;  4L5L A;  2WRT A;  4V2N A;  3ZRD A;  1BAY A;  1Z5Y E;  3BBY A;  4BL7 A;  1IYI A;  2ZCT A;  3APO A;  2M80 A;  1WMJ A;  2IFQ A;  2O89 A;  3DRN A;  4XTS A;  2KOK A;  2LST A;  2VM1 A;  1F37 A;  3GTU A;  2FD3 A;  4MZB A;  4MCU A;  5EL8 A;  1OAZ A;  3KIJ A;  3IBH A;  3ME7 A;  2H6Z A;  1GH2 A;  5EVO A;  4CDO A;  4K1F A;  6GSS A;  1GNE A;  1XOA A;  2OBK A;  2B6M A;  2BMX A;  2A4V A;  2N5B A;  3DVX A;  3BJ5 A;  13GS A;  1XVQ A;  3TJK A;  2YWI A;  3QAV A;  4EDY A;  1XWA A;  3HCZ A;  2IMI A;  4BPY A;  1B8X A;  2GSS A;  1MD4 A;  2XBQ A;  3FY7 A;  4PQ1 A;  2IPA A;  4XS4 A;  22GS A;  1VF1 A;  1TU8 A;  4I2T A;  1TRU A;  4HEA 2;  4FYU A;  2YN1 A;  2ES7 A;  1EP8 A;  2G0F A;  2H72 A;  5J5N A;  1O7U A;  4NMU A;  3P2A A;  2GST A;  3BCI A;  3EUR A;  2C0G A;  3TRP A;  1T7P B;  2O8V B;  5IOX A;  3F63 A;  4IP6 A;  4FYB A;  2AJQ B;  4BVX A;  3TKS E;  1Z6M A;  1EOG A;  2JZR A;  1EWX A;  4OO4 A;  2NTO A;  1X9S B;  5G2Z A;  4EKZ A;  3GST A;  1PL2 A;  4ECJ A;  4MPF A;  5EPF A;  4POB A;  2ON5 A;  2EIO A;  1AUC A;  4HQZ A;  3U5R E;  2DJ1 A;  3UAP A;  1GSU A;  3TKP A;  3VI7 A;  1B4P A;  1WWJ A;  1VF3 A;  2H71 A;  4RQX A;  2QSI A;  1T4Z A;  1R7H A;  1YEX A;  1YF1 A;  4KGI A;  4RUV A;  4EC0 A;  2GZP A;  4MMM A;  5H5S A;  1NHO A;  2P31 A;  2ON7 A;  1T00 A;  3GMF A;  2HI7 A;  4IW9 A;  5EY6 A;  1WPI A;  2LJA A;  4Q5F A;  4TN8 A;  3S9F A;  1OC9 B;  3H8Q A;  3ED3 A;  3F0I A;  1HNA A;  3KCM A;  1PSQ A;  4WR5 A;  3FEU A;  2JAD A;  3TDG A;  1T1V A;  3EE2 A;  3ZIJ A;  4L0W A;  2H6Y A;  5J9C A;  1U3I A;  3WT1 A;  1JLW A;  3N9J A;  5AIX A;  5HR2 A;  3VK9 A;  4WEY A;  2HFD A;  5B6N A;  16GS A;  1SL1 B;  1Z7P A;  5ECN B;  1R4W A;  3P7X A;  2I4A A;  3JCM L;  1J0F A;  1EGR A;  1NM3 A;  2YOI A;  1A2J A;  4HU9 A;  2N5F A;  1TRW A;  2XHF A;  1K0A A;  3U6V A;  2REM A;  5ELG A;  1XBS A;  1ERW A;  2OE1 A;  3EMX A;  2M46 A;  2H01 A;  3W8J A;  2WS2 A;  3I9V 2;  4K0N A;  2C3T A;  3FK8 A;  2GZZ A;  2IN3 A;  3SWL A;  3GNJ A;  2E2M A;  1ZGN A;  2LS5 A;  2JSY A;  2AYT A;  4KDY A;  2R4V A;  2FUG 2;  2A2S A;  4Q5Q A;  3GN3 A;  2PN8 A;  3NZN A;  1AC1 A;  4JRR A;  3KD0 A;  3LQ7 A;  10GS A;  4NWY A;  1FVK A;  1NW2 A;  4L5O A;  2R2J A;  4H86 A;  3F3Q A;  4MF6 A;  4HI7 A;  1SL2 B;  4AJ7 A;  1QQ2 A;  4JR6 A;  4BVY A;  4AJ8 A;  4MH3 A;  2FLS A;  5DCH A;  1GSF A;  1DUG A;  3C8E A;  1PN9 A;  2PVO C;  4YAP A;  4EDZ A;  5J9B A;  3M0F A;  3RPN A;  1DE1 A;  4ZL9 A;  1JHB A;  2B1L A;  3Q19 A;  3ISO A;  2YWO A;  4J56 E;  2YV7 A;  4MF5 A;  2DML A;  3F3R A;  1M7T A;  2FA8 A;  5CRH A;  1G6W A;  2YJ7 A;  2G2Q A;  3O3T A;  4HJM A;  1GP1 A;  5HFK A;  4MH2 A;  2LKU A;  2WDU A;  3KTB A;  1SK0 A;  2DSA A;  4I2U A;  3QAG A;  3M3M A;  1GTA A;  1QMV A;  4G19 A;  3GV1 A;  2FNO A;  5IPG A;  1PKW A;  3ZMK A;  5IMD A;  3NIV A;  3GHA A;  1XFL A;  1OVN A;  14GS A;  4NXI A;  4MZC A;  5F05 A;  1B4Q A;  1ACV A;  1JZR A;  1ML6 A;  3QR6 A;  3C1R A;  1OC8 A;  4NHZ A;  5CRW A;  3RBT A;  3M8N A;  1TOF A;  2C0D A;  2L5O A;  3ME8 A;  6GSV A;  3US3 A;  3QAW A;  4HS1 A;  2C80 A;  2XPE A;  1K0O A;  4X43 A;  2IL3 A;  4N11 A;  4EVM A;  5KN3 A;  5D8I A;  2K18 A;  2V6K A;  3VPQ A;  4ZB6 A;  3OR5 A;  4GST A;  4OCF A;  3IOS A;  1EV9 A;  2FA4 A;  4FIW A;  5KN2 A;  2AV4 A;  2MBT A;  4LLR A;  1OKT A;  2R5G A;  3LWA A;  2KP1 A;  1HYU A;  3PGT A;  5J3R A;  2V6O A;  4OO5 A;  1J9B A;  5D9V A;  2CVD A;  3F6F A;  3HD5 A;  3TKS C;  2B5Y A;  3GSS A;  4IGJ A;  2RUF A;  3D5J A;  3FRC A;  4LA1 A;  1HD2 A;  2QGV A;  1SU9 A;  1OC9 A;  4Q5N A;  1J08 A;  1G0T A;  3QDN A;  1YEP A;  5HFG A;  1A8L A;  4POL A;  1XWK A;  2ALB A;  4YQM A;  1O8X A;  4TOP A;  2DIY A;  2MYG A;  4ZL7 A;  3IRA A;  2CAQ A;  3C73 A;  1X0R A;  2VLU A;  2L4C A;  4G9H A;  3GH6 A;  5ECM B;  2VIM A;  2C3Q A;  4DSR A;  3TUE A;  1SYX A;  4OFM A;  2YWM A;  5IMV A;  1TTZ A;  3UMA A;  3L9U A;  2P0G A;  1ST9 A;  3L9S A;  1SKR B;  3FKF A;  4OCE A;  4E8E A;  1XXU A;  1ZOF A;  1X5D A;  2FGX A;  2R6K A;  2EIQ A;  3HJM A;  2I3Y A;  5INY A;  1MEK A;  3KJY A;  4V2L A;  3ZML A;  2QKE A;  4L0U A;  3VWV A;  4OFN A;  3WT2 A;  5CP1 A;  4IS0 A;  5HR1 A;  4MP4 A;  3D22 A;  1GSQ A;  4V1A p;  2MMO A;  2DJ3 A;  4WR4 A;  2R37 A;  1XW9 A;  1OC3 A;  4PQH A;  3RHB A;  2V1M A;  2E0Q A;  4V2M A;  1Y25 A;  2YZU A;  3KZQ A;  2VL3 A;  3EWL A;  5KN0 A;  2FWE A;  4ML6 A;  2CZ3 A;  2QC7 A;  2H30 A;  1M0U A;  2H0I A;  4LL4 B;  3P90 A;  1F6M C;  2C0E A;  1G7E A;  1SL0 B;  2LNT A;  4JED A;  1GSE A;  1EEJ A;  4WBR D;  3A2V A;  1HNB A;  2BTO T;  5IO0 A;  2MBS A;  4FH8 A;  3MNG A;  4MA9 A;  1GWC A;  5IMF A;  3ZIV A;  1XIY A;  2VLV A;  1USB A;  1XWB A;  5ECO B;  2C1Y A;  1TI3 A;  1XZO A;  1WP0 A;  4IQA A;  1THX A;  4ZIJ A;  1YDK A;  5L71 A;  2N5A A;  1SKW B;  4NAX A;  1Z3E A;  2B7J A;  3UBL A;  1GUL A;  3GA4 A;  1XWC A;  2KHP A;  3MSZ A;  2VCT A;  2X64 A;  3DYR A;  1AQX A;  1T3B A;  4D73 B;  2J9H A;  4OMV A;  2DJJ A;  3AY8 A;  