4TKYA

The complex structure of e. coli dsba bound to a peptide at the dsba/dsbb interface
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Peptide Inhibitors of the Escherichia coli DsbA Oxidative Machinery Essential for Bacterial Virulence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/peptide inhibitor
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tkyA00
2FD3A 4MMMA 4PX1A 2H6ZA 4TN8A 2M72A 1U87A 2H76A 3CRUA 3RHBA 1O7UA 2VCWA 1SU9A 1GNEA 5IPHA 2H8LA 2O8VB 4L0UA 3FZ9A 1OAZA 1EV9A 1RW1A 1V9WA 1XXUA 1GLQA 12GSA 1K0BA 5DBQA 4N30A 2DJ2A 4MPGA 2LSTA 3FR6A 3JCML 3G7JA 5IMAA 1OC9A 1Z6MA 3N9JA 3GIXA 2EIOA 2HLSA 4MZCA 1WPIA 3EVIA 3Q74A 1T4YA 5ECSA 4GQFA 2X8HA 4IP1A 2WDUA 4FO5A 2IMIA 5COHA 2H19A 2IFQB 5H5QA 3TJFA 1QQ2A 3GL5A 2K6VA 11GSA 3GKNA 3F6DA 3IAM2 1B4QA 2VAFA 3HYPA 4IQAA 4EXJA 5EY6A 2IWTA 1U6TA 5H5SA 3EU4A 1DSBA 1WIKA 2EIRA 2X8CA 3A2XA 1Z5YE 4TRXA 4NXIA 3J7Yb 4LMWA 5A5KA 1XOAA 3K8NA 3DKSA 4NHWA 1EP7A 1ML6A 3HJPA 3GKMA 3AY8A 4ZL7A 1BJXA 3F9UA 5D8IA 3GL3A 5ECMB 1EP8A 4POBA 1PD21 2O85A 1F3BA 4XRDA 3C1SA 3MDKA 5JWRB 2DSAA 1ERUA 3D0ZA 2JU5A 4ML6A 2VD0A 1PRXA 1TXXA 4KDUA 4WBRD 1OVNA 3NOFA 3HY2A 1JZWA 1SENA 1S3DA 2YWMA 4JZQA 3G9BA 2FY6A 2BTOT 5D93A 2LS5A 2LV3A 3QD9A 2H6XA 1SK2A 2V6KA 2LNTA 5HR3A 2VM2A 4X1UA 4O5RA 3ZIVA 3KTLA 1FB0A 1TRWA 4GLTA 3TKSA 3HHVA 1Q98A 4XTSA 3G7YA 3CSJA 4EL1A 2VL2A 4QQ7A 3HJOA 3M3MA 2KUCA 1EV4A 3QAWA 2EC4A 3WD6A 5AIXA 4GRFA 4JU5A 3FK8A 3IHQA 2CAIA 2CZ3A 1MTCA 4KCEA 1M9AA 2WS2A 1ZOFA 3HZ4A 3ZREA 5DQSA 2RUFA 1I9DA 4OWYA 1AAZA 4DSQA 1Q4JA 2FGXA 2I1UA 3IA1A 4FIWA 4FYUA 1AQVA 3KP9A 4KDYA 4J57E 4OO5A 3GSTA 4F82A 2CVBA 1V2AA 3TB2A 4MABA 5J5NA 2V1MA 2YV7A 1DE2A 2C0GA 3FZ5A 3LXZA 4CW9A 3EE2A 1OKTA 5LCZA 2H73A 4MP4A 3GA4A 3F6FA 5J9BA 1ZMAA 3A3TA 3FR9A 4ZXGA 1K0AA 3PINA 4XS4B 3WGEA 5J9CA 5IMZA 4XS1A 1MDKA 2M80A 2WZ9A 2TRXA 5LNKe 1J0FA 2GQKA 3IRAA 1Z7PA 4RQRA 2C1YA 5FWGA 2TRCP 1MD3A 2NVLA 3GX8A 2VL2C 4ZL9A 1NW2A 4V1Ag 3Q18A 2A2RA 5HFGA 2HT9A 1QMVA 2HRNA 2GT6A 3GURA 2X64A 3APQA 4AF2A 3ERFA 4OFNA 2ON7A 1Z7RA 1W4VA 5F0GA 5DAKB 4K7NA 3VI7A 3GKXA 5HR2A 5JCWA 2DIZA 2IIYA 1J08A 4WBJA 1TK8B 1VF3A 2DC5A 4YQVA 3C71A 2JZSA 3FYGA 4TR1A 1SK1A 2KHPA 4XS4A 2CZ2A 3DXBA 2FWHA 1GSUA 3FZ4A 3I69A 2MBTA 3KXOA 4KGIA 2LEGA 1PSQA 1R7HA 1X5EA 1YEXA 4KUNA 4OFMA 4ZIJA 2X99A 2B5XA 1K0MA 3KEBA 3ZYWA 1O8WA 2KP2A 4Q5RA 4NPBA 3UVTA 4GWRA 1OKDA 4ECBA 1CQGA 3QR6A 5D9XA 4WETA 5DAKA 4G19A 3F3RA 4D73B 2G2QA 3ISOA 1WP0A 2E0QA 1X9MB 4K7IA 4WEYA 5AIVA 1EGOA 1R5PA 2PBJA 2VCQA 2A2SA 2B7JA 1OE7A 4WR4A 1N8JA 2GDRA 2IMKA 3BOAA 2X8GA 1XWCA 2LRNA 4Q5NA 1TOFA 1K0CA 2K8VA 1UC7A 4EO3A 1ILOA 6GSSA 1PKWA 1V57A 2AJQB 4HS1A 3E3EA 3TUEA 1A2MA 2TIRA 2FWFA 3P7XA 2A4VA 3MAKA 3QDNA 3BCKA 2R4VA 5KN1A 3LORA 4LLRA 3EWLA 4ZB9A 3MWHA 4JEDA 1XPVA 5GSTA 1W89A 4F0CA 5AN1A 4JE1A 2GLRA 2XPDA 4YQMA 5IO0A 5C04A 5DDLA 5KEJA 2C3QA 3UBKA 3ZL5A 9GSSA 2KOKA 2MMZA 4NMUA 1TK0B 4J2FA 1YEPA 3U5RE 2NDOA 4N11A 2XC2A 5IMDA 2GSQA 2FNOA 5HR0A 2GT5A 2J9HA 3R2QA 3KH9A 1MD4A 2O89A 2BJXA 2H1AA 2M46A 2CAQA 2DJ0A 3CRTA 4IELA 4AGSA 1AXDA 4BWQA 2CQ9A 3P8WA 4V1Ap 3ERWA 4V2NA 3QAGA 4XIHA 2P5QA 5CP1A 4AJ8A 2XPEA 1ERTA 3UIWA 4IKHA 1K3YA 2RUEA 4BPYA 4TKYA 3CTGA 1SD8A 5CNWA 2P5RA 3GHAA 3F63A 3FRCA 4LL4B 1YDKA 2WB9A 3CTFA 1XW6A 4BVYA 2N5BA 4I97A 3IK9A 1O8XA 1HNBA 1K3LA 2VCTA 3GUSA 3A2WA 1XWGA 1OC9B 1GUMA 4MZBA 1TRVA 1PL2A 2LUSA 4MJEA 1YJ6A 2LKUA 6GSUA 2WGRA 5G1KA 4AJ7A 1XOBA 2H70A 2FWGA 1XIYA 1RK4A 2LNSA 2L5OA 2G0FA 1FG4A 4TOPA 1Y6EA 5JCUA 3TJJA 4NAXA 1G7EA 1F37A 1TRSA 5AISA 3F4RA 4PQHA 1X9WB 1GP1A 4BVXA 5A4VA 4G2EA 2KLXA 3DVWA 1UN2A 1TTZA 1A8LA 4K0NA 5B8BA 3CYNA 1YZXA 2IPAA 4KCAA 5ECOB 1BAYA 6GSXA 3HD5A 3IC4A 4L5OA 2L6DA 1TRUA 3KP8A 1V40A 4YAPA 3U6VA 1GRXA 3H1NA 4POKA 1A0FA 1K3OA 5CRGA 2PPTA 4IBPA 1NSWA 2YWIA 3E0UA 1HNCA 4I8BA 6GSYA 4MCUA 1ERVA 3IK7A 1GTBA 4PUAA 3TRXA 3VPQA 1U88A 1NM3A 3W8JA 2C0EA 4KH7A 3KIJA 3CSHA 4ID0A 2H1DA 3V1WA 1AW9A 4HZ4A 5KN3A 4IW9A 1O73A 3UARA 1WWJA 4CDOA 1U3IA 4EUYA 1GTIA 3UEMA 1FAAA 1PL1A 2V6OA 3ED3A 4O7HA 2RIIA 1SK0A 1N2AA 2CVDA 5HQPA 5IOWA 2ES7A 4DVCA 2VOCA 3LGCA 1EGRA 2E2MA 5IMVA 3CBUA 4RQXA 2K9FA 1T00A 3BCIA 2F8FA 4GSNA 5ABRA 3F0IA 1SL0B 5B8AA 4PNGA 2RM5A 1JLWA 3ZITA 4PXOA 1G6YA 5GSSA 3IBHA 1SYXA 5A4WA 1BX9A 1PA3A 1KTEA 2P31A 2H0GA 3DRNA 4TXOB 1XVQA 4YH2A 3DMLA 1XVWA 3TJKA 1GSDA 1XWBA 2H6YA 4TR0A 4ISDA 3GRXA 1ST9A 2HYXA 2B3SA 4BWSA 3DIEA 3ME8A 5CAXA 2HXKA 4POMA 3TKPA 1ZCPA 3M0FA 1VF4A 1IYIA 4HI7A 3TOUA 3M1GA 1SJIA 3TKSE 4L5LA 3ZRDA 4E8HA 1LBKA 3KH7A 4FYBA 3O3TA 5IMCA 1WOUA 2VLUA 5ECRB 5G2ZA 1X5DA 3RBTA 3LWAA 3L4NA 2F9SA 3TRPA 3FHKA 16GSA 4TXOA 5INYA 2H71A 3KZQA 2DIYA 2FWEA 4PQIA 4X43A 4ZBAA 3ZFBA 2IL3A 1GLPA 2YWOA 2C80A 1A23A 1WMJA 1YY7A 2AAWA 7GSSA 1EEMA 4F9ZA 2ZCTA 1DE1A 2DJJA 3L9VA 3L78A 3L9SA 3IPZA 2FA8A 3GNJA 1MDIA 3H79A 2GSRA 2PVOC 2WRTA 4O92A 1Z6NA 1SYRA 2H75A 5DQYA 1AQXA 4KA0A 3UJ1A 1TK5B 4MF6A 4ZBBA 1QXHA 4TR1B 5G5FA 2B5YA 2GVPA 3IOSA 4KNDA 2YOIA 2PWJA 1CQHA 4TR4A 2NPBA 3LQ7A 5ECKB 3TKSC 2XBIA 4POLA 5HFIA 5CYYA 1H75A 4HJMA 5ENUA 1B9XC 1ACVA 4MLYA 1E2YA 4OFTA 4X0XA 3SWLA 3QMXA 3ME7A 2B5EA 2MYGA 2ALBA 3E9JB 2ZNMA 4JRRA 3ZMLA 4WXTA 4HU9A 5D9TA 4F0BA 1M99A 4IQ1A 3LYPA 2C3TA 3GTUA 3KM6A 3KGKA 4HZ2A 1QK8A 4K1FA 2GQLA 1TU8A 1PX7A 3TRQA 2ZUPA 1A2LA 2PUKC 3CMIA 4ZB8A 5AGYA 3W8SA 4PQ1A 2HNLA 2WCIA 1C72A 4QL9A 5ECLB 4XCSA 1TDIA 1FW1A 1T3BA 1VGLA 3PH9A 4GSSA 4IJ3A 1K0DA 6GSWA 1G7OA 2WFCA 5HR1A 1DUGA 1GH2A 4F2IA 2DJ3A 2GZYA 4KDXA 5DCGA 2MMOA 4GQCA 1QFNA 4GCIA 1O81A 2R5GA 3KJYA 3LG6A 1BQ7A 3ZTLA 1HD2A 2L5LA 5IMFA 4LL1B 1GL8A 1V58A 3KD0A 1DBYA 3KMNA 1EEJA 4TW5A 2D2ZA 4P3YB 2CX3A 2HFDA 1K0OA 2EIQA 1YKAA 4IN0A 4IP6A 4LMVA 4FYCA 22GSA 2OBIA 4ZBDA 18GSA 1A8YA 2DLXA 2R37A 2DJ1A 2C0DA 3WT2A 2L4QA 1R4WA 4FH8A 2IJYA 3NZNA 3I9V2 3J7Yk 2IN3A 2R3XA 2QSIA 3L0HA 3WT1A 1ZYQB 1OC3A 1S3AA 2VM1A 2Z9SA 4TXVA 3QFAC 2JL4A 2FHEA 4JBBA 4ZILA 1SKRB 4DEJA 4OCFA 5EL8A 2CX4A 4I2UA 2OKAA 4KAEA 2CVKA 2DBCA 2RLIA 1I5GA 4WKWA 3IE3A 3IR4A 4KSMA 3ZVJD 1KBNA 5ECHB 2JZRA 2K8SA 2CT6A 5CRWA 1PN9A 2GQMA 5E59A 2GSTA 3IDVA 5ELGA 2L57A 4IHUA 1AUCA 3ZLPA 1PKZA 3I43A 5L71A 5EVOA 4I2TA 3FW2A 4E8EA 3C8EA 2YANA 5D9WA 2MBSA 1A2JA 4OO4A 5E4WA 1FVJA 1M2BA 3LJRA 5D73A 4EDZA 4OMVA 4AJ6A 5ECNB 3LFLA 3VI5A 3M8NA 2VL9A 1FOVA 2F51A 3HJMA 2GTUA 3DGQA 4ZL8A 2DMLA 3ZIJA 2JZTA 3TGZA 2H01A 3D4TA 4K6XA 2PMTA 4KW6A 1G0TA 1YF0A 4DSRA 3HVSA 2I4AA 3FZAA 3RDWA 1X5CA 2F3MA 2GGTA 2KP1A 1URMA 5CRHA 10GSA 4HJ2A 1JZOA 5GAND 4EDYA 1THXA 5DALB 3VLNA 3HZ8A 1GULA 4DSSA 2B1LA 4PGTA 3HCZA 4I5QA 4K2DA 3RAZA 2QKEA 1PX6A 5ECQB 2H0IA 3VK9A 1M0UA 1T7PB 2IMFA 3OR5A 3ERGA 2BMXA 3PR8A 2C8UA 3A2VA 4MA9A 3BBYA 4YAVA 4PNFA 3F3QA 2B7KA 2CV4A 1SJ6A 2AYTA 4ECJA 5D96A 2JACA 2LRTA 3UMAA 1WE0A 3TJGA 6GSVA 2OE0A 4XRAA 2E2GA 1GTUA 4ILFA 4G10A 4EVMA 4HQZA 2JSYA 1NHOA 1YF1A 4XHMA 5JCGA 2V2GA 1HQOA 2OADA 1YQ1A 2LTKA 4K9ZA 3GH9A 4WF5A 5DALA 8GSSA 1Y25A 2O87A 4IVFA 4ECCA 4MF5A 2QC7A 1O85A 3G7IA 1WJKA 2WULA 4LA1A 2WJUA 3DVXA 5ID2A 19GSA 2DJKA 4GTUA 2GZPA 3DEXA 2FUG2 5IM9A 1ZL9A 3TCOA 2YPMA 3GFKA 2I9HA 3HXSA 2VD1A 2HRFA 4OD7A 3O6TA 2VCZA 4KSOA 1TKDB 1ZZYA 2V41A 1JHBA 1EWXA 1XZOA 4JR4A 4ECIA 2MMNA 1BEDA 2PN8A 2H30A 1GSFA 1WRYA 4MJBA 2OBKA 2MZCA 2V32A 5FT3A 3RHCA 1G6WA 4K7OA 3O76A 5DJMA 2CA8A 1UVZA 3F8UA 3US3A 2HI7A 1M9BA 3Q19A 2B1KA 1VF1A 4GSTA 1EOGA 2VO4A 4HDEA 1T8EB 3HDCA 2N5FA 3M9KA 3UBLA 1LU4A 1ABAA 2F8AA 1E6BA 1VF2A 3KTBA 1M7TA 1AC1A 3TKQA 2IFQA 5IO2A 3HA9A 1ERWA 2VLTA 2VCVA 5B6MA 3ZZXA 2QGVA 4GXZA 2REMA 2FLSA 3VURA 3C73A 1FB6A 3D5JA 2O7KA 3LYKA 1TI3A 3N5OA 3HVXA 1B9YC 1GSYA 4O32A 1Z3EA 5LD0A 5EPFA 1SD9A 4K8MA 4L8EA 1UA5A 4TR3A 1TW9A 3IV4A 3Q6OA 5B7CA 3H93A 3VWUA 3S9FA 3HVVA 3LEFA 2PGTA 1TU7A 3GH6A 4RI7A 1A24A 2HSYA 1XWKA 2K18A 3RPNA 1H4OA 2H74A 5A4UA 4IS0A 3UL3A 1TI1A 1OYJA 1OE8A 5G31A 1X0RA 3FY7A 3TKRA 3GSSA 2FA4A 2XHFA 3P2AA 2R6KA 3EURA 1V98A 3MNGA 4ZB6A 2E7PA 3IAS2 3EMPA 4EKZA 4PURA 4MZWA 2NTOA 4V2MA 3TDGA 1PMTA 3WGXA 4PUFC 4ACSA 3BJ5A 3GTUB 5J4UA 1A0RP 1EZKA 4GF0A 4KX4A 2LQQA 4JR6A 4ULXA 2VL3A 1KEBA 4IJIA 2VLVA 3PGTA 3TOTA 1GTAA 3W6GA 2H72A 3GMFA 4MK3A 1PGTA 3QOUA 1SL2B 2L59A 3H4KA 5IOXA 2H1GA 3GX0A 5JWQB 5D9VA 3NIVA 5F05A 4MPFA 4N0ZA 20GSA 4MF7A 3LXTA 4Q5QA 3ZVJA 2XBQA 2B6MA 3WYWA 4MH2A 3CSIA 3CXGA 1FVKA 2C3NA 4EC0A 4TVEA 4NHZA 2YZUA 3KMOA 3H8QA 2I81A 2PERA 5GAPD 2P0GA 1GWCA 2YWNA 5F8BA 1FO5A 2LRCA 2YN1A 2YJHA 5CREA 1XWAA 2L4CA 1THOA 2JSZA 2YJ7A 1SKSB 1TJDA 5KN2A 4OCEA 5ELAA 2HE3A 5DVBA 14GSA 1SKWB 1T4ZA 2AHEA 2IMEA 1F6MC 4YQUA 1MDJA 1B48A 4N0VA 1EOHA 3A5WA 5DCHA 5KN0A 3MSZA 4EE0A 1JLVA 2OE1A 3D6IA 4HQSA 4BL7A 1XBSA 5CO3A 1T1VA 3TJBA 1S3CA 4Z7XA 2AB6A 2OACA 4J56E 2OE3A 3EYTA 1R26A 4NV5A 1OC8A 1M2DA 2VCXA 13GSA 4Q5FA 1JZRA 4CHSA 1VRSD 6GSTA 2YCDA 4MDCA 3UAPA 2NBSA 4G9HA 2DMMA 3GV1A 2GSSA 2R2JA 1X9SB 3RPPA 1O6JA 4HOJA 2HZFA 3QAVA 4HU7A 1QGVA 1USBA 5G5EA 3C1RA 3EINA 1QUWA 1AQWA 1F3AA 3EMXA 4L0WA 5JWOB 3QCPA 3QPMA 1GNWA 2I3YA 3FEUA 2C4JA 1FHEA 2AUVA 4RUVA 2H66A 2H0HA 2N5AA 3DYRA 3DWVA 2MMAA 4BA7A 2OA7A 2YNXA 3D22A 4NV2A 4MH3A 5F07A 1B4PA 1F2EA 2LQOA 2AV4A 1JZDA 2VUPA 4IGJA 1F9MA 4KE3A 4K0GA 4WR5A 5C00A 3APOA 3M9JA 1RQMA 1BYEA 2HSHA 1K0NA 2YV9A 5G1LA 1JFUA 2GS3A 2ON5A 1SJZA 4RI6A 5J3RA 5GZZB 1ZGNA 3VWXA 17GSA 4MJAA 2C0FA 2LJRA 3HKRA 2PVQA 2JADA 1BG5A 4D73A 1TP9A 3P90A 5FHIA 3F4SA 3VWWA 4DSSB 3ZFLA 4HUAA 3C7MA 3I6AA 3UVHA 5J41A 1HNAA 4XS6A 1HYUA 1M2AA 1XW9A 1ZYEA 5F06A 3KCMA 3EC3A 5B6NA 2HZEB 4H86A 3FKFA 3QFBC 2J23A 3VPTA 1LJRA 1Z9HA 3GKKA 4F03A 4N10A 1GUHA 1XFLA 4I6XA 1AIUA 1PQNA 2IMDA 2YP6A 1B8XA 3BD2A 1J9BA 3UOMA 2L6CA 4KB3A 2PU9C 5H5RA 4NWYA 3APSA 1R5AA 1ON4A 2FCHA 1U3AA 1KNGA 3VFIA 5IPGA 2LJAA 4V2LA 5DJLA 3FR3A 1GSSA 2RM6A 4ML1A 5CRDA 1XCCA 4HEA2 4MJCA 3GN3A 3L9UA 3SBCA 3LSZA 5IIZA 4QL7A 3DD3A 2LJKA 1GUKA 2VIMA 3GYKA 3ZMKA 5G30A 2YZHA 2HZEA 2OJLA 3IXRA 4WF4A 5ID2B 1SL1B 2H1BA 1XW5A 3D21A 5HFKA 1IYHA 3WGDA 3D4MA 1GSEA 1MEKA 3F4TA 1NHYA 1GSQA 4EF0A 2GZZA 3VWVA 5IQYA 1YKCA 3EU3A 5ECIB 5ECPB
