1Y25A

Structure of mycobacterial thiol peroxidase tpx
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
165
Chain Sequence
HSQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVSATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thiol peroxidase
publication title Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 54
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2004-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1y25A00
4FYBA 1SKWB 6GSVA 2H1BA 22GSA 2H1GA 1Z6NA 3EE2A 5IMVA 3ERGA 2XBQA 2DJKA 1SD8A 2YN1A 3GYKA 1OC9B 3A3TA 3ZRDA 1HYUA 3ZIVA 3M9JA 4LMVA 2VAFA 3GRXA 5IPHA 5COHA 1R7HA 1TKDB 5ENUA 5E59A 3ME8A 1QMVA 1PKWA 2H0HA 1XIYA 3TGZA 4ZB6A 3LXTA 2YZHA 5A4VA 1ABAA 1SKRB 1TDIA 3M9KA 3GTUA 2LQQA 4HJ2A 1AIUA 4DEJA 1GUMA 1K3OA 4KDXA 2B3SA 3M1GA 2JZTA 3TUEA 3IOSA 4MZWA 4G9HA 4NHZA 5ECIB 1T4YA 4BWQA 3UBLA 1DUGA 3KGKA 3LEFA 3LFLA 4FH8A 2PUKC 3TKQA 3FY7A 2VCQA 4K9ZA 2VD0A 5JCUA 3F6DA 4KAEA 2E7PA 2KP1A 4FO5A 1HNCA 2MYGA 1XWAA 4RI6A 4L5LA 2FWEA 1OC3A 3UOMA 1FHEA 2ON5A 3TDGA 3H93A 2VM1A 5CAXA 2G0FA 4IBPA 1NW2A 2YOIA 2HFDA 2GZPA 2AUVA 4MJCA 1F37A 2OE0A 5DCGA 3GMFA 5CP1A 1U88A 3GN3A 2GSTA 1RW1A 4PQ1A 3FW2A 3I43A 1G0TA 3UL3A 2L5OA 3QDNA 5G2ZA 2LEGA 3M8NA 3IAS2 2VL9A 2H74A 3HKRA 3BOAA 3C1SA 3EINA 3KIJA 3KM6A 5DQYA 5DVBA 2IMFA 4MJBA 3BJ5A 2YV7A 2R3XA 4JZQA 4OD7A 1TW9A 5C00A 5B8BA 1EV4A 1GSSA 1ON4A 2EIQA 2G2QA 2VL2A 2VLUA 1BG5A 8GSSA 2JZRA 2PMTA 1SK2A 1O7UA 2DMMA 2O87A 1EEJA 3IHQA 3GV1A 1XVQA 1WE0A 2FLSA 2C80A 2WULA 3IK9A 1F3AA 2B5XA 1TTZA 1SYXA 1K3LA 2AYTA 1HD2A 4WBRD 1G7OA 3TKSE 2KP2A 3LYKA 3IV4A 1IYIA 2DJ2A 3TJBA 5C04A 4ZBBA 4AJ7A 2DLXA 2LSTA 1AW9A 5HFKA 4I2UA 1S3AA 2FWHA 1BYEA 3V1WA 3D6IA 3H4KA 3TJFA 3WT1A 4IQAA 1B48A 4GXZA 4AJ6A 1TU7A 4G2EA 3WYWA 4V2MA 3RAZA 3DRNA 1OYJA 2OBKA 1URMA 3FZAA 12GSA 2A4VA 3D21A 5D9XA 3KMNA 1B8XA 2HE3A 4ZL7A 2VM2A 1HNBA 4RUVA 3OR5A 3DMLA 3HVVA 5DCHA 4PNGA 4L5OA 4I6XA 2NBSA 3H79A 3VFIA 4F2IA 1Y25A 5AISA 3VPQA 4N11A 4LL4B 1ML6A 1A2MA 5EPFA 3CRTA 2LUSA 2F9SA 2F3MA 4TXVA 4BPYA 3VWUA 2O85A 3LJRA 4MABA 3ZYWA 4LLRA 4HU7A 1JLWA 3DD3A 1AC1A 2V6OA 4KDYA 3EYTA 3ZTLA 1J08A 5ECNB 2IPAA 1AQWA 4Q5RA 2X64A 1A8YA 2YV9A 4KUNA 4KGIA 1WIKA 4ECJA 1ZL9A 3K8NA 2HZEA 1YF1A 2EIRA 2H0IA 4V1Ag 2DJ1A 5ECMB 3KZQA 4HI7A 3EU4A 3VWVA 2M72A 5JWQB 4ZIJA 3F9UA 2H75A 2FCHA 4BA7A 1PL2A 3CXGA 1THOA 5DBQA 4JEDA 2WRTA 5D9TA 1X9SB 1WOUA 1ERUA 5B6NA 4N30A 2I81A 5H5SA 4ULXA 1XVWA 4GF0A 3TKPA 1XWBA 1LU4A 1O6JA 2GZYA 1FVJA 1K0DA 2ON7A 1TRWA 2AHEA 2PVQA 4PUFC 1SJIA 2DJ3A 1UA5A 4HEA2 4MJAA 2FY6A 3Q19A 3HJPA 2N5FA 3RPPA 1EV9A 1FB0A 4QQ7A 5J9CA 19GSA 4XCSA 3QMXA 1T7PB 1B9YC 1GTIA 2CT6A 1Q98A 3HCZA 1FO5A 2DIZA 4MF6A 1ACVA 3CMIA 4XS4B 4F9ZA 2HXKA 4BWSA 3GNJA 4ML1A 1PX7A 1UN2A 3C7MA 5G1KA 2M46A 1GNWA 4AF2A 2B5YA 2FA8A 1ERTA 4MPGA 1ZYQB 2A2SA 1XCCA 3IA1A 1QUWA 4WR4A 2DJ0A 3A2XA 4IJIA 1RK4A 3L0HA 2IMIA 4RQRA 3GKXA 1I9DA 4X43A 3QFBC 2CQ9A 2H0GA 1PL1A 1OC8A 3CTFA 3CRUA 3HY2A 4IELA 3O76A 1TK0B 4KX4A 4GWRA 3RHBA 5FWGA 5FHIA 3F3RA 2NVLA 1WMJA 2CVKA 4JR6A 3QOUA 1DE1A 4KCAA 2JACA 2GDRA 2R5GA 2H30A 5ECRB 4H86A 2GGTA 5ELAA 4MCUA 1W4VA 4KH7A 4LMWA 1A2LA 2NTOA 4ZL9A 2ZCTA 4V2NA 2CAQA 3WT2A 2VO4A 3EU3A 1PQNA 1YF0A 3VPTA 3IBHA 4OO4A 1ZMAA 5ID2A 2EIOA 3LG6A 1XBSA 2DMLA 2M80A 4FYUA 2DC5A 3WD6A 4RQXA 1A8LA 1EGOA 1OE8A 4L0UA 4J2FA 4F0CA 11GSA 3VLNA 2XHFA 3WGDA 3G7JA 2BJXA 3VWXA 4ECBA 2B7JA 3FR3A 3KH7A 1M99A 2R4VA 6GSYA 4JU5A 3VI7A 1PMTA 1G7EA 4YQUA 4PQHA 3IE3A 3TB2A 2F8FA 2P5RA 2H1AA 2WB9A 5HFGA 2OJLA 2C0FA 3LQ7A 3G7IA 1Y6EA 4PGTA 3Q74A 2X8HA 4IP6A 2PPTA 2HRFA 1USBA 2PVOC 5DALA 2OBIA 4EF0A 1TI3A 3APOA 4EC0A 4I5QA 1MEKA 5IMZA 2WFCA 4TR4A 5F07A 5CRHA 2H6XA 1XXUA 2V2GA 2H66A 3PH9A 3KD0A 1GNEA 3RHCA 1M7TA 2V1MA 3MWHA 3ZFLA 5H5QA 3QD9A 3KXOA 3IDVA 3P2AA 1AXDA 2LRCA 5G5FA 2GQLA 4O5RA 3HDCA 3HZ4A 6GSUA 1F2EA 1GTAA 1MD4A 4KCEA 1NHYA 4D73A 3GURA 2WCIA 1GH2A 2IN3A 5IOWA 1V40A 3U6VA 1T00A 4Q5NA 2PGTA 5ECQB 4TR3A 2CA8A 5GZZB 3PGTA 2RUFA 3F3QA 2H70A 1E6BA 4XIHA 2VL3A 2C4JA 1TRUA 3D0ZA 3H8QA 5G1LA 1K0NA 2KUCA 3P8WA 4OCEA 4FYCA 5D9VA 1SENA 13GSA 3KJYA 3HVXA 2R2JA 1V98A 1K0AA 4NV5A 2GVPA 3M0FA 5CRWA 2GZZA 1BJXA 1U3AA 2H01A 2NPBA 3FRCA 2IFQA 2HNLA 1XWKA 2L6DA 2VL2C 3UBKA 4KNDA 1B4QA 3TJGA 4MF5A 5DAKB 1X9MB 3EVIA 2DIYA 3F4SA 5DDLA 2WJUA 2VCZA 1O81A 1RQMA 4PURA 4WF5A 5F0GA 2YWNA 2DJJA 3QPMA 2YJHA 1FW1A 1X0RA 1EOHA 4PQIA 6GSTA 2CVBA 1KNGA 1PSQA 1Q4JA 5HR1A 2H8LA 3RDWA 1EP7A 2E2GA 4K6XA 1EWXA 4WR5A 4POMA 5KN2A 2YCDA 4KE3A 1R5AA 2HRNA 1EGRA 3VURA 3LXZA 1MTCA 2R6KA 4TRXA 1YQ1A 4KA0A 4ISDA 3FK8A 3IRAA 1OVNA 1FVKA 3DYRA 1Z7RA 1OC9A 2JSYA 4V1Ap 3SWLA 3L78A 3D22A 1TP9A 1VRSD 3ZIJA 2OE3A 4K0GA 3J7Yb 2GSSA 18GSA 2CV4A 4MJEA 1AQXA 3U5RE 1B4PA 1GTBA 1A0FA 3GKMA 3N9JA 3F0IA 2YZUA 5JWRB 4TXOB 3LSZA 5J41A 2TIRA 2VUPA 1DE2A 5IM9A 3TKSA 4JR4A 2P5QA 2K6VA 2GLRA 2FNOA 3FHKA 4MF7A 3FZ4A 3KMOA 3C8EA 4PX1A 2NDOA 2X99A 4OMVA 1DSBA 1CQHA 4ML6A 3G9BA 3DIEA 4TR1B 5INYA 2AJQB 4NPBA 4I2TA 4N0VA 1A0RP 5J9BA 4HDEA 1SL2B 1TRVA 2WGRA 6GSSA 4DVCA 4EDYA 4K7OA 1TI1A 4WF4A 2PU9C 2I9HA 3UMAA 5LNKe 1BAYA 1JZRA 2O7KA 2K9FA 4K0NA 1E2YA 2QGVA 4WEYA 4X0XA 3O6TA 1GLQA 4NMUA 3O3TA 3GFKA 4HQSA 3L4NA 3DEXA 3ERWA 1H4OA 4ZL8A 1TOFA 20GSA 1TJDA 1SK1A 2DSAA 2H6YA 4POKA 2BTOT 3US3A 4MH3A 3ME7A 2OE1A 5IIZA 3UEMA 2I1UA 5KN0A 4N0ZA 4XS6A 2L59A 3BCIA 1ERVA 1SK0A 4MZCA 5CREA 3TRXA 1TRSA 4ZBDA 4YQMA 1YEPA 3GKKA 5EY6A 5G30A 3I6AA 3GSSA 2JADA 3C1RA 1F6MC 4J57E 1A24A 5E4WA 4KSMA 3IC4A 2AAWA 3M3MA 1Z9HA 4ZB9A 3HZ8A 1QXHA 3KP9A 3A2WA 4OCFA 2ES7A 4NWYA 5AN1A 3UVTA 2C0DA 2OA7A 1MDIA 5F8BA 3KEBA 1X5EA 4YH2A 2H76A 3WGXA 4CW9A 3IR4A 3ZITA 1B9XC 1EOGA 3W8JA 2CAIA 1S3CA 2VCXA 2JZSA 3HXSA 5GSSA 2GSRA 3FZ9A 4HZ2A 3GH6A 2KLXA 5CYYA 4EL1A 5HR2A 5J3RA 1BX9A 2HYXA 3QFAC 3NZNA 5D73A 1GSFA 2CVDA 4QL7A 5ECOB 4JBBA 2RM5A 4K1FA 2YANA 5LD0A 3QR6A 4MA9A 1OE7A 1SYRA 2IL3A 4ECIA 5J5NA 2YJ7A 4XTSA 4MP4A 4K8MA 3E0UA 3GL3A 5LCZA 1SKSB 3CBUA 1H75A 4HU9A 2LNTA 3MAKA 3LYPA 5G5EA 2LRTA 5GSTA 4K2DA 3ZFBA 1PD21 1VF4A 2N5AA 4HQZA 2P0GA 5DALB 3W8SA 2JU5A 4G19A 1K0MA 5JCGA 4HUAA 1BEDA 4IVFA 5GAPD 2HI7A 2AB6A 4MPFA 2F51A 4E8EA 3FEUA 1PX6A 1F3BA 2CZ2A 3HVSA 3R2QA 4OFNA 3P90A 1GSYA 1QFNA 16GSA 2B1KA 5HR3A 2C3QA 4NAXA 1T3BA 3ZMLA 5IO0A 5KN3A 2H1DA 2WDUA 1GL8A 4GQCA 4XRAA 1AUCA 2IMKA 4EUYA 1K0BA 3MSZA 2XPEA 2CX3A 4EE0A 3GTUB 5L71A 1PA3A 1IYHA 1V9WA 1N8JA 17GSA 3BCKA 5B7CA 2OKAA 1JLVA 1VF2A 4G10A 3JCML 3TOUA 4IKHA 3N5OA 3BBYA 3NIVA 4F82A 2RUEA 4OWYA 3PINA 1THXA 2XBIA 1KTEA 1JZOA 3APQA 2LNSA 4GCIA 1XWGA 3GIXA 1I5GA 2X8CA 2YP6A 2OADA 3IK7A 4GSTA 1W89A 5ECKB 2F8AA 2IFQB 4WETA 4ILFA 1WRYA 1XWCA 4PXOA 1V58A 4TN8A 5DJLA 5ABRA 1M9BA 3D4MA 1FOVA 1OKDA 2P31A 2A2RA 3DWVA 1GLPA 4TVEA 3TCOA 4L8EA 4K7NA 2I3YA 5D93A 3VWWA 2KOKA 6GSWA 3IAM2 2XPDA 1G6WA 1O85A 2L4QA 4XS4A 3FZ5A 3VI5A 1NHOA 3A2VA 1AQVA 2B7KA 1T4ZA 2VD1A 4RI7A 3TRQA 3CTGA 2C3NA 1HQOA 2L4CA 4ID0A 2YWIA 1MD3A 1ST9A 5IOXA 3MDKA 4TKYA 1C72A 3LWAA 3Q18A 4XHMA 3D4TA 3QAVA 2PWJA 1G6YA 5IMAA 4ZILA 4NV2A 3ZL5A 5A4WA 2MBTA 4EVMA 3ZLPA 1TU8A 2PBJA 2GT6A 5CRGA 1U3IA 2GSQA 3F4RA 3NOFA 3EC3A 2L57A 5CNWA 2I4AA 5AGYA 1SL1B 3DVWA 1YKAA 5KEJA 1BQ7A 1R4WA 3C71A 2H71A 2JL4A 2LV3A 4QL9A 2GQKA 5GAND 3GL5A 1PKZA 4DSQA 1R26A 2LS5A 2B6MA 1YY7A 3CSIA 3HHVA 1GSDA 3QAGA 4XRDA 1WP0A 2EC4A 2CX4A 3L9VA 1N2AA 4YQVA 4GQFA 3MNGA 4BVYA 2FHEA 2J23A 1XW9A 1Z3EA 1FG4A 3E3EA 5ECHB 4EKZA 3DXBA 4DSSA 2MZCA 3ZMKA 2QSIA 2YWOA 1KEBA 2KHPA 2X8GA 4MZBA 2MMNA 2YNXA 1ERWA 2C8UA 2FA4A 5F06A 1YDKA 1J9BA 4WKWA 2MMAA 1F9MA 2ZNMA 1GSQA 1M2DA 2WZ9A 1A2JA 3DKSA 1XZOA 2O89A 1EP8A 1ZYEA 4ZXGA 2TRCP 4I97A 3HJMA 2HSHA 1M2BA 3KP8A 2B1LA 1ZOFA 2K18A 4JRRA 1QK8A 5IQYA 1JZWA 1GULA 3G7YA 4O32A 1M0UA 1LJRA 2HZFA 1YEXA 1M9AA 3I9V2 3ED3A 5JCWA 3TKSC 1WPIA 2K8VA 4O7HA 4TR0A 2OACA 4AGSA 5ECPB 5A5KA 3UARA 3IXRA 1NM3A 4NXIA 1CQGA 4BL7A 4I8BA 4J56E 2L6CA 2V6KA 3GUSA 2HZEB 2IIYA 2RM6A 1QQ2A 1LBKA 2D2ZA 4OFMA 4IQ1A 2O8VB 3TJKA 4POBA 1XW5A 3L9SA 2PN8A 3HJOA 1WJKA 4IJ3A 2E2MA 3QAWA 1OKTA 5IMDA 3UIWA 6GSXA 2TRXA 3EWLA 3ZVJD 14GSA 2HSYA 4FIWA 1M2AA 4YAPA 3W6GA 2LJRA 5ELGA 4GTUA 4MK3A 4P3YB 1KBNA 5HQPA 4XS1A 4MH2A 5AIVA 5J4UA 2GTUA 2HLSA 3HYPA 1NSWA 2XC2A 2L5LA 3L9UA 1PRXA 2J9HA 5D96A 1O73A 1MDKA 4F03A 1GTUA 3LORA 3KTLA 1ZCPA 2B5EA 1FB6A 3UJ1A 4L0WA 3GX0A 2CZ3A 4N10A 1VGLA 1TK8B 3UVHA 1XPVA 3AY8A 2GS3A 5DAKA 1Z5YE 4F0BA 5HFIA 1T1VA 2LQOA 2LKUA 1X5DA 1OAZA 3P7XA 3GX8A 3WGEA 4LA1A 4TOPA 2LJAA 2LJKA 1DBYA 1K0OA 3BD2A 4OO5A 1A23A 3APSA 4MLYA 2LTKA 1V2AA 1UC7A 4BVXA 2N5BA 1GP1A 1TK5B 1FAAA 2IMDA 2PERA 3TOTA 5EL8A 4Q5QA 3TJJA 5CO3A 4LL1B 4HS1A 1VF1A 4Z7XA 1O8WA 5F05A 1TXXA 4KSOA 2VCWA 1K0CA 5DJMA 4IN0A 1S3DA 4NHWA 7GSSA 4AJ8A 2MBSA 5IMFA 2VCVA 4WBJA 3H1NA 4IS0A 1YKCA 3F8UA 1O8XA 2RLIA 4MMMA 3ZZXA 2MMZA 1GUKA 5D8IA 5IMCA 4TXOA 1Z7PA 1K3YA 3DGQA 4DSRA 2VOCA 3J7Yk 2VLTA 5HR0A 2C0EA 2FWFA 3ISOA 5JWOB 1X9WB 5ID2B 5KN1A 4PNFA 3FR6A 3A5WA 2C0GA 1JZDA 2VLVA 4GSNA 2C3TA 3VK9A 4Q5FA 1XOBA 5CRDA 3RBTA 1QGVA 3LGCA 1HNAA 3RPNA 4TR1A 4EXJA 2V41A 4OFTA 1JHBA 1V57A 10GSA 2FUG2 2IWTA 2FWGA 2DBCA 1SJZA 3HA9A 3IPZA 3ZVJA 2C1YA 2FGXA 3ZREA 9GSSA 5FT3A 4K7IA 3KH9A 3HD5A 3KCMA 1YZXA 2K8SA 4EDZA 1ZGNA 4IW9A 4ECCA 2VCTA 2REMA 2V32A 3FKFA 1GSEA 4IHUA 3ERFA 1JFUA 4O92A 1XOAA 4KDUA 3TKRA 1R5PA 3GSTA 3Q6OA 2IJYA 2QC7A 4V2LA 2GQMA 3CYNA 1PN9A 1XFLA 3GA4A 2IMEA 3CSHA 4ZBAA 4E8HA 3D5JA 3GKNA 2HT9A 1ILOA 2Z9SA 5ECSA 4POLA 3I69A 4D73B 3PR8A 1T8EB 1VF3A 2H6ZA 5ECLB 1EZKA 5B6MA 4TW5A 4IP1A 5DQSA 1GUHA 2JSZA 1Z6MA 3QCPA 1XW6A 1U87A 3F6FA 3SBCA 3FR9A 3TRPA 3E9JB 3KTBA 5A4UA 2MMOA 4MDCA 1SU9A 4CHSA 2E0QA 4YAVA 1J0FA 1X5CA 1PGTA 2R37A 5AIXA 1WWJA 5H5RA 1AAZA 2AV4A 4ZB8A 4HJMA 4X1UA 3C73A 4KW6A 4CDOA 4ACSA 2H73A 4HZ4A 2FD3A 3GH9A 3CSJA 4DSSB 5B8AA 2H19A 1EEMA 2BMXA 5EVOA 5IO2A 3S9FA 2YPMA 1GRXA 2YWMA 2GT5A 3F4TA 4KB3A 5D9WA 3GHAA 3EURA 3FYGA 1GSUA 1SJ6A 3EMPA 2QKEA 3UAPA 2RIIA 4JE1A 1YJ6A 4EO3A 1GWCA 4HOJA 3DVXA 5G31A 4GSSA 1SL0B 2WS2A 1UVZA 4IGJA 2VIMA 1SD9A 4GRFA 1U6TA 2LRNA 4PUAA 4GLTA 2ZUPA 2H72A 3EMXA 1ZZYA 5IPGA 1MDJA 4WXTA 3F63A 2ALBA