5CRD A;  2HXK A;  4KH7 A;  4TR4 A;  3GIX A;  3GX0 A;  1TW9 A;  3FZ4 A;  1GUK A;  2DC5 A;  3CXG A;  4OD7 A;  2LRT A;  4PGT A;  2GT6 A;  1GLQ A;  1UA5 A;  1FO5 A;  1C72 A;  3UL3 A;  2VL2 A;  3UJ1 A;  4TR0 A;  4KX4 A;  3D0Z A;  4MLY A;  2H0G A;  1PX7 A;  5B8B A;  5IIZ A;  1B9Y C;  1BJX A;  2IJY A;  3TJJ A;  3EU4 A;  2OKA A;  5ENU A;  3HVV A;  1TK5 B;  4ECI A;  6GSU A;  4TR3 A;  3CSI A;  4YQU A;  5ECH B;  3CTG A;  3GRX A;  2H19 A;  1YJ6 A;  1VRS D;  3UIW A;  4KUN A;  1T4Y A;  4GXZ A;  2JL4 A;  1V98 A;  5A4V A;  3KTL A;  3H1N A;  3LEF A;  3QMX A;  2H8L A;  3HZ8 A;  2MMZ A;  1BED A;  5C04 A;  2EC4 A;  3BD2 A;  2JSZ A;  2H0H A;  2XPD A;  5IO2 A;  3L9V A;  2VD1 A;  1ERV A;  3WGX A;  5ECR B;  3LYK A;  1B48 A;  3WGD A;  4YAV A;  3KH9 A;  1EGO A;  3IPZ A;  3CSH A;  4TW5 A;  4DSQ A;  5CO3 A;  1LU4 A;  3IV4 A;  5F8B A;  1F2E A;  2H70 A;  1G7O A;  1M2B A;  2X99 A;  1A24 A;  2YNX A;  4F82 A;  1K0N A;  5B6M A;  2IWT A;  3WYW A;  4ID0 A;  1YZX A;  3TJB A;  3TCO A;  2PER A;  3ERG A;  1SK1 A;  1X9W B;  1YQ1 A;  4OWY A;  2RM5 A;  4WKW A;  3K8N A;  2CT6 A;  4KA0 A;  2OE3 A;  4FYC A;  4ZXG A;  5DBQ A;  6GST A;  2B7K A;  2GQK A;  4QL7 A;  3QD9 A;  4XS1 A;  2IIY A;  5D9T A;  4IEL A;  2OAC A;  2LV3 A;  2HT9 A;  2KLX A;  2FHE A;  4KCA A;  4WF4 A;  3HDC A;  6GSW A;  1NHY A;  1GTI A;  2PVQ A;  2GDR A;  2OE0 A;  2CA8 A;  1ERU A;  2V41 A;  2I81 A;  5H5R A;  1JZD A;  3GUR A;  3UOM A;  4KE3 A;  1FAA A;  4CHS A;  2B3S A;  3VPT A;  3TB2 A;  2H1A A;  2HNL A;  2F3M A;  5AN1 A;  4F03 A;  3LSZ A;  2IMF A;  2L59 A;  3ERF A;  5LNK e;  4JU5 A;  3LJR A;  1KEB A;  1QFN A;  1TRV A;  3IDV A;  4IVF A;  1TI1 A;  1V57 A;  2DIZ A;  3F4T A;  2WGR A;  3SBC A;  1EV4 A;  3IK7 A;  3ZLP A;  2GGT A;  4MJA A;  3FW2 A;  5JCU A;  2F8A A;  5AIV A;  5G5E A;  1PD2 1;  1PX6 A;  1G6Y A;  1V9W A;  1F3A A;  1ZYE A;  2F51 A;  1LBK A;  3CYN A;  5ELA A;  1BX9 A;  1URM A;  4IHU A;  2NBS A;  4K7N A;  5A4U A;  5G30 A;  4MJE A;  4KW6 A;  1VF4 A;  1W4V A;  2LRC A;  3HY2 A;  3EVI A;  3VFI A;  3BOA A;  2L6C A;  1Q4J A;  1FHE A;  5ID2 B;  17GS A;  1KNG A;  4D73 A;  3GH9 A;  1Y6E A;  1Z7R A;  1JZO A;  2B5E A;  2HZF A;  3KMO A;  5ECP B;  3ZZX A;  12GS A;  1AXD A;  1ILO A;  3APS A;  2LQO A;  3E3E A;  1K3Y A;  2RII A;  1O73 A;  1X5C A;  5LD0 A;  4HUA A;  1N8J A;  5HFI A;  2LQQ A;  1WRY A;  1WOU A;  3GKK A;  4X0X A;  1ERT A;  1QXH A;  4O92 A;  4KSO A;  3A3T A;  2KP2 A;  2HRF A;  4JE1 A;  4GQC A;  5B8A A;  4TXO B;  2GT5 A;  1DBY A;  2YCD A;  4EE0 A;  11GS A;  4I97 A;  1V58 A;  2PMT A;  4PNG A;  2FWF A;  3H4K A;  1PRX A;  4G2E A;  2FCH A;  3IK9 A;  3ZRE A;  3C7M A;  1CQG A;  2YWN A;  3M1G A;  3HJP A;  2GTU A;  4IN0 A;  2R3X A;  7GSS A;  5IMZ A;  2DMM A;  5DAK B;  5AGY A;  2LJR A;  1GNW A;  4HQS A;  3TKQ A;  3EU3 A;  4N30 A;  1FOV A;  2V32 A;  4MDC A;  1HNC A;  1KBN A;  2KUC A;  3FYG A;  3C71 A;  4YQV A;  5HQP A;  4IBP A;  2A2R A;  4DSS B;  5DCG A;  2P5Q A;  4O5R A;  4CW9 A;  1U88 A;  4IQ1 A;  1GSD A;  3FR6 A;  3LOR A;  2PBJ A;  4NV5 A;  4KAE A;  2YPM A;  4N0V A;  4TRX A;  1ZMA A;  20GS A;  2WUL A;  5E4W A;  5ABR A;  4IKH A;  2BJX A;  3HA9 A;  4X1U A;  3UBK A;  1V2A A;  1TK0 B;  3KEB A;  3UAR A;  4NHW A;  4MPG A;  1O8W A;  3VWX A;  3A2X A;  4MJC A;  2C8U A;  5ECQ B;  2VCV A;  4K0G A;  3L0H A;  3TOT A;  4PNF A;  3LXT A;  4I5Q A;  3KP9 A;  2H6X A;  2LJK A;  3CBU A;  4J2F A;  2LEG A;  3APQ A;  2PPT A;  4LL1 B;  4N0Z A;  2K6V A;  1UC7 A;  1QUW A;  3IAS 2;  2FY6 A;  5J4U A;  2HRN A;  3MWH A;  3EIN A;  2EIR A;  2VM2 A;  3F4S A;  2JAC A;  2GZY A;  3NOF A;  1O85 A;  2VD0 A;  2ZNM A;  4ZB8 A;  6GSY A;  3P8W A;  1ZCP A;  1MDJ A;  1TK8 B;  1MDK A;  3Q18 A;  2TIR A;  1S3A A;  1BQ7 A;  4WF5 A;  3LXZ A;  5FHI A;  18GS A;  2WB9 A;  2YJH A;  1RW1 A;  2HZE B;  2WZ9 A;  2H75 A;  5DJM A;  1TP9 A;  1YY7 A;  3N5O A;  1XPV A;  2CX4 A;  4P3Y B;  3RHC A;  1K0D A;  5F06 A;  4GCI A;  4XS6 A;  3KH7 A;  1M9A A;  3A2W A;  4ZIL A;  1WIK A;  2XC2 A;  3QFA C;  4GLT A;  3A5W A;  2OBI A;  4TXV A;  3ZVJ A;  1KTE A;  4EO3 A;  2YP6 A;  2WJU A;  2FWH A;  1DE2 A;  1SYR A;  5AIS A;  3PIN A;  1Z9H A;  5CAX A;  2HSH A;  4F0B A;  4MF7 A;  4E8H A;  3DKS A;  5GAN D;  4O7H A;  1VGL A;  1SKS B;  2H66 A;  4WET A;  4F9Z A;  3LFL A;  3TOU A;  3I6A A;  1AQW A;  2CX3 A;  1JLV A;  4GQF A;  3HJO A;  2CAI A;  4GTU A;  4Q5R A;  2GSQ A;  4L8E A;  1K3L A;  1GRX A;  3DIE A;  1X9M B;  3HHV A;  4EF0 A;  1JFU A;  3LG6 A;  1FVJ A;  3IC4 A;  4AJ6 A;  1TXX A;  5F07 A;  1UN2 A;  2VOC A;  3BCK A;  2F8F A;  5J41 A;  3HYP A;  4Z7X A;  3CTF A;  1W89 A;  1R5P A;  1MDI A;  2L5L A;  3EMP A;  1OE7 A;  5GSS A;  4LMW A;  2K8S A;  3RAZ A;  3IA1 A;  3ZFL A; 
#chains in the Genus database with same CATH topology