chains in the Genus database with same CATH superfamily
2FD3A 4MMMA 4PX1A 2H6ZA 4TN8A 2M72A 1U87A 2H76A 3CRUA 3RHBA 1O7UA 2VCWA 1SU9A 1GNEA 5IPHA 2H8LA 2O8VB 4L0UA 3FZ9A 1OAZA 1EV9A 1RW1A 1V9WA 1XXUA 1GLQA 12GSA 1K0BA 5DBQA 4N30A 2DJ2A 4MPGA 2LSTA 3FR6A 3JCML 3G7JA 3MIXA 5IMAA 1OC9A 1Z6MA 3N9JA 3GIXA 2EIOA 2HLSA 4MZCA 1WPIA 3EVIA 3Q74A 1T4YA 5ECSA 4GQFA 2X8HA 4IP1A 2WDUA 1PFOA 4FO5A 2IMIA 5COHA 2H19A 2IFQB 5H5QA 3TJFA 1QQ2A 3GL5A 2K6VA 11GSA 3GKNA 3F6DA 3IAM2 1B4QA 2VAFA 3HYPA 4IQAA 4EXJA 5EY6A 2IWTA 1U6TA 5H5SA 3EU4A 1DSBA 1WIKA 2EIRA 2X8CA 3A2XA 1Z5YE 4TRXA 4NXIA 3J7Yb 4LMWA 5A5KA 1XOAA 3K8NA 3DKSA 4NHWA 1EP7A 1ML6A 3HJPA 3GKMA 3AY8A 4ZL7A 1BJXA 3F9UA 5D8IA 3GL3A 5ECMB 1EP8A 1S3RA 4POBA 1PD21 2O85A 1F3BA 4XRDA 3C1SA 3MDKA 5JWRB 2DSAA 1ERUA 3D0ZA 2JU5A 4ML6A 2VD0A 1PRXA 1TXXA 4KDUA 4WBRD 1OVNA 3NOFA 3HY2A 1JZWA 1SENA 1S3DA 2YWMA 4JZQA 3G9BA 2FY6A 2BTOT 3IC8A 5D93A 2LS5A 2LV3A 3QD9A 2H6XA 1SK2A 2V6KA 2LNTA 5HR3A 2VM2A 4X1UA 4O5RA 3ZIVA 3KTLA 1FB0A 1TRWA 4GLTA 3TKSA 3HHVA 1Q98A 4XTSA 3G7YA 3CSJA 4EL1A 2VL2A 4QQ7A 3HJOA 3M3MA 2KUCA 1EV4A 1ZYPA 3QAWA 2EC4A 3WD6A 5AIXA 4K2XA 4GRFA 2QA2A 4JU5A 3FK8A 3IHQA 2CAIA 2CZ3A 1MTCA 4KCEA 1M9AA 2WS2A 1ZOFA 3HZ4A 3ZREA 3A5IA 5DQSA 2RUFA 1I9DA 4OWYA 1AAZA 4DSQA 1Q4JA 2FGXA 2I1UA 3IA1A 4FIWA 4FYUA 1AQVA 3KP9A 4KDYA 4J57E 4OO5A 3GSTA 4F82A 2CVBA 1V2AA 3TB2A 4MABA 5J5NA 2V1MA 2YV7A 1DE2A 2C0GA 3FZ5A 3LXZA 4CW9A 3EE2A 1OKTA 5LCZA 2H73A 4MP4A 3GA4A 3F6FA 5J9BA 1ZMAA 3EPTA 3A3TA 3FR9A 4ZXGA 1K0AA 4Z2RA 3PINA 4XS4B 4BL7B 3WGEA 5J9CA 5IMZA 4XS1A 1MDKA 2M80A 2WZ9A 2TRXA 5LNKe 1J0FA 2GQKA 3IRAA 1Z7PA 4RQRA 2C1YA 5FWGA 2TRCP 1MD3A 2NVLA 3GX8A 2VL2C 4ZL9A 1NW2A 4V1Ag 3Q18A 2A2RA 5HFGA 2HT9A 1QMVA 2HRNA 2GT6A 3GURA 2X64A 3APQA 4AF2A 3ERFA 4OFNA 2ON7A 1Z7RA 1W4VA 5F0GA 5DAKB 4K7NA 3VI7A 3GKXA 5HR2A 5JCWA 2DIZA 2IIYA 1J08A 4WBJA 1TK8B 1VF3A 2DC5A 4YQVA 3C71A 2JZSA 3FYGA 2A4HA 4TR1A 1SK1A 2KHPA 4XS4A 2CZ2A 3DXBA 2FWHA 1GSUA 3FZ4A 3I69A 2MBTA 3KXOA 4KGIA 2LEGA 1PSQA 1R7HA 1X5EA 1YEXA 4KUNA 4OFMA 4ZIJA 2X99A 2B5XA 1K0MA 3KEBA 3ZYWA 1O8WA 2KP2A 4Q5RA 4NPBA 3UVTA 4GWRA 1OKDA 4ECBA 1CQGA 3QR6A 5D9XA 4WETA 5DAKA 4G19A 3F3RA 4D73B 2G2QA 3ISOA 1WP0A 2E0QA 1X9MB 1FOHA 4K7IA 4WEYA 5AIVA 1EGOA 1R5PA 2PBJA 2VCQA 2A2SA 2B7JA 1OE7A 4WR4A 1N8JA 2GDRA 2IMKA 3BOAA 2X8GA 1XWCA 2LRNA 4Q5NA 1TOFA 1K0CA 2K8VA 1UC7A 4EO3A 1ILOA 6GSSA 1PKWA 1V57A 2AJQB 2R0PA 4HS1A 3E3EA 3TUEA 1A2MA 2TIRA 1M3IA 2FWFA 3P7XA 2A4VA 3MAKA 3QDNA 3BCKA 2R4VA 5KN1A 3LORA 4LLRA 3EWLA 4ZB9A 3MWHA 4JEDA 1XPVA 5GSTA 1W89A 4F0CA 5AN1A 4JE1A 2GLRA 2XPDA 4YQMA 4BVYB 5IO0A 5C04A 5DDLA 5KEJA 2C3QA 3UBKA 3ZL5A 9GSSA 2KOKA 2MMZA 4NMUA 1TK0B 4J2FA 1YEPA 3U5RE 2NDOA 4N11A 2XC2A 5IMDA 2GSQA 2FNOA 5HR0A 2GT5A 2J9HA 3R2QA 3KH9A 1MD4A 2O89A 2BJXA 2H1AA 2M46A 2CAQA 2DJ0A 3CRTA 4IELA 4AGSA 1AXDA 4BWQA 2CQ9A 3P8WA 4V1Ap 3ERWA 4V2NA 3QAGA 4XIHA 2P5QA 5CP1A 4AJ8A 2XPEA 1ERTA 3UIWA 4BVXB 4IKHA 1K3YA 2RUEA 4BPYA 1XG8A 4TKYA 3CTGA 1SD8A 5CNWA 2P5RA 3GHAA 3F63A 3FRCA 4LL4B 1YDKA 2WB9A 3CTFA 1XW6A 4BVYA 2N5BA 4I97A 3IK9A 1O8XA 1HNBA 1K3LA 2A2PA 2VCTA 3GUSA 3A2WA 1XWGA 1OC9B 1GUMA 4MZBA 1TRVA 1PL2A 2LUSA 4MJEA 1YJ6A 2LKUA 6GSUA 2WGRA 5G1KA 4AJ7A 1XOBA 2H70A 2FWGA 1XIYA 1RK4A 2LNSA 2L5OA 2G0FA 1FG4A 4TOPA 1Y6EA 5JCUA 3TJJA 4NAXA 1G7EA 1F37A 1TRSA 5AISA 3F4RA 4PQHA 1X9WB 1GP1A 4BVXA 5A4VA 4G2EA 2KLXA 3DVWA 1UN2A 1TTZA 1A8LA 4K0NA 5B8BA 3CYNA 1YZXA 2IPAA 4KCAA 4A5PA 5ECOB 1BAYA 6GSXA 3HD5A 3IC4A 4L5OA 2L6DA 1TRUA 3KP8A 1V40A 4YAPA 3U6VA 1GRXA 4YKFA 3H1NA 4POKA 1A0FA 1K3OA 5CRGA 2PPTA 4IBPA 1NSWA 2YWIA 3E0UA 1HNCA 4I8BA 6GSYA 4MCUA 1ERVA 3IK7A 1GTBA 4PUAA 3TRXA 3VPQA 1U88A 1NM3A 3W8JA 2C0EA 4KH7A 3KIJA 3CSHA 4ID0A 2H1DA 3V1WA 1AW9A 4HZ4A 5KN3A 4IW9A 2QA1A 1O73A 3UARA 1WWJA 4CDOA 1U3IA 4EUYA 1GTIA 3UEMA 1FAAA 1PL1A 2V6OA 3ED3A 4O7HA 4PTSA 2RIIA 1SK0A 1N2AA 2CVDA 5HQPA 5IOWA 2ES7A 4DVCA 2VOCA 3LGCA 1EGRA 4CY6A 2E2MA 5IMVA 3CBUA 4RQXA 2K9FA 1T00A 3BCIA 2F8FA 4GSNA 5ABRA 3F0IA 1SL0B 5B8AA 4PNGA 2RM5A 1JLWA 3ZITA 4PXOA 1G6YA 5GSSA 3IBHA 1SYXA 5A4WA 1BX9A 1PA3A 1KTEA 2P31A 2H0GA 3DRNA 4TXOB 1XVQA 4YH2A 3DMLA 1XVWA 3TJKA 1GSDA 1XWBA 2H6YA 4TR0A 4ISDA 3GRXA 1ST9A 2HYXA 2B3SA 4BWSA 3DIEA 3ME8A 5CAXA 2HXKA 4POMA 3TKPA 1ZCPA 3M0FA 1VF4A 1IYIA 4HI7A 3TOUA 3M1GA 1SJIA 3TKSE 4L5LA 3ZRDA 4E8HA 1LBKA 3KH7A 4FYBA 3O3TA 5IMCA 1WOUA 2VLUA 5ECRB 5G2ZA 1X5DA 3RBTA 3LWAA 3L4NA 2F9SA 3TRPA 3FHKA 2UZ8A 16GSA 4TXOA 5INYA 2H71A 1M3JA 3KZQA 3MYDA 2DIYA 2FWEA 4PQIA 4X43A 4ZBAA 3ZFBA 2IL3A 1GLPA 2YWOA 2C80A 1A23A 1WMJA 4O5QA 1YY7A 2AAWA 7GSSA 1EEMA 4F9ZA 2ZCTA 1DE1A 2DJJA 3L9VA 3L78A 3L9SA 3IPZA 2FA8A 3GNJA 1MDIA 3H79A 2GSRA 2PVOC 4CY8A 2WRTA 4O92A 1Z6NA 1SYRA 2H75A 5DQYA 1AQXA 4KA0A 3UJ1A 4G0KA 1TK5B 4MF6A 4ZBBA 1QXHA 4TR1B 5G5FA 4YKGA 2B5YA 2GVPA 3IOSA 4KNDA 2YOIA 2PWJA 1CQHA 4TR4A 2NPBA 3LQ7A 5ECKB 3TKSC 2XBIA 4POLA 5HFIA 5CYYA 1H75A 4HJMA 5ENUA 1B9XC 1ACVA 4MLYA 1E2YA 4OFTA 4X0XA 3SWLA 3QMXA 3ME7A 2B5EA 2MYGA 2ALBA 3E9JB 2ZNMA 4JRRA 3ZMLA 4WXTA 4HU9A 5D9TA 4F0BA 1M99A 4IQ1A 3LYPA 2C3TA 3GTUA 3KM6A 3KGKA 4HZ2A 1QK8A 4K1FA 2GQLA 1TU8A 1PX7A 3TRQA 2ZUPA 1A2LA 2PUKC 3CMIA 4ZB8A 5AGYA 3W8SA 4PQ1A 2HNLA 2WCIA 1C72A 4QL9A 5ECLB 4XCSA 1TDIA 1FW1A 1T3BA 1VGLA 3PH9A 4GSSA 4IJ3A 1K0DA 6GSWA 1G7OA 2WFCA 5HR1A 1DUGA 1GH2A 4F2IA 2DJ3A 2GZYA 4KDXA 5DCGA 2MMOA 4GQCA 1QFNA 4GCIA 1O81A 2R5GA 3KJYA 3LG6A 1BQ7A 3ZTLA 1HD2A 2L5LA 5IMFA 4LL1B 1GL8A 1V58A 3KD0A 1DBYA 3KMNA 1EEJA 4TW5A 2D2ZA 4P3YB 2CX3A 5KOWA 2HFDA 1K0OA 2EIQA 1YKAA 4IN0A 4IP6A 4LMVA 4FYCA 22GSA 2OBIA 4ZBDA 18GSA 1A8YA 2DLXA 2R37A 2DJ1A 2X49A 2C0DA 3WT2A 2L4QA 1R4WA 2R0CA 4FH8A 2IJYA 3NZNA 3I9V2 3J7Yk 2IN3A 2R3XA 2QSIA 3L0HA 3WT1A 1ZYQB 1OC3A 1S3AA 2VM1A 2DKIA 2Z9SA 4TXVA 3QFAC 2JL4A 2FHEA 4JBBA 4ZILA 1SKRB 4DEJA 4OCFA 5EL8A 2CX4A 4I2UA 2OKAA 4KAEA 2CVKA 2DBCA 2RLIA 1I5GA 4WKWA 3IE3A 3IR4A 4KSMA 3ZVJD 1KBNA 5ECHB 2JZRA 2K8SA 2CT6A 5CRWA 1PN9A 2GQMA 5E59A 2GSTA 3IDVA 5ELGA 2L57A 4IHUA 1AUCA 3ZLPA 1PKZA 3I43A 5L71A 5EVOA 4I2TA 3FW2A 4E8EA 3C8EA 2YANA 5D9WA 2MBSA 1A2JA 4OO4A 5E4WA 1FVJA 1M2BA 3LJRA 5D73A 4EDZA 4OMVA 4AJ6A 5ECNB 3LFLA 3VI5A 3M8NA 2VL9A 1FOVA 2F51A 3HJMA 2GTUA 3DGQA 4ZL8A 2DMLA 3ZIJA 2JZTA 3TGZA 2H01A 2HRAA 3D4TA 4K6XA 2PMTA 4KW6A 1G0TA 1YF0A 4DSRA 3HVSA 2I4AA 3FZAA 3RDWA 1X5CA 2F3MA 2GGTA 2KP1A 1URMA 5CRHA 10GSA 4HJ2A 1JZOA 5GAND 4EDYA 3FMWA 1THXA 5DALB 3VLNA 3HZ8A 1GULA 4DSSA 2B1LA 4PGTA 3HCZA 4I5QA 4K2DA 3RAZA 2QKEA 1PX6A 5ECQB 2H0IA 3VK9A 1M0UA 1T7PB 2IMFA 3CQFA 3OR5A 3ERGA 5KOXA 2BMXA 3PR8A 2C8UA 3A2VA 4MA9A 3BBYA 4YAVA 4PNFA 3F3QA 2B7KA 2CV4A 1SJ6A 2AYTA 4ECJA 5D96A 2JACA 2LRTA 3UMAA 1WE0A 3TJGA 6GSVA 2OE0A 4XRAA 2E2GA 1GTUA 4ILFA 4G10A 4ICYA 4EVMA 4HQZA 2JSYA 1NHOA 1YF1A 4XHMA 5JCGA 2V2GA 1HQOA 2OADA 1YQ1A 2LTKA 4K9ZA 3GH9A 4WF5A 5DALA 8GSSA 1Y25A 2O87A 2R0GA 4IVFA 4ECCA 4MF5A 2QC7A 1O85A 3G7IA 1WJKA 2WULA 4LA1A 2WJUA 3DVXA 5ID2A 19GSA 2DJKA 4GTUA 2GZPA 3DEXA 2FUG2 5IM9A 1ZL9A 3TCOA 2YPMA 3GFKA 2I9HA 3HXSA 2VD1A 4K5RA 2HRFA 4OD7A 3O6TA 2VCZA 4KSOA 4Z2TA 1TKDB 1ZZYA 2V41A 1JHBA 4MNNA 1EWXA 1XZOA 4JR4A 4ECIA 2MMNA 1BEDA 2PN8A 2H30A 1GSFA 1WRYA 4MJBA 2OBKA 2MZCA 2V32A 5FT3A 3RHCA 2X4AA 1G6WA 4K7OA 3O76A 5DJMA 2CA8A 1UVZA 3F8UA 3US3A 2HI7A 1M9BA 3Q19A 2B1KA 1VF1A 4GSTA 1EOGA 4G0IA 2VO4A 4HDEA 1T8EB 3HDCA 2N5FA 3M9KA 3UBLA 1LU4A 1ABAA 2F8AA 1E6BA 1VF2A 3KTBA 1M7TA 1AC1A 3TKQA 2IFQA 5IO2A 3HA9A 1ERWA 2VLTA 3LW9A 2VCVA 5B6MA 3ZZXA 2QGVA 4GXZA 2REMA 2FLSA 1PN0A 3VURA 3C73A 1FB6A 3D5JA 2O7KA 3PPUA 3LYKA 1TI3A 3N5OA 3HVXA 1B9YC 1GSYA 4O32A 1Z3EA 5LD0A 5EPFA 1SD9A 4K8MA 4L8EA 1UA5A 4TR3A 1TW9A 3IV4A 3Q6OA 5B7CA 3H93A 3VWUA 3S9FA 3HVVA 3LEFA 2PGTA 1TU7A 3GH6A 4RI7A 1A24A 2HSYA 1XWKA 2K18A 3RPNA 1H4OA 2H74A 5A4UA 4IS0A 3UL3A 1TI1A 1OYJA 1OE8A 5G31A 1X0RA 3FY7A 3TKRA 3GSSA 2FA4A 2XHFA 3P2AA 2R6KA 3EURA 1V98A 3MNGA 4ZB6A 2E7PA 3IAS2 3EMPA 4EKZA 4PURA 4MZWA 2NTOA 4V2MA 3TDGA 1PMTA 3WGXA 4PUFC 4ACSA 3BJ5A 3GTUB 5J4UA 1A0RP 1EZKA 4GF0A 4KX4A 2LQQA 4JR6A 4ULXA 2VL3A 1KEBA 4IJIA 2VLVA 3PGTA 5BRTA 3TOTA 1GTAA 3W6GA 2H72A 3GMFA 4MK3A 1PGTA 3QOUA 1SL2B 2L59A 4EIPA 3H4KA 5IOXA 2H1GA 3GX0A 5JWQB 5D9VA 3NIVA 5F05A 4MPFA 4N0ZA 20GSA 3IHGA 3LXTA 4MF7A 4Q5QA 3ZVJA 2XBQA 2B6MA 3WYWA 4MH2A 3CSIA 3CXGA 1FVKA 2C3NA 4EC0A 4TVEA 4NHZA 2YZUA 1ZYNA 3KMOA 3H8QA 2I81A 2PERA 5GAPD 2P0GA 2DKHA 1GWCA 2YWNA 5F8BA 1FO5A 2LRCA 2YN1A 2YJHA 5CREA 1XWAA 2L4CA 1THOA 2JSZA 2YJ7A 1SKSB 1TJDA 5KN2A 4OCEA 5ELAA 3HVNA 5BMUA 2HSMA 2HE3A 5DVBA 14GSA 1SKWB 1T4ZA 2AHEA 2IMEA 1F6MC 4YQUA 1MDJA 1B48A 4N0VA 1EOHA 3A5WA 5DCHA 5KN0A 3MSZA 4EE0A 1JLVA 2OE1A 3D6IA 4HQSA 4BL7A 1XBSA 5CO3A 4FQUA 1T1VA 3TJBA 1S3CA 4Z7XA 2AB6A 2OACA 4J56E 2OE3A 3EYTA 1R26A 4NV5A 1OC8A 1M2DA 2VCXA 13GSA 4Q5FA 1JZRA 4CHSA 1VRSD 6GSTA 2YCDA 4MDCA 3UAPA 2NBSA 4G9HA 2DMMA 3GV1A 2GSSA 2R2JA 1X9SB 3RPPA 1O6JA 4HOJA 2HZFA 3QAVA 4HU7A 1QGVA 1USBA 5G5EA 3C1RA 3EINA 1QUWA 1AQWA 1F3AA 3EMXA 4O5UA 4L0WA 5JWOB 3QCPA 3QPMA 4USSA 1GNWA 2I3YA 3FEUA 2C4JA 1FHEA 4BIKA 2AUVA 4RUVA 2H66A 3R3EA 2H0HA 2N5AA 3DYRA 3DWVA 2MMAA 4BA7A 2OA7A 2YNXA 3D22A 4NV2A 4MH3A 5F07A 1B4PA 1F2EA 2LQOA 2AV4A 1JZDA 2VUPA 4IGJA 1F9MA 4KE3A 4K0GA 4WR5A 5C00A 3APOA 3M9JA 1RQMA 1BYEA 2HSHA 1K0NA 2YV9A 5G1LA 1JFUA 2GS3A 2ON5A 1SJZA 4RI6A 5J3RA 5GZZB 1ZGNA 3VWXA 17GSA 4MJAA 2C0FA 2LJRA 3HKRA 2PVQA 4EIQA 2JADA 1BG5A 4D73A 1TP9A 3P90A 5FHIA 3F4SA 3VWWA 4DSSB 3ZFLA 4HUAA 3C7MA 3I6AA 3UVHA 5J41A 1HNAA 4XS6A 1HYUA 1M2AA 1XW9A 1ZYEA 5F06A 3KCMA 3EC3A 5B6NA 2HZEB 4H86A 3FKFA 3QFBC 2J23A 3VPTA 1LJRA 1Z9HA 3GKKA 4F03A 4N10A 4HSCX 1GUHA 1XFLA 4I6XA 1AIUA 1PQNA 2IMDA 2YP6A 1B8XA 3BD2A 1J9BA 3UOMA 2L6CA 4KB3A 2PU9C 5H5RA 4NWYA 3APSA 1R5AA 1ON4A 2FCHA 1U3AA 1KNGA 3VFIA 5IPGA 2LJAA 4V2LA 5DJLA 3FR3A 1GSSA 2RM6A 4ML1A 4X4JA 5CRDA 4K5SA 1XCCA 4HEA2 4MJCA 3GN3A 3L9UA 4G0LA 3SBCA 3LSZA 5IIZA 4QL7A 3DD3A 2LJKA 1GUKA 2VIMA 3GYKA 3ZMKA 5G30A 2YZHA 2HZEA 2OJLA 3IXRA 4WF4A 5ID2B 1SL1B 2H1BA 1XW5A 3D21A 5HFKA 1IYHA 3WGDA 4Z2UA 2HRKA 3D4MA 1GSEA 1MEKA 3F4TA 1NHYA 1GSQA 4EF0A 2GZZA 4KF9A 3VWVA 5IQYA 1YKCA 3EU3A 5ECIB 5ECPB
