4TKYA

The complex structure of e. coli dsba bound to a peptide at the dsba/dsbb interface
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/peptide inhibitor
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Peptide Inhibitors of the Escherichia coli DsbA Oxidative Machinery Essential for Bacterial Virulence.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tkyA00
4MP4A 4JRRA 4GSTA 3A2WA 3LQ7A 3WT2A 4IVFA 3RHCA 5CRDA 3U5RE 5EL8A 4F03A 4WBJA 1M0UA 1XVQA 2HI7A 4HJMA 2IWTA 1TI1A 4TXOB 2WRTA 3KH9A 2LKUA 8GSSA 5ELAA 4ZB6A 4X0XA 5IPHA 5ECMB 3ZFBA 3O76A 4MF5A 4ZBAA 4BA7A 1GNEA 1Z7PA 3GKNA 2YWOA 4WEYA 2VL3A 2C1YA 2DJ0A 3TGZA 2IMEA 2FWFA 5ENUA 3L78A 2VLTA 1EZKA 1F2EA 4V2LA 3TJBA 4BWSA 4MZWA 3UJ1A 3Q18A 2VL9A 3CSHA 4CW9A 1UC7A 4GRFA 4L5OA 4MPGA 2DSAA 3HY2A 1ERWA 5ECRB 4KSMA 3EC3A 3IC4A 1YF1A 2H73A 1C72A 4L0UA 2C0EA 2VO4A 3CSJA 2H74A 3DXBA 1DUGA 3UVTA 2L4CA 3F3RA 2JACA 5CRHA 1JZOA 5IOWA 3VPQA 5CRWA 4F2IA 1FAAA 3F8UA 2PVOC 1UA5A 3VWWA 5IO0A 1EOGA 2IMDA 5HFIA 1FHEA 2PGTA 5EY6A 1SK2A 3IAS2 1XWAA 5GAPD 1KNGA 2G0FA 2P0GA 5CP1A 3UVHA 1B9XC 4OWYA 2LJRA 1DE2A 2K9FA 3HJMA 5JWRB 3A5WA 4IN0A 3TKSA 4ZB8A 2VCZA 3F9UA 4KW6A 3FYGA 2LRTA 6GSVA 3BJ5A 5F06A 5CNWA 3MSZA 1AC1A 2RM5A 2KHPA 3R2QA 2NTOA 1PSQA 3VFIA 5ECKB 2YWNA 1THOA 10GSA 5L71A 2A2RA 2IIYA 2I9HA 1A8YA 4JZQA 4KB3A 4Q5RA 2WDUA 3HA9A 1ILOA 1VF4A 1XFLA 3HDCA 1MD4A 3F0IA 3GSTA 3LWAA 3RPPA 4WETA 3LEFA 2WGRA 4L5LA 2E7PA 1GP1A 3WGXA 5HR0A 2F8FA 5A5KA 2R2JA 3RDWA 5F0GA 3KP9A 3MDKA 2J23A 3DWVA 4G10A 2K8VA 4XS6A 4TR4A 2V32A 2ZUPA 4KGIA 5DALA 4OO5A 4AJ8A 2C3QA 3GL3A 1MDKA 1UN2A 1FVJA 3GFKA 2FCHA 1O8XA 2OJLA 4ZILA 2K8SA 3HVVA 1GUMA 5DALB 5AISA 3TRQA 2X8CA 3KM6A 4J2FA 4MJBA 2WZ9A 3PINA 1PL2A 1WOUA 2B5YA 4TR1B 2L59A 1Z5YE 3ZTLA 2F51A 1YZXA 3IK9A 3TB2A 4YQVA 2GSTA 5JCUA 1SL1B 3DMLA 4DSRA 2BJXA 5IMCA 1YJ6A 2IJYA 5J5NA 1A0RP 1KTEA 3UIWA 4YQMA 1BAYA 2L57A 4WF4A 3WGEA 3ZYWA 2C8UA 1MDJA 1ZOFA 1O85A 3C73A 1VF2A 3CXGA 1K0BA 1JZRA 1SKRB 3BD2A 2GS3A 1XVWA 4ISDA 2O7KA 4F9ZA 4XRDA 5B6NA 4BVXA 5D73A 3APQA 3EU4A 1SYXA 4EUYA 5D9VA 4HOJA 2FWHA 4K7IA 3GYKA 1ZYQB 5D9TA 1FOVA 4V1Ag 4MJCA 1B8XA 1X5DA 1BQ7A 2GVPA 2H19A 2EIRA 4J57E 2QKEA 3PR8A 3BCIA 2ON5A 1PKWA 3GSSA 2H6YA 1XIYA 3UEMA 1SU9A 4TVEA 3L9VA 1YDKA 1SK1A 1SL0B 1J08A 4TRXA 3TCOA 1YF0A 4G2EA 3C8EA 2PU9C 4ZL9A 5J9BA 1G7OA 1GULA 1B48A 2F8AA 2IMKA 3QD9A 4D73A 1ZGNA 3C71A 2CX3A 3HZ8A 3A2VA 2AUVA 4ECBA 3MAKA 2FGXA 5IMZA 3HYPA 2MMNA 4FH8A 4EDYA 5HQPA 3DYRA 4D73B 3I9V2 5ECHB 3QOUA 1OC9B 3GKKA 4MK3A 2H1GA 1Q98A 1RQMA 4MABA 3LYPA 3QPMA 4ILFA 4JU5A 5D8IA 3M0FA 5KN1A 3ZLPA 2QC7A 1MDIA 2GSSA 3CYNA 4MZCA 2X8HA 4IGJA 3J7Yb 4POMA 3WYWA 1V58A 2HFDA 2E2GA 3F6DA 4FYUA 3EU3A 3UL3A 2H0GA 1T4YA 2GSRA 2VM2A 4H86A 2RLIA 4XTSA 2WULA 1ZYEA 2GZPA 1XXUA 4Q5FA 3GKMA 2E0QA 3GA4A 5LNKe 2KOKA 3UBKA 1BYEA 5F07A 2DJJA 3FY7A 4DVCA 3ZIVA 1S3AA 3TOTA 2GZYA 3F3QA 2X8GA 4PUFC 4I2UA 5A4VA 3EMPA 11GSA 3HJPA 3FZ4A 3HJOA 2XPDA 4XIHA 4MCUA 4XRAA 3O6TA 1PD21 3LSZA 1SJ6A 4EKZA 3KJYA 3NOFA 3GTUA 2RIIA 4QL7A 3G9BA 3QAWA 3E9JB 5D96A 4I5QA 4WR4A 4BVYA 1SD8A 9GSSA 1DE1A 3CRUA 2MMZA 2JZTA 2V2GA 4N0ZA 4X1UA 3A3TA 1HQOA 4MZBA 2YWMA 3RBTA 3CTGA 1XW6A 1EOHA 4MMMA 2OE3A 3H1NA 4YAVA 2YN1A 1GTBA 4EVMA 3GIXA 1XCCA 1AQXA 2FWEA 3IRAA 4GQFA 2JSYA 1OKDA 1TXXA 1WWJA 1KEBA 3M9KA 1X9SB 1Z9HA 1PX7A 2YWIA 3Q74A 2GQMA 2LNSA 1XBSA 5AIXA 1ML6A 1WJKA 3BBYA 1W89A 1S3CA 5G5EA 1X9WB 4ULXA 3KZQA 4V2NA 1G0TA 3LORA 2K18A 1OYJA 1A23A 1F9MA 3HZ4A 4GSNA 4K0NA 3P8WA 1XOAA 4HEA2 2XPEA 1ZMAA 14GSA 4KUNA 5CO3A 4I97A 4G9HA 3ERWA 4IS0A 3WD6A 3EMXA 3IV4A 1J0FA 1Z6NA 5FHIA 2AB6A 1NW2A 4NMUA 2R5GA 2CV4A 2BMXA 3VURA 4PQHA 5HR2A 4E8HA 2LRCA 2C80A 1AAZA 1ZL9A 2ZCTA 3IE3A 1M2AA 1SJIA 3KMNA 4HZ2A 4KH7A 4DSSA 6GSTA 1F37A 1OKTA 2VCQA 4IKHA 1K0OA 5DBQA 1GNWA 1EEMA 6GSYA 5ECQB 17GSA 5DDLA 5IIZA 1TRSA 3GRXA 4DSSB 4TKYA 5HR1A 5DQSA 3IXRA 1WIKA 3GURA 1M2DA 2CZ2A 3TKRA 4KCAA 1TKDB 5KN3A 4F0BA 2V6KA 5A4UA 3FK8A 2B5XA 4KCEA 2PVQA 2OE1A 5ECOB 2L6DA 3APSA 1Y25A 1EWXA 3D5JA 1Z7RA 5EPFA 4CHSA 2VAFA 2H76A 3EWLA 1DBYA 3DRNA 3QFAC 3VI7A 3GH6A 2YV9A 3ZMLA 3TJJA 3C1SA 3FKFA 2LJKA 3ME7A 5IOXA 5C04A 5H5QA 2C3TA 2QSIA 1OAZA 2VCVA 1EP7A 2DLXA 3VLNA 4LLRA 2NBSA 4ZBDA 1R5AA 1GUHA 2LS5A 1F3BA 2N5BA 2ES7A 1TU7A 5ECIB 3PGTA 2PBJA 2G2QA 1GSFA 1ON4A 5D9XA 4I8BA 3C7MA 2DMMA 3LXTA 1KBNA 1GH2A 5H5RA 1SYRA 2CVBA 3HVSA 1BG5A 1N2AA 4JR6A 3H4KA 13GSA 2WCIA 19GSA 2O89A 3P2AA 2LSTA 4K1FA 3GKXA 4QL9A 4F82A 3F4RA 1TK0B 5GAND 2LV3A 1EV9A 3FW2A 4GXZA 4NHZA 4CDOA 4ID0A 2OBIA 3VWXA 3M3MA 4PNFA 2H6ZA 1U87A 1K3OA 3VK9A 5DJMA 3FZ5A 3E3EA 4BWQA 2M72A 2JU5A 4MPFA 2HZFA 3VI5A 1T1VA 2HYXA 2DBCA 3TJKA 2H1DA 3ZITA 1OVNA 1WE0A 4ECIA 2H0HA 1F6MC 1PA3A 3HHVA 3TRPA 4KE3A 4TR1A 2H30A 1K0CA 2H0IA 3NZNA 2L4QA 1ABAA 3ZMKA 1GL8A 1PN9A 2FA8A 1Z6MA 2KLXA 1EEJA 1GSDA 2AJQB 1CQGA 1OC8A 2LJAA 2B7KA 3G7YA 2A4VA 3EVIA 1BEDA 1TP9A 5CRGA 3M8NA 3ERFA 1TK5B 1TRUA 1R5PA 2N5AA 3E0UA 2KUCA 3TKSC 2CT6A 4WXTA 3LGCA 2PPTA 2YZHA 4OMVA 4AGSA 4TW5A 1FVKA 2BTOT 4F0CA 3D4TA 4N0VA 4KAEA 3KIJA 4RI6A 2HNLA 2MZCA 2M46A 3KP8A 4WR5A 1FO5A 4MH2A 1EGOA 1T7PB 2XBQA 2LQOA 4K6XA 3ZVJD 1I5GA 3ISOA 2N5FA 4JE1A 3GV1A 4NV5A 2IL3A 4K0GA 3TOUA 2O8VB 2H8LA 1JZDA 2VLUA 3EURA 2KP1A 2GQLA 2HZEA 3O3TA 3IA1A 4WF5A 2B6MA 3EYTA 4L8EA 1XWBA 3GUSA 3FEUA 3H8QA 3TJFA 1FW1A 2ZNMA 5ELGA 2GSQA 3GH9A 2HZEB 2GT6A 2IFQB 3QAVA 2LEGA 4I6XA 2JL4A 4ECJA 5G1KA 1PMTA 3PH9A 4HI7A 1SJZA 2TRCP 2YJ7A 4LMWA 2B7JA 4FO5A 2J9HA 5J4UA 2V6OA 5DVBA 4ZBBA 1OC9A 4NAXA 2GZZA 1V9WA 3M9JA 4WBRD 3GN3A 1JLVA 1V98A 1ERTA 3C1RA 1B9YC 2IMFA 4XS4A 1Q4JA 2HE3A 2NVLA 2CAIA 3RHBA 3HD5A 2MMAA 5JCWA 2AAWA 4AF2A 1PQNA 1J9BA 1GTUA 1LBKA 3DIEA 2H75A 3H93A 2B3SA 4XS4B 4KNDA 4OD7A 4HJ2A 4KA0A 4NXIA 2PN8A 1WRYA 1VF1A 3ME8A 1HD2A 3IK7A 3KCMA 3MNGA 3ZVJA 1K3LA 3DD3A 5KEJA 1HNAA 3DKSA 4IP6A 1TOFA 2WJUA 4GF0A 3D6IA 4K2DA 2OBKA 1SKSB 2FLSA 2JZSA 1TW9A 1VRSD 1AQWA 4EE0A 3WT1A 2B1LA 2CZ3A 4TXVA 2EC4A 4OFNA 1MTCA 5E4WA 2YP6A 4BL7A 5B8BA 4PGTA 2DIYA 2R3XA 2DJKA 4EXJA 1PX6A 3F4TA 2VL2A 1GTAA 3FRCA 2MMOA 5B7CA 2V41A 1WMJA 5HFKA 1FG4A 3K8NA 4LA1A 4HQSA 3ZRDA 3KEBA 3KTLA 4V1Ap 5J9CA 2LQQA 2LTKA 3QAGA 5HR3A 3WGDA 2I1UA 3TUEA 3GNJA 1QXHA 1QUWA 2YNXA 3D0ZA 4OO4A 1QK8A 3ZREA 4IJ3A 4MDCA 3GL5A 2DMLA 3IBHA 2YOIA 2GLRA 1U3IA 1GSQA 2P5RA 22GSA 3Q19A 2VCXA 1YKCA 4HUAA 5CREA 2H71A 4ZL8A 1LJRA 4GWRA 5IPGA 20GSA 6GSXA 2XBIA 2GTUA 5CYYA 5KN0A 3QR6A 2E2MA 1RK4A 1R26A 4MJAA 4K7OA 4LL4B 2V1MA 3QFBC 5IM9A 4PXOA 1T3BA 4OCFA 5ECLB 3FR9A 2I81A 5DCGA 6GSSA 5B8AA 3HCZA 4ZIJA 3EE2A 4O7HA 4EL1A 2AV4A 3APOA 1RW1A 3F63A 4DEJA 1FB6A 1THXA 1ERVA 3GHAA 1B4QA 2HSYA 4GTUA 1V40A 2RUEA 5IMFA 4ACSA 1U6TA 4GCIA 4TN8A 5G31A 1PGTA 3UBLA 4PNGA 2VLVA 6GSWA 4ECCA 4YAPA 2VL2C 2H6XA 1M99A 5GSTA 1MD3A 2H72A 1EV4A 4EO3A 5IMAA 1H75A 2YJHA 2C0DA 5G1LA 5J41A 3FR6A 4PQ1A 3LXZA 1O8WA 1XWGA 1AXDA 1G6WA 4RUVA 2HRFA 3TDGA 1HNBA 2TRXA 4WKWA 3H79A 4TR3A 5JWQB 3VWUA 3ZFLA 4EF0A 3CBUA 4NWYA 3N5OA 1B4PA 2C4JA 1UVZA 1W4VA 2EIOA 5DJLA 1OE8A 2HSHA 3D21A 1NHOA 18GSA 3L9UA 1TTZA 2B5EA 2YV7A 4V2MA 5F05A 2H70A 4YQUA 4AJ7A 2OKAA 1SL2B 2CA8A 4ML6A 2HRNA 5AIVA 4POBA 2PERA 5ABRA 1AUCA 1R7HA 2HT9A 5G5FA 1ERUA 1GRXA 2X64A 3J7Yk 2PUKC 1F3AA 5ECNB 3D22A 3I6AA 5E59A 3W6GA 4ZXGA 4HS1A 3BCKA 4K7NA 2PWJA 5JWOB 1O73A 2YZUA 2JZRA 5IQYA 2AYTA 1EGRA 1NHYA 3N9JA 3US3A 2YANA 2CVKA 2FWGA 1X5CA 4OCEA 2M80A 2WS2A 2L5LA 4IP1A 4RQXA 2VM1A 1SKWB 3UOMA 2F9SA 2CAQA 12GSA 2VD1A 4IQ1A 2IPAA 4L0WA 2L6CA 1USBA 1YQ1A 5J3RA 5FWGA 4MJEA 1GSSA 1OE7A 4NHWA 1VGLA 3CSIA 3GMFA 1M9BA 1DSBA 5FT3A 4HQZA 4HDEA 1LU4A 1V57A 1GSEA 1JFUA 3BOAA 3HVXA 2IN3A 1QQ2A 2VUPA 4LL1B 4Z7XA 5A4WA 3L9SA 5LD0A 1GTIA 4FYCA 3CMIA 5B6MA 3UARA 5ID2A 5IMVA 2DC5A 1I9DA 2REMA 3A2XA 4N30A 1QMVA 3U6VA 3CTFA 3G7IA 3GX0A 1O6JA 5ECPB 3TKQA 3UMAA 2O87A 2OACA 5ID2B 2DIZA 1TU8A 1SK0A 1K0AA 3FZ9A 2MYGA 2K6VA 2YCDA 2D2ZA 1PL1A 4E8EA 4QQ7A 1T4ZA 1T8EB 1TDIA 1JHBA 4TOPA 2A2SA 3I43A 3I69A 5DCHA 1BJXA 4IELA 2DJ2A 2F3MA 1A0FA 1Z3EA 1M9AA 2H1AA 5C00A 5AGYA 4MLYA 5KN2A 1VF3A 2FA4A 2H1BA 2FY6A 3OR5A 2YPMA 4JEDA 1A2JA 4KX4A 2H66A 3L0HA 2ALBA 2JSZA 4Q5QA 4IBPA 2Z9SA 1K0DA 4BPYA 1O7UA 5HFGA 3ZIJA 2VOCA 2VCWA 2ON7A 1PKZA 1WP0A 2HXKA 4DSQA 2WFCA 1U3AA 1R4WA 5JCGA 3ERGA 2AHEA 1S3DA 3LG6A 4J56E 3S9FA 3ED3A 3G7JA 5G30A 3RAZA 3TRXA 1GUKA 4N11A 1TI3A 4ZB9A 1FB0A 2R37A 4O92A 1ACVA 1NM3A 3F6FA 1E6BA 2XC2A 4MH3A 2IFQA 3V1WA 5F8BA 4Q5NA 2VCTA 1IYHA 1QGVA 1JZWA 3L4NA 1QFNA 1ST9A 3FZAA 3KXOA 5DQYA 2GGTA 7GSSA 2FUG2 4EC0A 4PX1A 2VIMA 4FIWA 1A8LA 4OFMA 16GSA 3ZL5A 1A24A 1EP8A 4K9ZA 1HYUA 1E2YA 4XCSA 1SENA 1X5EA 2TIRA 1N8JA 4NV2A 2RM6A 1JLWA 4K8MA 1YKAA 3AY8A 5D9WA 4KDUA 2R6KA 3Q6OA 5GSSA 4JR4A 1GWCA 5GZZB 3TKSE 1XWCA 2VD0A 1M2BA 1NSWA 2X99A 3NIVA 3VWVA 3TJGA 1GLPA 4N10A 1U88A 2NPBA 1TRVA 3SWLA 4HU7A 4PUAA 5H5SA 2DJ1A 3IAM2 1PRXA 3MWHA 1BX9A 3KMOA 1GSUA 1G7EA 1A2LA 1YY7A 1T00A 1WPIA 2C0FA 2DJ3A 3CRTA 4IQAA 3DEXA 4KDYA 2P5QA 1AIUA 1G6YA 1SD9A 4ZL7A 1HNCA 1TK8B 4IW9A 2OA7A 1ZZYA 3TKPA 1V2AA 4AJ6A 1URMA 3FR3A 2MBTA 2OADA 1X9MB 2LRNA 1GSYA 4PQIA 5LCZA 3LFLA 3JCML 4MA9A 1K0NA 2LNTA 1CQHA 1YEPA 3EINA 1TRWA 3KH7A 4GSSA 2PMTA 5COHA 4XS1A 2C0GA 2O85A 2QGVA 1AQVA 2EIQA 3QCPA 4POLA 2CQ9A 4G19A 4ML1A 3LYKA 3QDNA 2P31A 5ECSA 3HXSA 4O32A 5IO2A 1XWKA 3LJRA 5DAKA 4KSOA 3W8JA 4GQCA 1K3YA 2NDOA 3GX8A 2GT5A 1XW9A 1YEXA 1XPVA 2FD3A 4IJIA 2C3NA 1Y6EA 1H4OA 3KGKA 2IMIA 4RQRA 4MF6A 2CVDA 1K0MA 3DVXA 3SBCA 4IHUA 2MBSA 1OC3A 2FNOA 4POKA 5DAKB 5IMDA 1XOBA 1M7TA 3IPZA 2HLSA 2WB9A 3D4MA 3ZZXA 1MEKA 4X43A 5INYA 4MF7A 1XW5A 2JADA 3DGQA 4EDZA 1A2MA 4TR0A 4YH2A 4O5RA 2RUFA 3DVWA 1IYIA 3IOSA 1XZOA 3IDVA 4XHMA 2GQKA 3IR4A 2L5OA 3P7XA 2KP2A 4RI7A 5D93A 3GTUB 4PURA 2LUSA 4I2TA 1GLQA 2I4AA 5AN1A 2OE0A 3KD0A 1ZCPA 4KDXA 4OFTA 5EVOA 4LMVA 5G2ZA 3P90A 4HZ4A 6GSUA 3KTBA 1AW9A 2H01A 1TJDA 5CAXA 3W8SA 3UAPA 3RPNA 2I3YA 4JBBA 2FHEA 3QMXA 4HU9A 3F4SA 4P3YB 2CX4A 3VPTA 3M1GA 3IHQA 4GLTA 2B1KA 4NPBA 2XHFA 3FHKA 2R4VA 1O81A 2GDRA 4TXOA 1X0RA 3HKRA 4FYBA