chains in the Genus database with same CATH superfamily
4FYBA 1SKWB 6GSVA 2H1BA 22GSA 2H1GA 1Z6NA 3EE2A 5IMVA 3EPTA 3ERGA 2XBQA 2DJKA 1SD8A 2YN1A 3GYKA 1OC9B 3A3TA 3ZRDA 1HYUA 3ZIVA 3M9JA 4LMVA 2VAFA 3GRXA 5IPHA 5COHA 1R7HA 1TKDB 5ENUA 5E59A 3ME8A 1QMVA 1PKWA 2H0HA 1XIYA 3TGZA 4ZB6A 3LXTA 2YZHA 5A4VA 1ABAA 1SKRB 1TDIA 3M9KA 3GTUA 2LQQA 4HJ2A 1AIUA 4DEJA 1GUMA 1K3OA 4KDXA 2B3SA 3M1GA 2JZTA 3TUEA 3IOSA 4MZWA 4G9HA 4NHZA 5ECIB 1T4YA 4BWQA 3UBLA 1DUGA 3KGKA 3LEFA 3LFLA 4FH8A 2PUKC 3TKQA 3FY7A 2VCQA 4K9ZA 2VD0A 5JCUA 3F6DA 4KAEA 2E7PA 2KP1A 4FO5A 1HNCA 2MYGA 1XWAA 4RI6A 2HRKA 4L5LA 2FWEA 1OC3A 3UOMA 1FHEA 2ON5A 3TDGA 3H93A 2VM1A 5CAXA 2G0FA 4IBPA 1NW2A 2YOIA 2HFDA 2GZPA 2AUVA 4MJCA 4Z2RA 1F37A 2OE0A 5DCGA 3GMFA 5CP1A 1U88A 3GN3A 2GSTA 1PN0A 1RW1A 4PQ1A 3FW2A 3I43A 1G0TA 3UL3A 2L5OA 3QDNA 5G2ZA 2LEGA 3M8NA 3IAS2 2VL9A 2H74A 3HKRA 3BOAA 3C1SA 3EINA 3KIJA 3KM6A 5DQYA 5DVBA 2IMFA 4MJBA 3BJ5A 2YV7A 2R3XA 4JZQA 4OD7A 1TW9A 5C00A 5B8BA 1EV4A 4K5RA 1GSSA 1ON4A 4BVXB 2EIQA 2G2QA 2VL2A 2VLUA 1BG5A 8GSSA 5KOWA 2JZRA 2PMTA 1SK2A 1O7UA 2DMMA 2O87A 1EEJA 3IHQA 3GV1A 1XVQA 1WE0A 2FLSA 2C80A 2WULA 3IK9A 1F3AA 2B5XA 1TTZA 1SYXA 1K3LA 2AYTA 1HD2A 4WBRD 1G7OA 3TKSE 2KP2A 2HRAA 3LYKA 3IV4A 1IYIA 2DJ2A 3TJBA 5C04A 4ZBBA 4AJ7A 2DLXA 2LSTA 1AW9A 5HFKA 1PFOA 4I2UA 1S3AA 2FWHA 1BYEA 3V1WA 3D6IA 3H4KA 3TJFA 3WT1A 4IQAA 1B48A 4GXZA 3IC8A 1TU7A 4G2EA 4AJ6A 3WYWA 4V2MA 3RAZA 3DRNA 1OYJA 2OBKA 1URMA 3FZAA 12GSA 2A4VA 3D21A 5D9XA 3KMNA 1B8XA 2HE3A 4ZL7A 2VM2A 1HNBA 4RUVA 3OR5A 3DMLA 3HVVA 5DCHA 4PNGA 4L5OA 4I6XA 2NBSA 3H79A 3VFIA 4F2IA 1Y25A 5AISA 3MIXA 3VPQA 4N11A 4LL4B 1ML6A 3CQFA 4EIPA 1A2MA 5EPFA 3CRTA 2LUSA 3PPUA 2F9SA 2F3MA 4TXVA 4BPYA 3VWUA 2O85A 3LJRA 4MABA 3ZYWA 4LLRA 4HU7A 1JLWA 3DD3A 1AC1A 2V6OA 4KDYA 3EYTA 3ZTLA 1J08A 5ECNB 2IPAA 1AQWA 4Q5RA 2X64A 1A8YA 2YV9A 4KUNA 4KGIA 1WIKA 4ECJA 1ZL9A 3K8NA 2HZEA 1YF1A 2EIRA 2H0IA 4V1Ag 2DJ1A 5ECMB 3KZQA 4HI7A 3EU4A 3VWVA 2M72A 5JWQB 4ZIJA 3F9UA 2H75A 2FCHA 4BA7A 1PL2A 3CXGA 1THOA 5DBQA 4JEDA 2WRTA 5D9TA 1X9SB 1WOUA 1ERUA 5B6NA 4N30A 2I81A 5H5SA 4ULXA 4K5SA 1XVWA 4GF0A 3TKPA 1XWBA 1LU4A 1O6JA 2GZYA 1FVJA 1K0DA 2ON7A 1TRWA 2AHEA 2PVQA 4PUFC 1SJIA 2DJ3A 1UA5A 4HEA2 4MJAA 2FY6A 4PTSA 3Q19A 3HJPA 4G0KA 2N5FA 3RPPA 1EV9A 1FB0A 4QQ7A 5J9CA 19GSA 4XCSA 3QMXA 1T7PB 1B9YC 1GTIA 2CT6A 1Q98A 3HCZA 3HVNA 4EIQA 1FO5A 2DIZA 4MF6A 1ACVA 3CMIA 4XS4B 4F9ZA 2HXKA 4BWSA 3GNJA 4ML1A 1PX7A 2R0CA 1UN2A 3C7MA 5G1KA 5KOXA 2M46A 1GNWA 4AF2A 2B5YA 2FA8A 1ERTA 4MPGA 1ZYQB 2A2SA 1XCCA 3IA1A 1QUWA 4WR4A 2DJ0A 3A2XA 4IJIA 1RK4A 3L0HA 2IMIA 4RQRA 3GKXA 1I9DA 4X43A 3QFBC 2CQ9A 4BIKA 2H0GA 1PL1A 1OC8A 3CTFA 3CRUA 3HY2A 4IELA 5BRTA 3O76A 1TK0B 4KX4A 4GWRA 3RHBA 5FWGA 5FHIA 3F3RA 2NVLA 1WMJA 2CVKA 4JR6A 3QOUA 1DE1A 4KCAA 2JACA 2GDRA 2R5GA 2H30A 5ECRB 4H86A 2GGTA 5ELAA 4MCUA 1W4VA 4KH7A 4LMWA 1A2LA 2NTOA 4ZL9A 2QA2A 2ZCTA 4V2NA 2CAQA 3WT2A 2VO4A 3EU3A 1PQNA 1YF0A 3VPTA 3IBHA 4OO4A 1ZMAA 5ID2A 2EIOA 3LG6A 1XBSA 2DMLA 2M80A 4FYUA 2DC5A 3WD6A 4RQXA 1A8LA 1EGOA 1OE8A 4L0UA 4J2FA 4F0CA 11GSA 3VLNA 2XHFA 3WGDA 3G7JA 2BJXA 3VWXA 4ECBA 2B7JA 3FR3A 3KH7A 1M99A 2R4VA 6GSYA 4JU5A 3VI7A 1PMTA 1G7EA 4YQUA 4PQHA 3IE3A 3TB2A 2F8FA 2P5RA 2H1AA 2WB9A 5HFGA 2OJLA 2C0FA 3LQ7A 3G7IA 1Y6EA 4PGTA 3Q74A 2X8HA 4IP6A 2PPTA 2HRFA 1USBA 2PVOC 5DALA 2OBIA 4EF0A 1TI3A 3APOA 4EC0A 4I5QA 1MEKA 5IMZA 2WFCA 4TR4A 5F07A 5CRHA 2H6XA 1XXUA 2V2GA 2H66A 3PH9A 3KD0A 1FOHA 1GNEA 4BL7B 3RHCA 1M7TA 2V1MA 3MWHA 3ZFLA 5H5QA 3QD9A 3KXOA 3IDVA 3P2AA 1AXDA 2LRCA 5G5FA 2GQLA 4O5RA 3HDCA 3HZ4A 6GSUA 1F2EA 1GTAA 1MD4A 4KCEA 1NHYA 4D73A 2A4HA 3GURA 2WCIA 1GH2A 2IN3A 5IOWA 1V40A 3U6VA 1T00A 4Q5NA 2PGTA 5ECQB 4TR3A 4CY8A 2CA8A 5GZZB 3PGTA 2RUFA 3F3QA 2H70A 1E6BA 4XIHA 2VL3A 2C4JA 1TRUA 3D0ZA 3H8QA 5G1LA 1K0NA 2KUCA 3P8WA 4OCEA 4FYCA 5D9VA 1SENA 13GSA 3KJYA 3HVXA 2R2JA 1V98A 1K0AA 4NV5A 2GVPA 3M0FA 5CRWA 2GZZA 4K2XA 1BJXA 1U3AA 2H01A 2NPBA 3FRCA 2IFQA 2HNLA 1XWKA 2L6DA 2VL2C 3UBKA 4KNDA 1B4QA 3TJGA 4MF5A 5DAKB 1X9MB 3EVIA 2DIYA 3F4SA 5DDLA 2WJUA 2VCZA 1O81A 1RQMA 4PURA 4WF5A 5F0GA 2YWNA 2DJJA 3QPMA 2YJHA 1FW1A 1X0RA 1EOHA 4PQIA 6GSTA 2CVBA 1KNGA 1PSQA 1Q4JA 5HR1A 2H8LA 3RDWA 1EP7A 2E2GA 4K6XA 1EWXA 4WR5A 4POMA 5KN2A 2YCDA 4KE3A 1R5AA 2HRNA 1EGRA 3VURA 3LXZA 1MTCA 2R6KA 4TRXA 1YQ1A 4KA0A 4ISDA 3FK8A 3IRAA 1OVNA 1FVKA 3DYRA 1Z7RA 1OC9A 2R0PA 2JSYA 4V1Ap 3SWLA 3L78A 3D22A 1TP9A 1VRSD 3ZIJA 2OE3A 4K0GA 3J7Yb 2GSSA 18GSA 2CV4A 4MJEA 1AQXA 3U5RE 1B4PA 1GTBA 1A0FA 3GKMA 3N9JA 3F0IA 2YZUA 5JWRB 4TXOB 3LSZA 5J41A 2TIRA 2VUPA 1DE2A 5IM9A 3TKSA 4JR4A 2P5QA 2K6VA 2GLRA 2FNOA 3FHKA 4MF7A 3FZ4A 3KMOA 3C8EA 4PX1A 2NDOA 2X99A 4OMVA 1DSBA 1CQHA 4ML6A 3G9BA 3DIEA 4TR1B 5INYA 2AJQB 4NPBA 4I2TA 4N0VA 1A0RP 5J9BA 4HDEA 1ZYNA 1SL2B 1TRVA 1M3IA 2WGRA 6GSSA 4DVCA 4EDYA 4K7OA 1TI1A 4WF4A 2PU9C 2I9HA 3UMAA 5LNKe 1BAYA 1JZRA 2O7KA 2K9FA 4K0NA 1E2YA 2QGVA 4WEYA 4X0XA 3O6TA 1GLQA 4NMUA 3O3TA 3GFKA 4HQSA 3L4NA 3DEXA 3ERWA 1H4OA 4ZL8A 1TOFA 20GSA 1TJDA 1SK1A 2DSAA 2H6YA 4POKA 2BTOT 3US3A 4MH3A 3ME7A 2OE1A 5IIZA 3UEMA 2I1UA 5KN0A 4N0ZA 4XS6A 2L59A 1M3JA 3BCIA 1ERVA 1SK0A 1ZYPA 4MZCA 5CREA 3TRXA 1TRSA 4ZBDA 4YQMA 1YEPA 3GKKA 5EY6A 5G30A 3I6AA 3GSSA 2JADA 3C1RA 1F6MC 4J57E 1A24A 5E4WA 4KSMA 3IC4A 4G0LA 2AAWA 3M3MA 1Z9HA 4ZB9A 3HZ8A 1QXHA 3KP9A 3A2WA 4OCFA 2ES7A 2R0GA 4NWYA 5AN1A 3UVTA 2C0DA 2OA7A 1MDIA 5F8BA 3KEBA 1X5EA 4YH2A 2H76A 3WGXA 4CW9A 3IR4A 3ZITA 1B9XC 1EOGA 3W8JA 2CAIA 1S3CA 2VCXA 2JZSA 3HXSA 5GSSA 2GSRA 3FZ9A 4HZ2A 3GH6A 2KLXA 3MYDA 5CYYA 4EL1A 5HR2A 5J3RA 1BX9A 2HYXA 3QFAC 3NZNA 5D73A 1GSFA 2CVDA 4USSA 4QL7A 5ECOB 4JBBA 2RM5A 4K1FA 2YANA 5LD0A 3QR6A 4MA9A 1S3RA 1OE7A 1SYRA 2IL3A 4ECIA 5J5NA 2YJ7A 4XTSA 4MP4A 4K8MA 3E0UA 3GL3A 5LCZA 1SKSB 3CBUA 1H75A 4HU9A 2LNTA 3MAKA 3LYPA 5G5EA 2LRTA 5GSTA 3A5IA 4K2DA 3ZFBA 1PD21 1VF4A 2N5AA 4HQZA 2P0GA 5DALB 3W8SA 2JU5A 4G19A 1K0MA 5JCGA 4HUAA 1BEDA 4IVFA 5GAPD 2HI7A 2AB6A 4MPFA 2F51A 4YKFA 4E8EA 3FEUA 1PX6A 2X49A 1F3BA 2CZ2A 3HVSA 3R2QA 4OFNA 3P90A 1GSYA 1QFNA 4G0IA 16GSA 4O5QA 2B1KA 5HR3A 2C3QA 4NAXA 1T3BA 3ZMLA 3R3EA 5IO0A 5KN3A 2H1DA 2WDUA 1GL8A 4GQCA 4XRAA 1AUCA 2IMKA 4EUYA 1K0BA 3MSZA 2XPEA 2CX3A 4EE0A 3GTUB 5L71A 1PA3A 1IYHA 1V9WA 1N8JA 17GSA 3BCKA 5B7CA 2OKAA 4Z2TA 1JLVA 1VF2A 4G10A 3IHGA 3JCML 3TOUA 4IKHA 3N5OA 2A2PA 3BBYA 3NIVA 4F82A 2RUEA 4OWYA 3PINA 1THXA 2XBIA 1KTEA 1JZOA 3APQA 2LNSA 4GCIA 1XWGA 3GIXA 1I5GA 2X8CA 2YP6A 2OADA 3IK7A 4GSTA 1W89A 5ECKB 2F8AA 2IFQB 4WETA 4ILFA 1WRYA 1XWCA 4PXOA 1V58A 4TN8A 5DJLA 4Z2UA 5ABRA 1M9BA 3D4MA 1FOVA 1OKDA 2P31A 2A2RA 3DWVA 1GLPA 4TVEA 3TCOA 4L8EA 4K7NA 2I3YA 5D93A 3VWWA 2KOKA 6GSWA 3IAM2 2XPDA 1G6WA 1O85A 2L4QA 4XS4A 3FZ5A 3VI5A 1NHOA 3A2VA 1AQVA 2B7KA 1T4ZA 2VD1A 4RI7A 3TRQA 3CTGA 2C3NA 1HQOA 2L4CA 4ID0A 2YWIA 1MD3A 1ST9A 5IOXA 3MDKA 4TKYA 1C72A 3LWAA 3Q18A 4XHMA 3D4TA 3QAVA 2PWJA 1G6YA 3LW9A 5IMAA 4ZILA 4NV2A 3ZL5A 5A4WA 2MBTA 4EVMA 3ZLPA 1TU8A 2PBJA 2GT6A 5CRGA 1U3IA 2GSQA 3F4RA 3NOFA 3EC3A 2L57A 5CNWA 2HSMA 2I4AA 5AGYA 1SL1B 3DVWA 1YKAA 5KEJA 1BQ7A 1R4WA 3C71A 2H71A 2JL4A 2LV3A 4QL9A 2GQKA 5GAND 3GL5A 1PKZA 4A5PA 4DSQA 1R26A 2LS5A 2B6MA 1YY7A 3CSIA 3HHVA 1GSDA 3QAGA 4XRDA 1WP0A 2EC4A 2CX4A 3L9VA 1N2AA 4YQVA 4GQFA 3MNGA 4BVYA 2FHEA 2J23A 1XW9A 1Z3EA 1FG4A 3E3EA 5ECHB 4EKZA 3DXBA 4DSSA 2MZCA 3ZMKA 2QSIA 2YWOA 1KEBA 2KHPA 2X8GA 4MZBA 2MMNA 2YNXA 1ERWA 2C8UA 2FA4A 5F06A 1J9BA 1YDKA 4WKWA 2MMAA 1F9MA 2ZNMA 1GSQA 1M2DA 2WZ9A 1A2JA 3DKSA 1XZOA 2O89A 1EP8A 1ZYEA 4ZXGA 2TRCP 4I97A 3HJMA 2HSHA 1M2BA 3KP8A 2B1LA 1ZOFA 2K18A 4JRRA 1QK8A 4HSCX 5IQYA 1JZWA 1GULA 3G7YA 4KF9A 4O32A 1M0UA 1LJRA 2HZFA 1YEXA 1M9AA 3I9V2 3ED3A 5BMUA 5JCWA 3TKSC 1WPIA 2K8VA 4O7HA 4TR0A 2OACA 4AGSA 5ECPB 5A5KA 3UARA 3IXRA 1NM3A 4NXIA 1CQGA 4BL7A 4I8BA 4J56E 2L6CA 2V6KA 3GUSA 2HZEB 2IIYA 2RM6A 1QQ2A 1LBKA 2D2ZA 4OFMA 4IQ1A 2O8VB 3TJKA 4POBA 1XW5A 3L9SA 2PN8A 3HJOA 1WJKA 4IJ3A 2E2MA 3QAWA 1OKTA 5IMDA 3UIWA 6GSXA 2TRXA 3EWLA 3ZVJD 14GSA 2HSYA 4FIWA 1M2AA 4YAPA 3W6GA 2LJRA 5ELGA 4GTUA 4MK3A 4P3YB 1KBNA 5HQPA 4XS1A 4MH2A 5AIVA 5J4UA 2GTUA 2HLSA 3HYPA 1NSWA 2XC2A 2L5LA 3L9UA 1PRXA 2J9HA 5D96A 1O73A 1MDKA 4F03A 1GTUA 3LORA 2QA1A 3KTLA 1ZCPA 2B5EA 1FB6A 3UJ1A 4L0WA 3GX0A 4FQUA 2CZ3A 4N10A 1VGLA 1TK8B 3UVHA 1XPVA 3AY8A 2GS3A 5DAKA 1Z5YE 4F0BA 5HFIA 1T1VA 2LQOA 2LKUA 1X5DA 1OAZA 3P7XA 3GX8A 3WGEA 4LA1A 4TOPA 2LJAA 2LJKA 1DBYA 1K0OA 3BD2A 4OO5A 1A23A 3APSA 4MLYA 2LTKA 1V2AA 4X4JA 1UC7A 4BVXA 2N5BA 1GP1A 1TK5B 1FAAA 2IMDA 2PERA 3TOTA 5EL8A 4Q5QA 3TJJA 5CO3A 4LL1B 4HS1A 1VF1A 4Z7XA 1O8WA 5F05A 1TXXA 4KSOA 2VCWA 1K0CA 5DJMA 4IN0A 1S3DA 4NHWA 7GSSA 4AJ8A 