chains in the Genus database with same CATH topology
2FD3A 4MMMA 4PX1A 2H6ZA 4TN8A 2M72A 1U87A 2H76A 3CRUA 3RHBA 1O7UA 2VCWA 1SU9A 1GNEA 5IPHA 2H8LA 2O8VB 4L0UA 3FZ9A 1OAZA 1EV9A 1RW1A 1V9WA 1XXUA 1GLQA 12GSA 1K0BA 5DBQA 4N30A 2DJ2A 4MPGA 2LSTA 3FR6A 3JCML 3G7JA 3MIXA 5IMAA 1OC9A 1Z6MA 3N9JA 3GIXA 2EIOA 2HLSA 4MZCA 1WPIA 3EVIA 3Q74A 1T4YA 5ECSA 4GQFA 2X8HA 4IP1A 2WDUA 4FO5A 2IMIA 5COHA 2H19A 2IFQB 5H5QA 3TJFA 1QQ2A 3GL5A 2K6VA 11GSA 3GKNA 3F6DA 3IAM2 1B4QA 2VAFA 3HYPA 4IQAA 4EXJA 5EY6A 2IWTA 1U6TA 5H5SA 3EU4A 1DSBA 1WIKA 2EIRA 2X8CA 3A2XA 1Z5YE 4TRXA 4NXIA 3J7Yb 4LMWA 5A5KA 1XOAA 3K8NA 3DKSA 4NHWA 1EP7A 1ML6A 3HJPA 3GKMA 3AY8A 4ZL7A 1BJXA 3F9UA 5D8IA 3GL3A 5ECMB 1EP8A 4POBA 1PD21 2O85A 1F3BA 4XRDA 3C1SA 3MDKA 5JWRB 2DSAA 1ERUA 3D0ZA 2JU5A 4ML6A 2VD0A 1PRXA 1TXXA 4KDUA 4WBRD 1OVNA 3NOFA 3HY2A 1JZWA 1SENA 1S3DA 2YWMA 4JZQA 3G9BA 2FY6A 2BTOT 3IC8A 5D93A 2LS5A 2LV3A 3QD9A 2H6XA 1SK2A 2V6KA 2LNTA 5HR3A 2VM2A 4X1UA 4O5RA 3ZIVA 3KTLA 1FB0A 1TRWA 4GLTA 3TKSA 3HHVA 1Q98A 4XTSA 3G7YA 3CSJA 4EL1A 2VL2A 4QQ7A 3HJOA 3M3MA 2KUCA 1EV4A 1ZYPA 3QAWA 2EC4A 3WD6A 5AIXA 4K2XA 4GRFA 2QA2A 4JU5A 3FK8A 3IHQA 2CAIA 2CZ3A 1MTCA 4KCEA 1M9AA 2WS2A 1ZOFA 3HZ4A 3ZREA 3A5IA 5DQSA 2RUFA 1I9DA 4OWYA 1AAZA 4DSQA 1Q4JA 2FGXA 2I1UA 3IA1A 4FIWA 4FYUA 1AQVA 3KP9A 4KDYA 4J57E 4OO5A 3GSTA 4F82A 2CVBA 1V2AA 3TB2A 4MABA 5J5NA 2V1MA 2YV7A 1DE2A 2C0GA 3FZ5A 3LXZA 4CW9A 3EE2A 1OKTA 5LCZA 2H73A 4MP4A 3GA4A 3F6FA 5J9BA 1ZMAA 3EPTA 3A3TA 3FR9A 4ZXGA 1K0AA 4Z2RA 3PINA 4XS4B 4BL7B 3WGEA 5J9CA 5IMZA 4XS1A 1MDKA 2M80A 2WZ9A 2TRXA 5LNKe 1J0FA 2GQKA 3IRAA 1Z7PA 4RQRA 2C1YA 5FWGA 2TRCP 1MD3A 2NVLA 3GX8A 2VL2C 4ZL9A 1NW2A 4V1Ag 3Q18A 2A2RA 5HFGA 2HT9A 1QMVA 2HRNA 2GT6A 3GURA 2X64A 3APQA 4AF2A 3ERFA 4OFNA 2ON7A 1Z7RA 1W4VA 5F0GA 5DAKB 4K7NA 3VI7A 3GKXA 5HR2A 5JCWA 2DIZA 2IIYA 1J08A 4WBJA 1TK8B 1VF3A 2DC5A 4YQVA 3C71A 2JZSA 3FYGA 2A4HA 4TR1A 1SK1A 2KHPA 4XS4A 2CZ2A 3DXBA 2FWHA 1GSUA 3FZ4A 3I69A 2MBTA 3KXOA 4KGIA 2LEGA 1PSQA 1R7HA 1X5EA 1YEXA 4KUNA 4OFMA 4ZIJA 2X99A 2B5XA 1K0MA 3KEBA 3ZYWA 1O8WA 2KP2A 4Q5RA 4NPBA 3UVTA 4GWRA 1OKDA 4ECBA 1CQGA 3QR6A 5D9XA 4WETA 5DAKA 4G19A 3F3RA 4D73B 2G2QA 3ISOA 1WP0A 2E0QA 1X9MB 1FOHA 4K7IA 4WEYA 5AIVA 1EGOA 1R5PA 2PBJA 2VCQA 2A2SA 2B7JA 1OE7A 4WR4A 1N8JA 2GDRA 2IMKA 3BOAA 2X8GA 1XWCA 2LRNA 4Q5NA 1TOFA 1K0CA 2K8VA 1UC7A 4EO3A 1ILOA 6GSSA 1PKWA 1V57A 2AJQB 2R0PA 4HS1A 3E3EA 3TUEA 1A2MA 2TIRA 2FWFA 3P7XA 2A4VA 3MAKA 3QDNA 3BCKA 2R4VA 5KN1A 3LORA 4LLRA 3EWLA 4ZB9A 3MWHA 4JEDA 1XPVA 5GSTA 1W89A 4F0CA 5AN1A 4JE1A 2GLRA 2XPDA 4YQMA 4BVYB 5IO0A 5C04A 5DDLA 5KEJA 2C3QA 3UBKA 3ZL5A 9GSSA 2KOKA 2MMZA 4NMUA 1TK0B 4J2FA 1YEPA 3U5RE 2NDOA 4N11A 2XC2A 5IMDA 2GSQA 2FNOA 5HR0A 2GT5A 2J9HA 3R2QA 3KH9A 1MD4A 2O89A 2BJXA 2H1AA 2M46A 2CAQA 2DJ0A 3CRTA 4IELA 4AGSA 1AXDA 4BWQA 2CQ9A 3P8WA 4V1Ap 3ERWA 4V2NA 3QAGA 4XIHA 2P5QA 5CP1A 4AJ8A 2XPEA 1ERTA 3UIWA 4BVXB 4IKHA 1K3YA 2RUEA 4BPYA 4TKYA 3CTGA 1SD8A 5CNWA 2P5RA 3GHAA 3F63A 3FRCA 4LL4B 1YDKA 2WB9A 3CTFA 1XW6A 4BVYA 2N5BA 4I97A 3IK9A 1O8XA 1HNBA 1K3LA 2A2PA 2VCTA 3GUSA 3A2WA 1XWGA 1OC9B 1GUMA 4MZBA 1TRVA 1PL2A 2LUSA 4MJEA 1YJ6A 2LKUA 6GSUA 2WGRA 5G1KA 4AJ7A 1XOBA 2H70A 2FWGA 1XIYA 1RK4A 2LNSA 2L5OA 2G0FA 1FG4A 4TOPA 1Y6EA 5JCUA 3TJJA 4NAXA 1G7EA 1F37A 1TRSA 5AISA 3F4RA 4PQHA 1X9WB 1GP1A 4BVXA 5A4VA 4G2EA 2KLXA 3DVWA 1UN2A 1TTZA 1A8LA 4K0NA 5B8BA 3CYNA 1YZXA 2IPAA 4KCAA 4A5PA 5ECOB 1BAYA 6GSXA 3HD5A 3IC4A 4L5OA 2L6DA 1TRUA 3KP8A 1V40A 4YAPA 3U6VA 1GRXA 4YKFA 3H1NA 4POKA 1A0FA 1K3OA 5CRGA 2PPTA 4IBPA 1NSWA 2YWIA 3E0UA 1HNCA 4I8BA 6GSYA 4MCUA 1ERVA 3IK7A 1GTBA 4PUAA 3TRXA 3VPQA 1U88A 1NM3A 3W8JA 2C0EA 4KH7A 3KIJA 3CSHA 4ID0A 2H1DA 3V1WA 1AW9A 4HZ4A 5KN3A 4IW9A 2QA1A 1O73A 3UARA 1WWJA 4CDOA 1U3IA 4EUYA 1GTIA 3UEMA 1FAAA 1PL1A 2V6OA 3ED3A 4O7HA 4PTSA 2RIIA 1SK0A 1N2AA 2CVDA 5HQPA 5IOWA 2ES7A 4DVCA 2VOCA 3LGCA 1EGRA 4CY6A 2E2MA 5IMVA 3CBUA 4RQXA 2K9FA 1T00A 3BCIA 2F8FA 4GSNA 5ABRA 3F0IA 1SL0B 5B8AA 4PNGA 2RM5A 1JLWA 3ZITA 4PXOA 1G6YA 5GSSA 3IBHA 1SYXA 5A4WA 1BX9A 1PA3A 1KTEA 2P31A 2H0GA 3DRNA 4TXOB 1XVQA 4YH2A 3DMLA 1XVWA 3TJKA 1GSDA 1XWBA 2H6YA 4TR0A 4ISDA 3GRXA 1ST9A 2HYXA 2B3SA 4BWSA 3DIEA 3ME8A 5CAXA 2HXKA 4POMA 3TKPA 1ZCPA 3M0FA 1VF4A 1IYIA 4HI7A 3TOUA 3M1GA 1SJIA 3TKSE 4L5LA 3ZRDA 4E8HA 1LBKA 3KH7A 4FYBA 3O3TA 5IMCA 1WOUA 2VLUA 5ECRB 5G2ZA 1X5DA 3RBTA 3LWAA 3L4NA 2F9SA 3TRPA 3FHKA 2UZ8A 16GSA 4TXOA 5INYA 2H71A 3KZQA 3MYDA 2DIYA 2FWEA 4PQIA 4X43A 4ZBAA 3ZFBA 2IL3A 1GLPA 2YWOA 2C80A 1A23A 1WMJA 4O5QA 1YY7A 2AAWA 7GSSA 1EEMA 4F9ZA 2ZCTA 1DE1A 2DJJA 3L9VA 3L78A 3L9SA 3IPZA 2FA8A 3GNJA 1MDIA 3H79A 2GSRA 2PVOC 4CY8A 2WRTA 4O92A 1Z6NA 1SYRA 2H75A 5DQYA 1AQXA 4KA0A 3UJ1A 4G0KA 1TK5B 4MF6A 4ZBBA 1QXHA 4TR1B 5G5FA 4YKGA 2B5YA 2GVPA 3IOSA 4KNDA 2YOIA 2PWJA 1CQHA 4TR4A 2NPBA 3LQ7A 5ECKB 3TKSC 2XBIA 4POLA 5HFIA 5CYYA 1H75A 4HJMA 5ENUA 1B9XC 1ACVA 4MLYA 1E2YA 4OFTA 4X0XA 3SWLA 3QMXA 3ME7A 2B5EA 2MYGA 2ALBA 3E9JB 2ZNMA 4JRRA 3ZMLA 4WXTA 4HU9A 5D9TA 4F0BA 1M99A 4IQ1A 3LYPA 2C3TA 3GTUA 3KM6A 3KGKA 4HZ2A 1QK8A 4K1FA 2GQLA 1TU8A 1PX7A 3TRQA 2ZUPA 1A2LA 2PUKC 3CMIA 4ZB8A 5AGYA 3W8SA 4PQ1A 2HNLA 2WCIA 1C72A 4QL9A 5ECLB 4XCSA 1TDIA 1FW1A 1T3BA 1VGLA 3PH9A 4GSSA 4IJ3A 1K0DA 6GSWA 1G7OA 2WFCA 5HR1A 1DUGA 1GH2A 4F2IA 2DJ3A 2GZYA 4KDXA 5DCGA 2MMOA 4GQCA 1QFNA 4GCIA 1O81A 2R5GA 3KJYA 3LG6A 1BQ7A 3ZTLA 1HD2A 2L5LA 5IMFA 4LL1B 1GL8A 1V58A 3KD0A 1DBYA 3KMNA 1EEJA 4TW5A 2D2ZA 4P3YB 2CX3A 5KOWA 2HFDA 1K0OA 2EIQA 1YKAA 4IN0A 4IP6A 4LMVA 4FYCA 22GSA 2OBIA 4ZBDA 18GSA 1A8YA 2DLXA 2R37A 2DJ1A 2X49A 2C0DA 3WT2A 2L4QA 1R4WA 2R0CA 4FH8A 2IJYA 3NZNA 3I9V2 3J7Yk 2IN3A 2R3XA 2QSIA 3L0HA 3WT1A 1ZYQB 1OC3A 1S3AA 2VM1A 2DKIA 2Z9SA 4TXVA 3QFAC 2JL4A 2FHEA 4JBBA 4ZILA 1SKRB 4DEJA 4OCFA 5EL8A 2CX4A 4I2UA 2OKAA 4KAEA 2CVKA 2DBCA 2RLIA 1I5GA 4WKWA 3IE3A 3IR4A 4KSMA 3ZVJD 1KBNA 5ECHB 2JZRA 2K8SA 2CT6A 5CRWA 1PN9A 2GQMA 5E59A 2GSTA 3IDVA 5ELGA 2L57A 4IHUA 1AUCA 3ZLPA 1PKZA 3I43A 5L71A 5EVOA 4I2TA 3FW2A 4E8EA 3C8EA 2YANA 5D9WA 2MBSA 1A2JA 4OO4A 5E4WA 1FVJA 1M2BA 3LJRA 5D73A 4EDZA 4OMVA 4AJ6A 5ECNB 3LFLA 3VI5A 3M8NA 2VL9A 1FOVA 2F51A 3HJMA 2GTUA 3DGQA 4ZL8A 2DMLA 3ZIJA 2JZTA 3TGZA 2H01A 2HRAA 3D4TA 4K6XA 2PMTA 4KW6A 1G0TA 1YF0A 4DSRA 3HVSA 2I4AA 3FZAA 3RDWA 1X5CA 2F3MA 2GGTA 2KP1A 1URMA 5CRHA 10GSA 4HJ2A 1JZOA 5GAND 4EDYA 3FMWA 1THXA 5DALB 3VLNA 3HZ8A 1GULA 4DSSA 2B1LA 4PGTA 3HCZA 4I5QA 4K2DA 3RAZA 2QKEA 1PX6A 5ECQB 2H0IA 3VK9A 1M0UA 1T7PB 2IMFA 3OR5A 3ERGA 5KOXA 2BMXA 3PR8A 2C8UA 3A2VA 4MA9A 3BBYA 4YAVA 4PNFA 3F3QA 2B7KA 2CV4A 1SJ6A 2AYTA 4ECJA 5D96A 2JACA 2LRTA 3UMAA 1WE0A 3TJGA 6GSVA 2OE0A 4XRAA 2E2GA 1GTUA 4ILFA 4G10A 4ICYA 4EVMA 4HQZA 2JSYA 1NHOA 1YF1A 4XHMA 5JCGA 2V2GA 1HQOA 2OADA 1YQ1A 2LTKA 4K9ZA 3GH9A 4WF5A 5DALA 8GSSA 1Y25A 2O87A 2R0GA 4IVFA 4ECCA 4MF5A 2QC7A 1O85A 3G7IA 1WJKA 2WULA 4LA1A 2WJUA 3DVXA 5ID2A 19GSA 2DJKA 4GTUA 2GZPA 3DEXA 2FUG2 5IM9A 1ZL9A 3TCOA 2YPMA 3GFKA 2I9HA 3HXSA 2VD1A 4K5RA 2HRFA 4OD7A 3O6TA 2VCZA 4KSOA 4Z2TA 1TKDB 1ZZYA 2V41A 1JHBA 4MNNA 1EWXA 1XZOA 4JR4A 4ECIA 2MMNA 1BEDA 2PN8A 2H30A 1GSFA 1WRYA 4MJBA 2OBKA 2MZCA 2V32A 5FT3A 3RHCA 2X4AA 1G6WA 4K7OA 3O76A 5DJMA 2CA8A 1UVZA 3F8UA 3US3A 2HI7A 1M9BA 3Q19A 2B1KA 1VF1A 4GSTA 1EOGA 4G0IA 2VO4A 4HDEA 1T8EB 3HDCA 2N5FA 3M9KA 3UBLA 1LU4A 1ABAA 2F8AA 1E6BA 1VF2A 3KTBA 1M7TA 1AC1A 3TKQA 2IFQA 5IO2A 3HA9A 1ERWA 2VLTA 3LW9A 2VCVA 5B6MA 3ZZXA 2QGVA 4GXZA 2REMA 2FLSA 1PN0A 3VURA 3C73A 1FB6A 3D5JA 2O7KA 3PPUA 3LYKA 1TI3A 3N5OA 3HVXA 1B9YC 1GSYA 4O32A 1Z3EA 5LD0A 5EPFA 1SD9A 4K8MA 4L8EA 1UA5A 4TR3A 1TW9A 3IV4A 3Q6OA 5B7CA 3H93A 3VWUA 3S9FA 3HVVA 3LEFA 2PGTA 1TU7A 3GH6A 4RI7A 1A24A 2HSYA 1XWKA 2K18A 3RPNA 1H4OA 2H74A 5A4UA 4IS0A 3UL3A 1TI1A 1OYJA 1OE8A 5G31A 1X0RA 3FY7A 3TKRA 3GSSA 2FA4A 2XHFA 3P2AA 2R6KA 3EURA 1V98A 3MNGA 4ZB6A 2E7PA 3IAS2 3EMPA 4EKZA 4PURA 4MZWA 2NTOA 4V2MA 3TDGA 1PMTA 3WGXA 4PUFC 4ACSA 3BJ5A 3GTUB 5J4UA 1A0RP 1EZKA 4GF0A 