chains in the Genus database with same CATH superfamily
4MP4A 4JRRA 4GSTA 3A2WA 3LQ7A 3WT2A 4IVFA 3RHCA 5CRDA 3U5RE 5EL8A 4F03A 4WBJA 1M0UA 1S3RA 1XVQA 2HI7A 4HJMA 2IWTA 1TI1A 4TXOB 2WRTA 1ZYPA 3KH9A 2LKUA 8GSSA 5ELAA 4ZB6A 4X0XA 5IPHA 5ECMB 3ZFBA 3O76A 4MF5A 4ZBAA 4BA7A 1GNEA 1Z7PA 3GKNA 2YWOA 4WEYA 2VL3A 2C1YA 2DJ0A 3TGZA 2IMEA 2FWFA 5ENUA 3L78A 2VLTA 1EZKA 1F2EA 4V2LA 3TJBA 4BWSA 4MZWA 3UJ1A 3Q18A 2VL9A 3CSHA 4CW9A 1UC7A 4GRFA 4L5OA 4MPGA 2DSAA 3HY2A 1ERWA 5ECRB 4KSMA 3EC3A 3IC4A 1YF1A 2H73A 1C72A 4L0UA 2C0EA 2VO4A 3CSJA 2H74A 3DXBA 1DUGA 3UVTA 2L4CA 3F3RA 2JACA 5CRHA 1JZOA 5IOWA 3VPQA 5CRWA 4F2IA 1FAAA 3F8UA 2QA1A 4G0KA 2PVOC 1UA5A 3VWWA 5IO0A 1EOGA 2IMDA 5HFIA 1FHEA 2PGTA 5EY6A 1SK2A 3IAS2 1XWAA 5GAPD 1KNGA 2G0FA 2P0GA 5CP1A 3UVHA 1B9XC 4OWYA 2HRKA 2LJRA 1DE2A 2K9FA 3MIXA 3HJMA 5JWRB 3A5WA 4IN0A 3TKSA 4ZB8A 2VCZA 3F9UA 4KW6A 3FYGA 2LRTA 6GSVA 3BJ5A 1XG8A 5F06A 5CNWA 3MSZA 1AC1A 2RM5A 2KHPA 3R2QA 2NTOA 1PSQA 3VFIA 5ECKB 2YWNA 1THOA 10GSA 5L71A 2A2RA 2IIYA 2I9HA 1A8YA 4JZQA 4KB3A 4Q5RA 2WDUA 1M3IA 3HA9A 1ILOA 1VF4A 1XFLA 3HDCA 1MD4A 3F0IA 3GSTA 3LWAA 3RPPA 4WETA 3LEFA 2WGRA 4L5LA 2E7PA 1GP1A 3WGXA 1M3JA 5HR0A 2F8FA 5A5KA 2R2JA 3RDWA 5F0GA 3KP9A 3MDKA 2J23A 3DWVA 4G10A 2K8VA 4XS6A 4TR4A 2V32A 2ZUPA 4KGIA 5DALA 4OO5A 4AJ8A 2C3QA 3GL3A 1MDKA 1UN2A 1FVJA 3GFKA 2FCHA 1O8XA 2OJLA 4ZILA 2K8SA 3HVVA 1GUMA 5DALB 5AISA 3TRQA 2X8CA 3KM6A 4J2FA 4MJBA 2WZ9A 3PINA 1PL2A 1WOUA 2B5YA 4TR1B 2L59A 1Z5YE 3ZTLA 2F51A 1YZXA 3IK9A 3TB2A 4YQVA 2GSTA 5JCUA 1SL1B 3DMLA 4DSRA 4O5UA 2BJXA 5IMCA 1YJ6A 2IJYA 5J5NA 1A0RP 1KTEA 3UIWA 4YQMA 1BAYA 2L57A 4WF4A 3WGEA 3ZYWA 2C8UA 1MDJA 1ZOFA 1O85A 3C73A 1VF2A 3CXGA 1K0BA 1JZRA 1SKRB 3BD2A 2GS3A 1XVWA 4ISDA 2O7KA 4F9ZA 4XRDA 5B6NA 4BVXA 5D73A 3APQA 3EU4A 1SYXA 4EUYA 5D9VA 4HOJA 2FWHA 4K7IA 3GYKA 1ZYQB 5D9TA 1FOVA 4V1Ag 4MJCA 1B8XA 1X5DA 1BQ7A 4BVXB 2GVPA 2H19A 2EIRA 4J57E 2QKEA 3PR8A 3BCIA 2ON5A 1PKWA 3GSSA 2H6YA 1XIYA 3UEMA 1FOHA 1SU9A 4TVEA 3L9VA 1YDKA 1SK1A 1SL0B 1J08A 4TRXA 3TCOA 1YF0A 4G2EA 3C8EA 2PU9C 4ZL9A 5J9BA 1G7OA 1GULA 1B48A 2F8AA 2IMKA 3QD9A 3R3EA 4D73A 1ZGNA 3C71A 2CX3A 3HZ8A 3A2VA 2AUVA 4ECBA 3MAKA 4FQUA 2FGXA 5IMZA 3HYPA 2MMNA 4FH8A 4EDYA 5BRTA 5HQPA 3DYRA 4D73B 3I9V2 5ECHB 3QOUA 1OC9B 3GKKA 4MK3A 2H1GA 1Q98A 1RQMA 4MABA 2R0PA 3LYPA 3QPMA 4ILFA 4JU5A 5D8IA 3M0FA 5KN1A 3ZLPA 2QC7A 1MDIA 2GSSA 3CYNA 4MZCA 2X8HA 4IGJA 3J7Yb 4POMA 3WYWA 1V58A 2HFDA 2E2GA 3F6DA 4FYUA 3EU3A 3UL3A 2HRAA 2H0GA 1T4YA 2GSRA 2VM2A 3HVNA 4H86A 5BMUA 2RLIA 4XTSA 2WULA 1ZYEA 2GZPA 1XXUA 4Q5FA 3GKMA 2E0QA 3GA4A 5LNKe 2KOKA 3UBKA 1BYEA 5F07A 2DJJA 3FY7A 4DVCA 3ZIVA 1S3AA 4BL7B 3TOTA 2GZYA 3F3QA 2X8GA 4PUFC 4I2UA 5A4VA 3EMPA 11GSA 3HJPA 3FZ4A 3HJOA 2XPDA 4XIHA 4MCUA 4XRAA 3O6TA 1PD21 3LSZA 1SJ6A 4EKZA 3KJYA 3NOFA 3GTUA 2RIIA 4QL7A 3G9BA 3QAWA 3E9JB 5D96A 4I5QA 4WR4A 4BVYA 1SD8A 9GSSA 1DE1A 3CRUA 2MMZA 2JZTA 2V2GA 4N0ZA 4X1UA 3A3TA 1HQOA 4MZBA 2YWMA 3RBTA 3CTGA 1XW6A 1EOHA 4MMMA 2OE3A 3H1NA 4YAVA 2YN1A 1GTBA 4EVMA 3A5IA 3GIXA 1XCCA 1AQXA 2FWEA 2HSMA 4G0IA 3IRAA 4GQFA 2JSYA 1OKDA 1TXXA 1WWJA 1KEBA 3M9KA 1X9SB 1Z9HA 1PX7A 2YWIA 3Q74A 2GQMA 2LNSA 1XBSA 5AIXA 1ML6A 1WJKA 3BBYA 1W89A 1S3CA 4USSA 5G5EA 1X9WB 4ULXA 3KZQA 4V2NA 1G0TA 3LORA 2K18A 4EIQA 1OYJA 1A23A 1F9MA 3HZ4A 4GSNA 4K0NA 3P8WA 1XOAA 4HEA2 2XPEA 1ZMAA 14GSA 4KUNA 5CO3A 4I97A 4G9HA 3ERWA 4IS0A 3WD6A 3EMXA 3IV4A 1J0FA 1Z6NA 5FHIA 2AB6A 1NW2A 4NMUA 2R5GA 2CV4A 2BMXA 3VURA 4PQHA 5HR2A 4E8HA 2LRCA 2C80A 1AAZA 1ZL9A 2ZCTA 3IE3A 1M2AA 1SJIA 3KMNA 4HZ2A 4KH7A 4DSSA 6GSTA 1F37A 1OKTA 2VCQA 4IKHA 1K0OA 3FMWA 5DBQA 1GNWA 1EEMA 6GSYA 5ECQB 17GSA 5DDLA 5IIZA 1TRSA 3GRXA 4DSSB 4TKYA 5HR1A 5DQSA 3IXRA 1WIKA 3GURA 1M2DA 2CZ2A 3TKRA 4KCAA 1TKDB 5KN3A 4F0BA 2V6KA 5A4UA 3FK8A 2B5XA 4KCEA 2PVQA 2OE1A 5ECOB 2L6DA 3APSA 1Y25A 1EWXA 3D5JA 1Z7RA 5EPFA 4CHSA 2VAFA 2H76A 4K5RA 3EWLA 1DBYA 3DRNA 3QFAC 3VI7A 3GH6A 2YV9A 3ZMLA 3TJJA 3C1SA 3FKFA 2LJKA 3ME7A 5IOXA 5C04A 5H5QA 2C3TA 2QSIA 1OAZA 2VCVA 1EP7A 2DLXA 3VLNA 4LLRA 2NBSA 4ZBDA 1R5AA 1GUHA 2LS5A 1F3BA 2N5BA 2ES7A 1TU7A 5ECIB 3PGTA 2PBJA 2G2QA 1GSFA 1ON4A 5D9XA 4I8BA 3C7MA 2DMMA 3LXTA 1KBNA 1GH2A 5H5RA 1SYRA 2CVBA 3HVSA 1BG5A 1N2AA 4JR6A 3H4KA 13GSA 2WCIA 19GSA 2O89A 3P2AA 2LSTA 4K1FA 3GKXA 4QL9A 4F82A 3F4RA 1TK0B 5GAND 2LV3A 1EV9A 3FW2A 4GXZA 4NHZA 4CDOA 4ID0A 2OBIA 3VWXA 3M3MA 3CQFA 4PNFA 2H6ZA 1U87A 1K3OA 3VK9A 5DJMA 3FZ5A 3E3EA 4BWQA 2M72A 2JU5A 4MPFA 2HZFA 3VI5A 1T1VA 4HSCX 2HYXA 2DBCA 3TJKA 2H1DA 3ZITA 1OVNA 1WE0A 4ECIA 2H0HA 1F6MC 1PA3A 3HHVA 3TRPA 4KE3A 4TR1A 2H30A 1K0CA 2H0IA 3NZNA 2L4QA 1ABAA 3ZMKA 1GL8A 1PN9A 2FA8A 1Z6MA 2KLXA 1EEJA 2R0GA 1GSDA 2AJQB 1CQGA 1OC8A 2LJAA 2B7KA 3G7YA 2A4VA 3EVIA 1BEDA 1TP9A 5CRGA 3M8NA 3ERFA 1TK5B 1TRUA 1R5PA 2N5AA 3E0UA 2KUCA 3TKSC 2CT6A 2X4AA 4WXTA 3LGCA 4Z2TA 2PPTA 2YZHA 4OMVA 4AGSA 4TW5A 1FVKA 2BTOT 4F0CA 3D4TA 4N0VA 4KAEA 3KIJA 4RI6A 2HNLA 2MZCA 2M46A 3KP8A 4WR5A 1FO5A 4MH2A 1EGOA 1T7PB 2XBQA 2LQOA 4K6XA 3ZVJD 1I5GA 2R0CA 3ISOA 2N5FA 4JE1A 3GV1A 4NV5A 2IL3A 4K0GA 3TOUA 2O8VB 2H8LA 1JZDA 2VLUA 3EURA 2KP1A 2GQLA 2HZEA 3O3TA 3IA1A 4WF5A 2B6MA 3EYTA 4L8EA 1XWBA 3GUSA 3FEUA 3H8QA 3TJFA 1FW1A 2UZ8A 2ZNMA 2DKIA 5ELGA 2GSQA 3GH9A 2HZEB 2GT6A 2IFQB 3QAVA 2LEGA 4I6XA 2JL4A 4ECJA 5G1KA 1PMTA 3PH9A 4HI7A 1SJZA 2TRCP 2YJ7A 4A5PA 4LMWA 2A4HA 2B7JA 4FO5A 2J9HA 4PTSA 5J4UA 2V6OA 5DVBA 4ZBBA 1OC9A 4NAXA 2GZZA 1V9WA 3M9JA 4WBRD 3GN3A 1JLVA 1V98A 1ERTA 3C1RA 1B9YC 2IMFA 4XS4A 1Q4JA 2HE3A 2NVLA 2CAIA 3RHBA 3HD5A 2MMAA 5JCWA 1ZYNA 2AAWA 4AF2A 1PQNA 1J9BA 1GTUA 1LBKA 3DIEA 2H75A 3H93A 2B3SA 4XS4B 4KNDA 4OD7A 4HJ2A 4KA0A 4NXIA 2PN8A 1WRYA 1VF1A 3ME8A 1HD2A 3IK7A 3KCMA 3MNGA 3ZVJA 4CY6A 1K3LA 3DD3A 5KEJA 1HNAA 3DKSA 4IP6A 1TOFA 2WJUA 4GF0A 3D6IA 4K2DA 2OBKA 1SKSB 2FLSA 2JZSA 1TW9A 1VRSD 1AQWA 4EE0A 3WT1A 2B1LA 2CZ3A 4TXVA 2EC4A 4OFNA 1MTCA 5E4WA 2YP6A 4BL7A 5B8BA 4PGTA 2DIYA 2R3XA 2DJKA 4EXJA 1PX6A 3F4TA 2VL2A 1GTAA 3FRCA 2MMOA 5B7CA 2V41A 1WMJA 5HFKA 1FG4A 3K8NA 4LA1A 4HQSA 3ZRDA 3KEBA 3KTLA 4V1Ap 5J9CA 2LQQA 2LTKA 3QAGA 5HR3A 3WGDA 2I1UA 3TUEA 3GNJA 1QXHA 1QUWA 2YNXA 3D0ZA 4OO4A 1QK8A 3ZREA 4IJ3A 4MDCA 3GL5A 2DMLA 3IBHA 2YOIA 2GLRA 1U3IA 4KF9A 2X49A 1GSQA 2P5RA 22GSA 3Q19A 2VCXA 1YKCA 4HUAA 5CREA 2H71A 4ZL8A 1LJRA 4GWRA 5IPGA 20GSA 6GSXA 2XBIA 2GTUA 5CYYA 5KN0A 3QR6A 2E2MA 1RK4A 1R26A 4MJAA 4K7OA 4LL4B 2V1MA 3QFBC 5IM9A 4PXOA 1T3BA 4OCFA 5ECLB 3FR9A 2I81A 3LW9A 5DCGA 6GSSA 5B8AA 3HCZA 4ZIJA 3EE2A 4O7HA 4EL1A 2AV4A 3APOA 1RW1A 3F63A 4DEJA 1FB6A 1THXA 1ERVA 3GHAA 1B4QA 2HSYA 4GTUA 1V40A 2RUEA 1PFOA 5IMFA 4ACSA 1U6TA 4GCIA 4TN8A 5G31A 4CY8A 1PGTA 3UBLA 4PNGA 2VLVA 6GSWA 4ECCA 4YAPA 2VL2C 2H6XA 1M99A 5GSTA 1MD3A 2H72A 1EV4A 4EO3A 5IMAA 1H75A 2YJHA 2C0DA 5G1LA 5J41A 3FR6A 4PQ1A 3LXZA 1O8WA 1XWGA 1AXDA 1G6WA 4RUVA 2HRFA 3TDGA 1HNBA 2TRXA 4WKWA 3H79A 4TR3A 5JWQB 3VWUA 3ZFLA 4EF0A 3CBUA 1PN0A 4NWYA 3N5OA 1B4PA 2C4JA 1UVZA 1W4VA 4EIPA 2EIOA 5DJLA 1OE8A 2HSHA 3D21A 1NHOA 18GSA 3L9UA 1TTZA 2B5EA 2YV7A 4V2MA 5F05A 2H70A 4YQUA 4AJ7A 2OKAA 1SL2B 2CA8A 4ML6A 2HRNA 5AIVA 4POBA 2PERA 3EPTA 5ABRA 1AUCA 1R7HA 2HT9A 5G5FA 1ERUA 2QA2A 1GRXA 2X64A 3J7Yk 2PUKC 1F3AA 5ECNB 3D22A 4YKGA 3I6AA 5E59A 3W6GA 4O5QA 4ZXGA 4HS1A 3BCKA 4X4JA 4K7NA 2PWJA 5JWOB 1O73A 2YZUA 2JZRA 5IQYA 2AYTA 1EGRA 1NHYA 3N9JA 3US3A 2YANA 2CVKA 2FWGA 1X5CA 4OCEA 2M80A 2WS2A 2A2PA 2L5LA 4IP1A 4RQXA 2VM1A 1SKWB 3UOMA 2F9SA 2CAQA 12GSA 2VD1A 4IQ1A 2IPAA 3IC8A 4L0WA 2L6CA 1USBA 1YQ1A 5J3RA 5FWGA 4MJEA 1GSSA 1OE7A 4NHWA 4YKFA 1VGLA 3CSIA 3GMFA 1M9BA 1DSBA 5FT3A 4HQZA 4HDEA 1LU4A 1V57A 1GSEA 1JFUA 4ICYA 3BOAA 3HVXA 2IN3A 1QQ2A 2VUPA 3MYDA 4LL1B 4Z7XA 5A4WA 3L9SA 5LD0A 1GTIA 4FYCA 3CMIA 5B6MA 3UARA 5ID2A 5IMVA 2DC5A 1I9DA 2REMA 3A2XA 4N30A 1QMVA 3U6VA 3CTFA 3G7IA 3GX0A 1O6JA 5ECPB 3TKQA 3UMAA 2O87A 2OACA 5ID2B 2DIZA 1TU8A 1SK0A 1K0AA 3FZ9A 2MYGA 2K6VA 2YCDA 2D2ZA 1PL1A 4E8EA 4QQ7A 1T4ZA 1T8EB 1TDIA 1JHBA 4TOPA 5KOWA 2A2SA 3I43A 3I69A 5DCHA 1BJXA 4IELA 2DJ2A 2F3MA 1A0FA 1Z3EA 1M9AA 2H1AA 5C00A 5AGYA 4MLYA 5KN2A 1VF3A 2FA4A 2H1BA 2FY6A 3OR5A 2YPMA 4JEDA 1A2JA 4KX4A 2H66A 3L0HA 2ALBA 2JSZA 4Q5QA 4IBPA 2Z9SA 1K0DA 4BPYA 1O7UA 5HFGA 3ZIJA 2VOCA 2VCWA 2ON7A 1PKZA 1WP0A 2HXKA 4DSQA 2WFCA 1U3AA 1R4WA 5JCGA 3ERGA 2AHEA 1S3DA 3LG6A 4J56E 3S9FA 3ED3A 3G7JA 5G30A 3RAZA 3TRXA 1GUKA 4N11A 1TI3A 4ZB9A 1FB0A 2R37A 4O92A 3IHGA 1ACVA 1NM3A 3F6FA 1E6BA 2XC2A 4MH3A 2IFQA 3V1WA 5F8BA 4Q5NA 2VCTA 1IYHA 1QGVA 1JZWA 3L4NA 1QFNA 1ST9A 3FZAA 3KXOA 5DQYA 2GGTA 7GSSA 2FUG2 4EC0A 4PX1A 2VIMA 4FIWA 1A8LA 4OFMA 4K2XA 16GSA 3ZL5A 1A24A 1EP8A 4K9ZA 1HYUA 1E2YA 4XCSA 4G0LA 1SENA 1X5EA 2TIRA 1N8JA 4NV2A 2RM6A 1JLWA 4Z2UA 4K8MA 1YKAA 3AY8A 5D9WA 4KDUA 2R6KA 3Q6OA 5GSSA 4JR4A 1GWCA 5GZZB 3TKSE 1XWCA 2VD0A 1M2BA 1NSWA 2X99A 3NIVA 3VWVA 3TJGA 1GLPA 4N10A 1U88A 2NPBA 1TRVA 3SWLA 4HU7A 4PUAA 5H5SA 2DJ1A 3IAM2 1PRXA 3MWHA 1BX9A 3KMOA 1GSUA 1G7EA 1A2LA 1YY7A 1T00A 1WPIA 2C0FA 2DJ3A 3CRTA 4IQAA 3DEXA 4KDYA 2P5QA 1AIUA 1G6YA 1SD9A 4ZL7A 1HNCA 1TK8B 4IW9A 2OA7A 1ZZYA 3TKPA 1V2AA 4AJ6A 1URMA 3FR3A 2MBTA 4K5SA 2OADA 1X9MB 2LRNA 1GSYA 4PQIA 5LCZA 3LFLA 3JCML 4MA9A 1K0NA 2LNTA 1CQHA 1YEPA 3EINA 1TRWA 3KH7A 4GSSA 2PMTA 5COHA 4XS1A 2C0GA 2O85A 2QGVA 1AQVA 2EIQA 3QCPA 4POLA 2CQ9A 4G19A 4ML1A 3LYKA 3QDNA 2P31A 5ECSA 3HXSA 4O32A 5IO2A 1XWKA 3LJRA 4Z2RA 5DAKA 4KSOA 3W8JA 4GQCA 1K3YA 2NDOA 3GX8A 2GT5A 1XW9A 1YEXA 1XPVA 2FD3A 4IJIA 2C3NA 1Y6EA 1H4OA 3KGKA 2IMIA 4RQRA 4MF6A 2CVDA 1K0MA 3DVXA 3SBCA 4IHUA 2MBSA 1OC3A 2FNOA 4POKA 5DAKB 5IMDA 1XOBA 1M7TA 3IPZA 2HLSA 2WB9A 3D4MA 3ZZXA 1MEKA 4X43A 5INYA 4MF7A 1XW5A 2JADA 3DGQA 4BIKA 4EDZA 1A2MA 4TR0A 4YH2A 4O5RA 2RUFA 3DVWA 1IYIA 3IOSA 4MNNA 1XZOA 3IDVA 4XHMA 2GQKA 3IR4A 2L5OA 3P7XA 2KP2A 4RI7A 5D93A 3GTUB 4PURA 2LUSA 4I2TA 1GLQA 2I4AA 5AN1A 2OE0A 3KD0A 1ZCPA 2DKHA 4KDXA 4OFTA 5EVOA 4BVYB 4LMVA 5G2ZA 3P90A 4HZ4A 6GSUA 3KTBA 1AW9A 3PPUA 2H01A 1TJDA 5CAXA 3W8SA 3UAPA 3RPNA 5KOXA 2I3YA 4JBBA 2FHEA 3QMXA 4HU9A 3F4SA 4P3YB 2CX4A 3VPTA 3M1GA 3IHQA 4GLTA 2B1KA 4NPBA 2XHFA 3FHKA 2R4VA 1O81A 2GDRA 4TXOA 1X0RA 3HKRA 4FYBA
