4TKYA

The complex structure of e. coli dsba bound to a peptide at the dsba/dsbb interface
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
b'AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Peptide Inhibitors of the Escherichia coli DsbA Oxidative Machinery Essential for Bacterial Virulence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/peptide inhibitor
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tkyA00
5D96A 2H1BA 3VLNA 2DSAA 2VO4A 2CQ9A 1XWGA 1G6YA 1WIKA 3UBLA 3GX0A 2TRXA 4PQIA 2GZYA 3HDCA 3F3QA 3TOTA 5C04A 2QSIA 3U6VA 3GKNA 1T00A 1TTZA 4ZBBA 3TDGA 3WGXA 2NDOA 2CZ3A 2LSTA 1ON4A 5JWRB 5ECPB 3DWVA 4KDXA 5DDLA 3V1WA 1TK0B 3WGEA 3HY2A 1JZOA 1O85A 1F2EA 4RI7A 4POBA 2HE3A 1F3BA 3EURA 1A24A 3VI5A 3GTUB 4ECJA 3A3TA 5ECLB 2K8SA 2HZEB 3C8EA 2JU5A 3GNJA 5KN0A 2E7PA 1MDKA 1R4WA 4F2IA 5CRDA 2MMNA 4PNGA 1U3AA 3LXTA 1YKAA 4OFTA 4AJ7A 4PURA 3CYNA 2BTOT 3JCML 3GUSA 4MZBA 1MD4A 1TK5B 2XBIA 3G7IA 5IMFA 1B48A 3BOAA 2TIRA 1V9WA 2PN8A 3GN3A 1LJRA 1YKCA 2VL3A 2H74A 4JBBA 2CA8A 4LA1A 3LG6A 3DD3A 9GSSA 4TR0A 4NMUA 3W8SA 4DSRA 5ELGA 4POLA 2H73A 3N5OA 5DQYA 4LLRA 5EPFA 1O81A 3H4KA 3TRXA 1BX9A 4EO3A 5IIZA 3H8QA 5D9XA 3TJJA 1B9YC 3TCOA 3D22A 2NBSA 1F9MA 4AJ6A 2P0GA 4WF5A 1S3AA 1XW9A 1OC9B 4I2TA 1ZL9A 5E4WA 3VWWA 2GSQA 3H93A 2H71A 3CBUA 5HFKA 3APSA 1TKDB 1PRXA 1MD3A 3GV1A 3FHKA 3L9VA 3E0UA 1KTEA 4GXZA 4WETA 1XOBA 1VRSD 3ZITA 2G0FA 2FWEA 2M80A 2VLUA 3HVSA 3GMFA 3GH9A 2LJRA 4IBPA 4PUFC 3O6TA 1SL1B 1VGLA 5ECNB 1PMTA 3FYGA 2OE0A 1MEKA 3P8WA 2OE3A 2E2MA 1SL2B 3LQ7A 3GFKA 4XS1A 2GSTA 2YZHA 4PQHA 3C1SA 3VWVA 3ZTLA 3TUEA 2LJAA 2GZPA 4D73A 3EMPA 1K0BA 1PX6A 5AISA 4IQAA 4MA9A 1HQOA 1JZRA 3RDWA 2CZ2A 2YWOA 4XRAA 3IAS2 1MDIA 3EC3A 2K18A 3A2XA 4ZIJA 3IK7A 2H0GA 3F6DA 2HI7A 2LNTA 3KM6A 3QAGA 2CVDA 3TKSA 1AQWA 5B8BA 3FR9A 2VCWA 6GSXA 4EE0A 2JACA 4TOPA 1XWCA 1S3DA 1OKDA 2YJHA 3FZ9A 1X9SB 2Z9SA 3VURA 3CSJA 2DJ3A 2L6CA 2EIOA 2J9HA 2HRFA 3DRNA 1GTBA 3G7YA 1M9AA 3HD5A 3HYPA 4OCEA 1GTAA 3W6GA 2I81A 4HJ2A 2C1YA 1T4ZA 4BL7A 4MZWA 4ML6A 3RHCA 4RI6A 1SKWB 5B6MA 2P31A 4KGIA 4HEA2 4TR1B 3CSHA 2HT9A 1O73A 4NHWA 2GSSA 2WFCA 4ZB6A 1K0DA 3GTUA 2FCHA 2PUKC 2XBQA 2HZEA 2C80A 3WT1A 4X43A 4ECIA 1NHYA 3WT2A 3KD0A 1A2JA 4KUNA 1GNWA 5EY6A 1R7HA 1FO5A 2DIYA 1EZKA 4TKYA 3TOUA 1T4YA 1N2AA 4V1Ap 1IYHA 4OO4A 1U88A 1F6MC 1TRVA 1SJ6A 2DC5A 1AQXA 4HJMA 3F4TA 3HZ8A 3ZFBA 12GSA 3D4TA 2H01A 3F3RA 2HFDA 3I9V2 4MK3A 5IQYA 2VIMA 1TU7A 2IFQA 4OO5A 2AAWA 1RW1A 5KEJA 1OC8A 3KMOA 1GRXA 1HNAA 2HRNA 1PN9A 2GLRA 1YDKA 3K8NA 3EU3A 1KBNA 1A2MA 1R5PA 1OYJA 4EF0A 3UEMA 4H86A 1ERWA 5KN3A 2WJUA 5IO2A 2H66A 1QMVA 1EOHA 4Q5QA 2MMZA 5JWOB 5IPHA 3IA1A 4OCFA 1Z7RA 1BQ7A 1TJDA 2H1DA 2H6ZA 2WDUA 2YOIA 4GF0A 1GSDA 1JFUA 1VF4A 1FB0A 1UN2A 1YEPA 1TP9A 4YH2A 2RIIA 1SYXA 1X0RA 2F51A 3GH6A 1ZYEA 3IRAA 4EVMA 3UBKA 1FB6A 2N5FA 3BJ5A 3QR6A 4JU5A 2LRTA 3M9KA 2R3XA 4K1FA 1RQMA 1BEDA 5IM9A 3M3MA 5HR0A 2VCTA 5FHIA 3I69A 3KH9A 4EDYA 3Q74A 3M8NA 3KH7A 19GSA 4GQCA 1M2DA 1K3LA 2QKEA 3IR4A 3ZREA 3IDVA 3APQA 4K2DA 3D21A 2R2JA 4F03A 2AB6A 4LL1B 2X8GA 3J7Yb 2MYGA 2ALBA 3TGZA 5CNWA 4GRFA 1XWAA 2I3YA 1Q98A 1GSUA 3ERWA 2YV7A 4GSTA 2LTKA 3J7Yk 5HQPA 4I97A 4TXOB 3Q6OA 2GZZA 3EYTA 4HUAA 1O6JA 4TW5A 1VF2A 5CRGA 4NAXA 5C00A 2X64A 2ES7A 4IQ1A 2HYXA 1GUKA 4OMVA 4MCUA 2DIZA 2GQKA 3F9UA 3OR5A 3UJ1A 3MSZA 2VCZA 3ZFLA 4KX4A 2JZRA 4L0UA 3TRPA 1URMA 2C0GA 1K0OA 2CVBA 5HR1A 4AJ8A 1XXUA 3FZ4A 3LGCA 1ZGNA 5G5EA 2HSYA 3KTLA 5DVBA 3VPTA 1U3IA 3FK8A 3WD6A 2MBTA 1TRUA 1PSQA 1DSBA 4WF4A 3SBCA 1T3BA 4DEJA 3TRQA 3FW2A 1X9MB 3KIJA 4Z7XA 1QK8A 3FRCA 1I5GA 3FY7A 2D2ZA 2FHEA 1U6TA 2GTUA 1OC3A 4DSSB 1GSEA 3HVXA 3IXRA 3GKXA 1RK4A 4K7IA 4WR4A 8GSSA 5AIXA 2YWMA 4MF6A 2PWJA 3UARA 1FW1A 2O85A 2XPDA 2YPMA 3QPMA 2GDRA 4YQVA 3ZVJD 2REMA 5HFGA 2J23A 5CREA 4Q5RA 1THOA 2LRNA 2I4AA 6GSVA 4MF5A 2HSHA 1AIUA 1PL2A 5DALA 5F0GA 3GIXA 4IN0A 4XIHA 3D4MA 3UOMA 2GQMA 1H4OA 4ZL7A 2OE1A 2QC7A 1PL1A 5JCGA 5DBQA 1OE7A 4F0BA 3HCZA 5G31A 1XVWA 3L0HA 3VWXA 1FVJA 1F37A 5F8BA 2N5BA 1W4VA 1TW9A 2NTOA 3PH9A 5G30A 1JZDA 4MF7A 1AXDA 1GSFA 4MMMA 2GVPA 1GULA 1YQ1A 3PR8A 1Z6NA 4NPBA 1JLWA 3DXBA 2GS3A 4L5OA 1QUWA 2YZUA 5GAPD 1QXHA 2MMOA 2R6KA 2YANA 2PBJA 2DMMA 3CMIA 4TRXA 1K0AA 2ZNMA 1TDIA 1ERUA 4IHUA 1Q4JA 4HQSA 2RLIA 2DMLA 1J08A 1XVQA 2IJYA 5GAND 1IYIA 2EIQA 2E0QA 4EDZA 1YZXA 3VWUA 1YY7A 1A0RP 2JZSA 2V2GA 3L9SA 1ERTA 2DJ2A 5LCZA 4X1UA 3GRXA 2LEGA 4O7HA 4BPYA 2BJXA 3F4RA 3EE2A 2YJ7A 1MDJA 4NV2A 3GL3A 3TJGA 1YF1A 22GSA 14GSA 4MZCA 5EVOA 5IOWA 5J9CA 2TRCP 3MNGA 3GX8A 4K0NA 5IOXA 2IMFA 4JR6A 3DGQA 3VI7A 1BAYA 2VM2A 2F8FA 5ELAA 5ECSA 2IMDA 1ZOFA 1XW6A 2HNLA 2H8LA 2V6KA 4K7NA 1KNGA 1GSQA 2EIRA 1OVNA 3GA4A 5L71A 1GUHA 4HU9A 1XBSA 2H6XA 1EP8A 2K6VA 1TRSA 2O8VB 4HU7A 2A2RA 4FO5A 2FLSA 2G2QA 3C1RA 5D9TA 2FA8A 3LORA 1ML6A 1GL8A 1NW2A 1WOUA 1PQNA 3P90A 1NSWA 5F06A 3LSZA 3IBHA 5DJMA 2IMEA 4JEDA 5DCHA 5DCGA 4JR4A 2H76A 1GP1A 1AQVA 4OFNA 5J5NA 3HA9A 1R26A 1K0MA 4KA0A 2HLSA 4XS6A 2RM6A 4IP6A 4JRRA 2C0FA 4GLTA 2LV3A 4XHMA 1K3YA 4IS0A 2K8VA 4PQ1A 2F8AA 4PGTA 3TJBA 4AGSA 2YV9A 4ZBDA 4DSSA 1GTUA 4J56E 2PERA 13GSA 2B6MA 3QOUA 3ME8A 4HDEA 3D0ZA 4O5RA 1B4QA 5G5FA 3DYRA 2MBSA 1PA3A 2LQOA 2JSYA 3RBTA 5H5QA 3DVXA 2JSZA 1ZZYA 2X8CA 1HD2A 5DQSA 2OADA 2WB9A 2JADA 5D93A 3GHAA 2B3SA 3QMXA 1G7OA 1XZOA 3FZAA 1A2LA 3A2VA 1ZYQB 16GSA 4ZBAA 1A0FA 3H1NA 5JCUA 4N11A 2FWFA 3KP8A 3FR6A 4ZB8A 4G2EA 1SD8A 4TXVA 2WS2A 3EWLA 4ZL8A 2JL4A 2B7JA 3UIWA 1PX7A 1ERVA 4K0GA 5J3RA 3CTFA 4BWQA 2C0DA 2M46A 4V2MA 5IPGA 3QAVA 4HOJA 2VOCA 2XHFA 4MJEA 3KCMA 4GWRA 4POMA 1FHEA 2CAIA 4FYBA 1LBKA 5HFIA 4TR4A 3TJFA 3ED3A 2V6OA 4GCIA 2GGTA 2YWIA 2VD0A 2N5AA 4PUAA 2NVLA 3UVHA 2B1KA 1K0NA 1SK0A 3TKSE 2R4VA 5A5KA 1OC9A 4OWYA 2V41A 2VM1A 2ON5A 4RQRA 4PX1A 2VCQA 2PU9C 4QL9A 1GLQA 4J57E 4BA7A 2RM5A 2DJKA 3WYWA 3DIEA 2VUPA 5B6NA 2AUVA 1HNBA 3C71A 1VF1A 3CRTA 1W89A 3HJOA 4RUVA 1V57A 1HYUA 2P5RA 3IAM2 4E8HA 3R2QA 5IMAA 3RPPA 4MJCA 5JWQB 4KW6A 1ZMAA 2LUSA 1FG4A 4K6XA 2CAQA 1XW5A 3G7JA 3NZNA 1EEMA 4G19A 6GSSA 1XCCA 2R37A 3RHBA 3KEBA 4K8MA 3DVWA 2L4QA 2FY6A 5LNKe 1M2BA 1X5EA 2PVQA 2CVKA 2OJLA 2LJKA 20GSA 3HHVA 4CDOA 3FZ5A 3DKSA 4K9ZA 3KGKA 4PNFA 5DJLA 4F0CA 3QFBC 3NIVA 4NXIA 3E3EA 2L59A 3F8UA 2C4JA 4FYUA 4N30A 2P5QA 3L9UA 2H19A 2RUEA 2H0IA 4V2NA 1BYEA 4L0WA 4LMVA 5A4WA 1OAZA 3TKRA 3F0IA 1XOAA 2L6DA 2B7KA 1E6BA 1UC7A 2DLXA 3KP9A 1WE0A 1WP0A 4X0XA 4ULXA 4WBRD 5ECKB 1M0UA 3GURA 2FNOA 2KP2A 4GSNA 2AYTA 3NOFA 2MZCA 3A5WA 2AHEA 2LRCA 5ENUA 1EGRA 2ON7A 3DMLA 3BCIA 2PVOC 3BBYA 4MH2A 3MWHA 4WXTA 4RQXA 5CO3A 4EL1A 4IGJA 2WULA 5EL8A 5GSSA 3Q19A 4YAPA 2ZCTA 2YN1A 1WMJA 4KAEA 2QGVA 2WRTA 3UAPA 2AJQB 4TR1A 5G2ZA 4KE3A 4POKA 3CXGA 2FWHA 4WR5A 3EMXA 2I1UA 3TKQA 2F9SA 1JHBA 5ID2B 2I9HA 1FOVA 4O92A 1SKRB 4FYCA 2WZ9A 2VL2C 4D73B 2NPBA 3GKKA 1B8XA 4E8EA 3IPZA 3RPNA 2LQQA 2C0EA 2LS5A 3UMAA 2PMTA 2CT6A 1EP7A 1TOFA 1G6WA 1T7PB 2HZFA 4KSOA 3D6IA 3F63A 3IOSA 2X99A 2LKUA 1WRYA 3HVVA 1ACVA 1FAAA 4XS4B 4L8EA 1KEBA 2PPTA 4ISDA 1ABAA 2GT6A 4I8BA 1DE1A 4NWYA 4F9ZA 2VLTA 1V58A 1F3AA 3GSSA 4ZXGA 3TB2A 5ECIB 1X9WB 1SD9A 2H1AA 1NHOA 2CX4A 4EKZA 2VL9A 1XIYA 3U5RE 4ML1A 1Z7PA 4KDUA 4KDYA 4YAVA 1SK2A 3IC4A 3APOA 2H1GA 1OE8A 2E2GA 4Q5FA 4Q5NA 1PKWA 4JE1A 4KCEA 5KN1A 3ZVJA 3HJPA 5HR3A 17GSA 2C8UA 3KZQA 2M72A 1AUCA 3HZ4A 4ACSA 5B7CA 1GWCA 3FR3A 3LFLA 4K7OA 4ZILA 3L4NA 3PGTA 2HXKA 1AC1A 1Y6EA 3ME7A 1SU9A 3F6FA 5J9BA 3EINA 3BD2A 3O3TA 5FWGA 1I9DA 2X8HA 1O7UA 2ZUPA 4MJAA 4GSSA 11GSA 3G9BA 4IELA 2DJ0A 1T8EB 4GQFA 2V1MA 3IK9A 1C72A 2IN3A 3EU4A 1HNCA 1EEJA 5GZZB 1O8XA 1R5AA 4IKHA 2H6YA 2V32A 3P2AA 5COHA 2DBCA 5A4UA 4ZB9A 1OKTA 2IFQB 3MAKA 1WWJA 3C73A 4MDCA 1U87A 1QQ2A 1VF3A 5D9WA 3S9FA 2OKAA 4MJBA 5DAKB 1AAZA 1K3OA 1GH2A 3ERFA 3ZIJA 5AN1A 2GSRA 1SK1A 3ZIVA 1GLPA 1E2YA 4I6XA 3IV4A 4HZ2A 2OA7A 1Y25A 6GSTA 1DUGA 4TXOA 5ECRB 4ECCA 1TI3A 1XWKA 6GSWA 5IO0A 2R5GA 3HKRA 4HI7A 4BVXA 3TKPA 4EUYA 3MDKA 5ECQB 1H75A 5IMZA 1CQHA 1PD21 5LD0A 4HQZA 4G10A 1A8LA 4TR3A 2L4CA 1M7TA 2VLVA 1G0TA 4N10A 2VCVA 4MABA 1M9BA 3ZMKA 4OFMA 1TXXA 5AIVA 1JLVA 5G1KA 5ID2A 1UVZA 5CAXA 3EVIA 3VPQA 3O76A 3ISOA 2MMAA 3CTGA 3PINA 1V40A 3LYPA 2YWNA 4OD7A 1S3CA 4WEYA 5E59A 4IJIA 1Z9HA 5JCWA 4J2FA 4V2LA 1J9BA 1SKSB 2H72A 4XS4A 1TRWA 1AW9A 4ID0A 2CV4A 1N8JA 3FKFA 3LXZA 1Z5YE 3KXOA 2WGRA 4N0ZA 1SJZA 2JZTA 1PGTA 1THXA 3VFIA 5J4UA 4DVCA 4XCSA 4WBJA 4LL4B 1SJIA 1GNEA 2IMKA 2LNSA 3TJKA 1EGOA 3ERGA 4HS1A 3ZLPA 2VAFA 4G9HA 1WJKA 3GYKA 2L5OA 4BWSA 1A8YA 3LJRA 2VD1A 4V1Ag 3UL3A 2C3NA 4GTUA 2KP1A 3ZRDA 3TKSC 2A2SA 2YNXA 2IPAA 3KJYA 1A23A 1YEXA 5GSTA 3RAZA 4JZQA 4KB3A 1ZCPA 1YJ6A 1FVKA 1B4PA 4KH7A 4O32A 3CSIA 4DSQA 4IW9A 1T1VA 1EOGA 4CW9A 1G7EA 5J41A 3BCKA 5F05A 4QL7A 5AGYA 4ZL9A 2B1LA 5FT3A 2OACA 4KNDA 3HXSA 1UA5A 4HZ4A 3M0FA 1X5DA 2H70A 3QCPA 2KHPA 3LWAA 5D73A 3ZL5A 3QAWA 2IMIA 5CRWA 4MPGA 3L78A 2YCDA 4CHSA 4I2UA 3W8JA 2KOKA 3ZYWA 2C3QA 2B5EA 2L57A 2FGXA 2H30A 4NHZA 3A2WA 1GUMA 1K0CA 1WPIA 3IHQA 3GL5A 1GSSA 1CQGA 2WCIA 4TN8A 2YP6A 4ILFA 3ZZXA 3QD9A 6GSUA 3CRUA 4MPFA 1Z3EA 3C7MA 3AY8A 4WKWA 1X5CA 5D9VA 5B8AA 5DAKA 2KLXA 5DALB 3E9JB 4AF2A 1TU8A 2F3MA 2GT5A 5D8IA 1SYRA 1TK8B 5INYA 5CYYA 1SL0B 4MLYA 2H0HA 4MP4A 2IIYA 3GKMA 4BVYA 3M1GA 3P7XA 1QFNA 3LYKA 5F07A 4XTSA 5KN2A 1XPVA 2DJ1A 18GSA 1PKZA 1Z6MA 1MTCA 4XRDA 1NM3A 3WGDA 4N0VA 4LMWA 5IMDA 2AV4A 2B5YA 3FEUA 2IL3A 5G1LA 1EV4A 4EC0A 4PXOA 4ECBA 4P3YB 2FA4A 5ECHB 3M9JA 2B5XA 4KSMA 2O87A 1B9XC 2RUFA 3H79A 3US3A 6GSYA 4YQUA 2A4VA 4EXJA 2OBIA 4FIWA 4FH8A 5CP1A 3VK9A 4YQMA 5IMVA 2K9FA 2OBKA 1GSYA 3I43A 5CRHA 1J0FA 3D5JA 2VL2A 1EWXA 4TVEA 4I5QA 3Q18A 1BG5A 3SWLA 3QDNA 2C3TA 1BJXA 1JZWA 2EC4A 1ST9A 4F82A 2FUG2 1EV9A 10GSA 5IMCA 4MH3A 2IWTA 2XPEA 3KTBA 5ECOB 7GSSA 1DBYA 1DE2A 2GQLA 1XFLA 2XC2A 1QGVA 3HJMA 1YF0A 3DEXA 1M2AA 2CX3A 5H5RA 2PGTA 3IE3A 3LEFA 4KCAA 2FD3A 3F4SA 3GSTA 2VCXA 4IP1A 2O89A 2DJJA 4QQ7A 1LU4A 1SENA 2KUCA 3KMNA 2L5LA 2BMXA 3QFAC 2O7KA 5ABRA 1ILOA 5HR2A 1TI1A 5A4VA 1V98A 3UVTA 3I6AA 2H75A 4NV5A 3ZMLA 1O8WA 1M99A 3N9JA 4IJ3A 1XWBA 4IVFA 5H5SA 1GTIA 5ECMB 1V2AA 4L5LA 1USBA 2FWGA