2MBSA 5IMFA 2VCVA 4WBJA 3H1NA 4IS0A 1YKCA 3F8UA 1O8XA 2RLIA 4MMMA 3ZZXA 2MMZA 1GUKA 2X4AA 5D8IA 4ICYA 5IMCA 4TXOA 1Z7PA 1K3YA 3DGQA 4DSRA 2VOCA 3J7Yk 2VLTA 5HR0A 2C0EA 2FWFA 3ISOA 5JWOB 1X9WB 5ID2B 5KN1A 4PNFA 3FR6A 3A5WA 2C0GA 1JZDA 2VLVA 4GSNA 2C3TA 3VK9A 4Q5FA 1XOBA 5CRDA 3RBTA 1QGVA 3LGCA 1HNAA 3RPNA 4TR1A 4EXJA 4MNNA 2V41A 4OFTA 1JHBA 2DKIA 1V57A 10GSA 2FUG2 2IWTA 2DKHA 2FWGA 2DBCA 1SJZA 3HA9A 3IPZA 3ZVJA 2C1YA 2FGXA 3ZREA 9GSSA 5FT3A 4K7IA 3KH9A 3HD5A 3KCMA 1YZXA 2K8SA 4EDZA 1ZGNA 4IW9A 4ECCA 2VCTA 2REMA 2V32A 3FKFA 1GSEA 4IHUA 3ERFA 1JFUA 4O92A 1XOAA 4KDUA 3TKRA 1R5PA 3GSTA 3Q6OA 2IJYA 2QC7A 4V2LA 2GQMA 3CYNA 1PN9A 1XFLA 3GA4A 2IMEA 3CSHA 4ZBAA 4E8HA 3D5JA 3GKNA 2HT9A 1ILOA 2Z9SA 5ECSA 4POLA 3I69A 4D73B 3PR8A 1T8EB 1VF3A 2H6ZA 5ECLB 1EZKA 5B6MA 4TW5A 4IP1A 5DQSA 1GUHA 2JSZA 1Z6MA 3QCPA 1XW6A 1U87A 3F6FA 3SBCA 3FR9A 3TRPA 3E9JB 3KTBA 4O5UA 5A4UA 2MMOA 2UZ8A 4MDCA 1SU9A 4CHSA 2E0QA 4YAVA 1J0FA 1X5CA 1PGTA 2R37A 5AIXA 4CY6A 1WWJA 4YKGA 5H5RA 3FMWA 1AAZA 2AV4A 4ZB8A 4HJMA 4X1UA 3C73A 4KW6A 4BVYB 4CDOA 4ACSA 2H73A 4HZ4A 2FD3A 3GH9A 3CSJA 4DSSB 5B8AA 1XG8A 2H19A 1EEMA 2BMXA 5EVOA 5IO2A 3S9FA 2YPMA 1GRXA 2YWMA 2GT5A 3F4TA 4KB3A 5D9WA 3GHAA 3EURA 3FYGA 1GSUA 1SJ6A 3EMPA 2QKEA 3UAPA 2RIIA 4JE1A 1YJ6A 4EO3A 1GWCA 4HOJA 3DVXA 5G31A 4GSSA 1SL0B 2WS2A 1UVZA 4IGJA 2VIMA 1SD9A 4GRFA 1U6TA 2LRNA 4PUAA 4GLTA 2ZUPA 2H72A 3EMXA 1ZZYA 5IPGA 1MDJA 4WXTA 3F63A 2ALBA
chains in the Genus database with same CATH topology
4FYBA 1SKWB 6GSVA 2H1BA 22GSA 2H1GA 1Z6NA 3EE2A 5IMVA 3EPTA 3ERGA 2XBQA 2DJKA 1SD8A 2YN1A 3GYKA 1OC9B 3A3TA 3ZRDA 1HYUA 3ZIVA 3M9JA 4LMVA 2VAFA 3GRXA 5IPHA 5COHA 1R7HA 1TKDB 5ENUA 5E59A 3ME8A 1QMVA 1PKWA 2H0HA 1XIYA 3TGZA 4ZB6A 3LXTA 2YZHA 5A4VA 1ABAA 1SKRB 1TDIA 3M9KA 3GTUA 2LQQA 4HJ2A 1AIUA 4DEJA 1GUMA 1K3OA 4KDXA 2B3SA 3M1GA 2JZTA 3TUEA 3IOSA 4MZWA 4G9HA 4NHZA 5ECIB 1T4YA 4BWQA 3UBLA 1DUGA 3KGKA 3LEFA 3LFLA 4FH8A 2PUKC 3TKQA 3FY7A 2VCQA 4K9ZA 2VD0A 5JCUA 3F6DA 4KAEA 2E7PA 2KP1A 4FO5A 1HNCA 2MYGA 1XWAA 4RI6A 2HRKA 4L5LA 2FWEA 1OC3A 3UOMA 1FHEA 2ON5A 3TDGA 3H93A 2VM1A 5CAXA 2G0FA 4IBPA 1NW2A 2YOIA 2HFDA 2GZPA 2AUVA 4MJCA 4Z2RA 1F37A 2OE0A 5DCGA 3GMFA 5CP1A 1U88A 3GN3A 2GSTA 1PN0A 1RW1A 4PQ1A 3FW2A 3I43A 1G0TA 3UL3A 2L5OA 3QDNA 5G2ZA 2LEGA 3M8NA 3IAS2 2VL9A 2H74A 3HKRA 3BOAA 3C1SA 3EINA 3KIJA 3KM6A 5DQYA 5DVBA 2IMFA 4MJBA 3BJ5A 2YV7A 2R3XA 4JZQA 4OD7A 1TW9A 5C00A 5B8BA 1EV4A 4K5RA 1GSSA 1ON4A 4BVXB 2EIQA 2G2QA 2VL2A 2VLUA 1BG5A 8GSSA 5KOWA 2JZRA 2PMTA 1SK2A 1O7UA 2DMMA 2O87A 1EEJA 3IHQA 3GV1A 1XVQA 1WE0A 2FLSA 2C80A 2WULA 3IK9A 1F3AA 2B5XA 1TTZA 1SYXA 1K3LA 2AYTA 1HD2A 4WBRD 1G7OA 3TKSE 2KP2A 2HRAA 3LYKA 3IV4A 1IYIA 2DJ2A 3TJBA 5C04A 4ZBBA 4AJ7A 2DLXA 2LSTA 1AW9A 5HFKA 4I2UA 1S3AA 2FWHA 1BYEA 3V1WA 3D6IA 3H4KA 3TJFA 3WT1A 4IQAA 1B48A 4GXZA 3IC8A 1TU7A 4G2EA 4AJ6A 3WYWA 4V2MA 3RAZA 3DRNA 1OYJA 2OBKA 1URMA 3FZAA 12GSA 2A4VA 3D21A 5D9XA 3KMNA 1B8XA 2HE3A 4ZL7A 2VM2A 1HNBA 4RUVA 3OR5A 3DMLA 3HVVA 5DCHA 4PNGA 4L5OA 4I6XA 2NBSA 3H79A 3VFIA 4F2IA 1Y25A 5AISA 3MIXA 3VPQA 4N11A 4LL4B 1ML6A 4EIPA 1A2MA 5EPFA 3CRTA 2LUSA 3PPUA 2F9SA 2F3MA 4TXVA 4BPYA 3VWUA 2O85A 3LJRA 4MABA 3ZYWA 4LLRA 4HU7A 1JLWA 3DD3A 1AC1A 2V6OA 4KDYA 3EYTA 3ZTLA 1J08A 5ECNB 2IPAA 1AQWA 4Q5RA 2X64A 1A8YA 2YV9A 4KUNA 4KGIA 1WIKA 4ECJA 1ZL9A 3K8NA 2HZEA 1YF1A 2EIRA 2H0IA 4V1Ag 2DJ1A 5ECMB 3KZQA 4HI7A 3EU4A 3VWVA 2M72A 5JWQB 4ZIJA 3F9UA 2H75A 2FCHA 4BA7A 1PL2A 3CXGA 1THOA 5DBQA 4JEDA 2WRTA 5D9TA 1X9SB 1WOUA 1ERUA 5B6NA 4N30A 2I81A 5H5SA 4ULXA 4K5SA 1XVWA 4GF0A 3TKPA 1XWBA 1LU4A 1O6JA 2GZYA 1FVJA 1K0DA 2ON7A 1TRWA 2AHEA 2PVQA 4PUFC 1SJIA 2DJ3A 1UA5A 4HEA2 4MJAA 2FY6A 4PTSA 3Q19A 3HJPA 4G0KA 2N5FA 3RPPA 1EV9A 1FB0A 4QQ7A 5J9CA 19GSA 4XCSA 3QMXA 1T7PB 1B9YC 1GTIA 2CT6A 1Q98A 3HCZA 4EIQA 1FO5A 2DIZA 4MF6A 1ACVA 3CMIA 4XS4B 4F9ZA 2HXKA 4BWSA 3GNJA 4ML1A 1PX7A 2R0CA 1UN2A 3C7MA 5G1KA 5KOXA 2M46A 1GNWA 4AF2A 2B5YA 2FA8A 1ERTA 4MPGA 1ZYQB 2A2SA 1XCCA 3IA1A 1QUWA 4WR4A 2DJ0A 3A2XA 4IJIA 1RK4A 3L0HA 2IMIA 4RQRA 3GKXA 1I9DA 4X43A 3QFBC 2CQ9A 2H0GA 1PL1A 1OC8A 3CTFA 3CRUA 3HY2A 4IELA 5BRTA 3O76A 1TK0B 4KX4A 4GWRA 3RHBA 5FWGA 5FHIA 3F3RA 2NVLA 1WMJA 2CVKA 4JR6A 3QOUA 1DE1A 4KCAA 2JACA 2GDRA 2R5GA 2H30A 5ECRB 4H86A 2GGTA 5ELAA 4MCUA 1W4VA 4KH7A 4LMWA 1A2LA 2NTOA 4ZL9A 2QA2A 2ZCTA 4V2NA 2CAQA 3WT2A 2VO4A 3EU3A 1PQNA 1YF0A 3VPTA 3IBHA 4OO4A 1ZMAA 5ID2A 2EIOA 3LG6A 1XBSA 2DMLA 2M80A 4FYUA 2DC5A 3WD6A 4RQXA 1A8LA 1EGOA 1OE8A 4L0UA 4J2FA 4F0CA 11GSA 3VLNA 2XHFA 3WGDA 3G7JA 2BJXA 3VWXA 4ECBA 2B7JA 3FR3A 3KH7A 1M99A 2R4VA 6GSYA 4JU5A 3VI7A 1PMTA 1G7EA 4YQUA 4PQHA 3IE3A 3TB2A 2F8FA 2P5RA 2H1AA 2WB9A 5HFGA 2OJLA 2C0FA 3LQ7A 3G7IA 1Y6EA 4PGTA 3Q74A 2X8HA 4IP6A 2PPTA 2HRFA 1USBA 2PVOC 5DALA 2OBIA 4EF0A 1TI3A 3APOA 4EC0A 4I5QA 1MEKA 5IMZA 2WFCA 4TR4A 5F07A 5CRHA 2H6XA 1XXUA 2V2GA 2H66A 3PH9A 3KD0A 1FOHA 1GNEA 4BL7B 3RHCA 1M7TA 2V1MA 3MWHA 3ZFLA 5H5QA 3QD9A 3KXOA 3IDVA 3P2AA 1AXDA 2LRCA 5G5FA 2GQLA 4O5RA 3HDCA 3HZ4A 6GSUA 1F2EA 1GTAA 1MD4A 4KCEA 1NHYA 4D73A 2A4HA 3GURA 2WCIA 1GH2A 2IN3A 5IOWA 1V40A 3U6VA 1T00A 4Q5NA 2PGTA 5ECQB 4TR3A 4CY8A 2CA8A 5GZZB 3PGTA 2RUFA 3F3QA 2H70A 1E6BA 4XIHA 2VL3A 2C4JA 1TRUA 3D0ZA 3H8QA 5G1LA 1K0NA 2KUCA 3P8WA 4OCEA 4FYCA 5D9VA 1SENA 13GSA 3KJYA 3HVXA 2R2JA 1V98A 1K0AA 4NV5A 2GVPA 3M0FA 5CRWA 2GZZA 4K2XA 1BJXA 1U3AA 2H01A 2NPBA 3FRCA 2IFQA 2HNLA 1XWKA 2L6DA 2VL2C 3UBKA 4KNDA 1B4QA 3TJGA 4MF5A 5DAKB 1X9MB 3EVIA 2DIYA 3F4SA 5DDLA 2WJUA 2VCZA 1O81A 1RQMA 4PURA 4WF5A 5F0GA 2YWNA 2DJJA 3QPMA 2YJHA 1FW1A 1X0RA 1EOHA 4PQIA 6GSTA 2CVBA 1KNGA 1PSQA 1Q4JA 5HR1A 2H8LA 3RDWA 1EP7A 2E2GA 4K6XA 1EWXA 4WR5A 4POMA 5KN2A 2YCDA 4KE3A 1R5AA 2HRNA 1EGRA 3VURA 3LXZA 1MTCA 2R6KA 4TRXA 1YQ1A 4KA0A 4ISDA 3FK8A 3IRAA 1OVNA 1FVKA 3DYRA 1Z7RA 1OC9A 2R0PA 2JSYA 4V1Ap 3SWLA 3L78A 3D22A 1TP9A 1VRSD 3ZIJA 2OE3A 4K0GA 3J7Yb 2GSSA 18GSA 2CV4A 4MJEA 1AQXA 3U5RE 1B4PA 1GTBA 1A0FA 3GKMA 3N9JA 3F0IA 2YZUA 5JWRB 4TXOB 3LSZA 5J41A 2TIRA 2VUPA 1DE2A 5IM9A 3TKSA 4JR4A 2P5QA 2K6VA 2GLRA 2FNOA 3FHKA 4MF7A 3FZ4A 3KMOA 3C8EA 4PX1A 2NDOA 2X99A 4OMVA 1DSBA 1CQHA 4ML6A 3G9BA 3DIEA 4TR1B 5INYA 2AJQB 4NPBA 4I2TA 4N0VA 1A0RP 5J9BA 4HDEA 1ZYNA 1SL2B 1TRVA 2WGRA 6GSSA 4DVCA 4EDYA 4K7OA 1TI1A 4WF4A 2PU9C 2I9HA 3UMAA 5LNKe 1BAYA 1JZRA 2O7KA 2K9FA 4K0NA 1E2YA 2QGVA 4WEYA 4X0XA 3O6TA 1GLQA 4NMUA 3O3TA 3GFKA 4HQSA 3L4NA 3DEXA 3ERWA 1H4OA 4ZL8A 1TOFA 20GSA 1TJDA 1SK1A 2DSAA 2H6YA 4POKA 2BTOT 3US3A 4MH3A 3ME7A 2OE1A 5IIZA 3UEMA 2I1UA 5KN0A 4N0ZA 4XS6A 2L59A 3BCIA 1ERVA 1SK0A 1ZYPA 4MZCA 5CREA 3TRXA 1TRSA 4ZBDA 4YQMA 1YEPA 3GKKA 5EY6A 5G30A 3I6AA 3GSSA 2JADA 3C1RA 1F6MC 4J57E 1A24A 5E4WA 4KSMA 3IC4A 4G0LA 2AAWA 3M3MA 1Z9HA 4ZB9A 3HZ8A 1QXHA 3KP9A 3A2WA 4OCFA 2ES7A 2R0GA 4NWYA 5AN1A 3UVTA 2C0DA 2OA7A 1MDIA 5F8BA 3KEBA 1X5EA 4YH2A 2H76A 3WGXA 4CW9A 3IR4A 3ZITA 1B9XC 1EOGA 3W8JA 2CAIA 1S3CA 2VCXA 2JZSA 3HXSA 5GSSA 2GSRA 3FZ9A 4HZ2A 3GH6A 2KLXA 3MYDA 5CYYA 4EL1A 5HR2A 5J3RA 1BX9A 2HYXA 3QFAC 3NZNA 5D73A 1GSFA 2CVDA 4USSA 4QL7A 5ECOB 4JBBA 2RM5A 4K1FA 2YANA 5LD0A 3QR6A 4MA9A 1OE7A 1SYRA 2IL3A 4ECIA 5J5NA 2YJ7A 4XTSA 4MP4A 4K8MA 3E0UA 3GL3A 5LCZA 1SKSB 3CBUA 1H75A 4HU9A 2LNTA 3MAKA 3LYPA 5G5EA 2LRTA 5GSTA 3A5IA 4K2DA 3ZFBA 1PD21 1VF4A 2N5AA 4HQZA 2P0GA 5DALB 3W8SA 2JU5A 4G19A 1K0MA 5JCGA 4HUAA 1BEDA 4IVFA 5GAPD 2HI7A 2AB6A 4MPFA 2F51A 4YKFA 4E8EA 3FEUA 1PX6A 2X49A 1F3BA 2CZ2A 3HVSA 3R2QA 4OFNA 3P90A 1GSYA 1QFNA 4G0IA 16GSA 4O5QA 2B1KA 5HR3A 2C3QA 4NAXA 1T3BA 3ZMLA 3R3EA 5IO0A 5KN3A 2H1DA 2WDUA 1GL8A 4GQCA 4XRAA 1AUCA 2IMKA 4EUYA 1K0BA 3MSZA 2XPEA 2CX3A 4EE0A 3GTUB 5L71A 1PA3A 1IYHA 1V9WA 1N8JA 17GSA 3BCKA 5B7CA 2OKAA 4Z2TA 1JLVA 1VF2A 4G10A 3IHGA 3JCML 3TOUA 4IKHA 3N5OA 2A2PA 3BBYA 3NIVA 4F82A 2RUEA 4OWYA 3PINA 1THXA 2XBIA 1KTEA 1JZOA 3APQA 2LNSA 4GCIA 1XWGA 3GIXA 1I5GA 2X8CA 2YP6A 2OADA 3IK7A 4GSTA 1W89A 5ECKB 2F8AA 2IFQB 4WETA 4ILFA 1WRYA 1XWCA 4PXOA 1V58A 4TN8A 5DJLA 4Z2UA 5ABRA 1M9BA 3D4MA 1FOVA 1OKDA 2P31A 2A2RA 3DWVA 1GLPA 4TVEA 3TCOA 4L8EA 4K7NA 2I3YA 5D93A 3VWWA 2KOKA 6GSWA 3IAM2 2XPDA 1G6WA 1O85A 2L4QA 4XS4A 3FZ5A 3VI5A 1NHOA 3A2VA 1AQVA 2B7KA 1T4ZA 2VD1A 4RI7A 3TRQA 3CTGA 2C3NA 1HQOA 2L4CA 4ID0A 2YWIA 1MD3A 1ST9A 5IOXA 3MDKA 4TKYA 1C72A 3LWAA 3Q18A 4XHMA 3D4TA 3QAVA 2PWJA 1G6YA 3LW9A 5IMAA 4ZILA 4NV2A 3ZL5A 5A4WA 2MBTA 4EVMA 3ZLPA 1TU8A 2PBJA 2GT6A 5CRGA 1U3IA 2GSQA 3F4RA 3NOFA 3EC3A 2L57A 5CNWA 2HSMA 2I4AA 5AGYA 1SL1B 3DVWA 1YKAA 5KEJA 1BQ7A 1R4WA 3C71A 2H71A 2JL4A 2LV3A 4QL9A 2GQKA 5GAND 3GL5A 1PKZA 4A5PA 4DSQA 1R26A 2LS5A 2B6MA 1YY7A 3CSIA 3HHVA 1GSDA 3QAGA 4XRDA 1WP0A 2EC4A 2CX4A 3L9VA 1N2AA 4YQVA 4GQFA 3MNGA 4BVYA 2FHEA 2J23A 1XW9A 1Z3EA 1FG4A 3E3EA 5ECHB 4EKZA 3DXBA 4DSSA 2MZCA 3ZMKA 2QSIA 2YWOA 1KEBA 2KHPA 2X8GA 4MZBA 2MMNA 2YNXA 1ERWA 2C8UA 2FA4A 5F06A 1YDKA 1J9BA 4WKWA 2MMAA 1F9MA 2ZNMA 1GSQA 1M2DA 2WZ9A 1A2JA 3DKSA 1XZOA 2O89A 1EP8A 1ZYEA 4ZXGA 2TRCP 4I97A 3HJMA 2HSHA 1M2BA 3KP8A 2B1LA 1ZOFA 2K18A 4JRRA 1QK8A 5IQYA 1JZWA 1GULA 3G7YA 4KF9A 4O32A 1M0UA 1LJRA 2HZFA 1YEXA 1M9AA 3I9V2 3ED3A 5BMUA 5JCWA 3TKSC 1WPIA 2K8VA 4O7HA 4TR0A 2OACA 4AGSA 5ECPB 5A5KA 3UARA 3IXRA 1NM3A 4NXIA 1CQGA 4BL7A 4I8BA 4J56E 2L6CA 2V6KA 3GUSA 2HZEB 2IIYA 2RM6A 1QQ2A 1LBKA 2D2ZA 4OFMA 4IQ1A 2O8VB 3TJKA 4POBA 1XW5A 3L9SA 2PN8A 3HJOA 1WJKA 4IJ3A 2E2MA 3QAWA 1OKTA 5IMDA 3UIWA 