2V1MA

Crystal structure of schistosoma mansoni glutathione peroxidase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
163
structure length
162
Chain Sequence
SWNSIYEFTVKDINGVDVSLEKYRGHVCLIVNVACKGATDKNYRQLQEMHTRLVGKGLRILAFPCNQFGGQEPWAEAEIKKFVTEKYGVQFDMFSKIKVNGSDADDLYKFLKSRQHGTLTNNIKWNFSKFLVDRQGQPVKRYSPTTAPYDIEGDIMELLEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE PEROXIDASE
publication title Combining Crystallography and Molecular Dynamics: The Case of Schistosoma Mansoni Phospholipid Glutathione Peroxidase.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 64
structure length 162
sequence length 163
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2008-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2v1mA00
4O7HA 1TJDA 5HR3A 1EEMA 1FO5A 4MZBA 4DEJA 1X5DA 1ACVA 3TOTA 2LJKA 5IIZA 2WDUA 1J08A 1K0AA 4N11A 2C3QA 2DIYA 4KA0A 2B5YA 2K8VA 5CYYA 3H4KA 1XZOA 5ELGA 1GSUA 4BA7A 4WF5A 4YAVA 5ECSA 2HI7A 4WBRD 4DSRA 3D22A 1BG5A 1KEBA 2HYXA 1WIKA 4ZILA 4WBJA 2WB9A 3HVXA 2VCQA 2IPAA 3EE2A 2VLVA 4XRDA 5COHA 4GLTA 2FA4A 3LYKA 2O7KA 3VWVA 3TKPA 1U6TA 1AW9A 3GTUB 3PH9A 2VM2A 1EGRA 1T1VA 2P0GA 3AY8A 4XS1A 1XIYA 3IXRA 4OCEA 2HT9A 1ILOA 2HRFA 4OO4A 4ECJA 3ZL5A 2LNTA 4NAXA 4HU9A 1T00A 2IFQB 3GYKA 2RUEA 4PNFA 4NPBA 1TRUA 4OWYA 4JU5A 2H1BA 4HJ2A 2FUG2 4MPFA 2GTUA 4NXIA 1BQ7A 4OFTA 2YWMA 4X1UA 1PL1A 4LL1B 17GSA 20GSA 2VL2C 1R7HA 3QR6A 2P5RA 2OBIA 2XBIA 4BVYA 2BMXA 3ZMKA 2FCHA 2P31A 3DWVA 5ECNB 3TRPA 3W6GA 1AUCA 3BJ5A 3TUEA 1IYHA 1R5PA 3Q6OA 1GUMA 2HZEB 2FWHA 4GRFA 1G7EA 1HNBA 3F6FA 2AJQB 5F05A 2L4QA 1GNEA 3L9VA 4ZXGA 2L6CA 2E2MA 4ZL7A 4PXOA 3O76A 5KN0A 3O6TA 5J4UA 1ZOFA 3I9V2 3TJGA 1B48A 1QK8A 2IFQA 3KEBA 2H0GA 4XIHA 4D73A 1SENA 2H8LA 3IC4A 2X8HA 2R2JA 1XW9A 3F9UA 4OO5A 3LEFA 6GSWA 2LRNA 1PA3A 1T4ZA 3C8EA 4PGTA 2H72A 1TDIA 2GT6A 4DSSB 1U3AA 4QQ7A 4Q5QA 2RUFA 4ZL8A 1V98A 3UBLA 3VI7A 1U3IA 4ML6A 3G7JA 3ZIVA 2DJ0A 1PRXA 4YH2A 5G1LA 2LJRA 3IK7A 5G1KA 22GSA 3TDGA 4HZ4A 3TKRA 6GSVA 3VLNA 3UL3A 1SL1B 3DEXA 2WFCA 1Z3EA 2PN8A 4HU7A 5A4WA 3P8WA 3HVVA 5IMZA 5DJLA 5J9CA 1BEDA 2JL4A 2H0IA 1XPVA 2R3XA 3F3RA 5AIVA 5IQYA 2B7KA 4J57E 1VRSD 4XRAA 1G0TA 5E59A 4GTUA 4K7IA 4QL9A 2EIOA 5B8BA 5GSTA 3APSA 3M3MA 2C80A 2IWTA 1B8XA 1FG4A 2VL3A 1S3DA 1OKTA 3GIXA 4TR3A 16GSA 1YF1A 4MF5A 1PD21 1K0BA 1GSEA 4GSNA 5ECPB 4K0NA 1GH2A 2ALBA 5EY6A 1OYJA 3RHCA 8GSSA 1ZL9A 3RAZA 4EE0A 2GT5A 2JZTA 2YNXA 5IPHA 3RPPA 4WF4A 3QAWA 1GLPA 4OFNA 2YOIA 1OC3A 3IV4A 3VPTA 3I69A 1FW1A 3UEMA 4E8EA 4X43A 2J9HA 3QPMA 4FYCA 1BJXA 2I9HA 4L5LA 4O92A 3FR3A 1K0CA 3D4TA 2H30A 1SD8A 1VF1A 3H1NA 1EEJA 3JCML 3W8JA 5D96A 4YQUA 5IMVA 4EDZA 3C1SA 5ECMB 2O87A 3QD9A 1G6WA 1K3LA 5AIXA 3KCMA 5A4VA 4I8BA 2M46A 1FOVA 1RQMA 2AB6A 2QSIA 2CVBA 3OR5A 1XW5A 1QXHA 1ZYQB 5A4UA 3IR4A 3LYPA 2I81A 1TKDB 1GTBA 3HKRA 1MD3A 3KXOA 1U87A 1X0RA 2CVDA 5ECRB 2DJKA 5HFGA 1A0FA 1JLWA 1AXDA 1O6JA 2VIMA 2B1LA 4YQMA 4GWRA 2HXKA 2IMEA 2LQOA 4MF6A 3MNGA 4PX1A 5ECQB 2N5AA 2MBTA 1A2LA 1SD9A 3WD6A 2C0DA 4ZB6A 1Z6MA 2WULA 3F6DA 5G30A 1WMJA 2C3NA 2ZCTA 1URMA 2N5FA 1ZCPA 3GKNA 3DKSA 19GSA 2EIRA 3WT2A 3HA9A 3UVHA 4G19A 3HJMA 1PX6A 3SBCA 2DMLA 1YKAA 1RK4A 5ENUA 5B6NA 4I6XA 2VCTA 1V57A 2XPDA 3MDKA 4KB3A 2FHEA 2MMOA 1T4YA 4EF0A 4L0WA 4ZB9A 4WEYA 2ES7A 1UN2A 2JZRA 1AAZA 2H71A 3TRXA 2HSYA 2FY6A 5D9XA 1Q98A 4JBBA 3IBHA 2F8AA 2JZSA 3ERWA 3HYPA 3GA4A 3EURA 5DCHA 1DBYA 3HDCA 4YAPA 4K8MA 1W4VA 2A2RA 1GUKA 3F4SA 2PUKC 1THOA 2LS5A 3TJJA 3ISOA 3D21A 1F37A 4XS6A 3ERGA 1A23A 2CT6A 5DAKA 5JWQB 1LBKA 3Q19A 5B7CA 3EINA 2MMAA 1S3AA 4K6XA 1Y25A 2M80A 2L59A 4XHMA 1W89A 1CQHA 1YEXA 2GSTA 3L4NA 1EOGA 2L5LA 4K9ZA 2QGVA 1F2EA 2VCWA 2RM5A 4NHZA 4TOPA 1JZDA 3LFLA 4RQRA 5CO3A 1UA5A 1ERVA 1RW1A 3ZITA 4KGIA 1J0FA 1X9MB 4MZCA 4KDUA 1GNWA 2PMTA 3ERFA 3FK8A 2DC5A 1GSYA 1ST9A 2VCXA 2R37A 4G9HA 4ZIJA 4JR6A 6GSUA 2WJUA 5IO0A 4MJAA 1X5CA 4TKYA 4JE1A 1JLVA 3ZTLA 4ACSA 1FB6A 4ZBAA 4HQZA 1NM3A 1O81A 2DIZA 1NW2A 1GSSA 1GSDA 3S9FA 1KNGA 4GSTA 2FWGA 4AGSA 1MEKA 1SKWB 2F9SA 3BCKA 1YQ1A 3ME8A 2O8VB 3RHBA 1SL2B 3KTBA 2R5GA 1ERWA 3PINA 6GSTA 2OE0A 1PGTA 2YCDA 4DSQA 2CZ3A 2VM1A 2XPEA 3Q18A 4FIWA 1B4QA 4DVCA 1Z6NA 1YF0A 3DIEA 4TN8A 3L78A 3F3QA 3NOFA 1PMTA 3ZZXA 4L0UA 1SK2A 5IO2A 1TU7A 1TTZA 1SYXA 4EDYA 2IJYA 4I97A 2PVQA 2ON7A 5AISA 1TK8B 3KP8A 4ILFA 2KP1A 1ZGNA 3R2QA 1V9WA 2G2QA 2X8GA 1AQXA 1MTCA 5ABRA 3D5JA 1XXUA 4AJ8A 3DVWA 2B3SA 2GS3A 5F0GA 4I2UA 3P90A 4MF7A 5HFIA 2PGTA 2WZ9A 4TXOB 2MMNA 5FT3A 3GSSA 1MD4A 3VFIA 3GMFA 4ZBDA 1JZWA 1DSBA 3CSIA 4HQSA 2H19A 1FAAA 2VOCA 3WGXA 4EUYA 4ISDA 4V2LA 4D73B 3CYNA 2VCZA 1Y6EA 5F8BA 2MMZA 4KE3A 2VCVA 4G10A 3GX0A 1QUWA 2I3YA 