chains in the Genus database with same CATH superfamily
5D96A 2H1BA 3VLNA 2DSAA 2VO4A 2CQ9A 1XWGA 1G6YA 1WIKA 3UBLA 3GX0A 2TRXA 4PQIA 2GZYA 3HDCA 3F3QA 3TOTA 5C04A 2QSIA 3U6VA 3GKNA 1T00A 1TTZA 4ZBBA 3TDGA 4BL7B 3WGXA 2NDOA 2CZ3A 2LSTA 1ON4A 5JWRB 5ECPB 2HSMA 3DWVA 4KDXA 5DDLA 3V1WA 1TK0B 3WGEA 3HY2A 1JZOA 1O85A 1F2EA 4RI7A 4POBA 2HE3A 1F3BA 3EURA 1A24A 3VI5A 3GTUB 4ECJA 3A3TA 5ECLB 2K8SA 2HZEB 3C8EA 1M3JA 2JU5A 3GNJA 5KN0A 2E7PA 1MDKA 1R4WA 2DKIA 4F2IA 4O5UA 5CRDA 2MMNA 4PNGA 1U3AA 3LXTA 1YKAA 4OFTA 4AJ7A 4PURA 3CYNA 2BTOT 3JCML 3GUSA 4MZBA 1MD4A 4CY8A 1TK5B 2XBIA 3G7IA 5IMFA 1B48A 3BOAA 2TIRA 1V9WA 2PN8A 3GN3A 1LJRA 1YKCA 2VL3A 2H74A 4JBBA 2CA8A 4LA1A 3LG6A 3DD3A 9GSSA 4TR0A 4NMUA 3W8SA 4DSRA 5ELGA 4POLA 2H73A 3N5OA 5DQYA 4LLRA 5EPFA 1O81A 3H4KA 4O5QA 3TRXA 1BX9A 4EO3A 5IIZA 3H8QA 5D9XA 3TJJA 1B9YC 3TCOA 3D22A 2NBSA 1F9MA 4AJ6A 2P0GA 4WF5A 1S3AA 1XW9A 1OC9B 4I2TA 1ZL9A 5E4WA 3VWWA 2GSQA 3H93A 2H71A 3CBUA 5HFKA 3APSA 1TKDB 1PRXA 1MD3A 3GV1A 3FHKA 3L9VA 3E0UA 1KTEA 4GXZA 4WETA 1XOBA 1VRSD 3ZITA 2G0FA 2FWEA 2M80A 2VLUA 3HVSA 3GMFA 3GH9A 2LJRA 4IBPA 4PUFC 3O6TA 1SL1B 1VGLA 5ECNB 1PMTA 3FYGA 2OE0A 1MEKA 3P8WA 4K2XA 2OE3A 2E2MA 1SL2B 3LQ7A 3GFKA 4XS1A 2GSTA 2YZHA 4PQHA 3C1SA 3VWVA 3ZTLA 3TUEA 2LJAA 2GZPA 2X49A 4D73A 3EMPA 1K0BA 1PX6A 5AISA 2HRAA 4IQAA 4MA9A 1HQOA 1JZRA 5BRTA 3RDWA 2CZ2A 2YWOA 4XRAA 3IAS2 1MDIA 3EC3A 2K18A 3A2XA 4ZIJA 3IK7A 2H0GA 3F6DA 2HI7A 2LNTA 3KM6A 3QAGA 4ICYA 2CVDA 3TKSA 1AQWA 5B8BA 3FR9A 2VCWA 6GSXA 4EE0A 2JACA 4TOPA 1XWCA 1S3DA 1OKDA 2YJHA 3FZ9A 1X9SB 2Z9SA 3VURA 3CSJA 2DJ3A 2L6CA 2EIOA 2J9HA 2HRFA 3DRNA 1GTBA 3G7YA 1M9AA 3HD5A 3HYPA 4OCEA 1GTAA 3W6GA 2I81A 4HJ2A 2C1YA 1T4ZA 4BL7A 4MZWA 4ML6A 3RHCA 4RI6A 1SKWB 5B6MA 2P31A 4KGIA 4HEA2 4TR1B 3CSHA 2HT9A 1O73A 4NHWA 4G0KA 2GSSA 2WFCA 4ZB6A 1K0DA 3GTUA 2FCHA 2PUKC 2XBQA 2HZEA 2C80A 3WT1A 4X43A 4ECIA 1NHYA 3WT2A 3KD0A 1A2JA 4KUNA 1GNWA 5EY6A 1R7HA 1FO5A 2DIYA 1EZKA 4TKYA 3TOUA 1T4YA 1N2AA 2QA2A 4V1Ap 1IYHA 4OO4A 1U88A 1F6MC 1TRVA 1SJ6A 2DC5A 1AQXA 4HJMA 3F4TA 3HZ8A 3ZFBA 12GSA 3D4TA 2H01A 3F3RA 2HFDA 3I9V2 4MK3A 5IQYA 2VIMA 1TU7A 2IFQA 4OO5A 1M3IA 2AAWA 1RW1A 5KEJA 1OC8A 3KMOA 1GRXA 1HNAA 2HRNA 1PN9A 2GLRA 1YDKA 3K8NA 3EU3A 1KBNA 1A2MA 1R5PA 4USSA 1OYJA 4EF0A 3UEMA 4H86A 1ERWA 5KN3A 2WJUA 5IO2A 2H66A 1QMVA 1EOHA 4Q5QA 2MMZA 5JWOB 5IPHA 3IA1A 4OCFA 1Z7RA 1BQ7A 1TJDA 2H1DA 2H6ZA 2WDUA 1S3RA 2YOIA 4GF0A 1GSDA 1JFUA 1VF4A 1FB0A 1UN2A 1YEPA 1TP9A 4YH2A 2RIIA 1SYXA 1X0RA 2F51A 3GH6A 1ZYEA 3IRAA 4EVMA 3UBKA 1FB6A 3PPUA 2N5FA 3BJ5A 3QR6A 4JU5A 3MIXA 2LRTA 3M9KA 2R3XA 4K1FA 1RQMA 1BEDA 5IM9A 3M3MA 5HR0A 2VCTA 5FHIA 3I69A 3KH9A 4EDYA 3Q74A 3M8NA 3KH7A 19GSA 4GQCA 1M2DA 4YKFA 1K3LA 4CY6A 2QKEA 3IR4A 3ZREA 3IDVA 3APQA 4K2DA 3D21A 2R2JA 4F03A 2AB6A 4LL1B 2X8GA 3J7Yb 2MYGA 2ALBA 3TGZA 5CNWA 4GRFA 1XWAA 2I3YA 1Q98A 1GSUA 3ERWA 2YV7A 4GSTA 2LTKA 3J7Yk 5HQPA 4I97A 4TXOB 3Q6OA 2GZZA 3EYTA 4HUAA 1O6JA 4TW5A 1VF2A 5CRGA 4NAXA 5C00A 4BVXB 2X64A 2ES7A 5KOWA 4IQ1A 2HYXA 1GUKA 4OMVA 4MCUA 2DIZA 2GQKA 3F9UA 3OR5A 3UJ1A 3MSZA 4YKGA 2VCZA 3ZFLA 4KX4A 2JZRA 4L0UA 3TRPA 1URMA 2C0GA 1K0OA 2CVBA 5HR1A 4AJ8A 1XXUA 3FZ4A 3LGCA 1ZGNA 5G5EA 2HSYA 3KTLA 5DVBA 3VPTA 1U3IA 3FK8A 3WD6A 2MBTA 1TRUA 1PSQA 1DSBA 4WF4A 3SBCA 1T3BA 4DEJA 3TRQA 3FW2A 1X9MB 3KIJA 4Z7XA 1QK8A 3FRCA 1I5GA 3FY7A 2D2ZA 2FHEA 1U6TA 2GTUA 1OC3A 4DSSB 1GSEA 3HVXA 3IXRA 3GKXA 1RK4A 4K7IA 4WR4A 8GSSA 5AIXA 2YWMA 4MF6A 2PWJA 3UARA 1FW1A 2O85A 2XPDA 2YPMA 3QPMA 2GDRA 4YQVA 3ZVJD 2REMA 5HFGA 2J23A 5CREA 4Q5RA 1THOA 2LRNA 2I4AA 6GSVA 4MF5A 2HSHA 1AIUA 1PL2A 5DALA 5F0GA 3GIXA 4IN0A 4XIHA 3D4MA 3UOMA 2GQMA 1H4OA 4ZL7A 2OE1A 2QC7A 2UZ8A 1PL1A 5JCGA 5DBQA 1OE7A 4F0BA 3HCZA 5G31A 1XVWA 3HVNA 3L0HA 3VWXA 1FVJA 1F37A 5F8BA 2N5BA 1W4VA 1TW9A 2NTOA 3PH9A 5G30A 1JZDA 4MF7A 1AXDA 1GSFA 4MMMA 2GVPA 1GULA 1YQ1A 3PR8A 1Z6NA 4NPBA 1JLWA 3DXBA 2GS3A 4L5OA 1QUWA 2YZUA 5GAPD 1QXHA 2MMOA 2R6KA 2YANA 2PBJA 2DMMA 3CMIA 4TRXA 1K0AA 2ZNMA 1TDIA 1ERUA 4IHUA 1Q4JA 4HQSA 2RLIA 2DMLA 1J08A 1XVQA 2IJYA 5GAND 1IYIA 2EIQA 2E0QA 4EDZA 1YZXA 3VWUA 1YY7A 1A0RP 2JZSA 2V2GA 3L9SA 1ERTA 2DJ2A 5LCZA 4X1UA 3GRXA 4X4JA 2LEGA 4O7HA 4BPYA 2BJXA 3F4RA 3EE2A 2YJ7A 1MDJA 4NV2A 3GL3A 3TJGA 1YF1A 22GSA 14GSA 4MZCA 5EVOA 4FQUA 5IOWA 5J9CA 2TRCP 3MNGA 3GX8A 4K0NA 5IOXA 2IMFA 4JR6A 3DGQA 3VI7A 1BAYA 2VM2A 2F8FA 5ELAA 5ECSA 2IMDA 1ZOFA 1XW6A 2HNLA 2H8LA 2V6KA 4K7NA 1KNGA 1GSQA 2EIRA 1OVNA 3GA4A 5L71A 1GUHA 4HU9A 1XBSA 2H6XA 1EP8A 4PTSA 2K6VA 1TRSA 2O8VB 4HU7A 2A2RA 4FO5A 2FLSA 2G2QA 3C1RA 5D9TA 2FA8A 3LORA 1ML6A 1GL8A 1NW2A 1WOUA 1PQNA 3P90A 1NSWA 5F06A 3LSZA 3IBHA 5DJMA 2IMEA 4JEDA 5DCHA 5DCGA 4JR4A 2H76A 1GP1A 1AQVA 4OFNA 5J5NA 3HA9A 1R26A 1K0MA 4KA0A 2HLSA 4XS6A 2RM6A 4IP6A 4Z2UA 4JRRA 2C0FA 4GLTA 2LV3A 4XHMA 1K3YA 4IS0A 2K8VA 4PQ1A 2F8AA 4PGTA 3TJBA 4AGSA 2YV9A 4ZBDA 4DSSA 1GTUA 1PN0A 4J56E 2PERA 13GSA 2B6MA 3QOUA 3ME8A 4HDEA 3D0ZA 4O5RA 1B4QA 5G5FA 3DYRA 2MBSA 1PA3A 2LQOA 2JSYA 3RBTA 5H5QA 3DVXA 2JSZA 1ZZYA 2X8CA 1HD2A 5DQSA 2OADA 2WB9A 2JADA 5D93A 3GHAA 2B3SA 3QMXA 4G0IA 1G7OA 1XZOA 3FZAA 1A2LA 3A2VA 1ZYQB 16GSA 4ZBAA 1A0FA 3H1NA 5JCUA 4N11A 2FWFA 3KP8A 3FR6A 4ZB8A 4G2EA 1SD8A 4TXVA 2WS2A 3EWLA 4ZL8A 2JL4A 2B7JA 3UIWA 4K5RA 1PX7A 1ERVA 4K0GA 5J3RA 3CTFA 4BWQA 1XG8A 2C0DA 2M46A 4V2MA 5IPGA 3QAVA 4HOJA 2VOCA 2XHFA 4MJEA 3KCMA 4GWRA 4POMA 1FHEA 2CAIA 4FYBA 1LBKA 5HFIA 4TR4A 3TJFA 3ED3A 2V6OA 4GCIA 2GGTA 2YWIA 2VD0A 2N5AA 4PUAA 2NVLA 3UVHA 2B1KA 1K0NA 1SK0A 3TKSE 2R4VA 5A5KA 1OC9A 4OWYA 2V41A 2VM1A 2ON5A 4RQRA 4PX1A 2VCQA 2PU9C 2HRKA 1GLQA 4QL9A 4J57E 4BA7A 2RM5A 2DJKA 3WYWA 3DIEA 2VUPA 5B6NA 2AUVA 2X4AA 1HNBA 3C71A 1VF1A 3CRTA 1W89A 3HJOA 4RUVA 1V57A 1HYUA 2P5RA 3IAM2 4E8HA 3R2QA 4K5SA 5IMAA 3RPPA 4MJCA 5JWQB 4KW6A 1ZMAA 2LUSA 1FG4A 4K6XA 2CAQA 1XW5A 3G7JA 3NZNA 1EEMA 4G19A 6GSSA 1XCCA 2R37A 3RHBA 3KEBA 4K8MA 3DVWA 2L4QA 2FY6A 5LNKe 1M2BA 1X5EA 2PVQA 2CVKA 2OJLA 2LJKA 20GSA 3HHVA 1ZYPA 4CDOA 3FZ5A 3DKSA 4K9ZA 3KGKA 4PNFA 5DJLA 4F0CA 3QFBC 3NIVA 4NXIA 3E3EA 2L59A 3A5IA 3F8UA 2C4JA 4FYUA 4N30A 2P5QA 3L9UA 2H19A 2RUEA 2H0IA 4V2NA 1BYEA 4L0WA 4LMVA 5A4WA 1OAZA 3TKRA 3F0IA 1XOAA 2L6DA 2B7KA 1E6BA 1UC7A 2DLXA 3KP9A 2A4HA 1WE0A 1WP0A 4X0XA 4ULXA 4WBRD 5ECKB 1M0UA 3GURA 2FNOA 2KP2A 4GSNA 2AYTA 3NOFA 4EIQA 2MZCA 3A5WA 2AHEA 2LRCA 5ENUA 1EGRA 2ON7A 3DMLA 3BCIA 2PVOC 3BBYA 4MH2A 3MWHA 4WXTA 4RQXA 5CO3A 4EL1A 4IGJA 2WULA 5EL8A 5GSSA 3Q19A 4YAPA 2ZCTA 2YN1A 1WMJA 4KAEA 2QGVA 2WRTA 4G0LA 3UAPA 2AJQB 2R0GA 4TR1A 5G2ZA 4KE3A 3FMWA 4POKA 3CXGA 4KF9A 2A2PA 2FWHA 5BMUA 4WR5A 3EMXA 2I1UA 3TKQA 2F9SA 1JHBA 5ID2B 2I9HA 1FOVA 4O92A 1SKRB 4FYCA 2WZ9A 2VL2C 4D73B 2NPBA 3GKKA 1B8XA 4E8EA 3IPZA 3RPNA 2LQQA 2C0EA 2LS5A 3UMAA 2PMTA 2CT6A 1EP7A 1TOFA 1G6WA 1T7PB 2HZFA 4KSOA 4A5PA 4EIPA 3D6IA 3F63A 3IOSA 2X99A 2LKUA 1WRYA 3HVVA 1ACVA 4HSCX 1FAAA 4XS4B 4MNNA 4L8EA 1KEBA 2PPTA 4ISDA 1ABAA 2GT6A 4I8BA 1DE1A 4NWYA 4F9ZA 2VLTA 1V58A 1F3AA 3GSSA 4ZXGA 3TB2A 5ECIB 1X9WB 3MYDA 1SD9A 2H1AA 1NHOA 2CX4A 4EKZA 2VL9A 1XIYA 3U5RE 4ML1A 1Z7PA 4KDUA 4KDYA 4YAVA 1SK2A 3IC4A 3APOA 2H1GA 1OE8A 2E2GA 4Q5FA 4Q5NA 1PKWA 4JE1A 4KCEA 5KN1A 3ZVJA 3HJPA 5HR3A 17GSA 2C8UA 3KZQA 2M72A 1AUCA 3HZ4A 4ACSA 5B7CA 1GWCA 3FR3A 3LFLA 4K7OA 4ZILA 3L4NA 3PGTA 2HXKA 1AC1A 1Y6EA 3ME7A 1SU9A 3F6FA 5J9BA 4Z2RA 3EINA 3BD2A 3O3TA 5FWGA 1I9DA 2X8HA 1O7UA 2ZUPA 4MJAA 4GSSA 11GSA 3G9BA 4IELA 2DJ0A 1T8EB 4GQFA 2V1MA 3IK9A 1C72A 2IN3A 3EU4A 1HNCA 1EEJA 5GZZB 1O8XA 1R5AA 4IKHA 2H6YA 2V32A 2QA1A 3P2AA 5COHA 2DBCA 5A4UA 4ZB9A 1OKTA 2IFQB 3MAKA 1WWJA 3C73A 4MDCA 1U87A 1QQ2A 1VF3A 5D9WA 3S9FA 2OKAA 4MJBA 5DAKB 1AAZA 1K3OA 3IC8A 1GH2A 3ERFA 3ZIJA 5AN1A 2GSRA 1SK1A 3ZIVA 1GLPA 1E2YA 4I6XA 3IV4A 4BVYB 4HZ2A 2OA7A 1Y25A 6GSTA 1DUGA 4TXOA 5ECRB 4ECCA 1TI3A 1XWKA 6GSWA 5IO0A 2R5GA 3HKRA 4HI7A 4BVXA 3TKPA 4EUYA 5KOXA 3MDKA 5ECQB 1H75A 5IMZA 1CQHA 1PD21 5LD0A 4HQZA 4G10A 1A8LA 4TR3A 2L4CA 1M7TA 2VLVA 1G0TA 4N10A 2VCVA 4MABA 1M9BA 3ZMKA 4OFMA 1TXXA 5AIVA 1JLVA 5G1KA 5ID2A 1UVZA 5CAXA 3EVIA 3VPQA 2R0CA 3O76A 3ISOA 2MMAA 3CTGA 4Z2TA 3PINA 1V40A 3LYPA 2YWNA 4OD7A 1S3CA 4WEYA 5E59A 4IJIA 1Z9HA 5JCWA 4J2FA 4V2LA 1J9BA 1SKSB 2H72A 4XS4A 1TRWA 1AW9A 4ID0A 2CV4A 1N8JA 3FKFA 3LXZA 1Z5YE 3CQFA 3KXOA 1PFOA 2WGRA 4N0ZA 1SJZA 2JZTA 1PGTA 1THXA 3VFIA 5J4UA 4DVCA 4XCSA 4WBJA 4LL4B 1SJIA 1GNEA 2IMKA 2LNSA 3TJKA 1EGOA 3ERGA 4HS1A 3ZLPA 2VAFA 4G9HA 1WJKA 3GYKA 2L5OA 4BWSA 1A8YA 3LJRA 2VD1A 4V1Ag 3UL3A 2C3NA 4GTUA 2KP1A 3ZRDA 3TKSC 2A2SA 2YNXA 2IPAA 3KJYA 1A23A 1YEXA 5GSTA 3RAZA 4JZQA 4KB3A 1ZCPA 1YJ6A 1FVKA 1B4PA 4KH7A 4O32A 3CSIA 4DSQA 4IW9A 1T1VA 1EOGA 4CW9A 1G7EA 5J41A 