chains in the Genus database with same CATH topology
4MP4A 4JRRA 4GSTA 3A2WA 3LQ7A 3WT2A 4IVFA 3RHCA 5CRDA 3U5RE 5EL8A 4F03A 4WBJA 1M0UA 1XVQA 2HI7A 4HJMA 2IWTA 1TI1A 4TXOB 2WRTA 1ZYPA 3KH9A 2LKUA 8GSSA 5ELAA 4ZB6A 4X0XA 5IPHA 5ECMB 3ZFBA 3O76A 4MF5A 4ZBAA 4BA7A 1GNEA 1Z7PA 3GKNA 2YWOA 4WEYA 2VL3A 2C1YA 2DJ0A 3TGZA 2IMEA 2FWFA 5ENUA 3L78A 2VLTA 1EZKA 1F2EA 4V2LA 3TJBA 4BWSA 4MZWA 3UJ1A 3Q18A 2VL9A 3CSHA 4CW9A 1UC7A 4GRFA 4L5OA 4MPGA 2DSAA 3HY2A 1ERWA 5ECRB 4KSMA 3EC3A 3IC4A 1YF1A 2H73A 1C72A 4L0UA 2C0EA 2VO4A 3CSJA 2H74A 3DXBA 1DUGA 3UVTA 2L4CA 3F3RA 2JACA 5CRHA 1JZOA 5IOWA 3VPQA 5CRWA 4F2IA 1FAAA 3F8UA 2QA1A 4G0KA 2PVOC 1UA5A 3VWWA 5IO0A 1EOGA 2IMDA 5HFIA 1FHEA 2PGTA 5EY6A 1SK2A 3IAS2 1XWAA 5GAPD 1KNGA 2G0FA 2P0GA 5CP1A 3UVHA 1B9XC 4OWYA 2HRKA 2LJRA 1DE2A 2K9FA 3MIXA 3HJMA 5JWRB 3A5WA 4IN0A 3TKSA 4ZB8A 2VCZA 3F9UA 4KW6A 3FYGA 2LRTA 6GSVA 3BJ5A 5F06A 5CNWA 3MSZA 1AC1A 2RM5A 2KHPA 3R2QA 2NTOA 1PSQA 3VFIA 5ECKB 2YWNA 1THOA 10GSA 5L71A 2A2RA 2IIYA 2I9HA 1A8YA 4JZQA 4KB3A 4Q5RA 2WDUA 3HA9A 1ILOA 1VF4A 1XFLA 3HDCA 1MD4A 3F0IA 3GSTA 3LWAA 3RPPA 4WETA 3LEFA 2WGRA 4L5LA 2E7PA 1GP1A 3WGXA 5HR0A 2F8FA 5A5KA 2R2JA 3RDWA 5F0GA 3KP9A 3MDKA 2J23A 3DWVA 4G10A 2K8VA 4XS6A 4TR4A 2V32A 2ZUPA 4KGIA 5DALA 4OO5A 4AJ8A 2C3QA 3GL3A 1MDKA 1UN2A 1FVJA 3GFKA 2FCHA 1O8XA 2OJLA 4ZILA 2K8SA 3HVVA 1GUMA 5DALB 5AISA 3TRQA 2X8CA 3KM6A 4J2FA 4MJBA 2WZ9A 3PINA 1PL2A 1WOUA 2B5YA 4TR1B 2L59A 1Z5YE 3ZTLA 2F51A 1YZXA 3IK9A 3TB2A 4YQVA 2GSTA 5JCUA 1SL1B 3DMLA 4DSRA 4O5UA 2BJXA 5IMCA 1YJ6A 2IJYA 5J5NA 1A0RP 1KTEA 3UIWA 4YQMA 1BAYA 2L57A 4WF4A 3WGEA 3ZYWA 2C8UA 1MDJA 1ZOFA 1O85A 3C73A 1VF2A 3CXGA 1K0BA 1JZRA 1SKRB 3BD2A 2GS3A 1XVWA 4ISDA 2O7KA 4F9ZA 4XRDA 5B6NA 4BVXA 5D73A 3APQA 3EU4A 1SYXA 4EUYA 5D9VA 4HOJA 2FWHA 4K7IA 3GYKA 1ZYQB 5D9TA 1FOVA 4V1Ag 4MJCA 1B8XA 1X5DA 1BQ7A 4BVXB 2GVPA 2H19A 2EIRA 4J57E 2QKEA 3PR8A 3BCIA 2ON5A 1PKWA 3GSSA 2H6YA 1XIYA 3UEMA 1FOHA 1SU9A 4TVEA 3L9VA 1YDKA 1SK1A 1SL0B 1J08A 4TRXA 3TCOA 1YF0A 4G2EA 3C8EA 2PU9C 4ZL9A 5J9BA 1G7OA 1GULA 1B48A 2F8AA 2IMKA 3QD9A 3R3EA 4D73A 1ZGNA 3C71A 2CX3A 3HZ8A 3A2VA 2AUVA 4ECBA 3MAKA 4FQUA 2FGXA 5IMZA 3HYPA 2MMNA 4FH8A 4EDYA 5BRTA 5HQPA 3DYRA 4D73B 3I9V2 5ECHB 3QOUA 1OC9B 3GKKA 4MK3A 2H1GA 1Q98A 1RQMA 4MABA 2R0PA 3LYPA 3QPMA 4ILFA 4JU5A 5D8IA 3M0FA 5KN1A 3ZLPA 2QC7A 1MDIA 2GSSA 3CYNA 4MZCA 2X8HA 4IGJA 3J7Yb 4POMA 3WYWA 1V58A 2HFDA 2E2GA 3F6DA 4FYUA 3EU3A 3UL3A 2HRAA 2H0GA 1T4YA 2GSRA 2VM2A 4H86A 5BMUA 2RLIA 4XTSA 2WULA 1ZYEA 2GZPA 1XXUA 4Q5FA 3GKMA 2E0QA 3GA4A 5LNKe 2KOKA 3UBKA 1BYEA 5F07A 2DJJA 3FY7A 4DVCA 3ZIVA 1S3AA 4BL7B 3TOTA 2GZYA 3F3QA 2X8GA 4PUFC 4I2UA 5A4VA 3EMPA 11GSA 3HJPA 3FZ4A 3HJOA 2XPDA 4XIHA 4MCUA 4XRAA 3O6TA 1PD21 3LSZA 1SJ6A 4EKZA 3KJYA 3NOFA 3GTUA 2RIIA 4QL7A 3G9BA 3QAWA 3E9JB 5D96A 4I5QA 4WR4A 4BVYA 1SD8A 9GSSA 1DE1A 3CRUA 2MMZA 2JZTA 2V2GA 4N0ZA 4X1UA 3A3TA 1HQOA 4MZBA 2YWMA 3RBTA 3CTGA 1XW6A 1EOHA 4MMMA 2OE3A 3H1NA 4YAVA 2YN1A 1GTBA 4EVMA 3A5IA 3GIXA 1XCCA 1AQXA 2FWEA 2HSMA 4G0IA 3IRAA 4GQFA 2JSYA 1OKDA 1TXXA 1WWJA 1KEBA 3M9KA 1X9SB 1Z9HA 1PX7A 2YWIA 3Q74A 2GQMA 2LNSA 1XBSA 5AIXA 1ML6A 1WJKA 3BBYA 1W89A 1S3CA 4USSA 5G5EA 1X9WB 4ULXA 3KZQA 4V2NA 1G0TA 3LORA 2K18A 4EIQA 1OYJA 1A23A 1F9MA 3HZ4A 4GSNA 4K0NA 3P8WA 1XOAA 4HEA2 2XPEA 1ZMAA 14GSA 4KUNA 5CO3A 4I97A 4G9HA 3ERWA 4IS0A 3WD6A 3EMXA 3IV4A 1J0FA 1Z6NA 5FHIA 2AB6A 1NW2A 4NMUA 2R5GA 2CV4A 2BMXA 3VURA 4PQHA 5HR2A 4E8HA 2LRCA 2C80A 1AAZA 1ZL9A 2ZCTA 3IE3A 1M2AA 1SJIA 3KMNA 4HZ2A 4KH7A 4DSSA 6GSTA 1F37A 1OKTA 2VCQA 4IKHA 1K0OA 3FMWA 5DBQA 1GNWA 1EEMA 6GSYA 5ECQB 17GSA 5DDLA 5IIZA 1TRSA 3GRXA 4DSSB 4TKYA 5HR1A 5DQSA 3IXRA 1WIKA 3GURA 1M2DA 2CZ2A 3TKRA 4KCAA 1TKDB 5KN3A 4F0BA 2V6KA 5A4UA 3FK8A 2B5XA 4KCEA 2PVQA 2OE1A 5ECOB 2L6DA 3APSA 1Y25A 1EWXA 3D5JA 1Z7RA 5EPFA 4CHSA 2VAFA 2H76A 4K5RA 3EWLA 1DBYA 3DRNA 3QFAC 3VI7A 3GH6A 2YV9A 3ZMLA 3TJJA 3C1SA 3FKFA 2LJKA 3ME7A 5IOXA 5C04A 5H5QA 2C3TA 2QSIA 1OAZA 2VCVA 1EP7A 2DLXA 3VLNA 4LLRA 2NBSA 4ZBDA 1R5AA 1GUHA 2LS5A 1F3BA 2N5BA 2ES7A 1TU7A 5ECIB 3PGTA 2PBJA 2G2QA 1GSFA 1ON4A 5D9XA 4I8BA 3C7MA 2DMMA 3LXTA 1KBNA 1GH2A 5H5RA 1SYRA 2CVBA 3HVSA 1BG5A 1N2AA 4JR6A 3H4KA 13GSA 2WCIA 19GSA 2O89A 3P2AA 2LSTA 4K1FA 3GKXA 4QL9A 4F82A 3F4RA 1TK0B 5GAND 2LV3A 1EV9A 3FW2A 4GXZA 4NHZA 4CDOA 4ID0A 2OBIA 3VWXA 3M3MA 4PNFA 2H6ZA 1U87A 1K3OA 3VK9A 5DJMA 3FZ5A 3E3EA 4BWQA 2M72A 2JU5A 4MPFA 2HZFA 3VI5A 1T1VA 2HYXA 2DBCA 3TJKA 2H1DA 3ZITA 1OVNA 1WE0A 4ECIA 2H0HA 1F6MC 1PA3A 3HHVA 3TRPA 4KE3A 4TR1A 2H30A 1K0CA 2H0IA 3NZNA 2L4QA 1ABAA 3ZMKA 1GL8A 1PN9A 2FA8A 1Z6MA 2KLXA 1EEJA 2R0GA 1GSDA 2AJQB 1CQGA 1OC8A 2LJAA 2B7KA 3G7YA 2A4VA 3EVIA 1BEDA 1TP9A 5CRGA 3M8NA 3ERFA 1TK5B 1TRUA 1R5PA 2N5AA 3E0UA 2KUCA 3TKSC 2CT6A 2X4AA 4WXTA 3LGCA 4Z2TA 2PPTA 2YZHA 4OMVA 4AGSA 4TW5A 1FVKA 2BTOT 4F0CA 3D4TA 4N0VA 4KAEA 3KIJA 4RI6A 2HNLA 2MZCA 2M46A 3KP8A 4WR5A 1FO5A 4MH2A 1EGOA 1T7PB 2XBQA 2LQOA 4K6XA 3ZVJD 1I5GA 2R0CA 3ISOA 2N5FA 4JE1A 3GV1A 4NV5A 2IL3A 4K0GA 3TOUA 2O8VB 2H8LA 1JZDA 2VLUA 3EURA 2KP1A 2GQLA 2HZEA 3O3TA 3IA1A 4WF5A 2B6MA 3EYTA 4L8EA 1XWBA 3GUSA 3FEUA 3H8QA 3TJFA 1FW1A 2UZ8A 2ZNMA 2DKIA 5ELGA 2GSQA 3GH9A 2HZEB 2GT6A 2IFQB 3QAVA 2LEGA 4I6XA 2JL4A 4ECJA 5G1KA 1PMTA 3PH9A 4HI7A 1SJZA 2TRCP 2YJ7A 4A5PA 4LMWA 2A4HA 2B7JA 4FO5A 2J9HA 4PTSA 5J4UA 2V6OA 5DVBA 4ZBBA 1OC9A 4NAXA 2GZZA 1V9WA 3M9JA 4WBRD 3GN3A 1JLVA 1V98A 1ERTA 3C1RA 1B9YC 2IMFA 4XS4A 1Q4JA 2HE3A 2NVLA 2CAIA 3RHBA 3HD5A 2MMAA 5JCWA 1ZYNA 2AAWA 4AF2A 1PQNA 1J9BA 1GTUA 1LBKA 3DIEA 2H75A 3H93A 2B3SA 4XS4B 4KNDA 4OD7A 4HJ2A 4KA0A 4NXIA 2PN8A 1WRYA 1VF1A 3ME8A 1HD2A 3IK7A 3KCMA 3MNGA 3ZVJA 4CY6A 1K3LA 3DD3A 5KEJA 1HNAA 3DKSA 4IP6A 1TOFA 2WJUA 4GF0A 3D6IA 4K2DA 2OBKA 1SKSB 2FLSA 2JZSA 1TW9A 1VRSD 1AQWA 4EE0A 3WT1A 2B1LA 2CZ3A 4TXVA 2EC4A 4OFNA 1MTCA 5E4WA 2YP6A 4BL7A 5B8BA 4PGTA 2DIYA 2R3XA 2DJKA 4EXJA 1PX6A 3F4TA 2VL2A 1GTAA 3FRCA 2MMOA 5B7CA 2V41A 1WMJA 5HFKA 1FG4A 3K8NA 4LA1A 4HQSA 3ZRDA 3KEBA 3KTLA 4V1Ap 5J9CA 2LQQA 2LTKA 3QAGA 5HR3A 3WGDA 2I1UA 3TUEA 3GNJA 1QXHA 1QUWA 2YNXA 3D0ZA 4OO4A 1QK8A 3ZREA 4IJ3A 4MDCA 3GL5A 2DMLA 3IBHA 2YOIA 2GLRA 1U3IA 4KF9A 2X49A 1GSQA 2P5RA 22GSA 3Q19A 2VCXA 1YKCA 4HUAA 5CREA 2H71A 4ZL8A 1LJRA 4GWRA 5IPGA 20GSA 6GSXA 2XBIA 2GTUA 5CYYA 5KN0A 3QR6A 2E2MA 1RK4A 1R26A 4MJAA 4K7OA 4LL4B 2V1MA 3QFBC 5IM9A 4PXOA 1T3BA 4OCFA 5ECLB 3FR9A 2I81A 3LW9A 5DCGA 6GSSA 5B8AA 3HCZA 4ZIJA 3EE2A 4O7HA 4EL1A 2AV4A 3APOA 1RW1A 3F63A 4DEJA 1FB6A 1THXA 1ERVA 3GHAA 1B4QA 2HSYA 4GTUA 1V40A 2RUEA 5IMFA 4ACSA 1U6TA 4GCIA 4TN8A 5G31A 4CY8A 1PGTA 3UBLA 4PNGA 2VLVA 6GSWA 4ECCA 4YAPA 2VL2C 2H6XA 1M99A 5GSTA 1MD3A 2H72A 1EV4A 4EO3A 5IMAA 1H75A 2YJHA 2C0DA 5G1LA 5J41A 3FR6A 4PQ1A 3LXZA 1O8WA 1XWGA 1AXDA 1G6WA 4RUVA 2HRFA 3TDGA 1HNBA 2TRXA 4WKWA 3H79A 4TR3A 5JWQB 3VWUA 3ZFLA 4EF0A 3CBUA 1PN0A 4NWYA 3N5OA 1B4PA 2C4JA 1UVZA 1W4VA 4EIPA 2EIOA 5DJLA 1OE8A 2HSHA 3D21A 1NHOA 18GSA 3L9UA 1TTZA 2B5EA 2YV7A 4V2MA 5F05A 2H70A 4YQUA 4AJ7A 2OKAA 1SL2B 2CA8A 4ML6A 2HRNA 5AIVA 4POBA 2PERA 3EPTA 5ABRA 1AUCA 1R7HA 2HT9A 5G5FA 1ERUA 2QA2A 1GRXA 2X64A 3J7Yk 2PUKC 1F3AA 5ECNB 3D22A 4YKGA 3I6AA 5E59A 3W6GA 4O5QA 4ZXGA 4HS1A 3BCKA 4X4JA 4K7NA 2PWJA 5JWOB 1O73A 2YZUA 2JZRA 5IQYA 2AYTA 1EGRA 1NHYA 3N9JA 3US3A 2YANA 2CVKA 2FWGA 1X5CA 4OCEA 2M80A 2WS2A 2A2PA 2L5LA 4IP1A 4RQXA 2VM1A 1SKWB 3UOMA 2F9SA 2CAQA 12GSA 2VD1A 4IQ1A 2IPAA 3IC8A 4L0WA 2L6CA 1USBA 1YQ1A 5J3RA 5FWGA 4MJEA 1GSSA 1OE7A 4NHWA 4YKFA 1VGLA 3CSIA 3GMFA 1M9BA 1DSBA 5FT3A 4HQZA 4HDEA 1LU4A 1V57A 1GSEA 1JFUA 4ICYA 3BOAA 3HVXA 2IN3A 1QQ2A 2VUPA 3MYDA 4LL1B 4Z7XA 5A4WA 3L9SA 5LD0A 1GTIA 4FYCA 3CMIA 5B6MA 3UARA 5ID2A 5IMVA 2DC5A 1I9DA 2REMA 3A2XA 4N30A 1QMVA 3U6VA 3CTFA 3G7IA 3GX0A 1O6JA 5ECPB 3TKQA 3UMAA 2O87A 2OACA 5ID2B 2DIZA 1TU8A 1SK0A 1K0AA 3FZ9A 2MYGA 2K6VA 2YCDA 2D2ZA 1PL1A 4E8EA 4QQ7A 1T4ZA 1T8EB 1TDIA 1JHBA 4TOPA 5KOWA 2A2SA 3I43A 3I69A 5DCHA 1BJXA 4IELA 2DJ2A 