 4RI7 A;  2NDO A;  3CSJ A;  3GFK A;  3KM6 A;  3IR4 A;  3D4M A;  3L4N A;  1ON4 A;  1GSS A;  4AF2 A;  2AUV A;  2C4J A;  5CNW A;  4ZBA A;  4QQ7 A;  3A5I A;  3ZFB A;  2Z9S A;  3R2Q A;  2P5R A;  3KMN A;  4MZW A;  1A2M A;  5HR3 A;  4K7O A;  2LTK A;  3KXO A;  2XBI A;  1K3O A;  3ZL5 A;  4TR1 B;  1OKD A;  3F8U A;  3QOU A;  1XOB A;  1AIU A;  1PMT A;  1OE8 A;  1OYJ A;  5ECI B;  4PQI A;  1O6J A;  4YH2 A;  4HU7 A;  4TVE A;  1U87 A;  1SJZ A;  2OA7 A;  4F2I A;  1GL8 A;  5GAP D;  2DJK A;  2GQL A;  2H1D A;  2LUS A;  1AW9 A;  8GSS A;  4GRF A;  2TRX A;  2O7K A;  3DD3 A;  1RQM A;  5CYY A;  3ZVJ D;  3D4T A;  5KOX A;  1SJI A;  1V40 A;  5G5F A;  2JZS A;  3GL5 A;  3FR9 A;  2HRK A;  1S3C A;  3QPM A;  1ZYN A;  3E9J B;  4JZQ A;  1PKZ A;  3V1W A;  3IE3 A;  1M2A A;  1WJK A;  4ACS A;  2DKH A;  2VL9 A;  4KCE A;  5LCZ A;  5FWG A;  5D73 A;  3W8S A;  4MJB A;  4BWQ A;  4ZBB A;  5COH A;  2DJ2 A;  3ERW A;  4POK A;  3GKN A;  4RQR A;  3DML A;  5JWQ B;  2AAW A;  5JWR B;  3Q74 A;  2H74 A;  2O87 A;  3I69 A;  19GS A;  1E2Y A;  4XCS A;  1HQO A;  3GKM A;  1I5G A;  1WE0 A;  2H1G A;  4PUF C;  5IM9 A;  4O32 A;  1EZK A;  3QFB C;  3FHK A;  5IMA A;  5D93 A;  3ZIT A;  3TKS A;  5G1L A;  2CZ2 A;  3IAM 2;  4I8B A;  2CQ9 A;  3TRQ A;  2X8H A;  5CRG A;  4HDE A;  4K2D A;  3RDW A;  3KGK A;  1Q98 A;  2HZE A;  5CRE A;  1A23 A;  4PXO A;  4GWR A;  1TRS A;  1GLP A;  2A2P A;  1UVZ A;  2L6D A;  1PA3 A;  4AGS A;  3GYK A;  1BG5 A;  9GSS A;  2OAD A;  5GST A;  3ZYW A;  1YF0 A;  5A5K A;  3EC3 A;  1CQH A;  2CVB A;  2LRN A;  2I1U A;  1AAZ A;  3D6I A;  5DAL B;  1SEN A;  3F6D A;  3G7J A;  3Q6O A;  2V2G A;  3C1S A;  3G7Y A;  4K2X A;  4HZ4 A;  1RK4 A;  4QL9 A;  3QCP A;  3E0U A;  1M9B A;  4J57 E;  1EOH A;  2VCX A;  1K0B A;  5DQY A;  1T8E B;  2YV9 A;  4MK3 A;  3TJF A;  3VLN A;  2X8C A;  2RUE A;  2RM6 A;  3CRT A;  3EYT A;  1EEM A;  1FW1 A;  5IQY A;  3LGC A;  4HJ2 A;  4KB3 A;  4KND A;  3IXR A;  3UEM A;  3W6G A;  3FZA A;  4JR4 A;  1A8Y A;  2I9H A;  1TU7 A;  1GUH A;  1A2L A;  2F9S A;  2L57 A;  3CRU A;  2OJL A;  2PWJ A;  1TDI A;  5ECS A;  2E2G A;  1H4O A;  1XVW A;  1O81 A;  2HLS A;  2L4Q A;  3HVN A;  1F3B A;  5KN1 A;  2TRC P;  4YKG A;  3HZ4 A;  2MMA A;  4GF0 A;  1GTU A;  3FZ9 A;  4EL1 A;  4FQU A;  1A0F A;  3DEX A;  1U6T A;  3KP8 A;  1ZYQ B;  2NPB A;  5IOW A;  4JBB A;  2DJ0 A;  2H76 A;  4TR1 A;  2DBC A;  1GUM A;  5H5Q A;  1M99 A;  4RI6 A;  2VL2 C;  3HVX A;  1THO A;  4NPB A;  3J7Y b;  1BYE A;  1FB0 A;  5D9W A;  2MMN A;  1XW6 A;  1X5E A;  1I9D A;  4LMV A;  1GSY A;  1TKD B;  1ZZY A;  3D21 A;  3VWU A;  2VUP A;  3UVH A;  3TJG A;  4K9Z A;  1R5A A;  4WBJ A;  2DLX A;  3IHQ A;  4PUR A;  3DXB A;  5D96 A;  2VCQ A;  1XW5 A;  4ECB A;  2VCW A;  3GUS A;  5DVB A;  2O85 A;  3H79 A;  1QK8 A;  4V1A g;  2PU9 C;  6GSX A;  3MAK A;  1Z6N A;  4PX1 A;  3R3E A;  2GS3 A;  2GVP A;  4IJI A;  1R26 A;  4KDX A;  1U3A A;  1XCC A;  5A4W A;  4BL7 B;  4KSM A;  1K0C A;  1DSB A;  5GZZ B;  5D9X A;  2IFQ B;  4WXT A;  4GSS A;  5KEJ A;  3WGE A;  3GTU B;  4ECC A;  3J7Y k;  1XG8 A;  3DWV A;  2GSR A;  2MZC A;  5C00 A;  3LYP A;  1M2D A;  3ZTL A;  2WFC A;  1F9M A;  2CVK A;  2VLT A;  2H73 A;  4PUA A;  2A4H A;  1YKC A;  5DQS A;  4XHM A;  3I43 A;  2HSY A;  4IP1 A;  4ULX A;  3GKX A;  3HKR A;  1SD9 A;  2AHE A;  3UVT A;  3TGZ A;  3VUR A;  4TKY A;  5DJL A;  1PL1 A;  2VO4 A;  4ZB9 A;  5DAL A;  3F9U A;  1S3D A;  5F0G A;  4BWS A;  4XS4 B;  5FT3 A;  2K9F A;  1IYH A;  4HOJ A;  1VF2 A;  4ISD A;  2HYX A;  3VWW A;  2NVL A;  1ZL9 A;  2X8G A;  4EXJ A;  4G0I A;  3MDK A;  2K8V A;  3L78 A;  2B1K A;  3CQF A;  4MNN A;  4DEJ A;  3F4R A;  5G31 A;  3TKR A;  3RPP A;  2CV4 A;  5ECL B;  5JCW A;  2VAF A;  4BA7 A;  2M72 A;  1YKA A;  4BVX B;  5ID2 A;  4HZ2 A;  2IMD A;  2PUK C;  2HE3 A;  1E6B A;  1PGT A;  3TRX A;  2GQM A;  4K5S A;  3WD6 A;  1NSW A;  1MD3 A;  1PFO A;  4K7I A;  1PQN A;  4KDU A;  3PR8 A;  5IPH A;  3FZ5 A;  3MYD A;  3G9B A;  4XIH A;  2E7P A;  2PGT A;  3DGQ A;  4G10 A;  5JWO B;  1FOH A;  3HXS A;  4K6X A;  4NV2 A;  2FWG A;  1FB6 A;  1FG4 A;  3GX8 A;  1JZW A;  2JZT A;  2VCZ A;  3O6T A;  5E59 A;  3CMI A;  5JCG A;  4EUY A;  4TXO A;  5B7C A;  1SK2 A;  1A0R P;  2C0F A;  3M9K A;  4ILF A;  1XWG A;  1GTB A;  4OFT A;  3H93 A;  4XRD A;  1N2A A;  2JU5 A;  2D2Z A;  1SD8 A;  1B9X C;  2H1B A;  2RLI A;  3VI5 A;  3O76 A;  5IMC A;  5ECK B;  2YZH A;  1LJR A;  1H75 A;  2IMK A;  3M9J A;  1MTC A;  5DAK A;  4ML1 A;  1SJ6 A;  4ZBD A;  4N10 A;  5DDL A;  1EP7 A;  2GLR A;  4FO5 A;  2IME A;  4ZL8 A;  3HVS A;  2AB6 A;  2B5X A;  4I6X A;  4POM A;  1ABA A;  3GL3 A;  2YAN A;  5G1K A;  4DVC A;  4DSS A;  3G7I A;  1TJD A;  4MAB A;  4G0K A;  4GSN A;  1QGV A;  4XRA A;  4ICY A;  1AQV A;  2J23 A;  5HR0 A;  4F0C A;  2ZUP A;  1K0M A;  2C3N A;  3FR3 A;  2WCI A;  4K8M A;  2LNS A;  3PH9 A;  3DVW A;  4IJ3 A;  4L5L A;  2WRT A;  4V2N A;  3ZRD A;  1BAY A;  1Z5Y E;  3BBY A;  4BL7 A;  1IYI A;  2ZCT A;  3APO A;  2M80 A;  1WMJ A;  2IFQ A;  2O89 A;  3DRN A;  4XTS A;  2KOK A;  2LST A;  2VM1 A;  1F37 A;  3GTU A;  2FD3 A;  4MZB A;  4MCU A;  5EL8 A;  1OAZ A;  3KIJ A;  3IBH A;  3ME7 A;  2H6Z A;  1GH2 