3BCKA 5F05A 4QL7A 5AGYA 4ZL9A 2B1LA 5FT3A 2OACA 4KNDA 3HXSA 1UA5A 4HZ4A 3M0FA 1X5DA 2H70A 3QCPA 2KHPA 3LWAA 5D73A 3ZL5A 3QAWA 2IMIA 5CRWA 4MPGA 3L78A 2YCDA 4CHSA 4I2UA 3W8JA 2KOKA 3ZYWA 2C3QA 2B5EA 2L57A 2FGXA 2H30A 4NHZA 3A2WA 1GUMA 1K0CA 1WPIA 3IHQA 3GL5A 1GSSA 1CQGA 2WCIA 4TN8A 2YP6A 4ILFA 3ZZXA 3QD9A 6GSUA 1FOHA 3CRUA 4MPFA 1Z3EA 3C7MA 3AY8A 4WKWA 1X5CA 5D9VA 5B8AA 5DAKA 2KLXA 5DALB 3E9JB 4AF2A 1TU8A 2F3MA 2GT5A 5D8IA 1SYRA 1TK8B 5INYA 5CYYA 1SL0B 4MLYA 2H0HA 4MP4A 2IIYA 3GKMA 4BVYA 3M1GA 3P7XA 1QFNA 3LYKA 5F07A 1ZYNA 4XTSA 5KN2A 1XPVA 2DJ1A 18GSA 1PKZA 1Z6MA 1MTCA 4XRDA 1NM3A 3WGDA 4N0VA 4LMWA 5IMDA 2AV4A 2B5YA 3FEUA 2IL3A 3LW9A 5G1LA 1EV4A 4EC0A 3R3EA 4PXOA 2DKHA 4ECBA 4P3YB 2FA4A 5ECHB 3M9JA 2B5XA 4KSMA 2O87A 1B9XC 2RUFA 3H79A 3US3A 6GSYA 4YQUA 2A4VA 4EXJA 2OBIA 4FIWA 4FH8A 5CP1A 3VK9A 3EPTA 4YQMA 5IMVA 2K9FA 2OBKA 1GSYA 3I43A 5CRHA 1J0FA 3D5JA 2VL2A 1EWXA 4TVEA 4I5QA 3Q18A 1BG5A 3SWLA 3QDNA 2C3TA 1BJXA 1JZWA 2EC4A 1ST9A 4F82A 2FUG2 1EV9A 10GSA 5IMCA 4MH3A 2IWTA 2XPEA 3KTBA 5ECOB 7GSSA 1DBYA 1DE2A 2GQLA 1XFLA 2XC2A 1QGVA 3HJMA 1YF0A 3DEXA 1M2AA 2CX3A 5H5RA 2PGTA 3IE3A 3LEFA 4KCAA 2FD3A 3F4SA 3GSTA 2VCXA 4IP1A 2O89A 2DJJA 4QQ7A 1LU4A 1SENA 2KUCA 3KMNA 2L5LA 3IHGA 2BMXA 3QFAC 2O7KA 5ABRA 1ILOA 5HR2A 1TI1A 5A4VA 1V98A 3UVTA 2R0PA 3I6AA 2H75A 4NV5A 3ZMLA 1O8WA 4BIKA 1M99A 3N9JA 4IJ3A 1XWBA 4IVFA 5H5SA 1GTIA 5ECMB 1V2AA 4L5LA 1USBA 2FWGA
chains in the Genus database with same CATH topology
5D96A 2H1BA 3VLNA 2DSAA 2VO4A 2CQ9A 1XWGA 1G6YA 1WIKA 3UBLA 3GX0A 2TRXA 4PQIA 2GZYA 3HDCA 3F3QA 3TOTA 5C04A 2QSIA 3U6VA 3GKNA 1T00A 1TTZA 4ZBBA 3TDGA 4BL7B 3WGXA 2NDOA 2CZ3A 2LSTA 1ON4A 5JWRB 5ECPB 2HSMA 3DWVA 4KDXA 5DDLA 3V1WA 1TK0B 3WGEA 3HY2A 1JZOA 1O85A 1F2EA 4RI7A 4POBA 2HE3A 1F3BA 3EURA 1A24A 3VI5A 3GTUB 4ECJA 3A3TA 5ECLB 2K8SA 2HZEB 3C8EA 2JU5A 3GNJA 5KN0A 2E7PA 1MDKA 1R4WA 2DKIA 4F2IA 4O5UA 5CRDA 2MMNA 4PNGA 1U3AA 3LXTA 1YKAA 4OFTA 4AJ7A 4PURA 3CYNA 2BTOT 3JCML 3GUSA 4MZBA 1MD4A 4CY8A 1TK5B 2XBIA 3G7IA 5IMFA 1B48A 3BOAA 2TIRA 1V9WA 2PN8A 3GN3A 1LJRA 1YKCA 2VL3A 2H74A 4JBBA 2CA8A 4LA1A 3LG6A 3DD3A 9GSSA 4TR0A 4NMUA 3W8SA 4DSRA 5ELGA 4POLA 2H73A 3N5OA 5DQYA 4LLRA 5EPFA 1O81A 3H4KA 4O5QA 3TRXA 1BX9A 4EO3A 5IIZA 3H8QA 5D9XA 3TJJA 1B9YC 3TCOA 3D22A 2NBSA 1F9MA 4AJ6A 2P0GA 4WF5A 1S3AA 1XW9A 1OC9B 4I2TA 1ZL9A 5E4WA 3VWWA 2GSQA 3H93A 2H71A 3CBUA 5HFKA 3APSA 1TKDB 1PRXA 1MD3A 3GV1A 3FHKA 3L9VA 3E0UA 1KTEA 4GXZA 4WETA 1XOBA 1VRSD 3ZITA 2G0FA 2FWEA 2M80A 2VLUA 3HVSA 3GMFA 3GH9A 2LJRA 4IBPA 4PUFC 3O6TA 1SL1B 1VGLA 5ECNB 1PMTA 3FYGA 2OE0A 1MEKA 3P8WA 4K2XA 2OE3A 2E2MA 1SL2B 3LQ7A 3GFKA 4XS1A 2GSTA 2YZHA 4PQHA 3C1SA 3VWVA 3ZTLA 3TUEA 2LJAA 2GZPA 2X49A 4D73A 3EMPA 1K0BA 1PX6A 5AISA 2HRAA 4IQAA 4MA9A 1HQOA 1JZRA 5BRTA 3RDWA 2CZ2A 2YWOA 4XRAA 3IAS2 1MDIA 3EC3A 2K18A 3A2XA 4ZIJA 3IK7A 2H0GA 3F6DA 2HI7A 2LNTA 3KM6A 3QAGA 4ICYA 2CVDA 3TKSA 1AQWA 5B8BA 3FR9A 2VCWA 6GSXA 4EE0A 2JACA 4TOPA 1XWCA 1S3DA 1OKDA 2YJHA 3FZ9A 1X9SB 2Z9SA 3VURA 3CSJA 2DJ3A 2L6CA 2EIOA 2J9HA 2HRFA 3DRNA 1GTBA 3G7YA 1M9AA 3HD5A 3HYPA 4OCEA 1GTAA 3W6GA 2I81A 4HJ2A 2C1YA 1T4ZA 4BL7A 4MZWA 4ML6A 3RHCA 4RI6A 1SKWB 5B6MA 2P31A 4KGIA 4HEA2 4TR1B 3CSHA 2HT9A 1O73A 4NHWA 4G0KA 2GSSA 2WFCA 4ZB6A 1K0DA 3GTUA 2FCHA 2PUKC 2XBQA 2HZEA 2C80A 3WT1A 4X43A 4ECIA 1NHYA 3WT2A 3KD0A 1A2JA 4KUNA 1GNWA 5EY6A 1R7HA 1FO5A 2DIYA 1EZKA 4TKYA 3TOUA 1T4YA 1N2AA 2QA2A 4V1Ap 1IYHA 4OO4A 1U88A 1F6MC 1TRVA 1SJ6A 2DC5A 1AQXA 4HJMA 3F4TA 3HZ8A 3ZFBA 12GSA 3D4TA 2H01A 3F3RA 2HFDA 3I9V2 4MK3A 5IQYA 2VIMA 1TU7A 2IFQA 4OO5A 2AAWA 1RW1A 5KEJA 1OC8A 3KMOA 1GRXA 1HNAA 2HRNA 1PN9A 2GLRA 1YDKA 3K8NA 3EU3A 1KBNA 1A2MA 1R5PA 4USSA 1OYJA 4EF0A 3UEMA 4H86A 1ERWA 5KN3A 2WJUA 5IO2A 2H66A 1QMVA 1EOHA 4Q5QA 2MMZA 5JWOB 5IPHA 3IA1A 4OCFA 1Z7RA 1BQ7A 1TJDA 2H1DA 2H6ZA 2WDUA 2YOIA 4GF0A 1GSDA 1JFUA 1VF4A 1FB0A 1UN2A 1YEPA 1TP9A 4YH2A 2RIIA 1SYXA 1X0RA 2F51A 3GH6A 1ZYEA 3IRAA 4EVMA 3UBKA 1FB6A 3PPUA 2N5FA 3BJ5A 3QR6A 4JU5A 3MIXA 2LRTA 3M9KA 2R3XA 4K1FA 1RQMA 1BEDA 5IM9A 3M3MA 5HR0A 2VCTA 5FHIA 3I69A 3KH9A 4EDYA 3Q74A 3M8NA 3KH7A 19GSA 4GQCA 1M2DA 4YKFA 1K3LA 4CY6A 2QKEA 3IR4A 3ZREA 3IDVA 3APQA 4K2DA 3D21A 2R2JA 4F03A 2AB6A 4LL1B 2X8GA 3J7Yb 2MYGA 2ALBA 3TGZA 5CNWA 4GRFA 1XWAA 2I3YA 1Q98A 1GSUA 3ERWA 2YV7A 4GSTA 2LTKA 3J7Yk 5HQPA 4I97A 4TXOB 3Q6OA 2GZZA 3EYTA 4HUAA 1O6JA 4TW5A 1VF2A 5CRGA 4NAXA 5C00A 4BVXB 2X64A 2ES7A 5KOWA 4IQ1A 2HYXA 1GUKA 4OMVA 4MCUA 2DIZA 2GQKA 3F9UA 3OR5A 3UJ1A 3MSZA 4YKGA 2VCZA 3ZFLA 4KX4A 2JZRA 4L0UA 3TRPA 1URMA 2C0GA 1K0OA 2CVBA 5HR1A 4AJ8A 1XXUA 3FZ4A 3LGCA 1ZGNA 5G5EA 2HSYA 3KTLA 5DVBA 3VPTA 1U3IA 3FK8A 3WD6A 2MBTA 1TRUA 1PSQA 1DSBA 4WF4A 3SBCA 1T3BA 4DEJA 3TRQA 3FW2A 1X9MB 3KIJA 4Z7XA 1QK8A 3FRCA 1I5GA 3FY7A 2D2ZA 2FHEA 1U6TA 2GTUA 1OC3A 4DSSB 1GSEA 3HVXA 3IXRA 3GKXA 1RK4A 4K7IA 4WR4A 8GSSA 5AIXA 2YWMA 4MF6A 2PWJA 3UARA 1FW1A 2O85A 2XPDA 2YPMA 3QPMA 2GDRA 4YQVA 3ZVJD 2REMA 5HFGA 2J23A 5CREA 4Q5RA 1THOA 2LRNA 2I4AA 6GSVA 4MF5A 2HSHA 1AIUA 1PL2A 5DALA 5F0GA 3GIXA 4IN0A 4XIHA 3D4MA 3UOMA 2GQMA 1H4OA 4ZL7A 2OE1A 2QC7A 2UZ8A 1PL1A 5JCGA 5DBQA 1OE7A 4F0BA 3HCZA 5G31A 1XVWA 3L0HA 3VWXA 1FVJA 1F37A 5F8BA 2N5BA 1W4VA 1TW9A 2NTOA 3PH9A 5G30A 1JZDA 4MF7A 1AXDA 1GSFA 4MMMA 2GVPA 1GULA 1YQ1A 3PR8A 1Z6NA 4NPBA 1JLWA 3DXBA 2GS3A 4L5OA 1QUWA 2YZUA 5GAPD 1QXHA 2MMOA 2R6KA 2YANA 2PBJA 2DMMA 3CMIA 4TRXA 1K0AA 2ZNMA 1TDIA 1ERUA 4IHUA 1Q4JA 4HQSA 2RLIA 2DMLA 1J08A 1XVQA 2IJYA 5GAND 1IYIA 2EIQA 2E0QA 4EDZA 1YZXA 3VWUA 1YY7A 1A0RP 2JZSA 2V2GA 3L9SA 1ERTA 2DJ2A 5LCZA 4X1UA 3GRXA 4X4JA 2LEGA 4O7HA 4BPYA 2BJXA 3F4RA 3EE2A 2YJ7A 1MDJA 4NV2A 3GL3A 3TJGA 1YF1A 22GSA 14GSA 4MZCA 5EVOA 4FQUA 5IOWA 5J9CA 2TRCP 3MNGA 3GX8A 4K0NA 5IOXA 2IMFA 4JR6A 3DGQA 3VI7A 1BAYA 2VM2A 2F8FA 5ELAA 5ECSA 2IMDA 1ZOFA 1XW6A 2HNLA 2H8LA 2V6KA 4K7NA 1KNGA 1GSQA 2EIRA 1OVNA 3GA4A 5L71A 1GUHA 4HU9A 1XBSA 2H6XA 1EP8A 4PTSA 2K6VA 1TRSA 2O8VB 4HU7A 2A2RA 4FO5A 2FLSA 2G2QA 3C1RA 5D9TA 2FA8A 3LORA 1ML6A 1GL8A 1NW2A 1WOUA 1PQNA 3P90A 1NSWA 5F06A 3LSZA 3IBHA 5DJMA 2IMEA 4JEDA 5DCHA 5DCGA 4JR4A 2H76A 1GP1A 1AQVA 4OFNA 5J5NA 3HA9A 1R26A 1K0MA 4KA0A 2HLSA 4XS6A 2RM6A 4IP6A 4Z2UA 4JRRA 2C0FA 4GLTA 2LV3A 4XHMA 1K3YA 4IS0A 2K8VA 4PQ1A 2F8AA 4PGTA 3TJBA 4AGSA 2YV9A 4ZBDA 4DSSA 1GTUA 1PN0A 4J56E 2PERA 13GSA 2B6MA 3QOUA 3ME8A 4HDEA 3D0ZA 4O5RA 1B4QA 5G5FA 3DYRA 2MBSA 1PA3A 2LQOA 2JSYA 3RBTA 5H5QA 3DVXA 2JSZA 1ZZYA 2X8CA 1HD2A 5DQSA 2OADA 2WB9A 2JADA 5D93A 3GHAA 2B3SA 3QMXA 4G0IA 1G7OA 1XZOA 3FZAA 1A2LA 3A2VA 1ZYQB 16GSA 4ZBAA 1A0FA 3H1NA 5JCUA 4N11A 2FWFA 3KP8A 3FR6A 4ZB8A 4G2EA 1SD8A 4TXVA 2WS2A 3EWLA 4ZL8A 2JL4A 2B7JA 3UIWA 4K5RA 1PX7A 1ERVA 4K0GA 5J3RA 3CTFA 4BWQA 2C0DA 2M46A 4V2MA 5IPGA 3QAVA 4HOJA 2VOCA 2XHFA 4MJEA 3KCMA 4GWRA 4POMA 1FHEA 2CAIA 4FYBA 1LBKA 5HFIA 4TR4A 3TJFA 3ED3A 2V6OA 4GCIA 2GGTA 2YWIA 2VD0A 2N5AA 4PUAA 2NVLA 3UVHA 2B1KA 1K0NA 1SK0A 3TKSE 2R4VA 5A5KA 1OC9A 4OWYA 2V41A 2VM1A 2ON5A 4RQRA 4PX1A 2VCQA 2PU9C 2HRKA 1GLQA 4QL9A 4J57E 4BA7A 2RM5A 2DJKA 3WYWA 3DIEA 2VUPA 5B6NA 2AUVA 2X4AA 1HNBA 3C71A 1VF1A 3CRTA 1W89A 3HJOA 4RUVA 1V57A 1HYUA 2P5RA 3IAM2 4E8HA 3R2QA 4K5SA 5IMAA 3RPPA 4MJCA 5JWQB 4KW6A 1ZMAA 2LUSA 1FG4A 4K6XA 2CAQA 1XW5A 3G7JA 3NZNA 1EEMA 4G19A 6GSSA 1XCCA 2R37A 3RHBA 3KEBA 4K8MA 3DVWA 2L4QA 2FY6A 5LNKe 1M2BA 1X5EA 2PVQA 2CVKA 2OJLA 2LJKA 20GSA 3HHVA 1ZYPA 4CDOA 3FZ5A 3DKSA 4K9ZA 3KGKA 4PNFA 5DJLA 4F0CA 3QFBC 3NIVA 4NXIA 3E3EA 2L59A 3A5IA 3F8UA 2C4JA 4FYUA 4N30A 2P5QA 3L9UA 2H19A 2RUEA 2H0IA 4V2NA 1BYEA 4L0WA 4LMVA 5A4WA 1OAZA 3TKRA 3F0IA 1XOAA 2L6DA 2B7KA 1E6BA 1UC7A 2DLXA 3KP9A 2A4HA 1WE0A 1WP0A 4X0XA 4ULXA 4WBRD 5ECKB 1M0UA 3GURA 2FNOA 2KP2A 4GSNA 2AYTA 3NOFA 4EIQA 2MZCA 3A5WA 2AHEA 2LRCA 5ENUA 1EGRA 2ON7A 3DMLA 3BCIA 2PVOC 3BBYA 4MH2A 3MWHA 4WXTA 4RQXA 5CO3A 4EL1A 4IGJA 2WULA 5EL8A 5GSSA 3Q19A 4YAPA 2ZCTA 2YN1A 1WMJA 4KAEA 2QGVA 2WRTA 4G0LA 3UAPA 2AJQB 2R0GA 4TR1A 5G2ZA 4KE3A 3FMWA 4POKA 3CXGA 4KF9A 2A2PA 2FWHA 5BMUA 4WR5A 3EMXA 2I1UA 3TKQA 2F9SA 1JHBA 5ID2B 2I9HA 1FOVA 4O92A 1SKRB 4FYCA 2WZ9A 2VL2C 4D73B 2NPBA 3GKKA 1B8XA 4E8EA 3IPZA 3RPNA 2LQQA 2C0EA 2LS5A 3UMAA 2PMTA 2CT6A 1EP7A 1TOFA 1G6WA 1T7PB 2HZFA 4KSOA 4A5PA 4EIPA 3D6IA 3F63A 3IOSA 2X99A 2LKUA 1WRYA 3HVVA 1ACVA 1FAAA 4XS4B 4MNNA 4L8EA 1KEBA 2PPTA 4ISDA 1ABAA 2GT6A 4I8BA 1DE1A 4NWYA 4F9ZA 2VLTA 1V58A 1F3AA 3GSSA 4ZXGA 3TB2A 5ECIB 1X9WB 3MYDA 1SD9A 2H1AA 1NHOA 2CX4A 4EKZA 2VL9A 1XIYA 3U5RE 4ML1A 1Z7PA 4KDUA 4KDYA 4YAVA 1SK2A 3IC4A 3APOA 2H1GA 1OE8A 2E2GA 4Q5FA 4Q5NA 1PKWA 4JE1A 4KCEA 5KN1A 3ZVJA 3HJPA 5HR3A 17GSA 2C8UA 3KZQA 2M72A 1AUCA 3HZ4A 4ACSA 5B7CA 1GWCA 3FR3A 3LFLA 4K7OA 4ZILA 3L4NA 3PGTA 2HXKA 1AC1A 1Y6EA 3ME7A 1SU9A 3F6FA 5J9BA 4Z2RA 3EINA 3BD2A 3O3TA 5FWGA 1I9DA 2X8HA 1O7UA 2ZUPA 4MJAA 4GSSA 11GSA 3G9BA 4IELA 2DJ0A 1T8EB 4GQFA 2V1MA 3IK9A 1C72A 2IN3A 3EU4A 1HNCA 1EEJA 5GZZB 1O8XA 1R5AA 4IKHA 2H6YA 2V32A 2QA1A 3P2AA 5COHA 2DBCA 5A4UA 4ZB9A 1OKTA 2IFQB 3MAKA 1WWJA 3C73A 4MDCA 1U87A 1QQ2A 1VF3A 5D9WA 3S9FA 2OKAA 4MJBA 5DAKB 1AAZA 1K3OA 3IC8A 1GH2A 3ERFA 3ZIJA 5AN1A 2GSRA 1SK1A 3ZIVA 1GLPA 1E2YA 4I6XA 3IV4A 4BVYB 4HZ2A 2OA7A 1Y25A 6GSTA 1DUGA 4TXOA 5ECRB 4ECCA 1TI3A 1XWKA 6GSWA 5IO0A 2R5GA 3HKRA 4HI7A 4BVXA 3TKPA 4EUYA 5KOXA 3MDKA 5ECQB 1H75A 5IMZA 1CQHA 1PD21 5LD0A 4HQZA 4G10A 1A8LA 4TR3A 2L4CA 1M7TA 2VLVA 