2F3MA 1A0FA 1Z3EA 1M9AA 2H1AA 5C00A 5AGYA 4MLYA 5KN2A 1VF3A 2FA4A 2H1BA 2FY6A 3OR5A 2YPMA 4JEDA 1A2JA 4KX4A 2H66A 3L0HA 2ALBA 2JSZA 4Q5QA 4IBPA 2Z9SA 1K0DA 4BPYA 1O7UA 5HFGA 3ZIJA 2VOCA 2VCWA 2ON7A 1PKZA 1WP0A 2HXKA 4DSQA 2WFCA 1U3AA 1R4WA 5JCGA 3ERGA 2AHEA 1S3DA 3LG6A 4J56E 3S9FA 3ED3A 3G7JA 5G30A 3RAZA 3TRXA 1GUKA 4N11A 1TI3A 4ZB9A 1FB0A 2R37A 4O92A 3IHGA 1ACVA 1NM3A 3F6FA 1E6BA 2XC2A 4MH3A 2IFQA 3V1WA 5F8BA 4Q5NA 2VCTA 1IYHA 1QGVA 1JZWA 3L4NA 1QFNA 1ST9A 3FZAA 3KXOA 5DQYA 2GGTA 7GSSA 2FUG2 4EC0A 4PX1A 2VIMA 4FIWA 1A8LA 4OFMA 4K2XA 16GSA 3ZL5A 1A24A 1EP8A 4K9ZA 1HYUA 1E2YA 4XCSA 4G0LA 1SENA 1X5EA 2TIRA 1N8JA 4NV2A 2RM6A 1JLWA 4Z2UA 4K8MA 1YKAA 3AY8A 5D9WA 4KDUA 2R6KA 3Q6OA 5GSSA 4JR4A 1GWCA 5GZZB 3TKSE 1XWCA 2VD0A 1M2BA 1NSWA 2X99A 3NIVA 3VWVA 3TJGA 1GLPA 4N10A 1U88A 2NPBA 1TRVA 3SWLA 4HU7A 4PUAA 5H5SA 2DJ1A 3IAM2 1PRXA 3MWHA 1BX9A 3KMOA 1GSUA 1G7EA 1A2LA 1YY7A 1T00A 1WPIA 2C0FA 2DJ3A 3CRTA 4IQAA 3DEXA 4KDYA 2P5QA 1AIUA 1G6YA 1SD9A 4ZL7A 1HNCA 1TK8B 4IW9A 2OA7A 1ZZYA 3TKPA 1V2AA 4AJ6A 1URMA 3FR3A 2MBTA 4K5SA 2OADA 1X9MB 2LRNA 1GSYA 4PQIA 5LCZA 3LFLA 3JCML 4MA9A 1K0NA 2LNTA 1CQHA 1YEPA 3EINA 1TRWA 3KH7A 4GSSA 2PMTA 5COHA 4XS1A 2C0GA 2O85A 2QGVA 1AQVA 2EIQA 3QCPA 4POLA 2CQ9A 4G19A 4ML1A 3LYKA 3QDNA 2P31A 5ECSA 3HXSA 4O32A 5IO2A 1XWKA 3LJRA 4Z2RA 5DAKA 4KSOA 3W8JA 4GQCA 1K3YA 2NDOA 3GX8A 2GT5A 1XW9A 1YEXA 1XPVA 2FD3A 4IJIA 2C3NA 1Y6EA 1H4OA 3KGKA 2IMIA 4RQRA 4MF6A 2CVDA 1K0MA 3DVXA 3SBCA 4IHUA 2MBSA 1OC3A 2FNOA 4POKA 5DAKB 5IMDA 1XOBA 1M7TA 3IPZA 2HLSA 2WB9A 3D4MA 3ZZXA 1MEKA 4X43A 5INYA 4MF7A 1XW5A 2JADA 3DGQA 4EDZA 1A2MA 4TR0A 4YH2A 4O5RA 2RUFA 3DVWA 1IYIA 3IOSA 4MNNA 1XZOA 3IDVA 4XHMA 2GQKA 3IR4A 2L5OA 3P7XA 2KP2A 4RI7A 5D93A 3GTUB 4PURA 2LUSA 4I2TA 1GLQA 2I4AA 5AN1A 2OE0A 3KD0A 1ZCPA 2DKHA 4KDXA 4OFTA 5EVOA 4BVYB 4LMVA 5G2ZA 3P90A 4HZ4A 6GSUA 3KTBA 1AW9A 3PPUA 2H01A 1TJDA 5CAXA 3W8SA 3UAPA 3RPNA 5KOXA 2I3YA 4JBBA 2FHEA 3QMXA 4HU9A 3F4SA 4P3YB 2CX4A 3VPTA 3M1GA 3IHQA 4GLTA 2B1KA 4NPBA 2XHFA 3FHKA 2R4VA 1O81A 2GDRA 4TXOA 1X0RA 3HKRA 4FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MP4 A;  4JRR A;  4GST A;  3A2W A;  3LQ7 A;  3WT2 A;  4IVF A;  3RHC A;  5CRD A;  3U5R E;  5EL8 A;  4F03 A;  4WBJ A;  1M0U A;  1XVQ A;  2HI7 A;  4HJM A;  2IWT A;  1TI1 A;  4TXO B;  2WRT A;  3KH9 A;  2LKU A;  8GSS A;  5ELA A;  4ZB6 A;  4X0X A;  5IPH A;  5ECM B;  3ZFB A;  3O76 A;  4MF5 A;  4ZBA A;  4BA7 A;  1GNE A;  1Z7P A;  3GKN A;  2YWO A;  4WEY A;  2VL3 A;  2C1Y A;  2DJ0 A;  3TGZ A;  2IME A;  2FWF A;  5ENU A;  3L78 A;  2VLT A;  1EZK A;  1F2E A;  4V2L A;  3TJB A;  4BWS A;  4MZW A;  3UJ1 A;  3Q18 A;  2VL9 A;  3CSH A;  4CW9 A;  1UC7 A;  4GRF A;  4L5O A;  4MPG A;  2DSA A;  3HY2 A;  1ERW A;  5ECR B;  4KSM A;  3EC3 A;  3IC4 A;  1YF1 A;  2H73 A;  1C72 A;  4L0U A;  2C0E A;  2VO4 A;  3CSJ A;  2H74 A;  3DXB A;  1DUG A;  3UVT A;  2L4C A;  3F3R A;  2JAC A;  5CRH A;  1JZO A;  5IOW A;  3VPQ A;  5CRW A;  4F2I A;  1FAA A;  3F8U A;  2PVO C;  1UA5 A;  3VWW A;  5IO0 A;  1EOG A;  2IMD A;  5HFI A;  1FHE A;  2PGT A;  5EY6 A;  1SK2 A;  3IAS 2;  1XWA A;  5GAP D;  1KNG A;  2G0F A;  2P0G A;  5CP1 A;  3UVH A;  1B9X C;  4OWY A;  2LJR A;  1DE2 A;  2K9F A;  3HJM A;  5JWR B;  3A5W A;  4IN0 A;  3TKS A;  4ZB8 A;  2VCZ A;  3F9U A;  4KW6 A;  3FYG A;  2LRT A;  6GSV A;  3BJ5 A;  5F06 A;  5CNW A;  3MSZ A;  1AC1 A;  2RM5 A;  2KHP A;  3R2Q A;  2NTO A;  1PSQ A;  3VFI A;  5ECK B;  2YWN A;  1THO A;  10GS A;  5L71 A;  2A2R A;  2IIY A;  2I9H A;  1A8Y A;  4JZQ A;  4KB3 A;  4Q5R A;  2WDU A;  3HA9 A;  1ILO A;  1VF4 A;  1XFL A;  3HDC A;  1MD4 A;  3F0I A;  3GST A;  3LWA A;  3RPP A;  4WET A;  3LEF A;  2WGR A;  4L5L A;  2E7P A;  1GP1 A;  3WGX A;  5HR0 A;  2F8F A;  5A5K A;  2R2J A;  3RDW A;  5F0G A;  3KP9 A;  3MDK A;  2J23 A;  3DWV A;  4G10 A;  2K8V A;  4XS6 A;  4TR4 A;  2V32 A;  2ZUP A;  4KGI A;  5DAL A;  4OO5 A;  4AJ8 A;  2C3Q A;  3GL3 A;  1MDK A;  1UN2 A;  1FVJ A;  3GFK A;  2FCH A;  1O8X A;  2OJL A;  4ZIL A;  2K8S A;  3HVV A;  1GUM A;  5DAL B;  5AIS A;  3TRQ A;  2X8C A;  3KM6 A;  4J2F A;  4MJB A;  2WZ9 A;  3PIN A;  1PL2 A;  1WOU A;  2B5Y A;  4TR1 B;  2L59 A;  1Z5Y E;  3ZTL A;  2F51 A;  1YZX A;  3IK9 A;  3TB2 A;  4YQV A;  2GST A;  5JCU A;  1SL1 B;  3DML A;  4DSR A;  2BJX A;  5IMC A;  1YJ6 A;  2IJY A;  5J5N A;  1A0R P;  1KTE A;  3UIW A;  4YQM A;  1BAY A;  2L57 A;  4WF4 A;  3WGE A;  3ZYW A;  2C8U A;  1MDJ A;  1ZOF A;  1O85 A;  3C73 A;  1VF2 A;  3CXG A;  1K0B A;  1JZR A;  1SKR B;  3BD2 A;  2GS3 A;  1XVW A;  4ISD A;  2O7K A;  4F9Z A;  4XRD A;  5B6N A;  4BVX A;  5D73 A;  3APQ A;  3EU4 A;  1SYX A;  4EUY A;  5D9V A;  4HOJ A;  2FWH A;  4K7I A;  3GYK A;  1ZYQ B;  5D9T A;  1FOV A;  4V1A g;  4MJC A;  1B8X A;  1X5D A;  1BQ7 A;  2GVP A;  2H19 A;  2EIR A;  4J57 E;  2QKE A;  3PR8 A;  3BCI A;  2ON5 A;  1PKW A;  3GSS A;  2H6Y A;  1XIY A;  3UEM A;  1SU9 A;  4TVE A;  3L9V A;  1YDK A;  1SK1 A;  1SL0 B;  1J08 A;  4TRX A;  3TCO A;  1YF0 A;  4G2E A;  3C8E A;  2PU9 C;  4ZL9 A;  5J9B A;  1G7O A;  1GUL A;  1B48 A;  2F8A A;  2IMK A;  3QD9 A;  4D73 A;  1ZGN A;  3C71 A;  2CX3 A;  3HZ8 A;  3A2V A;  2AUV A;  4ECB A;  3MAK A;  2FGX A;  5IMZ A;  3HYP A;  2MMN A;  4FH8 A;  4EDY A;  5HQP A;  3DYR A;  4D73 B;  3I9V 2;  5ECH B;  3QOU A;  1OC9 B;  3GKK A;  4MK3 A;  2H1G A;  1Q98 A;  1RQM A;  4MAB A;  3LYP A;  3QPM A;  4ILF A;  4JU5 A;  5D8I A;  3M0F A;  5KN1 A;  3ZLP A;  2QC7 A;  1MDI A;  2GSS A;  3CYN A;  4MZC A;  2X8H A;  4IGJ A;  3J7Y b;  4POM A;  3WYW A;  1V58 A;  2HFD A;  2E2G A;  3F6D A;  4FYU A;  3EU3 A;  3UL3 A;  2H0G A;  1T4Y A;  2GSR A;  2VM2 A;  4H86 A;  2RLI A;  4XTS A;  2WUL A;  1ZYE A;  2GZP A;  1XXU A;  4Q5F A;  3GKM A;  2E0Q A;  3GA4 A;  5LNK e;  2KOK A;  3UBK A;  1BYE A;  5F07 A;  2DJJ A;  3FY7 A;  4DVC A;  3ZIV A;  1S3A A;  3TOT A;  2GZY A;  3F3Q A;  2X8G A;  4PUF C;  4I2U A;  5A4V A;  3EMP A;  11GS A;  3HJP A;  3FZ4 A;  3HJO A;  2XPD A;  4XIH A;  4MCU A;  4XRA A;  3O6T A;  1PD2 1;  3LSZ A;  1SJ6 A;  4EKZ A;  3KJY A;  3NOF A;  3GTU A;  2RII A;  4QL7 A;  3G9B A;  3QAW A;  3E9J B;  5D96 A;  4I5Q A;  4WR4 A;  4BVY A;  1SD8 A;  9GSS A;  1DE1 A;  3CRU A;  2MMZ A;  2JZT A;  2V2G A;  4N0Z A;  4X1U A;  3A3T A;  1HQO A;  4MZB A;  2YWM A;  3RBT A;  3CTG A;  1XW6 A;  1EOH A;  4MMM A;  2OE3 A;  3H1N A;  4YAV A;  2YN1 A;  1GTB A;  4EVM A;  3GIX A;  1XCC A;  1AQX A;  2FWE A;  3IRA A;  4GQF A;  2JSY A;  1OKD A;  1TXX A;  1WWJ A;  1KEB A;  3M9K A;  1X9S B;  1Z9H A;  1PX7 A;  2YWI A;  3Q74 A;  2GQM A;  2LNS A;  1XBS A;  5AIX A;  1ML6 A;  1WJK A;  3BBY A;  1W89 A;  1S3C A;  5G5E A;  1X9W B;  4ULX A;  3KZQ A;  4V2N A;  1G0T A;  3LOR A;  2K18 A;  1OYJ A;  1A23 A;  1F9M A;  3HZ4 A;  4GSN A;  4K0N A;  3P8W A;  1XOA A;  4HEA 2;  2XPE A;  1ZMA A;  14GS A;  4KUN A;  5CO3 A;  4I97 A;  4G9H A;  3ERW A;  4IS0 A;  3WD6 A;  3EMX A;  3IV4 A;  1J0F A;  1Z6N A;  5FHI A;  2AB6 A;  1NW2 A;  4NMU A;  2R5G A;  2CV4 A;  2BMX A;  3VUR A;  4PQH A;  5HR2 A;  4E8H A;  2LRC A;  2C80 A;  1AAZ A;  1ZL9 A;  2ZCT A;  3IE3 A;  1M2A A;  1SJI A;  3KMN A;  4HZ2 A;  4KH7 A;  4DSS A;  6GST A;  1F37 A;  1OKT A;  2VCQ A;  4IKH A;  1K0O A;  5DBQ A;  1GNW A;  1EEM A;  6GSY A;  5ECQ B;  17GS A;  5DDL A;  5IIZ A;  1TRS A;  3GRX A;  4DSS B;  4TKY A;  5HR1 A;  5DQS A;  3IXR A;  1WIK A;  3GUR A;  1M2D A;  2CZ2 A;  3TKR A;  4KCA A;  1TKD B;  5KN3 A;  4F0B A;  2V6K A;  5A4U A;  3FK8 A;  2B5X A;  4KCE A;  2PVQ A;  2OE1 A;  5ECO B;  2L6D A;  3APS A;  1Y25 A;  1EWX A;  3D5J A;  1Z7R A;  5EPF A;  4CHS A;  2VAF A;  2H76 A;  3EWL A;  1DBY A;  3DRN A;  3QFA C;  3VI7 A;  3GH6 A;  2YV9 A;  3ZML A;  3TJJ A;  3C1S A;  3FKF A;  2LJK A;  3ME7 A;  5IOX A;  5C04 A;  5H5Q A;  2C3T A;  2QSI A;  1OAZ A;  2VCV A;  1EP7 A;  2DLX A;  3VLN A;  4LLR A;  2NBS A;  4ZBD A;  1R5A A;  1GUH A;  2LS5 A;  1F3B A;  2N5B A;  2ES7 A;  1TU7 A;  5ECI B;  3PGT A;  2PBJ A;  2G2Q A;  1GSF A;  1ON4 A;  5D9X A;  4I8B A;  3C7M A;  2DMM A;  3LXT A;  1KBN A;  1GH2 A;  5H5R A;  1SYR A;  2CVB A;  3HVS A;  1BG5 A;  1N2A A;  4JR6 A;  3H4K A;  13GS A;  2WCI A;  19GS A;  2O89 A;  3P2A A;  2LST A;  4K1F A;  3GKX A;  4QL9 A;  4F82 A;  3F4R A;  1TK0 B;  5GAN D;  2LV3 A;  1EV9 A;  3FW2 A;  4GXZ A;  4NHZ A;  4CDO A;  4ID0 A;  2OBI A;  3VWX A;  3M3M A;  4PNF A;  2H6Z A;  1U87 A;  1K3O A;  3VK9 A;  5DJM A;  3FZ5 A;  3E3E A;  4BWQ A;  2M72 A;  2JU5 A;  4MPF A;  2HZF A;  3VI5 A;  1T1V A;  2HYX A;  2DBC A;  3TJK A;  2H1D A;  3ZIT A;  1OVN A;  1WE0 A;  4ECI A;  2H0H A;  1F6M C;  1PA3 A;  3HHV A;  3TRP A;  4KE3 A;  4TR1 A;  2H30 A;  1K0C A;  2H0I A;  3NZN A;  2L4Q A;  1ABA A;  3ZMK A;  1GL8 A;  1PN9 A;  2FA8 A;  1Z6M A;  2KLX A;  1EEJ A;  1GSD A;  2AJQ B;  1CQG A;  1OC8 A;  2LJA A;  2B7K A;  3G7Y A;  2A4V A;  3EVI A;  1BED A;  1TP9 A;  5CRG A;  3M8N A;  3ERF A;  1TK5 B;  1TRU A;  1R5P A;  2N5A A;  3E0U A;  2KUC A;  3TKS C;  2CT6 A;  4WXT A;  3LGC A;  2PPT A;  2YZH A;  4OMV A;  4AGS A;  4TW5 A;  1FVK A;  2BTO T;  4F0C A;  3D4T A;  4N0V A;  4KAE A;  3KIJ A;  4RI6 A;  2HNL A;  2MZC A;  2M46 A;  3KP8 A;  4WR5 A;  1FO5 A;  4MH2 A;  1EGO A;  1T7P B;  2XBQ A;  2LQO A;  4K6X A;  3ZVJ D;  1I5G A;  3ISO A;  2N5F A;  4JE1 A;  3GV1 A;  4NV5 A;  2IL3 A;  4K0G A;  3TOU A;  