A;  4BVY B;  5EVO A;  4CDO A;  4K1F A;  6GSS A;  1GNE A;  1XOA A;  2OBK A;  2B6M A;  2BMX A;  2A4V A;  2N5B A;  3DVX A;  3BJ5 A;  13GS A;  1XVQ A;  3TJK A;  2YWI A;  3QAV A;  4EDY A;  1XWA A;  3HCZ A;  2IMI A;  4BPY A;  1B8X A;  2GSS A;  1MD4 A;  2XBQ A;  3FY7 A;  4PQ1 A;  2IPA A;  4A5P A;  4XS4 A;  22GS A;  1VF1 A;  1TU8 A;  4I2T A;  1TRU A;  4HEA 2;  4FYU A;  2YN1 A;  2ES7 A;  1EP8 A;  2G0F A;  2H72 A;  5J5N A;  1O7U A;  4NMU A;  3P2A A;  2GST A;  3BCI A;  3EUR A;  2C0G A;  3TRP A;  1T7P B;  2O8V B;  5IOX A;  3F63 A;  4IP6 A;  4FYB A;  2AJQ B;  4BVX A;  3TKS E;  3IHG A;  1Z6M A;  1EOG A;  2JZR A;  1EWX A;  4OO4 A;  2NTO A;  1X9S B;  5G2Z A;  4EKZ A;  3GST A;  1PL2 A;  4ECJ A;  4MPF A;  5EPF A;  4POB A;  2ON5 A;  2EIO A;  1AUC A;  4Z2R A;  4HQZ A;  3U5R E;  2DJ1 A;  3UAP A;  1GSU A;  3TKP A;  3VI7 A;  1B4P A;  1WWJ A;  4BIK A;  1VF3 A;  2H71 A;  4RQX A;  2QSI A;  1T4Z A;  4Z2T A;  1R7H A;  1YEX A;  1YF1 A;  4KGI A;  4RUV A;  4EC0 A;  2GZP A;  4MMM A;  5H5S A;  1NHO A;  2P31 A;  2ON7 A;  1T00 A;  3GMF A;  2HI7 A;  4IW9 A;  5EY6 A;  1WPI A;  2LJA A;  4Q5F A;  4TN8 A;  4CY6 A;  3S9F A;  1OC9 B;  3H8Q A;  3ED3 A;  3F0I A;  1HNA A;  3KCM A;  1PSQ A;  4WR5 A;  3FEU A;  2JAD A;  3TDG A;  1T1V A;  3EE2 A;  4EIQ A;  3ZIJ A;  4L0W A;  2H6Y A;  5J9C A;  1U3I A;  3WT1 A;  1JLW A;  3N9J A;  5AIX A;  5HR2 A;  3VK9 A;  4WEY A;  2HFD A;  5B6N A;  16GS A;  1SL1 B;  1Z7P A;  5ECN B;  1R4W A;  3P7X A;  2I4A A;  3JCM L;  1J0F A;  1EGR A;  1NM3 A;  2YOI A;  1A2J A;  4HU9 A;  2N5F A;  1TRW A;  2XHF A;  1K0A A;  3U6V A;  2REM A;  5ELG A;  1XBS A;  1ERW A;  2OE1 A;  3EMX A;  2M46 A;  2H01 A;  3W8J A;  2WS2 A;  3I9V 2;  4K0N A;  2C3T A;  3FK8 A;  2GZZ A;  2IN3 A;  3SWL A;  3GNJ A;  2E2M A;  1ZGN A;  2LS5 A;  2JSY A;  2AYT A;  4KDY A;  2R4V A;  2FUG 2;  2A2S A;  4Q5Q A;  3GN3 A;  2PN8 A;  3NZN A;  1AC1 A;  4JRR A;  3KD0 A;  3LQ7 A;  10GS A;  4NWY A;  1FVK A;  1NW2 A;  4L5O A;  2R2J A;  4H86 A;  3F3Q A;  4MF6 A;  4HI7 A;  1SL2 B;  4AJ7 A;  1QQ2 A;  4JR6 A;  4BVY A;  4AJ8 A;  4MH3 A;  2FLS A;  5DCH A;  1GSF A;  1DUG A;  3C8E A;  1PN9 A;  2PVO C;  4YAP A;  4EDZ A;  5J9B A;  4K5R A;  3M0F A;  3RPN A;  1DE1 A;  4ZL9 A;  1JHB A;  2B1L A;  3Q19 A;  3ISO A;  2YWO A;  4J56 E;  2YV7 A;  4MF5 A;  2X49 A;  2DML A;  3F3R A;  1M7T A;  2FA8 A;  5CRH A;  1G6W A;  2YJ7 A;  2G2Q A;  3O3T A;  4HJM A;  1GP1 A;  5HFK A;  4MH2 A;  2LKU A;  2WDU A;  3KTB A;  1SK0 A;  2DSA A;  2UZ8 A;  4I2U A;  3QAG A;  3M3M A;  1GTA A;  1QMV A;  4G19 A;  3GV1 A;  2FNO A;  5IPG A;  4KF9 A;  1PKW A;  3ZMK A;  5IMD A;  3NIV A;  3GHA A;  1XFL A;  1OVN A;  14GS A;  4NXI A;  4MZC A;  5F05 A;  1B4Q A;  1ACV A;  1JZR A;  1M3I A;  1ML6 A;  3QR6 A;  3C1R A;  1OC8 A;  4NHZ A;  5CRW A;  2R0G A;  3RBT A;  3M8N A;  1TOF A;  2C0D A;  2L5O A;  3ME8 A;  6GSV A;  3US3 A;  3QAW A;  4HS1 A;  2C80 A;  2XPE A;  1K0O A;  4X43 A;  2IL3 A;  4N11 A;  4EVM A;  5KN3 A;  5D8I A;  2K18 A;  2V6K A;  3VPQ A;  4ZB6 A;  3OR5 A;  4GST A;  4OCF A;  3IOS A;  1EV9 A;  2FA4 A;  4FIW A;  5KN2 A;  2AV4 A;  2MBT A;  4LLR A;  1OKT A;  2R5G A;  3LWA A;  2KP1 A;  1HYU A;  3PGT A;  5J3R A;  2V6O A;  4OO5 A;  1J9B A;  5D9V A;  2CVD A;  3F6F A;  3HD5 A;  3TKS C;  2B5Y A;  3GSS A;  4IGJ A;  2RUF A;  3D5J A;  3FRC A;  4LA1 A;  1HD2 A;  2QGV A;  1SU9 A;  1OC9 A;  4Q5N A;  1J08 A;  1G0T A;  3QDN A;  1YEP A;  5HFG A;  1A8L A;  4POL A;  1XWK A;  2ALB A;  4YQM A;  1O8X A;  4TOP A;  4USS A;  2DIY A;  2MYG A;  3FMW A;  4ZL7 A;  3IRA A;  2CAQ A;  3C73 A;  1X0R A;  2VLU A;  2L4C A;  4G9H A;  3GH6 A;  5ECM B;  2VIM A;  2C3Q A;  4DSR A;  3TUE A;  1SYX A;  4OFM A;  2YWM A;  5IMV A;  1TTZ A;  4O5U A;  3UMA A;  3L9U A;  2P0G A;  1ST9 A;  3L9S A;  1SKR B;  3FKF A;  4OCE A;  4E8E A;  1XXU A;  1ZOF A;  1X5D A;  2FGX A;  2R6K A;  2EIQ A;  3HJM A;  2I3Y A;  5INY A;  1MEK A;  3KJY A;  4V2L A;  3ZML A;  2QKE A;  4L0U A;  3VWV A;  4OFN A;  3WT2 A;  5CP1 A;  4IS0 A;  5HR1 A;  4MP4 A;  3D22 A;  1GSQ A;  4V1A p;  2MMO A;  2DJ3 A;  4WR4 A;  2R37 A;  1XW9 A;  1OC3 A;  2HRA A;  4PQH A;  3RHB A;  2V1M A;  2E0Q A;  4V2M A;  1Y25 A;  2YZU A;  3KZQ A;  2VL3 A;  3EWL A;  5KN0 A;  2FWE A;  4ML6 A;  2CZ3 A;  2QC7 A;  2H30 A;  1M0U A;  2H0I A;  4LL4 B;  3P90 A;  1F6M C;  2C0E A;  1G7E A;  1SL0 B;  2LNT A;  4JED A;  1GSE A;  1EEJ A;  4WBR D;  3A2V A;  1HNB A;  2BTO T;  5IO0 A;  2MBS A;  4FH8 A;  3MNG A;  4MA9 A;  1GWC A;  3PPU A;  5IMF A;  3ZIV A;  1XIY A;  2VLV A;  1USB A;  1XWB A;  5ECO B;  2C1Y A;  1TI3 A;  1XZO A;  1WP0 A;  4IQA A;  1THX A;  4ZIJ A;  1YDK A;  5L71 A;  2N5A A;  1SKW B;  4NAX A;  1Z3E A;  2B7J A;  3UBL A;  1GUL A;  3GA4 A;  1XWC A;  3DYR A;  3MSZ A;  2KHP A;  2R0P A;  2VCT A;  2X64 A;  1AQX A;  1T3B A;  2J9H A;  4D73 B;  4OMV A;  2DJJ A;  3AY8 A;  5CRD A;  2HXK A;  4KH7 A;  4TR4 A;  3GIX A;  3EPT A;  3GX0 A;  1TW9 A;  3FZ4 A;  1GUK A;  2DC5 A;  3CXG