1G0TA 4N10A 2VCVA 4MABA 1M9BA 3ZMKA 4OFMA 1TXXA 5AIVA 1JLVA 5G1KA 5ID2A 1UVZA 5CAXA 3EVIA 3VPQA 2R0CA 3O76A 3ISOA 2MMAA 3CTGA 4Z2TA 3PINA 1V40A 3LYPA 2YWNA 4OD7A 1S3CA 4WEYA 5E59A 4IJIA 1Z9HA 5JCWA 4J2FA 4V2LA 1J9BA 1SKSB 2H72A 4XS4A 1TRWA 1AW9A 4ID0A 2CV4A 1N8JA 3FKFA 3LXZA 1Z5YE 3KXOA 2WGRA 4N0ZA 1SJZA 2JZTA 1PGTA 1THXA 3VFIA 5J4UA 4DVCA 4XCSA 4WBJA 4LL4B 1SJIA 1GNEA 2IMKA 2LNSA 3TJKA 1EGOA 3ERGA 4HS1A 3ZLPA 2VAFA 4G9HA 1WJKA 3GYKA 2L5OA 4BWSA 1A8YA 3LJRA 2VD1A 4V1Ag 3UL3A 2C3NA 4GTUA 2KP1A 3ZRDA 3TKSC 2A2SA 2YNXA 2IPAA 3KJYA 1A23A 1YEXA 5GSTA 3RAZA 4JZQA 4KB3A 1ZCPA 1YJ6A 1FVKA 1B4PA 4KH7A 4O32A 3CSIA 4DSQA 4IW9A 1T1VA 1EOGA 4CW9A 1G7EA 5J41A 3BCKA 5F05A 4QL7A 5AGYA 4ZL9A 2B1LA 5FT3A 2OACA 4KNDA 3HXSA 1UA5A 4HZ4A 3M0FA 1X5DA 2H70A 3QCPA 2KHPA 3LWAA 5D73A 3ZL5A 3QAWA 2IMIA 5CRWA 4MPGA 3L78A 2YCDA 4CHSA 4I2UA 3W8JA 2KOKA 3ZYWA 2C3QA 2B5EA 2L57A 2FGXA 2H30A 4NHZA 3A2WA 1GUMA 1K0CA 1WPIA 3IHQA 3GL5A 1GSSA 1CQGA 2WCIA 4TN8A 2YP6A 4ILFA 3ZZXA 3QD9A 6GSUA 1FOHA 3CRUA 4MPFA 1Z3EA 3C7MA 3AY8A 4WKWA 1X5CA 5D9VA 5B8AA 5DAKA 2KLXA 5DALB 3E9JB 4AF2A 1TU8A 2F3MA 2GT5A 5D8IA 1SYRA 1TK8B 5INYA 5CYYA 1SL0B 4MLYA 2H0HA 4MP4A 2IIYA 3GKMA 4BVYA 3M1GA 3P7XA 1QFNA 3LYKA 5F07A 1ZYNA 4XTSA 5KN2A 1XPVA 2DJ1A 18GSA 1PKZA 1Z6MA 1MTCA 4XRDA 1NM3A 3WGDA 4N0VA 4LMWA 5IMDA 2AV4A 2B5YA 3FEUA 2IL3A 3LW9A 5G1LA 1EV4A 4EC0A 3R3EA 4PXOA 2DKHA 4ECBA 4P3YB 2FA4A 5ECHB 3M9JA 2B5XA 4KSMA 2O87A 1B9XC 2RUFA 3H79A 3US3A 6GSYA 4YQUA 2A4VA 4EXJA 2OBIA 4FIWA 4FH8A 5CP1A 3VK9A 3EPTA 4YQMA 5IMVA 2K9FA 2OBKA 1GSYA 3I43A 5CRHA 1J0FA 3D5JA 2VL2A 1EWXA 4TVEA 4I5QA 3Q18A 1BG5A 3SWLA 3QDNA 2C3TA 1BJXA 1JZWA 2EC4A 1ST9A 4F82A 2FUG2 1EV9A 10GSA 5IMCA 4MH3A 2IWTA 2XPEA 3KTBA 5ECOB 7GSSA 1DBYA 1DE2A 2GQLA 1XFLA 2XC2A 1QGVA 3HJMA 1YF0A 3DEXA 1M2AA 2CX3A 5H5RA 2PGTA 3IE3A 3LEFA 4KCAA 2FD3A 3F4SA 3GSTA 2VCXA 4IP1A 2O89A 2DJJA 4QQ7A 1LU4A 1SENA 2KUCA 3KMNA 2L5LA 3IHGA 2BMXA 3QFAC 2O7KA 5ABRA 1ILOA 5HR2A 1TI1A 5A4VA 1V98A 3UVTA 2R0PA 3I6AA 2H75A 4NV5A 3ZMLA 1O8WA 1M99A 3N9JA 4IJ3A 1XWBA 4IVFA 5H5SA 1GTIA 5ECMB 1V2AA 4L5LA 1USBA 2FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D96 A;  2H1B A;  3VLN A;  2DSA A;  2VO4 A;  2CQ9 A;  1XWG A;  1G6Y A;  1WIK A;  3UBL A;  3GX0 A;  2TRX A;  4PQI A;  2GZY A;  3HDC A;  3F3Q A;  3TOT A;  5C04 A;  2QSI A;  3U6V A;  3GKN A;  1T00 A;  1TTZ A;  4ZBB A;  3TDG A;  3WGX A;  2NDO A;  2CZ3 A;  2LST A;  1ON4 A;  5JWR B;  5ECP B;  3DWV A;  4KDX A;  5DDL A;  3V1W A;  1TK0 B;  3WGE A;  3HY2 A;  1JZO A;  1O85 A;  1F2E A;  4RI7 A;  4POB A;  2HE3 A;  1F3B A;  3EUR A;  1A24 A;  3VI5 A;  3GTU B;  4ECJ A;  3A3T A;  5ECL B;  2K8S A;  2HZE B;  3C8E A;  2JU5 A;  3GNJ A;  5KN0 A;  2E7P A;  1MDK A;  1R4W A;  4F2I A;  5CRD A;  2MMN A;  4PNG A;  1U3A A;  3LXT A;  1YKA A;  4OFT A;  4AJ7 A;  4PUR A;  3CYN A;  2BTO T;  3JCM L;  3GUS A;  4MZB A;  1MD4 A;  1TK5 B;  2XBI A;  3G7I A;  5IMF A;  1B48 A;  3BOA A;  2TIR A;  1V9W A;  2PN8 A;  3GN3 A;  1LJR A;  1YKC A;  2VL3 A;  2H74 A;  4JBB A;  2CA8 A;  4LA1 A;  3LG6 A;  3DD3 A;  9GSS A;  4TR0 A;  4NMU A;  3W8S A;  4DSR A;  5ELG A;  4POL A;  2H73 A;  3N5O A;  5DQY A;  4LLR A;  5EPF A;  1O81 A;  3H4K A;  3TRX A;  1BX9 A;  4EO3 A;  5IIZ A;  3H8Q A;  5D9X A;  3TJJ A;  1B9Y C;  3TCO A;  3D22 A;  2NBS A;  1F9M A;  4AJ6 A;  2P0G A;  4WF5 A;  1S3A A;  1XW9 A;  1OC9 B;  4I2T A;  1ZL9 A;  5E4W A;  3VWW A;  2GSQ A;  3H93 A;  2H71 A;  3CBU A;  5HFK A;  3APS A;  1TKD B;  1PRX A;  1MD3 A;  3GV1 A;  3FHK A;  3L9V A;  3E0U A;  1KTE A;  4GXZ A;  4WET A;  1XOB A;  1VRS D;  3ZIT A;  2G0F A;  2FWE A;  2M80 A;  2VLU A;  3HVS A;  3GMF A;  3GH9 A;  2LJR A;  4IBP A;  4PUF C;  3O6T A;  1SL1 B;  1VGL A;  5ECN B;  1PMT A;  3FYG A;  2OE0 A;  1MEK A;  3P8W A;  2OE3 A;  2E2M A;  1SL2 B;  3LQ7 A;  3GFK A;  4XS1 A;  2GST A;  2YZH A;  4PQH A;  3C1S A;  3VWV A;  3ZTL A;  3TUE A;  2LJA A;  2GZP A;  4D73 A;  3EMP A;  1K0B A;  1PX6 A;  5AIS A;  4IQA A;  4MA9 A;  1HQO A;  1JZR A;  3RDW A;  2CZ2 A;  2YWO A;  4XRA A;  3IAS 2;  1MDI A;  3EC3 A;  2K18 A;  3A2X A;  4ZIJ A;  3IK7 A;  2H0G A;  3F6D A;  2HI7 A;  2LNT A;  3KM6 A;  3QAG A;  2CVD A;  3TKS A;  1AQW A;  5B8B A;  3FR9 A;  2VCW A;  6GSX A;  4EE0 A;  2JAC A;  4TOP A;  1XWC A;  1S3D A;  1OKD A;  2YJH A;  3FZ9 A;  1X9S B;  2Z9S A;  3VUR A;  3CSJ A;  2DJ3 A;  2L6C A;  2EIO A;  2J9H A;  2HRF A;  3DRN A;  1GTB A;  3G7Y A;  1M9A A;  3HD5 A;  3HYP A;  4OCE A;  1GTA A;  3W6G A;  2I81 A;  4HJ2 A;  2C1Y A;  1T4Z A;  4BL7 A;  4MZW A;  4ML6 A;  3RHC A;  4RI6 A;  1SKW B;  5B6M A;  2P31 A;  4KGI A;  4HEA 2;  4TR1 B;  3CSH A;  2HT9 A;  1O73 A;  4NHW A;  2GSS A;  2WFC A;  4ZB6 A;  1K0D A;  3GTU A;  2FCH A;  2PUK C;  2XBQ A;  2HZE A;  2C80 A;  3WT1 A;  4X43 A;  4ECI A;  1NHY A;  3WT2 A;  3KD0 A;  1A2J A;  4KUN A;  1GNW A;  5EY6 A;  1R7H A;  1FO5 A;  2DIY A;  1EZK A;  4TKY A;  3TOU A;  1T4Y A;  1N2A A;  4V1A p;  1IYH A;  4OO4 A;  1U88 A;  1F6M C;  1TRV A;  1SJ6 A;  2DC5 A;  1AQX A;  4HJM A;  3F4T A;  3HZ8 A;  3ZFB A;  12GS A;  3D4T A;  2H01 A;  3F3R A;  2HFD A;  3I9V 2;  4MK3 A;  5IQY A;  2VIM A;  1TU7 A;  2IFQ A;  4OO5 A;  2AAW A;  1RW1 A;  5KEJ A;  1OC8 A;  3KMO A;  1GRX A;  1HNA A;  2HRN A;  1PN9 A;  2GLR A;  1YDK A;  3K8N A;  3EU3 A;  1KBN A;  1A2M A;  1R5P A;  1OYJ A;  4EF0 A;  3UEM A;  4H86 A;  1ERW A;  5KN3 A;  2WJU A;  5IO2 A;  2H66 A;  1QMV A;  1EOH A;  4Q5Q A;  2MMZ A;  5JWO B;  5IPH A;  3IA1 A;  4OCF A;  1Z7R A;  1BQ7 A;  1TJD A;  2H1D A;  2H6Z A;  2WDU A;  2YOI A;  4GF0 A;  1GSD A;  1JFU A;  1VF4 A;  1FB0 A;  1UN2 A;  1YEP A;  1TP9 A;  4YH2 A;  2RII A;  1SYX A;  1X0R A;  2F51 A;  3GH6 A;  1ZYE A;  3IRA A;  4EVM A;  3UBK A;  1FB6 A;  2N5F A;  3BJ5 A;  3QR6 A;  4JU5 A;  2LRT A;  3M9K A;  2R3X A;  4K1F A;  1RQM A;  1BED A;  5IM9 A;  3M3M A;  5HR0 A;  2VCT A;  5FHI A;  3I69 A;  3KH9 A;  4EDY A;  3Q74 A;  3M8N A;  3KH7 A;  19GS A;  4GQC A;  1M2D A;  1K3L A;  2QKE A;  3IR4 A;  3ZRE A;  3IDV A;  3APQ A;  4K2D A;  3D21 A;  2R2J A;  4F03 A;  2AB6 A;  4LL1 B;  2X8G A;  3J7Y b;  2MYG A;  2ALB A;  3TGZ A;  5CNW A;  4GRF A;  1XWA A;  2I3Y A;  1Q98 A;  1GSU A;  3ERW A;  2YV7 A;  4GST A;  2LTK A;  3J7Y k;  5HQP A;  4I97 A;  4TXO B;  3Q6O A;  2GZZ A;  3EYT A;  4HUA A;  1O6J A;  4TW5 A;  1VF2 A;  5CRG A;  4NAX A;  5C00 A;  2X64 A;  2ES7 A;  4IQ1 A;  2HYX A;  1GUK A;  4OMV A;  4MCU A;  2DIZ A;  2GQK A;  3F9U A;  3OR5 A;  3UJ1 A;  3MSZ A;  2VCZ A;  3ZFL A;  4KX4 A;  2JZR A;  4L0U A;  3TRP A;  1URM A;  2C0G A;  1K0O A;  2CVB A;  5HR1 A;  4AJ8 A;  1XXU A;  3FZ4 A;  3LGC A;  1ZGN A;  5G5E A;  2HSY A;  3KTL A;  5DVB A;  3VPT A;  1U3I A;  3FK8 A;  3WD6 A;  2MBT A;  1TRU A;  1PSQ A;  1DSB A;  4WF4 A;  3SBC A;  1T3B A;  4DEJ A;  3TRQ A;  3FW2 A;  1X9M B;  3KIJ A;  4Z7X A;  1QK8 A;  3FRC A;  1I5G A;  3FY7 A;  2D2Z A;  2FHE A;  1U6T A;  2GTU A;  1OC3 A;  4DSS B;  1GSE A;  3HVX A;  3IXR A;  3GKX A;  1RK4 A;  4K7I A;  4WR4 A;  8GSS A;  5AIX A;  2YWM A;  4MF6 A;  2PWJ A;  3UAR A;  1FW1 A;  2O85 A;  2XPD A;  2YPM A;  3QPM A;  2GDR A;  4YQV A;  3ZVJ D;  2REM A;  5HFG A;  2J23 A;  5CRE A;  4Q5R A;  1THO A;  2LRN A;  2I4A A;  6GSV A;  4MF5 A;  2HSH A;  1AIU A;  1PL2 A;  5DAL A;  5F0G A;  3GIX A;  4IN0 A;  4XIH A;  3D4M A;  3UOM A;  2GQM A;  1H4O A;  4ZL7 A;  2OE1 A;  2QC7 A;  1PL1 A;  5JCG A;  5DBQ A;  1OE7 A;  4F0B A;  3HCZ A;  5G31 A;  1XVW A;  3L0H A;  3VWX A;  1FVJ A;  1F37 A;  5F8B A;  2N5B A;  1W4V A;  1TW9 A;  2NTO A;  3PH9 A;  5G30 A;  1JZD A;  4MF7 A;  1AXD A;  1GSF A;  4MMM A;  2GVP A;  1GUL A;  1YQ1 A;  3PR8 A;  1Z6N A;  4NPB A;  1JLW A;  3DXB A;  2GS3 A;  4L5O A;  1QUW A;  2YZU A;  5GAP D;  1QXH A;  2MMO A;  2R6K A;  2YAN A;  2PBJ A;  2DMM A;  3CMI A;  4TRX A;  1K0A A;  2ZNM A;  1TDI A;  1ERU A;  4IHU A;  1Q4J A;  4HQS A;  2RLI A;  2DML A;  1J08 A;  1XVQ A;  2IJY A;  5GAN D;  1IYI A;  2EIQ A;  2E0Q A;  4EDZ A;  1YZX A;  3VWU A;  1YY7 A;  1A0R P;  2JZS A;  2V2G A;  3L9S A;  1ERT A;  2DJ2 A;  5LCZ A;  4X1U A;  3GRX A;  2LEG A;  4O7H A;  4BPY A;  2BJX A;  3F4R A;  3EE2 A;  2YJ7 A;  1MDJ A;  4NV2 A;  3GL3 A;  3TJG A;  1YF1 A;  22GS A;  14GS A;  4MZC A;  5EVO A;  5IOW A;  5J9C A;  2TRC P;  3MNG A;  3GX8 A;  4K0N A;  5IOX A;  2IMF A;  4JR6 A;  3DGQ A;  3VI7 A;  1BAY A;  2VM2 A;  2F8F A;  5ELA A;  5ECS A;  2IMD A;  1ZOF A;  1XW6 A;  2HNL A;  2H8L A;  2V6K A;  4K7N A;  1KNG A;  1GSQ A;  2EIR A;  1OVN A;  3GA4 A;  5L71 A;  1GUH A;  4HU9 A;  1XBS A;  2H6X A;  1EP8 A;  2K6V A;  1TRS A;  2O8V B;  4HU7 A;  2A2R A;  4FO5 A;  2FLS A;  2G2Q A;  3C1R A;  5D9T A;  2FA8 A;  3LOR A;  1ML6 A;  1GL8 A;  1NW2 A;  1WOU A;  1PQN A;  3P90 A;  1NSW A;  5F06 A;  3LSZ A;  3IBH A;  5DJM A;  2IME A;  4JED A;  5DCH A;  5DCG A;  4JR4 A;  2H76 A;  1GP1 A;  1AQV A;  4OFN A;  5J5N A;  3HA9 A;  1R26 A;  1K0M A;  4KA0 A;  2HLS A;  4XS6 A;  2RM6 A;  4IP6 A;  4JRR A;  2C0F A;  4GLT A;  2LV3 A;  4XHM A;  1K3Y A;  4IS0 A;  2K8V A;  4PQ1 A;  2F8A A;  4PGT A;  3TJB A;  4AGS A;  2YV9 A;  4ZBD A;  4DSS A;  1GTU A;  4J56 E;  2PER A;  13GS A;  2B6M A;  3QOU A;  3ME8 A;  4HDE A;  3D0Z A;  4O5R A;  1B4Q A;  5G5F A;  3DYR A;  2MBS A;  1PA3 A;  2LQO A;  2JSY A;  3RBT A;  5H5Q A;  3DVX A;  2JSZ A;  1ZZY A;  2X8C A;  1HD2 A;  