2O8V B;  2H8L A;  1JZD A;  2VLU A;  3EUR A;  2KP1 A;  2GQL A;  2HZE A;  3O3T A;  3IA1 A;  4WF5 A;  2B6M A;  3EYT A;  4L8E A;  1XWB A;  3GUS A;  3FEU A;  3H8Q A;  3TJF A;  1FW1 A;  2ZNM A;  5ELG A;  2GSQ A;  3GH9 A;  2HZE B;  2GT6 A;  2IFQ B;  3QAV A;  2LEG A;  4I6X A;  2JL4 A;  4ECJ A;  5G1K A;  1PMT A;  3PH9 A;  4HI7 A;  1SJZ A;  2TRC P;  2YJ7 A;  4LMW A;  2B7J A;  4FO5 A;  2J9H A;  5J4U A;  2V6O A;  5DVB A;  4ZBB A;  1OC9 A;  4NAX A;  2GZZ A;  1V9W A;  3M9J A;  4WBR D;  3GN3 A;  1JLV A;  1V98 A;  1ERT A;  3C1R A;  1B9Y C;  2IMF A;  4XS4 A;  1Q4J A;  2HE3 A;  2NVL A;  2CAI A;  3RHB A;  3HD5 A;  2MMA A;  5JCW A;  2AAW A;  4AF2 A;  1PQN A;  1J9B A;  1GTU A;  1LBK A;  3DIE A;  2H75 A;  3H93 A;  2B3S A;  4XS4 B;  4KND A;  4OD7 A;  4HJ2 A;  4KA0 A;  4NXI A;  2PN8 A;  1WRY A;  1VF1 A;  3ME8 A;  1HD2 A;  3IK7 A;  3KCM A;  3MNG A;  3ZVJ A;  1K3L A;  3DD3 A;  5KEJ A;  1HNA A;  3DKS A;  4IP6 A;  1TOF A;  2WJU A;  4GF0 A;  3D6I A;  4K2D A;  2OBK A;  1SKS B;  2FLS A;  2JZS A;  1TW9 A;  1VRS D;  1AQW A;  4EE0 A;  3WT1 A;  2B1L A;  2CZ3 A;  4TXV A;  2EC4 A;  4OFN A;  1MTC A;  5E4W A;  2YP6 A;  4BL7 A;  5B8B A;  4PGT A;  2DIY A;  2R3X A;  2DJK A;  4EXJ A;  1PX6 A;  3F4T A;  2VL2 A;  1GTA A;  3FRC A;  2MMO A;  5B7C A;  2V41 A;  1WMJ A;  5HFK A;  1FG4 A;  3K8N A;  4LA1 A;  4HQS A;  3ZRD A;  3KEB A;  3KTL A;  4V1A p;  5J9C A;  2LQQ A;  2LTK A;  3QAG A;  5HR3 A;  3WGD A;  2I1U A;  3TUE A;  3GNJ A;  1QXH A;  1QUW A;  2YNX A;  3D0Z A;  4OO4 A;  1QK8 A;  3ZRE A;  4IJ3 A;  4MDC A;  3GL5 A;  2DML A;  3IBH A;  2YOI A;  2GLR A;  1U3I A;  1GSQ A;  2P5R A;  22GS A;  3Q19 A;  2VCX A;  1YKC A;  4HUA A;  5CRE A;  2H71 A;  4ZL8 A;  1LJR A;  4GWR A;  5IPG A;  20GS A;  6GSX A;  2XBI A;  2GTU A;  5CYY A;  5KN0 A;  3QR6 A;  2E2M A;  1RK4 A;  1R26 A;  4MJA A;  4K7O A;  4LL4 B;  2V1M A;  3QFB C;  5IM9 A;  4PXO A;  1T3B A;  4OCF A;  5ECL B;  3FR9 A;  2I81 A;  5DCG A;  6GSS A;  5B8A A;  3HCZ A;  4ZIJ A;  3EE2 A;  4O7H A;  4EL1 A;  2AV4 A;  3APO A;  1RW1 A;  3F63 A;  4DEJ A;  1FB6 A;  1THX A;  1ERV A;  3GHA A;  1B4Q A;  2HSY A;  4GTU A;  1V40 A;  2RUE A;  5IMF A;  4ACS A;  1U6T A;  4GCI A;  4TN8 A;  5G31 A;  1PGT A;  3UBL A;  4PNG A;  2VLV A;  6GSW A;  4ECC A;  4YAP A;  2VL2 C;  2H6X A;  1M99 A;  5GST A;  1MD3 A;  2H72 A;  1EV4 A;  4EO3 A;  5IMA A;  1H75 A;  2YJH A;  2C0D A;  5G1L A;  5J41 A;  3FR6 A;  4PQ1 A;  3LXZ A;  1O8W A;  1XWG A;  1AXD A;  1G6W A;  4RUV A;  2HRF A;  3TDG A;  1HNB A;  2TRX A;  4WKW A;  3H79 A;  4TR3 A;  5JWQ B;  3VWU A;  3ZFL A;  4EF0 A;  3CBU A;  4NWY A;  3N5O A;  1B4P A;  2C4J A;  1UVZ A;  1W4V A;  2EIO A;  5DJL A;  1OE8 A;  2HSH A;  3D21 A;  1NHO A;  18GS A;  3L9U A;  1TTZ A;  2B5E A;  2YV7 A;  4V2M A;  5F05 A;  2H70 A;  4YQU A;  4AJ7 A;  2OKA A;  1SL2 B;  2CA8 A;  4ML6 A;  2HRN A;  5AIV A;  4POB A;  2PER A;  5ABR A;  1AUC A;  1R7H A;  2HT9 A;  5G5F A;  1ERU A;  1GRX A;  2X64 A;  3J7Y k;  2PUK C;  1F3A A;  5ECN B;  3D22 A;  3I6A A;  5E59 A;  3W6G A;  4ZXG A;  4HS1 A;  3BCK A;  4K7N A;  2PWJ A;  5JWO B;  1O73 A;  2YZU A;  2JZR A;  5IQY A;  2AYT A;  1EGR A;  1NHY A;  3N9J A;  3US3 A;  2YAN A;  2CVK A;  2FWG A;  1X5C A;  4OCE A;  2M80 A;  2WS2 A;  2L5L A;  4IP1 A;  4RQX A;  2VM1 A;  1SKW B;  3UOM A;  2F9S A;  2CAQ A;  12GS A;  2VD1 A;  4IQ1 A;  2IPA A;  4L0W A;  2L6C A;  1USB A;  1YQ1 A;  5J3R A;  5FWG A;  4MJE A;  1GSS A;  1OE7 A;  4NHW A;  1VGL A;  3CSI A;  3GMF A;  1M9B A;  1DSB A;  5FT3 A;  4HQZ A;  4HDE A;  1LU4 A;  1V57 A;  1GSE A;  1JFU A;  3BOA A;  3HVX A;  2IN3 A;  1QQ2 A;  2VUP A;  4LL1 B;  4Z7X A;  5A4W A;  3L9S A;  5LD0 A;  1GTI A;  4FYC A;  3CMI A;  5B6M A;  3UAR A;  5ID2 A;  5IMV A;  2DC5 A;  1I9D A;  2REM A;  3A2X A;  4N30 A;  1QMV A;  3U6V A;  3CTF A;  3G7I A;  3GX0 A;  1O6J A;  5ECP B;  3TKQ A;  3UMA A;  2O87 A;  2OAC A;  5ID2 B;  2DIZ A;  1TU8 A;  1SK0 A;  1K0A A;  3FZ9 A;  2MYG A;  2K6V A;  2YCD A;  2D2Z A;  1PL1 A;  4E8E A;  4QQ7 A;  1T4Z A;  1T8E B;  1TDI A;  1JHB A;  4TOP A;  2A2S A;  3I43 A;  3I69 A;  5DCH A;  1BJX A;  4IEL A;  2DJ2 A;  2F3M A;  1A0F A;  1Z3E A;  1M9A A;  2H1A A;  5C00 A;  5AGY A;  4MLY A;  5KN2 A;  1VF3 A;  2FA4 A;  2H1B A;  2FY6 A;  3OR5 A;  2YPM A;  4JED A;  1A2J A;  4KX4 A;  2H66 A;  3L0H A;  2ALB A;  2JSZ A;  4Q5Q A;  4IBP A;  2Z9S A;  1K0D A;  4BPY A;  1O7U A;  5HFG A;  3ZIJ A;  2VOC A;  2VCW A;  2ON7 A;  1PKZ A;  1WP0 A;  2HXK A;  4DSQ A;  2WFC A;  1U3A A;  1R4W A;  5JCG A;  3ERG A;  2AHE A;  1S3D A;  3LG6 A;  4J56 E;  3S9F A;  3ED3 A;  3G7J A;  5G30 A;  3RAZ A;  3TRX A;  1GUK A;  4N11 A;  1TI3 A;  4ZB9 A;  1FB0 A;  2R37 A;  4O92 A;  1ACV A;  1NM3 A;  3F6F A;  1E6B A;  2XC2 A;  4MH3 A;  2IFQ A;  3V1W A;  5F8B A;  4Q5N A;  2VCT A;  1IYH A;  1QGV A;  1JZW A;  3L4N A;  1QFN A;  1ST9 A;  3FZA A;  3KXO A;  5DQY A;  2GGT A;  7GSS A;  2FUG 2;  4EC0 A;  4PX1 A;  2VIM A;  4FIW A;  1A8L A;  4OFM A;  16GS A;  3ZL5 A;  1A24 A;  1EP8 A;  4K9Z A;  1HYU A;  1E2Y A;  4XCS A;  1SEN A;  1X5E A;  2TIR A;  1N8J A;  4NV2 A;  2RM6 A;  1JLW A;  4K8M A;  1YKA A;  3AY8 A;  5D9W A;  4KDU A;  2R6K A;  3Q6O A;  5GSS A;  4JR4 A;  1GWC A;  5GZZ B;  3TKS E;  1XWC A;  2VD0 A;  1M2B A;  1NSW A;  2X99 A;  3NIV A;  3VWV A;  3TJG A;  1GLP A;  4N10 A;  1U88 A;  2NPB A;  1TRV A;  3SWL A;  4HU7 A;  4PUA A;  5H5S A;  2DJ1 A;  3IAM 2;  1PRX A;  3MWH A;  1BX9 A;  3KMO A;  1GSU A;  1G7E A;  1A2L A;  1YY7 A;  1T00 A;  1WPI A;  2C0F A;  2DJ3 A;  3CRT A;  4IQA A;  3DEX A;  4KDY A;  2P5Q A;  1AIU A;  1G6Y A;  1SD9 A;  4ZL7 A;  1HNC A;  1TK8 B;  4IW9 A;  2OA7 A;  1ZZY A;  3TKP A;  1V2A A;  4AJ6 A;  1URM A;  3FR3 A;  2MBT A;  2OAD A;  1X9M B;  2LRN A;  1GSY A;  4PQI A;  5LCZ A;  3LFL A;  3JCM L;  4MA9 A;  1K0N A;  2LNT A;  1CQH A;  1YEP A;  3EIN A;  1TRW A;  3KH7 A;  4GSS A;  2PMT A;  5COH A;  4XS1 A;  2C0G A;  2O85 A;  2QGV A;  1AQV A;  2EIQ A;  3QCP A;  4POL A;  2CQ9 A;  4G19 A;  4ML1 A;  3LYK A;  3QDN A;  2P31 A;  5ECS A;  3HXS A;  4O32 A;  5IO2 A;  1XWK A;  3LJR A;  5DAK A;  4KSO A;  3W8J A;  4GQC A;  1K3Y A;  2NDO A;  3GX8 A;  2GT5 A;  1XW9 A;  1YEX A;  1XPV A;  2FD3 A;  4IJI A;  2C3N A;  1Y6E A;  1H4O A;  3KGK A;  2IMI A;  4RQR A;  4MF6 A;  2CVD A;  1K0M A;  3DVX A;  3SBC A;  4IHU A;  2MBS A;  1OC3 A;  2FNO A;  4POK A;  5DAK B;  5IMD A;  1XOB A;  1M7T A;  3IPZ A;  2HLS A;  2WB9 A;  3D4M A;  3ZZX A;  1MEK A;  4X43 A;  5INY A;  4MF7 A;  1XW5 A;  2JAD A;  3DGQ A;  4EDZ A;  1A2M A;  4TR0 A;  4YH2 A;  4O5R A;  2RUF A;  3DVW A;  1IYI A;  3IOS A;  1XZO A;  3IDV A;  4XHM A;  2GQK A;  3IR4 A;  2L5O A;  3P7X A;  2KP2 A;  4RI7 A;  5D93 A;  3GTU B;  4PUR A;  2LUS A;  4I2T A;  1GLQ A;  2I4A A;  5AN1 A;  2OE0 A;  3KD0 A;  1ZCP A;  4KDX A;  4OFT A;  5EVO A;  4LMV A;  5G2Z A;  3P90 A;  4HZ4 A;  6GSU A;  3KTB A;  1AW9 A;  2H01 A;  1TJD A;  5CAX A;  3W8S A;  3UAP A;  3RPN A;  2I3Y A;  4JBB A;  2FHE A;  3QMX A;  4HU9 A;  3F4S A;  4P3Y B;  2CX4 A;  3VPT A;  3M1G A;  3IHQ A;  4GLT A;  2B1K A;  4NPB A;  2XHF A;  3FHK A;  2R4V A;  1O81 A;  2GDR A;  4TXO A;  1X0R A;  3HKR A;  4FYB A; 
#chains in the Genus database with same CATH topology
 4MP4 A;  4JRR A;  4GST A;  3A2W A;  3LQ7 A;  3WT2 A;  4IVF A;  3RHC A;  5CRD A;  3U5R E;  5EL8 A;  4F03 A;  4WBJ A;  1M0U A;  1S3R A;  1XVQ A;  2HI7 A;  4HJM A;  2IWT A;  1TI1 A;  4TXO B;  2WRT A;  1ZYP A;  3KH9 A;  2LKU A;  8GSS A;  5ELA A;  4ZB6 A;  4X0X A;  5IPH A;  5ECM B;  3ZFB A;  3O76 A;  4MF5 A;  4ZBA A;  4BA7 A;  1GNE A;  1Z7P A;  3GKN A;  2YWO A;  4WEY A;  2VL3 A;  2C1Y A;  2DJ0 A;  3TGZ A;  2IME A;  2FWF A;  5ENU A;  3L78 A;  2VLT A;  1EZK A;  1F2E A;  4V2L A;  3TJB A;  4BWS A;  4MZW A;  3UJ1 A;  3Q18 A;  2VL9 A;  3CSH A;  4CW9 A;  1UC7 A;  4GRF A;  4L5O A;  4MPG A;  2DSA A;  3HY2 A;  1ERW A;  5ECR B;  4KSM A;  3EC3 A;  3IC4 A;  1YF1 A;  2H73 A;  1C72 A;  4L0U A;  2C0E A;  2VO4 A;  3CSJ A;  2H74 A;  3DXB A;  1DUG A;  3UVT A;  2L4C A;  3F3R A;  2JAC A;  5CRH A;  1JZO A;  5IOW A;  3VPQ A;  5CRW A;  4F2I A;  1FAA A;  3F8U A;  2QA1 A;  4G0K A;  2PVO C;  1UA5 A;  3VWW A;  5IO0 A;  1EOG A;  2IMD A;  5HFI A;  1FHE A;  2PGT A;  5EY6 A;  1SK2 A;  3IAS 2;  1XWA A;  5GAP D;  1KNG A;  2G0F A;  2P0G A;  5CP1 A;  3UVH A;  1B9X C;  4OWY A;  2HRK A;  2LJR A;  1DE2 A;  2K9F A;  3MIX A;  3HJM A;  5JWR B;  3A5W A;  4IN0 A;  3TKS A;  4ZB8 A;  2VCZ A;  3F9U A;  4KW6 A;  3FYG A;  2LRT A;  6GSV A;  3BJ5 A;  1XG8 A;  5F06 A;  5CNW A;  3MSZ A;  1AC1 A;  2RM5 A;  2KHP A;  3R2Q A;  2NTO A;  1PSQ A;  3VFI A;  5ECK B;  2YWN A;  1THO A;  10GS A;  5L71 A;  2A2R A;  2IIY A;  2I9H A;  1A8Y A;  4JZQ A;  4KB3 A;  4Q5R A;  2WDU A;  1M3I A;  3HA9 A;  1ILO A;  1VF4 A;  1XFL A;  3HDC A;  1MD4 A;  3F0I A;  3GST A;  3LWA A;  3RPP A;  4WET A;  3LEF A;  2WGR A;  4L5L A;  2E7P A;  1GP1 A;  3WGX A;  1M3J A;  5HR0 A;  2F8F A;  5A5K A;  2R2J A;  3RDW A;  5F0G A;  3KP9 A;  3MDK A;  2J23 A;  3DWV A;  4G10 A;  2K8V A;  4XS6 A;  4TR4 A;  2V32 A;  2ZUP A;  4KGI A;  5DAL A;  4OO5 A;  4AJ8 A;  2C3Q A;  3GL3 A;  1MDK A;  1UN2 A;  1FVJ A;  3GFK A;  2FCH A;  1O8X A;  2OJL A;  4ZIL A;  2K8S A;  3HVV A;  1GUM A;  5DAL B;  5AIS A;  3TRQ A;  2X8C A;  3KM6 A;  4J2F A;  4MJB A;  2WZ9 A;  3PIN A;  