A;  4OD7 A;  2LRT A;  4PGT A;  2GT6 A;  1GLQ A;  1UA5 A;  2R0C A;  1FO5 A;  1C72 A;  3UL3 A;  2VL2 A;  3UJ1 A;  4TR0 A;  4KX4 A;  3D0Z A;  4MLY A;  2H0G A;  1PX7 A;  5B8B A;  5IIZ A;  1B9Y C;  1BJX A;  2IJY A;  3TJJ A;  3EU4 A;  2OKA A;  5ENU A;  3HVV A;  1TK5 B;  4ECI A;  6GSU A;  4TR3 A;  3CSI A;  4YQU A;  5ECH B;  3CTG A;  3GRX A;  2H19 A;  1YJ6 A;  1VRS D;  3UIW A;  4KUN A;  1T4Y A;  4GXZ A;  2HSM A;  2JL4 A;  1V98 A;  5A4V A;  3KTL A;  3H1N A;  3LEF A;  3QMX A;  2H8L A;  3HZ8 A;  2MMZ A;  1BED A;  5C04 A;  2EC4 A;  3BD2 A;  2JSZ A;  2H0H A;  2XPD A;  5IO2 A;  3L9V A;  2VD1 A;  1ERV A;  3WGX A;  5ECR B;  3LYK A;  1B48 A;  3WGD A;  4YAV A;  3KH9 A;  1EGO A;  3IPZ A;  3CSH A;  4TW5 A;  4DSQ A;  5CO3 A;  1LU4 A;  3IV4 A;  5F8B A;  1F2E A;  2H70 A;  1G7O A;  1M2B A;  2X99 A;  1A24 A;  2YNX A;  4F82 A;  1K0N A;  5B6M A;  2IWT A;  3WYW A;  4ID0 A;  1YZX A;  3TJB A;  3TCO A;  2PER A;  3ERG A;  1SK1 A;  1X9W B;  1YQ1 A;  4OWY A;  2RM5 A;  4WKW A;  3K8N A;  2CT6 A;  4KA0 A;  2OE3 A;  4FYC A;  4PTS A;  4ZXG A;  5DBQ A;  6GST A;  2B7K A;  2GQK A;  4QL7 A;  3QD9 A;  4XS1 A;  2IIY A;  5D9T A;  4IEL A;  2OAC A;  2LV3 A;  2HT9 A;  2KLX A;  2FHE A;  4WF4 A;  4KCA A;  3HDC A;  6GSW A;  1NHY A;  1GTI A;  2PVQ A;  2GDR A;  2OE0 A;  2CA8 A;  1ERU A;  2V41 A;  2I81 A;  5H5R A;  1JZD A;  3GUR A;  3UOM A;  4KE3 A;  1FAA A;  4EIP A;  4CHS A;  2B3S A;  3VPT A;  3TB2 A;  2H1A A;  2HNL A;  2F3M A;  5AN1 A;  4F03 A;  3LSZ A;  2IMF A;  2L59 A;  3ERF A;  5LNK e;  4JU5 A;  3LJR A;  1KEB A;  1QFN A;  1TRV A;  3IDV A;  4IVF A;  1TI1 A;  1V57 A;  2DIZ A;  3F4T A;  1PN0 A;  2QA2 A;  2WGR A;  3SBC A;  1EV4 A;  3IK7 A;  3ZLP A;  2GGT A;  4MJA A;  3FW2 A;  5JCU A;  2F8A A;  5AIV A;  5G5E A;  1PD2 1;  1PX6 A;  1G6Y A;  1V9W A;  1F3A A;  1ZYE A;  2F51 A;  1LBK A;  3CYN A;  5ELA A;  1BX9 A;  1URM A;  4IHU A;  4CY8 A;  2NBS A;  4K7N A;  5A4U A;  5G30 A;  4MJE A;  4KW6 A;  1VF4 A;  1W4V A;  2LRC A;  3HY2 A;  3EVI A;  3VFI A;  3BOA A;  2L6C A;  1Q4J A;  1FHE A;  5ID2 B;  17GS A;  1KNG A;  4D73 A;  3GH9 A;  1Y6E A;  1Z7R A;  1JZO A;  2B5E A;  2HZF A;  3KMO A;  5ECP B;  3ZZX A;  12GS A;  1AXD A;  1ILO A;  3APS A;  2LQO A;  3E3E A;  1K3Y A;  2RII A;  1O73 A;  1X5C A;  5LD0 A;  4HUA A;  2QA1 A;  1N8J A;  5HFI A;  2LQQ A;  1WRY A;  1WOU A;  3GKK A;  5KOW A;  4X0X A;  1ERT A;  1QXH A;  4O92 A;  4KSO A;  3A3T A;  1M3J A;  2HRF A;  2KP2 A;  4JE1 A;  4GQC A;  1ZYP A;  5B8A A;  4TXO B;  2GT5 A;  1DBY A;  2YCD A;  4EE0 A;  11GS A;  4I97 A;  1V58 A;  2PMT A;  4PNG A;  2FWF A;  3H4K A;  1PRX A;  4G2E A;  2FCH A;  3IK9 A;  3ZRE A;  3C7M A;  1CQG A;  2YWN A;  3M1G A;  3HJP A;  2GTU A;  4IN0 A;  2R3X A;  7GSS A;  5IMZ A;  2DMM A;  5DAK B;  5AGY A;  2LJR A;  1GNW A;  4HQS A;  3TKQ A;  3EU3 A;  4N30 A;  1FOV A;  2V32 A;  4MDC A;  1HNC A;  3MIX A;  1KBN A;  2KUC A;  3FYG A;  3C71 A;  4YQV A;  5HQP A;  4IBP A;  2A2R A;  4DSS B;  5DCG A;  2P5Q A;  4Z2U A;  4O5R A;  4CW9 A;  5BRT A;  1U88 A;  4IQ1 A;  1GSD A;  3FR6 A;  3LOR A;  2PBJ A;  4NV5 A;  4KAE A;  2YPM A;  4N0V A;  4TRX A;  1ZMA A;  20GS A;  2WUL A;  5E4W A;  5ABR A;  4IKH A;  2BJX A;  3HA9 A;  2X4A A;  4X1U A;  3UBK A;  1V2A A;  1TK0 B;  3KEB A;  4YKF A;  3UAR A;  4NHW A;  4MPG A;  1O8W A;  3VWX A;  3A2X A;  4G0L A;  4MJC A;  2C8U A;  5ECQ B;  2VCV A;  4K0G A;  3L0H A;  3TOT A;  4PNF A;  3LXT A;  4I5Q A;  3KP9 A;  2H6X A;  2LJK A;  3CBU A;  4J2F A;  2LEG A;  3APQ A;  2PPT A;  1S3R A;  4LL1 B;  4N0Z A;  2K6V A;  1UC7 A;  1QUW A;  3IAS 2;  2FY6 A;  5J4U A;  2HRN A;  3MWH A;  3EIN A;  2EIR A;  2VM2 A;  4X4J A;  3F4S A;  2JAC A;  4O5Q A;  2GZY A;  3NOF A;  1O85 A;  2VD0 A;  2ZNM A;  4ZB8 A;  6GSY A;  3P8W A;  1ZCP A;  1MDJ A;  1TK8 B;  1MDK A;  3Q18 A;  2TIR A;  1S3A A;  1BQ7 A;  4WF5 A;  3LXZ A;  5FHI A;  18GS A;  2WB9 A;  2YJH A;  1RW1 A;  2HZE B;  2WZ9 A;  2H75 A;  5DJM A;  1TP9 A;  1YY7 A;  3N5O A;  1XPV A;  2CX4 A;  4P3Y B;  3RHC A;  1K0D A;  5F06 A;  4GCI A;  4XS6 A;  3KH7 A;  1M9A A;  3A2W A;  4ZIL A;  1WIK A;  2XC2 A;  3QFA C;  4GLT A;  3A5W A;  2OBI A;  4TXV A;  3ZVJ A;  1KTE A;  4EO3 A;  2YP6 A;  2WJU A;  2FWH A;  1DE2 A;  1SYR A;  5AIS A;  5BMU A;  3PIN A;  1Z9H A;  5CAX A;  2HSH A;  4F0B A;  4HSC X;  4MF7 A;  4E8H A;  3DKS A;  5GAN D;  4O7H A;  2DKI A;  1VGL A;  1SKS B;  2H66 A;  4WET A;  4F9Z A;  3LFL A;  3TOU A;  3I6A A;  1AQW A;  2CX3 A;  1JLV A;  4GQF A;  3HJO A;  2CAI A;  4GTU A;  4Q5R A;  2GSQ A;  4L8E A;  1K3L A;  3IC8 A;  1GRX A;  3DIE A;  1X9M B;  3HHV A;  4EF0 A;  1JFU A;  3LG6 A;  1FVJ A;  3IC4 A;  4AJ6 A;  1TXX A;  1UN2 A;  5F07 A;  2VOC A;  3BCK A;  2F8F A;  5J41 A;  3HYP A;  4Z7X A;  3CTF A;  1W89 A;  1R5P A;  3LW9 A;  1MDI A;  2L5L A;  3EMP A;  1OE7 A;  5GSS A;  4LMW A;  2K8S A;  3RAZ A;  3IA1 A;  3ZFL A; 
#chains in the Genus database with same CATH homology