1Z9HA 1SJIA 4XS4A 1AC1A 3A2XA 3VK9A 2C0GA 4OFMA 5HR1A 5ELAA 3CSJA 1GUHA 1SYRA 2OKAA 4EO3A 13GSA 2JU5A 2V41A 3NIVA 2CQ9A 3ZLPA 5D9TA 2WGRA 4PUFC 1BAYA 4MH3A 3VPQA 2R6KA 1VF2A 4KX4A 1PKWA 2H73A 5LCZA 2IMDA 2DJJA 4G2EA 3GUSA 4JRRA 5H5RA 4IKHA 3D4MA 4TXOA 3FHKA 3M9KA 4NMUA 2F51A 1WJKA 3RPNA 4ECCA 2FLSA 2K18A 1H75A 4MH2A 2CAIA 2DLXA 2H6ZA 2XC2A 1R4WA 5ECHB 2OJLA 1H4OA 3KP9A 1I9DA 1TK0B 3D6IA 2HNLA 2GDRA 1F6MC 4EVMA 3EYTA 1OE8A 3QFAC 2TIRA 2DMMA 3FY7A 4J2FA 4FYUA 3WT1A 18GSA 3C73A 4JEDA 2YP6A 1EGOA 2MZCA 3LORA 3HXSA 3KMNA 5KN2A 1WPIA 4MA9A 1QFNA 2K9FA 2GVPA 1TXXA 4LLRA 4Q5FA 5DALB 1X9SB 4X0XA 3TOUA 5IMDA 4ECBA 3GKXA 1K0NA 4GQFA 1A2JA 2EIQA 5FWGA 2H70A 4NV2A 2VLUA 5L71A 1O7UA 2C3TA 4KSOA 3US3A 3FZ5A 1T7PB 1A24A 1MDIA 3DXBA 4Z7XA 2PERA 4MABA 2YPMA 2QC7A 1V58A 1HNAA 3U5RE 10GSA 5IMCA 5IMFA 5H5QA 4F2IA 3EVIA 4HJMA 3ME7A 4Q5NA 3FZAA 1O85A 1XW6A 3DRNA 3IOSA 3QDNA 2FGXA 4AJ7A 3FW2A 3IAS2 1DUGA 3F0IA 2L57A 1TK5B 1WE0A 3A3TA 2IMFA 3EC3A 3KM6A 4MK3A 2E7PA 4TVEA 2WCIA 3ZVJD 3LXTA 1UC7A 3IRAA 3CRUA 4TXVA 4WXTA 2I4AA 5DALA 1FHEA 1XBSA 3BOAA 4KUNA 5ECLB 3FZ4A 1TRWA 1GWCA 3ZRDA 1TI3A 2V6OA 5F07A 5F06A 1O8XA 1SL0B 5A5KA 3HY2A 4TR0A 2H01A 1X5EA 4PQIA 3U6VA 1WOUA 3M1GA 4RI7A 3FR6A 4XCSA 3KGKA 3FYGA 5JWOB 4POMA 2B5EA 3QAGA 2AYTA 2JADA 11GSA 4J56E 1E6BA 5H5SA 2E0QA 1B9XC 4IJIA 1F3BA 4EC0A 3K8NA 2OADA 14GSA 5G5EA 5G2ZA 4O5RA 3GRXA 1XWGA 3A2VA 3SWLA 1MDJA 3QFBC 1A2MA 2YZUA 2J23A 1HNCA 2VLTA 2NVLA 1EWXA 5HFKA 5DQYA 1O8WA 2C0EA 1SJZA 4MPGA 3GKMA 5EL8A 1V40A 5D8IA 1VF3A 1XFLA 1EOHA 3UBKA 2V32A 1GRXA 1XCCA 4CW9A 3FZ9A 1XWCA 2H1GA 2YV7A 1C72A 2H75A 6GSYA 4K7OA 2GQKA 5DAKB 3E9JB 3IA1A 2OE1A 4KDXA 5GZZB 5ID2B 3J7Yk 2LRTA 1GSFA 4IN0A 4ID0A 3MSZA 1X9WB 2N5BA 3TJFA 1OE7A 3F8UA 2V2GA 2O89A 2OA7A 2PVOC 1PN9A 2ZUPA 4KCAA 3VI5A 3VWUA 3GV1A 4IJ3A 2H66A 3MAKA 4AF2A 3V1WA 4PNGA 3KH7A 1B9YC 4KNDA 5CAXA 3ZMLA 4AJ6A 3TRQA 2VAFA 3FKFA 2HSHA 6GSSA 1U88A 3KZQA 2EC4A 3ZFBA 2FWEA 3RBTA 4K1FA 1M0UA 4PUAA 5IOWA 3P7XA 2QKEA 1A0RP 4ML1A 3HZ8A 4PQ1A 3MWHA 1YKCA 4FYBA 4P3YB 1SKSB 2NPBA 2G0FA 4IQ1A 5GAPD 2E2GA 4WKWA 5GAND 2PWJA 3GX8A 3L0HA 3GH9A 2VL9A 4HDEA 4ZL9A 1M9AA 2NDOA 2M72A 1EP8A 1R5AA 3GL3A 4BVXA 1BX9A 2GZZA 5ID2A 4LMVA 3LSZA 3UIWA 2LKUA 3UVTA 2TRCP 4HEA2 2LUSA 2D2ZA 4MCUA 1QGVA 3N5OA 4GSSA 2YJ7A 1ABAA 2YJHA 3M0FA 1N2AA 4IP1A 2GGTA 4ZB8A 4KAEA 1QQ2A 1T3BA 2VUPA 4KW6A 2YN1A 2VL2A 2IIYA 3WGDA 3QMXA 2X99A 3APQA 2I1UA 1GTAA 3DVXA 2LEGA 4POBA 1B4PA 1V2AA 5AGYA 4CHSA 1JFUA 1XWAA 2AV4A 4IS0A 2GSQA 1GLQA 2MYGA 2BTOT 1JHBA 1NHYA 3TKSE 1JZRA 2KOKA 2PU9C 1SJ6A 2C8UA 3A5WA 4XS4B 1TP9A 2H76A 1WP0A 5ECOB 2WS2A 2GQLA 3FEUA 2GZYA 4L5OA 5IM9A 1XWBA 3GN3A 2IN3A 3IPZA 2YANA 1GP1A 3HJPA 4LMWA 3I6AA 3TJKA 3CSHA 3H79A 2YV9A 3GHAA 3RDWA 2VD0A 1PKZA 3H8QA 3G9BA 2GLRA 2KHPA 1M7TA 4POKA 5CREA 1ZZYA 1M2DA 1XVQA 4IBPA 3EU4A 5B8AA 4GF0A 4FO5A 4TR1A 2GSSA 4K0GA 1TW9A 5C04A 1K3OA 3PR8A 2LRCA 3DYRA 4V2MA 4BL7A 1DE2A 1Q4JA 2BJXA 2HZFA 2VO4A 3VWWA 4IVFA 2ON5A 5D9VA 2YWNA 2TRXA 5HR2A 1K0MA 1PSQA 3IHQA 5IPGA 5CNWA 1USBA 5DDLA 4F82A 3J7Yb 3H93A 2OACA 1M9BA 3UMAA 2LQQA 2GSRA 3EU3A 3C71A 2HE3A 1OAZA 1YDKA 4YQVA 3TJBA 2X8CA 3UJ1A 4WETA 4EKZA 1XVWA 5LNKe 3QAVA 3VURA 4TRXA 1EZKA 1A8LA 5C00A 3D0ZA 3L9UA 5G5FA 1IYIA 5IOXA 1HQOA 2FD3A 2F8FA 3GTUA 1ON4A 5E4WA 4KCEA 2GQMA 3ED3A 3WYWA 5JCGA 2O85A 2WRTA 1KBNA 3CTGA 2L6DA 4NV5A 3O3TA 4HOJA 3W8SA 1K0DA 1UVZA 1LJRA 1OKDA 2REMA 3BD2A 4GXZA 1GTIA 5D73A 4F9ZA 4O32A 1SK0A 5DVBA 3TB2A 3CTFA 2PPTA 3IDVA 12GSA 5D9WA 4OCFA 1OC8A 1J9BA 1ERTA 2JACA 7GSSA 1AQVA 1G6YA 1KTEA 4MP4A 2V6KA 1TOFA 1TI1A 4N0ZA 3I43A 3FRCA 4ZBBA 2OE3A 1FB0A 3KD0A 1YEPA 2AHEA 1S3CA 4WR5A 3LQ7A 5J3RA 4IQAA 1TRSA 2DJ3A 2HRNA 3ZVJA 3M8NA 4Q5RA 2LTKA 2H0HA 2PBJA 2HZEA 4NHWA 2FA8A 2V1MA 3VWXA 2ZNMA 4JZQA 1NSWA 4TW5A 1HD2A 3IE3A 5ECIB 5B6MA 3CXGA 4MJBA 2GZPA 3HD5A 3IAM2 1ML6A 3TGZA 4RUVA 2IMKA 5HR0A 4V1Ap 2K6VA 4IHUA 4N30A 2OBKA 1SK1A 2L4CA 2CX3A 5J41A 2LNSA 1OVNA 1XOBA 5AN1A 3NZNA 5ECKB 3HVSA 5J5NA 1WWJA 1M2BA 1XOAA 5FHIA 1QMVA 4MDCA 4NWYA 4MLYA 2HFDA 3F4TA 4HZ2A 1CQGA 1NHOA 9GSSA 2H1DA 2YZHA 4DSSA 5DJMA 2C0FA 4BPYA 1Z7PA 1GSQA 3TKQA 2X64A 3HCZA 4RI6A 5HQPA 5IMAA 1G7OA 4MMMA 2A4VA 2B7JA 4EXJA 5EPFA 3WGEA 4KH7A 2DSAA 1M99A 3KTLA 2NBSA 4OMVA 3ZREA 5EVOA 1Z7RA 4QL7A 1N8JA 3G7YA 3KH9A 3GFKA 4HI7A 2JSZA 4IGJA 1DE1A 5CRWA 4E8HA 1F9MA 4BWSA 3TKSA 2IL3A 3DD3A 4POLA 2YWOA 1PL2A 4KSMA 2H74A 1F3AA 4F0CA 3C1RA 2RIIA 3HZ4A 1R26A 2LV3A 5CRGA 4EL1A 3ZFLA 4PQHA 2FWFA 1VF4A 4LA1A 5KN3A 1TRVA 2HLSA 4BWQA 2NTOA 4WR4A 5LD0A 3L9SA 3CRTA 4KDYA 3G7IA 1EP7A 1E2YA 1T8EB 4CDOA 1LU4A 1EV9A 2CX4A 3BCIA 2LJAA 3M9JA 3CMIA 3F63A 3GL5A 