6GSXA 2TRXA 3EWLA 3ZVJD 14GSA 2HSYA 4FIWA 1M2AA 4YAPA 3W6GA 2LJRA 5ELGA 4GTUA 4MK3A 4P3YB 1KBNA 5HQPA 4XS1A 4MH2A 5AIVA 5J4UA 2GTUA 2HLSA 3HYPA 1NSWA 2XC2A 2L5LA 3L9UA 1PRXA 2J9HA 5D96A 1O73A 1MDKA 4F03A 1GTUA 3LORA 2QA1A 3KTLA 1ZCPA 2B5EA 1FB6A 3UJ1A 4L0WA 3GX0A 4FQUA 2CZ3A 4N10A 1VGLA 1TK8B 3UVHA 1XPVA 3AY8A 2GS3A 5DAKA 1Z5YE 4F0BA 5HFIA 1T1VA 2LQOA 2LKUA 1X5DA 1OAZA 3P7XA 3GX8A 3WGEA 4LA1A 4TOPA 2LJAA 2LJKA 1DBYA 1K0OA 3BD2A 4OO5A 1A23A 3APSA 4MLYA 2LTKA 1V2AA 4X4JA 1UC7A 4BVXA 2N5BA 1GP1A 1TK5B 1FAAA 2IMDA 2PERA 3TOTA 5EL8A 4Q5QA 3TJJA 5CO3A 4LL1B 4HS1A 1VF1A 4Z7XA 1O8WA 5F05A 1TXXA 4KSOA 2VCWA 1K0CA 5DJMA 4IN0A 1S3DA 4NHWA 7GSSA 4AJ8A 2MBSA 5IMFA 2VCVA 4WBJA 3H1NA 4IS0A 1YKCA 3F8UA 1O8XA 2RLIA 4MMMA 3ZZXA 2MMZA 1GUKA 2X4AA 5D8IA 4ICYA 5IMCA 4TXOA 1Z7PA 1K3YA 3DGQA 4DSRA 2VOCA 3J7Yk 2VLTA 5HR0A 2C0EA 2FWFA 3ISOA 5JWOB 1X9WB 5ID2B 5KN1A 4PNFA 3FR6A 3A5WA 2C0GA 1JZDA 2VLVA 4GSNA 2C3TA 3VK9A 4Q5FA 1XOBA 5CRDA 3RBTA 1QGVA 3LGCA 1HNAA 3RPNA 4TR1A 4EXJA 4MNNA 2V41A 4OFTA 1JHBA 2DKIA 1V57A 10GSA 2FUG2 2IWTA 2DKHA 2FWGA 2DBCA 1SJZA 3HA9A 3IPZA 3ZVJA 2C1YA 2FGXA 3ZREA 9GSSA 5FT3A 4K7IA 3KH9A 3HD5A 3KCMA 1YZXA 2K8SA 4EDZA 1ZGNA 4IW9A 4ECCA 2VCTA 2REMA 2V32A 3FKFA 1GSEA 4IHUA 3ERFA 1JFUA 4O92A 1XOAA 4KDUA 3TKRA 1R5PA 3GSTA 3Q6OA 2IJYA 2QC7A 4V2LA 2GQMA 3CYNA 1PN9A 1XFLA 3GA4A 2IMEA 3CSHA 4ZBAA 4E8HA 3D5JA 3GKNA 2HT9A 1ILOA 2Z9SA 5ECSA 4POLA 3I69A 4D73B 3PR8A 1T8EB 1VF3A 2H6ZA 5ECLB 1EZKA 5B6MA 4TW5A 4IP1A 5DQSA 1GUHA 2JSZA 1Z6MA 3QCPA 1XW6A 1U87A 3F6FA 3SBCA 3FR9A 3TRPA 3E9JB 3KTBA 4O5UA 5A4UA 2MMOA 2UZ8A 4MDCA 1SU9A 4CHSA 2E0QA 4YAVA 1J0FA 1X5CA 1PGTA 2R37A 5AIXA 4CY6A 1WWJA 4YKGA 5H5RA 3FMWA 1AAZA 2AV4A 4ZB8A 4HJMA 4X1UA 3C73A 4KW6A 4BVYB 4CDOA 4ACSA 2H73A 4HZ4A 2FD3A 3GH9A 3CSJA 4DSSB 5B8AA 2H19A 1EEMA 2BMXA 5EVOA 5IO2A 3S9FA 2YPMA 1GRXA 2YWMA 2GT5A 3F4TA 4KB3A 5D9WA 3GHAA 3EURA 3FYGA 1GSUA 1SJ6A 3EMPA 2QKEA 3UAPA 2RIIA 4JE1A 1YJ6A 4EO3A 1GWCA 4HOJA 3DVXA 5G31A 4GSSA 1SL0B 2WS2A 1UVZA 4IGJA 2VIMA 1SD9A 4GRFA 1U6TA 2LRNA 4PUAA 4GLTA 2ZUPA 2H72A 3EMXA 1ZZYA 5IPGA 1MDJA 4WXTA 3F63A 2ALBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FYB A;  1SKW B;  6GSV A;  2H1B A;  22GS A;  2H1G A;  1Z6N A;  3EE2 A;  5IMV A;  3ERG A;  2XBQ A;  2DJK A;  1SD8 A;  2YN1 A;  3GYK A;  1OC9 B;  3A3T A;  3ZRD A;  1HYU A;  3ZIV A;  3M9J A;  4LMV A;  2VAF A;  3GRX A;  5IPH A;  5COH A;  1R7H A;  1TKD B;  5ENU A;  5E59 A;  3ME8 A;  1QMV A;  1PKW A;  2H0H A;  1XIY A;  3TGZ A;  4ZB6 A;  3LXT A;  2YZH A;  5A4V A;  1ABA A;  1SKR B;  1TDI A;  3M9K A;  3GTU A;  2LQQ A;  4HJ2 A;  1AIU A;  4DEJ A;  1GUM A;  1K3O A;  4KDX A;  2B3S A;  3M1G A;  2JZT A;  3TUE A;  3IOS A;  4MZW A;  4G9H A;  4NHZ A;  5ECI B;  1T4Y A;  4BWQ A;  3UBL A;  1DUG A;  3KGK A;  3LEF A;  3LFL A;  4FH8 A;  2PUK C;  3TKQ A;  3FY7 A;  2VCQ A;  4K9Z A;  2VD0 A;  5JCU A;  3F6D A;  4KAE A;  2E7P A;  2KP1 A;  4FO5 A;  1HNC A;  2MYG A;  1XWA A;  4RI6 A;  4L5L A;  2FWE A;  1OC3 A;  3UOM A;  1FHE A;  2ON5 A;  3TDG A;  3H93 A;  2VM1 A;  5CAX A;  2G0F A;  4IBP A;  1NW2 A;  2YOI A;  2HFD A;  2GZP A;  2AUV A;  4MJC A;  1F37 A;  2OE0 A;  5DCG A;  3GMF A;  5CP1 A;  1U88 A;  3GN3 A;  2GST A;  1RW1 A;  4PQ1 A;  3FW2 A;  3I43 A;  1G0T A;  3UL3 A;  2L5O A;  3QDN A;  5G2Z A;  2LEG A;  3M8N A;  3IAS 2;  2VL9 A;  2H74 A;  3HKR A;  3BOA A;  3C1S A;  3EIN A;  3KIJ A;  3KM6 A;  5DQY A;  5DVB A;  2IMF A;  4MJB A;  3BJ5 A;  2YV7 A;  2R3X A;  4JZQ A;  4OD7 A;  1TW9 A;  5C00 A;  5B8B A;  1EV4 A;  1GSS A;  1ON4 A;  2EIQ A;  2G2Q A;  2VL2 A;  2VLU A;  1BG5 A;  8GSS A;  2JZR A;  2PMT A;  1SK2 A;  1O7U A;  2DMM A;  2O87 A;  1EEJ A;  3IHQ A;  3GV1 A;  1XVQ A;  1WE0 A;  2FLS A;  2C80 A;  2WUL A;  3IK9 A;  1F3A A;  2B5X A;  1TTZ A;  1SYX A;  1K3L A;  2AYT A;  1HD2 A;  4WBR D;  1G7O A;  3TKS E;  2KP2 A;  3LYK A;  3IV4 A;  1IYI A;  2DJ2 A;  3TJB A;  5C04 A;  4ZBB A;  4AJ7 A;  2DLX A;  2LST A;  1AW9 A;  5HFK A;  4I2U A;  1S3A A;  2FWH A;  1BYE A;  3V1W A;  3D6I A;  3H4K A;  3TJF A;  3WT1 A;  4IQA A;  1B48 A;  4GXZ A;  4AJ6 A;  1TU7 A;  4G2E A;  3WYW A;  4V2M A;  3RAZ A;  3DRN A;  1OYJ A;  2OBK A;  1URM A;  3FZA A;  12GS A;  2A4V A;  3D21 A;  5D9X A;  3KMN A;  1B8X A;  2HE3 A;  4ZL7 A;  2VM2 A;  1HNB A;  4RUV A;  3OR5 A;  3DML A;  3HVV A;  5DCH A;  4PNG A;  4L5O A;  4I6X A;  2NBS A;  3H79 A;  3VFI A;  4F2I A;  1Y25 A;  5AIS A;  3VPQ A;  4N11 A;  4LL4 B;  1ML6 A;  1A2M A;  5EPF A;  3CRT A;  2LUS A;  2F9S A;  2F3M A;  4TXV A;  4BPY A;  3VWU A;  2O85 A;  3LJR A;  4MAB A;  3ZYW A;  4LLR A;  4HU7 A;  1JLW A;  3DD3 A;  1AC1 A;  2V6O A;  4KDY A;  3EYT A;  3ZTL A;  1J08 A;  5ECN B;  2IPA A;  1AQW A;  4Q5R A;  2X64 A;  1A8Y A;  2YV9 A;  4KUN A;  4KGI A;  1WIK A;  4ECJ A;  1ZL9 A;  3K8N A;  2HZE A;  1YF1 A;  2EIR A;  2H0I A;  4V1A g;  2DJ1 A;  5ECM B;  3KZQ A;  4HI7 A;  3EU4 A;  3VWV A;  2M72 A;  5JWQ B;  4ZIJ A;  3F9U A;  2H75 A;  2FCH A;  4BA7 A;  1PL2 A;  3CXG A;  1THO A;  5DBQ A;  4JED A;  2WRT A;  5D9T A;  1X9S B;  1WOU A;  1ERU A;  5B6N A;  4N30 A;  2I81 A;  5H5S A;  4ULX A;  1XVW A;  4GF0 A;  3TKP A;  1XWB A;  1LU4 A;  1O6J A;  2GZY A;  1FVJ A;  1K0D A;  2ON7 A;  1TRW A;  2AHE A;  2PVQ A;  4PUF C;  1SJI A;  2DJ3 A;  1UA5 A;  4HEA 2;  4MJA A;  2FY6 A;  3Q19 A;  3HJP A;  2N5F A;  3RPP A;  1EV9 A;  1FB0 A;  4QQ7 A;  5J9C A;  19GS A;  4XCS A;  3QMX A;  1T7P B;  1B9Y C;  1GTI A;  2CT6 A;  1Q98 A;  3HCZ A;  1FO5 A;  2DIZ A;  4MF6 A;  1ACV A;  3CMI A;  4XS4 B;  4F9Z A;  2HXK A;  4BWS A;  3GNJ A;  4ML1 A;  1PX7 A;  1UN2 A;  3C7M A;  5G1K A;  2M46 A;  1GNW A;  4AF2 A;  2B5Y A;  2FA8 A;  1ERT A;  4MPG A;  1ZYQ B;  2A2S A;  1XCC A;  3IA1 A;  1QUW A;  4WR4 A;  2DJ0 A;  3A2X A;  4IJI A;  1RK4 A;  3L0H A;  2IMI A;  4RQR A;  3GKX A;  1I9D A;  4X43 A;  3QFB C;  2CQ9 A;  2H0G A;  1PL1 A;  1OC8 A;  3CTF A;  3CRU A;  3HY2 A;  4IEL A;  3O76 A;  1TK0 B;  4KX4 A;  4GWR A;  3RHB A;  5FWG A;  5FHI A;  3F3R A;  2NVL A;  1WMJ A;  2CVK A;  4JR6 A;  3QOU A;  1DE1 A;  4KCA A;  2JAC A;  2GDR A;  2R5G A;  2H30 A;  5ECR B;  4H86 A;  2GGT A;  5ELA A;  4MCU A;  1W4V A;  4KH7 A;  4LMW A;  1A2L A;  2NTO A;  4ZL9 A;  2ZCT A;  4V2N A;  2CAQ A;  3WT2 A;  2VO4 A;  3EU3 A;  1PQN A;  1YF0 A;  3VPT A;  3IBH A;  4OO4 A;  1ZMA A;  5ID2 A;  2EIO A;  3LG6 A;  1XBS A;  2DML A;  2M80 A;  4FYU A;  2DC5 A;  3WD6 A;  4RQX A;  1A8L A;  1EGO A;  1OE8 A;  4L0U A;  4J2F A;  4F0C A;  11GS A;  3VLN A;  2XHF A;  3WGD A;  3G7J A;  2BJX A;  3VWX A;  4ECB A;  2B7J A;  3FR3 A;  3KH7 A;  1M99 A;  2R4V A;  6GSY A;  4JU5 A;  3VI7 A;  1PMT A;  1G7E A;  4YQU A;  4PQH A;  3IE3 A;  3TB2 A;  2F8F A;  2P5R A;  2H1A A;  2WB9 A;  5HFG A;  2OJL A;  2C0F A;  3LQ7 A;  3G7I A;  1Y6E A;  4PGT A;  3Q74 A;  2X8H A;  4IP6 A;  2PPT A;  2HRF A;  1USB A;  2PVO C;  5DAL A;  2OBI A;  4EF0 A;  1TI3 A;  3APO A;  4EC0 A;  4I5Q A;  1MEK A;  5IMZ A;  2WFC A;  4TR4 A;  5F07 A;  5CRH A;  2H6X A;  1XXU A;  2V2G A;  2H66 A;  3PH9 A;  3KD0 A;  1GNE A;  3RHC A;  1M7T A;  2V1M A;  3MWH A;  3ZFL A;  5H5Q A;  3QD9 A;  3KXO A;  3IDV A;  3P2A A;  1AXD A;  2LRC A;  5G5F A;  2GQL A;  4O5R A;  3HDC A;  3HZ4 A;  6GSU A;  1F2E A;  1GTA A;  1MD4 A;  4KCE A;  1NHY A;  4D73 A;  3GUR A;  2WCI A;  1GH2 A;  2IN3 A;  5IOW A;  1V40 A;  3U6V A;  1T00 A;  4Q5N A;  2PGT A;  5ECQ B;  4TR3 A;  2CA8 A;  5GZZ B;  3PGT A;  2RUF A;  3F3Q A;  2H70 A;  1E6B A;  4XIH A;  2VL3 A;  2C4J A;  1TRU A;  3D0Z A;  3H8Q A;  5G1L A;  1K0N A;  2KUC A;  3P8W A;  4OCE A;  4FYC A;  5D9V A;  1SEN A;  13GS A;  3KJY A;  3HVX A;  2R2J A;  1V98 A;  1K0A A;  4NV5 A;  2GVP A;  3M0F A;  5CRW A;  2GZZ A;  1BJX A;  1U3A A;  2H01 A;  2NPB A;  3FRC A;  2IFQ A;  2HNL A;  1XWK A;  2L6D A;  2VL2 C;  3UBK A;  4KND A;  1B4Q A;  3TJG A;  4MF5 A;  5DAK B;  1X9M B;  3EVI A;  2DIY A;  3F4S A;  5DDL A;  2WJU A;  2VCZ A;  1O81 A;  1RQM A;  4PUR A;  4WF5 A;  5F0G A;  2YWN A;  2DJJ A;  3QPM A;  2YJH A;  1FW1 A;  1X0R A;  1EOH A;  4PQI A;  6GST A;  2CVB A;  1KNG A;  1PSQ A;  1Q4J A;  5HR1 A;  2H8L A;  3RDW A;  1EP7 A;  2E2G A;  4K6X A;  1EWX A;  4WR5 A;  4POM A;  5KN2 A;  2YCD A;  4KE3 A;  1R5A A;  2HRN A;  1EGR A;  3VUR A;  3LXZ A;  1MTC A;  2R6K A;  4TRX A;  1YQ1 A;  4KA0 A;  4ISD A;  3FK8 A;  3IRA A;  1OVN A;  1FVK A;  3DYR A;  1Z7R A;  1OC9 A;  2JSY A;  4V1A p;  3SWL A;  3L78 A;  3D22 A;  1TP9 A;  1VRS D;  3ZIJ A;  2OE3 A;  4K0G A;  3J7Y b;  2GSS A;  18GS A;  2CV4 A;  4MJE A;  1AQX A;  3U5R E;  1B4P A;  1GTB A;  1A0F A;  3GKM A;  3N9J A;  3F0I A;  2YZU A;  5JWR B;  4TXO B;  3LSZ A;  5J41 A;  2TIR A;  2VUP A;  1DE2 A;  5IM9 A;  3TKS A;  4JR4 A;  2P5Q A;  2K6V A;  2GLR A;  2FNO A;  3FHK A;  4MF7 A;  3FZ4 A;  3KMO A;  3C8E A;  4PX1 A;  2NDO A;  2X99 A;  4OMV A;  1DSB A;  1CQH A;  4ML6 A;  3G9B A;  3DIE A;  4TR1 B;  5INY A;  2AJQ B;  4NPB A;  4I2T A;  4N0V A;  1A0R P;  5J9B A;  4HDE A;  1SL2 B;  1TRV A;  2WGR A;  6GSS A;  4DVC A;  4EDY A;  4K7O A;  1TI1 A;  4WF4 A;  2PU9 C;  2I9H A;  3UMA A;  5LNK e;  1BAY A;  1JZR A;  2O7K A;  2K9F A;  4K0N A;  1E2Y A;  2QGV A;  4WEY A;  4X0X A;  3O6T A;  1GLQ A;  4NMU A;  3O3T A;  3GFK A;  4HQS A;  3L4N A;  3DEX A;  3ERW A;  1H4O A;  4ZL8 A;  1TOF A;  20GS A;  1TJD A;  1SK1 A;  2DSA A;  2H6Y A;  4POK A;  2BTO T;  3US3 A;  4MH3 A;  3ME7 A;  2OE1 A;  5IIZ A;  3UEM A;  2I1U A;  5KN0 A;  4N0Z A;  4XS6 A;  2L59 A;  3BCI A;  1ERV A;  1SK0 A;  4MZC A;  5CRE A;  3TRX A;  1TRS A;  4ZBD A;  4YQM A;  1YEP A;  3GKK A;  5EY6 A;  5G30 A;  3I6A A;  3GSS A;  2JAD A;  3C1R A;  1F6M C;  4J57 E;  1A24 A;  5E4W A;  4KSM A;  3IC4 A;  2AAW A;  3M3M A;  1Z9H A;  4ZB9 A;  3HZ8 A;  1QXH A;  3KP9 A;  3A2W A;  4OCF A;  2ES7 A;  4NWY A;  5AN1 A;  3UVT A;  2C0D A;  2OA7 A;  1MDI A;  5F8B A;  3KEB A;  1X5E A;  4YH2 A;  2H76 A;  3WGX A;  4CW9 A;  3IR4 A;  3ZIT A;  1B9X C;  1EOG A;  3W8J A;  2CAI A;  1S3C A;  2VCX A;  2JZS A;  3HXS A;  5GSS A;  2GSR A;  3FZ9 A;  4HZ2 A;  3GH6 A;  2KLX A;  5CYY A;  4EL1 A;  5HR2 A;  5J3R A;  1BX9 A;  2HYX A;  3QFA C;  3NZN A;  5D73 A;  1GSF A;  2CVD A;  4QL7 A;  5ECO B;  4JBB A;  2RM5 A;  4K1F A;  2YAN A;  5LD0 A;  3QR6 A;  4MA9 A;  1OE7 A;  1SYR A;  2IL3 A;  4ECI A;  5J5N A;  2YJ7 A;  4XTS A;  4MP4 A;  4K8M A;  3E0U A;  3GL3 A;  5LCZ A;  1SKS B;  3CBU A;  1H75 A;  4HU9 A;  2LNT A;  3MAK A;  3LYP A;  5G5E A;  2LRT A;  5GST A;  4K2D A;  3ZFB A;  1PD2 1;  1VF4 A;  2N5A A;  4HQZ A;  2P0G A;  5DAL B;  3W8S A;  2JU5 A;  4G19 A;  1K0M A;  5JCG A;  4HUA A;  1BED A;  4IVF A;  5GAP D;  2HI7 A;  2AB6 A;  4MPF A;  2F51 A;  4E8E A;  3FEU A;  1PX6 A;  1F3B A;  2CZ2 A;  3HVS A;  3R2Q A;  4OFN A;  3P90 A;  1GSY A;  1QFN A;  16GS A;  2B1K A;  5HR3 A;  2C3Q A;  4NAX A;  1T3B A;  3ZML A;  5IO0 A;  5KN3 A;  2H1D A;  2WDU A;  1GL8 A;  4GQC A;  4XRA A;  1AUC A;  2IMK A;  4EUY A;  1K0B A;  3MSZ A;  2XPE A;  2CX3 A;  4EE0 A;  3GTU B;  5L71 A;  1PA3 A;  1IYH A;  1V9W A;  1N8J A;  17GS A;  3BCK A;  5B7C A;  2OKA A;  1JLV A;  1VF2 A;  4G10 A;  3JCM L;  3TOU A;  4IKH A;  3N5O A;  3BBY A;  3NIV A;  4F82 A;  2RUE A;  4OWY A;  3PIN A;  1THX A;  2XBI A;  1KTE A;  1JZO A;  3APQ A;  2LNS A;  4GCI A;  1XWG A;  3GIX A;  1I5G A;  2X8C A;  2YP6 A;  2OAD A;  3IK7 A;  4GST A;  1W89 A;  5ECK B;  2F8A A;  2IFQ B;  4WET A;  4ILF A;  1WRY A;  1XWC A;  4PXO A;  1V58 A;  4TN8 A;  5DJL A;  5ABR A;  1M9B A;  3D4M A;  1FOV A;  1OKD A;  2P31 A;  2A2R A;  3DWV A;  1GLP A;  4TVE A;  3TCO A;  4L8E A;  4K7N A;  2I3Y A;  5D93 A;  3VWW A;  2KOK A;  6GSW A;  3IAM 2;  2XPD A;  1G6W A;  1O85 A;  2L4Q A;  4XS4 A;  3FZ5 A;  3VI5 A;  1NHO A;  3A2V A;  1AQV A;  2B7K A;  1T4Z A;  2VD1 A;  4RI7 A;  3TRQ A;  3CTG A;  2C3N A;  1HQO A;  2L4C A;  4ID0 A;  2YWI A;  1MD3 A;  1ST9 A;  5IOX A;  3MDK A;  4TKY A;  1C72 A;  3LWA A;  3Q18 A;  4XHM A;  3D4T A;  3QAV A;  2PWJ A;  1G6Y A;  5IMA A;  4ZIL A;  4NV2 A;  3ZL5 A;  5A4W A;  2MBT A;  4EVM A;  3ZLP A;  1TU8 A;  2PBJ A;  2GT6 A;  5CRG A;  1U3I A;  2GSQ A;  3F4R A;  3NOF A;  3EC3 A;  2L57 A;  5CNW A;  2I4A A;  5AGY A;  1SL1 B;  3DVW A;  1YKA A;  5KEJ A;  1BQ7 A;  1R4W A;  3C71 A;  2H71 A;  2JL4 A;  2LV3 A;  4QL9 A;  2GQK A;  5GAN D;  3GL5 A;  1PKZ A;  4DSQ A;  1R26 A;  2LS5 A;  2B6M A;  1YY7 A;  3CSI A;  3HHV A;  1GSD A;  3QAG A;  4XRD A;  1WP0 A;  2EC4 A;  2CX4 A;  3L9V A;  1N2A A;  4YQV A;  4GQF A;  3MNG A;  4BVY A;  2FHE A;  2J23 A;  1XW9 A;  1Z3E A;  1FG4 A;  3E3E A;  5ECH B;  4EKZ A;  3DXB A;  4DSS A;  2MZC A;  3ZMK A;  2QSI A;  2YWO A;  1KEB A;  2KHP A;  2X8G A;  4MZB A;  2MMN A;  2YNX A;  1ERW A;  2C8U A;  2FA4 A;  5F06 A;  1YDK A;  1J9B A;  4WKW A;  2MMA A;  1F9M A;  2ZNM A;  1GSQ A;  1M2D A;  2WZ9 A;  1A2J A;  3DKS A;  1XZO A;  2O89 A;  1EP8 A;  1ZYE A;  4ZXG A;  2TRC P;  4I97 A;  3HJM A;  2HSH A;  1M2B A;  3KP8 A;  2B1L A;  1ZOF A;  2K18 A;  4JRR A;  1QK8 A;  5IQY A;  1JZW A;  1GUL A;  3G7Y A;  4O32 A;  1M0U A;  1LJR A;  2HZF A;  1YEX A;  1M9A A;  3I9V 2;  3ED3 A;  5JCW A;  3TKS C;  1WPI A;  2K8V A;  4O7H A;  4TR0 A;  2OAC A;  4AGS A;  5ECP B;  5A5K A;  3UAR A;  3IXR A;  1NM3 A;  4NXI A;  1CQG A;  4BL7 A;  4I8B A;  4J56 E;  2L6C A;  2V6K A;  3GUS A;  2HZE B;  2IIY A;  2RM6 A;  1QQ2 A;  1LBK A;  2D2Z A;  4OFM A;  4IQ1 A;  2O8V B;  3TJK A;  4POB A;  1XW5 A;  3L9S A;  2PN8 A;  3HJO A;  1WJK A;  4IJ3 A;  2E2M A;  3QAW A;  1OKT A;  5IMD A;  3UIW A;  6GSX A;  2TRX A;  3EWL A;  3ZVJ D;  14GS A;  2HSY A;  4FIW A;  1M2A A;  4YAP A;  3W6G A;  2LJR A;  5ELG A;  4GTU A;  4MK3 A;  4P3Y B;  1KBN A;  5HQP A;  4XS1 A;  4MH2 A;  5AIV A;  5J4U A;  2GTU A;  2HLS A;  3HYP A;  1NSW A;  2XC2 A;  2L5L A;  3L9U A;  1PRX A;  2J9H A;  5D96 A;  1O73 A;  1MDK A;  4F03 A;  1GTU A;  3LOR A;  3KTL A;  1ZCP A;  2B5E A;  1FB6 A;  3UJ1 A;  4L0W A;  3GX0 A;  2CZ3 A;  4N10 A;  1VGL A;  1TK8 B;  3UVH A;  1XPV A;  3AY8 A;  2GS3 A;  5DAK A;  1Z5Y E;  4F0B A;  5HFI A;  1T1V A;  2LQO A;  2LKU A;  1X5D A;  1OAZ A;  3P7X A;  3GX8 A;  3WGE A;  4LA1 A;  4TOP A;  2LJA A;  2LJK A;  1DBY A;  1K0O A;  3BD2 A;  4OO5 A;  1A23 A;  3APS A;  4MLY A;  2LTK A;  1V2A A;  1UC7 A;  4BVX A;  2N5B A;  1GP1 A;  1TK5 B;  1FAA A;  2IMD A;  2PER A;  3TOT A;  5EL8 A;  4Q5Q A;  3TJJ A;  5CO3 A;  4LL1 B;  4HS1 A;  1VF1 A;  4Z7X A;  1O8W A;  5F05 A;  1TXX A;  4KSO A;  2VCW A;  1K0C A;  5DJM A;  4IN0 A;  1S3D A;  4NHW A;  7GSS A;  4AJ8 A;  2MBS A;  5IMF A;  2VCV A;  4WBJ A;  3H1N A;  4IS0 A;  1YKC A;  3F8U A;  1O8X A;  2RLI A;  4MMM A;  3ZZX A;  2MMZ A;  1GUK A;  5D8I A;  5IMC A;  4TXO A;  1Z7P A;  1K3Y A;  3DGQ A;  4DSR A;  2VOC A;  3J7Y k;  2VLT A;  5HR0 A;  2C0E A;  2FWF A;  3ISO A;  5JWO B;  1X9W B;  5ID2 B;  5KN1 A;  4PNF A;  3FR6 A;  3A5W A;  2C0G A;  1JZD A;  2VLV A;  4GSN A;  2C3T A;  3VK9 A;  4Q5F A;  1XOB A;  5CRD A;  3RBT A;  1QGV A;  3LGC A;  1HNA A;  3RPN A;  4TR1 A;  4EXJ A;  2V41 A;  4OFT A;  1JHB A;  1V57 A;  10GS A;  2FUG 2;  2IWT A;  2FWG A;  2DBC A;  1SJZ A;  3HA9 A;  3IPZ A;  3ZVJ A;  2C1Y A;  2FGX A;  3ZRE A;  9GSS A;  5FT3 A;  4K7I A;  3KH9 A;  3HD5 A;  3KCM A;  1YZX A;  2K8S A;  4EDZ A;  1ZGN A;  4IW9 A;  4ECC A;  2VCT A;  2REM A;  2V32 A;  3FKF A;  1GSE A;  4IHU A;  3ERF A;  1JFU A;  4O92 A;  1XOA A;  4KDU A;  3TKR A;  1R5P A;  3GST A;  3Q6O A;  2IJY A;  2QC7 A;  4V2L A;  2GQM A;  3CYN A;  1PN9 A;  1XFL A;  3GA4 A;  2IME A;  3CSH A;  4ZBA A;  4E8H A;  3D5J A;  3GKN A;  2HT9 A;  1ILO A;  2Z9S A;  5ECS A;  4POL A;  3I69 A;  4D73 B;  3PR8 A;  1T8E B;  1VF3 A;  2H6Z A;  5ECL B;  1EZK A;  5B6M A;  4TW5 A;  4IP1 A;  5DQS A;  1GUH A;  2JSZ A;  1Z6M A;  3QCP A;  1XW6 A;  1U87 A;  3F6F A;  3SBC A;  3FR9 A;  3TRP A;  3E9J B;  3KTB A;  5A4U A;  2MMO A;  4MDC A;  1SU9 A;  4CHS A;  2E0Q A;  4YAV A;  1J0F A;  1X5C A;  1PGT A;  2R37 A;  5AIX A;  1WWJ A;  5H5R A;  1AAZ A;  2AV4 A;  4ZB8 A;  4HJM A;  4X1U A;  3C73 A;  4KW6 A;  4CDO A;  4ACS A;  2H73 A;  4HZ4 A;  2FD3 A;  3GH9 A;  3CSJ A;  4DSS B;  5B8A A;  2H19 A;  1EEM A;  2BMX A;  5EVO A;  5IO2 A;  3S9F A;  2YPM A;  1GRX A;  2YWM A;  2GT5 A;  3F4T A;  4KB3 A;  5D9W A;  3GHA A;  3EUR A;  3FYG A;  1GSU A;  1SJ6 A;  3EMP A;  2QKE A;  3UAP A;  2RII A;  4JE1 A;  1YJ6 A;  4EO3 A;  1GWC A;  4HOJ A;  3DVX A;  5G31 A;  4GSS A;  1SL0 B;  2WS2 A;  1UVZ A;  4IGJ A;  2VIM A;  1SD9 A;  4GRF A;  1U6T A;  2LRN A;  4PUA A;  4GLT A;  2ZUP A;  2H72 A;  3EMX A;  1ZZY A;  5IPG A;  1MDJ A;  4WXT A;  3F63 A;  2ALB A; 
#chains in the Genus database with same CATH topology
 4FYB A;  1SKW B;  6GSV A;  2H1B A;  22GS A;  2H1G A;  1Z6N A;  3EE2 A;  5IMV A;  3EPT A;  3ERG A;  2XBQ A;  2DJK A;  1SD8 A;  2YN1 A;  3GYK A;  1OC9 B;  3A3T A;  3ZRD A;  1HYU A;  3ZIV A;  3M9J A;  4LMV A;  2VAF A;  3GRX A;  5IPH A;  5COH A;  1R7H A;  1TKD B;  5ENU A;  5E59 A;  3ME8 A;  1QMV A;  1PKW A;  2H0H A;  1XIY A;  3TGZ A;  4ZB6 A;  3LXT A;  2YZH A;  5A4V A;  1ABA A;  1SKR B;  1TDI A;  3M9K A;  3GTU A;  2LQQ A;  4HJ2 A;  1AIU A;  4DEJ A;  1GUM A;  1K3O A;  4KDX A;  2B3S A;  3M1G A;  2JZT A;  3TUE A;  3IOS A;  4MZW A;  4G9H A;  4NHZ A;  5ECI B;  1T4Y A;  4BWQ A;  3UBL A;  1DUG A;  3KGK A;  3LEF A;  3LFL A;  4FH8 A;  2PUK C;  3TKQ A;  3FY7 A;  2VCQ A;  4K9Z A;  2VD0 A;  5JCU A;  3F6D A;  4KAE A;  2E7P A;  2KP1 A;  4FO5 A;  1HNC A;  2MYG A;  1XWA A;  4RI6 A;  2HRK A;  4L5L A;  2FWE A;  1OC3 A;  3UOM A;  1FHE A;  2ON5 A;  3TDG A;  3H93 A;  2VM1 A;  5CAX A;  2G0F A;  4IBP A;  1NW2 A;  2YOI A;  2HFD A;  2GZP A;  2AUV A;  4MJC A;  4Z2R A;  1F37 A;  2OE0 A;  5DCG A;  3GMF A;  5CP1 A;  1U88 A;  3GN3 A;  2GST A;  1PN0 A;  1RW1 A;  4PQ1 A;  3FW2 A;  3I43 A;  1G0T A;  3UL3 A;  2L5O A;  3QDN A;  5G2Z A;  2LEG A;  3M8N A;  3IAS 2;  2VL9 A;  2H74 A;  3HKR A;  3BOA A;  3C1S A;  3EIN A;  3KIJ A;  3KM6 A;  5DQY A;  5DVB A;  2IMF A;  4MJB A;  3BJ5 A;  2YV7 A;  2R3X A;  4JZQ A;  4OD7 A;  1TW9 A;  5C00 A;  5B8B A;  1EV4 A;  4K5R A;  1GSS A;  1ON4 A;  4BVX B;  2EIQ A;  2G2Q A;  2VL2 A;  2VLU A;  1BG5 A;  8GSS A;  5KOW A;  2JZR A;  2PMT A;  1SK2 A;  1O7U A;  2DMM A;  2O87 A;  1EEJ A;  3IHQ A;  3GV1 A;  1XVQ A;  1WE0 A;  2FLS A;  2C80 A;  2WUL A;  3IK9 A;  1F3A A;  2B5X A;  1TTZ A;  1SYX A;  1K3L A;  2AYT A;  1HD2 A;  4WBR D;  1G7O A;  3TKS E;  2KP2 A;  2HRA A;  3LYK A;  3IV4 A;  1IYI A;  2DJ2 A;  3TJB A;  5C04 A;  4ZBB A;  4AJ7 A;  2DLX A;  2LST A;  1AW9 A;  5HFK A;  1PFO A;  4I2U A;  1S3A A;  2FWH A;  1BYE A;  3V1W A;  3D6I A;  3H4K A;  3TJF A;  3WT1 A;  4IQA A;  1B48 A;  4GXZ A;  3IC8 A;  1TU7 A;  4G2E A;  4AJ6 A;  3WYW A;  4V2M A;  