1PL2 A;  1WOU A;  2B5Y A;  4TR1 B;  2L59 A;  1Z5Y E;  3ZTL A;  2F51 A;  1YZX A;  3IK9 A;  3TB2 A;  4YQV A;  2GST A;  5JCU A;  1SL1 B;  3DML A;  4DSR A;  4O5U A;  2BJX A;  5IMC A;  1YJ6 A;  2IJY A;  5J5N A;  1A0R P;  1KTE A;  3UIW A;  4YQM A;  1BAY A;  2L57 A;  4WF4 A;  3WGE A;  3ZYW A;  2C8U A;  1MDJ A;  1ZOF A;  1O85 A;  3C73 A;  1VF2 A;  3CXG A;  1K0B A;  1JZR A;  1SKR B;  3BD2 A;  2GS3 A;  1XVW A;  4ISD A;  2O7K A;  4F9Z A;  4XRD A;  5B6N A;  4BVX A;  5D73 A;  3APQ A;  3EU4 A;  1SYX A;  4EUY A;  5D9V A;  4HOJ A;  2FWH A;  4K7I A;  3GYK A;  1ZYQ B;  5D9T A;  1FOV A;  4V1A g;  4MJC A;  1B8X A;  1X5D A;  1BQ7 A;  4BVX B;  2GVP A;  2H19 A;  2EIR A;  4J57 E;  2QKE A;  3PR8 A;  3BCI A;  2ON5 A;  1PKW A;  3GSS A;  2H6Y A;  1XIY A;  3UEM A;  1FOH A;  1SU9 A;  4TVE A;  3L9V A;  1YDK A;  1SK1 A;  1SL0 B;  1J08 A;  4TRX A;  3TCO A;  1YF0 A;  4G2E A;  3C8E A;  2PU9 C;  4ZL9 A;  5J9B A;  1G7O A;  1GUL A;  1B48 A;  2F8A A;  2IMK A;  3QD9 A;  3R3E A;  4D73 A;  1ZGN A;  3C71 A;  2CX3 A;  3HZ8 A;  3A2V A;  2AUV A;  4ECB A;  3MAK A;  4FQU A;  2FGX A;  5IMZ A;  3HYP A;  2MMN A;  4FH8 A;  4EDY A;  5BRT A;  5HQP A;  3DYR A;  4D73 B;  3I9V 2;  5ECH B;  3QOU A;  1OC9 B;  3GKK A;  4MK3 A;  2H1G A;  1Q98 A;  1RQM A;  4MAB A;  2R0P A;  3LYP A;  3QPM A;  4ILF A;  4JU5 A;  5D8I A;  3M0F A;  5KN1 A;  3ZLP A;  2QC7 A;  1MDI A;  2GSS A;  3CYN A;  4MZC A;  2X8H A;  4IGJ A;  3J7Y b;  4POM A;  3WYW A;  1V58 A;  2HFD A;  2E2G A;  3F6D A;  4FYU A;  3EU3 A;  3UL3 A;  2HRA A;  2H0G A;  1T4Y A;  2GSR A;  2VM2 A;  3HVN A;  4H86 A;  5BMU A;  2RLI A;  4XTS A;  2WUL A;  1ZYE A;  2GZP A;  1XXU A;  4Q5F A;  3GKM A;  2E0Q A;  3GA4 A;  5LNK e;  2KOK A;  3UBK A;  1BYE A;  5F07 A;  2DJJ A;  3FY7 A;  4DVC A;  3ZIV A;  1S3A A;  4BL7 B;  3TOT A;  2GZY A;  3F3Q A;  2X8G A;  4PUF C;  4I2U A;  5A4V A;  3EMP A;  11GS A;  3HJP A;  3FZ4 A;  3HJO A;  2XPD A;  4XIH A;  4MCU A;  4XRA A;  3O6T A;  1PD2 1;  3LSZ A;  1SJ6 A;  4EKZ A;  3KJY A;  3NOF A;  3GTU A;  2RII A;  4QL7 A;  3G9B A;  3QAW A;  3E9J B;  5D96 A;  4I5Q A;  4WR4 A;  4BVY A;  1SD8 A;  9GSS A;  1DE1 A;  3CRU A;  2MMZ A;  2JZT A;  2V2G A;  4N0Z A;  4X1U A;  3A3T A;  1HQO A;  4MZB A;  2YWM A;  3RBT A;  3CTG A;  1XW6 A;  1EOH A;  4MMM A;  2OE3 A;  3H1N A;  4YAV A;  2YN1 A;  1GTB A;  4EVM A;  3A5I A;  3GIX A;  1XCC A;  1AQX A;  2FWE A;  2HSM A;  4G0I A;  3IRA A;  4GQF A;  2JSY A;  1OKD A;  1TXX A;  1WWJ A;  1KEB A;  3M9K A;  1X9S B;  1Z9H A;  1PX7 A;  2YWI A;  3Q74 A;  2GQM A;  2LNS A;  1XBS A;  5AIX A;  1ML6 A;  1WJK A;  3BBY A;  1W89 A;  1S3C A;  4USS A;  5G5E A;  1X9W B;  4ULX A;  3KZQ A;  4V2N A;  1G0T A;  3LOR A;  2K18 A;  4EIQ A;  1OYJ A;  1A23 A;  1F9M A;  3HZ4 A;  4GSN A;  4K0N A;  3P8W A;  1XOA A;  4HEA 2;  2XPE A;  1ZMA A;  14GS A;  4KUN A;  5CO3 A;  4I97 A;  4G9H A;  3ERW A;  4IS0 A;  3WD6 A;  3EMX A;  3IV4 A;  1J0F A;  1Z6N A;  5FHI A;  2AB6 A;  1NW2 A;  4NMU A;  2R5G A;  2CV4 A;  2BMX A;  3VUR A;  4PQH A;  5HR2 A;  4E8H A;  2LRC A;  2C80 A;  1AAZ A;  1ZL9 A;  2ZCT A;  3IE3 A;  1M2A A;  1SJI A;  3KMN A;  4HZ2 A;  4KH7 A;  4DSS A;  6GST A;  1F37 A;  1OKT A;  2VCQ A;  4IKH A;  1K0O A;  3FMW A;  5DBQ A;  1GNW A;  1EEM A;  6GSY A;  5ECQ B;  17GS A;  5DDL A;  5IIZ A;  1TRS A;  3GRX A;  4DSS B;  4TKY A;  5HR1 A;  5DQS A;  3IXR A;  1WIK A;  3GUR A;  1M2D A;  2CZ2 A;  3TKR A;  4KCA A;  1TKD B;  5KN3 A;  4F0B A;  2V6K A;  5A4U A;  3FK8 A;  2B5X A;  4KCE A;  2PVQ A;  2OE1 A;  5ECO B;  2L6D A;  3APS A;  1Y25 A;  1EWX A;  3D5J A;  1Z7R A;  5EPF A;  4CHS A;  2VAF A;  2H76 A;  4K5R A;  3EWL A;  1DBY A;  3DRN A;  3QFA C;  3VI7 A;  3GH6 A;  2YV9 A;  3ZML A;  3TJJ A;  3C1S A;  3FKF A;  2LJK A;  3ME7 A;  5IOX A;  5C04 A;  5H5Q A;  2C3T A;  2QSI A;  1OAZ A;  2VCV A;  1EP7 A;  2DLX A;  3VLN A;  4LLR A;  2NBS A;  4ZBD A;  1R5A A;  1GUH A;  2LS5 A;  1F3B A;  2N5B A;  2ES7 A;  1TU7 A;  5ECI B;  3PGT A;  2PBJ A;  2G2Q A;  1GSF A;  1ON4 A;  5D9X A;  4I8B A;  3C7M A;  2DMM A;  3LXT A;  1KBN A;  1GH2 A;  5H5R A;  1SYR A;  2CVB A;  3HVS A;  1BG5 A;  1N2A A;  4JR6 A;  3H4K A;  13GS A;  2WCI A;  19GS A;  2O89 A;  3P2A A;  2LST A;  4K1F A;  3GKX A;  4QL9 A;  4F82 A;  3F4R A;  1TK0 B;  5GAN D;  2LV3 A;  1EV9 A;  3FW2 A;  4GXZ A;  4NHZ A;  4CDO A;  4ID0 A;  2OBI A;  3VWX A;  3M3M A;  3CQF A;  4PNF A;  2H6Z A;  1U87 A;  1K3O A;  3VK9 A;  5DJM A;  3FZ5 A;  3E3E A;  4BWQ A;  2M72 A;  2JU5 A;  4MPF A;  2HZF A;  3VI5 A;  1T1V A;  4HSC X;  2HYX A;  2DBC A;  3TJK A;  2H1D A;  3ZIT A;  1OVN A;  1WE0 A;  4ECI A;  2H0H A;  1F6M C;  1PA3 A;  3HHV A;  3TRP A;  4KE3 A;  4TR1 A;  2H30 A;  1K0C A;  2H0I A;  3NZN A;  2L4Q A;  1ABA A;  3ZMK A;  1GL8 A;  1PN9 A;  2FA8 A;  1Z6M A;  2KLX A;  1EEJ A;  2R0G A;  1GSD A;  2AJQ B;  1CQG A;  1OC8 A;  2LJA A;  2B7K A;  3G7Y A;  2A4V A;  3EVI A;  1BED A;  1TP9 A;  5CRG A;  3M8N A;  3ERF A;  1TK5 B;  1TRU A;  1R5P A;  2N5A A;  3E0U A;  2KUC A;  3TKS C;  2CT6 A;  2X4A A;  4WXT A;  3LGC A;  4Z2T A;  2PPT A;  2YZH A;  4OMV A;  4AGS A;  4TW5 A;  1FVK A;  2BTO T;  4F0C A;  3D4T A;  4N0V A;  4KAE A;  3KIJ A;  4RI6 A;  2HNL A;  2MZC A;  2M46 A;  3KP8 A;  4WR5 A;  1FO5 A;  4MH2 A;  1EGO A;  1T7P B;  2XBQ A;  2LQO A;  4K6X A;  3ZVJ D;  1I5G A;  2R0C A;  3ISO A;  2N5F A;  4JE1 A;  3GV1 A;  4NV5 A;  2IL3 A;  4K0G A;  3TOU A;  2O8V B;  2H8L A;  1JZD A;  2VLU A;  3EUR A;  2KP1 A;  2GQL A;  2HZE A;  3O3T A;  3IA1 A;  4WF5 A;  2B6M A;  3EYT A;  4L8E A;  1XWB A;  3GUS A;  3FEU A;  3H8Q A;  3TJF A;  1FW1 A;  2UZ8 A;  2ZNM A;  2DKI A;  5ELG A;  2GSQ A;  3GH9 A;  2HZE B;  2GT6 A;  2IFQ B;  3QAV A;  2LEG A;  4I6X A;  2JL4 A;  4ECJ A;  5G1K A;  1PMT A;  3PH9 A;  4HI7 A;  1SJZ A;  2TRC P;  2YJ7 A;  4A5P A;  4LMW A;  2A4H A;  2B7J A;  4FO5 A;  2J9H A;  4PTS A;  5J4U A;  2V6O A;  5DVB A;  4ZBB A;  1OC9 A;  4NAX A;  2GZZ A;  1V9W A;  3M9J A;  4WBR D;  3GN3 A;  1JLV A;  1V98 A;  1ERT A;  3C1R A;  1B9Y C;  2IMF A;  4XS4 A;  1Q4J A;  2HE3 A;  2NVL A;  2CAI A;  3RHB A;  3HD5 A;  2MMA A;  5JCW A;  1ZYN A;  2AAW A;  4AF2 A;  1PQN A;  1J9B A;  1GTU A;  1LBK A;  3DIE A;  2H75 A;  3H93 A;  2B3S A;  4XS4 B;  4KND A;  4OD7 A;  4HJ2 A;  4KA0 A;  4NXI A;  2PN8 A;  1WRY A;  1VF1 A;  3ME8 A;  1HD2 A;  3IK7 A;  3KCM A;  3MNG A;  3ZVJ A;  4CY6 A;  1K3L A;  3DD3 A;  5KEJ A;  1HNA A;  3DKS A;  4IP6 A;  1TOF A;  2WJU A;  4GF0 A;  3D6I A;  4K2D A;  2OBK A;  1SKS B;  2FLS A;  2JZS A;  1TW9 A;  1VRS D;  1AQW A;  4EE0 A;  3WT1 A;  2B1L A;  2CZ3 A;  4TXV A;  2EC4 A;  4OFN A;  1MTC A;  5E4W A;  2YP6 A;  4BL7 A;  5B8B A;  4PGT A;  2DIY A;  2R3X A;  2DJK A;  4EXJ A;  1PX6 A;  3F4T A;  2VL2 A;  1GTA A;  3FRC A;  2MMO A;  5B7C A;  2V41 A;  1WMJ A;  5HFK A;  1FG4 A;  3K8N A;  4LA1 A;  4HQS A;  3ZRD A;  3KEB A;  3KTL A;  4V1A p;  5J9C A;  2LQQ A;  2LTK A;  3QAG A;  5HR3 A;  3WGD A;  2I1U A;  3TUE A;  3GNJ A;  1QXH A;  1QUW A;  2YNX A;  3D0Z A;  4OO4 A;  1QK8 A;  3ZRE A;  4IJ3 A;  4MDC A;  3GL5 A;  2DML A;  3IBH A;  2YOI A;  2GLR A;  1U3I A;  4KF9 A;  2X49 A;  1GSQ A;  2P5R A;  22GS A;  3Q19 A;  2VCX A;  1YKC A;  4HUA A;  5CRE A;  2H71 A;  4ZL8 A;  1LJR A;  4GWR A;  5IPG A;  20GS A;  6GSX A;  2XBI A;  2GTU A;  5CYY A;  5KN0 A;  3QR6 A;  2E2M A;  1RK4 A;  1R26 A;  4MJA A;  4K7O A;  4LL4 B;  2V1M A;  3QFB C;  5IM9 A;  4PXO A;  1T3B A;  4OCF A;  5ECL B;  3FR9 A;  2I81 A;  3LW9 A;  5DCG A;  6GSS A;  5B8A A;  3HCZ A;  4ZIJ A;  3EE2 A;  4O7H A;  4EL1 A;  2AV4 A;  3APO A;  1RW1 A;  3F63 A;  4DEJ A;  1FB6 A;  1THX A;  1ERV A;  3GHA A;  1B4Q A;  2HSY A;  4GTU A;  1V40 A;  2RUE A;  1PFO A;  5IMF A;  4ACS A;  1U6T A;  4GCI A;  4TN8 A;  5G31 A;  4CY8 A;  1PGT A;  3UBL A;  4PNG A;  2VLV A;  6GSW A;  4ECC A;  4YAP A;  2VL2 C;  2H6X A;  1M99 A;  5GST A;  1MD3 A;  2H72 A;  1EV4 A;  4EO3 A;  5IMA A;  1H75 A;  2YJH A;  2C0D A;  5G1L A;  5J41 A;  3FR6 A;  4PQ1 A;  3LXZ A;  1O8W A;  1XWG A;  1AXD A;  1G6W A;  4RUV A;  2HRF A;  3TDG A;  1HNB A;  2TRX A;  4WKW A;  3H79 A;  4TR3 A;  5JWQ B;  3VWU A;  3ZFL A;  4EF0 A;  3CBU A;  1PN0 A;  4NWY A;  3N5O A;  1B4P A;  2C4J A;  1UVZ A;  1W4V A;  4EIP A;  2EIO A;  5DJL A;  1OE8 A;  2HSH A;  3D21 A;  1NHO A;  18GS A;  3L9U A;  1TTZ A;  2B5E A;  2YV7 A;  4V2M A;  5F05 A;  2H70 A;  4YQU A;  4AJ7 A;  2OKA A;  1SL2 B;  2CA8 A;  4ML6 A;  2HRN A;  5AIV A;  4POB A;  2PER A;  3EPT A;  5ABR A;  1AUC A;  1R7H A;  2HT9 A;  5G5F A;  1ERU A;  2QA2 A;  1GRX A;  2X64 A;  3J7Y k;  2PUK C;  1F3A A;  5ECN B;  3D22 A;  4YKG A;  3I6A A;  5E59 A;  3W6G A;  4O5Q A;  4ZXG A;  4HS1 A;  3BCK A;  4X4J A;  4K7N A;  2PWJ A;  5JWO B;  1O73 A;  2YZU A;  2JZR A;  5IQY A;  2AYT A;  1EGR A;  1NHY A;  3N9J A;  3US3 A;  2YAN A;  2CVK A;  2FWG A;  1X5C A;  4OCE A;  2M80 A;  2WS2 A;  2A2P A;  2L5L A;  4IP1 A;  4RQX A;  2VM1 A;  1SKW B;  3UOM A;  2F9S A;  2CAQ A;  12GS A;  2VD1 A;  4IQ1 A;  2IPA A;  3IC8 A;  4L0W A;  2L6C A;  1USB A;  1YQ1 A;  5J3R A;  5FWG A;  4MJE A;  1GSS A;  1OE7 A;  4NHW A;  4YKF A;  1VGL A;  3CSI A;  3GMF A;  1M9B A;  1DSB A;  5FT3 A;  4HQZ A;  4HDE A;  1LU4 A;  1V57 A;  1GSE A;  1JFU A;  4ICY A;  3BOA A;  3HVX A;  2IN3 A;  1QQ2 A;  2VUP A;  3MYD A;  4LL1 B;  4Z7X A;  5A4W A;  3L9S A;  5LD0 A;  1GTI