2DBCA 3UAPA 4FH8A 1OC9B 1JZOA 2DJ1A 5CP1A 5G31A 4MJCA 2A2SA 4N10A 3KMOA 3P2AA 5KEJA 2CV4A 4V2NA 2MBSA 4IP6A 1PQNA 2B5XA 5CRHA 1K3YA 2RM6A 2KP2A 2R4VA 1YZXA 4MJEA 4F0BA 3HJOA 3N9JA 5INYA 3GURA 3CBUA 5CRDA 2L5OA 2H1AA 1WRYA 2XHFA 5DQSA 4I2TA 1Z5YE 3QOUA 1XWKA 4LL4B 4XTSA 2CA8A 3GKKA 2F3MA 2B1KA 3EWLA 2H6XA 2H6YA 3E0UA 6GSXA 1YJ6A 1AQWA 3C7MA 1ZYEA 3LJRA 1FVKA 3ZYWA 1SKRB 3GH6A 5JCUA 2CZ2A 5KN1A 4GCIA 3KIJA 4V1Ag 1A8YA 4IW9A 3EMPA 3TCOA 4I5QA 1ZMAA 4F03A 3GNJA 3LGCA 5JWRB 3EMXA 3KJYA 4IELA 3LXZA 3ZIJA 2AAWA 1OC9A 2IMIA 3DMLA 4ULXA 1FVJA 1SU9A 1O73A 1GL8A 2P5QA 4RQXA 3UOMA 3DGQA 2RLIA 1THXA 2CAQA 4HS1A 2YWIA 4GQCA 1MDKA 4OD7A 3QCPA 1HYUA 1AIUA 5DBQA 1TU8A 4H86A 1I5GA 1PX7A 1EV4A 3A2WA 1K0OA 1YY7A 3Q74A 4JR4A 5J9BA 3BBYA 1GULA 4L8EA 3TKSC 4K7NA 2JSYA 3F4RA 2B6MA 2K8SA 5D93A 1BYEA 3LG6A 4PURA 2VD1A 2C4JA 2KLXA 3UARA 2Z9SA 4N0VA 3E3EA 4MZWA 3IK9A 2KUCA 2LSTA 1GTUA 2AUVA 4ECIA 2DJ2A 3GSTA 4K2DA 2XBQA 2FNOA 5JCWA 3APOA 4TR1B 3FR9A 3HHVA 5DCGA 1ERUA 1M2AA 2C1YA 3PGTA 4HUAA 2CVKA 1VGLA 4TR4A 3LWAA 5GSSA
chains in the Genus database with same CATH superfamily
4O7HA 1TJDA 4BL7B 5HR3A 1EEMA 1FO5A 4MZBA 4DEJA 1X5DA 3LW9A 1ACVA 3TOTA 2LJKA 5IIZA 2WDUA 5BRTA 1J08A 1K0AA 4N11A 2C3QA 2DIYA 4KA0A 2B5YA 2K8VA 5CYYA 3H4KA 1XZOA 5ELGA 1GSUA 4BA7A 4WF5A 4YAVA 4G0KA 5ECSA 2HI7A 4WBRD 4DSRA 3D22A 4BVYB 1BG5A 1KEBA 2HYXA 1WIKA 4ZILA 4WBJA 2WB9A 3HVXA 2VCQA 2IPAA 3EE2A 2VLVA 4XRDA 5COHA 4GLTA 3HVNA 2FA4A 3LYKA 2O7KA 3VWVA 3TKPA 1U6TA 1AW9A 3GTUB 3PH9A 2VM2A 1EGRA 1T1VA 2P0GA 3AY8A 4XS1A 1XIYA 3IXRA 4OCEA 2HT9A 1ILOA 2HRFA 4OO4A 4ECJA 3ZL5A 4MNNA 2LNTA 4NAXA 4HU9A 1T00A 2IFQB 3GYKA 2RUEA 4PNFA 4NPBA 1TRUA 4OWYA 4JU5A 2H1BA 4HJ2A 2FUG2 4MPFA 2GTUA 4NXIA 1BQ7A 4OFTA 2YWMA 4X1UA 1PL1A 2DKHA 4LL1B 17GSA 20GSA 2VL2C 1R7HA 3QR6A 2P5RA 2OBIA 2XBIA 4BVYA 2BMXA 3ZMKA 2FCHA 2P31A 3DWVA 5ECNB 3TRPA 3W6GA 1AUCA 3BJ5A 3TUEA 1IYHA 1R5PA 3Q6OA 1GUMA 2HZEB 2FWHA 4GRFA 1G7EA 1HNBA 3F6FA 2AJQB 5F05A 2L4QA 1GNEA 3L9VA 4ZXGA 2L6CA 2E2MA 4ZL7A 4PXOA 1S3RA 3O76A 5KN0A 3O6TA 5J4UA 1ZOFA 3I9V2 3TJGA 1B48A 1QK8A 2IFQA 3KEBA 2H0GA 4XIHA 4D73A 1SENA 2H8LA 3IC4A 2X8HA 2R2JA 1XW9A 3F9UA 4OO5A 3LEFA 6GSWA 2A4HA 2LRNA 1PA3A 1T4ZA 3C8EA 4PGTA 2H72A 1TDIA 4EIQA 2GT6A 4DSSB 1U3AA 4QQ7A 1M3JA 4Q5QA 4BIKA 2RUFA 4ZL8A 1V98A 3UBLA 3VI7A 1U3IA 4ML6A 3G7JA 3ZIVA 2DJ0A 1PRXA 4YH2A 5G1LA 2LJRA 3IK7A 5G1KA 22GSA 1PFOA 3TDGA 4HZ4A 4K5RA 3TKRA 6GSVA 1ZYPA 3VLNA 3UL3A 1SL1B 3DEXA 2WFCA 1Z3EA 2PN8A 4HU7A 5A4WA 3P8WA 3HVVA 5IMZA 1FOHA 5DJLA 5J9CA 1BEDA 3R3EA 2JL4A 2H0IA 1XPVA 2R3XA 3F3RA 5AIVA 5IQYA 2B7KA 4J57E 4PTSA 1VRSD 4XRAA 1G0TA 5E59A 4GTUA 4K7IA 4QL9A 2EIOA 5B8BA 5GSTA 3APSA 3M3MA 2C80A 2IWTA 1B8XA 1FG4A 2VL3A 1S3DA 1OKTA 3GIXA 4TR3A 16GSA 1YF1A 4MF5A 1PD21 1K0BA 1GSEA 4GSNA 5ECPB 4K0NA 1GH2A 2ALBA 5EY6A 1OYJA 3RHCA 8GSSA 1ZL9A 3RAZA 4EE0A 2GT5A 2JZTA 2YNXA 5IPHA 4FQUA 3RPPA 4WF4A 3QAWA 1GLPA 4OFNA 2YOIA 1OC3A 3IV4A 3VPTA 3I69A 1FW1A 3UEMA 4E8EA 4X43A 2J9HA 3QPMA 4FYCA 1BJXA 2I9HA 4L5LA 4O92A 3FR3A 1K0CA 3D4TA 2H30A 1SD8A 1VF1A 3H1NA 1EEJA 3JCML 4EIPA 3W8JA 5D96A 4YQUA 5IMVA 4EDZA 3C1SA 5ECMB 2O87A 3QD9A 1G6WA 1K3LA 5AIXA 4K2XA 3KCMA 5A4VA 4I8BA 2M46A 1FOVA 1RQMA 2AB6A 2QSIA 2CVBA 3OR5A 1XW5A 1QXHA 1ZYQB 5A4UA 3IR4A 3LYPA 2I81A 1TKDB 1GTBA 3HKRA 1MD3A 3KXOA 1U87A 1X0RA 2CVDA 5BMUA 5ECRB 2DJKA 5HFGA 1A0FA 1JLWA 1AXDA 1O6JA 2VIMA 2B1LA 4YQMA 4GWRA 2HXKA 2IMEA 2LQOA 4MF6A 3MNGA 4PX1A 5ECQB 2N5AA 2MBTA 1A2LA 1SD9A 3WD6A 2C0DA 4ZB6A 1Z6MA 2WULA 3F6DA 5G30A 1WMJA 2C3NA 2ZCTA 4Z2RA 1URMA 2N5FA 1ZCPA 3GKNA 3DKSA 19GSA 2EIRA 3WT2A 3HA9A 3UVHA 4G19A 3HJMA 1PX6A 3SBCA 2DMLA 2HRAA 1YKAA 1RK4A 5ENUA 5B6NA 4I6XA 2VCTA 1V57A 2XPDA 3MDKA 4KB3A 2FHEA 2MMOA 1T4YA 4EF0A 4L0WA 4ZB9A 4WEYA 2ES7A 1UN2A 2JZRA 1AAZA 2H71A 3TRXA 4Z2UA 2HSYA 2R0GA 2FY6A 5D9XA 1Q98A 4JBBA 3IBHA 2F8AA 2JZSA 3ERWA 3HYPA 3GA4A 3EURA 5DCHA 1DBYA 3HDCA 4YAPA 4K8MA 1W4VA 2A2RA 1GUKA 3F4SA 2PUKC 1THOA 2LS5A 3TJJA 3ISOA 3D21A 1F37A 4XS6A 3ERGA 1A23A 2CT6A 5DAKA 5JWQB 1LBKA 3Q19A 5B7CA 3EINA 2MMAA 4YKFA 1S3AA 4K6XA 1Y25A 2M80A 1M3IA 2L59A 4XHMA 1W89A 1CQHA 1YEXA 2GSTA 3L4NA 1EOGA 2L5LA 4CY8A 4K9ZA 1XG8A 2QGVA 1F2EA 2VCWA 2RM5A 4NHZA 4TOPA 1JZDA 3LFLA 4RQRA 5CO3A 1UA5A 1ERVA 1RW1A 3ZITA 4KGIA 1J0FA 1X9MB 4MZCA 4KDUA 1GNWA 2PMTA 3ERFA 3FK8A 2DC5A 1GSYA 1ST9A 2VCXA 2R37A 4G9HA 4ZIJA 4JR6A 6GSUA 2WJUA 5IO0A 4MJAA 1X5CA 4TKYA 4JE1A 1JLVA 3ZTLA 4ACSA 1FB6A 4ZBAA 4HQZA 1NM3A 1O81A 2DIZA 1NW2A 1GSSA 1PN0A 1GSDA 3S9FA 1KNGA 4GSTA 2FWGA 4AGSA 1MEKA 1SKWB 2F9SA 3BCKA 1YQ1A 3ME8A 2O8VB 2A2PA 3RHBA 1SL2B 3KTBA 2R5GA 1ERWA 3PINA 6GSTA 2OE0A 