3RAZ A;  3DRN A;  1OYJ A;  2OBK A;  1URM A;  3FZA A;  12GS A;  2A4V A;  3D21 A;  5D9X A;  3KMN A;  1B8X A;  2HE3 A;  4ZL7 A;  2VM2 A;  1HNB A;  4RUV A;  3OR5 A;  3DML A;  3HVV A;  5DCH A;  4PNG A;  4L5O A;  4I6X A;  2NBS A;  3H79 A;  3VFI A;  4F2I A;  1Y25 A;  5AIS A;  3MIX A;  3VPQ A;  4N11 A;  4LL4 B;  1ML6 A;  3CQF A;  4EIP A;  1A2M A;  5EPF A;  3CRT A;  2LUS A;  3PPU A;  2F9S A;  2F3M A;  4TXV A;  4BPY A;  3VWU A;  2O85 A;  3LJR A;  4MAB A;  3ZYW A;  4LLR A;  4HU7 A;  1JLW A;  3DD3 A;  1AC1 A;  2V6O A;  4KDY A;  3EYT A;  3ZTL A;  1J08 A;  5ECN B;  2IPA A;  1AQW A;  4Q5R A;  2X64 A;  1A8Y A;  2YV9 A;  4KUN A;  4KGI A;  1WIK A;  4ECJ A;  1ZL9 A;  3K8N A;  2HZE A;  1YF1 A;  2EIR A;  2H0I A;  4V1A g;  2DJ1 A;  5ECM B;  3KZQ A;  4HI7 A;  3EU4 A;  3VWV A;  2M72 A;  5JWQ B;  4ZIJ A;  3F9U A;  2H75 A;  2FCH A;  4BA7 A;  1PL2 A;  3CXG A;  1THO A;  5DBQ A;  4JED A;  2WRT A;  5D9T A;  1X9S B;  1WOU A;  1ERU A;  5B6N A;  4N30 A;  2I81 A;  5H5S A;  4ULX A;  4K5S A;  1XVW A;  4GF0 A;  3TKP A;  1XWB A;  1LU4 A;  1O6J A;  2GZY A;  1FVJ A;  1K0D A;  2ON7 A;  1TRW A;  2AHE A;  2PVQ A;  4PUF C;  1SJI A;  2DJ3 A;  1UA5 A;  4HEA 2;  4MJA A;  2FY6 A;  4PTS A;  3Q19 A;  3HJP A;  4G0K A;  2N5F A;  3RPP A;  1EV9 A;  1FB0 A;  4QQ7 A;  5J9C A;  19GS A;  4XCS A;  3QMX A;  1T7P B;  1B9Y C;  1GTI A;  2CT6 A;  1Q98 A;  3HCZ A;  3HVN A;  4EIQ A;  1FO5 A;  2DIZ A;  4MF6 A;  1ACV A;  3CMI A;  4XS4 B;  4F9Z A;  2HXK A;  4BWS A;  3GNJ A;  4ML1 A;  1PX7 A;  2R0C A;  1UN2 A;  3C7M A;  5G1K A;  5KOX A;  2M46 A;  1GNW A;  4AF2 A;  2B5Y A;  2FA8 A;  1ERT A;  4MPG A;  1ZYQ B;  2A2S A;  1XCC A;  3IA1 A;  1QUW A;  4WR4 A;  2DJ0 A;  3A2X A;  4IJI A;  1RK4 A;  3L0H A;  2IMI A;  4RQR A;  3GKX A;  1I9D A;  4X43 A;  3QFB C;  2CQ9 A;  4BIK A;  2H0G A;  1PL1 A;  1OC8 A;  3CTF A;  3CRU A;  3HY2 A;  4IEL A;  5BRT A;  3O76 A;  1TK0 B;  4KX4 A;  4GWR A;  3RHB A;  5FWG A;  5FHI A;  3F3R A;  2NVL A;  1WMJ A;  2CVK A;  4JR6 A;  3QOU A;  1DE1 A;  4KCA A;  2JAC A;  2GDR A;  2R5G A;  2H30 A;  5ECR B;  4H86 A;  2GGT A;  5ELA A;  4MCU A;  1W4V A;  4KH7 A;  4LMW A;  1A2L A;  2NTO A;  4ZL9 A;  2QA2 A;  2ZCT A;  4V2N A;  2CAQ A;  3WT2 A;  2VO4 A;  3EU3 A;  1PQN A;  1YF0 A;  3VPT A;  3IBH A;  4OO4 A;  1ZMA A;  5ID2 A;  2EIO A;  3LG6 A;  1XBS A;  2DML A;  2M80 A;  4FYU A;  2DC5 A;  3WD6 A;  4RQX A;  1A8L A;  1EGO A;  1OE8 A;  4L0U A;  4J2F A;  4F0C A;  11GS A;  3VLN A;  2XHF A;  3WGD A;  3G7J A;  2BJX A;  3VWX A;  4ECB A;  2B7J A;  3FR3 A;  3KH7 A;  1M99 A;  2R4V A;  6GSY A;  4JU5 A;  3VI7 A;  1PMT A;  1G7E A;  4YQU A;  4PQH A;  3IE3 A;  3TB2 A;  2F8F A;  2P5R A;  2H1A A;  2WB9 A;  5HFG A;  2OJL A;  2C0F A;  3LQ7 A;  3G7I A;  1Y6E A;  4PGT A;  3Q74 A;  2X8H A;  4IP6 A;  2PPT A;  2HRF A;  1USB A;  2PVO C;  5DAL A;  2OBI A;  4EF0 A;  1TI3 A;  3APO A;  4EC0 A;  4I5Q A;  1MEK A;  5IMZ A;  2WFC A;  4TR4 A;  5F07 A;  5CRH A;  2H6X A;  1XXU A;  2V2G A;  2H66 A;  3PH9 A;  3KD0 A;  1FOH A;  1GNE A;  4BL7 B;  3RHC A;  1M7T A;  2V1M A;  3MWH A;  3ZFL A;  5H5Q A;  3QD9 A;  3KXO A;  3IDV A;  3P2A A;  1AXD A;  2LRC A;  5G5F A;  2GQL A;  4O5R A;  3HDC A;  3HZ4 A;  6GSU A;  1F2E A;  1GTA A;  1MD4 A;  4KCE A;  1NHY A;  4D73 A;  2A4H A;  3GUR A;  2WCI A;  1GH2 A;  2IN3 A;  5IOW A;  1V40 A;  3U6V A;  1T00 A;  4Q5N A;  2PGT A;  5ECQ B;  4TR3 A;  4CY8 A;  2CA8 A;  5GZZ B;  3PGT A;  2RUF A;  3F3Q A;  2H70 A;  1E6B A;  4XIH A;  2VL3 A;  2C4J A;  1TRU A;  3D0Z A;  3H8Q A;  5G1L A;  1K0N A;  2KUC A;  3P8W A;  4OCE A;  4FYC A;  5D9V A;  1SEN A;  13GS A;  3KJY A;  3HVX A;  2R2J A;  1V98 A;  1K0A A;  4NV5 A;  2GVP A;  3M0F A;  5CRW A;  2GZZ A;  4K2X A;  1BJX A;  1U3A A;  2H01 A;  2NPB A;  3FRC A;  2IFQ A;  2HNL A;  1XWK A;  2L6D A;  2VL2 C;  3UBK A;  4KND A;  1B4Q A;  3TJG A;  4MF5 A;  5DAK B;  1X9M B;  3EVI A;  2DIY A;  3F4S A;  5DDL A;  2WJU A;  2VCZ A;  1O81 A;  1RQM A;  4PUR A;  4WF5 A;  5F0G A;  2YWN A;  2DJJ A;  3QPM A;  2YJH A;  1FW1 A;  1X0R A;  1EOH A;  4PQI A;  6GST A;  2CVB A;  1KNG A;  1PSQ A;  1Q4J A;  5HR1 A;  2H8L A;  3RDW A;  1EP7 A;  2E2G A;  4K6X A;  1EWX A;  4WR5 A;  4POM A;  5KN2 A;  2YCD A;  4KE3 A;  1R5A A;  2HRN A;  1EGR A;  3VUR A;  3LXZ A;  1MTC A;  2R6K A;  4TRX A;  1YQ1 A;  4KA0 A;  4ISD A;  3FK8 A;  3IRA A;  1OVN A;  1FVK A;  3DYR A;  1Z7R A;  1OC9 A;  2R0P A;  2JSY A;  4V1A p;  3SWL A;  3L78 A;  3D22 A;  1TP9 A;  1VRS D;  3ZIJ A;  2OE3 A;  4K0G A;  3J7Y b;  2GSS A;  18GS A;  2CV4 A;  4MJE A;  1AQX A;  3U5R E;  1B4P A;  1GTB A;  1A0F A;  3GKM A;  3N9J A;  3F0I A;  2YZU A;  5JWR B;  4TXO B;  3LSZ A;  5J41 A;  2TIR A;  2VUP A;  1DE2 A;  5IM9 A;  3TKS A;  4JR4 A;  2P5Q A;  2K6V A;  2GLR A;  2FNO A;  3FHK A;  4MF7 A;  3FZ4 A;  3KMO A;  3C8E A;  4PX1 A;  2NDO A;  2X99 A;  4OMV A;  1DSB A;  1CQH A;  4ML6 A;  3G9B A;  3DIE A;  4TR1 B;  5INY A;  2AJQ B;  4NPB A;  4I2T A;  4N0V A;  1A0R P;  5J9B A;  4HDE A;  1ZYN A;  1SL2 B;  1TRV A;  1M3I A;  2WGR A;  6GSS A;  4DVC A;  4EDY A;  4K7O A;  1TI1 A;  4WF4 A;  2PU9 C;  2I9H A;  3UMA A;  5LNK e;  1BAY A;  1JZR A;  2O7K A;  2K9F A;  4K0N A;  1E2Y A;  2QGV A;  4WEY A;  4X0X A;  3O6T A;  1GLQ A;  4NMU A;  3O3T A;  3GFK A;  4HQS A;  3L4N A;  3DEX A;  3ERW A;  1H4O A;  4ZL8 A;  1TOF A;  20GS A;  1TJD A;  1SK1 A;  2DSA A;  2H6Y A;  4POK A;  2BTO T;  3US3 A;  4MH3 A;  3ME7 A;  2OE1 A;  5IIZ A;  3UEM A;  2I1U A;  5KN0 A;  4N0Z A;  4XS6 A;  2L59 A;  1M3J A;  3BCI A;  1ERV A;  1SK0 A;  1ZYP A;  4MZC A;  5CRE A;  3TRX A;  1TRS A;  4ZBD A;  4YQM A;  1YEP A;  3GKK A;  5EY6 A;  5G30 A;  3I6A A;  3GSS A;  2JAD A;  3C1R A;  1F6M C;  4J57 E;  1A24 A;  5E4W A;  4KSM A;  3IC4 A;  4G0L A;  2AAW A;  3M3M A;  1Z9H A;  4ZB9 A;  3HZ8 A;  1QXH A;  3KP9 A;  3A2W A;  4OCF A;  2ES7 A;  2R0G A;  4NWY A;  5AN1 A;  3UVT A;  2C0D A;  2OA7 A;  1MDI A;  5F8B A;  3KEB A;  1X5E A;  4YH2 A;  2H76 A;  3WGX A;  4CW9 A;  3IR4 A;  3ZIT A;  1B9X C;  1EOG A;  3W8J A;  2CAI A;  1S3C A;  2VCX A;  2JZS A;  3HXS A;  5GSS A;  2GSR A;  3FZ9 A;  4HZ2 A;  3GH6 A;  2KLX A;  3MYD A;  5CYY A;  4EL1 A;  5HR2 A;  5J3R A;  1BX9 A;  2HYX A;  3QFA C;  3NZN A;  5D73 A;  1GSF A;  2CVD A;  4USS A;  4QL7 A;  5ECO B;  4JBB A;  2RM5 A;  4K1F A;  2YAN A;  5LD0 A;  3QR6 A;  4MA9 A;  1S3R A;  1OE7 A;  1SYR A;  2IL3 A;  4ECI A;  5J5N A;  2YJ7 A;  4XTS A;  4MP4 A;  4K8M A;  3E0U A;  3GL3 A;  5LCZ A;  1SKS B;  3CBU A;  1H75 A;  4HU9 A;  2LNT A;  3MAK A;  3LYP A;  5G5E A;  2LRT A;  5GST A;  3A5I A;  4K2D A;  3ZFB A;  1PD2 1;  1VF4 A;  2N5A A;  4HQZ A;  2P0G A;  5DAL B;  3W8S A;  2JU5 A;  4G19 A;  1K0M A;  5JCG A;  4HUA A;  1BED A;  4IVF A;  5GAP D;  2HI7 A;  2AB6 A;  4MPF A;  2F51 A;  4YKF A;  4E8E A;  3FEU A;  1PX6 A;  2X49 A;  1F3B A;  2CZ2 A;  3HVS A;  3R2Q A;  4OFN A;  3P90 A;  1GSY A;  1QFN A;  4G0I A;  16GS A;  4O5Q A;  2B1K A;  5HR3 A;  2C3Q A;  4NAX A;  1T3B A;  3ZML A;  3R3E A;  5IO0 A;  5KN3 A;  2H1D A;  2WDU A;  1GL8 A;  4GQC A;  4XRA A;  1AUC A;  2IMK A;  4EUY A;  1K0B A;  3MSZ A;  2XPE A;  2CX3 A;  4EE0 A;  3GTU B;  5L71 A;  1PA3 A;  1IYH A;  1V9W A;  1N8J A;  17GS A;  3BCK A;  5B7C A;  2OKA A;  4Z2T A;  1JLV A;  1VF2 A;  4G10 A;  3IHG A;  3JCM L;  3TOU A;  4IKH A;  3N5O A;  2A2P A;  3BBY A;  3NIV A;  4F82 A;  2RUE A;  4OWY A;  3PIN A;  1THX A;  2XBI A;  1KTE A;  1JZO A;  3APQ A;  2LNS A;  4GCI A;  1XWG A;  3GIX A;  1I5G A;  2X8C A;  2YP6 A;  2OAD A;  3IK7 A;  4GST A;  1W89 A;  5ECK B;  2F8A A;  2IFQ B;  4WET A;  4ILF A;  1WRY A;  1XWC A;  4PXO A;  1V58 A;  4TN8 A;  5DJL A;  4Z2U A;  5ABR A;  1M9B A;  3D4M A;  1FOV A;  1OKD A;  2P31 A;  2A2R A;  3DWV A;  1GLP A;  4TVE A;  3TCO A;  4L8E A;  4K7N A;  2I3Y A;  5D93 A;  3VWW A;  2KOK A;  6GSW A;  3IAM 2;  2XPD A;  1G6W A;  1O85 A;  2L4Q A;  4XS4 A;  3FZ5 A;  3VI5 A;  1NHO A;  3A2V A;  1AQV A;  2B7K A;  1T4Z A;  2VD1 A;  4RI7 A;  3TRQ A;  3CTG A;  2C3N A;  1HQO A;  2L4C A;  4ID0 A;  2YWI A;  1MD3 A;  1ST9 A;  5IOX A;  3MDK A;  4TKY A;  1C72 A;  3LWA A;  3Q18 A;  4XHM A;  3D4T A;  3QAV A;  2PWJ A;  1G6Y A;  3LW9 A;  5IMA A;  4ZIL A;  4NV2 A;  3ZL5 A;  5A4W A;  2MBT A;  4EVM A;  3ZLP A;  1TU8 A;  2PBJ A;  2GT6 A;  5CRG A;  1U3I A;  2GSQ A;  3F4R A;  3NOF A;  3EC3 A;  2L57 A;  5CNW A;  2HSM A;  2I4A A;  5AGY A;  1SL1 B;  3DVW A;  1YKA A;  5KEJ A;  1BQ7 A;  1R4W A;  3C71 A;  2H71 A;  2JL4 A;  2LV3 A;  4QL9 A;  2GQK A;  5GAN D;  3GL5 A;  1PKZ A;  4A5P A;  4DSQ A;  1R26 A;  2LS5 A;  2B6M A;  1YY7 A;  3CSI A;  3HHV A;  1GSD A;  3QAG A;  4XRD A;  1WP0 A;  2EC4 A;  2CX4 A;  3L9V A;  1N2A A;  4YQV A;  4GQF A;  3MNG A;  4BVY A;  2FHE A;  2J23 A;  1XW9 A;  1Z3E A;  1FG4 A;  3E3E A;  5ECH B;  4EKZ A;  3DXB A;  4DSS A;  2MZC A;  3ZMK A;  2QSI A;  2YWO A;  1KEB A;  2KHP A;  2X8G A;  4MZB A;  2MMN A;  2YNX A;  1ERW A;  2C8U A;  2FA4 A;  5F06 A;  1J9B A;  1YDK A;  4WKW A;  2MMA A;  1F9M A;  2ZNM A;  1GSQ A;  1M2D A;  2WZ9 A;  1A2J A;  3DKS A;  1XZO A;  2O89 A;  1EP8 A;  1ZYE A;  4ZXG A;  2TRC P;  4I97 A;  3HJM A;  2HSH A;  1M2B A;  3KP8 A;  2B1L A;  1ZOF A;  2K18 A;  4JRR A;  1QK8 A;  4HSC X;  5IQY A;  1JZW A;  1GUL A;  3G7Y A;  4KF9 A;  4O32 A;  1M0U A;  1LJR A;  2HZF A;  1YEX A;  1M9A A;  3I9V 2;  3ED3 A;  5BMU