5DQS A;  2OAD A;  2WB9 A;  2JAD A;  5D93 A;  3GHA A;  2B3S A;  3QMX A;  1G7O A;  1XZO A;  3FZA A;  1A2L A;  3A2V A;  1ZYQ B;  16GS A;  4ZBA A;  1A0F A;  3H1N A;  5JCU A;  4N11 A;  2FWF A;  3KP8 A;  3FR6 A;  4ZB8 A;  4G2E A;  1SD8 A;  4TXV A;  2WS2 A;  3EWL A;  4ZL8 A;  2JL4 A;  2B7J A;  3UIW A;  1PX7 A;  1ERV A;  4K0G A;  5J3R A;  3CTF A;  4BWQ A;  2C0D A;  2M46 A;  4V2M A;  5IPG A;  3QAV A;  4HOJ A;  2VOC A;  2XHF A;  4MJE A;  3KCM A;  4GWR A;  4POM A;  1FHE A;  2CAI A;  4FYB A;  1LBK A;  5HFI A;  4TR4 A;  3TJF A;  3ED3 A;  2V6O A;  4GCI A;  2GGT A;  2YWI A;  2VD0 A;  2N5A A;  4PUA A;  2NVL A;  3UVH A;  2B1K A;  1K0N A;  1SK0 A;  3TKS E;  2R4V A;  5A5K A;  1OC9 A;  4OWY A;  2V41 A;  2VM1 A;  2ON5 A;  4RQR A;  4PX1 A;  2VCQ A;  2PU9 C;  4QL9 A;  1GLQ A;  4J57 E;  4BA7 A;  2RM5 A;  2DJK A;  3WYW A;  3DIE A;  2VUP A;  5B6N A;  2AUV A;  1HNB A;  3C71 A;  1VF1 A;  3CRT A;  1W89 A;  3HJO A;  4RUV A;  1V57 A;  1HYU A;  2P5R A;  3IAM 2;  4E8H A;  3R2Q A;  5IMA A;  3RPP A;  4MJC A;  5JWQ B;  4KW6 A;  1ZMA A;  2LUS A;  1FG4 A;  4K6X A;  2CAQ A;  1XW5 A;  3G7J A;  3NZN A;  1EEM A;  4G19 A;  6GSS A;  1XCC A;  2R37 A;  3RHB A;  3KEB A;  4K8M A;  3DVW A;  2L4Q A;  2FY6 A;  5LNK e;  1M2B A;  1X5E A;  2PVQ A;  2CVK A;  2OJL A;  2LJK A;  20GS A;  3HHV A;  4CDO A;  3FZ5 A;  3DKS A;  4K9Z A;  3KGK A;  4PNF A;  5DJL A;  4F0C A;  3QFB C;  3NIV A;  4NXI A;  3E3E A;  2L59 A;  3F8U A;  2C4J A;  4FYU A;  4N30 A;  2P5Q A;  3L9U A;  2H19 A;  2RUE A;  2H0I A;  4V2N A;  1BYE A;  4L0W A;  4LMV A;  5A4W A;  1OAZ A;  3TKR A;  3F0I A;  1XOA A;  2L6D A;  2B7K A;  1E6B A;  1UC7 A;  2DLX A;  3KP9 A;  1WE0 A;  1WP0 A;  4X0X A;  4ULX A;  4WBR D;  5ECK B;  1M0U A;  3GUR A;  2FNO A;  2KP2 A;  4GSN A;  2AYT A;  3NOF A;  2MZC A;  3A5W A;  2AHE A;  2LRC A;  5ENU A;  1EGR A;  2ON7 A;  3DML A;  3BCI A;  2PVO C;  3BBY A;  4MH2 A;  3MWH A;  4WXT A;  4RQX A;  5CO3 A;  4EL1 A;  4IGJ A;  2WUL A;  5EL8 A;  5GSS A;  3Q19 A;  4YAP A;  2ZCT A;  2YN1 A;  1WMJ A;  4KAE A;  2QGV A;  2WRT A;  3UAP A;  2AJQ B;  4TR1 A;  5G2Z A;  4KE3 A;  4POK A;  3CXG A;  2FWH A;  4WR5 A;  3EMX A;  2I1U A;  3TKQ A;  2F9S A;  1JHB A;  5ID2 B;  2I9H A;  1FOV A;  4O92 A;  1SKR B;  4FYC A;  2WZ9 A;  2VL2 C;  4D73 B;  2NPB A;  3GKK A;  1B8X A;  4E8E A;  3IPZ A;  3RPN A;  2LQQ A;  2C0E A;  2LS5 A;  3UMA A;  2PMT A;  2CT6 A;  1EP7 A;  1TOF A;  1G6W A;  1T7P B;  2HZF A;  4KSO A;  3D6I A;  3F63 A;  3IOS A;  2X99 A;  2LKU A;  1WRY A;  3HVV A;  1ACV A;  1FAA A;  4XS4 B;  4L8E A;  1KEB A;  2PPT A;  4ISD A;  1ABA A;  2GT6 A;  4I8B A;  1DE1 A;  4NWY A;  4F9Z A;  2VLT A;  1V58 A;  1F3A A;  3GSS A;  4ZXG A;  3TB2 A;  5ECI B;  1X9W B;  1SD9 A;  2H1A A;  1NHO A;  2CX4 A;  4EKZ A;  2VL9 A;  1XIY A;  3U5R E;  4ML1 A;  1Z7P A;  4KDU A;  4KDY A;  4YAV A;  1SK2 A;  3IC4 A;  3APO A;  2H1G A;  1OE8 A;  2E2G A;  4Q5F A;  4Q5N A;  1PKW A;  4JE1 A;  4KCE A;  5KN1 A;  3ZVJ A;  3HJP A;  5HR3 A;  17GS A;  2C8U A;  3KZQ A;  2M72 A;  1AUC A;  3HZ4 A;  4ACS A;  5B7C A;  1GWC A;  3FR3 A;  3LFL A;  4K7O A;  4ZIL A;  3L4N A;  3PGT A;  2HXK A;  1AC1 A;  1Y6E A;  3ME7 A;  1SU9 A;  3F6F A;  5J9B A;  3EIN A;  3BD2 A;  3O3T A;  5FWG A;  1I9D A;  2X8H A;  1O7U A;  2ZUP A;  4MJA A;  4GSS A;  11GS A;  3G9B A;  4IEL A;  2DJ0 A;  1T8E B;  4GQF A;  2V1M A;  3IK9 A;  1C72 A;  2IN3 A;  3EU4 A;  1HNC A;  1EEJ A;  5GZZ B;  1O8X A;  1R5A A;  4IKH A;  2H6Y A;  2V32 A;  3P2A A;  5COH A;  2DBC A;  5A4U A;  4ZB9 A;  1OKT A;  2IFQ B;  3MAK A;  1WWJ A;  3C73 A;  4MDC A;  1U87 A;  1QQ2 A;  1VF3 A;  5D9W A;  3S9F A;  2OKA A;  4MJB A;  5DAK B;  1AAZ A;  1K3O A;  1GH2 A;  3ERF A;  3ZIJ A;  5AN1 A;  2GSR A;  1SK1 A;  3ZIV A;  1GLP A;  1E2Y A;  4I6X A;  3IV4 A;  4HZ2 A;  2OA7 A;  1Y25 A;  6GST A;  1DUG A;  4TXO A;  5ECR B;  4ECC A;  1TI3 A;  1XWK A;  6GSW A;  5IO0 A;  2R5G A;  3HKR A;  4HI7 A;  4BVX A;  3TKP A;  4EUY A;  3MDK A;  5ECQ B;  1H75 A;  5IMZ A;  1CQH A;  1PD2 1;  5LD0 A;  4HQZ A;  4G10 A;  1A8L A;  4TR3 A;  2L4C A;  1M7T A;  2VLV A;  1G0T A;  4N10 A;  2VCV A;  4MAB A;  1M9B A;  3ZMK A;  4OFM A;  1TXX A;  5AIV A;  1JLV A;  5G1K A;  5ID2 A;  1UVZ A;  5CAX A;  3EVI A;  3VPQ A;  3O76 A;  3ISO A;  2MMA A;  3CTG A;  3PIN A;  1V40 A;  3LYP A;  2YWN A;  4OD7 A;  1S3C A;  4WEY A;  5E59 A;  4IJI A;  1Z9H A;  5JCW A;  4J2F A;  4V2L A;  1J9B A;  1SKS B;  2H72 A;  4XS4 A;  1TRW A;  1AW9 A;  4ID0 A;  2CV4 A;  1N8J A;  3FKF A;  3LXZ A;  1Z5Y E;  3KXO A;  2WGR A;  4N0Z A;  1SJZ A;  2JZT A;  1PGT A;  1THX A;  3VFI A;  5J4U A;  4DVC A;  4XCS A;  4WBJ A;  4LL4 B;  1SJI A;  1GNE A;  2IMK A;  2LNS A;  3TJK A;  1EGO A;  3ERG A;  4HS1 A;  3ZLP A;  2VAF A;  4G9H A;  1WJK A;  3GYK A;  2L5O A;  4BWS A;  1A8Y A;  3LJR A;  2VD1 A;  4V1A g;  3UL3 A;  2C3N A;  4GTU A;  2KP1 A;  3ZRD A;  3TKS C;  2A2S A;  2YNX A;  2IPA A;  3KJY A;  1A23 A;  1YEX A;  5GST A;  3RAZ A;  4JZQ A;  4KB3 A;  1ZCP A;  1YJ6 A;  1FVK A;  1B4P A;  4KH7 A;  4O32 A;  3CSI A;  4DSQ A;  4IW9 A;  1T1V A;  1EOG A;  4CW9 A;  1G7E A;  5J41 A;  3BCK A;  5F05 A;  4QL7 A;  5AGY A;  4ZL9 A;  2B1L A;  5FT3 A;  2OAC A;  4KND A;  3HXS A;  1UA5 A;  4HZ4 A;  3M0F A;  1X5D A;  2H70 A;  3QCP A;  2KHP A;  3LWA A;  5D73 A;  3ZL5 A;  3QAW A;  2IMI A;  5CRW A;  4MPG A;  3L78 A;  2YCD A;  4CHS A;  4I2U A;  3W8J A;  2KOK A;  3ZYW A;  2C3Q A;  2B5E A;  2L57 A;  2FGX A;  2H30 A;  4NHZ A;  3A2W A;  1GUM A;  1K0C A;  1WPI A;  3IHQ A;  3GL5 A;  1GSS A;  1CQG A;  2WCI A;  4TN8 A;  2YP6 A;  4ILF A;  3ZZX A;  3QD9 A;  6GSU A;  3CRU A;  4MPF A;  1Z3E A;  3C7M A;  3AY8 A;  4WKW A;  1X5C A;  5D9V A;  5B8A A;  5DAK A;  2KLX A;  5DAL B;  3E9J B;  4AF2 A;  1TU8 A;  2F3M A;  2GT5 A;  5D8I A;  1SYR A;  1TK8 B;  5INY A;  5CYY A;  1SL0 B;  4MLY A;  2H0H A;  4MP4 A;  2IIY A;  3GKM A;  4BVY A;  3M1G A;  3P7X A;  1QFN A;  3LYK A;  5F07 A;  4XTS A;  5KN2 A;  1XPV A;  2DJ1 A;  18GS A;  1PKZ A;  1Z6M A;  1MTC A;  4XRD A;  1NM3 A;  3WGD A;  4N0V A;  4LMW A;  5IMD A;  2AV4 A;  2B5Y A;  3FEU A;  2IL3 A;  5G1L A;  1EV4 A;  4EC0 A;  4PXO A;  4ECB A;  4P3Y B;  2FA4 A;  5ECH B;  3M9J A;  2B5X A;  4KSM A;  2O87 A;  1B9X C;  2RUF A;  3H79 A;  3US3 A;  6GSY A;  4YQU A;  2A4V A;  4EXJ A;  2OBI A;  4FIW A;  4FH8 A;  5CP1 A;  3VK9 A;  4YQM A;  5IMV A;  2K9F A;  2OBK A;  1GSY A;  3I43 A;  5CRH A;  1J0F A;  3D5J A;  2VL2 A;  1EWX A;  4TVE A;  4I5Q A;  3Q18 A;  1BG5 A;  3SWL A;  3QDN A;  2C3T A;  1BJX A;  1JZW A;  2EC4 A;  1ST9 A;  4F82 A;  2FUG 2;  1EV9 A;  10GS A;  5IMC A;  4MH3 A;  2IWT A;  2XPE A;  3KTB A;  5ECO B;  7GSS A;  1DBY A;  1DE2 A;  2GQL A;  1XFL A;  2XC2 A;  1QGV A;  3HJM A;  1YF0 A;  3DEX A;  1M2A A;  2CX3 A;  5H5R A;  2PGT A;  3IE3 A;  3LEF A;  4KCA A;  2FD3 A;  3F4S A;  3GST A;  2VCX A;  4IP1 A;  2O89 A;  2DJJ A;  4QQ7 A;  1LU4 A;  1SEN A;  2KUC A;  3KMN A;  2L5L A;  2BMX A;  3QFA C;  2O7K A;  5ABR A;  1ILO A;  5HR2 A;  1TI1 A;  5A4V A;  1V98 A;  3UVT A;  3I6A A;  2H75 A;  4NV5 A;  3ZML A;  1O8W A;  1M99 A;  3N9J A;  4IJ3 A;  1XWB A;  4IVF A;  5H5S A;  1GTI A;  5ECM B;  1V2A A;  4L5L A;  1USB A;  2FWG A; 
#chains in the Genus database with same CATH topology
 5D96 A;  2H1B A;  3VLN A;  2DSA A;  2VO4 A;  2CQ9 A;  1XWG A;  1G6Y A;  1WIK A;  3UBL A;  3GX0 A;  2TRX A;  4PQI A;  2GZY A;  3HDC A;  3F3Q A;  3TOT A;  5C04 A;  2QSI A;  3U6V A;  3GKN A;  1T00 A;  1TTZ A;  4ZBB A;  3TDG A;  4BL7 B;  3WGX A;  2NDO A;  2CZ3 A;  2LST A;  1ON4 A;  5JWR B;  5ECP B;  2HSM A;  3DWV A;  4KDX A;  5DDL A;  3V1W A;  1TK0 B;  3WGE A;  3HY2 A;  1JZO A;  1O85 A;  1F2E A;  4RI7 A;  4POB A;  2HE3 A;  1F3B A;  3EUR A;  1A24 A;  3VI5 A;  3GTU B;  4ECJ A;  3A3T A;  5ECL B;  2K8S A;  2HZE B;  3C8E A;  1M3J A;  2JU5 A;  3GNJ A;  5KN0 A;  2E7P A;  1MDK A;  1R4W A;  2DKI A;  4F2I A;  4O5U A;  5CRD A;  2MMN A;  4PNG A;  1U3A A;  3LXT A;  1YKA A;  4OFT A;  4AJ7 A;  4PUR A;  3CYN A;  2BTO T;  3JCM L;  3GUS A;  4MZB A;  1MD4 A;  4CY8 A;  1TK5 B;  2XBI A;  3G7I A;  5IMF A;  1B48 A;  3BOA A;  2TIR A;  1V9W A;  2PN8 A;  3GN3 A;  1LJR A;  1YKC A;  2VL3 A;  2H74 A;  4JBB A;  2CA8 A;  4LA1 A;  3LG6 A;  3DD3 A;  9GSS A;  4TR0 A;  4NMU A;  3W8S A;  4DSR A;  5ELG A;  4POL A;  2H73 A;  3N5O A;  5DQY A;  4LLR A;  5EPF A;  1O81 A;  3H4K A;  4O5Q A;  3TRX A;  1BX9 A;  4EO3 A;  5IIZ A;  3H8Q A;  5D9X A;  3TJJ A;  1B9Y C;  3TCO A;  3D22 A;  2NBS A;  1F9M A;  4AJ6 A;  2P0G A;  4WF5 A;  1S3A A;  1XW9 A;  1OC9 B;  4I2T A;  1ZL9 A;  5E4W A;  3VWW A;  2GSQ A;  3H93 A;  2H71 A;  3CBU A;  5HFK A;  3APS A;  1TKD B;  1PRX A;  1MD3 A;  3GV1 A;  3FHK A;  3L9V A;  3E0U A;  1KTE A;  4GXZ A;  4WET A;  1XOB A;  1VRS D;  3ZIT A;  2G0F A;  2FWE A;  2M80 A;  2VLU A;  3HVS A;  3GMF A;  3GH9 A;  2LJR A;  4IBP A;  4PUF C;  3O6T A;  1SL1 B;  1VGL A;  5ECN B;  1PMT A;  3FYG A;  2OE0 A;  1MEK A;  3P8W A;  4K2X A;  2OE3 A;  2E2M A;  1SL2 B;  3LQ7 A;  3GFK A;  4XS1 A;  2GST A;  2YZH A;  4PQH A;  3C1S A;  3VWV A;  3ZTL A;  3TUE A;  2LJA A;  2GZP A;  2X49 A;  4D73 A;  3EMP A;  1K0B A;  1PX6 A;  5AIS A;  2HRA A;  4IQA A;  4MA9 A;  1HQO A;  1JZR A;  5BRT A;  3RDW A;  2CZ2 A;  2YWO A;  4XRA A;  3IAS 2;  1MDI A;  3EC3 A;  2K18 A;  3A2X A;  4ZIJ A;  3IK7 A;  2H0G A;  