1PGTA 2YCDA 4DSQA 2CZ3A 2VM1A 2XPEA 3Q18A 4FIWA 1B4QA 4DVCA 1Z6NA 1YF0A 3DIEA 4TN8A 3L78A 3F3QA 3NOFA 1PMTA 3ZZXA 4L0UA 1SK2A 5IO2A 1TU7A 1TTZA 1SYXA 4EDYA 2IJYA 4I97A 2PVQA 2ON7A 5AISA 1TK8B 3KP8A 4ILFA 2KP1A 1ZGNA 3R2QA 1V9WA 2G2QA 2X8GA 1AQXA 1MTCA 2QA1A 5ABRA 3D5JA 1XXUA 4AJ8A 3DVWA 2B3SA 2GS3A 5F0GA 4I2UA 3P90A 4MF7A 5HFIA 2PGTA 2WZ9A 4TXOB 2MMNA 5FT3A 3GSSA 1MD4A 3VFIA 3GMFA 4ZBDA 1JZWA 1DSBA 3CSIA 4HQSA 2H19A 1FAAA 2VOCA 3WGXA 4EUYA 4ISDA 4V2LA 4D73B 3CYNA 2VCZA 1Y6EA 5F8BA 2MMZA 4KE3A 2VCVA 4G10A 3GX0A 1QUWA 2I3YA 1Z9HA 1SJIA 4XS4A 1AC1A 3A2XA 3VK9A 2C0GA 4OFMA 5HR1A 5ELAA 3CSJA 1GUHA 1SYRA 2OKAA 4EO3A 13GSA 3PPUA 2JU5A 2V41A 3NIVA 2CQ9A 3ZLPA 5D9TA 2WGRA 4PUFC 1BAYA 4MH3A 3VPQA 2R6KA 1VF2A 4KX4A 1PKWA 2H73A 5LCZA 2IMDA 2DJJA 4G2EA 3GUSA 4JRRA 5H5RA 4IKHA 3D4MA 4TXOA 3FHKA 3M9KA 4NMUA 2F51A 1WJKA 3RPNA 4ECCA 2FLSA 2K18A 3A5IA 1H75A 4MH2A 2CAIA 2DLXA 2H6ZA 2XC2A 1R4WA 5ECHB 2OJLA 1H4OA 3KP9A 1I9DA 1TK0B 3D6IA 2HNLA 2GDRA 1F6MC 4EVMA 3EYTA 1OE8A 3QFAC 2TIRA 2DMMA 3FY7A 4J2FA 4FYUA 3WT1A 18GSA 3C73A 4JEDA 2YP6A 1EGOA 2MZCA 3LORA 3HXSA 3KMNA 5KN2A 1WPIA 4MA9A 1QFNA 2K9FA 2GVPA 1TXXA 4LLRA 4Q5FA 5DALB 1X9SB 4X0XA 3TOUA 5IMDA 4ECBA 3GKXA 1K0NA 2QA2A 4GQFA 4A5PA 1A2JA 2EIQA 5FWGA 2H70A 4NV2A 2VLUA 5L71A 1O7UA 2C3TA 4KSOA 3US3A 3FZ5A 1T7PB 1A24A 1MDIA 3DXBA 4Z7XA 2PERA 4MABA 2YPMA 2QC7A 1V58A 1HNAA 3U5RE 10GSA 3IC8A 5IMCA 5KOWA 5IMFA 5H5QA 4F2IA 3EVIA 4HJMA 3ME7A 4Q5NA 3FZAA 1O85A 1XW6A 3DRNA 3IOSA 3QDNA 2FGXA 4AJ7A 3FW2A 3IAS2 1DUGA 3F0IA 4G0LA 2L57A 5KOXA 1TK5B 1WE0A 3A3TA 2IMFA 3EC3A 3KM6A 4MK3A 2E7PA 4TVEA 4O5QA 2WCIA 3ZVJD 3LXTA 1UC7A 3IRAA 3CRUA 4TXVA 4WXTA 2I4AA 5DALA 1FHEA 1XBSA 3BOAA 4KUNA 5ECLB 3FZ4A 4ICYA 1TRWA 1GWCA 3ZRDA 1TI3A 2V6OA 5F07A 5F06A 1O8XA 1SL0B 5A5KA 3HY2A 4TR0A 2H01A 1X5EA 4PQIA 4HSCX 3MIXA 3U6VA 1WOUA 3M1GA 4RI7A 3FR6A 4XCSA 3KGKA 3FYGA 5JWOB 4POMA 2B5EA 3QAGA 2AYTA 2JADA 11GSA 4J56E 1E6BA 5H5SA 2E0QA 1B9XC 4IJIA 1F3BA 4EC0A 3K8NA 2OADA 14GSA 5G5EA 5G2ZA 4O5RA 3GRXA 1XWGA 3A2VA 3SWLA 1MDJA 3QFBC 1A2MA 2YZUA 2J23A 1HNCA 2VLTA 2NVLA 1EWXA 5HFKA 5DQYA 1O8WA 2C0EA 4G0IA 1SJZA 4MPGA 3GKMA 5EL8A 1V40A 5D8IA 1VF3A 1XFLA 1EOHA 3UBKA 2V32A 1GRXA 1XCCA 4CW9A 3FZ9A 1XWCA 2H1GA 2YV7A 1C72A 2H75A 6GSYA 4K7OA 2GQKA 5DAKB 3E9JB 3IA1A 2OE1A 4BVXB 4KDXA 5GZZB 5ID2B 3J7Yk 2LRTA 1GSFA 4IN0A 4ID0A 3MSZA 1X9WB 2N5BA 3TJFA 1OE7A 3F8UA 2V2GA 2O89A 2OA7A 2PVOC 1PN9A 2ZUPA 4KCAA 3VI5A 3VWUA 3GV1A 4IJ3A 2H66A 3MAKA 4AF2A 3V1WA 4PNGA 3KH7A 1B9YC 4KNDA 5CAXA 3ZMLA 4AJ6A 3TRQA 2VAFA 3FKFA 2HSHA 6GSSA 1U88A 3KZQA 2EC4A 3ZFBA 2FWEA 3RBTA 4K1FA 1M0UA 4PUAA 5IOWA 3P7XA 2QKEA 1A0RP 4ML1A 3HZ8A 4PQ1A 3MWHA 1YKCA 4FYBA 4P3YB 1SKSB 2NPBA 2G0FA 4IQ1A 5GAPD 2E2GA 4WKWA 5GAND 2PWJA 3GX8A 3L0HA 3GH9A 2VL9A 4HDEA 4ZL9A 1M9AA 2NDOA 2M72A 1EP8A 1R5AA 3GL3A 4BVXA 1BX9A 2GZZA 5ID2A 4LMVA 3LSZA 3UIWA 2LKUA 3UVTA 2TRCP 4HEA2 2LUSA 2D2ZA 4MCUA 2UZ8A 1QGVA 3N5OA 4GSSA 2YJ7A 1ABAA 2YJHA 3M0FA 1N2AA 4IP1A 2GGTA 4ZB8A 4KAEA 1QQ2A 1T3BA 2VUPA 4KW6A 2YN1A 2VL2A 2IIYA 3WGDA 3QMXA 2X99A 3APQA 2I1UA 1GTAA 3DVXA 2LEGA 4POBA 1B4PA 1V2AA 5AGYA 4CHSA 1JFUA 1XWAA 2AV4A 4IS0A 2GSQA 1GLQA 2MYGA 2BTOT 1JHBA 1NHYA 3TKSE 1JZRA 2KOKA 2PU9C 1SJ6A 2C8UA 3A5WA 4XS4B 1TP9A 2H76A 1ZYNA 1WP0A 5ECOB 2WS2A 2GQLA 3FEUA 2GZYA 4L5OA 5IM9A 1XWBA 3GN3A 2IN3A 3IPZA 2YANA 1GP1A 3HJPA 4LMWA 3I6AA 3TJKA 3CSHA 3H79A 2YV9A 3GHAA 3RDWA 2VD0A 3MYDA 1PKZA 3H8QA 3G9BA 2GLRA 2KHPA 1M7TA 4POKA 5CREA 1ZZYA 1M2DA 1XVQA 4IBPA 3EU4A 5B8AA 4GF0A 4FO5A 4TR1A 2GSSA 4K0GA 1TW9A 5C04A 1K3OA 3PR8A 2LRCA 3DYRA 4V2MA 4BL7A 1DE2A 1Q4JA 4USSA 2BJXA 2HZFA 2VO4A 3VWWA 4IVFA 2HRKA 2ON5A 5D9VA 2YWNA 2TRXA 5HR2A 1K0MA 1PSQA 3IHQA 5IPGA 5CNWA 1USBA 5DDLA 4F82A 3J7Yb 3H93A 2OACA 1M9BA 3UMAA 2LQQA 2X49A 2GSRA 3EU3A 3C71A 2HE3A 1OAZA 1YDKA 4YQVA 3TJBA 2X8CA 3UJ1A 4WETA 4EKZA 1XVWA 5LNKe 3QAVA 3VURA 4TRXA 1EZKA 1A8LA 5C00A 3D0ZA 3L9UA 5G5FA 1IYIA 5IOXA 1HQOA 2FD3A 2F8FA 3GTUA 1ON4A 5E4WA 4KCEA 2GQMA 3ED3A 3WYWA 5JCGA 2O85A 2WRTA 1KBNA 3CTGA 2L6DA 4NV5A 3O3TA 4HOJA 3W8SA 1K0DA 1UVZA 1LJRA 1OKDA 2REMA 3BD2A 4GXZA 1GTIA 5D73A 4F9ZA 4O32A 1SK0A 5DVBA 3TB2A 3CTFA 2PPTA 3IDVA 12GSA 5D9WA 4OCFA 1OC8A 1J9BA 1ERTA 2JACA 7GSSA 1AQVA 1G6YA 4O5UA 1KTEA 4MP4A 2V6KA 1TOFA 1TI1A 4N0ZA 3I43A 3FRCA 4ZBBA 2OE3A 1FB0A 3KD0A 1YEPA 2AHEA 3CQFA 1S3CA 4WR5A 2R0CA 3LQ7A 5J3RA 4IQAA 1TRSA 2DJ3A 2HRNA 2R0PA 3ZVJA 3M8NA 4Q5RA 2LTKA 2H0HA 2PBJA 2HZEA 4NHWA 2FA8A 2V1MA 3VWXA 2ZNMA 4JZQA 1NSWA 4TW5A 1HD2A 3IE3A 5ECIB 5B6MA 3CXGA 4MJBA 2GZPA 3HD5A 3IAM2 1ML6A 3TGZA 4RUVA 2IMKA 5HR0A 4V1Ap 2K6VA 4IHUA 4N30A 2OBKA 1SK1A 2L4CA 2CX3A 