 4RI7 A;  2NDO A;  3CSJ A;  3GFK A;  3KM6 A;  3IR4 A;  3D4M A;  3L4N A;  1ON4 A;  1GSS A;  4AF2 A;  2AUV A;  2C4J A;  5CNW A;  4ZBA A;  4QQ7 A;  3A5I A;  3ZFB A;  2Z9S A;  3R2Q A;  2P5R A;  3KMN A;  4MZW A;  1A2M A;  5HR3 A;  4K7O A;  2LTK A;  3KXO A;  2XBI A;  1K3O A;  3ZL5 A;  4TR1 B;  1OKD A;  3F8U A;  3QOU A;  1XOB A;  1AIU A;  1PMT A;  1OE8 A;  1OYJ A;  5ECI B;  4PQI A;  1O6J A;  4YH2 A;  4HU7 A;  4TVE A;  1U87 A;  1SJZ A;  2OA7 A;  4F2I A;  1GL8 A;  5GAP D;  2DJK A;  2GQL A;  2H1D A;  2LUS A;  1AW9 A;  8GSS A;  4GRF A;  2TRX A;  5CYY A;  2O7K A;  3DD3 A;  1RQM A;  3ZVJ D;  3D4T A;  5KOX A;  1SJI A;  1V40 A;  5G5F A;  2JZS A;  3GL5 A;  3FR9 A;  2HRK A;  1S3C A;  3QPM A;  1ZYN A;  3E9J B;  4JZQ A;  1PKZ A;  3V1W A;  3IE3 A;  1M2A A;  1WJK A;  4ACS A;  2DKH A;  2VL9 A;  4KCE A;  5LCZ A;  5FWG A;  5D73 A;  3W8S A;  4MJB A;  4BWQ A;  4ZBB A;  5COH A;  2DJ2 A;  3ERW A;  4POK A;  3GKN A;  4RQR A;  3DML A;  5JWQ B;  2AAW A;  5JWR B;  3Q74 A;  2H74 A;  2O87 A;  3I69 A;  19GS A;  1E2Y A;  4XCS A;  1HQO A;  3GKM A;  1I5G A;  1WE0 A;  2H1G A;  4PUF C;  5IM9 A;  4O32 A;  1EZK A;  3QFB C;  3FHK A;  5IMA A;  5D93 A;  3ZIT A;  3TKS A;  5G1L A;  2CZ2 A;  3IAM 2;  4I8B A;  2CQ9 A;  3TRQ A;  2X8H A;  5CRG A;  4HDE A;  4K2D A;  3RDW A;  3KGK A;  1Q98 A;  2HZE A;  5CRE A;  1A23 A;  4PXO A;  4GWR A;  1TRS A;  1GLP A;  2A2P A;  1UVZ A;  2L6D A;  1PA3 A;  4AGS A;  3GYK A;  1BG5 A;  9GSS A;  2OAD A;  5GST A;  3ZYW A;  1YF0 A;  5A5K A;  3EC3 A;  1CQH A;  2CVB A;  2LRN A;  2I1U A;  1AAZ A;  3D6I A;  5DAL B;  1SEN A;  3F6D A;  3G7J A;  3Q6O A;  2V2G A;  3C1S A;  3G7Y A;  4K2X A;  4HZ4 A;  1RK4 A;  4QL9 A;  3QCP A;  3E0U A;  1M9B A;  4J57 E;  1EOH A;  2VCX A;  1K0B A;  5DQY A;  1T8E B;  2YV9 A;  4MK3 A;  3TJF A;  3VLN A;  2X8C A;  2RUE A;  2RM6 A;  3CRT A;  3EYT A;  1EEM A;  1FW1 A;  5IQY A;  3LGC A;  4HJ2 A;  4KB3 A;  4KND A;  3IXR A;  3UEM A;  3W6G A;  3FZA A;  4JR4 A;  1A8Y A;  2I9H A;  1TU7 A;  1GUH A;  1A2L A;  2F9S A;  2L57 A;  3CRU A;  2OJL A;  2PWJ A;  1TDI A;  5ECS A;  2E2G A;  1H4O A;  1XVW A;  1O81 A;  2HLS A;  2L4Q A;  1F3B A;  5KN1 A;  2TRC P;  4YKG A;  3HZ4 A;  2MMA A;  4GF0 A;  1GTU A;  3FZ9 A;  4EL1 A;  4FQU A;  1A0F A;  3DEX A;  1U6T A;  3KP8 A;  1ZYQ B;  2NPB A;  5IOW A;  4JBB A;  2DJ0 A;  2H76 A;  4TR1 A;  2DBC A;  1GUM A;  5H5Q A;  1M99 A;  4RI6 A;  2VL2 C;  3HVX A;  1THO A;  4NPB A;  3J7Y b;  1BYE A;  1FB0 A;  5D9W A;  2MMN A;  1XW6 A;  1X5E A;  1I9D A;  4LMV A;  1GSY A;  1TKD B;  1ZZY A;  3D21 A;  3VWU A;  2VUP A;  3UVH A;  3TJG A;  4K9Z A;  1R5A A;  4WBJ A;  2DLX A;  3IHQ A;  4PUR A;  3DXB A;  5D96 A;  2VCQ A;  1XW5 A;  4ECB A;  2VCW A;  3GUS A;  5DVB A;  2O85 A;  3H79 A;  1QK8 A;  4V1A g;  2PU9 C;  6GSX A;  3MAK A;  1Z6N A;  4PX1 A;  3R3E A;  2GS3 A;  2GVP A;  4IJI A;  1R26 A;  4KDX A;  1U3A A;  1XCC A;  5A4W A;  4BL7 B;  4KSM A;  1K0C A;  1DSB A;  5GZZ B;  5D9X A;  2IFQ B;  4WXT A;  4GSS A;  5KEJ A;  3WGE A;  3GTU B;  4ECC A;  3J7Y k;  3DWV A;  2GSR A;  2MZC A;  5C00 A;  3LYP A;  1M2D A;  3ZTL A;  2WFC A;  1F9M A;  2CVK A;  2VLT A;  2H73 A;  4PUA A;  2A4H A;  1YKC A;  5DQS A;  4XHM A;  3I43 A;  2HSY A;  4IP1 A;  4ULX A;  3GKX A;  3HKR A;  1SD9 A;  2AHE A;  3UVT A;  3TGZ A;  3VUR A;  4TKY A;  5DJL A;  1PL1 A;  2VO4 A;  4ZB9 A;  5DAL A;  3F9U A;  1S3D A;  5F0G A;  4BWS A;  4XS4 B;  5FT3 A;  2K9F A;  1IYH A;  4HOJ A;  1VF2 A;  4ISD A;  2HYX A;  3VWW A;  2NVL A;  1ZL9 A;  2X8G A;  4EXJ A;  4G0I A;  3MDK A;  2K8V A;  3L78 A;  2B1K A;  4DEJ A;  4MNN A;  3F4R A;  5G31 A;  3TKR A;  3RPP A;  2CV4 A;  5ECL B;  5JCW A;  2VAF A;  4BA7 A;  2M72 A;  1YKA A;  4BVX B;  5ID2 A;  4HZ2 A;  2IMD A;  2PUK C;  2HE3 A;  1E6B A;  1PGT A;  3TRX A;  2GQM A;  4K5S A;  3WD6 A;  1NSW A;  1MD3 A;  4K7I A;  1PQN A;  4KDU A;  3PR8 A;  5IPH A;  3FZ5 A;  3MYD A;  3G9B A;  4XIH A;  2E7P A;  2PGT A;  3DGQ A;  4G10 A;  5JWO B;  1FOH A;  3HXS A;  4K6X A;  4NV2 A;  2FWG A;  1FB6 A;  1FG4 A;  3GX8 A;  1JZW A;  2JZT A;  2VCZ A;  3O6T A;  5E59 A;  3CMI A;  5JCG A;  4EUY A;  4TXO A;  5B7C A;  1SK2 A;  1A0R P;  2C0F A;  3M9K A;  4ILF A;  1XWG A;  1GTB A;  4OFT A;  3H93 A;  4XRD A;  1N2A A;  2JU5 A;  2D2Z A;  1SD8 A;  1B9X C;  2H1B A;  2RLI A;  3VI5 A;  3O76 A;  5IMC A;  5ECK B;  2YZH A;  1LJR A;  1H75 A;  2IMK A;  3M9J A;  1MTC A;  5DAK A;  4ML1 A;  1SJ6 A;  4ZBD A;  4N10 A;  5DDL A;  1EP7 A;  2GLR A;  4FO5 A;  2IME A;  4ZL8 A;  3HVS A;  2AB6 A;  2B5X A;  4I6X A;  4POM A;  1ABA A;  3GL3 A;  2YAN A;  5G1K A;  4DVC A;  4DSS A;  3G7I A;  1TJD A;  4MAB A;  4G0K A;  4GSN A;  1QGV A;  4XRA A;  4ICY A;  1AQV A;  2J23 A;  5HR0 A;  4F0C A;  2ZUP A;  1K0M A;  2C3N A;  3FR3 A;  2WCI A;  4K8M A;  2LNS A;  3PH9 A;  3DVW A;  4IJ3 A;  4L5L A;  2WRT A;  4V2N A;  3ZRD A;  1BAY A;  1Z5Y E;  3BBY A;  4BL7 A;  1IYI A;  2ZCT A;  3APO A;  2M80 A;  1WMJ A;  2IFQ A;  2O89 A;  3DRN A;  4XTS A;  2KOK A;  2LST A;  2VM1 A;  1F37 A;  