3F6D A;  2HI7 A;  2LNT A;  3KM6 A;  3QAG A;  4ICY A;  2CVD A;  3TKS A;  1AQW A;  5B8B A;  3FR9 A;  2VCW A;  6GSX A;  4EE0 A;  2JAC A;  4TOP A;  1XWC A;  1S3D A;  1OKD A;  2YJH A;  3FZ9 A;  1X9S B;  2Z9S A;  3VUR A;  3CSJ A;  2DJ3 A;  2L6C A;  2EIO A;  2J9H A;  2HRF A;  3DRN A;  1GTB A;  3G7Y A;  1M9A A;  3HD5 A;  3HYP A;  4OCE A;  1GTA A;  3W6G A;  2I81 A;  4HJ2 A;  2C1Y A;  1T4Z A;  4BL7 A;  4MZW A;  4ML6 A;  3RHC A;  4RI6 A;  1SKW B;  5B6M A;  2P31 A;  4KGI A;  4HEA 2;  4TR1 B;  3CSH A;  2HT9 A;  1O73 A;  4NHW A;  4G0K A;  2GSS A;  2WFC A;  4ZB6 A;  1K0D A;  3GTU A;  2FCH A;  2PUK C;  2XBQ A;  2HZE A;  2C80 A;  3WT1 A;  4X43 A;  4ECI A;  1NHY A;  3WT2 A;  3KD0 A;  1A2J A;  4KUN A;  1GNW A;  5EY6 A;  1R7H A;  1FO5 A;  2DIY A;  1EZK A;  4TKY A;  3TOU A;  1T4Y A;  1N2A A;  2QA2 A;  4V1A p;  1IYH A;  4OO4 A;  1U88 A;  1F6M C;  1TRV A;  1SJ6 A;  2DC5 A;  1AQX A;  4HJM A;  3F4T A;  3HZ8 A;  3ZFB A;  12GS A;  3D4T A;  2H01 A;  3F3R A;  2HFD A;  3I9V 2;  4MK3 A;  5IQY A;  2VIM A;  1TU7 A;  2IFQ A;  4OO5 A;  1M3I A;  2AAW A;  1RW1 A;  5KEJ A;  1OC8 A;  3KMO A;  1GRX A;  1HNA A;  2HRN A;  1PN9 A;  2GLR A;  1YDK A;  3K8N A;  3EU3 A;  1KBN A;  1A2M A;  1R5P A;  4USS A;  1OYJ A;  4EF0 A;  3UEM A;  4H86 A;  1ERW A;  5KN3 A;  2WJU A;  5IO2 A;  2H66 A;  1QMV A;  1EOH A;  4Q5Q A;  2MMZ A;  5JWO B;  5IPH A;  3IA1 A;  4OCF A;  1Z7R A;  1BQ7 A;  1TJD A;  2H1D A;  2H6Z A;  2WDU A;  1S3R A;  2YOI A;  4GF0 A;  1GSD A;  1JFU A;  1VF4 A;  1FB0 A;  1UN2 A;  1YEP A;  1TP9 A;  4YH2 A;  2RII A;  1SYX A;  1X0R A;  2F51 A;  3GH6 A;  1ZYE A;  3IRA A;  4EVM A;  3UBK A;  1FB6 A;  3PPU A;  2N5F A;  3BJ5 A;  3QR6 A;  4JU5 A;  3MIX A;  2LRT A;  3M9K A;  2R3X A;  4K1F A;  1RQM A;  1BED A;  5IM9 A;  3M3M A;  5HR0 A;  2VCT A;  5FHI A;  3I69 A;  3KH9 A;  4EDY A;  3Q74 A;  3M8N A;  3KH7 A;  19GS A;  4GQC A;  1M2D A;  4YKF A;  1K3L A;  4CY6 A;  2QKE A;  3IR4 A;  3ZRE A;  3IDV A;  3APQ A;  4K2D A;  3D21 A;  2R2J A;  4F03 A;  2AB6 A;  4LL1 B;  2X8G A;  3J7Y b;  2MYG A;  2ALB A;  3TGZ A;  5CNW A;  4GRF A;  1XWA A;  2I3Y A;  1Q98 A;  1GSU A;  3ERW A;  2YV7 A;  4GST A;  2LTK A;  3J7Y k;  5HQP A;  4I97 A;  4TXO B;  3Q6O A;  2GZZ A;  3EYT A;  4HUA A;  1O6J A;  4TW5 A;  1VF2 A;  5CRG A;  4NAX A;  5C00 A;  4BVX B;  2X64 A;  2ES7 A;  5KOW A;  4IQ1 A;  2HYX A;  1GUK A;  4OMV A;  4MCU A;  2DIZ A;  2GQK A;  3F9U A;  3OR5 A;  3UJ1 A;  3MSZ A;  4YKG A;  2VCZ A;  3ZFL A;  4KX4 A;  2JZR A;  4L0U A;  3TRP A;  1URM A;  2C0G A;  1K0O A;  2CVB A;  5HR1 A;  4AJ8 A;  1XXU A;  3FZ4 A;  3LGC A;  1ZGN A;  5G5E A;  2HSY A;  3KTL A;  5DVB A;  3VPT A;  1U3I A;  3FK8 A;  3WD6 A;  2MBT A;  1TRU A;  1PSQ A;  1DSB A;  4WF4 A;  3SBC A;  1T3B A;  4DEJ A;  3TRQ A;  3FW2 A;  1X9M B;  3KIJ A;  4Z7X A;  1QK8 A;  3FRC A;  1I5G A;  3FY7 A;  2D2Z A;  2FHE A;  1U6T A;  2GTU A;  1OC3 A;  4DSS B;  1GSE A;  3HVX A;  3IXR A;  3GKX A;  1RK4 A;  4K7I A;  4WR4 A;  8GSS A;  5AIX A;  2YWM A;  4MF6 A;  2PWJ A;  3UAR A;  1FW1 A;  2O85 A;  2XPD A;  2YPM A;  3QPM A;  2GDR A;  4YQV A;  3ZVJ D;  2REM A;  5HFG A;  2J23 A;  5CRE A;  4Q5R A;  1THO A;  2LRN A;  2I4A A;  6GSV A;  4MF5 A;  2HSH A;  1AIU A;  1PL2 A;  5DAL A;  5F0G A;  3GIX A;  4IN0 A;  4XIH A;  3D4M A;  3UOM A;  2GQM A;  1H4O A;  4ZL7 A;  2OE1 A;  2QC7 A;  2UZ8 A;  1PL1 A;  5JCG A;  5DBQ A;  1OE7 A;  4F0B A;  3HCZ A;  5G31 A;  1XVW A;  3HVN A;  3L0H A;  3VWX A;  1FVJ A;  1F37 A;  5F8B A;  2N5B A;  1W4V A;  1TW9 A;  2NTO A;  3PH9 A;  5G30 A;  1JZD A;  4MF7 A;  1AXD A;  1GSF A;  4MMM A;  2GVP A;  1GUL A;  1YQ1 A;  3PR8 A;  1Z6N A;  4NPB A;  1JLW A;  3DXB A;  2GS3 A;  4L5O A;  1QUW A;  2YZU A;  5GAP D;  1QXH A;  2MMO A;  2R6K A;  2YAN A;  2PBJ A;  2DMM A;  3CMI A;  4TRX A;  1K0A A;  2ZNM A;  1TDI A;  1ERU A;  4IHU A;  1Q4J A;  4HQS A;  2RLI A;  2DML A;  1J08 A;  1XVQ A;  2IJY A;  5GAN D;  1IYI A;  2EIQ A;  2E0Q A;  4EDZ A;  1YZX A;  3VWU A;  1YY7 A;  1A0R P;  2JZS A;  2V2G A;  3L9S A;  1ERT A;  2DJ2 A;  5LCZ A;  4X1U A;  3GRX A;  4X4J A;  2LEG A;  4O7H A;  4BPY A;  2BJX A;  3F4R A;  3EE2 A;  2YJ7 A;  1MDJ A;  4NV2 A;  3GL3 A;  3TJG A;  1YF1 A;  22GS A;  14GS A;  4MZC A;  5EVO A;  4FQU A;  5IOW A;  5J9C A;  2TRC P;  3MNG A;  3GX8 A;  4K0N A;  5IOX A;  2IMF A;  4JR6 A;  3DGQ A;  3VI7 A;  1BAY A;  2VM2 A;  2F8F A;  5ELA A;  5ECS A;  2IMD A;  1ZOF A;  1XW6 A;  2HNL A;  2H8L A;  2V6K A;  4K7N A;  1KNG A;  1GSQ A;  2EIR A;  1OVN A;  3GA4 A;  5L71 A;  1GUH A;  4HU9 A;  1XBS A;  2H6X A;  1EP8 A;  4PTS A;  2K6V A;  1TRS A;  2O8V B;  4HU7 A;  2A2R A;  4FO5 A;  2FLS A;  2G2Q A;  3C1R A;  5D9T A;  2FA8 A;  3LOR A;  1ML6 A;  1GL8 A;  1NW2 A;  1WOU A;  1PQN A;  3P90 A;  1NSW A;  5F06 A;  3LSZ A;  3IBH A;  5DJM A;  2IME A;  4JED A;  5DCH A;  5DCG A;  4JR4 A;  2H76 A;  1GP1 A;  1AQV A;  4OFN A;  5J5N A;  3HA9 A;  1R26 A;  1K0M A;  4KA0 A;  2HLS A;  4XS6 A;  2RM6 A;  4IP6 A;  4Z2U A;  4JRR A;  2C0F A;  4GLT A;  2LV3 A;  4XHM A;  1K3Y A;  4IS0 A;  2K8V A;  4PQ1 A;  2F8A A;  4PGT A;  3TJB A;  4AGS A;  2YV9 A;  4ZBD A;  4DSS A;  1GTU A;  1PN0 A;  4J56 E;  2PER A;  13GS A;  2B6M A;  3QOU A;  3ME8 A;  4HDE A;  3D0Z A;  4O5R A;  1B4Q A;  5G5F A;  3DYR A;  2MBS A;  1PA3 A;  2LQO A;  2JSY A;  3RBT A;  5H5Q A;  3DVX A;  2JSZ A;  1ZZY A;  2X8C A;  1HD2 A;  5DQS A;  2OAD A;  2WB9 A;  2JAD A;  5D93 A;  3GHA A;  2B3S A;  3QMX A;  4G0I A;  1G7O A;  1XZO A;  3FZA A;  1A2L A;  3A2V A;  1ZYQ B;  16GS A;  4ZBA A;  1A0F A;  3H1N A;  5JCU A;  4N11 A;  2FWF A;  3KP8 A;  3FR6 A;  4ZB8 A;  4G2E A;  1SD8 A;  4TXV A;  2WS2 A;  3EWL A;  4ZL8 A;  2JL4 A;  2B7J A;  3UIW A;  4K5R A;  1PX7 A;  1ERV A;  4K0G A;  5J3R A;  3CTF A;  4BWQ A;  1XG8 A;  2C0D A;  2M46 A;  4V2M A;  5IPG A;  3QAV A;  4HOJ A;  2VOC A;  2XHF A;  4MJE A;  3KCM A;  4GWR A;  4POM A;  1FHE A;  2CAI A;  4FYB A;  1LBK A;  5HFI A;  4TR4 A;  3TJF A;  3ED3 A;  2V6O A;  4GCI A;  2GGT A;  2YWI A;  2VD0 A;  2N5A A;  4PUA A;  2NVL A;  3UVH A;  2B1K A;  1K0N A;  1SK0 A;  3TKS E;  2R4V A;  5A5K A;  1OC9 A;  4OWY A;  2V41 A;  2VM1 A;  2ON5 A;  4RQR A;  4PX1 A;  2VCQ A;  2PU9 C;  2HRK A;  1GLQ A;  4QL9 A;  4J57 E;  4BA7 A;  2RM5 A;  2DJK A;  3WYW A;  3DIE A;  2VUP A;  5B6N A;  2AUV A;  2X4A A;  1HNB A;  3C71 A;  1VF1 A;  3CRT A;  1W89 A;  3HJO A;  4RUV A;  1V57 A;  1HYU A;  2P5R A;  3IAM 2;  4E8H A;  3R2Q A;  4K5S A;  5IMA A;  3RPP A;  4MJC A;  5JWQ B;  4KW6 A;  1ZMA A;  2LUS A;  1FG4 A;  4K6X A;  2CAQ A;  1XW5 A;  3G7J A;  3NZN A;  1EEM A;  4G19 A;  6GSS A;  1XCC A;  2R37 A;  3RHB A;  3KEB A;  4K8M A;  3DVW A;  2L4Q A;  2FY6 A;  5LNK e;  1M2B A;  1X5E A;  2PVQ A;  2CVK A;  2OJL A;  2LJK A;  20GS A;  3HHV A;  1ZYP A;  4CDO A;  3FZ5 A;  3DKS A;  4K9Z A;  3KGK A;  4PNF A;  5DJL A;  4F0C A;  3QFB C;  3NIV A;  4NXI A;  3E3E A;  2L59 A;  3A5I A;  3F8U A;  2C4J A;  4FYU A;  4N30 A;  2P5Q A;  3L9U A;  2H19 A;  2RUE A;  2H0I A;  4V2N A;  1BYE A;  4L0W A;  4LMV A;  5A4W A;  1OAZ A;  3TKR A;  3F0I A;  1XOA A;  2L6D A;  2B7K A;  1E6B A;  1UC7 A;  2DLX A;  3KP9 A;  2A4H A;  1WE0 A;  1WP0 A;  4X0X A;  4ULX A;  4WBR D;  5ECK B;  1M0U A;  3GUR A;  2FNO A;  2KP2 A;  4GSN A;  2AYT A;  3NOF A;  4EIQ A;  2MZC A;  3A5W A;  2AHE A;  2LRC A;  5ENU A;  1EGR A;  2ON7 A;  3DML A;  3BCI A;  2PVO C;  3BBY A;  4MH2 A;  3MWH A;  4WXT A;  4RQX A;  5CO3 A;  4EL1 A;  4IGJ A;  2WUL A;  5EL8 A;  5GSS A;  3Q19 A;  4YAP A;  2ZCT A;  2YN1 A;  1WMJ A;  4KAE A;  2QGV A;  2WRT A;  4G0L A;  3UAP A;  2AJQ B;  2R0G A;  4TR1 A;  5G2Z A;  4KE3 A;  3FMW A;  4POK A;  3CXG A;  4KF9 A;  2A2P A;  2FWH A;  5BMU A;  4WR5 A;  3EMX A;  2I1U A;  3TKQ A;  2F9S A;  1JHB A;  5ID2 B;  2I9H A;  1FOV A;  4O92 A;  1SKR B;  4FYC A;  2WZ9 A;  2VL2 C;  4D73 B;  2NPB A;  3GKK A;  1B8X A;  4E8E A;  3IPZ A;  3RPN A;  2LQQ A;  2C0E A;  2LS5 A;  3UMA A;  2PMT A;  2CT6 A;  1EP7 A;  1TOF A;  1G6W A;  1T7P B;  2HZF A;  4KSO A;  4A5P A;  4EIP A;  3D6I A;  3F63 A;  3IOS A;  2X99 A;  2LKU A;  1WRY A;  3HVV A;  1ACV A;  4HSC X;  1FAA A;  4XS4 B;  4MNN A;  4L8E A;  1KEB A;  2PPT A;  4ISD A;  1ABA A;  2GT6 A;  4I8B A;  1DE1 A;  4NWY A;  4F9Z A;  2VLT A;  1V58 A;  1F3A A;  3GSS A;  4ZXG A;  3TB2 A;  5ECI B;  1X9W B;  3MYD A;  1SD9 A;  2H1A A;  1NHO A;  2CX4 A;  4EKZ A;  2VL9 A;  1XIY A;  3U5R E;  4ML1 A;  1Z7P A;  4KDU A;  4KDY A;  4YAV A;  1SK2 A;  3IC4 A;  3APO A;  2H1G A;  1OE8 A;  2E2G A;  4Q5F A;  4Q5N A;  1PKW A;  4JE1 A;  4KCE A;  5KN1 A;  3ZVJ A;  3HJP A;  5HR3 A;  17GS A;  2C8U A;  3KZQ A;  2M72 A;  1AUC A;  3HZ4 A;  4ACS A;  5B7C A;  1GWC A;  3FR3 A;  3LFL A;  4K7O A;  4ZIL A;  3L4N A;  3PGT A;  2HXK A;  1AC1 A;  1Y6E A;  3ME7 A;  1SU9 A;  3F6F A;  5J9B A;  4Z2R A;  3EIN A;  3BD2 A;  3O3T A;  5FWG A;  1I9D A;  2X8H A;  1O7U A;  2ZUP A;  4MJA A;  4GSS A;  11GS A;  3G9B A;  4IEL A;  2DJ0 A;  1T8E B;  4GQF A;  2V1M A;  3IK9 A;  1C72 A;  2IN3 A;  3EU4 A;  1HNC A;  1EEJ A;  5GZZ B;  1O8X A;  1R5A A;  4IKH A;  2H6Y A;  2V32 A;  2QA1 A;  3P2A A;  5COH A;  2DBC A;  5A4U A;  4ZB9 A;  1OKT A;  2IFQ B;  3MAK A;  1WWJ A;  3C73 A;  4MDC A;  1U87 A;  1QQ2 A;  1VF3 A;  5D9W A;  3S9F A;  2OKA A;  4MJB A;  5DAK B;  1AAZ A;  1K3O A;  3IC8 A;  1GH2 A;  3ERF A;  3ZIJ A;  