4KX4A 2LQQA 4JR6A 4ULXA 2VL3A 1KEBA 4IJIA 2VLVA 3PGTA 5BRTA 3TOTA 1GTAA 3W6GA 2H72A 3GMFA 4MK3A 1PGTA 3QOUA 1SL2B 2L59A 4EIPA 3H4KA 5IOXA 2H1GA 3GX0A 5JWQB 5D9VA 3NIVA 5F05A 4MPFA 4N0ZA 20GSA 3IHGA 3LXTA 4MF7A 4Q5QA 3ZVJA 2XBQA 2B6MA 3WYWA 4MH2A 3CSIA 3CXGA 1FVKA 2C3NA 4EC0A 4TVEA 4NHZA 2YZUA 1ZYNA 3KMOA 3H8QA 2I81A 2PERA 5GAPD 2P0GA 2DKHA 1GWCA 2YWNA 5F8BA 1FO5A 2LRCA 2YN1A 2YJHA 5CREA 1XWAA 2L4CA 1THOA 2JSZA 2YJ7A 1SKSB 1TJDA 5KN2A 4OCEA 5ELAA 5BMUA 2HSMA 2HE3A 5DVBA 14GSA 1SKWB 1T4ZA 2AHEA 2IMEA 1F6MC 4YQUA 1MDJA 1B48A 4N0VA 1EOHA 3A5WA 5DCHA 5KN0A 3MSZA 4EE0A 1JLVA 2OE1A 3D6IA 4HQSA 4BL7A 1XBSA 5CO3A 4FQUA 1T1VA 3TJBA 1S3CA 4Z7XA 2AB6A 2OACA 4J56E 2OE3A 3EYTA 1R26A 4NV5A 1OC8A 1M2DA 2VCXA 13GSA 4Q5FA 1JZRA 4CHSA 1VRSD 6GSTA 2YCDA 4MDCA 3UAPA 2NBSA 4G9HA 2DMMA 3GV1A 2GSSA 2R2JA 1X9SB 3RPPA 1O6JA 4HOJA 2HZFA 3QAVA 4HU7A 1QGVA 1USBA 5G5EA 3C1RA 3EINA 1QUWA 1AQWA 1F3AA 3EMXA 4O5UA 4L0WA 5JWOB 3QCPA 3QPMA 4USSA 1GNWA 2I3YA 3FEUA 2C4JA 1FHEA 2AUVA 4RUVA 2H66A 3R3EA 2H0HA 2N5AA 3DYRA 3DWVA 2MMAA 4BA7A 2OA7A 2YNXA 3D22A 4NV2A 4MH3A 5F07A 1B4PA 1F2EA 2LQOA 2AV4A 1JZDA 2VUPA 4IGJA 1F9MA 4KE3A 4K0GA 4WR5A 5C00A 3APOA 3M9JA 1RQMA 1BYEA 2HSHA 1K0NA 2YV9A 5G1LA 1JFUA 2GS3A 2ON5A 1SJZA 4RI6A 5J3RA 5GZZB 1ZGNA 3VWXA 17GSA 4MJAA 2C0FA 2LJRA 3HKRA 2PVQA 4EIQA 2JADA 1BG5A 4D73A 1TP9A 3P90A 5FHIA 3F4SA 3VWWA 4DSSB 3ZFLA 4HUAA 3C7MA 3I6AA 3UVHA 5J41A 1HNAA 4XS6A 1HYUA 1M2AA 1XW9A 1ZYEA 5F06A 3KCMA 3EC3A 5B6NA 2HZEB 4H86A 3FKFA 3QFBC 2J23A 3VPTA 1LJRA 1Z9HA 3GKKA 4F03A 4N10A 1GUHA 1XFLA 4I6XA 1AIUA 1PQNA 2IMDA 2YP6A 1B8XA 3BD2A 1J9BA 3UOMA 2L6CA 4KB3A 2PU9C 5H5RA 4NWYA 3APSA 1R5AA 1ON4A 2FCHA 1U3AA 1KNGA 3VFIA 5IPGA 2LJAA 4V2LA 5DJLA 3FR3A 1GSSA 2RM6A 4ML1A 4X4JA 5CRDA 4K5SA 1XCCA 4HEA2 4MJCA 3GN3A 3L9UA 4G0LA 3SBCA 3LSZA 5IIZA 4QL7A 3DD3A 2LJKA 1GUKA 2VIMA 3GYKA 3ZMKA 5G30A 2YZHA 2HZEA 2OJLA 3IXRA 4WF4A 5ID2B 1SL1B 2H1BA 1XW5A 3D21A 5HFKA 1IYHA 3WGDA 4Z2UA 2HRKA 3D4MA 1GSEA 1MEKA 3F4TA 1NHYA 1GSQA 4EF0A 2GZZA 4KF9A 3VWVA 5IQYA 1YKCA 3EU3A 5ECIB 5ECPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD3 A;  4MMM A;  4PX1 A;  2H6Z A;  4TN8 A;  2M72 A;  1U87 A;  2H76 A;  3CRU A;  3RHB A;  1O7U A;  2VCW A;  1SU9 A;  1GNE A;  5IPH A;  2H8L A;  2O8V B;  4L0U A;  3FZ9 A;  1OAZ A;  1EV9 A;  1RW1 A;  1V9W A;  1XXU A;  1GLQ A;  12GS A;  1K0B A;  5DBQ A;  4N30 A;  2DJ2 A;  4MPG A;  2LST A;  3FR6 A;  3JCM L;  3G7J A;  5IMA A;  1OC9 A;  1Z6M A;  3N9J A;  3GIX A;  2EIO A;  2HLS A;  4MZC A;  1WPI A;  3EVI A;  3Q74 A;  1T4Y A;  5ECS A;  4GQF A;  2X8H A;  4IP1 A;  2WDU A;  4FO5 A;  2IMI A;  5COH A;  2H19 A;  2IFQ B;  5H5Q A;  3TJF A;  1QQ2 A;  3GL5 A;  2K6V A;  11GS A;  3GKN A;  3F6D A;  3IAM 2;  1B4Q A;  2VAF A;  3HYP A;  4IQA A;  4EXJ A;  5EY6 A;  2IWT A;  1U6T A;  5H5S A;  3EU4 A;  1DSB A;  1WIK A;  2EIR A;  2X8C A;  3A2X A;  1Z5Y E;  4TRX A;  4NXI A;  3J7Y b;  4LMW A;  5A5K A;  1XOA A;  3K8N A;  3DKS A;  4NHW A;  1EP7 A;  1ML6 A;  3HJP A;  3GKM A;  3AY8 A;  4ZL7 A;  1BJX A;  3F9U A;  5D8I A;  3GL3 A;  5ECM B;  1EP8 A;  4POB A;  1PD2 1;  2O85 A;  1F3B A;  4XRD A;  3C1S A;  3MDK A;  5JWR B;  2DSA A;  1ERU A;  3D0Z A;  2JU5 A;  4ML6 A;  2VD0 A;  1PRX A;  1TXX A;  4KDU A;  4WBR D;  1OVN A;  3NOF A;  3HY2 A;  1JZW A;  1SEN A;  1S3D A;  2YWM A;  4JZQ A;  3G9B A;  2FY6 A;  2BTO T;  5D93 A;  2LS5 A;  2LV3 A;  3QD9 A;  2H6X A;  1SK2 A;  2V6K A;  2LNT A;  5HR3 A;  2VM2 A;  4X1U A;  4O5R A;  3ZIV A;  3KTL A;  1FB0 A;  1TRW A;  4GLT A;  3TKS A;  3HHV A;  1Q98 A;  4XTS A;  3G7Y A;  3CSJ A;  4EL1 A;  2VL2 A;  4QQ7 A;  3HJO A;  3M3M A;  2KUC A;  1EV4 A;  3QAW A;  2EC4 A;  3WD6 A;  5AIX A;  4GRF A;  4JU5 A;  3FK8 A;  3IHQ A;  2CAI A;  2CZ3 A;  1MTC A;  4KCE A;  1M9A A;  2WS2 A;  1ZOF A;  3HZ4 A;  3ZRE A;  5DQS A;  2RUF A;  1I9D A;  4OWY A;  1AAZ A;  4DSQ A;  1Q4J A;  2FGX A;  2I1U A;  3IA1 A;  4FIW A;  4FYU A;  1AQV A;  3KP9 A;  4KDY A;  4J57 E;  4OO5 A;  3GST A;  4F82 A;  2CVB A;  1V2A A;  3TB2 A;  4MAB A;  5J5N A;  2V1M A;  2YV7 A;  1DE2 A;  2C0G A;  3FZ5 A;  3LXZ A;  4CW9 A;  3EE2 A;  1OKT A;  5LCZ A;  2H73 A;  4MP4 A;  3GA4 A;  3F6F A;  5J9B A;  1ZMA A;  3A3T A;  3FR9 A;  4ZXG A;  1K0A A;  3PIN A;  4XS4 B;  3WGE A;  5J9C A;  5IMZ A;  4XS1 A;  1MDK A;  2M80 A;  2WZ9 A;  2TRX A;  5LNK e;  1J0F A;  2GQK A;  3IRA A;  1Z7P A;  4RQR A;  2C1Y A;  5FWG A;  2TRC P;  1MD3 A;  2NVL A;  3GX8 A;  2VL2 C;  4ZL9 A;  1NW2 A;  4V1A g;  3Q18 A;  2A2R A;  5HFG A;  2HT9 A;  1QMV A;  2HRN A;  2GT6 A;  3GUR A;  2X64 A;  3APQ A;  4AF2 A;  3ERF A;  4OFN A;  2ON7 A;  1Z7R A;  1W4V A;  5F0G A;  5DAK B;  4K7N A;  3VI7 A;  3GKX A;  5HR2 A;  5JCW A;  2DIZ A;  2IIY A;  1J08 A;  4WBJ A;  1TK8 B;  1VF3 A;  2DC5 A;  4YQV A;  3C71 A;  2JZS A;  3FYG A;  4TR1 A;  1SK1 A;  2KHP A;  4XS4 A;  2CZ2 A;  3DXB A;  2FWH A;  1GSU A;  3FZ4 A;  3I69 A;  2MBT A;  3KXO A;  4KGI A;  2LEG A;  1PSQ A;  1R7H A;  1X5E A;  1YEX A;  4KUN A;  4OFM A;  4ZIJ A;  2X99 A;  2B5X A;  1K0M A;  3KEB A;  3ZYW A;  1O8W A;  2KP2 A;  4Q5R A;  4NPB A;  3UVT A;  4GWR A;  1OKD A;  4ECB A;  1CQG A;  3QR6 A;  5D9X A;  4WET A;  5DAK A;  4G19 A;  3F3R A;  4D73 B;  2G2Q A;  3ISO A;  1WP0 A;  2E0Q A;  1X9M B;  4K7I A;  4WEY A;  5AIV A;  1EGO A;  1R5P A;  2PBJ A;  2VCQ A;  2A2S A;  2B7J A;  1OE7 A;  4WR4 A;  1N8J A;  2GDR A;  2IMK A;  3BOA A;  2X8G A;  1XWC A;  2LRN A;  4Q5N A;  1TOF A;  1K0C A;  2K8V A;  1UC7 A;  4EO3 A;  1ILO A;  6GSS A;  1PKW A;  1V57 A;  2AJQ B;  4HS1 A;  3E3E A;  3TUE A;  1A2M A;  2TIR A;  2FWF A;  3P7X A;  2A4V A;  3MAK A;  3QDN A;  3BCK A;  2R4V A;  5KN1 A;  3LOR A;  4LLR A;  3EWL A;  4ZB9 A;  3MWH A;  4JED A;  1XPV A;  5GST A;  1W89 A;  4F0C A;  5AN1 A;  4JE1 A;  2GLR A;  2XPD A;  4YQM A;  5IO0 A;  5C04 A;  5DDL A;  5KEJ A;  2C3Q A;  3UBK A;  3ZL5 A;  9GSS A;  2KOK A;  2MMZ A;  4NMU A;  1TK0 B;  4J2F A;  1YEP A;  3U5R E;  2NDO A;  4N11 A;  2XC2 A;  5IMD A;  2GSQ A;  2FNO A;  5HR0 A;  2GT5 A;  2J9H A;  3R2Q A;  3KH9 A;  1MD4 A;  2O89 A;  2BJX A;  2H1A A;  2M46 A;  2CAQ A;  2DJ0 A;  3CRT A;  4IEL A;  4AGS A;  1AXD A;  4BWQ A;  2CQ9 A;  3P8W A;  4V1A p;  3ERW A;  4V2N A;  3QAG A;  4XIH A;  2P5Q A;  5CP1 A;  4AJ8 A;  2XPE A;  1ERT A;  3UIW A;  4IKH A;  1K3Y A;  2RUE A;  4BPY A;  4TKY A;  3CTG A;  1SD8 A;  5CNW A;  2P5R A;  3GHA A;  3F63 A;  3FRC A;  4LL4 B;  1YDK A;  2WB9 A;  3CTF A;  1XW6 A;  4BVY A;  2N5B A;  4I97 A;  3IK9 A;  1O8X A;  1HNB A;  1K3L A;  2VCT A;  3GUS A;  3A2W A;  1XWG A;  1OC9 B;  1GUM A;  4MZB A;  1TRV A;  1PL2 A;  2LUS A;  4MJE A;  1YJ6 A;  2LKU A;  6GSU A;  2WGR A;  5G1K A;  4AJ7 A;  1XOB A;  2H70 A;  2FWG A;  1XIY A;  1RK4 A;  2LNS A;  2L5O A;  2G0F A;  1FG4 A;  4TOP A;  1Y6E A;  5JCU A;  3TJJ A;  4NAX A;  1G7E A;  1F37 A;  1TRS A;  5AIS A;  3F4R A;  4PQH A;  1X9W B;  1GP1 A;  4BVX A;  5A4V A;  4G2E A;  2KLX A;  3DVW A;  1UN2 A;  1TTZ A;  1A8L A;  4K0N A;  5B8B A;  3CYN A;  1YZX A;  2IPA A;  4KCA A;  5ECO B;  1BAY A;  6GSX A;  3HD5 A;  3IC4 A;  4L5O A;  2L6D A;  1TRU A;  3KP8 A;  1V40 A;  4YAP A;  3U6V A;  1GRX A;  3H1N A;  4POK A;  1A0F A;  1K3O A;  5CRG A;  2PPT A;  4IBP A;  1NSW A;  2YWI A;  3E0U A;  1HNC A;  4I8B A;  6GSY A;  4MCU A;  1ERV A;  3IK7 A;  1GTB A;  4PUA A;  3TRX A;  3VPQ A;  1U88 A;  1NM3 A;  3W8J A;  2C0E A;  4KH7 A;  3KIJ A;  3CSH A;  4ID0 A;  2H1D A;  3V1W A;  1AW9 A;  4HZ4 A;  5KN3 A;  4IW9 A;  1O73 A;  3UAR A;  1WWJ A;  4CDO A;  1U3I A;  4EUY A;  1GTI A;  3UEM A;  1FAA A;  1PL1 A;  2V6O A;  3ED3 A;  4O7H A;  2RII A;  1SK0 A;  1N2A A;  2CVD A;  5HQP A;  5IOW A;  2ES7 A;  4DVC A;  2VOC A;  3LGC A;  1EGR A;  2E2M A;  5IMV A;  3CBU A;  4RQX A;  2K9F A;  1T00 A;  3BCI A;  2F8F A;  4GSN A;  5ABR A;  3F0I A;  1SL0 B;  5B8A A;  4PNG A;  2RM5 A;  1JLW A;  3ZIT A;  4PXO A;  1G6Y A;  5GSS A;  3IBH A;  1SYX A;  5A4W A;  1BX9 A;  1PA3 A;  1KTE A;  2P31 A;  2H0G A;  3DRN A;  4TXO B;  1XVQ A;  4YH2 A;  3DML A;  1XVW A;  3TJK A;  1GSD A;  1XWB A;  2H6Y A;  4TR0 A;  4ISD A;  3GRX A;  1ST9 A;  2HYX A;  2B3S A;  4BWS A;  3DIE A;  3ME8 A;  5CAX A;  2HXK A;  4POM A;  3TKP A;  1ZCP A;  3M0F A;  1VF4 A;  1IYI A;  4HI7 A;  3TOU A;  3M1G A;  1SJI A;  3TKS E;  4L5L A;  3ZRD A;  4E8H A;  1LBK A;  3KH7 A;  4FYB A;  3O3T A;  5IMC A;  1WOU A;  2VLU A;  5ECR B;  5G2Z A;  1X5D A;  3RBT A;  3LWA A;  3L4N A;  2F9S A;  3TRP A;  3FHK A;  16GS A;  4TXO A;  5INY A;  2H71 A;  3KZQ A;  2DIY A;  2FWE A;  4PQI A;  4X43 A;  4ZBA A;  3ZFB A;  2IL3 A;  1GLP A;  2YWO A;  2C80 A;  1A23 A;  1WMJ A;  1YY7 A;  2AAW A;  7GSS A;  1EEM A;  4F9Z A;  2ZCT A;  1DE1 A;  2DJJ A;  3L9V A;  3L78 A;  3L9S A;  3IPZ A;  2FA8 A;  3GNJ A;  1MDI A;  3H79 A;  2GSR A;  2PVO C;  2WRT A;  4O92 A;  1Z6N A;  1SYR A;  2H75 A;  5DQY A;  1AQX A;  4KA0 A;  3UJ1 A;  1TK5 B;  4MF6 A;  4ZBB A;  1QXH A;  4TR1 B;  5G5F A;  2B5Y A;  2GVP A;  3IOS A;  4KND A;  2YOI A;  2PWJ A;  1CQH A;  4TR4 A;  2NPB A;  3LQ7 A;  5ECK B;  3TKS C;  2XBI A;  4POL A;  5HFI A;  5CYY A;  1H75 A;  4HJM A;  5ENU A;  1B9X C;  1ACV A;  4MLY A;  1E2Y A;  4OFT A;  4X0X A;  3SWL A;  3QMX A;  3ME7 A;  2B5E A;  2MYG A;  2ALB A;  3E9J B;  2ZNM A;  4JRR A;  3ZML A;  4WXT A;  4HU9 A;  5D9T A;  4F0B A;  1M99 A;  