5J41A 2LNSA 1OVNA 1XOBA 5AN1A 3NZNA 5ECKB 3HVSA 5J5NA 1WWJA 1M2BA 1XOAA 5FHIA 1QMVA 4MDCA 4NWYA 4MLYA 2HFDA 3F4TA 4HZ2A 1CQGA 1NHOA 9GSSA 2H1DA 2YZHA 4DSSA 5DJMA 2C0FA 4K5SA 4BPYA 1Z7PA 1GSQA 3TKQA 2X64A 3HCZA 4RI6A 5HQPA 5IMAA 1G7OA 4YKGA 4MMMA 2A4VA 2B7JA 4EXJA 5EPFA 3WGEA 4KH7A 2DSAA 1M99A 3KTLA 2NBSA 4OMVA 3ZREA 4X4JA 5EVOA 1Z7RA 4QL7A 1N8JA 3G7YA 3KH9A 3GFKA 4KF9A 4HI7A 2JSZA 4IGJA 1DE1A 5CRWA 4E8HA 1F9MA 4BWSA 2HSMA 3TKSA 2IL3A 3DD3A 4POLA 4CY6A 2YWOA 1PL2A 4KSMA 2H74A 1F3AA 4F0CA 3C1RA 2RIIA 3HZ4A 1R26A 2LV3A 5CRGA 4EL1A 3ZFLA 4PQHA 2FWFA 1VF4A 4LA1A 5KN3A 1TRVA 2DKIA 2HLSA 4BWQA 2NTOA 4WR4A 5LD0A 3L9SA 3CRTA 4KDYA 3G7IA 1EP7A 1E2YA 1T8EB 4CDOA 1LU4A 1EV9A 2CX4A 3BCIA 2LJAA 3M9JA 3CMIA 3F63A 3GL5A 2DBCA 3UAPA 4FH8A 1OC9B 1JZOA 2DJ1A 5CP1A 5G31A 4MJCA 2A2SA 4N10A 3KMOA 3P2AA 5KEJA 2CV4A 4V2NA 2MBSA 4IP6A 1PQNA 2B5XA 5CRHA 1K3YA 2RM6A 2KP2A 2R4VA 1YZXA 4MJEA 4F0BA 3HJOA 3N9JA 5INYA 3GURA 3CBUA 5CRDA 2L5OA 2H1AA 1WRYA 2XHFA 5DQSA 4I2TA 1Z5YE 3QOUA 1XWKA 4LL4B 4XTSA 2CA8A 3GKKA 2F3MA 2B1KA 3EWLA 2H6XA 2H6YA 3E0UA 6GSXA 1YJ6A 1AQWA 3C7MA 1ZYEA 3LJRA 1FVKA 3ZYWA 1SKRB 3GH6A 5JCUA 2CZ2A 5KN1A 4GCIA 3KIJA 4V1Ag 1A8YA 4IW9A 3EMPA 3TCOA 4I5QA 1ZMAA 2X4AA 4F03A 3GNJA 3LGCA 5JWRB 3EMXA 3KJYA 4IELA 3LXZA 3ZIJA 2AAWA 1OC9A 2IMIA 3DMLA 4ULXA 1FVJA 1SU9A 1O73A 1GL8A 2P5QA 4RQXA 3UOMA 3DGQA 2RLIA 1THXA 2CAQA 4HS1A 2YWIA 4GQCA 1MDKA 3IHGA 4OD7A 3QCPA 1HYUA 1AIUA 5DBQA 1TU8A 4H86A 1I5GA 1PX7A 1EV4A 3A2WA 1K0OA 1YY7A 3Q74A 4JR4A 5J9BA 4Z2TA 3BBYA 1GULA 4L8EA 3TKSC 4K7NA 2JSYA 3F4RA 2B6MA 2K8SA 5D93A 1BYEA 3LG6A 4PURA 2VD1A 2C4JA 2KLXA 3UARA 2Z9SA 4N0VA 3E3EA 4MZWA 3IK9A 2KUCA 2LSTA 1GTUA 2AUVA 4ECIA 2DJ2A 3GSTA 4K2DA 2XBQA 2FNOA 5JCWA 3APOA 3EPTA 4TR1B 3FR9A 3HHVA 5DCGA 1ERUA 1M2AA 2C1YA 3FMWA 3PGTA 4HUAA 2CVKA 1VGLA 4TR4A 3LWAA 5GSSA
chains in the Genus database with same CATH topology
4O7HA 1TJDA 4BL7B 5HR3A 1EEMA 1FO5A 4MZBA 4DEJA 1X5DA 3LW9A 1ACVA 3TOTA 2LJKA 5IIZA 2WDUA 5BRTA 1J08A 1K0AA 4N11A 2C3QA 2DIYA 4KA0A 2B5YA 2K8VA 5CYYA 3H4KA 1XZOA 5ELGA 1GSUA 4BA7A 4WF5A 4YAVA 4G0KA 5ECSA 2HI7A 4WBRD 4DSRA 3D22A 4BVYB 1BG5A 1KEBA 2HYXA 1WIKA 4ZILA 4WBJA 2WB9A 3HVXA 2VCQA 2IPAA 3EE2A 2VLVA 4XRDA 5COHA 4GLTA 2FA4A 3LYKA 2O7KA 3VWVA 3TKPA 1U6TA 1AW9A 3GTUB 3PH9A 2VM2A 1EGRA 1T1VA 2P0GA 3AY8A 4XS1A 1XIYA 3IXRA 4OCEA 2HT9A 1ILOA 2HRFA 4OO4A 4ECJA 3ZL5A 4MNNA 2LNTA 4NAXA 4HU9A 1T00A 2IFQB 3GYKA 2RUEA 4PNFA 4NPBA 1TRUA 4OWYA 4JU5A 2H1BA 4HJ2A 2FUG2 4MPFA 2GTUA 4NXIA 1BQ7A 4OFTA 2YWMA 4X1UA 1PL1A 2DKHA 4LL1B 17GSA 20GSA 2VL2C 1R7HA 3QR6A 2P5RA 2OBIA 2XBIA 4BVYA 2BMXA 3ZMKA 2FCHA 2P31A 3DWVA 5ECNB 3TRPA 3W6GA 1AUCA 3BJ5A 3TUEA 1IYHA 1R5PA 3Q6OA 1GUMA 2HZEB 2FWHA 4GRFA 1G7EA 1HNBA 3F6FA 2AJQB 5F05A 2L4QA 1GNEA 3L9VA 4ZXGA 2L6CA 2E2MA 4ZL7A 4PXOA 3O76A 5KN0A 3O6TA 5J4UA 1ZOFA 3I9V2 3TJGA 1B48A 1QK8A 2IFQA 3KEBA 2H0GA 4XIHA 4D73A 1SENA 2H8LA 3IC4A 2X8HA 2R2JA 1XW9A 3F9UA 4OO5A 3LEFA 6GSWA 2A4HA 2LRNA 1PA3A 1T4ZA 3C8EA 4PGTA 2H72A 1TDIA 4EIQA 2GT6A 4DSSB 1U3AA 4QQ7A 4Q5QA 2RUFA 4ZL8A 1V98A 3UBLA 3VI7A 1U3IA 4ML6A 3G7JA 3ZIVA 2DJ0A 1PRXA 4YH2A 5G1LA 2LJRA 3IK7A 5G1KA 22GSA 3TDGA 4HZ4A 4K5RA 3TKRA 6GSVA 1ZYPA 3VLNA 3UL3A 1SL1B 3DEXA 2WFCA 1Z3EA 2PN8A 4HU7A 5A4WA 3P8WA 3HVVA 5IMZA 1FOHA 5DJLA 5J9CA 1BEDA 3R3EA 2JL4A 2H0IA 1XPVA 2R3XA 3F3RA 5AIVA 5IQYA 2B7KA 4J57E 4PTSA 1VRSD 4XRAA 1G0TA 5E59A 4GTUA 4K7IA 4QL9A 2EIOA 5B8BA 5GSTA 3APSA 3M3MA 2C80A 2IWTA 1B8XA 1FG4A 2VL3A 1S3DA 1OKTA 3GIXA 4TR3A 16GSA 1YF1A 4MF5A 1PD21 1K0BA 1GSEA 4GSNA 5ECPB 4K0NA 1GH2A 2ALBA 5EY6A 1OYJA 3RHCA 8GSSA 1ZL9A 3RAZA 4EE0A 2GT5A 2JZTA 2YNXA 5IPHA 4FQUA 3RPPA 4WF4A 3QAWA 1GLPA 4OFNA 2YOIA 1OC3A 3IV4A 3VPTA 3I69A 1FW1A 3UEMA 4E8EA 4X43A 2J9HA 3QPMA 4FYCA 1BJXA 2I9HA 4L5LA 4O92A 3FR3A 1K0CA 3D4TA 2H30A 1SD8A 1VF1A 3H1NA 1EEJA 3JCML 4EIPA 3W8JA 5D96A 4YQUA 5IMVA 4EDZA 3C1SA 5ECMB 2O87A 3QD9A 1G6WA 1K3LA 5AIXA 4K2XA 3KCMA 5A4VA 4I8BA 2M46A 1FOVA 1RQMA 2AB6A 2QSIA 2CVBA 3OR5A 1XW5A 1QXHA 1ZYQB 5A4UA 3IR4A 3LYPA 2I81A 1TKDB 1GTBA 3HKRA 1MD3A 3KXOA 1U87A 1X0RA 2CVDA 5BMUA 5ECRB 2DJKA 5HFGA 1A0FA 1JLWA 1AXDA 1O6JA 2VIMA 2B1LA 4YQMA 4GWRA 2HXKA 2IMEA 2LQOA 4MF6A 3MNGA 4PX1A 5ECQB 2N5AA 2MBTA 1A2LA 1SD9A 3WD6A 2C0DA 4ZB6A 1Z6MA 2WULA 3F6DA 5G30A 1WMJA 2C3NA 2ZCTA 4Z2RA 1URMA 2N5FA 1ZCPA 3GKNA 3DKSA 19GSA 2EIRA 3WT2A 3HA9A 3UVHA 4G19A 3HJMA 1PX6A 3SBCA 2DMLA 2HRAA 1YKAA 1RK4A 5ENUA 5B6NA 4I6XA 2VCTA 1V57A 2XPDA 3MDKA 4KB3A 2FHEA 2MMOA 1T4YA 4EF0A 4L0WA 4ZB9A 4WEYA 2ES7A 1UN2A 2JZRA 1AAZA 2H71A 3TRXA 4Z2UA 2HSYA 2R0GA 2FY6A 5D9XA 1Q98A 4JBBA 3IBHA 2F8AA 2JZSA 3ERWA 3HYPA 