5AN1 A;  2GSR A;  1SK1 A;  3ZIV A;  1GLP A;  1E2Y A;  4I6X A;  3IV4 A;  4BVY B;  4HZ2 A;  2OA7 A;  1Y25 A;  6GST A;  1DUG A;  4TXO A;  5ECR B;  4ECC A;  1TI3 A;  1XWK A;  6GSW A;  5IO0 A;  2R5G A;  3HKR A;  4HI7 A;  4BVX A;  3TKP A;  4EUY A;  5KOX A;  3MDK A;  5ECQ B;  1H75 A;  5IMZ A;  1CQH A;  1PD2 1;  5LD0 A;  4HQZ A;  4G10 A;  1A8L A;  4TR3 A;  2L4C A;  1M7T A;  2VLV A;  1G0T A;  4N10 A;  2VCV A;  4MAB A;  1M9B A;  3ZMK A;  4OFM A;  1TXX A;  5AIV A;  1JLV A;  5G1K A;  5ID2 A;  1UVZ A;  5CAX A;  3EVI A;  3VPQ A;  2R0C A;  3O76 A;  3ISO A;  2MMA A;  3CTG A;  4Z2T A;  3PIN A;  1V40 A;  3LYP A;  2YWN A;  4OD7 A;  1S3C A;  4WEY A;  5E59 A;  4IJI A;  1Z9H A;  5JCW A;  4J2F A;  4V2L A;  1J9B A;  1SKS B;  2H72 A;  4XS4 A;  1TRW A;  1AW9 A;  4ID0 A;  2CV4 A;  1N8J A;  3FKF A;  3LXZ A;  1Z5Y E;  3CQF A;  3KXO A;  1PFO A;  2WGR A;  4N0Z A;  1SJZ A;  2JZT A;  1PGT A;  1THX A;  3VFI A;  5J4U A;  4DVC A;  4XCS A;  4WBJ A;  4LL4 B;  1SJI A;  1GNE A;  2IMK A;  2LNS A;  3TJK A;  1EGO A;  3ERG A;  4HS1 A;  3ZLP A;  2VAF A;  4G9H A;  1WJK A;  3GYK A;  2L5O A;  4BWS A;  1A8Y A;  3LJR A;  2VD1 A;  4V1A g;  3UL3 A;  2C3N A;  4GTU A;  2KP1 A;  3ZRD A;  3TKS C;  2A2S A;  2YNX A;  2IPA A;  3KJY A;  1A23 A;  1YEX A;  5GST A;  3RAZ A;  4JZQ A;  4KB3 A;  1ZCP A;  1YJ6 A;  1FVK A;  1B4P A;  4KH7 A;  4O32 A;  3CSI A;  4DSQ A;  4IW9 A;  1T1V A;  1EOG A;  4CW9 A;  1G7E A;  5J41 A;  3BCK A;  5F05 A;  4QL7 A;  5AGY A;  4ZL9 A;  2B1L A;  5FT3 A;  2OAC A;  4KND A;  3HXS A;  1UA5 A;  4HZ4 A;  3M0F A;  1X5D A;  2H70 A;  3QCP A;  2KHP A;  3LWA A;  5D73 A;  3ZL5 A;  3QAW A;  2IMI A;  5CRW A;  4MPG A;  3L78 A;  2YCD A;  4CHS A;  4I2U A;  3W8J A;  2KOK A;  3ZYW A;  2C3Q A;  2B5E A;  2L57 A;  2FGX A;  2H30 A;  4NHZ A;  3A2W A;  1GUM A;  1K0C A;  1WPI A;  3IHQ A;  3GL5 A;  1GSS A;  1CQG A;  2WCI A;  4TN8 A;  2YP6 A;  4ILF A;  3ZZX A;  3QD9 A;  6GSU A;  1FOH A;  3CRU A;  4MPF A;  1Z3E A;  3C7M A;  3AY8 A;  4WKW A;  1X5C A;  5D9V A;  5B8A A;  5DAK A;  2KLX A;  5DAL B;  3E9J B;  4AF2 A;  1TU8 A;  2F3M A;  2GT5 A;  5D8I A;  1SYR A;  1TK8 B;  5INY A;  5CYY A;  1SL0 B;  4MLY A;  2H0H A;  4MP4 A;  2IIY A;  3GKM A;  4BVY A;  3M1G A;  3P7X A;  1QFN A;  3LYK A;  5F07 A;  1ZYN A;  4XTS A;  5KN2 A;  1XPV A;  2DJ1 A;  18GS A;  1PKZ A;  1Z6M A;  1MTC A;  4XRD A;  1NM3 A;  3WGD A;  4N0V A;  4LMW A;  5IMD A;  2AV4 A;  2B5Y A;  3FEU A;  2IL3 A;  3LW9 A;  5G1L A;  1EV4 A;  4EC0 A;  3R3E A;  4PXO A;  2DKH A;  4ECB A;  4P3Y B;  2FA4 A;  5ECH B;  3M9J A;  2B5X A;  4KSM A;  2O87 A;  1B9X C;  2RUF A;  3H79 A;  3US3 A;  6GSY A;  4YQU A;  2A4V A;  4EXJ A;  2OBI A;  4FIW A;  4FH8 A;  5CP1 A;  3VK9 A;  3EPT A;  4YQM A;  5IMV A;  2K9F A;  2OBK A;  1GSY A;  3I43 A;  5CRH A;  1J0F A;  3D5J A;  2VL2 A;  1EWX A;  4TVE A;  4I5Q A;  3Q18 A;  1BG5 A;  3SWL A;  3QDN A;  2C3T A;  1BJX A;  1JZW A;  2EC4 A;  1ST9 A;  4F82 A;  2FUG 2;  1EV9 A;  10GS A;  5IMC A;  4MH3 A;  2IWT A;  2XPE A;  3KTB A;  5ECO B;  7GSS A;  1DBY A;  1DE2 A;  2GQL A;  1XFL A;  2XC2 A;  1QGV A;  3HJM A;  1YF0 A;  3DEX A;  1M2A A;  2CX3 A;  5H5R A;  2PGT A;  3IE3 A;  3LEF A;  4KCA A;  2FD3 A;  3F4S A;  3GST A;  2VCX A;  4IP1 A;  2O89 A;  2DJJ A;  4QQ7 A;  1LU4 A;  1SEN A;  2KUC A;  3KMN A;  2L5L A;  3IHG A;  2BMX A;  3QFA C;  2O7K A;  5ABR A;  1ILO A;  5HR2 A;  1TI1 A;  5A4V A;  1V98 A;  3UVT A;  2R0P A;  3I6A A;  2H75 A;  4NV5 A;  3ZML A;  1O8W A;  4BIK A;  1M99 A;  3N9J A;  4IJ3 A;  1XWB A;  4IVF A;  5H5S A;  1GTI A;  5ECM B;  1V2A A;  4L5L A;  1USB A;  2FWG A; 
#chains in the Genus database with same CATH homology
 5D96 A;  2H1B A;  3VLN A;  2DSA A;  2VO4 A;  2CQ9 A;  1XWG A;  1G6Y A;  1WIK A;  3UBL A;  3GX0 A;  2TRX A;  4PQI A;  2GZY A;  3HDC A;  3F3Q A;  3TOT A;  5C04 A;  2QSI A;  3U6V A;  3GKN A;  1T00 A;  1TTZ A;  4ZBB A;  3TDG A;  4BL7 B;  3WGX A;  2NDO A;  2CZ3 A;  2LST A;  1ON4 A;  5JWR B;  5ECP B;  2HSM A;  3DWV A;  4KDX A;  5DDL A;  3V1W A;  1TK0 B;  3WGE A;  3HY2 A;  1JZO A;  1O85 A;  1F2E A;  4RI7 A;  4POB A;  2HE3 A;  1F3B A;  3EUR A;  1A24 A;  3VI5 A;  3GTU B;  4ECJ A;  3A3T A;  5ECL B;  2K8S A;  2HZE B;  3C8E A;  2JU5 A;  3GNJ A;  5KN0 A;  2E7P A;  1MDK A;  1R4W A;  2DKI A;  4F2I A;  4O5U A;  5CRD A;  2MMN A;  4PNG A;  1U3A A;  3LXT A;  1YKA A;  4OFT A;  4AJ7 A;  4PUR A;  3CYN A;  2BTO T;  3JCM L;  3GUS A;  4MZB A;  1MD4 A;  4CY8 A;  1TK5 B;  2XBI A;  3G7I A;  5IMF A;  1B48 A;  3BOA A;  2TIR A;  1V9W A;  2PN8 A;  3GN3 A;  1LJR A;  1YKC A;  2VL3 A;  2H74 A;  4JBB A;  2CA8 A;  4LA1 A;  3LG6 A;  3DD3 A;  9GSS A;  4TR0 A;  4NMU A;  3W8S A;  4DSR A;  5ELG A;  4POL A;  2H73 A;  3N5O A;  5DQY A;  4LLR A;  5EPF A;  1O81 A;  3H4K A;  4O5Q A;  3TRX A;  1BX9 A;  4EO3 A;  5IIZ A;  3H8Q A;  5D9X A;  3TJJ A;  1B9Y C;  3TCO A;  3D22 A;  2NBS A;  1F9M A;  4AJ6 A;  2P0G A;  4WF5 A;  1S3A A;  1XW9 A;  1OC9 B;  4I2T A;  1ZL9 A;  5E4W A;  3VWW A;  2GSQ A;  3H93 A;  2H71 A;  3CBU A;  5HFK A;  3APS A;  1TKD B;  1PRX A;  1MD3 A;  3GV1 A;  3FHK A;  3L9V A;  3E0U A;  1KTE A;  4GXZ A;  4WET A;  1XOB A;  1VRS D;  3ZIT A;  2G0F A;  2FWE A;  2M80 A;  2VLU A;  3HVS A;  3GMF A;  3GH9 A;  2LJR A;  4IBP A;  4PUF C;  3O6T A;  1SL1 B;  1VGL A;  5ECN B;  1PMT A;  3FYG A;  2OE0 A;  1MEK A;  3P8W A;  4K2X A;  2OE3 A;  2E2M A;  1SL2 B;  3LQ7 A;  3GFK A;  4XS1 A;  2GST A;  2YZH A;  4PQH A;  3C1S A;  3VWV A;  3ZTL A;  3TUE A;  2LJA A;  2GZP A;  2X49 A;  4D73 A;  3EMP A;  1K0B A;  1PX6 A;  5AIS A;  2HRA A;  4IQA A;  4MA9 A;  1HQO A;  1JZR A;  5BRT A;  3RDW A;  2CZ2 A;  2YWO A;  4XRA A;  3IAS 2;  1MDI A;  3EC3 A;  2K18 A;  3A2X A;  4ZIJ A;  3IK7 A;  2H0G A;  3F6D A;  2HI7 A;  2LNT A;  3KM6 A;  3QAG A;  4ICY A;  2CVD A;  3TKS A;  1AQW A;  5B8B A;  3FR9 A;  2VCW A;  6GSX A;  4EE0 A;  2JAC A;  4TOP A;  1XWC A;  1S3D A;  1OKD A;  2YJH A;  3FZ9 A;  1X9S B;  2Z9S A;  3VUR A;  3CSJ A;  2DJ3 A;  2L6C A;  2EIO A;  2J9H A;  2HRF A;  3DRN A;  1GTB A;  3G7Y A;  1M9A A;  3HD5 A;  3HYP A;  4OCE A;  1GTA A;  3W6G A;  2I81 A;  4HJ2 A;  2C1Y A;  1T4Z A;  4BL7 A;  4MZW A;  4ML6 A;  3RHC A;  4RI6 A;  1SKW B;  5B6M A;  2P31 A;  4KGI A;  4HEA 2;  4TR1 B;  3CSH A;  2HT9 A;  1O73 A;  4NHW A;  4G0K A;  2GSS A;  2WFC A;  4ZB6 A;  1K0D A;  3GTU A;  2FCH A;  2PUK C;  2XBQ A;  2HZE A;  2C80 A;  3WT1 A;  4X43 A;  4ECI A;  1NHY A;  3WT2 A;  3KD0 A;  1A2J A;  4KUN A;  1GNW A;  5EY6 A;  1R7H A;  1FO5 A;  2DIY A;  1EZK A;  4TKY A;  3TOU A;  1T4Y A;  1N2A A;  2QA2 A;  4V1A p;  1IYH A;  4OO4 A;  1U88 A;  1F6M C;  1TRV A;  1SJ6 A;  2DC5 A;  1AQX A;  4HJM A;  3F4T A;  3HZ8 A;  3ZFB A;  12GS A;  3D4T A;  2H01 A;  3F3R A;  2HFD A;  3I9V 2;  4MK3 A;  5IQY A;  2VIM A;  1TU7 A;  2IFQ A;  4OO5 A;  2AAW A;  1RW1 A;  5KEJ A;  1OC8 A;  3KMO A;  1GRX A;  1HNA A;  2HRN A;  1PN9 A;  2GLR A;  1YDK A;  3K8N A;  3EU3 A;  1KBN A;  1A2M A;  1R5P A;  4USS A;  1OYJ A;  4EF0 A;  3UEM A;  4H86 A;  1ERW A;  5KN3 A;  2WJU A;  5IO2 A;  2H66 A;  1QMV A;  1EOH A;  4Q5Q A;  2MMZ A;  5JWO B;  5IPH A;  3IA1 A;  4OCF A;  1Z7R A;  1BQ7 A;  1TJD A;  2H1D A;  2H6Z A;  2WDU A;  2YOI A;  4GF0 A;  1GSD A;  1JFU A;  1VF4 A;  1FB0 A;  1UN2 A;  1YEP A;  1TP9 A;  4YH2 A;  2RII A;  1SYX A;  1X0R A;  2F51 A;  3GH6 A;  1ZYE A;  3IRA A;  4EVM A;  3UBK A;  1FB6 A;  3PPU A;  2N5F A;  3BJ5 A;  3QR6 A;  4JU5 A;  3MIX A;  2LRT A;  3M9K A;  2R3X A;  4K1F A;  1RQM A;  1BED A;  5IM9 A;  3M3M A;  5HR0 A;  2VCT A;  5FHI A;  3I69 A;  3KH9 A;  4EDY A;  3Q74 A;  3M8N A;  3KH7 A;  19GS A;  4GQC A;  1M2D A;  4YKF A;  1K3L A;  4CY6 A;  2QKE A;  3IR4 A;  3ZRE A;  3IDV A;  3APQ A;  4K2D A;  3D21 A;  2R2J A;  4F03 A;  2AB6 A;  4LL1 B;  2X8G A;  3J7Y b;  2MYG A;  2ALB A;  3TGZ A;  5CNW A;  4GRF A;  1XWA A;  2I3Y A;  1Q98 A;  1GSU A;  3ERW A;  2YV7 A;  4GST A;  2LTK A;  3J7Y k;  5HQP A;  4I97 A;  4TXO B;  3Q6O A;  2GZZ A;  3EYT A;  4HUA A;  1O6J A;  4TW5 A;  1VF2 A;  5CRG A;  4NAX A;  5C00 A;  4BVX B;  2X64 A;  2ES7 A;  5KOW A;  4IQ1 A;  2HYX A;  1GUK A;  4OMV A;  4MCU A;  2DIZ A;  2GQK A;  3F9U A;  3OR5 A;  3UJ1 A;  3MSZ A;  4YKG A;  2VCZ A;  3ZFL A;  4KX4 A;  2JZR A;  4L0U A;  3TRP A;  1URM A;  2C0G A;  1K0O A;  2CVB A;  5HR1 A;  4AJ8 A;  1XXU A;  3FZ4 A;  3LGC A;  1ZGN A;  5G5E A;  2HSY A;  3KTL A;  5DVB A;  3VPT A;  1U3I A;  3FK8 A;  3WD6 A;  2MBT A;  1TRU A;  1PSQ A;  1DSB A;  4WF4 A;  3SBC A;  1T3B A;  4DEJ A;  3TRQ A;  3FW2 A;  1X9M B;  3KIJ A;  4Z7X A;  1QK8 A;  3FRC A;  1I5G A;  3FY7 A;  2D2Z A;  2FHE A;  1U6T A;  2GTU A;  1OC3 A;  4DSS B;  1GSE A;  3HVX A;  3IXR A;  3GKX A;  1RK4 A;  4K7I A;  4WR4 A;  8GSS A;  5AIX A;  2YWM A;  4MF6 A;  2PWJ A;  3UAR A;  1FW1 A;  2O85 A;  2XPD A;  2YPM A;  3QPM A;  2GDR A;  4YQV A;  3ZVJ D;  2REM A;  5HFG A;  2J23 A;  5CRE A;  4Q5R A;  1THO A;  2LRN A;  2I4A A;  6GSV A;  4MF5 A;  2HSH A;  1AIU A;  1PL2 A;  5DAL A;  5F0G A;  3GIX A;  4IN0 A;  4XIH A;  3D4M A;  3UOM A;  2GQM A;  1H4O A;  4ZL7 A;  2OE1 A;  2QC7 A;  2UZ8 A;  1PL1 A;  5JCG A;  5DBQ A;  1OE7 A;  4F0B A;  3HCZ A;  5G31 A;  1XVW A;  3L0H A;  3VWX A;  1FVJ A;  1F37 A;  5F8B A;  2N5B A;  1W4V A;  1TW9 A;  2NTO A;  3PH9 A;  5G30 A;  1JZD A;  4MF7 A;  1AXD A;  1GSF A;  4MMM A;  2GVP A;  