4IQ1 A;  3LYP A;  2C3T A;  3GTU A;  3KM6 A;  3KGK A;  4HZ2 A;  1QK8 A;  4K1F A;  2GQL A;  1TU8 A;  1PX7 A;  3TRQ A;  2ZUP A;  1A2L A;  2PUK C;  3CMI A;  4ZB8 A;  5AGY A;  3W8S A;  4PQ1 A;  2HNL A;  2WCI A;  1C72 A;  4QL9 A;  5ECL B;  4XCS A;  1TDI A;  1FW1 A;  1T3B A;  1VGL A;  3PH9 A;  4GSS A;  4IJ3 A;  1K0D A;  6GSW A;  1G7O A;  2WFC A;  5HR1 A;  1DUG A;  1GH2 A;  4F2I A;  2DJ3 A;  2GZY A;  4KDX A;  5DCG A;  2MMO A;  4GQC A;  1QFN A;  4GCI A;  1O81 A;  2R5G A;  3KJY A;  3LG6 A;  1BQ7 A;  3ZTL A;  1HD2 A;  2L5L A;  5IMF A;  4LL1 B;  1GL8 A;  1V58 A;  3KD0 A;  1DBY A;  3KMN A;  1EEJ A;  4TW5 A;  2D2Z A;  4P3Y B;  2CX3 A;  2HFD A;  1K0O A;  2EIQ A;  1YKA A;  4IN0 A;  4IP6 A;  4LMV A;  4FYC A;  22GS A;  2OBI A;  4ZBD A;  18GS A;  1A8Y A;  2DLX A;  2R37 A;  2DJ1 A;  2C0D A;  3WT2 A;  2L4Q A;  1R4W A;  4FH8 A;  2IJY A;  3NZN A;  3I9V 2;  3J7Y k;  2IN3 A;  2R3X A;  2QSI A;  3L0H A;  3WT1 A;  1ZYQ B;  1OC3 A;  1S3A A;  2VM1 A;  2Z9S A;  4TXV A;  3QFA C;  2JL4 A;  2FHE A;  4JBB A;  4ZIL A;  1SKR B;  4DEJ A;  4OCF A;  5EL8 A;  2CX4 A;  4I2U A;  2OKA A;  4KAE A;  2CVK A;  2DBC A;  2RLI A;  1I5G A;  4WKW A;  3IE3 A;  3IR4 A;  4KSM A;  3ZVJ D;  1KBN A;  5ECH B;  2JZR A;  2K8S A;  2CT6 A;  5CRW A;  1PN9 A;  2GQM A;  5E59 A;  2GST A;  3IDV A;  5ELG A;  2L57 A;  4IHU A;  1AUC A;  3ZLP A;  1PKZ A;  3I43 A;  5L71 A;  5EVO A;  4I2T A;  3FW2 A;  4E8E A;  3C8E A;  2YAN A;  5D9W A;  2MBS A;  1A2J A;  4OO4 A;  5E4W A;  1FVJ A;  1M2B A;  3LJR A;  5D73 A;  4EDZ A;  4OMV A;  4AJ6 A;  5ECN B;  3LFL A;  3VI5 A;  3M8N A;  2VL9 A;  1FOV A;  2F51 A;  3HJM A;  2GTU A;  3DGQ A;  4ZL8 A;  2DML A;  3ZIJ A;  2JZT A;  3TGZ A;  2H01 A;  3D4T A;  4K6X A;  2PMT A;  4KW6 A;  1G0T A;  1YF0 A;  4DSR A;  3HVS A;  2I4A A;  3FZA A;  3RDW A;  1X5C A;  2F3M A;  2GGT A;  2KP1 A;  1URM A;  5CRH A;  10GS A;  4HJ2 A;  1JZO A;  5GAN D;  4EDY A;  1THX A;  5DAL B;  3VLN A;  3HZ8 A;  1GUL A;  4DSS A;  2B1L A;  4PGT A;  3HCZ A;  4I5Q A;  4K2D A;  3RAZ A;  2QKE A;  1PX6 A;  5ECQ B;  2H0I A;  3VK9 A;  1M0U A;  1T7P B;  2IMF A;  3OR5 A;  3ERG A;  2BMX A;  3PR8 A;  2C8U A;  3A2V A;  4MA9 A;  3BBY A;  4YAV A;  4PNF A;  3F3Q A;  2B7K A;  2CV4 A;  1SJ6 A;  2AYT A;  4ECJ A;  5D96 A;  2JAC A;  2LRT A;  3UMA A;  1WE0 A;  3TJG A;  6GSV A;  2OE0 A;  4XRA A;  2E2G A;  1GTU A;  4ILF A;  4G10 A;  4EVM A;  4HQZ A;  2JSY A;  1NHO A;  1YF1 A;  4XHM A;  5JCG A;  2V2G A;  1HQO A;  2OAD A;  1YQ1 A;  2LTK A;  4K9Z A;  3GH9 A;  4WF5 A;  5DAL A;  8GSS A;  1Y25 A;  2O87 A;  4IVF A;  4ECC A;  4MF5 A;  2QC7 A;  1O85 A;  3G7I A;  1WJK A;  2WUL A;  4LA1 A;  2WJU A;  3DVX A;  5ID2 A;  19GS A;  2DJK A;  4GTU A;  2GZP A;  3DEX A;  2FUG 2;  5IM9 A;  1ZL9 A;  3TCO A;  2YPM A;  3GFK A;  2I9H A;  3HXS A;  2VD1 A;  2HRF A;  4OD7 A;  3O6T A;  2VCZ A;  4KSO A;  1TKD B;  1ZZY A;  2V41 A;  1JHB A;  1EWX A;  1XZO A;  4JR4 A;  4ECI A;  2MMN A;  1BED A;  2PN8 A;  2H30 A;  1GSF A;  1WRY A;  4MJB A;  2OBK A;  2MZC A;  2V32 A;  5FT3 A;  3RHC A;  1G6W A;  4K7O A;  3O76 A;  5DJM A;  2CA8 A;  1UVZ A;  3F8U A;  3US3 A;  2HI7 A;  1M9B A;  3Q19 A;  2B1K A;  1VF1 A;  4GST A;  1EOG A;  2VO4 A;  4HDE A;  1T8E B;  3HDC A;  2N5F A;  3M9K A;  3UBL A;  1LU4 A;  1ABA A;  2F8A A;  1E6B A;  1VF2 A;  3KTB A;  1M7T A;  1AC1 A;  3TKQ A;  2IFQ A;  5IO2 A;  3HA9 A;  1ERW A;  2VLT A;  2VCV A;  5B6M A;  3ZZX A;  2QGV A;  4GXZ A;  2REM A;  2FLS A;  3VUR A;  3C73 A;  1FB6 A;  3D5J A;  2O7K A;  3LYK A;  1TI3 A;  3N5O A;  3HVX A;  1B9Y C;  1GSY A;  4O32 A;  1Z3E A;  5LD0 A;  5EPF A;  1SD9 A;  4K8M A;  4L8E A;  1UA5 A;  4TR3 A;  1TW9 A;  3IV4 A;  3Q6O A;  5B7C A;  3H93 A;  3VWU A;  3S9F A;  3HVV A;  3LEF A;  2PGT A;  1TU7 A;  3GH6 A;  4RI7 A;  1A24 A;  2HSY A;  1XWK A;  2K18 A;  3RPN A;  1H4O A;  2H74 A;  5A4U A;  4IS0 A;  3UL3 A;  1TI1 A;  1OYJ A;  1OE8 A;  5G31 A;  1X0R A;  3FY7 A;  3TKR A;  3GSS A;  2FA4 A;  2XHF A;  3P2A A;  2R6K A;  3EUR A;  1V98 A;  3MNG A;  4ZB6 A;  2E7P A;  3IAS 2;  3EMP A;  4EKZ A;  4PUR A;  4MZW A;  2NTO A;  4V2M A;  3TDG A;  1PMT A;  3WGX A;  4PUF C;  4ACS A;  3BJ5 A;  3GTU B;  5J4U A;  1A0R P;  1EZK A;  4GF0 A;  4KX4 A;  2LQQ A;  4JR6 A;  4ULX A;  2VL3 A;  1KEB A;  4IJI A;  2VLV A;  3PGT A;  3TOT A;  1GTA A;  3W6G A;  2H72 A;  3GMF A;  4MK3 A;  1PGT A;  3QOU A;  1SL2 B;  2L59 A;  3H4K A;  5IOX A;  2H1G A;  3GX0 A;  5JWQ B;  5D9V A;  3NIV A;  5F05 A;  4MPF A;  4N0Z A;  20GS A;  4MF7 A;  3LXT A;  4Q5Q A;  3ZVJ A;  2XBQ A;  2B6M A;  3WYW A;  4MH2 A;  3CSI A;  3CXG A;  1FVK A;  2C3N A;  4EC0 A;  4TVE A;  4NHZ A;  2YZU A;  3KMO A;  3H8Q A;  2I81 A;  2PER A;  5GAP D;  2P0G A;  1GWC A;  2YWN A;  5F8B A;  1FO5 A;  2LRC A;  2YN1 A;  2YJH A;  5CRE A;  1XWA A;  2L4C A;  1THO A;  2JSZ A;  2YJ7 A;  1SKS B;  1TJD A;  5KN2 A;  4OCE A;  5ELA A;  2HE3 A;  5DVB A;  14GS A;  1SKW B;  1T4Z A;  2AHE A;  2IME A;  1F6M C;  4YQU A;  1MDJ A;  1B48 A;  4N0V A;  1EOH A;  3A5W A;  5DCH A;  5KN0 A;  3MSZ A;  4EE0 A;  1JLV A;  2OE1 A;  3D6I A;  4HQS A;  4BL7 A;  1XBS A;  5CO3 A;  1T1V A;  3TJB A;  1S3C A;  4Z7X A;  2AB6 A;  2OAC A;  4J56 E;  2OE3 A;  3EYT A;  1R26 A;  4NV5 A;  1OC8 A;  1M2D A;  2VCX A;  13GS A;  4Q5F A;  1JZR A;  4CHS A;  1VRS D;  6GST A;  2YCD A;  4MDC A;  3UAP A;  2NBS A;  4G9H A;  2DMM A;  3GV1 A;  2GSS A;  2R2J A;  1X9S B;  3RPP A;  1O6J A;  4HOJ A;  2HZF A;  3QAV A;  4HU7 A;  1QGV A;  1USB A;  5G5E A;  3C1R A;  3EIN A;  1QUW A;  1AQW A;  1F3A A;  3EMX A;  4L0W A;  5JWO B;  3QCP A;  3QPM A;  1GNW A;  2I3Y A;  3FEU A;  2C4J A;  1FHE A;  2AUV A;  4RUV A;  2H66 A;  2H0H A;  2N5A A;  3DYR A;  3DWV A;  2MMA A;  4BA7 A;  2OA7 A;  2YNX A;  3D22 A;  4NV2 A;  4MH3 A;  5F07 A;  1B4P A;  1F2E A;  2LQO A;  2AV4 A;  1JZD A;  2VUP A;  4IGJ A;  1F9M A;  4KE3 A;  4K0G A;  4WR5 A;  5C00 A;  3APO A;  3M9J A;  1RQM A;  1BYE A;  2HSH A;  1K0N A;  2YV9 A;  5G1L A;  1JFU A;  2GS3 A;  2ON5 A;  1SJZ A;  4RI6 A;  5J3R A;  5GZZ B;  1ZGN A;  3VWX A;  17GS A;  4MJA A;  2C0F A;  2LJR A;  3HKR A;  2PVQ A;  2JAD A;  1BG5 A;  4D73 A;  1TP9 A;  3P90 A;  5FHI A;  3F4S A;  3VWW A;  4DSS B;  3ZFL A;  4HUA A;  3C7M A;  3I6A A;  3UVH A;  5J41 A;  1HNA A;  4XS6 A;  1HYU A;  1M2A A;  1XW9 A;  1ZYE A;  5F06 A;  3KCM A;  3EC3 A;  5B6N A;  2HZE B;  4H86 A;  3FKF A;  3QFB C;  2J23 A;  3VPT A;  1LJR A;  1Z9H A;  3GKK A;  4F03 A;  4N10 A;  1GUH A;  1XFL A;  4I6X A;  1AIU A;  1PQN A;  2IMD A;  2YP6 A;  1B8X A;  3BD2 A;  1J9B A;  3UOM A;  2L6C A;  4KB3 A;  2PU9 C;  5H5R A;  4NWY A;  3APS A;  1R5A A;  1ON4 A;  2FCH A;  1U3A A;  1KNG A;  3VFI A;  5IPG A;  2LJA A;  4V2L A;  5DJL A;  3FR3 A;  1GSS A;  2RM6 A;  4ML1 A;  5CRD A;  1XCC A;  4HEA 2;  4MJC A;  3GN3 A;  3L9U A;  3SBC A;  3LSZ A;  5IIZ A;  4QL7 A;  3DD3 A;  2LJK A;  1GUK A;  2VIM A;  3GYK A;  3ZMK A;  5G30 A;  2YZH A;  2HZE A;  2OJL A;  3IXR A;  4WF4 A;  5ID2 B;  1SL1 B;  2H1B A;  1XW5 A;  3D21 A;  5HFK A;  1IYH A;  3WGD A;  3D4M A;  1GSE A;  1MEK A;  3F4T A;  1NHY A;  1GSQ A;  4EF0 A;  2GZZ A;  3VWV A;  5IQY A;  1YKC A;  3EU3 A;  5ECI B;  5ECP B; 
#chains in the Genus database with same CATH topology
 2FD3 A;  4MMM A;  4PX1 A;  2H6Z A;  4TN8 A;  2M72 A;  1U87 A;  2H76 A;  3CRU A;  3RHB A;  1O7U A;  2VCW A;  1SU9 A;  1GNE A;  5IPH A;  2H8L A;  2O8V B;  4L0U A;  3FZ9 A;  1OAZ A;  1EV9 A;  1RW1 A;  1V9W A;  1XXU A;  1GLQ A;  12GS A;  1K0B A;  5DBQ A;  4N30 A;  2DJ2 A;  4MPG A;  2LST A;  3FR6 A;  3JCM L;  3G7J A;  3MIX A;  5IMA A;  1OC9 A;  1Z6M A;  3N9J A;  3GIX A;  2EIO A;  2HLS A;  4MZC A;  1WPI A;  3EVI A;  3Q74 A;  1T4Y A;  5ECS A;  4GQF A;  2X8H A;  4IP1 A;  2WDU A;  1PFO A;  4FO5 A;  2IMI A;  5COH A;  2H19 A;  2IFQ B;  5H5Q A;  3TJF A;  1QQ2 A;  3GL5 A;  2K6V A;  11GS A;  3GKN A;  3F6D A;  3IAM 2;  1B4Q A;  2VAF A;  3HYP A;  4IQA A;  4EXJ A;  5EY6 A;  2IWT A;  1U6T A;  5H5S A;  3EU4 A;  1DSB A;  1WIK A;  2EIR A;  2X8C A;  3A2X A;  1Z5Y E;  4TRX A;  4NXI A;  3J7Y b;  4LMW A;  5A5K A;  1XOA A;  3K8N A;  3DKS A;  4NHW A;  1EP7 A;  1ML6 A;  3HJP A;  3GKM A;  3AY8 A;  4ZL7 A;  1BJX A;  3F9U A;  5D8I A;  3GL3 A;  5ECM B;  1EP8 A;  1S3R A;  4POB A;  1PD2 1;  2O85 A;  1F3B A;  4XRD A;  3C1S A;  3MDK A;  5JWR B;  2DSA A;  1ERU A;  3D0Z A;  2JU5 A;  4ML6 A;  2VD0 A;  1PRX A;  1TXX A;  4KDU A;  4WBR D;  1OVN A;  3NOF A;  3HY2 A;  1JZW A;  1SEN A;  1S3D A;  2YWM A;  4JZQ A;  3G9B A;  2FY6 A;  2BTO T;  3IC8 A;  5D93 A;  2LS5 A;  2LV3 A;  3QD9 A;  2H6X A;  1SK2 A;  2V6K A;  2LNT A;  5HR3 A;  2VM2 A;  4X1U A;  4O5R A;  3ZIV A;  3KTL A;  1FB0 A;  1TRW A;  4GLT A;  3TKS A;  3HHV A;  1Q98 A;  4XTS A;  3G7Y A;  3CSJ A;  4EL1 A;  2VL2 A;  4QQ7 A;  3HJO A;  3M3M A;  2KUC A;  1EV4 A;  1ZYP A;  3QAW A;  2EC4 A;  3WD6 A;  5AIX A;  4K2X A;  4GRF A;  2QA2 A;  4JU5 A;  3FK8 A;  3IHQ A;  2CAI A;  2CZ3 A;  1MTC A;  4KCE A;  1M9A A;  2WS2 A;  1ZOF A;  3HZ4 A;  3ZRE A;  3A5I A;  5DQS A;  2RUF A;  1I9D A;  4OWY A;  1AAZ A;  4DSQ A;  1Q4J A;  2FGX A;  2I1U A;  3IA1 A;  4FIW A;  4FYU A;  1AQV A;  3KP9 A;  4KDY A;  4J57 E;  4OO5 A;  3GST A;  4F82 A;  2CVB A;  1V2A A;  3TB2 A;  4MAB A;  5J5N A;  2V1M A;  2YV7 A;  1DE2 A;  2C0G A;  3FZ5 A;  3LXZ A;  4CW9 A;  3EE2 A;  1OKT A;  5LCZ A;  2H73 A;  4MP4 A;  3GA4 A;  3F6F A;  5J9B A;  1ZMA A;  3EPT A;  3A3T A;  3FR9 A;  4ZXG A;  1K0A A;  4Z2R A;  3PIN A;  4XS4 B;  4BL7 B;  3WGE A;  5J9C A;  5IMZ A;  4XS1 A;  1MDK A;  2M80 A;  2WZ9 A;  2TRX A;  5LNK e;  1J0F A;  2GQK A;  3IRA A;  1Z7P A;  4RQR A;  2C1Y A;  5FWG A;  2TRC P;  1MD3 A;  2NVL A;  3GX8 A;  2VL2 C;  4ZL9 A;  1NW2 A;  4V1A g;  3Q18 A;  2A2R A;  5HFG A;  2HT9 A;  1QMV A;  2HRN A;  2GT6 A;  3GUR A;  2X64 A;  3APQ A;  4AF2 A;  3ERF A;  4OFN A;  2ON7 A;  1Z7R A;  1W4V A;  5F0G A;  5DAK B;  4K7N A;  3VI7 A;  3GKX A;  5HR2 A;  5JCW A;  2DIZ A;  2IIY A;  1J08 A;  4WBJ A;  1TK8 B;  1VF3 A;  2DC5 A;  4YQV A;  3C71 A;  2JZS A;  3FYG A;  2A4H A;  4TR1 A;  1SK1 A;  2KHP A;  4XS4 A;  2CZ2 A;  3DXB A;  2FWH A;  1GSU A;  3FZ4 A;  3I69 A;  2MBT A;  3KXO A;  4KGI A;  2LEG A;  1PSQ A;  1R7H A;  1X5E A;  1YEX A;  4KUN A;  4OFM A;  4ZIJ A;  2X99 A;  2B5X A;  1K0M A;  3KEB A;  3ZYW A;  1O8W A;  2KP2 A;  4Q5R A;  4NPB A;  3UVT A;  4GWR A;  1OKD A;  4ECB A;  1CQG A;  3QR6 A;  5D9X A;  4WET A;  5DAK A;  4G19 A;  3F3R A;  4D73 B;  2G2Q A;  3ISO A;  1WP0 A;  2E0Q A;  1X9M B;  1FOH A;  4K7I A;  4WEY A;  5AIV A;  1EGO A;  1R5P A;  2PBJ A;  2VCQ A;  2A2S A;  2B7J A;  1OE7 A;  4WR4 A;  1N8J A;  2GDR A;  2IMK A;  3BOA A;  2X8G A;  1XWC A;  2LRN A;  4Q5N A;  1TOF A;  1K0C A;  2K8V A;  1UC7 A;  4EO3 A;  1ILO A;  6GSS A;  1PKW A;  1V57 A;  2AJQ B;  2R0P A;  4HS1 A;  3E3E A;  3TUE A;  1A2M A;  2TIR A;  1M3I A;  2FWF A;  3P7X A;  2A4V A;  3MAK A;  3QDN A;  3BCK A;  2R4V A;  5KN1 A;  3LOR A;  4LLR A;  3EWL A;  4ZB9 A;  3MWH A;  4JED A;  1XPV A;  5GST A;  1W89 A;  4F0C A;  5AN1 A;  4JE1 A;  2GLR A;  2XPD A;  4YQM A;  4BVY B;  5IO0 A;  5C04 A;  5DDL A;  5KEJ A;  2C3Q A;  3UBK A;  3ZL5 A;  9GSS A;  2KOK A;  2MMZ A;  4NMU A;  1TK0 B;  4J2F A;  1YEP A;  3U5R E;  2NDO A;  4N11 A;  2XC2 A;  5IMD A;  2GSQ A;  2FNO A;  5HR0 A;  2GT5 A;  2J9H A;  3R2Q A;  3KH9 A;  1MD4 A;  2O89 A;  2BJX A;  2H1A A;  2M46 A;  2CAQ A;  2DJ0 A;  3CRT A;  4IEL A;  4AGS A;  1AXD A;  4BWQ A;  2CQ9 A;  3P8W A;  4V1A p;  3ERW A;  4V2N A;  3QAG A;  4XIH A;  2P5Q A;  5CP1 A;  4AJ8 A;  2XPE A;  1ERT A;  3UIW A;  4BVX B;  4IKH A;  1K3Y A;  2RUE A;  4BPY A;  1XG8 A;  4TKY A;  3CTG A;  1SD8 A;  5CNW A;  2P5R A;  3GHA A;  3F63 A;  3FRC A;  4LL4 B;  1YDK A;  2WB9 A;  3CTF A;  1XW6 A;  4BVY A;  2N5B A;  4I97 A;  3IK9 A;  1O8X A;  1HNB A;  1K3L A;  2A2P A;  2VCT A;  3GUS A;  3A2W A;  1XWG A;  1OC9 B;  1GUM A;  4MZB A;  1TRV A;  1PL2 A;  2LUS A;  4MJE A;  1YJ6 A;  2LKU A;  6GSU A;  2WGR A;  5G1K A;  4AJ7 A;  1XOB A;  2H70 A;  2FWG A;  1XIY A;  1RK4 A;  2LNS A;  2L5O A;  2G0F A;  1FG4 A;  4TOP A;  1Y6E A;  5JCU A;  3TJJ A;  4NAX A;  1G7E A;  1F37 A;  1TRS A;  5AIS A;  3F4R A;  4PQH A;  1X9W B;  1GP1 A;  4BVX A;  5A4V A;  4G2E A;  2KLX A;  3DVW A;  1UN2 A;  1TTZ A;  1A8L A;  4K0N A;  5B8B A;  3CYN A;  1YZX A;  2IPA A;  4KCA A;  4A5P A;  5ECO B;  1BAY A;  6GSX A;  3HD5 A;  3IC4 A;  4L5O A;  2L6D A;  1TRU A;  3KP8 A;  1V40 A;  4YAP A;  3U6V A;  1GRX A;  4YKF A;  3H1N A;  4POK A;  1A0F A;  1K3O A;  5CRG A;  2PPT A;  4IBP A;  1NSW A;  2YWI A;  3E0U A;  1HNC A;  4I8B A;  6GSY A;  4MCU A;  1ERV A;  3IK7 A;  1GTB A;  4PUA A;  3TRX A;  3VPQ A;  1U88 A;  1NM3 A;  3W8J A;  2C0E A;  4KH7 A;  3KIJ A;  3CSH A;  4ID0 A;  2H1D A;  3V1W A;  1AW9 A;  4HZ4 A;  5KN3 A;  4IW9 A;  2QA1 A;  1O73 A;  3UAR A;  1WWJ A;  4CDO A;  1U3I A;  4EUY A;  1GTI A;  3UEM A;  1FAA A;  1PL1 A;  2V6O A;  3ED3 A;  4O7H A;  4PTS A;  2RII A;  1SK0 A;  1N2A A;  2CVD A;  5HQP A;  5IOW A;  2ES7 A;  4DVC A;  2VOC A;  3LGC A;  1EGR A;  4CY6 A;  2E2M A;  5IMV A;  3CBU A;  4RQX A;  2K9F A;  1T00 A;  3BCI A;  2F8F A;  4GSN A;  5ABR A;  3F0I A;  1SL0 B;  5B8A A;  4PNG A;  2RM5 A;  1JLW A;  3ZIT A;  4PXO A;  1G6Y A;  5GSS A;  3IBH A;  1SYX A;  5A4W A;  1BX9 A;  1PA3 A;  1KTE A;  2P31 A;  2H0G A;  3DRN A;  4TXO B;  1XVQ A;  4YH2 A;  3DML A;  1XVW A;  3TJK A;  1GSD A;  1XWB A;  2H6Y A;  4TR0 A;  4ISD A;  3GRX A;  1ST9 A;  2HYX A;  2B3S A;  4BWS A;  3DIE A;  3ME8 A;  5CAX A;  2HXK A;  4POM A;  3TKP A;  1ZCP A;  3M0F A;  1VF4 A;  1IYI A;  4HI7 A;  3TOU A;  3M1G A;  1SJI A;  3TKS E;  4L5L A;  3ZRD A;  4E8H A;  1LBK A;  3KH7 A;  4FYB A;  3O3T A;  5IMC A;  1WOU A;  2VLU A;  5ECR B;  5G2Z A;  1X5D A;  3RBT A;  3LWA A;  3L4N A;  2F9S A;  3TRP A;  3FHK A;  2UZ8 A;  16GS A;  4TXO A;  5INY A;  2H71 A;  1M3J A;  3KZQ A;  3MYD A;  2DIY A;  2FWE A;  4PQI A;  4X43 A;  4ZBA A;  3ZFB A;  2IL3 A;  1GLP A;  2YWO A;  2C80 A;  1A23 A;  1WMJ A;  4O5Q A;  1YY7 A;  2AAW A;  7GSS A;  1EEM A;  4F9Z A;  2ZCT A;  1DE1 A;  2DJJ A;  3L9V A;  3L78 A;  3L9S A;  3IPZ A;  2FA8 A;  3GNJ A;  1MDI A;  3H79 A;  2GSR A;  2PVO C;  4CY8 A;  2WRT A;  4O92 A;  1Z6N A;  1SYR A;  2H75 A;  5DQY A;  1AQX A;  4KA0 A;  3UJ1 A;  4G0K A;  1TK5 B;  4MF6 A;  4ZBB A;  1QXH A;  4TR1 B;  5G5F A;  4YKG A;  2B5Y A;  2GVP A;  3IOS A;  4KND A;  2YOI A;  2PWJ A;  1CQH A;  4TR4 A;  2NPB A;  3LQ7 A;  5ECK B;  3TKS C;  2XBI A;  4POL A;  5HFI A;  5CYY A;  1H75 A;  4HJM A;  5ENU A;  1B9X C;  1ACV A;  4MLY A;  1E2Y A;  4OFT A;  4X0X A;  3SWL A;  3QMX A;  3ME7 A;  2B5E A;  2MYG A;  2ALB A;  3E9J B;  2ZNM A;  4JRR A;  3ZML A;  4WXT A;  4HU9 A;  5D9T A;  4F0B A;  1M99 A;  4IQ1 A;  3LYP A;  2C3T A;  3GTU A;  3KM6 A;  3KGK A;  4HZ2 A;  1QK8 A;  4K1F A;  2GQL A;  1TU8 A;  1PX7 A;  3TRQ A;  2ZUP A;  1A2L A;  2PUK C;  3CMI A;  4ZB8 A;  5AGY A;  3W8S A;  4PQ1 A;  2HNL A;  2WCI A;  1C72 A;  4QL9 A;  5ECL B;  4XCS A;  1TDI A;  1FW1 A;  1T3B A;  1VGL A;  3PH9 A;  4GSS A;  4IJ3 A;  1K0D A;  6GSW A;  1G7O A;  2WFC A;  5HR1 A;  1DUG A;  1GH2 A;  4F2I A;  2DJ3 A;  2GZY A;  4KDX A;  5DCG A;  2MMO A;  4GQC A;  1QFN A;  4GCI A;  1O81 A;  2R5G A;  3KJY A;  3LG6 A;  1BQ7 A;  3ZTL A;  1HD2 A;  2L5L A;  5IMF A;  4LL1 B;  1GL8 A;  1V58 A;  3KD0 A;  1DBY A;  3KMN A;  1EEJ A;  4TW5 A;  2D2Z A;  4P3Y B;  2CX3 A;  5KOW A;  2HFD A;  1K0O A;  2EIQ A;  1YKA A;  4IN0 A;  4IP6 A;  4LMV A;  4FYC A;  22GS A;  2OBI A;  4ZBD A;  18GS A;  1A8Y A;  2DLX A;  2R37 A;  2DJ1 A;  2X49 A;  2C0D A;  3WT2 A;  2L4Q A;  1R4W A;  2R0C A;  4FH8 A;  2IJY A;  3NZN A;  3I9V 2;  3J7Y k;  2IN3 A;  2R3X A;  2QSI A;  3L0H A;  3WT1 A;  1ZYQ B;  1OC3 A;  1S3A A;  2VM1 A;  2DKI A;  2Z9S A;  4TXV A;  3QFA C;  2JL4 A;  2FHE A;  4JBB A;  4ZIL A;  1SKR B;  4DEJ A;  4OCF A;  5EL8 A;  2CX4 A;  4I2U A;  2OKA A;  4KAE A;  2CVK A;  2DBC A;  2RLI A;  1I5G A;  4WKW A;  3IE3 A;  3IR4 A;  4KSM A;  3ZVJ D;  1KBN A;  5ECH B;  2JZR A;  2K8S A;  2CT6 A;  5CRW A;  1PN9 A;  2GQM A;  5E59 A;  2GST A;  3IDV A;  5ELG A;  2L57 A;  4IHU A;  1AUC A;  3ZLP A;  1PKZ A;  3I43 A;  5L71 A;  5EVO A;  4I2T A;  3FW2 A;  4E8E A;  3C8E A;  2YAN A;  5D9W A;  2MBS A;  1A2J A;  4OO4 A;  5E4W A;  1FVJ A;  1M2B A;  3LJR A;  5D73 A;  4EDZ A;  4OMV A;  4AJ6 A;  5ECN B;  3LFL A;  3VI5 A;  3M8N A;  2VL9 A;  1FOV A;  2F51 A;  3HJM A;  2GTU A;  3DGQ A;  4ZL8 A;  2DML A;  3ZIJ A;  2JZT A;  3TGZ A;  2H01 A;  2HRA A;  3D4T A;  4K6X A;  2PMT A;  4KW6 A;  1G0T A;  1YF0 A;  4DSR A;  3HVS A;  2I4A A;  3FZA A;  3RDW A;  1X5C A;  2F3M A;  2GGT A;  2KP1 A;  1URM A;  5CRH A;  10GS A;  4HJ2 A;  1JZO A;  5GAN D;  4EDY A;  3FMW A;  1THX A;  5DAL B;  3VLN A;  3HZ8 A;  1GUL A;  4DSS A;  2B1L A;  4PGT A;  3HCZ A;  4I5Q A;  4K2D A;  3RAZ A;  2QKE A;  1PX6 A;  5ECQ B;  2H0I A;  3VK9 A;  1M0U A;  1T7P B;  2IMF A;  3CQF A;  3OR5 A;  3ERG A;  5KOX A;  2BMX A;  3PR8 A;  2C8U A;  3A2V A;  4MA9 A;  3BBY A;  4YAV A;  4PNF A;  3F3Q A;  2B7K A;  2CV4 A;  1SJ6 A;  2AYT A;  4ECJ A;  5D96 A;  2JAC A;  2LRT A;  3UMA A;  1WE0 A;  3TJG A;  6GSV A;  2OE0 A;  4XRA A;  2E2G A;  1GTU A;  4ILF A;  4G10 A;  4ICY A;  4EVM A;  4HQZ A;  2JSY A;  1NHO A;  1YF1 A;  4XHM A;  5JCG A;  2V2G A;  1HQO A;  2OAD A;  1YQ1 A;  2LTK A;  4K9Z A;  3GH9 A;  4WF5 A;  5DAL A;  8GSS A;  1Y25 A;  2O87 A;  2R0G A;  4IVF A;  4ECC A;  4MF5 A;  2QC7 A;  1O85 A;  3G7I A;  1WJK A;  2WUL A;  4LA1 A;  2WJU A;  3DVX A;  5ID2 A;  19GS A;  2DJK A;  4GTU A;  2GZP A;  3DEX A;  2FUG 2;  5IM9 A;  1ZL9 A;  3TCO A;  2YPM A;  3GFK A;  2I9H A;  3HXS A;  2VD1 A;  4K5R A;  2HRF A;  4OD7 A;  3O6T A;  2VCZ A;  4KSO A;  4Z2T A;  1TKD B;  1ZZY A;  2V41 A;  1JHB A;  4MNN A;  1EWX A;  1XZO A;  4JR4 A;  4ECI A;  2MMN A;  1BED A;  2PN8 A;  2H30 A;  1GSF A;  1WRY A;  4MJB A;  2OBK A;  2MZC A;  2V32 A;  5FT3 A;  3RHC A;  2X4A A;  1G6W A;  4K7O A;  3O76 A;  5DJM A;  2CA8 A;  1UVZ A;  3F8U A;  3US3 A;  2HI7 A;  1M9B A;  3Q19 A;  2B1K A;  1VF1 A;  4GST A;  1EOG A;  4G0I A;  2VO4 A;  4HDE A;  1T8E B;  3HDC A;  2N5F A;  3M9K A;  3UBL A;  1LU4 A;  1ABA A;  2F8A A;  1E6B A;  1VF2 A;  3KTB A;  1M7T A;  1AC1 A;  3TKQ A;  2IFQ A;  5IO2 A;  3HA9 A;  1ERW A;  2VLT A;  3LW9 A;  2VCV A;  5B6M A;  3ZZX A;  2QGV A;  4GXZ A;  2REM A;  2FLS A;  1PN0 A;  3VUR A;  3C73 A;  1FB6 A;  3D5J A;  2O7K A;  3PPU A;  3LYK A;  1TI3 A;  3N5O A;  3HVX A;  1B9Y C;  1GSY A;  4O32 A;  1Z3E A;  5LD0 A;  5EPF A;  1SD9 A;  4K8M A;  4L8E A;  1UA5 A;  4TR3 A;  1TW9 A;  3IV4 A;  3Q6O A;  5B7C A;  3H93 A;  3VWU A;  3S9F A;  3HVV A;  3LEF A;  2PGT A;  1TU7 A;  