3GA4A 3EURA 5DCHA 1DBYA 3HDCA 4YAPA 4K8MA 1W4VA 2A2RA 1GUKA 3F4SA 2PUKC 1THOA 2LS5A 3TJJA 3ISOA 3D21A 1F37A 4XS6A 3ERGA 1A23A 2CT6A 5DAKA 5JWQB 1LBKA 3Q19A 5B7CA 3EINA 2MMAA 4YKFA 1S3AA 4K6XA 1Y25A 2M80A 2L59A 4XHMA 1W89A 1CQHA 1YEXA 2GSTA 3L4NA 1EOGA 2L5LA 4CY8A 4K9ZA 2QGVA 1F2EA 2VCWA 2RM5A 4NHZA 4TOPA 1JZDA 3LFLA 4RQRA 5CO3A 1UA5A 1ERVA 1RW1A 3ZITA 4KGIA 1J0FA 1X9MB 4MZCA 4KDUA 1GNWA 2PMTA 3ERFA 3FK8A 2DC5A 1GSYA 1ST9A 2VCXA 2R37A 4G9HA 4ZIJA 4JR6A 6GSUA 2WJUA 5IO0A 4MJAA 1X5CA 4TKYA 4JE1A 1JLVA 3ZTLA 4ACSA 1FB6A 4ZBAA 4HQZA 1NM3A 1O81A 2DIZA 1NW2A 1GSSA 1PN0A 1GSDA 3S9FA 1KNGA 4GSTA 2FWGA 4AGSA 1MEKA 1SKWB 2F9SA 3BCKA 1YQ1A 3ME8A 2O8VB 2A2PA 3RHBA 1SL2B 3KTBA 2R5GA 1ERWA 3PINA 6GSTA 2OE0A 1PGTA 2YCDA 4DSQA 2CZ3A 2VM1A 2XPEA 3Q18A 4FIWA 1B4QA 4DVCA 1Z6NA 1YF0A 3DIEA 4TN8A 3L78A 3F3QA 3NOFA 1PMTA 3ZZXA 4L0UA 1SK2A 5IO2A 1TU7A 1TTZA 1SYXA 4EDYA 2IJYA 4I97A 2PVQA 2ON7A 5AISA 1TK8B 3KP8A 4ILFA 2KP1A 1ZGNA 3R2QA 1V9WA 2G2QA 2X8GA 1AQXA 1MTCA 2QA1A 5ABRA 3D5JA 1XXUA 4AJ8A 3DVWA 2B3SA 2GS3A 5F0GA 4I2UA 3P90A 4MF7A 5HFIA 2PGTA 2WZ9A 4TXOB 2MMNA 5FT3A 3GSSA 1MD4A 3VFIA 3GMFA 4ZBDA 1JZWA 1DSBA 3CSIA 4HQSA 2H19A 1FAAA 2VOCA 3WGXA 4EUYA 4ISDA 4V2LA 4D73B 3CYNA 2VCZA 1Y6EA 5F8BA 2MMZA 4KE3A 2VCVA 4G10A 3GX0A 1QUWA 2I3YA 1Z9HA 1SJIA 4XS4A 1AC1A 3A2XA 3VK9A 2C0GA 4OFMA 5HR1A 5ELAA 3CSJA 1GUHA 1SYRA 2OKAA 4EO3A 13GSA 3PPUA 2JU5A 2V41A 3NIVA 2CQ9A 3ZLPA 5D9TA 2WGRA 4PUFC 1BAYA 4MH3A 3VPQA 2R6KA 1VF2A 4KX4A 1PKWA 2H73A 5LCZA 2IMDA 2DJJA 4G2EA 3GUSA 4JRRA 5H5RA 4IKHA 3D4MA 4TXOA 3FHKA 3M9KA 4NMUA 2F51A 1WJKA 3RPNA 4ECCA 2FLSA 2K18A 3A5IA 1H75A 4MH2A 2CAIA 2DLXA 2H6ZA 2XC2A 1R4WA 5ECHB 2OJLA 1H4OA 3KP9A 1I9DA 1TK0B 3D6IA 2HNLA 2GDRA 1F6MC 4EVMA 3EYTA 1OE8A 3QFAC 2TIRA 2DMMA 3FY7A 4J2FA 4FYUA 3WT1A 18GSA 3C73A 4JEDA 2YP6A 1EGOA 2MZCA 3LORA 3HXSA 3KMNA 5KN2A 1WPIA 4MA9A 1QFNA 2K9FA 2GVPA 1TXXA 4LLRA 4Q5FA 5DALB 1X9SB 4X0XA 3TOUA 5IMDA 4ECBA 3GKXA 1K0NA 2QA2A 4GQFA 4A5PA 1A2JA 2EIQA 5FWGA 2H70A 4NV2A 2VLUA 5L71A 1O7UA 2C3TA 4KSOA 3US3A 3FZ5A 1T7PB 1A24A 1MDIA 3DXBA 4Z7XA 2PERA 4MABA 2YPMA 2QC7A 1V58A 1HNAA 3U5RE 10GSA 3IC8A 5IMCA 5KOWA 5IMFA 5H5QA 4F2IA 3EVIA 4HJMA 3ME7A 4Q5NA 3FZAA 1O85A 1XW6A 3DRNA 3IOSA 3QDNA 2FGXA 4AJ7A 3FW2A 3IAS2 1DUGA 3F0IA 4G0LA 2L57A 5KOXA 1TK5B 1WE0A 3A3TA 2IMFA 3EC3A 3KM6A 4MK3A 2E7PA 4TVEA 4O5QA 2WCIA 3ZVJD 3LXTA 1UC7A 3IRAA 3CRUA 4TXVA 4WXTA 2I4AA 5DALA 1FHEA 1XBSA 3BOAA 4KUNA 5ECLB 3FZ4A 4ICYA 1TRWA 1GWCA 3ZRDA 1TI3A 2V6OA 5F07A 5F06A 1O8XA 1SL0B 5A5KA 3HY2A 4TR0A 2H01A 1X5EA 4PQIA 3MIXA 3U6VA 1WOUA 3M1GA 4RI7A 3FR6A 4XCSA 3KGKA 3FYGA 5JWOB 4POMA 2B5EA 3QAGA 2AYTA 2JADA 11GSA 4J56E 1E6BA 5H5SA 2E0QA 1B9XC 4IJIA 1F3BA 4EC0A 3K8NA 2OADA 14GSA 5G5EA 5G2ZA 4O5RA 3GRXA 1XWGA 3A2VA 3SWLA 1MDJA 3QFBC 1A2MA 2YZUA 2J23A 1HNCA 2VLTA 2NVLA 1EWXA 5HFKA 5DQYA 1O8WA 2C0EA 4G0IA 1SJZA 4MPGA 3GKMA 5EL8A 1V40A 5D8IA 1VF3A 1XFLA 1EOHA 3UBKA 2V32A 1GRXA 1XCCA 4CW9A 3FZ9A 1XWCA 2H1GA 2YV7A 1C72A 2H75A 6GSYA 4K7OA 2GQKA 5DAKB 3E9JB 3IA1A 2OE1A 4BVXB 4KDXA 5GZZB 5ID2B 3J7Yk 2LRTA 1GSFA 4IN0A 4ID0A 3MSZA 1X9WB 2N5BA 3TJFA 1OE7A 3F8UA 2V2GA 2O89A 2OA7A 2PVOC 1PN9A 2ZUPA 4KCAA 3VI5A 3VWUA 3GV1A 4IJ3A 2H66A 3MAKA 4AF2A 3V1WA 4PNGA 3KH7A 1B9YC 4KNDA 5CAXA 3ZMLA 4AJ6A 3TRQA 2VAFA 3FKFA 2HSHA 6GSSA 1U88A 3KZQA 2EC4A 3ZFBA 2FWEA 3RBTA 4K1FA 1M0UA 4PUAA 5IOWA 3P7XA 2QKEA 1A0RP 4ML1A 3HZ8A 4PQ1A 3MWHA 1YKCA 4FYBA 4P3YB 1SKSB 2NPBA 2G0FA 4IQ1A 5GAPD 2E2GA 4WKWA 5GAND 2PWJA 3GX8A 3L0HA 3GH9A 2VL9A 4HDEA 4ZL9A 1M9AA 2NDOA 2M72A 1EP8A 1R5AA 3GL3A 4BVXA 1BX9A 2GZZA 5ID2A 4LMVA 3LSZA 3UIWA 2LKUA 3UVTA 2TRCP 4HEA2 2LUSA 2D2ZA 4MCUA 2UZ8A 1QGVA 3N5OA 4GSSA 2YJ7A 1ABAA 2YJHA 3M0FA 1N2AA 4IP1A 2GGTA 4ZB8A 4KAEA 1QQ2A 1T3BA 2VUPA 4KW6A 2YN1A 2VL2A 2IIYA 3WGDA 3QMXA 2X99A 3APQA 2I1UA 1GTAA 3DVXA 2LEGA 4POBA 1B4PA 1V2AA 5AGYA 4CHSA 1JFUA 1XWAA 2AV4A 4IS0A 2GSQA 1GLQA 2MYGA 2BTOT 1JHBA 1NHYA 3TKSE 1JZRA 2KOKA 2PU9C 1SJ6A 2C8UA 3A5WA 4XS4B 1TP9A 2H76A 1ZYNA 1WP0A 5ECOB 2WS2A 2GQLA 3FEUA 2GZYA 4L5OA 5IM9A 1XWBA 3GN3A 2IN3A 3IPZA 2YANA 1GP1A 3HJPA 4LMWA 3I6AA 3TJKA 3CSHA 3H79A 2YV9A 3GHAA 3RDWA 2VD0A 3MYDA 1PKZA 3H8QA 3G9BA 2GLRA 2KHPA 1M7TA 4POKA 5CREA 1ZZYA 1M2DA 1XVQA 4IBPA 3EU4A 5B8AA 4GF0A 4FO5A 4TR1A 2GSSA 4K0GA 1TW9A 5C04A 1K3OA 3PR8A 2LRCA 3DYRA 4V2MA 4BL7A 1DE2A 1Q4JA 4USSA 2BJXA 2HZFA 2VO4A 3VWWA 4IVFA 2HRKA 2ON5A 5D9VA 2YWNA 2TRXA 5HR2A 1K0MA 1PSQA 3IHQA 5IPGA 5CNWA 1USBA 5DDLA 4F82A 3J7Yb 3H93A 2OACA 1M9BA 3UMAA 2LQQA 2X49A 2GSRA 3EU3A 3C71A 2HE3A 1OAZA 1YDKA 4YQVA 3TJBA 2X8CA 3UJ1A 4WETA 4EKZA 1XVWA 5LNKe 3QAVA 3VURA 4TRXA 1EZKA 1A8LA 