1GUL A;  1YQ1 A;  3PR8 A;  1Z6N A;  4NPB A;  1JLW A;  3DXB A;  2GS3 A;  4L5O A;  1QUW A;  2YZU A;  5GAP D;  1QXH A;  2MMO A;  2R6K A;  2YAN A;  2PBJ A;  2DMM A;  3CMI A;  4TRX A;  1K0A A;  2ZNM A;  1TDI A;  1ERU A;  4IHU A;  1Q4J A;  4HQS A;  2RLI A;  2DML A;  1J08 A;  1XVQ A;  2IJY A;  5GAN D;  1IYI A;  2EIQ A;  2E0Q A;  4EDZ A;  1YZX A;  3VWU A;  1YY7 A;  1A0R P;  2JZS A;  2V2G A;  3L9S A;  1ERT A;  2DJ2 A;  5LCZ A;  4X1U A;  3GRX A;  4X4J A;  2LEG A;  4O7H A;  4BPY A;  2BJX A;  3F4R A;  3EE2 A;  2YJ7 A;  1MDJ A;  4NV2 A;  3GL3 A;  3TJG A;  1YF1 A;  22GS A;  14GS A;  4MZC A;  5EVO A;  4FQU A;  5IOW A;  5J9C A;  2TRC P;  3MNG A;  3GX8 A;  4K0N A;  5IOX A;  2IMF A;  4JR6 A;  3DGQ A;  3VI7 A;  1BAY A;  2VM2 A;  2F8F A;  5ELA A;  5ECS A;  2IMD A;  1ZOF A;  1XW6 A;  2HNL A;  2H8L A;  2V6K A;  4K7N A;  1KNG A;  1GSQ A;  2EIR A;  1OVN A;  3GA4 A;  5L71 A;  1GUH A;  4HU9 A;  1XBS A;  2H6X A;  1EP8 A;  4PTS A;  2K6V A;  1TRS A;  2O8V B;  4HU7 A;  2A2R A;  4FO5 A;  2FLS A;  2G2Q A;  3C1R A;  5D9T A;  2FA8 A;  3LOR A;  1ML6 A;  1GL8 A;  1NW2 A;  1WOU A;  1PQN A;  3P90 A;  1NSW A;  5F06 A;  3LSZ A;  3IBH A;  5DJM A;  2IME A;  4JED A;  5DCH A;  5DCG A;  4JR4 A;  2H76 A;  1GP1 A;  1AQV A;  4OFN A;  5J5N A;  3HA9 A;  1R26 A;  1K0M A;  4KA0 A;  2HLS A;  4XS6 A;  2RM6 A;  4IP6 A;  4Z2U A;  4JRR A;  2C0F A;  4GLT A;  2LV3 A;  4XHM A;  1K3Y A;  4IS0 A;  2K8V A;  4PQ1 A;  2F8A A;  4PGT A;  3TJB A;  4AGS A;  2YV9 A;  4ZBD A;  4DSS A;  1GTU A;  1PN0 A;  4J56 E;  2PER A;  13GS A;  2B6M A;  3QOU A;  3ME8 A;  4HDE A;  3D0Z A;  4O5R A;  1B4Q A;  5G5F A;  3DYR A;  2MBS A;  1PA3 A;  2LQO A;  2JSY A;  3RBT A;  5H5Q A;  3DVX A;  2JSZ A;  1ZZY A;  2X8C A;  1HD2 A;  5DQS A;  2OAD A;  2WB9 A;  2JAD A;  5D93 A;  3GHA A;  2B3S A;  3QMX A;  4G0I A;  1G7O A;  1XZO A;  3FZA A;  1A2L A;  3A2V A;  1ZYQ B;  16GS A;  4ZBA A;  1A0F A;  3H1N A;  5JCU A;  4N11 A;  2FWF A;  3KP8 A;  3FR6 A;  4ZB8 A;  4G2E A;  1SD8 A;  4TXV A;  2WS2 A;  3EWL A;  4ZL8 A;  2JL4 A;  2B7J A;  3UIW A;  4K5R A;  1PX7 A;  1ERV A;  4K0G A;  5J3R A;  3CTF A;  4BWQ A;  2C0D A;  2M46 A;  4V2M A;  5IPG A;  3QAV A;  4HOJ A;  2VOC A;  2XHF A;  4MJE A;  3KCM A;  4GWR A;  4POM A;  1FHE A;  2CAI A;  4FYB A;  1LBK A;  5HFI A;  4TR4 A;  3TJF A;  3ED3 A;  2V6O A;  4GCI A;  2GGT A;  2YWI A;  2VD0 A;  2N5A A;  4PUA A;  2NVL A;  3UVH A;  2B1K A;  1K0N A;  1SK0 A;  3TKS E;  2R4V A;  5A5K A;  1OC9 A;  4OWY A;  2V41 A;  2VM1 A;  2ON5 A;  4RQR A;  4PX1 A;  2VCQ A;  2PU9 C;  2HRK A;  1GLQ A;  4QL9 A;  4J57 E;  4BA7 A;  2RM5 A;  2DJK A;  3WYW A;  3DIE A;  2VUP A;  5B6N A;  2AUV A;  2X4A A;  1HNB A;  3C71 A;  1VF1 A;  3CRT A;  1W89 A;  3HJO A;  4RUV A;  1V57 A;  1HYU A;  2P5R A;  3IAM 2;  4E8H A;  3R2Q A;  4K5S A;  5IMA A;  3RPP A;  4MJC A;  5JWQ B;  4KW6 A;  1ZMA A;  2LUS A;  1FG4 A;  4K6X A;  2CAQ A;  1XW5 A;  3G7J A;  3NZN A;  1EEM A;  4G19 A;  6GSS A;  1XCC A;  2R37 A;  3RHB A;  3KEB A;  4K8M A;  3DVW A;  2L4Q A;  2FY6 A;  5LNK e;  1M2B A;  1X5E A;  2PVQ A;  2CVK A;  2OJL A;  2LJK A;  20GS A;  3HHV A;  1ZYP A;  4CDO A;  3FZ5 A;  3DKS A;  4K9Z A;  3KGK A;  4PNF A;  5DJL A;  4F0C A;  3QFB C;  3NIV A;  4NXI A;  3E3E A;  2L59 A;  3A5I A;  3F8U A;  2C4J A;  4FYU A;  4N30 A;  2P5Q A;  3L9U A;  2H19 A;  2RUE A;  2H0I A;  4V2N A;  1BYE A;  4L0W A;  4LMV A;  5A4W A;  1OAZ A;  3TKR A;  3F0I A;  1XOA A;  2L6D A;  2B7K A;  1E6B A;  1UC7 A;  2DLX A;  3KP9 A;  2A4H A;  1WE0 A;  1WP0 A;  4X0X A;  4ULX A;  4WBR D;  5ECK B;  1M0U A;  3GUR A;  2FNO A;  2KP2 A;  4GSN A;  2AYT A;  3NOF A;  4EIQ A;  2MZC A;  3A5W A;  2AHE A;  2LRC A;  5ENU A;  1EGR A;  2ON7 A;  3DML A;  3BCI A;  2PVO C;  3BBY A;  4MH2 A;  3MWH A;  4WXT A;  4RQX A;  5CO3 A;  4EL1 A;  4IGJ A;  2WUL A;  5EL8 A;  5GSS A;  3Q19 A;  4YAP A;  2ZCT A;  2YN1 A;  1WMJ A;  4KAE A;  2QGV A;  2WRT A;  4G0L A;  3UAP A;  2AJQ B;  2R0G A;  4TR1 A;  5G2Z A;  4KE3 A;  3FMW A;  4POK A;  3CXG A;  4KF9 A;  2A2P A;  2FWH A;  5BMU A;  4WR5 A;  3EMX A;  2I1U A;  3TKQ A;  2F9S A;  1JHB A;  5ID2 B;  2I9H A;  1FOV A;  4O92 A;  1SKR B;  4FYC A;  2WZ9 A;  2VL2 C;  4D73 B;  2NPB A;  3GKK A;  1B8X A;  4E8E A;  3IPZ A;  3RPN A;  2LQQ A;  2C0E A;  2LS5 A;  3UMA A;  2PMT A;  2CT6 A;  1EP7 A;  1TOF A;  1G6W A;  1T7P B;  2HZF A;  4KSO A;  4A5P A;  4EIP A;  3D6I A;  3F63 A;  3IOS A;  2X99 A;  2LKU A;  1WRY A;  3HVV A;  1ACV A;  1FAA A;  4XS4 B;  4MNN A;  4L8E A;  1KEB A;  2PPT A;  4ISD A;  1ABA A;  2GT6 A;  4I8B A;  1DE1 A;  4NWY A;  4F9Z A;  2VLT A;  1V58 A;  1F3A A;  3GSS A;  4ZXG A;  3TB2 A;  5ECI B;  1X9W B;  3MYD A;  1SD9 A;  2H1A A;  1NHO A;  2CX4 A;  4EKZ A;  2VL9 A;  1XIY A;  3U5R E;  4ML1 A;  1Z7P A;  4KDU A;  4KDY A;  4YAV A;  1SK2 A;  3IC4 A;  3APO A;  2H1G A;  1OE8 A;  2E2G A;  4Q5F A;  4Q5N A;  1PKW A;  4JE1 A;  4KCE A;  5KN1 A;  3ZVJ A;  3HJP A;  5HR3 A;  17GS A;  2C8U A;  3KZQ A;  2M72 A;  1AUC A;  3HZ4 A;  4ACS A;  5B7C A;  1GWC A;  3FR3 A;  3LFL A;  4K7O A;  4ZIL A;  3L4N A;  3PGT A;  2HXK A;  1AC1 A;  1Y6E A;  3ME7 A;  1SU9 A;  3F6F A;  5J9B A;  4Z2R A;  3EIN A;  3BD2 A;  3O3T A;  5FWG A;  1I9D A;  2X8H A;  1O7U A;  2ZUP A;  4MJA A;  4GSS A;  11GS A;  3G9B A;  4IEL A;  2DJ0 A;  1T8E B;  4GQF A;  2V1M A;  3IK9 A;  1C72 A;  2IN3 A;  3EU4 A;  1HNC A;  1EEJ A;  5GZZ B;  1O8X A;  1R5A A;  4IKH A;  2H6Y A;  2V32 A;  2QA1 A;  3P2A A;  5COH A;  2DBC A;  5A4U A;  4ZB9 A;  1OKT A;  2IFQ B;  3MAK A;  1WWJ A;  3C73 A;  4MDC A;  1U87 A;  1QQ2 A;  1VF3 A;  5D9W A;  3S9F A;  2OKA A;  4MJB A;  5DAK B;  1AAZ A;  1K3O A;  3IC8 A;  1GH2 A;  3ERF A;  3ZIJ A;  5AN1 A;  2GSR A;  1SK1 A;  3ZIV A;  1GLP A;  1E2Y A;  4I6X A;  3IV4 A;  4BVY B;  4HZ2 A;  2OA7 A;  1Y25 A;  6GST A;  1DUG A;  4TXO A;  5ECR B;  4ECC A;  1TI3 A;  1XWK A;  6GSW A;  5IO0 A;  2R5G A;  3HKR A;  4HI7 A;  4BVX A;  3TKP A;  4EUY A;  5KOX A;  3MDK A;  5ECQ B;  1H75 A;  5IMZ A;  1CQH A;  1PD2 1;  5LD0 A;  4HQZ A;  4G10 A;  1A8L A;  4TR3 A;  2L4C A;  1M7T A;  2VLV A;  1G0T A;  4N10 A;  2VCV A;  4MAB A;  1M9B A;  3ZMK A;  4OFM A;  1TXX A;  5AIV A;  1JLV A;  5G1K A;  5ID2 A;  1UVZ A;  5CAX A;  3EVI A;  3VPQ A;  2R0C A;  3O76 A;  3ISO A;  2MMA A;  3CTG A;  4Z2T A;  3PIN A;  1V40 A;  3LYP A;  2YWN A;  4OD7 A;  1S3C A;  4WEY A;  5E59 A;  4IJI A;  1Z9H A;  5JCW A;  4J2F A;  4V2L A;  1J9B A;  1SKS B;  2H72 A;  4XS4 A;  1TRW A;  1AW9 A;  4ID0 A;  2CV4 A;  1N8J A;  3FKF A;  3LXZ A;  1Z5Y E;  3KXO A;  2WGR A;  4N0Z A;  1SJZ A;  2JZT A;  1PGT A;  1THX A;  3VFI A;  5J4U A;  4DVC A;  4XCS A;  4WBJ A;  4LL4 B;  1SJI A;  1GNE A;  2IMK A;  2LNS A;  3TJK A;  1EGO A;  3ERG A;  4HS1 A;  3ZLP A;  2VAF A;  4G9H A;  1WJK A;  3GYK A;  2L5O A;  4BWS A;  1A8Y A;  3LJR A;  2VD1 A;  4V1A g;  3UL3 A;  2C3N A;  4GTU A;  2KP1 A;  3ZRD A;  3TKS C;  2A2S A;  2YNX A;  2IPA A;  3KJY A;  1A23 A;  1YEX A;  5GST A;  3RAZ A;  4JZQ A;  4KB3 A;  1ZCP A;  1YJ6 A;  1FVK A;  1B4P A;  4KH7 A;  4O32 A;  3CSI A;  4DSQ A;  4IW9 A;  1T1V A;  1EOG A;  4CW9 A;  1G7E A;  5J41 A;  3BCK A;  5F05 A;  4QL7 A;  5AGY A;  4ZL9 A;  2B1L A;  5FT3 A;  2OAC A;  4KND A;  3HXS A;  1UA5 A;  4HZ4 A;  3M0F A;  1X5D A;  2H70 A;  3QCP A;  2KHP A;  3LWA A;  5D73 A;  3ZL5 A;  3QAW A;  2IMI A;  5CRW A;  4MPG A;  3L78 A;  2YCD A;  4CHS A;  4I2U A;  3W8J A;  2KOK A;  3ZYW A;  2C3Q A;  2B5E A;  2L57 A;  2FGX A;  2H30 A;  4NHZ A;  3A2W A;  1GUM A;  1K0C A;  1WPI A;  3IHQ A;  3GL5 A;  1GSS A;  1CQG A;  2WCI A;  4TN8 A;  2YP6 A;  4ILF A;  3ZZX A;  3QD9 A;  6GSU A;  1FOH A;  3CRU A;  4MPF A;  1Z3E A;  3C7M A;  3AY8 A;  4WKW A;  1X5C A;  5D9V A;  5B8A A;  5DAK A;  2KLX A;  5DAL B;  3E9J B;  4AF2 A;  1TU8 A;  2F3M A;  2GT5 A;  5D8I A;  1SYR A;  1TK8 B;  5INY A;  5CYY A;  1SL0 B;  4MLY A;  2H0H A;  4MP4 A;  2IIY A;  3GKM A;  4BVY A;  3M1G A;  3P7X A;  1QFN A;  3LYK A;  5F07 A;  1ZYN A;  4XTS A;  5KN2 A;  1XPV A;  2DJ1 A;  18GS A;  1PKZ A;  1Z6M A;  1MTC A;  4XRD A;  1NM3 A;  3WGD A;  4N0V A;  4LMW A;  5IMD A;  2AV4 A;  2B5Y A;  3FEU A;  2IL3 A;  3LW9 A;  5G1L A;  1EV4 A;  4EC0 A;  3R3E A;  4PXO A;  2DKH A;  4ECB A;  4P3Y B;  2FA4 A;  5ECH B;  3M9J A;  2B5X A;  4KSM A;  2O87 A;  1B9X C;  2RUF A;  3H79 A;  3US3 A;  6GSY A;  4YQU A;  2A4V A;  4EXJ A;  2OBI A;  4FIW A;  4FH8 A;  5CP1 A;  3VK9 A;  3EPT A;  4YQM A;  5IMV A;  2K9F A;  2OBK A;  1GSY A;  3I43 A;  5CRH A;  1J0F A;  3D5J A;  2VL2 A;  1EWX A;  4TVE A;  4I5Q A;  3Q18 A;  1BG5 A;  3SWL A;  3QDN A;  2C3T A;  1BJX A;  1JZW A;  2EC4 A;  1ST9 A;  4F82 A;  2FUG 2;  1EV9 A;  10GS A;  5IMC A;  4MH3 A;  2IWT A;  2XPE A;  3KTB A;  5ECO B;  7GSS A;  1DBY A;  1DE2 A;  2GQL A;  1XFL A;  2XC2 A;  1QGV A;  3HJM A;  1YF0 A;  3DEX A;  1M2A A;  2CX3 A;  5H5R A;  2PGT A;  3IE3 A;  3LEF A;  4KCA A;  2FD3 A;  3F4S A;  3GST A;  2VCX A;  4IP1 A;  2O89 A;  2DJJ A;  4QQ7 A;  1LU4 A;  1SEN A;  2KUC A;  3KMN A;  2L5L A;  3IHG A;  2BMX A;  3QFA C;  2O7K A;  5ABR A;  1ILO A;  5HR2 A;  1TI1 A;  5A4V A;  1V98 A;  3UVT A;  2R0P A;  3I6A A;  2H75 A;  4NV5 A;  3ZML A;  1O8W A;  1M99 A;  3N9J A;  4IJ3 A;  1XWB A;  4IVF A;  5H5S A;  1GTI A;  5ECM B;  1V2A A;  4L5L A;  1USB A;  2FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...