3GH6 A;  4RI7 A;  1A24 A;  2HSY A;  1XWK A;  2K18 A;  3RPN A;  1H4O A;  2H74 A;  5A4U A;  4IS0 A;  3UL3 A;  1TI1 A;  1OYJ A;  1OE8 A;  5G31 A;  1X0R A;  3FY7 A;  3TKR A;  3GSS A;  2FA4 A;  2XHF A;  3P2A A;  2R6K A;  3EUR A;  1V98 A;  3MNG A;  4ZB6 A;  2E7P A;  3IAS 2;  3EMP A;  4EKZ A;  4PUR A;  4MZW A;  2NTO A;  4V2M A;  3TDG A;  1PMT A;  3WGX A;  4PUF C;  4ACS A;  3BJ5 A;  3GTU B;  5J4U A;  1A0R P;  1EZK A;  4GF0 A;  4KX4 A;  2LQQ A;  4JR6 A;  4ULX A;  2VL3 A;  1KEB A;  4IJI A;  2VLV A;  3PGT A;  5BRT A;  3TOT A;  1GTA A;  3W6G A;  2H72 A;  3GMF A;  4MK3 A;  1PGT A;  3QOU A;  1SL2 B;  2L59 A;  4EIP A;  3H4K A;  5IOX A;  2H1G A;  3GX0 A;  5JWQ B;  5D9V A;  3NIV A;  5F05 A;  4MPF A;  4N0Z A;  20GS A;  3IHG A;  3LXT A;  4MF7 A;  4Q5Q A;  3ZVJ A;  2XBQ A;  2B6M A;  3WYW A;  4MH2 A;  3CSI A;  3CXG A;  1FVK A;  2C3N A;  4EC0 A;  4TVE A;  4NHZ A;  2YZU A;  1ZYN A;  3KMO A;  3H8Q A;  2I81 A;  2PER A;  5GAP D;  2P0G A;  2DKH A;  1GWC A;  2YWN A;  5F8B A;  1FO5 A;  2LRC A;  2YN1 A;  2YJH A;  5CRE A;  1XWA A;  2L4C A;  1THO A;  2JSZ A;  2YJ7 A;  1SKS B;  1TJD A;  5KN2 A;  4OCE A;  5ELA A;  3HVN A;  5BMU A;  2HSM A;  2HE3 A;  5DVB A;  14GS A;  1SKW B;  1T4Z A;  2AHE A;  2IME A;  1F6M C;  4YQU A;  1MDJ A;  1B48 A;  4N0V A;  1EOH A;  3A5W A;  5DCH A;  5KN0 A;  3MSZ A;  4EE0 A;  1JLV A;  2OE1 A;  3D6I A;  4HQS A;  4BL7 A;  1XBS A;  5CO3 A;  4FQU A;  1T1V A;  3TJB A;  1S3C A;  4Z7X A;  2AB6 A;  2OAC A;  4J56 E;  2OE3 A;  3EYT A;  1R26 A;  4NV5 A;  1OC8 A;  1M2D A;  2VCX A;  13GS A;  4Q5F A;  1JZR A;  4CHS A;  1VRS D;  6GST A;  2YCD A;  4MDC A;  3UAP A;  2NBS A;  4G9H A;  2DMM A;  3GV1 A;  2GSS A;  2R2J A;  1X9S B;  3RPP A;  1O6J A;  4HOJ A;  2HZF A;  3QAV A;  4HU7 A;  1QGV A;  1USB A;  5G5E A;  3C1R A;  3EIN A;  1QUW A;  1AQW A;  1F3A A;  3EMX A;  4O5U A;  4L0W A;  5JWO B;  3QCP A;  3QPM A;  4USS A;  1GNW A;  2I3Y A;  3FEU A;  2C4J A;  1FHE A;  4BIK A;  2AUV A;  4RUV A;  2H66 A;  3R3E A;  2H0H A;  2N5A A;  3DYR A;  3DWV A;  2MMA A;  4BA7 A;  2OA7 A;  2YNX A;  3D22 A;  4NV2 A;  4MH3 A;  5F07 A;  1B4P A;  1F2E A;  2LQO A;  2AV4 A;  1JZD A;  2VUP A;  4IGJ A;  1F9M A;  4KE3 A;  4K0G A;  4WR5 A;  5C00 A;  3APO A;  3M9J A;  1RQM A;  1BYE A;  2HSH A;  1K0N A;  2YV9 A;  5G1L A;  1JFU A;  2GS3 A;  2ON5 A;  1SJZ A;  4RI6 A;  5J3R A;  5GZZ B;  1ZGN A;  3VWX A;  17GS A;  4MJA A;  2C0F A;  2LJR A;  3HKR A;  2PVQ A;  4EIQ A;  2JAD A;  1BG5 A;  4D73 A;  1TP9 A;  3P90 A;  5FHI A;  3F4S A;  3VWW A;  4DSS B;  3ZFL A;  4HUA A;  3C7M A;  3I6A A;  3UVH A;  5J41 A;  1HNA A;  4XS6 A;  1HYU A;  1M2A A;  1XW9 A;  1ZYE A;  5F06 A;  3KCM A;  3EC3 A;  5B6N A;  2HZE B;  4H86 A;  3FKF A;  3QFB C;  2J23 A;  3VPT A;  1LJR A;  1Z9H A;  3GKK A;  4F03 A;  4N10 A;  4HSC X;  1GUH A;  1XFL A;  4I6X A;  1AIU A;  1PQN A;  2IMD A;  2YP6 A;  1B8X A;  3BD2 A;  1J9B A;  3UOM A;  2L6C A;  4KB3 A;  2PU9 C;  5H5R A;  4NWY A;  3APS A;  1R5A A;  1ON4 A;  2FCH A;  1U3A A;  1KNG A;  3VFI A;  5IPG A;  2LJA A;  4V2L A;  5DJL A;  3FR3 A;  1GSS A;  2RM6 A;  4ML1 A;  4X4J A;  5CRD A;  4K5S A;  1XCC A;  4HEA 2;  4MJC A;  3GN3 A;  3L9U A;  4G0L A;  3SBC A;  3LSZ A;  5IIZ A;  4QL7 A;  3DD3 A;  2LJK A;  1GUK A;  2VIM A;  3GYK A;  3ZMK A;  5G30 A;  2YZH A;  2HZE A;  2OJL A;  3IXR A;  4WF4 A;  5ID2 B;  1SL1 B;  2H1B A;  1XW5 A;  3D21 A;  5HFK A;  1IYH A;  3WGD A;  4Z2U A;  2HRK A;  3D4M A;  1GSE A;  1MEK A;  3F4T A;  1NHY A;  1GSQ A;  4EF0 A;  2GZZ A;  4KF9 A;  3VWV A;  5IQY A;  1YKC A;  3EU3 A;  5ECI B;  5ECP B; 
#chains in the Genus database with same CATH homology
 2FD3 A;  4MMM A;  4PX1 A;  2H6Z A;  4TN8 A;  2M72 A;  1U87 A;  2H76 A;  3CRU A;  3RHB A;  1O7U A;  2VCW A;  1SU9 A;  1GNE A;  5IPH A;  2H8L A;  2O8V B;  4L0U A;  3FZ9 A;  1OAZ A;  1EV9 A;  1RW1 A;  1V9W A;  1XXU A;  1GLQ A;  12GS A;  1K0B A;  5DBQ A;  4N30 A;  2DJ2 A;  4MPG A;  2LST A;  3FR6 A;  3JCM L;  3G7J A;  3MIX A;  5IMA A;  1OC9 A;  1Z6M A;  3N9J A;  3GIX A;  2EIO A;  2HLS A;  4MZC A;  1WPI A;  3EVI A;  3Q74 A;  1T4Y A;  5ECS A;  4GQF A;  2X8H A;  4IP1 A;  2WDU A;  4FO5 A;  2IMI A;  5COH A;  2H19 A;  2IFQ B;  5H5Q A;  3TJF A;  1QQ2 A;  3GL5 A;  2K6V A;  11GS A;  3GKN A;  3F6D A;  3IAM 2;  1B4Q A;  2VAF A;  3HYP A;  4IQA A;  4EXJ A;  5EY6 A;  2IWT A;  1U6T A;  5H5S A;  3EU4 A;  1DSB A;  1WIK A;  2EIR A;  2X8C A;  3A2X A;  1Z5Y E;  4TRX A;  4NXI A;  3J7Y b;  4LMW A;  5A5K A;  1XOA A;  3K8N A;  3DKS A;  4NHW A;  1EP7 A;  1ML6 A;  3HJP A;  3GKM A;  3AY8 A;  4ZL7 A;  1BJX A;  3F9U A;  5D8I A;  3GL3 A;  5ECM B;  1EP8 A;  4POB A;  1PD2 1;  2O85 A;  1F3B A;  4XRD A;  3C1S A;  3MDK A;  5JWR B;  2DSA A;  1ERU A;  3D0Z A;  2JU5 A;  4ML6 A;  2VD0 A;  1PRX A;  1TXX A;  4KDU A;  4WBR D;  1OVN A;  3NOF A;  3HY2 A;  1JZW A;  1SEN A;  1S3D A;  2YWM A;  4JZQ A;  3G9B A;  2FY6 A;  2BTO T;  3IC8 A;  5D93 A;  2LS5 A;  2LV3 A;  3QD9 A;  2H6X A;  1SK2 A;  2V6K A;  2LNT A;  5HR3 A;  2VM2 A;  4X1U A;  4O5R A;  3ZIV A;  3KTL A;  1FB0 A;  1TRW A;  4GLT A;  3TKS A;  3HHV A;  1Q98 A;  4XTS A;  3G7Y A;  3CSJ A;  4EL1 A;  2VL2 A;  4QQ7 A;  3HJO A;  3M3M A;  2KUC A;  1EV4 A;  1ZYP A;  3QAW A;  2EC4 A;  3WD6 A;  5AIX A;  4K2X A;  4GRF A;  2QA2 A;  4JU5 A;  3FK8 A;  3IHQ A;  2CAI A;  2CZ3 A;  1MTC A;  4KCE A;  1M9A A;  2WS2 A;  1ZOF A;  3HZ4 A;  3ZRE A;  3A5I A;  5DQS A;  2RUF A;  1I9D A;  4OWY A;  1AAZ A;  4DSQ A;  1Q4J A;  2FGX A;  2I1U A;  3IA1 A;  4FIW A;  4FYU A;  1AQV A;  3KP9 A;  4KDY A;  4J57 E;  4OO5 A;  3GST A;  4F82 A;  2CVB A;  1V2A A;  3TB2 A;  4MAB A;  5J5N A;  2V1M A;  2YV7 A;  1DE2 A;  2C0G A;  3FZ5 A;  3LXZ A;  4CW9 A;  3EE2 A;  1OKT A;  5LCZ A;  2H73 A;  4MP4 A;  3GA4 A;  3F6F A;  5J9B A;  1ZMA A;  3EPT A;  3A3T A;  3FR9 A;  4ZXG A;  1K0A A;  4Z2R A;  3PIN A;  4XS4 B;  4BL7 B;  3WGE A;  5J9C A;  5IMZ A;  4XS1 A;  1MDK A;  2M80 A;  2WZ9 A;  2TRX A;  5LNK e;  1J0F A;  2GQK A;  3IRA A;  1Z7P A;  4RQR A;  2C1Y A;  5FWG A;  2TRC P;  1MD3 A;  2NVL A;  3GX8 A;  2VL2 C;  4ZL9 A;  1NW2 A;  4V1A g;  3Q18 A;  2A2R A;  5HFG A;  2HT9 A;  1QMV A;  2HRN A;  2GT6 A;  3GUR A;  2X64 A;  3APQ A;  4AF2 A;  3ERF A;  4OFN A;  2ON7 A;  1Z7R A;  1W4V A;  5F0G A;  5DAK B;  4K7N A;  3VI7 A;  3GKX A;  5HR2 A;  5JCW A;  2DIZ A;  2IIY A;  1J08 A;  4WBJ A;  1TK8 B;  1VF3 A;  2DC5 A;  4YQV A;  3C71 A;  2JZS A;  3FYG A;  2A4H A;  4TR1 A;  1SK1 A;  2KHP A;  4XS4 A;  2CZ2 A;  3DXB A;  2FWH A;  1GSU A;  3FZ4 A;  3I69 A;  2MBT A;  3KXO A;  4KGI A;  2LEG A;  1PSQ A;  1R7H A;  1X5E A;  1YEX A;  4KUN A;  4OFM A;  4ZIJ A;  2X99 A;  2B5X A;  1K0M A;  3KEB A;  3ZYW A;  1O8W A;  2KP2 A;  4Q5R A;  4NPB A;  3UVT A;  4GWR A;  1OKD A;  4ECB A;  1CQG A;  3QR6 A;  5D9X A;  4WET A;  5DAK A;  4G19 A;  3F3R A;  4D73 B;  2G2Q A;  3ISO A;  1WP0 A;  2E0Q A;  1X9M B;  1FOH A;  4K7I A;  4WEY A;  5AIV A;  1EGO A;  1R5P A;  2PBJ A;  2VCQ A;  2A2S A;  2B7J A;  1OE7 A;  4WR4 A;  1N8J A;  2GDR A;  2IMK A;  3BOA A;  2X8G A;  1XWC A;  2LRN A;  4Q5N A;  1TOF A;  1K0C A;  2K8V A;  1UC7 A;  4EO3 A;  1ILO A;  6GSS A;  1PKW A;  1V57 A;  2AJQ B;  2R0P A;  4HS1 A;  3E3E A;  3TUE A;  1A2M A;  2TIR A;  2FWF A;  3P7X A;  2A4V A;  3MAK A;  3QDN A;  3BCK A;  2R4V A;  5KN1 A;  3LOR A;  4LLR A;  3EWL A;  4ZB9 A;  3MWH A;  4JED A;  1XPV A;  5GST A;  1W89 A;  4F0C A;  5AN1 A;  4JE1 A;  2GLR A;  2XPD A;  4YQM A;  4BVY B;  5IO0 A;  5C04 A;  5DDL A;  5KEJ A;  2C3Q A;  3UBK A;  3ZL5 A;  9GSS A;  2KOK A;  2MMZ A;  4NMU A;  1TK0 B;  4J2F A;  1YEP A;  3U5R E;  2NDO A;  4N11 A;  2XC2 A;  5IMD A;  2GSQ A;  2FNO A;  5HR0 A;  2GT5 A;  2J9H A;  3R2Q A;  3KH9 A;  1MD4 A;  2O89 A;  2BJX A;  2H1A A;  2M46 A;  2CAQ A;  2DJ0 A;  3CRT A;  4IEL A;  4AGS A;  1AXD A;  4BWQ A;  2CQ9 A;  3P8W A;  4V1A p;  3ERW A;  4V2N A;  3QAG A;  4XIH A;  2P5Q A;  5CP1 A;  4AJ8 A;  2XPE A;  1ERT A;  3UIW A;  4BVX B;  4IKH A;  1K3Y A;  2RUE A;  4BPY A;  4TKY A;  3CTG A;  1SD8 A;  5CNW A;  2P5R A;  3GHA A;  3F63 A;  3FRC A;  4LL4 B;  1YDK A;  2WB9 A;  3CTF A;  1XW6 A;  4BVY A;  2N5B A;  4I97 A;  3IK9 A;  1O8X A;  1HNB A;  1K3L A;  2A2P A;  2VCT A;  3GUS A;  3A2W A;  1XWG A;  1OC9 B;  1GUM A;  4MZB A;  1TRV A;  1PL2 A;  2LUS A;  4MJE A;  1YJ6 A;  2LKU A;  6GSU A;  2WGR A;  5G1K A;  4AJ7 A;  1XOB A;  2H70 A;  2FWG A;  1XIY A;  1RK4 A;  2LNS A;  2L5O A;  2G0F A;  1FG4 A;  4TOP A;  1Y6E A;  5JCU A;  3TJJ A;  4NAX A;  1G7E A;  1F37 A;  1TRS A;  5AIS A;  3F4R A;  4PQH A;  1X9W B;  1GP1 A;  4BVX A;  5A4V A;  4G2E A;  2KLX A;  3DVW A;  1UN2 A;  1TTZ A;  1A8L A;  4K0N A;  5B8B A;  3CYN A;  1YZX A;  2IPA A;  4KCA A;  4A5P A;  5ECO B;  1BAY A;  6GSX A;  3HD5 A;  3IC4 A;  4L5O A;  2L6D A;  1TRU A;  3KP8 A;  1V40 A;  4YAP A;  3U6V A;  1GRX A;  4YKF A;  3H1N A;  4POK A;  1A0F A;  1K3O A;  5CRG A;  2PPT A;  4IBP A;  1NSW A;  2YWI A;  3E0U A;  1HNC A;  4I8B A;  6GSY A;  4MCU A;  1ERV A;  3IK7 A;  1GTB A;  4PUA A;  3TRX A;  3VPQ A;  1U88 A;  1NM3 A;  3W8J A;  2C0E A;  4KH7 A;  3KIJ A;  3CSH A;  4ID0 A;  2H1D A;  3V1W A;  1AW9 A;  4HZ4 A;  5KN3 A;  4IW9 A;  2QA1 A;  1O73 A;  3UAR A;  1WWJ A;  4CDO A;  1U3I A;  4EUY A;  1GTI A;  3UEM A;  1FAA A;  1PL1 A;  2V6O A;  3ED3 A;  4O7H A;  4PTS A;  2RII A;  