5C00A 3D0ZA 3L9UA 5G5FA 1IYIA 5IOXA 1HQOA 2FD3A 2F8FA 3GTUA 1ON4A 5E4WA 4KCEA 2GQMA 3ED3A 3WYWA 5JCGA 2O85A 2WRTA 1KBNA 3CTGA 2L6DA 4NV5A 3O3TA 4HOJA 3W8SA 1K0DA 1UVZA 1LJRA 1OKDA 2REMA 3BD2A 4GXZA 1GTIA 5D73A 4F9ZA 4O32A 1SK0A 5DVBA 3TB2A 3CTFA 2PPTA 3IDVA 12GSA 5D9WA 4OCFA 1OC8A 1J9BA 1ERTA 2JACA 7GSSA 1AQVA 1G6YA 4O5UA 1KTEA 4MP4A 2V6KA 1TOFA 1TI1A 4N0ZA 3I43A 3FRCA 4ZBBA 2OE3A 1FB0A 3KD0A 1YEPA 2AHEA 1S3CA 4WR5A 2R0CA 3LQ7A 5J3RA 4IQAA 1TRSA 2DJ3A 2HRNA 2R0PA 3ZVJA 3M8NA 4Q5RA 2LTKA 2H0HA 2PBJA 2HZEA 4NHWA 2FA8A 2V1MA 3VWXA 2ZNMA 4JZQA 1NSWA 4TW5A 1HD2A 3IE3A 5ECIB 5B6MA 3CXGA 4MJBA 2GZPA 3HD5A 3IAM2 1ML6A 3TGZA 4RUVA 2IMKA 5HR0A 4V1Ap 2K6VA 4IHUA 4N30A 2OBKA 1SK1A 2L4CA 2CX3A 5J41A 2LNSA 1OVNA 1XOBA 5AN1A 3NZNA 5ECKB 3HVSA 5J5NA 1WWJA 1M2BA 1XOAA 5FHIA 1QMVA 4MDCA 4NWYA 4MLYA 2HFDA 3F4TA 4HZ2A 1CQGA 1NHOA 9GSSA 2H1DA 2YZHA 4DSSA 5DJMA 2C0FA 4K5SA 4BPYA 1Z7PA 1GSQA 3TKQA 2X64A 3HCZA 4RI6A 5HQPA 5IMAA 1G7OA 4YKGA 4MMMA 2A4VA 2B7JA 4EXJA 5EPFA 3WGEA 4KH7A 2DSAA 1M99A 3KTLA 2NBSA 4OMVA 3ZREA 4X4JA 5EVOA 1Z7RA 4QL7A 1N8JA 3G7YA 3KH9A 3GFKA 4KF9A 4HI7A 2JSZA 4IGJA 1DE1A 5CRWA 4E8HA 1F9MA 4BWSA 2HSMA 3TKSA 2IL3A 3DD3A 4POLA 4CY6A 2YWOA 1PL2A 4KSMA 2H74A 1F3AA 4F0CA 3C1RA 2RIIA 3HZ4A 1R26A 2LV3A 5CRGA 4EL1A 3ZFLA 4PQHA 2FWFA 1VF4A 4LA1A 5KN3A 1TRVA 2DKIA 2HLSA 4BWQA 2NTOA 4WR4A 5LD0A 3L9SA 3CRTA 4KDYA 3G7IA 1EP7A 1E2YA 1T8EB 4CDOA 1LU4A 1EV9A 2CX4A 3BCIA 2LJAA 3M9JA 3CMIA 3F63A 3GL5A 2DBCA 3UAPA 4FH8A 1OC9B 1JZOA 2DJ1A 5CP1A 5G31A 4MJCA 2A2SA 4N10A 3KMOA 3P2AA 5KEJA 2CV4A 4V2NA 2MBSA 4IP6A 1PQNA 2B5XA 5CRHA 1K3YA 2RM6A 2KP2A 2R4VA 1YZXA 4MJEA 4F0BA 3HJOA 3N9JA 5INYA 3GURA 3CBUA 5CRDA 2L5OA 2H1AA 1WRYA 2XHFA 5DQSA 4I2TA 1Z5YE 3QOUA 1XWKA 4LL4B 4XTSA 2CA8A 3GKKA 2F3MA 2B1KA 3EWLA 2H6XA 2H6YA 3E0UA 6GSXA 1YJ6A 1AQWA 3C7MA 1ZYEA 3LJRA 1FVKA 3ZYWA 1SKRB 3GH6A 5JCUA 2CZ2A 5KN1A 4GCIA 3KIJA 4V1Ag 1A8YA 4IW9A 3EMPA 3TCOA 4I5QA 1ZMAA 2X4AA 4F03A 3GNJA 3LGCA 5JWRB 3EMXA 3KJYA 4IELA 3LXZA 3ZIJA 2AAWA 1OC9A 2IMIA 3DMLA 4ULXA 1FVJA 1SU9A 1O73A 1GL8A 2P5QA 4RQXA 3UOMA 3DGQA 2RLIA 1THXA 2CAQA 4HS1A 2YWIA 4GQCA 1MDKA 3IHGA 4OD7A 3QCPA 1HYUA 1AIUA 5DBQA 1TU8A 4H86A 1I5GA 1PX7A 1EV4A 3A2WA 1K0OA 1YY7A 3Q74A 4JR4A 5J9BA 4Z2TA 3BBYA 1GULA 4L8EA 3TKSC 4K7NA 2JSYA 3F4RA 2B6MA 2K8SA 5D93A 1BYEA 3LG6A 4PURA 2VD1A 2C4JA 2KLXA 3UARA 2Z9SA 4N0VA 3E3EA 4MZWA 3IK9A 2KUCA 2LSTA 1GTUA 2AUVA 4ECIA 2DJ2A 3GSTA 4K2DA 2XBQA 2FNOA 5JCWA 3APOA 3EPTA 4TR1B 3FR9A 3HHVA 5DCGA 1ERUA 1M2AA 2C1YA 3FMWA 3PGTA 4HUAA 2CVKA 1VGLA 4TR4A 3LWAA 5GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7H A;  1TJD A;  5HR3 A;  1EEM A;  1FO5 A;  4MZB A;  4DEJ A;  1X5D A;  1ACV A;  3TOT A;  2LJK A;  5IIZ A;  2WDU A;  1J08 A;  1K0A A;  4N11 A;  2C3Q A;  2DIY A;  4KA0 A;  2B5Y A;  2K8V A;  5CYY A;  3H4K A;  1XZO A;  5ELG A;  1GSU A;  4BA7 A;  4WF5 A;  4YAV A;  5ECS A;  2HI7 A;  4WBR D;  4DSR A;  3D22 A;  1BG5 A;  1KEB A;  2HYX A;  1WIK A;  4ZIL A;  4WBJ A;  2WB9 A;  3HVX A;  2VCQ A;  2IPA A;  3EE2 A;  2VLV A;  4XRD A;  5COH A;  4GLT A;  2FA4 A;  3LYK A;  2O7K A;  3VWV A;  3TKP A;  1U6T A;  1AW9 A;  3GTU B;  3PH9 A;  2VM2 A;  1EGR A;  1T1V A;  2P0G A;  3AY8 A;  4XS1 A;  1XIY A;  3IXR A;  4OCE A;  2HT9 A;  1ILO A;  2HRF A;  4OO4 A;  4ECJ A;  3ZL5 A;  2LNT A;  4NAX A;  4HU9 A;  1T00 A;  2IFQ B;  3GYK A;  2RUE A;  4PNF A;  4NPB A;  1TRU A;  4OWY A;  4JU5 A;  2H1B A;  4HJ2 A;  2FUG 2;  4MPF A;  2GTU A;  4NXI A;  1BQ7 A;  4OFT A;  2YWM A;  4X1U A;  1PL1 A;  4LL1 B;  17GS A;  20GS A;  2VL2 C;  1R7H A;  3QR6 A;  2P5R A;  2OBI A;  2XBI A;  4BVY A;  2BMX A;  3ZMK A;  2FCH A;  2P31 A;  3DWV A;  5ECN B;  3TRP A;  3W6G A;  1AUC A;  3BJ5 A;  3TUE A;  1IYH A;  1R5P A;  3Q6O A;  1GUM A;  2HZE B;  2FWH A;  4GRF A;  1G7E A;  1HNB A;  3F6F A;  2AJQ B;  5F05 A;  2L4Q A;  1GNE A;  3L9V A;  4ZXG A;  2L6C A;  2E2M A;  4ZL7 A;  4PXO A;  3O76 A;  5KN0 A;  3O6T A;  5J4U A;  1ZOF A;  3I9V 2;  3TJG A;  1B48 A;  1QK8 A;  2IFQ A;  3KEB A;  2H0G A;  4XIH A;  4D73 A;  1SEN A;  2H8L A;  3IC4 A;  2X8H A;  2R2J A;  1XW9 A;  3F9U A;  4OO5 A;  3LEF A;  6GSW A;  2LRN A;  1PA3 A;  1T4Z A;  3C8E A;  4PGT A;  2H72 A;  1TDI A;  2GT6 A;  4DSS B;  1U3A A;  4QQ7 A;  4Q5Q A;  2RUF A;  4ZL8 A;  1V98 A;  3UBL A;  3VI7 A;  1U3I A;  4ML6 A;  3G7J A;  3ZIV A;  2DJ0 A;  1PRX A;  4YH2 A;  5G1L A;  2LJR A;  3IK7 A;  5G1K A;  22GS A;  3TDG A;  4HZ4 A;  3TKR A;  6GSV A;  3VLN A;  3UL3 A;  1SL1 B;  3DEX A;  2WFC A;  1Z3E A;  2PN8 A;  4HU7 A;  5A4W A;  3P8W A;  3HVV A;  5IMZ A;  5DJL A;  5J9C A;  1BED A;  2JL4 A;  2H0I A;  1XPV