A;  5JCW A;  3TKS C;  1WPI A;  2K8V A;  4O7H A;  4TR0 A;  2OAC A;  4AGS A;  5ECP B;  5A5K A;  3UAR A;  3IXR A;  1NM3 A;  4NXI A;  1CQG A;  4BL7 A;  4I8B A;  4J56 E;  2L6C A;  2V6K A;  3GUS A;  2HZE B;  2IIY A;  2RM6 A;  1QQ2 A;  1LBK A;  2D2Z A;  4OFM A;  4IQ1 A;  2O8V B;  3TJK A;  4POB A;  1XW5 A;  3L9S A;  2PN8 A;  3HJO A;  1WJK A;  4IJ3 A;  2E2M A;  3QAW A;  1OKT A;  5IMD A;  3UIW A;  6GSX A;  2TRX A;  3EWL A;  3ZVJ D;  14GS A;  2HSY A;  4FIW A;  1M2A A;  4YAP A;  3W6G A;  2LJR A;  5ELG A;  4GTU A;  4MK3 A;  4P3Y B;  1KBN A;  5HQP A;  4XS1 A;  4MH2 A;  5AIV A;  5J4U A;  2GTU A;  2HLS A;  3HYP A;  1NSW A;  2XC2 A;  2L5L A;  3L9U A;  1PRX A;  2J9H A;  5D96 A;  1O73 A;  1MDK A;  4F03 A;  1GTU A;  3LOR A;  2QA1 A;  3KTL A;  1ZCP A;  2B5E A;  1FB6 A;  3UJ1 A;  4L0W A;  3GX0 A;  4FQU A;  2CZ3 A;  4N10 A;  1VGL A;  1TK8 B;  3UVH A;  1XPV A;  3AY8 A;  2GS3 A;  5DAK A;  1Z5Y E;  4F0B A;  5HFI A;  1T1V A;  2LQO A;  2LKU A;  1X5D A;  1OAZ A;  3P7X A;  3GX8 A;  3WGE A;  4LA1 A;  4TOP A;  2LJA A;  2LJK A;  1DBY A;  1K0O A;  3BD2 A;  4OO5 A;  1A23 A;  3APS A;  4MLY A;  2LTK A;  1V2A A;  4X4J A;  1UC7 A;  4BVX A;  2N5B A;  1GP1 A;  1TK5 B;  1FAA A;  2IMD A;  2PER A;  3TOT A;  5EL8 A;  4Q5Q A;  3TJJ A;  5CO3 A;  4LL1 B;  4HS1 A;  1VF1 A;  4Z7X A;  1O8W A;  5F05 A;  1TXX A;  4KSO A;  2VCW A;  1K0C A;  5DJM A;  4IN0 A;  1S3D A;  4NHW A;  7GSS A;  4AJ8 A;  2MBS A;  5IMF A;  2VCV A;  4WBJ A;  3H1N A;  4IS0 A;  1YKC A;  3F8U A;  1O8X A;  2RLI A;  4MMM A;  3ZZX A;  2MMZ A;  1GUK A;  2X4A A;  5D8I A;  4ICY A;  5IMC A;  4TXO A;  1Z7P A;  1K3Y A;  3DGQ A;  4DSR A;  2VOC A;  3J7Y k;  2VLT A;  5HR0 A;  2C0E A;  2FWF A;  3ISO A;  5JWO B;  1X9W B;  5ID2 B;  5KN1 A;  4PNF A;  3FR6 A;  3A5W A;  2C0G A;  1JZD A;  2VLV A;  4GSN A;  2C3T A;  3VK9 A;  4Q5F A;  1XOB A;  5CRD A;  3RBT A;  1QGV A;  3LGC A;  1HNA A;  3RPN A;  4TR1 A;  4EXJ A;  4MNN A;  2V41 A;  4OFT A;  1JHB A;  2DKI A;  1V57 A;  10GS A;  2FUG 2;  2IWT A;  2DKH A;  2FWG A;  2DBC A;  1SJZ A;  3HA9 A;  3IPZ A;  3ZVJ A;  2C1Y A;  2FGX A;  3ZRE A;  9GSS A;  5FT3 A;  4K7I A;  3KH9 A;  3HD5 A;  3KCM A;  1YZX A;  2K8S A;  4EDZ A;  1ZGN A;  4IW9 A;  4ECC A;  2VCT A;  2REM A;  2V32 A;  3FKF A;  1GSE A;  4IHU A;  3ERF A;  1JFU A;  4O92 A;  1XOA A;  4KDU A;  3TKR A;  1R5P A;  3GST A;  3Q6O A;  2IJY A;  2QC7 A;  4V2L A;  2GQM A;  3CYN A;  1PN9 A;  1XFL A;  3GA4 A;  2IME A;  3CSH A;  4ZBA A;  4E8H A;  3D5J A;  3GKN A;  2HT9 A;  1ILO A;  2Z9S A;  5ECS A;  4POL A;  3I69 A;  4D73 B;  3PR8 A;  1T8E B;  1VF3 A;  2H6Z A;  5ECL B;  1EZK A;  5B6M A;  4TW5 A;  4IP1 A;  5DQS A;  1GUH A;  2JSZ A;  1Z6M A;  3QCP A;  1XW6 A;  1U87 A;  3F6F A;  3SBC A;  3FR9 A;  3TRP A;  3E9J B;  3KTB A;  4O5U A;  5A4U A;  2MMO A;  2UZ8 A;  4MDC A;  1SU9 A;  4CHS A;  2E0Q A;  4YAV A;  1J0F A;  1X5C A;  1PGT A;  2R37 A;  5AIX A;  4CY6 A;  1WWJ A;  4YKG A;  5H5R A;  3FMW A;  1AAZ A;  2AV4 A;  4ZB8 A;  4HJM A;  4X1U A;  3C73 A;  4KW6 A;  4BVY B;  4CDO A;  4ACS A;  2H73 A;  4HZ4 A;  2FD3 A;  3GH9 A;  3CSJ A;  4DSS B;  5B8A A;  1XG8 A;  2H19 A;  1EEM A;  2BMX A;  5EVO A;  5IO2 A;  3S9F A;  2YPM A;  1GRX A;  2YWM A;  2GT5 A;  3F4T A;  4KB3 A;  5D9W A;  3GHA A;  3EUR A;  3FYG A;  1GSU A;  1SJ6 A;  3EMP A;  2QKE A;  3UAP A;  2RII A;  4JE1 A;  1YJ6 A;  4EO3 A;  1GWC A;  4HOJ A;  3DVX A;  5G31 A;  4GSS A;  1SL0 B;  2WS2 A;  1UVZ A;  4IGJ A;  2VIM A;  1SD9 A;  4GRF A;  1U6T A;  2LRN A;  4PUA A;  4GLT A;  2ZUP A;  2H72 A;  3EMX A;  1ZZY A;  5IPG A;  1MDJ A;  4WXT A;  3F63 A;  2ALB A; 
#chains in the Genus database with same CATH homology
 4FYB A;  1SKW B;  6GSV A;  2H1B A;  22GS A;  2H1G A;  1Z6N A;  3EE2 A;  5IMV A;  3EPT A;  3ERG A;  2XBQ A;  2DJK A;  1SD8 A;  2YN1 A;  3GYK A;  1OC9 B;  3A3T A;  3ZRD A;  1HYU A;  3ZIV A;  3M9J A;  4LMV A;  2VAF A;  3GRX A;  5IPH A;  5COH A;  1R7H A;  1TKD B;  5ENU A;  5E59 A;  3ME8 A;  1QMV A;  1PKW A;  2H0H A;  1XIY A;  3TGZ A;  4ZB6 A;  3LXT A;  2YZH A;  5A4V A;  1ABA A;  1SKR B;  1TDI A;  3M9K A;  3GTU A;  2LQQ A;  4HJ2 A;  1AIU A;  4DEJ A;  1GUM A;  1K3O A;  4KDX A;  2B3S A;  3M1G A;  2JZT A;  3TUE A;  3IOS A;  4MZW A;  4G9H A;  4NHZ A;  5ECI B;  1T4Y A;  4BWQ A;  3UBL A;  1DUG A;  3KGK A;  3LEF A;  3LFL A;  4FH8 A;  2PUK C;  3TKQ A;  3FY7 A;  2VCQ A;  4K9Z A;  2VD0 A;  5JCU A;  3F6D A;  4KAE A;  2E7P A;  2KP1 A;  4FO5 A;  1HNC A;  2MYG A;  1XWA A;  4RI6 A;  2HRK A;  4L5L A;  2FWE A;  1OC3 A;  3UOM A;  1FHE A;  2ON5 A;  3TDG A;  3H93 A;  2VM1 A;  5CAX A;  2G0F A;  4IBP A;  1NW2 A;  2YOI A;  2HFD A;  2GZP A;  2AUV A;  4MJC A;  4Z2R A;  1F37 A;  2OE0 A;  5DCG A;  3GMF A;  5CP1 A;  1U88 A;  3GN3 A;  2GST A;  1PN0 A;  1RW1 A;  4PQ1 A;  3FW2 A;  3I43 A;  1G0T A;  3UL3 A;  2L5O A;  3QDN A;  5G2Z A;  2LEG A;  3M8N A;  3IAS 2;  2VL9 A;  2H74 A;  3HKR A;  3BOA A;  3C1S A;  3EIN A;  3KIJ A;  3KM6 A;  5DQY A;  5DVB A;  2IMF A;  4MJB A;  3BJ5 A;  2YV7 A;  2R3X A;  4JZQ A;  4OD7 A;  1TW9 A;  5C00 A;  5B8B A;  1EV4 A;  4K5R A;  1GSS A;  1ON4 A;  4BVX B;  2EIQ A;  2G2Q A;  2VL2 A;  2VLU A;  1BG5 A;  8GSS A;  5KOW A;  2JZR A;  2PMT A;  1SK2 A;  1O7U A;  2DMM A;  2O87 A;  1EEJ A;  3IHQ A;  3GV1 A;  1XVQ A;  1WE0 A;  2FLS A;  2C80 A;  2WUL A;  3IK9 A;  1F3A A;  2B5X A;  1TTZ A;  1SYX A;  1K3L A;  2AYT A;  1HD2 A;  4WBR D;  1G7O A;  3TKS E;  2KP2 A;  2HRA A;  3LYK A;  3IV4 A;  1IYI A;  2DJ2 A;  3TJB A;  5C04 A;  4ZBB A;  4AJ7 A;  2DLX A;  2LST A;  1AW9 A;  5HFK A;  4I2U A;  1S3A A;  2FWH A;  1BYE A;  3V1W A;  3D6I A;  3H4K A;  3TJF A;  3WT1 A;  4IQA A;  1B48 A;  4GXZ A;  3IC8 A;  1TU7 A;  4G2E A;  4AJ6 A;  3WYW A;  4V2M A;  3RAZ A;  3DRN A;  1OYJ A;  2OBK A;  1URM A;  3FZA A;  12GS A;  2A4V A;  3D21 A;  5D9X A;  3KMN A;  1B8X A;  2HE3 A;  4ZL7 A;  2VM2 A;  1HNB A;  4RUV A;  3OR5 A;  3DML A;  3HVV A;  5DCH A;  4PNG A;  4L5O A;  4I6X A;  2NBS A;  3H79 A;  3VFI A;  4F2I A;  1Y25 A;  5AIS A;  3MIX A;  3VPQ A;  4N11 A;  4LL4 B;  1ML6 A;  4EIP A;  1A2M A;  5EPF A;  3CRT A;  2LUS A;  3PPU A;  2F9S A;  2F3M A;  4TXV A;  4BPY A;  3VWU A;  2O85 A;  3LJR A;  4MAB A;  3ZYW A;  4LLR A;  4HU7 A;  1JLW A;  3DD3 A;  1AC1 A;  2V6O A;  4KDY A;  3EYT A;  3ZTL A;  1J08 A;  5ECN B;  2IPA A;  1AQW A;  4Q5R A;  2X64 A;  1A8Y A;  2YV9 A;  4KUN A;  4KGI A;  1WIK A;  4ECJ A;  1ZL9 A;  3K8N A;  2HZE A;  1YF1 A;  2EIR A;  2H0I A;  4V1A g;  2DJ1 A;  5ECM B;  3KZQ A;  4HI7 A;  3EU4 A;  3VWV A;  2M72 A;  5JWQ B;  4ZIJ A;  3F9U A;  2H75 A;  2FCH A;  4BA7 A;  1PL2 A;  3CXG A;  1THO A;  5DBQ A;  4JED A;  2WRT A;  5D9T A;  1X9S B;  1WOU A;  1ERU A;  5B6N A;  4N30 A;  2I81 A;  5H5S A;  4ULX A;  4K5S A;  1XVW A;  4GF0 A;  3TKP A;  1XWB A;  1LU4 A;  1O6J A;  2GZY A;  1FVJ A;  1K0D A;  2ON7 A;  1TRW A;  2AHE A;  2PVQ A;  4PUF C;  1SJI A;  2DJ3 A;  1UA5 A;  4HEA 2;  4MJA A;  2FY6 A;  4PTS A;  3Q19 A;  3HJP A;  4G0K A;  2N5F A;  3RPP A;  1EV9 A;  1FB0 A;  4QQ7 A;  5J9C A;  19GS A;  4XCS A;  3QMX A;  1T7P B;  1B9Y C;  1GTI A;  2CT6 A;  1Q98 A;  3HCZ A;  4EIQ A;  1FO5 A;  2DIZ A;  4MF6 A;  1ACV A;  3CMI A;  4XS4 B;  4F9Z A;  2HXK A;  4BWS A;  3GNJ A;  4ML1 A;  1PX7 A;  2R0C A;  1UN2 A;  3C7M A;  5G1K A;  5KOX A;  2M46 A;  1GNW A;  4AF2 A;  2B5Y A;  2FA8 A;  1ERT A;  4MPG A;  1ZYQ B;  2A2S A;  1XCC A;  3IA1 A;  1QUW A;  4WR4 A;  2DJ0 A;  3A2X A;  4IJI A;  1RK4 A;  3L0H A;  2IMI A;  4RQR A;  3GKX A;  1I9D A;  4X43 A;  3QFB C;  2CQ9 A;  2H0G A;  1PL1 A;  1OC8 A;  3CTF A;  3CRU A;  3HY2 A;  4IEL A;  5BRT A;  3O76 A;  1TK0 B;  4KX4 A;  4GWR A;  3RHB A;  5FWG A;  5FHI A;  3F3R A;  2NVL A;  1WMJ A;  2CVK A;  4JR6 A;  3QOU A;  1DE1 A;  4KCA A;  2JAC A;  2GDR A;  2R5G A;  2H30 A;  5ECR B;  4H86 A;  2GGT A;  5ELA A;  4MCU A;  1W4V A;  4KH7 A;  4LMW A;  1A2L A;  2NTO A;  4ZL9 A;  2QA2 A;  2ZCT A;  4V2N A;  2CAQ A;  3WT2 A;  2VO4 A;  3EU3 A;  1PQN A;  1YF0 A;  3VPT A;  3IBH A;  4OO4 A;  1ZMA A;  5ID2 A;  2EIO A;  3LG6 A;  1XBS A;  2DML A;  2M80 A;  4FYU A;  2DC5 A;  3WD6 A;  4RQX A;  1A8L A;  1EGO A;  1OE8 A;  4L0U A;  4J2F A;  4F0C A;  11GS A;  3VLN A;  2XHF A;  3WGD A;  3G7J A;  2BJX A;  3VWX A;  4ECB A;  2B7J A;  3FR3 A;  3KH7 A;  1M99 A;  2R4V A;  6GSY A;  4JU5 A;  3VI7 A;  1PMT A;  1G7E A;  4YQU A;  4PQH A;  3IE3 A;  3TB2 A;  2F8F A;  2P5R A;  2H1A A;  2WB9 A;  5HFG A;  2OJL A;  2C0F A;  3LQ7 A;  3G7I A;  1Y6E A;  4PGT A;  3Q74 A;  2X8H A;  4IP6 A;  2PPT A;  2HRF A;  1USB A;  2PVO C;  5DAL A;  2OBI A;  4EF0 A;  1TI3 A;  3APO A;  4EC0 A;  4I5Q A;  1MEK A;  5IMZ A;  2WFC A;  4TR4 A;  5F07 A;  5CRH A;  2H6X A;  1XXU A;  2V2G A;  2H66 A;  3PH9 A;  3KD0 A;  1FOH A;  1GNE A;  4BL7 B;  3RHC A;  1M7T A;  2V1M A;  3MWH A;  3ZFL A;  5H5Q A;  3QD9 A;  3KXO A;  3IDV A;  3P2A A;  1AXD A;  2LRC A;  5G5F A;  2GQL A;  4O5R A;  3HDC A;  3HZ4 A;  6GSU A;  1F2E A;  1GTA A;  1MD4 A;  4KCE A;  1NHY A;  4D73 A;  2A4H A;  3GUR A;  2WCI A;  1GH2 A;  2IN3 A;  5IOW A;  1V40 A;  3U6V A;  1T00 A;  4Q5N A;  2PGT A;  5ECQ B;  4TR3 A;  4CY8 A;  2CA8 A;  5GZZ B;  3PGT A;  2RUF A;  3F3Q A;  2H70 A;  1E6B A;  4XIH A;  2VL3 A;  2C4J A;  1TRU A;  3D0Z A;  3H8Q A;  5G1L A;  1K0N A;  2KUC A;  3P8W A;  4OCE A;  4FYC A;  5D9V A;  1SEN A;  13GS A;  