3GTU A;  2FD3 A;  4MZB A;  4MCU A;  5EL8 A;  1OAZ A;  3KIJ A;  3IBH A;  3ME7 A;  2H6Z A;  1GH2 A;  4BVY B;  5EVO A;  4CDO A;  4K1F A;  6GSS A;  1GNE A;  1XOA A;  2OBK A;  2B6M A;  2BMX A;  2A4V A;  2N5B A;  3DVX A;  3BJ5 A;  13GS A;  1XVQ A;  3TJK A;  2YWI A;  3QAV A;  4EDY A;  1XWA A;  3HCZ A;  2IMI A;  4BPY A;  1B8X A;  2GSS A;  1MD4 A;  2XBQ A;  3FY7 A;  4PQ1 A;  2IPA A;  4A5P A;  4XS4 A;  22GS A;  1VF1 A;  1TU8 A;  4I2T A;  1TRU A;  4HEA 2;  4FYU A;  2YN1 A;  2ES7 A;  1EP8 A;  2G0F A;  2H72 A;  5J5N A;  1O7U A;  4NMU A;  3P2A A;  2GST A;  3BCI A;  3EUR A;  2C0G A;  3TRP A;  1T7P B;  2O8V B;  5IOX A;  3F63 A;  4IP6 A;  4FYB A;  2AJQ B;  4BVX A;  3TKS E;  3IHG A;  1Z6M A;  1EOG A;  2JZR A;  1EWX A;  4OO4 A;  2NTO A;  1X9S B;  5G2Z A;  4EKZ A;  3GST A;  1PL2 A;  4ECJ A;  4MPF A;  5EPF A;  4POB A;  2ON5 A;  2EIO A;  1AUC A;  4Z2R A;  4HQZ A;  3U5R E;  2DJ1 A;  3UAP A;  1GSU A;  3TKP A;  3VI7 A;  1B4P A;  1WWJ A;  1VF3 A;  2H71 A;  4RQX A;  2QSI A;  1T4Z A;  4Z2T A;  1R7H A;  1YEX A;  1YF1 A;  4KGI A;  4RUV A;  4EC0 A;  2GZP A;  4MMM A;  5H5S A;  1NHO A;  2P31 A;  2ON7 A;  1T00 A;  3GMF A;  2HI7 A;  4IW9 A;  5EY6 A;  1WPI A;  2LJA A;  4Q5F A;  4TN8 A;  4CY6 A;  3S9F A;  1OC9 B;  3H8Q A;  3ED3 A;  3F0I A;  1HNA A;  3KCM A;  1PSQ A;  4WR5 A;  3FEU A;  2JAD A;  3TDG A;  1T1V A;  3EE2 A;  4EIQ A;  3ZIJ A;  4L0W A;  2H6Y A;  5J9C A;  1U3I A;  3WT1 A;  1JLW A;  3N9J A;  5AIX A;  5HR2 A;  3VK9 A;  4WEY A;  2HFD A;  5B6N A;  16GS A;  1SL1 B;  1Z7P A;  5ECN B;  1R4W A;  3P7X A;  2I4A A;  3JCM L;  1J0F A;  1EGR A;  1NM3 A;  2YOI A;  1A2J A;  4HU9 A;  2N5F A;  1TRW A;  2XHF A;  1K0A A;  3U6V A;  2REM A;  5ELG A;  1XBS A;  1ERW A;  2OE1 A;  3EMX A;  2M46 A;  2H01 A;  3W8J A;  2WS2 A;  3I9V 2;  4K0N A;  2C3T A;  3FK8 A;  2GZZ A;  2IN3 A;  3SWL A;  3GNJ A;  2E2M A;  1ZGN A;  2LS5 A;  2JSY A;  2AYT A;  4KDY A;  2R4V A;  2FUG 2;  2A2S A;  4Q5Q A;  3GN3 A;  2PN8 A;  3NZN A;  1AC1 A;  4JRR A;  3KD0 A;  3LQ7 A;  10GS A;  4NWY A;  1FVK A;  1NW2 A;  4L5O A;  2R2J A;  4H86 A;  3F3Q A;  4MF6 A;  4HI7 A;  1SL2 B;  4AJ7 A;  1QQ2 A;  4JR6 A;  4BVY A;  4AJ8 A;  4MH3 A;  2FLS A;  5DCH A;  1GSF A;  1DUG A;  3C8E A;  1PN9 A;  2PVO C;  4YAP A;  4EDZ A;  5J9B A;  4K5R A;  3M0F A;  3RPN A;  1DE1 A;  4ZL9 A;  1JHB A;  2B1L A;  3Q19 A;  3ISO A;  2YWO A;  4J56 E;  2YV7 A;  4MF5 A;  2X49 A;  2DML A;  3F3R A;  1M7T A;  2FA8 A;  5CRH A;  1G6W A;  2YJ7 A;  2G2Q A;  3O3T A;  4HJM A;  1GP1 A;  5HFK A;  4MH2 A;  2LKU A;  2WDU A;  3KTB A;  1SK0 A;  2DSA A;  2UZ8 A;  4I2U A;  3QAG A;  3M3M A;  1GTA A;  1QMV A;  4G19 A;  3GV1 A;  2FNO A;  5IPG A;  4KF9 A;  1PKW A;  3ZMK A;  5IMD A;  3NIV A;  3GHA A;  1XFL A;  1OVN A;  14GS A;  4NXI A;  4MZC A;  5F05 A;  1B4Q A;  1ACV A;  1JZR A;  1ML6 A;  3QR6 A;  3C1R A;  1OC8 A;  4NHZ A;  5CRW A;  2R0G A;  3RBT A;  3M8N A;  1TOF A;  2C0D A;  2L5O A;  3ME8 A;  6GSV A;  3US3 A;  3QAW A;  4HS1 A;  2C80 A;  2XPE A;  1K0O A;  4X43 A;  2IL3 A;  4N11 A;  4EVM A;  5KN3 A;  5D8I A;  2K18 A;  2V6K A;  3VPQ A;  4ZB6 A;  3OR5 A;  4GST A;  4OCF A;  3IOS A;  1EV9 A;  2FA4 A;  4FIW A;  5KN2 A;  2AV4 A;  2MBT A;  4LLR A;  1OKT A;  2R5G A;  3LWA A;  2KP1 A;  1HYU A;  3PGT A;  5J3R A;  2V6O A;  4OO5 A;  1J9B A;  5D9V A;  2CVD A;  3F6F A;  3HD5 A;  3TKS C;  2B5Y A;  3GSS A;  4IGJ A;  2RUF A;  3D5J A;  3FRC A;  4LA1 A;  1HD2 A;  2QGV A;  1SU9 A;  1OC9 A;  4Q5N A;  1J08 A;  1G0T A;  3QDN A;  1YEP A;  5HFG A;  1A8L A;  4POL A;  1XWK A;  2ALB A;  4YQM A;  1O8X A;  4TOP A;  4USS A;  2DIY A;  2MYG A;  3FMW A;  4ZL7 A;  3IRA A;  2CAQ A;  3C73 A;  1X0R A;  2VLU A;  2L4C A;  4G9H A;  3GH6 A;  5ECM B;  2VIM A;  2C3Q A;  4DSR A;  3TUE A;  1SYX A;  4OFM A;  2YWM A;  5IMV A;  1TTZ A;  4O5U A;  3UMA A;  3L9U A;  2P0G A;  1ST9 A;  3L9S A;  1SKR B;  3FKF A;  4OCE A;  4E8E A;  1XXU A;  1ZOF A;  1X5D A;  2FGX A;  2R6K A;  2EIQ A;  3HJM A;  2I3Y A;  5INY A;  1MEK A;  3KJY A;  4V2L A;  3ZML A;  2QKE A;  4L0U A;  3VWV A;  4OFN A;  3WT2 A;  5CP1 A;  4IS0 A;  5HR1 A;  4MP4 A;  3D22 A;  1GSQ A;  4V1A p;  2MMO A;  2DJ3 A;  4WR4 A;  2R37 A;  1XW9 A;  1OC3 A;  2HRA A;  4PQH A;  3RHB A;  2V1M A;  2E0Q A;  4V2M A;  1Y25 A;  2YZU A;  3KZQ A;  2VL3 A;  3EWL A;  5KN0 A;  2FWE A;  4ML6 A;  2CZ3 A;  2QC7 A;  2H30 A;  1M0U A;  2H0I A;  4LL4 B;  3P90 A;  1F6M C;  2C0E A;  1G7E A;  1SL0 B;  2LNT A;  4JED A;  1GSE A;  1EEJ A;  4WBR D;  3A2V A;  1HNB A;  2BTO T;  5IO0 A;  2MBS A;  4FH8 A;  3MNG A;  4MA9 A;  1GWC A;  3PPU A;  5IMF A;  3ZIV A;  1XIY A;  2VLV A;  1USB A;  1XWB A;  5ECO B;  2C1Y A;  1TI3 A;  1XZO A;  1WP0 A;  4IQA A;  1THX A;  4ZIJ A;  1YDK A;  5L71 A;  2N5A A;  1SKW B;  4NAX A;  1Z3E A;  2B7J A;  3UBL A;  1GUL A;  3GA4 A;  1XWC A;  3DYR A;  3MSZ A;  2KHP A;  2R0P A;  2VCT A;  2X64 A;  1AQX A;  1T3B A;  2J9H A;  4D73 B;  4OMV A;  2DJJ A;  3AY8 A;  5CRD A;  2HXK A;  4KH7 A;  4TR4 