A;  4FYC A;  3CMI A;  5B6M A;  3UAR A;  5ID2 A;  5IMV A;  2DC5 A;  1I9D A;  2REM A;  3A2X A;  4N30 A;  1QMV A;  3U6V A;  3CTF A;  3G7I A;  3GX0 A;  1O6J A;  5ECP B;  3TKQ A;  3UMA A;  2O87 A;  2OAC A;  5ID2 B;  2DIZ A;  1TU8 A;  1SK0 A;  1K0A A;  3FZ9 A;  2MYG A;  2K6V A;  2YCD A;  2D2Z A;  1PL1 A;  4E8E A;  4QQ7 A;  1T4Z A;  1T8E B;  1TDI A;  1JHB A;  4TOP A;  5KOW A;  2A2S A;  3I43 A;  3I69 A;  5DCH A;  1BJX A;  4IEL A;  2DJ2 A;  2F3M A;  1A0F A;  1Z3E A;  1M9A A;  2H1A A;  5C00 A;  5AGY A;  4MLY A;  5KN2 A;  1VF3 A;  2FA4 A;  2H1B A;  2FY6 A;  3OR5 A;  2YPM A;  4JED A;  1A2J A;  4KX4 A;  2H66 A;  3L0H A;  2ALB A;  2JSZ A;  4Q5Q A;  4IBP A;  2Z9S A;  1K0D A;  4BPY A;  1O7U A;  5HFG A;  3ZIJ A;  2VOC A;  2VCW A;  2ON7 A;  1PKZ A;  1WP0 A;  2HXK A;  4DSQ A;  2WFC A;  1U3A A;  1R4W A;  5JCG A;  3ERG A;  2AHE A;  1S3D A;  3LG6 A;  4J56 E;  3S9F A;  3ED3 A;  3G7J A;  5G30 A;  3RAZ A;  3TRX A;  1GUK A;  4N11 A;  1TI3 A;  4ZB9 A;  1FB0 A;  2R37 A;  4O92 A;  3IHG A;  1ACV A;  1NM3 A;  3F6F A;  1E6B A;  2XC2 A;  4MH3 A;  2IFQ A;  3V1W A;  5F8B A;  4Q5N A;  2VCT A;  1IYH A;  1QGV A;  1JZW A;  3L4N A;  1QFN A;  1ST9 A;  3FZA A;  3KXO A;  5DQY A;  2GGT A;  7GSS A;  2FUG 2;  4EC0 A;  4PX1 A;  2VIM A;  4FIW A;  1A8L A;  4OFM A;  4K2X A;  16GS A;  3ZL5 A;  1A24 A;  1EP8 A;  4K9Z A;  1HYU A;  1E2Y A;  4XCS A;  4G0L A;  1SEN A;  1X5E A;  2TIR A;  1N8J A;  4NV2 A;  2RM6 A;  1JLW A;  4Z2U A;  4K8M A;  1YKA A;  3AY8 A;  5D9W A;  4KDU A;  2R6K A;  3Q6O A;  5GSS A;  4JR4 A;  1GWC A;  5GZZ B;  3TKS E;  1XWC A;  2VD0 A;  1M2B A;  1NSW A;  2X99 A;  3NIV A;  3VWV A;  3TJG A;  1GLP A;  4N10 A;  1U88 A;  2NPB A;  1TRV A;  3SWL A;  4HU7 A;  4PUA A;  5H5S A;  2DJ1 A;  3IAM 2;  1PRX A;  3MWH A;  1BX9 A;  3KMO A;  1GSU A;  1G7E A;  1A2L A;  1YY7 A;  1T00 A;  1WPI A;  2C0F A;  2DJ3 A;  3CRT A;  4IQA A;  3DEX A;  4KDY A;  2P5Q A;  1AIU A;  1G6Y A;  1SD9 A;  4ZL7 A;  1HNC A;  1TK8 B;  4IW9 A;  2OA7 A;  1ZZY A;  3TKP A;  1V2A A;  4AJ6 A;  1URM A;  3FR3 A;  2MBT A;  4K5S A;  2OAD A;  1X9M B;  2LRN A;  1GSY A;  4PQI A;  5LCZ A;  3LFL A;  3JCM L;  4MA9 A;  1K0N A;  2LNT A;  1CQH A;  1YEP A;  3EIN A;  1TRW A;  3KH7 A;  4GSS A;  2PMT A;  5COH A;  4XS1 A;  2C0G A;  2O85 A;  2QGV A;  1AQV A;  2EIQ A;  3QCP A;  4POL A;  2CQ9 A;  4G19 A;  4ML1 A;  3LYK A;  3QDN A;  2P31 A;  5ECS A;  3HXS A;  4O32 A;  5IO2 A;  1XWK A;  3LJR A;  4Z2R A;  5DAK A;  4KSO A;  3W8J A;  4GQC A;  1K3Y A;  2NDO A;  3GX8 A;  2GT5 A;  1XW9 A;  1YEX A;  1XPV A;  2FD3 A;  4IJI A;  2C3N A;  1Y6E A;  1H4O A;  3KGK A;  2IMI A;  4RQR A;  4MF6 A;  2CVD A;  1K0M A;  3DVX A;  3SBC A;  4IHU A;  2MBS A;  1OC3 A;  2FNO A;  4POK A;  5DAK B;  5IMD A;  1XOB A;  1M7T A;  3IPZ A;  2HLS A;  2WB9 A;  3D4M A;  3ZZX A;  1MEK A;  4X43 A;  5INY A;  4MF7 A;  1XW5 A;  2JAD A;  3DGQ A;  4BIK A;  4EDZ A;  1A2M A;  4TR0 A;  4YH2 A;  4O5R A;  2RUF A;  3DVW A;  1IYI A;  3IOS A;  4MNN A;  1XZO A;  3IDV A;  4XHM A;  2GQK A;  3IR4 A;  2L5O A;  3P7X A;  2KP2 A;  4RI7 A;  5D93 A;  3GTU B;  4PUR A;  2LUS A;  4I2T A;  1GLQ A;  2I4A A;  5AN1 A;  2OE0 A;  3KD0 A;  1ZCP A;  2DKH A;  4KDX A;  4OFT A;  5EVO A;  4BVY B;  4LMV A;  5G2Z A;  3P90 A;  4HZ4 A;  6GSU A;  3KTB A;  1AW9 A;  3PPU A;  2H01 A;  1TJD A;  5CAX A;  3W8S A;  3UAP A;  3RPN A;  5KOX A;  2I3Y A;  4JBB A;  2FHE A;  3QMX A;  4HU9 A;  3F4S A;  4P3Y B;  2CX4 A;  3VPT A;  3M1G A;  3IHQ A;  4GLT A;  2B1K A;  4NPB A;  2XHF A;  3FHK A;  2R4V A;  1O81 A;  2GDR A;  4TXO A;  1X0R A;  3HKR A;  4FYB A; 
#chains in the Genus database with same CATH homology
 4MP4 A;  4JRR A;  4GST A;  3A2W A;  3LQ7 A;  3WT2 A;  4IVF A;  3RHC A;  5CRD A;  3U5R E;  5EL8 A;  4F03 A;  4WBJ A;  1M0U A;  1XVQ A;  2HI7 A;  4HJM A;  2IWT A;  1TI1 A;  4TXO B;  2WRT A;  1ZYP A;  3KH9 A;  2LKU A;  8GSS A;  5ELA A;  4ZB6 A;  4X0X A;  5IPH A;  5ECM B;  3ZFB A;  3O76 A;  4MF5 A;  4ZBA A;  4BA7 A;  1GNE A;  1Z7P A;  3GKN A;  2YWO A;  4WEY A;  2VL3 A;  2C1Y A;  2DJ0 A;  3TGZ A;  2IME A;  2FWF A;  5ENU A;  3L78 A;  2VLT A;  1EZK A;  1F2E A;  4V2L A;  3TJB A;  4BWS A;  4MZW A;  3UJ1 A;  3Q18 A;  2VL9 A;  3CSH A;  4CW9 A;  1UC7 A;  4GRF A;  4L5O A;  4MPG A;  2DSA A;  3HY2 A;  1ERW A;  5ECR B;  4KSM A;  3EC3 A;  3IC4 A;  1YF1 A;  2H73 A;  1C72 A;  4L0U A;  2C0E A;  2VO4 A;  3CSJ A;  2H74 A;  3DXB A;  1DUG A;  3UVT A;  2L4C A;  3F3R A;  2JAC A;  5CRH A;  1JZO A;  5IOW A;  3VPQ A;  5CRW A;  4F2I A;  1FAA A;  3F8U A;  2QA1 A;  4G0K A;  2PVO C;  1UA5 A;  3VWW A;  5IO0 A;  1EOG A;  2IMD A;  5HFI A;  1FHE A;  2PGT A;  5EY6 A;  1SK2 A;  3IAS 2;  1XWA A;  5GAP D;  1KNG A;  2G0F A;  2P0G A;  5CP1 A;  3UVH A;  1B9X C;  4OWY A;  2HRK A;  2LJR A;  1DE2 A;  2K9F A;  3MIX A;  3HJM A;  5JWR B;  3A5W A;  4IN0 A;  3TKS A;  4ZB8 A;  2VCZ A;  3F9U A;  4KW6 A;  3FYG A;  2LRT A;  6GSV A;  3BJ5 A;  5F06 A;  5CNW A;  3MSZ A;  1AC1 A;  2RM5 A;  2KHP A;  3R2Q A;  2NTO A;  1PSQ A;  3VFI A;  5ECK B;  2YWN A;  1THO A;  10GS A;  5L71 A;  2A2R A;  2IIY A;  2I9H A;  1A8Y A;  4JZQ A;  4KB3 A;  4Q5R A;  2WDU A;  3HA9 A;  1ILO A;  1VF4 A;  1XFL A;  3HDC A;  1MD4 A;  3F0I A;  3GST A;  3LWA A;  3RPP A;  4WET A;  3LEF A;  2WGR A;  4L5L A;  2E7P A;  1GP1 A;  3WGX A;  5HR0 A;  2F8F A;  5A5K A;  2R2J A;  3RDW A;  5F0G A;  3KP9 A;  3MDK A;  2J23 A;  3DWV A;  4G10 A;  2K8V A;  4XS6 A;  4TR4 A;  2V32 A;  2ZUP A;  4KGI A;  5DAL A;  4OO5 A;  4AJ8 A;  2C3Q A;  3GL3 A;  1MDK A;  1UN2 A;  1FVJ A;  3GFK A;  2FCH A;  1O8X A;  2OJL A;  4ZIL A;  2K8S A;  3HVV A;  1GUM A;  5DAL B;  5AIS A;  3TRQ A;  2X8C A;  3KM6 A;  4J2F A;  4MJB A;  2WZ9 A;  3PIN A;  1PL2 A;  1WOU A;  2B5Y A;  4TR1 B;  2L59 A;  1Z5Y E;  3ZTL A;  2F51 A;  1YZX A;  3IK9 A;  3TB2 A;  4YQV A;  2GST A;  5JCU A;  1SL1 B;  3DML A;  4DSR A;  4O5U A;  2BJX A;  5IMC A;  1YJ6 A;  2IJY A;  5J5N A;  1A0R P;  1KTE A;  3UIW A;  4YQM A;  1BAY A;  2L57 A;  4WF4 A;  3WGE A;  3ZYW A;  2C8U A;  1MDJ A;  1ZOF A;  1O85 A;  3C73 A;  1VF2 A;  3CXG A;  1K0B A;  1JZR A;  1SKR B;  3BD2 A;  2GS3 A;  1XVW A;  4ISD A;  2O7K A;  4F9Z A;  4XRD A;  5B6N A;  4BVX A;  5D73 A;  3APQ A;  3EU4 A;  1SYX A;  4EUY A;  5D9V A;  4HOJ A;  2FWH A;  4K7I A;  3GYK A;  1ZYQ B;  5D9T A;  1FOV A;  4V1A g;  4MJC A;  1B8X A;  1X5D A;  1BQ7 A;  4BVX B;  2GVP A;  2H19 A;  2EIR A;  4J57 E;  2QKE A;  3PR8 A;  3BCI A;  2ON5 A;  1PKW A;  3GSS A;  2H6Y A;  1XIY A;  3UEM A;  1FOH A;  1SU9 A;  4TVE A;  3L9V A;  1YDK A;  1SK1 A;  1SL0 B;  1J08 A;  4TRX A;  3TCO A;  1YF0 A;  4G2E A;  3C8E A;  2PU9 C;  4ZL9 A;  5J9B A;  1G7O A;  1GUL A;  1B48 A;  2F8A A;  2IMK A;  3QD9 A;  3R3E A;  4D73 A;  1ZGN A;  3C71 A;  2CX3 A;  3HZ8 A;  3A2V A;  2AUV A;  4ECB A;  3MAK A;  4FQU A;  2FGX A;  5IMZ A;  3HYP A;  2MMN A;  4FH8 A;  4EDY A;  5BRT A;  5HQP A;  3DYR A;  4D73 B;  3I9V 2;  5ECH B;  3QOU A;  1OC9 B;  3GKK A;  4MK3 A;  2H1G A;  1Q98 A;  1RQM A;  4MAB A;  2R0P A;  3LYP A;  3QPM A;  4ILF A;  4JU5 A;  5D8I A;  3M0F A;  5KN1 A;  3ZLP A;  2QC7 A;  1MDI A;  2GSS A;  3CYN A;  4MZC A;  2X8H A;  4IGJ A;  3J7Y b;  4POM A;  3WYW A;  1V58 A;  2HFD A;  2E2G A;  3F6D A;  4FYU A;  3EU3 A;  3UL3 A;  2HRA A;  2H0G A;  1T4Y A;  2GSR A;  2VM2 A;  4H86 A;  5BMU A;  2RLI A;  4XTS A;  2WUL A;  1ZYE A;  2GZP A;  1XXU A;  4Q5F A;  3GKM A;  2E0Q A;  3GA4 A;  5LNK e;  2KOK A;  3UBK A;  1BYE A;  5F07 A;  2DJJ A;  3FY7 A;  4DVC A;  3ZIV A;  1S3A A;  4BL7 B;  3TOT A;  2GZY A;  3F3Q A;  2X8G A;  4PUF C;  4I2U A;  5A4V A;  3EMP A;  11GS A;  3HJP A;  3FZ4 A;  3HJO A;  2XPD A;  4XIH A;  4MCU A;  4XRA A;  3O6T A;  1PD2 1;  3LSZ A;  1SJ6 A;  4EKZ A;  3KJY A;  3NOF A;  3GTU A;  2RII A;  4QL7 A;  3G9B A;  3QAW A;  3E9J B;  5D96 A;  4I5Q A;  4WR4 A;  4BVY A;  1SD8 A;  9GSS A;  1DE1 A;  3CRU A;  2MMZ A;  2JZT A;  2V2G A;  4N0Z A;  4X1U A;  3A3T A;  1HQO A;  4MZB A;  2YWM A;  3RBT A;  3CTG A;  1XW6 A;  1EOH A;  4MMM A;  2OE3 A;  3H1N A;  4YAV A;  2YN1 A;  1GTB A;  4EVM A;  3A5I A;  3GIX A;  1XCC A;  1AQX A;  2FWE A;  2HSM A;  4G0I A;  3IRA A;  4GQF A;  2JSY A;  1OKD A;  1TXX A;  1WWJ A;  1KEB A;  3M9K A;  1X9S B;  1Z9H A;  1PX7 A;  2YWI A;  3Q74 A;  2GQM A;  2LNS A;  1XBS A;  5AIX A;  1ML6 A;  1WJK A;  3BBY A;  1W89 A;  1S3C A;  4USS A;  5G5E A;  1X9W B;  4ULX A;  3KZQ A;  4V2N A;  1G0T A;  3LOR A;  2K18 A;  4EIQ A;  1OYJ A;  1A23 A;  1F9M A;  3HZ4 A;  4GSN A;  4K0N A;  3P8W A;  1XOA A;  4HEA 2;  2XPE A;  1ZMA A;  14GS A;  4KUN A;  5CO3 A;  4I97 A;  4G9H A;  3ERW A;  4IS0 A;  3WD6 A;  3EMX A;  3IV4 A;  1J0F A;  1Z6N A;  5FHI A;  2AB6 A;  1NW2 A;  4NMU A;  2R5G A;  2CV4 A;  2BMX A;  3VUR A;  4PQH A;  5HR2 A;  4E8H A;  2LRC A;  2C80 A;  1AAZ A;  1ZL9 A;  2ZCT A;  3IE3 A;  1M2A A;  1SJI A;  3KMN A;  4HZ2 A;  4KH7 A;  4DSS A;  6GST A;  1F37 A;  1OKT A;  2VCQ A;  4IKH A;  1K0O A;  3FMW A;  5DBQ A;  1GNW A;  1EEM A;  6GSY A;  5ECQ B;  17GS A;  5DDL A;  5IIZ A;  1TRS A;  3GRX A;  4DSS B;  4TKY A;  5HR1 A;  5DQS A;  3IXR A;  1WIK A;  3GUR A;  1M2D A;  2CZ2 A;  3TKR A;  4KCA A;  1TKD B;  5KN3 A;  4F0B A;  2V6K A;  5A4U A;  3FK8 A;  2B5X A;  4KCE A;  2PVQ A;  2OE1 A;  5ECO B;  2L6D A;  3APS A;  1Y25 A;  1EWX A;  3D5J A;  1Z7R A;  5EPF A;  4CHS A;  