1SK0 A;  1N2A A;  2CVD A;  5HQP A;  5IOW A;  2ES7 A;  4DVC A;  2VOC A;  3LGC A;  1EGR A;  4CY6 A;  2E2M A;  5IMV A;  3CBU A;  4RQX A;  2K9F A;  1T00 A;  3BCI A;  2F8F A;  4GSN A;  5ABR A;  3F0I A;  1SL0 B;  5B8A A;  4PNG A;  2RM5 A;  1JLW A;  3ZIT A;  4PXO A;  1G6Y A;  5GSS A;  3IBH A;  1SYX A;  5A4W A;  1BX9 A;  1PA3 A;  1KTE A;  2P31 A;  2H0G A;  3DRN A;  4TXO B;  1XVQ A;  4YH2 A;  3DML A;  1XVW A;  3TJK A;  1GSD A;  1XWB A;  2H6Y A;  4TR0 A;  4ISD A;  3GRX A;  1ST9 A;  2HYX A;  2B3S A;  4BWS A;  3DIE A;  3ME8 A;  5CAX A;  2HXK A;  4POM A;  3TKP A;  1ZCP A;  3M0F A;  1VF4 A;  1IYI A;  4HI7 A;  3TOU A;  3M1G A;  1SJI A;  3TKS E;  4L5L A;  3ZRD A;  4E8H A;  1LBK A;  3KH7 A;  4FYB A;  3O3T A;  5IMC A;  1WOU A;  2VLU A;  5ECR B;  5G2Z A;  1X5D A;  3RBT A;  3LWA A;  3L4N A;  2F9S A;  3TRP A;  3FHK A;  2UZ8 A;  16GS A;  4TXO A;  5INY A;  2H71 A;  3KZQ A;  3MYD A;  2DIY A;  2FWE A;  4PQI A;  4X43 A;  4ZBA A;  3ZFB A;  2IL3 A;  1GLP A;  2YWO A;  2C80 A;  1A23 A;  1WMJ A;  4O5Q A;  1YY7 A;  2AAW A;  7GSS A;  1EEM A;  4F9Z A;  2ZCT A;  1DE1 A;  2DJJ A;  3L9V A;  3L78 A;  3L9S A;  3IPZ A;  2FA8 A;  3GNJ A;  1MDI A;  3H79 A;  2GSR A;  2PVO C;  4CY8 A;  2WRT A;  4O92 A;  1Z6N A;  1SYR A;  2H75 A;  5DQY A;  1AQX A;  4KA0 A;  3UJ1 A;  4G0K A;  1TK5 B;  4MF6 A;  4ZBB A;  1QXH A;  4TR1 B;  5G5F A;  4YKG A;  2B5Y A;  2GVP A;  3IOS A;  4KND A;  2YOI A;  2PWJ A;  1CQH A;  4TR4 A;  2NPB A;  3LQ7 A;  5ECK B;  3TKS C;  2XBI A;  4POL A;  5HFI A;  5CYY A;  1H75 A;  4HJM A;  5ENU A;  1B9X C;  1ACV A;  4MLY A;  1E2Y A;  4OFT A;  4X0X A;  3SWL A;  3QMX A;  3ME7 A;  2B5E A;  2MYG A;  2ALB A;  3E9J B;  2ZNM A;  4JRR A;  3ZML A;  4WXT A;  4HU9 A;  5D9T A;  4F0B A;  1M99 A;  4IQ1 A;  3LYP A;  2C3T A;  3GTU A;  3KM6 A;  3KGK A;  4HZ2 A;  1QK8 A;  4K1F A;  2GQL A;  1TU8 A;  1PX7 A;  3TRQ A;  2ZUP A;  1A2L A;  2PUK C;  3CMI A;  4ZB8 A;  5AGY A;  3W8S A;  4PQ1 A;  2HNL A;  2WCI A;  1C72 A;  4QL9 A;  5ECL B;  4XCS A;  1TDI A;  1FW1 A;  1T3B A;  1VGL A;  3PH9 A;  4GSS A;  4IJ3 A;  1K0D A;  6GSW A;  1G7O A;  2WFC A;  5HR1 A;  1DUG A;  1GH2 A;  4F2I A;  2DJ3 A;  2GZY A;  4KDX A;  5DCG A;  2MMO A;  4GQC A;  1QFN A;  4GCI A;  1O81 A;  2R5G A;  3KJY A;  3LG6 A;  1BQ7 A;  3ZTL A;  1HD2 A;  2L5L A;  5IMF A;  4LL1 B;  1GL8 A;  1V58 A;  3KD0 A;  1DBY A;  3KMN A;  1EEJ A;  4TW5 A;  2D2Z A;  4P3Y B;  2CX3 A;  5KOW A;  2HFD A;  1K0O A;  2EIQ A;  1YKA A;  4IN0 A;  4IP6 A;  4LMV A;  4FYC A;  22GS A;  2OBI A;  4ZBD A;  18GS A;  1A8Y A;  2DLX A;  2R37 A;  2DJ1 A;  2X49 A;  2C0D A;  3WT2 A;  2L4Q A;  1R4W A;  2R0C A;  4FH8 A;  2IJY A;  3NZN A;  3I9V 2;  3J7Y k;  2IN3 A;  2R3X A;  2QSI A;  3L0H A;  3WT1 A;  1ZYQ B;  1OC3 A;  1S3A A;  2VM1 A;  2DKI A;  2Z9S A;  4TXV A;  3QFA C;  2JL4 A;  2FHE A;  4JBB A;  4ZIL A;  1SKR B;  4DEJ A;  4OCF A;  5EL8 A;  2CX4 A;  4I2U A;  2OKA A;  4KAE A;  2CVK A;  2DBC A;  2RLI A;  1I5G A;  4WKW A;  3IE3 A;  3IR4 A;  4KSM A;  3ZVJ D;  1KBN A;  5ECH B;  2JZR A;  2K8S A;  2CT6 A;  5CRW A;  1PN9 A;  2GQM A;  5E59 A;  2GST A;  3IDV A;  5ELG A;  2L57 A;  4IHU A;  1AUC A;  3ZLP A;  1PKZ A;  3I43 A;  5L71 A;  5EVO A;  4I2T A;  3FW2 A;  4E8E A;  3C8E A;  2YAN A;  5D9W A;  2MBS A;  1A2J A;  4OO4 A;  5E4W A;  1FVJ A;  1M2B A;  3LJR A;  5D73 A;  4EDZ A;  4OMV A;  4AJ6 A;  5ECN B;  3LFL A;  3VI5 A;  3M8N A;  2VL9 A;  1FOV A;  2F51 A;  3HJM A;  2GTU A;  3DGQ A;  4ZL8 A;  2DML A;  3ZIJ A;  2JZT A;  3TGZ A;  2H01 A;  2HRA A;  3D4T A;  4K6X A;  2PMT A;  4KW6 A;  1G0T A;  1YF0 A;  4DSR A;  3HVS A;  2I4A A;  3FZA A;  3RDW A;  1X5C A;  2F3M A;  2GGT A;  2KP1 A;  1URM A;  5CRH A;  10GS A;  4HJ2 A;  1JZO A;  5GAN D;  4EDY A;  3FMW A;  1THX A;  5DAL B;  3VLN A;  3HZ8 A;  1GUL A;  4DSS A;  2B1L A;  4PGT A;  3HCZ A;  4I5Q A;  4K2D A;  3RAZ A;  2QKE A;  1PX6 A;  5ECQ B;  2H0I A;  3VK9 A;  1M0U A;  1T7P B;  2IMF A;  3OR5 A;  3ERG A;  5KOX A;  2BMX A;  3PR8 A;  2C8U A;  3A2V A;  4MA9 A;  3BBY A;  4YAV A;  4PNF A;  3F3Q A;  2B7K A;  2CV4 A;  1SJ6 A;  2AYT A;  4ECJ A;  5D96 A;  2JAC A;  2LRT A;  3UMA A;  1WE0 A;  3TJG A;  6GSV A;  2OE0 A;  4XRA A;  2E2G A;  1GTU A;  4ILF A;  4G10 A;  4ICY A;  4EVM A;  4HQZ A;  2JSY A;  1NHO A;  1YF1 A;  4XHM A;  5JCG A;  2V2G A;  1HQO A;  2OAD A;  1YQ1 A;  2LTK A;  4K9Z A;  3GH9 A;  4WF5 A;  5DAL A;  8GSS A;  1Y25 A;  2O87 A;  2R0G A;  4IVF A;  4ECC A;  4MF5 A;  2QC7 A;  1O85 A;  3G7I A;  1WJK A;  2WUL A;  4LA1 A;  2WJU A;  3DVX A;  5ID2 A;  19GS A;  2DJK A;  4GTU A;  2GZP A;  3DEX A;  2FUG 2;  5IM9 A;  1ZL9 A;  3TCO A;  2YPM A;  3GFK A;  2I9H A;  3HXS A;  2VD1 A;  4K5R A;  2HRF A;  4OD7 A;  3O6T A;  2VCZ A;  4KSO A;  4Z2T A;  1TKD B;  1ZZY A;  2V41 A;  1JHB A;  4MNN A;  1EWX A;  1XZO A;  4JR4 A;  4ECI A;  2MMN A;  1BED A;  2PN8 A;  2H30 A;  1GSF A;  1WRY A;  4MJB A;  2OBK A;  2MZC A;  2V32 A;  5FT3 A;  3RHC A;  2X4A A;  1G6W A;  4K7O A;  3O76 A;  5DJM A;  2CA8 A;  1UVZ A;  3F8U A;  3US3 A;  2HI7 A;  1M9B A;  3Q19 A;  2B1K A;  1VF1 A;  4GST A;  1EOG A;  4G0I A;  2VO4 A;  4HDE A;  1T8E B;  3HDC A;  2N5F A;  3M9K A;  3UBL A;  1LU4 A;  1ABA A;  2F8A A;  1E6B A;  1VF2 A;  3KTB A;  1M7T A;  1AC1 A;  3TKQ A;  2IFQ A;  5IO2 A;  3HA9 A;  1ERW A;  2VLT A;  3LW9 A;  2VCV A;  5B6M A;  3ZZX A;  2QGV A;  4GXZ A;  2REM A;  2FLS A;  1PN0 A;  3VUR A;  3C73 A;  1FB6 A;  3D5J A;  2O7K A;  3PPU A;  3LYK A;  1TI3 A;  3N5O A;  3HVX A;  1B9Y C;  1GSY A;  4O32 A;  1Z3E A;  5LD0 A;  5EPF A;  1SD9 A;  4K8M A;  4L8E A;  1UA5 A;  4TR3 A;  1TW9 A;  3IV4 A;  3Q6O A;  5B7C A;  3H93 A;  3VWU A;  3S9F A;  3HVV A;  3LEF A;  2PGT A;  1TU7 A;  3GH6 A;  4RI7 A;  1A24 A;  2HSY A;  1XWK A;  2K18 A;  3RPN A;  1H4O A;  2H74 A;  5A4U A;  4IS0 A;  3UL3 A;  1TI1 A;  1OYJ A;  1OE8 A;  5G31 A;  1X0R A;  3FY7 A;  3TKR A;  3GSS A;  2FA4 A;  2XHF A;  3P2A A;  2R6K A;  3EUR A;  1V98 A;  3MNG A;  4ZB6 A;  2E7P A;  3IAS 2;  3EMP A;  4EKZ A;  4PUR A;  4MZW A;  2NTO A;  4V2M A;  3TDG A;  1PMT A;  3WGX A;  4PUF C;  4ACS A;  3BJ5 A;  3GTU B;  5J4U A;  1A0R P;  1EZK A;  4GF0 A;  4KX4 A;  2LQQ A;  4JR6 A;  4ULX A;  2VL3 A;  1KEB A;  4IJI A;  2VLV A;  3PGT A;  5BRT A;  3TOT A;  1GTA A;  3W6G A;  2H72 A;  3GMF A;  4MK3 A;  1PGT A;  3QOU A;  1SL2 B;  2L59 A;  4EIP A;  3H4K A;  5IOX A;  2H1G A;  3GX0 A;  5JWQ B;  5D9V A;  3NIV A;  5F05 A;  4MPF A;  4N0Z A;  20GS A;  3IHG A;  3LXT A;  4MF7 A;  4Q5Q A;  3ZVJ A;  2XBQ A;  2B6M A;  3WYW A;  4MH2 A;  3CSI A;  3CXG A;  1FVK A;  2C3N A;  4EC0 A;  4TVE A;  4NHZ A;  2YZU A;  1ZYN A;  3KMO A;  3H8Q A;  2I81 A;  2PER A;  5GAP D;  2P0G A;  2DKH A;  1GWC A;  2YWN A;  5F8B A;  1FO5 A;  2LRC A;  2YN1 A;  2YJH A;  5CRE A;  1XWA A;  2L4C A;  1THO A;  2JSZ A;  2YJ7 A;  1SKS B;  1TJD A;  5KN2 A;  4OCE A;  5ELA A;  5BMU A;  2HSM A;  2HE3 A;  5DVB A;  14GS A;  1SKW B;  1T4Z A;  2AHE A;  2IME A;  1F6M C;  4YQU A;  1MDJ A;  1B48 A;  4N0V A;  1EOH A;  3A5W A;  5DCH A;  5KN0 A;  3MSZ A;  4EE0 A;  1JLV A;  2OE1 A;  3D6I A;  4HQS A;  4BL7 A;  1XBS A;  5CO3 A;  4FQU A;  1T1V A;  3TJB A;  1S3C A;  4Z7X A;  2AB6 A;  2OAC A;  4J56 E;  2OE3 A;  3EYT A;  1R26 A;  4NV5 A;  1OC8 A;  1M2D A;  2VCX A;  13GS A;  4Q5F A;  1JZR A;  4CHS A;  1VRS D;  6GST A;  2YCD A;  4MDC A;  3UAP A;  2NBS A;  4G9H A;  2DMM A;  3GV1 A;  2GSS A;  2R2J A;  1X9S B;  3RPP A;  1O6J A;  4HOJ A;  2HZF A;  3QAV A;  4HU7 A;  1QGV A;  1USB A;  5G5E A;  3C1R A;  3EIN A;  1QUW A;  1AQW A;  1F3A A;  3EMX A;  4O5U A;  4L0W A;  5JWO B;  3QCP A;  3QPM A;  4USS A;  1GNW A;  2I3Y A;  3FEU A;  2C4J A;  1FHE A;  2AUV A;  4RUV A;  2H66 A;  3R3E A;  2H0H A;  2N5A A;  3DYR A;  3DWV A;  2MMA A;  4BA7 A;  2OA7 A;  2YNX A;  3D22 A;  4NV2 A;  4MH3 A;  5F07 A;  1B4P A;  1F2E A;  2LQO A;  2AV4 A;  1JZD A;  2VUP A;  4IGJ A;  1F9M A;  4KE3 A;  4K0G A;  4WR5 A;  5C00 A;  3APO A;  3M9J A;  1RQM A;  1BYE A;  2HSH A;  1K0N A;  2YV9 A;  5G1L A;  1JFU A;  2GS3 A;  2ON5 A;  1SJZ A;  4RI6 A;  5J3R A;  5GZZ B;  1ZGN A;  3VWX A;  17GS A;  4MJA A;  2C0F A;  2LJR A;  3HKR A;  2PVQ A;  4EIQ A;  2JAD A;  1BG5 A;  4D73 A;  1TP9 A;  3P90 A;  5FHI A;  3F4S A;  3VWW A;  4DSS B;  3ZFL A;  4HUA A;  3C7M A;  3I6A A;  3UVH A;  5J41 A;  1HNA A;  4XS6 A;  1HYU A;  1M2A A;  1XW9 A;  1ZYE A;  5F06 A;  3KCM A;  3EC3 A;  5B6N A;  2HZE B;  4H86 A;  3FKF A;  3QFB C;  2J23 A;  3VPT A;  1LJR A;  1Z9H A;  3GKK A;  4F03 A;  4N10 A;  1GUH A;  1XFL A;  4I6X A;  1AIU A;  1PQN A;  2IMD A;  2YP6 A;  1B8X A;  3BD2 A;  1J9B A;  3UOM A;  2L6C A;  4KB3 A;  2PU9 C;  5H5R A;  4NWY A;  3APS A;  1R5A A;  1ON4 A;  2FCH A;  1U3A A;  1KNG A;  3VFI A;  5IPG A;  2LJA A;  4V2L A;  5DJL A;  3FR3 A;  1GSS A;  2RM6 A;  4ML1 A;  4X4J A;  5CRD A;  4K5S A;  1XCC A;  4HEA 2;  4MJC A;  3GN3 A;  3L9U A;  4G0L A;  3SBC A;  3LSZ A;  5IIZ A;  4QL7 A;  3DD3 A;  2LJK A;  1GUK A;  2VIM A;  3GYK A;  3ZMK A;  5G30 A;  2YZH A;  2HZE A;  2OJL A;  3IXR A;  4WF4 A;  5ID2 B;  1SL1 B;  2H1B A;  1XW5 A;  3D21 A;  5HFK A;  1IYH A;  3WGD A;  4Z2U A;  2HRK A;  3D4M A;  1GSE A;  1MEK A;  3F4T A;  1NHY A;  1GSQ A;  4EF0 A;  2GZZ A;  4KF9 A;  3VWV A;  5IQY A;  1YKC A;  3EU3 A;  5ECI B;  5ECP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...