3KJY A;  3HVX A;  2R2J A;  1V98 A;  1K0A A;  4NV5 A;  2GVP A;  3M0F A;  5CRW A;  2GZZ A;  4K2X A;  1BJX A;  1U3A A;  2H01 A;  2NPB A;  3FRC A;  2IFQ A;  2HNL A;  1XWK A;  2L6D A;  2VL2 C;  3UBK A;  4KND A;  1B4Q A;  3TJG A;  4MF5 A;  5DAK B;  1X9M B;  3EVI A;  2DIY A;  3F4S A;  5DDL A;  2WJU A;  2VCZ A;  1O81 A;  1RQM A;  4PUR A;  4WF5 A;  5F0G A;  2YWN A;  2DJJ A;  3QPM A;  2YJH A;  1FW1 A;  1X0R A;  1EOH A;  4PQI A;  6GST A;  2CVB A;  1KNG A;  1PSQ A;  1Q4J A;  5HR1 A;  2H8L A;  3RDW A;  1EP7 A;  2E2G A;  4K6X A;  1EWX A;  4WR5 A;  4POM A;  5KN2 A;  2YCD A;  4KE3 A;  1R5A A;  2HRN A;  1EGR A;  3VUR A;  3LXZ A;  1MTC A;  2R6K A;  4TRX A;  1YQ1 A;  4KA0 A;  4ISD A;  3FK8 A;  3IRA A;  1OVN A;  1FVK A;  3DYR A;  1Z7R A;  1OC9 A;  2R0P A;  2JSY A;  4V1A p;  3SWL A;  3L78 A;  3D22 A;  1TP9 A;  1VRS D;  3ZIJ A;  2OE3 A;  4K0G A;  3J7Y b;  2GSS A;  18GS A;  2CV4 A;  4MJE A;  1AQX A;  3U5R E;  1B4P A;  1GTB A;  1A0F A;  3GKM A;  3N9J A;  3F0I A;  2YZU A;  5JWR B;  4TXO B;  3LSZ A;  5J41 A;  2TIR A;  2VUP A;  1DE2 A;  5IM9 A;  3TKS A;  4JR4 A;  2P5Q A;  2K6V A;  2GLR A;  2FNO A;  3FHK A;  4MF7 A;  3FZ4 A;  3KMO A;  3C8E A;  4PX1 A;  2NDO A;  2X99 A;  4OMV A;  1DSB A;  1CQH A;  4ML6 A;  3G9B A;  3DIE A;  4TR1 B;  5INY A;  2AJQ B;  4NPB A;  4I2T A;  4N0V A;  1A0R P;  5J9B A;  4HDE A;  1ZYN A;  1SL2 B;  1TRV A;  2WGR A;  6GSS A;  4DVC A;  4EDY A;  4K7O A;  1TI1 A;  4WF4 A;  2PU9 C;  2I9H A;  3UMA A;  5LNK e;  1BAY A;  1JZR A;  2O7K A;  2K9F A;  4K0N A;  1E2Y A;  2QGV A;  4WEY A;  4X0X A;  3O6T A;  1GLQ A;  4NMU A;  3O3T A;  3GFK A;  4HQS A;  3L4N A;  3DEX A;  3ERW A;  1H4O A;  4ZL8 A;  1TOF A;  20GS A;  1TJD A;  1SK1 A;  2DSA A;  2H6Y A;  4POK A;  2BTO T;  3US3 A;  4MH3 A;  3ME7 A;  2OE1 A;  5IIZ A;  3UEM A;  2I1U A;  5KN0 A;  4N0Z A;  4XS6 A;  2L59 A;  3BCI A;  1ERV A;  1SK0 A;  1ZYP A;  4MZC A;  5CRE A;  3TRX A;  1TRS A;  4ZBD A;  4YQM A;  1YEP A;  3GKK A;  5EY6 A;  5G30 A;  3I6A A;  3GSS A;  2JAD A;  3C1R A;  1F6M C;  4J57 E;  1A24 A;  5E4W A;  4KSM A;  3IC4 A;  4G0L A;  2AAW A;  3M3M A;  1Z9H A;  4ZB9 A;  3HZ8 A;  1QXH A;  3KP9 A;  3A2W A;  4OCF A;  2ES7 A;  2R0G A;  4NWY A;  5AN1 A;  3UVT A;  2C0D A;  2OA7 A;  1MDI A;  5F8B A;  3KEB A;  1X5E A;  4YH2 A;  2H76 A;  3WGX A;  4CW9 A;  3IR4 A;  3ZIT A;  1B9X C;  1EOG A;  3W8J A;  2CAI A;  1S3C A;  2VCX A;  2JZS A;  3HXS A;  5GSS A;  2GSR A;  3FZ9 A;  4HZ2 A;  3GH6 A;  2KLX A;  3MYD A;  5CYY A;  4EL1 A;  5HR2 A;  5J3R A;  1BX9 A;  2HYX A;  3QFA C;  3NZN A;  5D73 A;  1GSF A;  2CVD A;  4USS A;  4QL7 A;  5ECO B;  4JBB A;  2RM5 A;  4K1F A;  2YAN A;  5LD0 A;  3QR6 A;  4MA9 A;  1OE7 A;  1SYR A;  2IL3 A;  4ECI A;  5J5N A;  2YJ7 A;  4XTS A;  4MP4 A;  4K8M A;  3E0U A;  3GL3 A;  5LCZ A;  1SKS B;  3CBU A;  1H75 A;  4HU9 A;  2LNT A;  3MAK A;  3LYP A;  5G5E A;  2LRT A;  5GST A;  3A5I A;  4K2D A;  3ZFB A;  1PD2 1;  1VF4 A;  2N5A A;  4HQZ A;  2P0G A;  5DAL B;  3W8S A;  2JU5 A;  4G19 A;  1K0M A;  5JCG A;  4HUA A;  1BED A;  4IVF A;  5GAP D;  2HI7 A;  2AB6 A;  4MPF A;  2F51 A;  4YKF A;  4E8E A;  3FEU A;  1PX6 A;  2X49 A;  1F3B A;  2CZ2 A;  3HVS A;  3R2Q A;  4OFN A;  3P90 A;  1GSY A;  1QFN A;  4G0I A;  16GS A;  4O5Q A;  2B1K A;  5HR3 A;  2C3Q A;  4NAX A;  1T3B A;  3ZML A;  3R3E A;  5IO0 A;  5KN3 A;  2H1D A;  2WDU A;  1GL8 A;  4GQC A;  4XRA A;  1AUC A;  2IMK A;  4EUY A;  1K0B A;  3MSZ A;  2XPE A;  2CX3 A;  4EE0 A;  3GTU B;  5L71 A;  1PA3 A;  1IYH A;  1V9W A;  1N8J A;  17GS A;  3BCK A;  5B7C A;  2OKA A;  4Z2T A;  1JLV A;  1VF2 A;  4G10 A;  3IHG A;  3JCM L;  3TOU A;  4IKH A;  3N5O A;  2A2P A;  3BBY A;  3NIV A;  4F82 A;  2RUE A;  4OWY A;  3PIN A;  1THX A;  2XBI A;  1KTE A;  1JZO A;  3APQ A;  2LNS A;  4GCI A;  1XWG A;  3GIX A;  1I5G A;  2X8C A;  2YP6 A;  2OAD A;  3IK7 A;  4GST A;  1W89 A;  5ECK B;  2F8A A;  2IFQ B;  4WET A;  4ILF A;  1WRY A;  1XWC A;  4PXO A;  1V58 A;  4TN8 A;  5DJL A;  4Z2U A;  5ABR A;  1M9B A;  3D4M A;  1FOV A;  1OKD A;  2P31 A;  2A2R A;  3DWV A;  1GLP A;  4TVE A;  3TCO A;  4L8E A;  4K7N A;  2I3Y A;  5D93 A;  3VWW A;  2KOK A;  6GSW A;  3IAM 2;  2XPD A;  1G6W A;  1O85 A;  2L4Q A;  4XS4 A;  3FZ5 A;  3VI5 A;  1NHO A;  3A2V A;  1AQV A;  2B7K A;  1T4Z A;  2VD1 A;  4RI7 A;  3TRQ A;  3CTG A;  2C3N A;  1HQO A;  2L4C A;  4ID0 A;  2YWI A;  1MD3 A;  1ST9 A;  5IOX A;  3MDK A;  4TKY A;  1C72 A;  3LWA A;  3Q18 A;  4XHM A;  3D4T A;  3QAV A;  2PWJ A;  1G6Y A;  3LW9 A;  5IMA A;  4ZIL A;  4NV2 A;  3ZL5 A;  5A4W A;  2MBT A;  4EVM A;  3ZLP A;  1TU8 A;  2PBJ A;  2GT6 A;  5CRG A;  1U3I A;  2GSQ A;  3F4R A;  3NOF A;  3EC3 A;  2L57 A;  5CNW A;  2HSM A;  2I4A A;  5AGY A;  1SL1 B;  3DVW A;  1YKA A;  5KEJ A;  1BQ7 A;  1R4W A;  3C71 A;  2H71 A;  2JL4 A;  2LV3 A;  4QL9 A;  2GQK A;  5GAN D;  3GL5 A;  1PKZ A;  4A5P A;  4DSQ A;  1R26 A;  2LS5 A;  2B6M A;  1YY7 A;  3CSI A;  3HHV A;  1GSD A;  3QAG A;  4XRD A;  1WP0 A;  2EC4 A;  2CX4 A;  3L9V A;  1N2A A;  4YQV A;  4GQF A;  3MNG A;  4BVY A;  2FHE A;  2J23 A;  1XW9 A;  1Z3E A;  1FG4 A;  3E3E A;  5ECH B;  4EKZ A;  3DXB A;  4DSS A;  2MZC A;  3ZMK A;  2QSI A;  2YWO A;  1KEB A;  2KHP A;  2X8G A;  4MZB A;  2MMN A;  2YNX A;  1ERW A;  2C8U A;  2FA4 A;  5F06 A;  1YDK A;  1J9B A;  4WKW A;  2MMA A;  1F9M A;  2ZNM A;  1GSQ A;  1M2D A;  2WZ9 A;  1A2J A;  3DKS A;  1XZO A;  2O89 A;  1EP8 A;  1ZYE A;  4ZXG A;  2TRC P;  4I97 A;  3HJM A;  2HSH A;  1M2B A;  3KP8 A;  2B1L A;  1ZOF A;  2K18 A;  4JRR A;  1QK8 A;  5IQY A;  1JZW A;  1GUL A;  3G7Y A;  4KF9 A;  4O32 A;  1M0U A;  1LJR A;  2HZF A;  1YEX A;  1M9A A;  3I9V 2;  3ED3 A;  5BMU A;  5JCW A;  3TKS C;  1WPI A;  2K8V A;  4O7H A;  4TR0 A;  2OAC A;  4AGS A;  5ECP B;  5A5K A;  3UAR A;  3IXR A;  1NM3 A;  4NXI A;  1CQG A;  4BL7 A;  4I8B A;  4J56 E;  2L6C A;  2V6K A;  3GUS A;  2HZE B;  2IIY A;  2RM6 A;  1QQ2 A;  1LBK A;  2D2Z A;  4OFM A;  4IQ1 A;  2O8V B;  3TJK A;  4POB A;  1XW5 A;  3L9S A;  2PN8 A;  3HJO A;  1WJK A;  4IJ3 A;  2E2M A;  3QAW A;  1OKT A;  5IMD A;  3UIW A;  6GSX A;  2TRX A;  3EWL A;  3ZVJ D;  14GS A;  2HSY A;  4FIW A;  1M2A A;  4YAP A;  3W6G A;  2LJR A;  5ELG A;  4GTU A;  4MK3 A;  4P3Y B;  1KBN A;  5HQP A;  4XS1 A;  4MH2 A;  5AIV A;  5J4U A;  2GTU A;  2HLS A;  3HYP A;  1NSW A;  2XC2 A;  2L5L A;  3L9U A;  1PRX A;  2J9H A;  5D96 A;  1O73 A;  1MDK A;  4F03 A;  1GTU A;  3LOR A;  2QA1 A;  3KTL A;  1ZCP A;  2B5E A;  1FB6 A;  3UJ1 A;  4L0W A;  3GX0 A;  4FQU A;  2CZ3 A;  4N10 A;  1VGL A;  1TK8 B;  3UVH A;  1XPV A;  3AY8 A;  2GS3 A;  5DAK A;  1Z5Y E;  4F0B A;  5HFI A;  1T1V A;  2LQO A;  2LKU A;  1X5D A;  1OAZ A;  3P7X A;  3GX8 A;  3WGE A;  4LA1 A;  4TOP A;  2LJA A;  2LJK A;  1DBY A;  1K0O A;  3BD2 A;  4OO5 A;  1A23 A;  3APS A;  4MLY A;  2LTK A;  1V2A A;  4X4J A;  1UC7 A;  4BVX A;  2N5B A;  1GP1 A;  1TK5 B;  1FAA A;  2IMD A;  2PER A;  3TOT A;  5EL8 A;  4Q5Q A;  3TJJ A;  5CO3 A;  4LL1 B;  4HS1 A;  1VF1 A;  4Z7X A;  1O8W A;  5F05 A;  1TXX A;  4KSO A;  2VCW A;  1K0C A;  5DJM A;  4IN0 A;  1S3D A;  4NHW A;  7GSS A;  4AJ8 A;  2MBS A;  5IMF A;  2VCV A;  4WBJ A;  3H1N A;  4IS0 A;  1YKC A;  3F8U A;  1O8X A;  2RLI A;  4MMM A;  3ZZX A;  2MMZ A;  1GUK A;  2X4A A;  5D8I A;  4ICY A;  5IMC A;  4TXO A;  1Z7P A;  1K3Y A;  3DGQ A;  4DSR A;  2VOC A;  3J7Y k;  2VLT A;  5HR0 A;  2C0E A;  2FWF A;  3ISO A;  5JWO B;  1X9W B;  5ID2 B;  5KN1 A;  4PNF A;  3FR6 A;  3A5W A;  2C0G A;  1JZD A;  2VLV A;  4GSN A;  2C3T A;  3VK9 A;  4Q5F A;  1XOB A;  5CRD A;  3RBT A;  1QGV A;  3LGC A;  1HNA A;  3RPN A;  4TR1 A;  4EXJ A;  4MNN A;  2V41 A;  4OFT A;  1JHB A;  2DKI A;  1V57 A;  10GS A;  2FUG 2;  2IWT A;  2DKH A;  2FWG A;  2DBC A;  1SJZ A;  3HA9 A;  3IPZ A;  3ZVJ A;  2C1Y A;  2FGX A;  3ZRE A;  9GSS A;  5FT3 A;  4K7I A;  3KH9 A;  3HD5 A;  3KCM A;  1YZX A;  2K8S A;  4EDZ A;  1ZGN A;  4IW9 A;  4ECC A;  2VCT A;  2REM A;  2V32 A;  3FKF A;  1GSE A;  4IHU A;  3ERF A;  1JFU A;  4O92 A;  1XOA A;  4KDU A;  3TKR A;  1R5P A;  3GST A;  3Q6O A;  2IJY A;  2QC7 A;  4V2L A;  2GQM A;  3CYN A;  1PN9 A;  1XFL A;  3GA4 A;  2IME A;  3CSH A;  4ZBA A;  4E8H A;  3D5J A;  3GKN A;  2HT9 A;  1ILO A;  2Z9S A;  5ECS A;  4POL A;  3I69 A;  4D73 B;  3PR8 A;  1T8E B;  1VF3 A;  2H6Z A;  5ECL B;  1EZK A;  5B6M A;  4TW5 A;  4IP1 A;  5DQS A;  1GUH A;  2JSZ A;  1Z6M A;  3QCP A;  1XW6 A;  1U87 A;  3F6F A;  3SBC A;  3FR9 A;  3TRP A;  3E9J B;  3KTB A;  4O5U A;  5A4U A;  2MMO A;  2UZ8 A;  4MDC A;  1SU9 A;  4CHS A;  2E0Q A;  4YAV A;  1J0F A;  1X5C A;  1PGT A;  2R37 A;  5AIX A;  4CY6 A;  1WWJ A;  4YKG A;  5H5R A;  3FMW A;  1AAZ A;  2AV4 A;  4ZB8 A;  4HJM A;  4X1U A;  3C73 A;  4KW6 A;  4BVY B;  4CDO A;  4ACS A;  2H73 A;  4HZ4 A;  2FD3 A;  3GH9 A;  3CSJ A;  4DSS B;  5B8A A;  2H19 A;  1EEM A;  2BMX A;  5EVO A;  5IO2 A;  3S9F A;  2YPM A;  1GRX A;  2YWM A;  2GT5 A;  3F4T A;  4KB3 A;  5D9W A;  3GHA A;  3EUR A;  3FYG A;  1GSU A;  1SJ6 A;  3EMP A;  2QKE A;  3UAP A;  2RII A;  4JE1 A;  1YJ6 A;  4EO3 A;  1GWC A;  4HOJ A;  3DVX A;  5G31 A;  4GSS A;  1SL0 B;  2WS2 A;  1UVZ A;  4IGJ A;  2VIM A;  1SD9 A;  4GRF A;  1U6T A;  2LRN A;  4PUA A;  4GLT A;  2ZUP A;  2H72 A;  3EMX A;  1ZZY A;  5IPG A;  1MDJ A;  4WXT A;  3F63 A;  2ALB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...