2VAF A;  2H76 A;  4K5R A;  3EWL A;  1DBY A;  3DRN A;  3QFA C;  3VI7 A;  3GH6 A;  2YV9 A;  3ZML A;  3TJJ A;  3C1S A;  3FKF A;  2LJK A;  3ME7 A;  5IOX A;  5C04 A;  5H5Q A;  2C3T A;  2QSI A;  1OAZ A;  2VCV A;  1EP7 A;  2DLX A;  3VLN A;  4LLR A;  2NBS A;  4ZBD A;  1R5A A;  1GUH A;  2LS5 A;  1F3B A;  2N5B A;  2ES7 A;  1TU7 A;  5ECI B;  3PGT A;  2PBJ A;  2G2Q A;  1GSF A;  1ON4 A;  5D9X A;  4I8B A;  3C7M A;  2DMM A;  3LXT A;  1KBN A;  1GH2 A;  5H5R A;  1SYR A;  2CVB A;  3HVS A;  1BG5 A;  1N2A A;  4JR6 A;  3H4K A;  13GS A;  2WCI A;  19GS A;  2O89 A;  3P2A A;  2LST A;  4K1F A;  3GKX A;  4QL9 A;  4F82 A;  3F4R A;  1TK0 B;  5GAN D;  2LV3 A;  1EV9 A;  3FW2 A;  4GXZ A;  4NHZ A;  4CDO A;  4ID0 A;  2OBI A;  3VWX A;  3M3M A;  4PNF A;  2H6Z A;  1U87 A;  1K3O A;  3VK9 A;  5DJM A;  3FZ5 A;  3E3E A;  4BWQ A;  2M72 A;  2JU5 A;  4MPF A;  2HZF A;  3VI5 A;  1T1V A;  2HYX A;  2DBC A;  3TJK A;  2H1D A;  3ZIT A;  1OVN A;  1WE0 A;  4ECI A;  2H0H A;  1F6M C;  1PA3 A;  3HHV A;  3TRP A;  4KE3 A;  4TR1 A;  2H30 A;  1K0C A;  2H0I A;  3NZN A;  2L4Q A;  1ABA A;  3ZMK A;  1GL8 A;  1PN9 A;  2FA8 A;  1Z6M A;  2KLX A;  1EEJ A;  2R0G A;  1GSD A;  2AJQ B;  1CQG A;  1OC8 A;  2LJA A;  2B7K A;  3G7Y A;  2A4V A;  3EVI A;  1BED A;  1TP9 A;  5CRG A;  3M8N A;  3ERF A;  1TK5 B;  1TRU A;  1R5P A;  2N5A A;  3E0U A;  2KUC A;  3TKS C;  2CT6 A;  2X4A A;  4WXT A;  3LGC A;  4Z2T A;  2PPT A;  2YZH A;  4OMV A;  4AGS A;  4TW5 A;  1FVK A;  2BTO T;  4F0C A;  3D4T A;  4N0V A;  4KAE A;  3KIJ A;  4RI6 A;  2HNL A;  2MZC A;  2M46 A;  3KP8 A;  4WR5 A;  1FO5 A;  4MH2 A;  1EGO A;  1T7P B;  2XBQ A;  2LQO A;  4K6X A;  3ZVJ D;  1I5G A;  2R0C A;  3ISO A;  2N5F A;  4JE1 A;  3GV1 A;  4NV5 A;  2IL3 A;  4K0G A;  3TOU A;  2O8V B;  2H8L A;  1JZD A;  2VLU A;  3EUR A;  2KP1 A;  2GQL A;  2HZE A;  3O3T A;  3IA1 A;  4WF5 A;  2B6M A;  3EYT A;  4L8E A;  1XWB A;  3GUS A;  3FEU A;  3H8Q A;  3TJF A;  1FW1 A;  2UZ8 A;  2ZNM A;  2DKI A;  5ELG A;  2GSQ A;  3GH9 A;  2HZE B;  2GT6 A;  2IFQ B;  3QAV A;  2LEG A;  4I6X A;  2JL4 A;  4ECJ A;  5G1K A;  1PMT A;  3PH9 A;  4HI7 A;  1SJZ A;  2TRC P;  2YJ7 A;  4A5P A;  4LMW A;  2A4H A;  2B7J A;  4FO5 A;  2J9H A;  4PTS A;  5J4U A;  2V6O A;  5DVB A;  4ZBB A;  1OC9 A;  4NAX A;  2GZZ A;  1V9W A;  3M9J A;  4WBR D;  3GN3 A;  1JLV A;  1V98 A;  1ERT A;  3C1R A;  1B9Y C;  2IMF A;  4XS4 A;  1Q4J A;  2HE3 A;  2NVL A;  2CAI A;  3RHB A;  3HD5 A;  2MMA A;  5JCW A;  1ZYN A;  2AAW A;  4AF2 A;  1PQN A;  1J9B A;  1GTU A;  1LBK A;  3DIE A;  2H75 A;  3H93 A;  2B3S A;  4XS4 B;  4KND A;  4OD7 A;  4HJ2 A;  4KA0 A;  4NXI A;  2PN8 A;  1WRY A;  1VF1 A;  3ME8 A;  1HD2 A;  3IK7 A;  3KCM A;  3MNG A;  3ZVJ A;  4CY6 A;  1K3L A;  3DD3 A;  5KEJ A;  1HNA A;  3DKS A;  4IP6 A;  1TOF A;  2WJU A;  4GF0 A;  3D6I A;  4K2D A;  2OBK A;  1SKS B;  2FLS A;  2JZS A;  1TW9 A;  1VRS D;  1AQW A;  4EE0 A;  3WT1 A;  2B1L A;  2CZ3 A;  4TXV A;  2EC4 A;  4OFN A;  1MTC A;  5E4W A;  2YP6 A;  4BL7 A;  5B8B A;  4PGT A;  2DIY A;  2R3X A;  2DJK A;  4EXJ A;  1PX6 A;  3F4T A;  2VL2 A;  1GTA A;  3FRC A;  2MMO A;  5B7C A;  2V41 A;  1WMJ A;  5HFK A;  1FG4 A;  3K8N A;  4LA1 A;  4HQS A;  3ZRD A;  3KEB A;  3KTL A;  4V1A p;  5J9C A;  2LQQ A;  2LTK A;  3QAG A;  5HR3 A;  3WGD A;  2I1U A;  3TUE A;  3GNJ A;  1QXH A;  1QUW A;  2YNX A;  3D0Z A;  4OO4 A;  1QK8 A;  3ZRE A;  4IJ3 A;  4MDC A;  3GL5 A;  2DML A;  3IBH A;  2YOI A;  2GLR A;  1U3I A;  4KF9 A;  2X49 A;  1GSQ A;  2P5R A;  22GS A;  3Q19 A;  2VCX A;  1YKC A;  4HUA A;  5CRE A;  2H71 A;  4ZL8 A;  1LJR A;  4GWR A;  5IPG A;  20GS A;  6GSX A;  2XBI A;  2GTU A;  5CYY A;  5KN0 A;  3QR6 A;  2E2M A;  1RK4 A;  1R26 A;  4MJA A;  4K7O A;  4LL4 B;  2V1M A;  3QFB C;  5IM9 A;  4PXO A;  1T3B A;  4OCF A;  5ECL B;  3FR9 A;  2I81 A;  3LW9 A;  5DCG A;  6GSS A;  5B8A A;  3HCZ A;  4ZIJ A;  3EE2 A;  4O7H A;  4EL1 A;  2AV4 A;  3APO A;  1RW1 A;  3F63 A;  4DEJ A;  1FB6 A;  1THX A;  1ERV A;  3GHA A;  1B4Q A;  2HSY A;  4GTU A;  1V40 A;  2RUE A;  5IMF A;  4ACS A;  1U6T A;  4GCI A;  4TN8 A;  5G31 A;  4CY8 A;  1PGT A;  3UBL A;  4PNG A;  2VLV A;  6GSW A;  4ECC A;  4YAP A;  2VL2 C;  2H6X A;  1M99 A;  5GST A;  1MD3 A;  2H72 A;  1EV4 A;  4EO3 A;  5IMA A;  1H75 A;  2YJH A;  2C0D A;  5G1L A;  5J41 A;  3FR6 A;  4PQ1 A;  3LXZ A;  1O8W A;  1XWG A;  1AXD A;  1G6W A;  4RUV A;  2HRF A;  3TDG A;  1HNB A;  2TRX A;  4WKW A;  3H79 A;  4TR3 A;  5JWQ B;  3VWU A;  3ZFL A;  4EF0 A;  3CBU A;  1PN0 A;  4NWY A;  3N5O A;  1B4P A;  2C4J A;  1UVZ A;  1W4V A;  4EIP A;  2EIO A;  5DJL A;  1OE8 A;  2HSH A;  3D21 A;  1NHO A;  18GS A;  3L9U A;  1TTZ A;  2B5E A;  2YV7 A;  4V2M A;  5F05 A;  2H70 A;  4YQU A;  4AJ7 A;  2OKA A;  1SL2 B;  2CA8 A;  4ML6 A;  2HRN A;  5AIV A;  4POB A;  2PER A;  3EPT A;  5ABR A;  1AUC A;  1R7H A;  2HT9 A;  5G5F A;  1ERU A;  2QA2 A;  1GRX A;  2X64 A;  3J7Y k;  2PUK C;  1F3A A;  5ECN B;  3D22 A;  4YKG A;  3I6A A;  5E59 A;  3W6G A;  4O5Q A;  4ZXG A;  4HS1 A;  3BCK A;  4X4J A;  4K7N A;  2PWJ A;  5JWO B;  1O73 A;  2YZU A;  2JZR A;  5IQY A;  2AYT A;  1EGR A;  1NHY A;  3N9J A;  3US3 A;  2YAN A;  2CVK A;  2FWG A;  1X5C A;  4OCE A;  2M80 A;  2WS2 A;  2A2P A;  2L5L A;  4IP1 A;  4RQX A;  2VM1 A;  1SKW B;  3UOM A;  2F9S A;  2CAQ A;  12GS A;  2VD1 A;  4IQ1 A;  2IPA A;  3IC8 A;  4L0W A;  2L6C A;  1USB A;  1YQ1 A;  5J3R A;  5FWG A;  4MJE A;  1GSS A;  1OE7 A;  4NHW A;  4YKF A;  1VGL A;  3CSI A;  3GMF A;  1M9B A;  1DSB A;  5FT3 A;  4HQZ A;  4HDE A;  1LU4 A;  1V57 A;  1GSE A;  1JFU A;  4ICY A;  3BOA A;  3HVX A;  2IN3 A;  1QQ2 A;  2VUP A;  3MYD A;  4LL1 B;  4Z7X A;  5A4W A;  3L9S A;  5LD0 A;  1GTI A;  4FYC A;  3CMI A;  5B6M A;  3UAR A;  5ID2 A;  5IMV A;  2DC5 A;  1I9D A;  2REM A;  3A2X A;  4N30 A;  1QMV A;  3U6V A;  3CTF A;  3G7I A;  3GX0 A;  1O6J A;  5ECP B;  3TKQ A;  3UMA A;  2O87 A;  2OAC A;  5ID2 B;  2DIZ A;  1TU8 A;  1SK0 A;  1K0A A;  3FZ9 A;  2MYG A;  2K6V A;  2YCD A;  2D2Z A;  1PL1 A;  4E8E A;  4QQ7 A;  1T4Z A;  1T8E B;  1TDI A;  1JHB A;  4TOP A;  5KOW A;  2A2S A;  3I43 A;  3I69 A;  5DCH A;  1BJX A;  4IEL A;  2DJ2 A;  2F3M A;  1A0F A;  1Z3E A;  1M9A A;  2H1A A;  5C00 A;  5AGY A;  4MLY A;  5KN2 A;  1VF3 A;  2FA4 A;  2H1B A;  2FY6 A;  3OR5 A;  2YPM A;  4JED A;  1A2J A;  4KX4 A;  2H66 A;  3L0H A;  2ALB A;  2JSZ A;  4Q5Q A;  4IBP A;  2Z9S A;  1K0D A;  4BPY A;  1O7U A;  5HFG A;  3ZIJ A;  2VOC A;  2VCW A;  2ON7 A;  1PKZ A;  1WP0 A;  2HXK A;  4DSQ A;  2WFC A;  1U3A A;  1R4W A;  5JCG A;  3ERG A;  2AHE A;  1S3D A;  3LG6 A;  4J56 E;  3S9F A;  3ED3 A;  3G7J A;  5G30 A;  3RAZ A;  3TRX A;  1GUK A;  4N11 A;  1TI3 A;  4ZB9 A;  1FB0 A;  2R37 A;  4O92 A;  3IHG A;  1ACV A;  1NM3 A;  3F6F A;  1E6B A;  2XC2 A;  4MH3 A;  2IFQ A;  3V1W A;  5F8B A;  4Q5N A;  2VCT A;  1IYH A;  1QGV A;  1JZW A;  3L4N A;  1QFN A;  1ST9 A;  3FZA A;  3KXO A;  5DQY A;  2GGT A;  7GSS A;  2FUG 2;  4EC0 A;  4PX1 A;  2VIM A;  4FIW A;  1A8L A;  4OFM A;  4K2X A;  16GS A;  3ZL5 A;  1A24 A;  1EP8 A;  4K9Z A;  1HYU A;  1E2Y A;  4XCS A;  4G0L A;  1SEN A;  1X5E A;  2TIR A;  1N8J A;  4NV2 A;  2RM6 A;  1JLW A;  4Z2U A;  4K8M A;  1YKA A;  3AY8 A;  5D9W A;  4KDU A;  2R6K A;  3Q6O A;  5GSS A;  4JR4 A;  1GWC A;  5GZZ B;  3TKS E;  1XWC A;  2VD0 A;  1M2B A;  1NSW A;  2X99 A;  3NIV A;  3VWV A;  3TJG A;  1GLP A;  4N10 A;  1U88 A;  2NPB A;  1TRV A;  3SWL A;  4HU7 A;  4PUA A;  5H5S A;  2DJ1 A;  3IAM 2;  1PRX A;  3MWH A;  1BX9 A;  3KMO A;  1GSU A;  1G7E A;  1A2L A;  1YY7 A;  1T00 A;  1WPI A;  2C0F A;  2DJ3 A;  3CRT A;  4IQA A;  3DEX A;  4KDY A;  2P5Q A;  1AIU A;  1G6Y A;  1SD9 A;  4ZL7 A;  1HNC A;  1TK8 B;  4IW9 A;  2OA7 A;  1ZZY A;  3TKP A;  1V2A A;  4AJ6 A;  1URM A;  3FR3 A;  2MBT A;  4K5S A;  2OAD A;  1X9M B;  2LRN A;  1GSY A;  4PQI A;  5LCZ A;  3LFL A;  3JCM L;  4MA9 A;  1K0N A;  2LNT A;  1CQH A;  1YEP A;  3EIN A;  1TRW A;  3KH7 A;  4GSS A;  2PMT A;  5COH A;  4XS1 A;  2C0G A;  2O85 A;  2QGV A;  1AQV A;  2EIQ A;  3QCP A;  4POL A;  2CQ9 A;  4G19 A;  4ML1 A;  3LYK A;  3QDN A;  2P31 A;  5ECS A;  3HXS A;  4O32 A;  5IO2 A;  1XWK A;  3LJR A;  4Z2R A;  5DAK A;  4KSO A;  3W8J A;  4GQC A;  1K3Y A;  2NDO A;  3GX8 A;  2GT5 A;  1XW9 A;  1YEX A;  1XPV A;  2FD3 A;  4IJI A;  2C3N A;  1Y6E A;  1H4O A;  3KGK A;  2IMI A;  4RQR A;  4MF6 A;  2CVD A;  1K0M A;  3DVX A;  3SBC A;  4IHU A;  2MBS A;  1OC3 A;  2FNO A;  4POK A;  5DAK B;  5IMD A;  1XOB A;  1M7T A;  3IPZ A;  2HLS A;  2WB9 A;  3D4M A;  3ZZX A;  1MEK A;  4X43 A;  5INY A;  4MF7 A;  1XW5 A;  2JAD A;  3DGQ A;  4EDZ A;  1A2M A;  4TR0 A;  4YH2 A;  4O5R A;  2RUF A;  3DVW A;  1IYI A;  3IOS A;  4MNN A;  1XZO A;  3IDV A;  4XHM A;  2GQK A;  3IR4 A;  2L5O A;  3P7X A;  2KP2 A;  4RI7 A;  5D93 A;  3GTU B;  4PUR A;  2LUS A;  4I2T A;  1GLQ A;  2I4A A;  5AN1 A;  2OE0 A;  3KD0 A;  1ZCP A;  2DKH A;  4KDX A;  4OFT A;  5EVO A;  4BVY B;  4LMV A;  5G2Z A;  3P90 A;  4HZ4 A;  6GSU A;  3KTB A;  1AW9 A;  3PPU A;  2H01 A;  1TJD A;  5CAX A;  3W8S A;  3UAP A;  3RPN A;  5KOX A;  2I3Y A;  4JBB A;  2FHE A;  3QMX A;  4HU9 A;  3F4S A;  4P3Y B;  2CX4 A;  3VPT A;  3M1G A;  3IHQ A;  4GLT A;  2B1K A;  4NPB A;  2XHF A;  3FHK A;  2R4V A;  1O81 A;  2GDR A;  4TXO A;  1X0R A;  3HKR A;  4FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...