A;  3GIX A;  3EPT A;  3GX0 A;  1TW9 A;  3FZ4 A;  1GUK A;  2DC5 A;  3CXG A;  4OD7 A;  2LRT A;  4PGT A;  2GT6 A;  1GLQ A;  1UA5 A;  2R0C A;  1FO5 A;  1C72 A;  3UL3 A;  2VL2 A;  3UJ1 A;  4TR0 A;  4KX4 A;  3D0Z A;  4MLY A;  2H0G A;  1PX7 A;  5B8B A;  5IIZ A;  1B9Y C;  1BJX A;  2IJY A;  3TJJ A;  3EU4 A;  2OKA A;  5ENU A;  3HVV A;  1TK5 B;  4ECI A;  6GSU A;  4TR3 A;  3CSI A;  4YQU A;  5ECH B;  3CTG A;  3GRX A;  2H19 A;  1YJ6 A;  1VRS D;  3UIW A;  4KUN A;  1T4Y A;  4GXZ A;  2HSM A;  2JL4 A;  1V98 A;  5A4V A;  3KTL A;  3H1N A;  3LEF A;  3QMX A;  2H8L A;  3HZ8 A;  2MMZ A;  1BED A;  5C04 A;  2EC4 A;  3BD2 A;  2JSZ A;  2H0H A;  2XPD A;  5IO2 A;  3L9V A;  2VD1 A;  1ERV A;  3WGX A;  5ECR B;  3LYK A;  1B48 A;  3WGD A;  4YAV A;  3KH9 A;  1EGO A;  3IPZ A;  3CSH A;  4TW5 A;  4DSQ A;  5CO3 A;  1LU4 A;  3IV4 A;  5F8B A;  1F2E A;  2H70 A;  1G7O A;  1M2B A;  2X99 A;  1A24 A;  2YNX A;  4F82 A;  1K0N A;  5B6M A;  2IWT A;  3WYW A;  4ID0 A;  1YZX A;  3TJB A;  3TCO A;  2PER A;  3ERG A;  1SK1 A;  1X9W B;  1YQ1 A;  4OWY A;  2RM5 A;  4WKW A;  3K8N A;  2CT6 A;  4KA0 A;  2OE3 A;  4FYC A;  4PTS A;  4ZXG A;  5DBQ A;  6GST A;  2B7K A;  2GQK A;  4QL7 A;  3QD9 A;  4XS1 A;  2IIY A;  5D9T A;  4IEL A;  2OAC A;  2LV3 A;  2HT9 A;  2KLX A;  2FHE A;  4KCA A;  4WF4 A;  3HDC A;  6GSW A;  1NHY A;  1GTI A;  2PVQ A;  2GDR A;  2OE0 A;  2CA8 A;  1ERU A;  2V41 A;  2I81 A;  5H5R A;  1JZD A;  3GUR A;  3UOM A;  4KE3 A;  1FAA A;  4EIP A;  4CHS A;  2B3S A;  3VPT A;  3TB2 A;  2H1A A;  2HNL A;  2F3M A;  5AN1 A;  4F03 A;  3LSZ A;  2IMF A;  2L59 A;  3ERF A;  5LNK e;  4JU5 A;  3LJR A;  1KEB A;  1QFN A;  1TRV A;  3IDV A;  4IVF A;  1TI1 A;  1V57 A;  2DIZ A;  3F4T A;  1PN0 A;  2QA2 A;  2WGR A;  3SBC A;  1EV4 A;  3IK7 A;  3ZLP A;  2GGT A;  4MJA A;  3FW2 A;  5JCU A;  2F8A A;  5AIV A;  5G5E A;  1PD2 1;  1PX6 A;  1G6Y A;  1V9W A;  1F3A A;  1ZYE A;  2F51 A;  1LBK A;  3CYN A;  5ELA A;  1BX9 A;  1URM A;  4IHU A;  4CY8 A;  2NBS A;  4K7N A;  5A4U A;  5G30 A;  4MJE A;  4KW6 A;  1VF4 A;  1W4V A;  2LRC A;  3HY2 A;  3EVI A;  3VFI A;  3BOA A;  2L6C A;  1Q4J A;  1FHE A;  5ID2 B;  17GS A;  1KNG A;  4D73 A;  3GH9 A;  1Y6E A;  1Z7R A;  1JZO A;  2B5E A;  2HZF A;  3KMO A;  5ECP B;  3ZZX A;  12GS A;  1AXD A;  1ILO A;  3APS A;  2LQO A;  3E3E A;  1K3Y A;  2RII A;  1O73 A;  1X5C A;  5LD0 A;  4HUA A;  2QA1 A;  1N8J A;  5HFI A;  2LQQ A;  1WRY A;  1WOU A;  3GKK A;  5KOW A;  4X0X A;  1ERT A;  1QXH A;  4O92 A;  4KSO A;  3A3T A;  2KP2 A;  2HRF A;  4JE1 A;  4GQC A;  1ZYP A;  5B8A A;  4TXO B;  2GT5 A;  1DBY A;  2YCD A;  4EE0 A;  11GS A;  4I97 A;  1V58 A;  2PMT A;  4PNG A;  2FWF A;  3H4K A;  1PRX A;  4G2E A;  2FCH A;  3IK9 A;  3ZRE A;  3C7M A;  1CQG A;  2YWN A;  3M1G A;  3HJP A;  2GTU A;  4IN0 A;  2R3X A;  7GSS A;  5IMZ A;  2DMM A;  5DAK B;  5AGY A;  2LJR A;  1GNW A;  4HQS A;  3TKQ A;  3EU3 A;  4N30 A;  1FOV A;  2V32 A;  4MDC A;  1HNC A;  3MIX A;  1KBN A;  2KUC A;  3FYG A;  3C71 A;  4YQV A;  5HQP A;  4IBP A;  2A2R A;  4DSS B;  5DCG A;  2P5Q A;  4Z2U A;  4O5R A;  4CW9 A;  5BRT A;  1U88 A;  4IQ1 A;  1GSD A;  3FR6 A;  3LOR A;  2PBJ A;  4NV5 A;  4KAE A;  2YPM A;  4N0V A;  4TRX A;  1ZMA A;  20GS A;  2WUL A;  5E4W A;  5ABR A;  4IKH A;  2BJX A;  3HA9 A;  2X4A A;  4X1U A;  3UBK A;  1V2A A;  1TK0 B;  3KEB A;  4YKF A;  3UAR A;  4NHW A;  4MPG A;  1O8W A;  3VWX A;  3A2X A;  4G0L A;  4MJC A;  2C8U A;  5ECQ B;  2VCV A;  4K0G A;  3L0H A;  3TOT A;  4PNF A;  3LXT A;  4I5Q A;  3KP9 A;  2H6X A;  2LJK A;  3CBU A;  4J2F A;  2LEG A;  3APQ A;  2PPT A;  4LL1 B;  4N0Z A;  2K6V A;  1UC7 A;  1QUW A;  3IAS 2;  2FY6 A;  5J4U A;  2HRN A;  3MWH A;  3EIN A;  2EIR A;  2VM2 A;  4X4J A;  3F4S A;  2JAC A;  4O5Q A;  2GZY A;  3NOF A;  1O85 A;  2VD0 A;  2ZNM A;  4ZB8 A;  6GSY A;  3P8W A;  1ZCP A;  1MDJ A;  1TK8 B;  1MDK A;  3Q18 A;  2TIR A;  1S3A A;  1BQ7 A;  4WF5 A;  3LXZ A;  5FHI A;  18GS A;  2WB9 A;  2YJH A;  1RW1 A;  2HZE B;  2WZ9 A;  2H75 A;  5DJM A;  1TP9 A;  1YY7 A;  3N5O A;  1XPV A;  2CX4 A;  4P3Y B;  3RHC A;  1K0D A;  5F06 A;  4GCI A;  4XS6 A;  3KH7 A;  1M9A A;  3A2W A;  4ZIL A;  1WIK A;  2XC2 A;  3QFA C;  4GLT A;  3A5W A;  2OBI A;  4TXV A;  3ZVJ A;  1KTE A;  4EO3 A;  2YP6 A;  2WJU A;  2FWH A;  1DE2 A;  1SYR A;  5AIS A;  5BMU A;  3PIN A;  1Z9H A;  5CAX A;  2HSH A;  4F0B A;  4MF7 A;  4E8H A;  3DKS A;  5GAN D;  4O7H A;  2DKI A;  1VGL A;  1SKS B;  2H66 A;  4WET A;  4F9Z A;  3LFL A;  3TOU A;  3I6A A;  1AQW A;  2CX3 A;  1JLV A;  4GQF A;  3HJO A;  2CAI A;  4GTU A;  4Q5R A;  2GSQ A;  4L8E A;  1K3L A;  3IC8 A;  1GRX A;  3DIE A;  1X9M B;  3HHV A;  4EF0 A;  1JFU A;  3LG6 A;  1FVJ A;  3IC4 A;  4AJ6 A;  1TXX A;  1UN2 A;  5F07 A;  2VOC A;  3BCK A;  2F8F A;  5J41 A;  3HYP A;  4Z7X A;  3CTF A;  1W89 A;  1R5P A;  3LW9 A;  1MDI A;  2L5L A;  3EMP A;  1OE7 A;  5GSS A;  4LMW A;  2K8S A;  3RAZ A;  3IA1 A;  3ZFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...