A;  2R3X A;  3F3R A;  5AIV A;  5IQY A;  2B7K A;  4J57 E;  1VRS D;  4XRA A;  1G0T A;  5E59 A;  4GTU A;  4K7I A;  4QL9 A;  2EIO A;  5B8B A;  5GST A;  3APS A;  3M3M A;  2C80 A;  2IWT A;  1B8X A;  1FG4 A;  2VL3 A;  1S3D A;  1OKT A;  3GIX A;  4TR3 A;  16GS A;  1YF1 A;  4MF5 A;  1PD2 1;  1K0B A;  1GSE A;  4GSN A;  5ECP B;  4K0N A;  1GH2 A;  2ALB A;  5EY6 A;  1OYJ A;  3RHC A;  8GSS A;  1ZL9 A;  3RAZ A;  4EE0 A;  2GT5 A;  2JZT A;  2YNX A;  5IPH A;  3RPP A;  4WF4 A;  3QAW A;  1GLP A;  4OFN A;  2YOI A;  1OC3 A;  3IV4 A;  3VPT A;  3I69 A;  1FW1 A;  3UEM A;  4E8E A;  4X43 A;  2J9H A;  3QPM A;  4FYC A;  1BJX A;  2I9H A;  4L5L A;  4O92 A;  3FR3 A;  1K0C A;  3D4T A;  2H30 A;  1SD8 A;  1VF1 A;  3H1N A;  1EEJ A;  3JCM L;  3W8J A;  5D96 A;  4YQU A;  5IMV A;  4EDZ A;  3C1S A;  5ECM B;  2O87 A;  3QD9 A;  1G6W A;  1K3L A;  5AIX A;  3KCM A;  5A4V A;  4I8B A;  2M46 A;  1FOV A;  1RQM A;  2AB6 A;  2QSI A;  2CVB A;  3OR5 A;  1XW5 A;  1QXH A;  1ZYQ B;  5A4U A;  3IR4 A;  3LYP A;  2I81 A;  1TKD B;  1GTB A;  3HKR A;  1MD3 A;  3KXO A;  1U87 A;  1X0R A;  2CVD A;  5ECR B;  2DJK A;  5HFG A;  1A0F A;  1JLW A;  1AXD A;  1O6J A;  2VIM A;  2B1L A;  4YQM A;  4GWR A;  2HXK A;  2IME A;  2LQO A;  4MF6 A;  3MNG A;  4PX1 A;  5ECQ B;  2N5A A;  2MBT A;  1A2L A;  1SD9 A;  3WD6 A;  2C0D A;  4ZB6 A;  1Z6M A;  2WUL A;  3F6D A;  5G30 A;  1WMJ A;  2C3N A;  2ZCT A;  1URM A;  2N5F A;  1ZCP A;  3GKN A;  3DKS A;  19GS A;  2EIR A;  3WT2 A;  3HA9 A;  3UVH A;  4G19 A;  3HJM A;  1PX6 A;  3SBC A;  2DML A;  1YKA A;  1RK4 A;  5ENU A;  5B6N A;  4I6X A;  2VCT A;  1V57 A;  2XPD A;  3MDK A;  4KB3 A;  2FHE A;  2MMO A;  1T4Y A;  4EF0 A;  4L0W A;  4ZB9 A;  4WEY A;  2ES7 A;  1UN2 A;  2JZR A;  1AAZ A;  2H71 A;  3TRX A;  2HSY A;  2FY6 A;  5D9X A;  1Q98 A;  4JBB A;  3IBH A;  2F8A A;  2JZS A;  3ERW A;  3HYP A;  3GA4 A;  3EUR A;  5DCH A;  1DBY A;  3HDC A;  4YAP A;  4K8M A;  1W4V A;  2A2R A;  1GUK A;  3F4S A;  2PUK C;  1THO A;  2LS5 A;  3TJJ A;  3ISO A;  3D21 A;  1F37 A;  4XS6 A;  3ERG A;  1A23 A;  2CT6 A;  5DAK A;  5JWQ B;  1LBK A;  3Q19 A;  5B7C A;  3EIN A;  2MMA A;  1S3A A;  4K6X A;  1Y25 A;  2M80 A;  2L59 A;  4XHM A;  1W89 A;  1CQH A;  1YEX A;  2GST A;  3L4N A;  1EOG A;  2L5L A;  4K9Z A;  2QGV A;  1F2E A;  2VCW A;  2RM5 A;  4NHZ A;  4TOP A;  1JZD A;  3LFL A;  4RQR A;  5CO3 A;  1UA5 A;  1ERV A;  1RW1 A;  3ZIT A;  4KGI A;  1J0F A;  1X9M B;  4MZC A;  4KDU A;  1GNW A;  2PMT A;  3ERF A;  3FK8 A;  2DC5 A;  1GSY A;  1ST9 A;  2VCX A;  2R37 A;  4G9H A;  4ZIJ A;  4JR6 A;  6GSU A;  2WJU A;  5IO0 A;  4MJA A;  1X5C A;  4TKY A;  4JE1 A;  1JLV A;  3ZTL A;  4ACS A;  1FB6 A;  4ZBA A;  4HQZ A;  1NM3 A;  1O81 A;  2DIZ A;  1NW2 A;  1GSS A;  1GSD A;  3S9F A;  1KNG A;  4GST A;  2FWG A;  4AGS A;  1MEK A;  1SKW B;  2F9S A;  3BCK A;  1YQ1 A;  3ME8 A;  2O8V B;  3RHB A;  1SL2 B;  3KTB A;  2R5G A;  1ERW A;  3PIN A;  6GST A;  2OE0 A;  1PGT A;  2YCD A;  4DSQ A;  2CZ3 A;  2VM1 A;  2XPE A;  3Q18 A;  4FIW A;  1B4Q A;  4DVC A;  1Z6N A;  1YF0 A;  3DIE A;  4TN8 A;  3L78 A;  3F3Q A;  3NOF A;  1PMT A;  3ZZX A;  4L0U A;  1SK2 A;  5IO2 A;  1TU7 A;  1TTZ A;  1SYX A;  4EDY A;  2IJY A;  4I97 A;  2PVQ A;  2ON7 A;  5AIS A;  1TK8 B;  3KP8 A;  4ILF A;  2KP1 A;  1ZGN A;  3R2Q A;  1V9W A;  2G2Q A;  2X8G A;  1AQX A;  1MTC A;  5ABR A;  3D5J A;  1XXU A;  4AJ8 A;  3DVW A;  2B3S A;  2GS3 A;  5F0G A;  4I2U A;  3P90 A;  4MF7 A;  5HFI A;  2PGT A;  2WZ9 A;  4TXO B;  2MMN A;  5FT3 A;  3GSS A;  1MD4 A;  3VFI A;  3GMF A;  4ZBD A;  1JZW A;  1DSB A;  3CSI A;  4HQS A;  2H19 A;  1FAA A;  2VOC A;  3WGX A;  4EUY A;  4ISD A;  4V2L A;  4D73 B;  3CYN A;  2VCZ A;  1Y6E A;  5F8B A;  2MMZ A;  4KE3 A;  2VCV A;  4G10 A;  3GX0 A;  1QUW A;  2I3Y A;  1Z9H A;  1SJI A;  4XS4 A;  1AC1 A;  3A2X A;  3VK9 A;  2C0G A;  4OFM A;  5HR1 A;  5ELA A;  3CSJ A;  1GUH A;  1SYR A;  2OKA A;  4EO3 A;  13GS A;  2JU5 A;  2V41 A;  3NIV A;  2CQ9 A;  3ZLP A;  5D9T A;  2WGR A;  4PUF C;  1BAY A;  4MH3 A;  3VPQ A;  2R6K A;  1VF2 A;  4KX4 A;  1PKW A;  2H73 A;  5LCZ A;  2IMD A;  2DJJ A;  4G2E A;  3GUS A;  4JRR A;  5H5R A;  4IKH A;  3D4M A;  4TXO A;  3FHK A;  3M9K A;  4NMU A;  2F51 A;  1WJK A;  3RPN A;  4ECC A;  2FLS A;  2K18 A;  1H75 A;  4MH2 A;  2CAI A;  2DLX A;  2H6Z A;  2XC2 A;  1R4W A;  5ECH B;  2OJL A;  1H4O A;  3KP9 A;  1I9D A;  1TK0 B;  3D6I A;  2HNL A;  2GDR A;  1F6M C;  4EVM A;  3EYT A;  1OE8 A;  3QFA C;  2TIR A;  2DMM A;  3FY7 A;  4J2F A;  4FYU A;  3WT1 A;  18GS A;  3C73 A;  4JED A;  2YP6 A;  1EGO A;  2MZC A;  3LOR A;  3HXS A;  3KMN A;  5KN2 A;  1WPI A;  4MA9 A;  1QFN A;  2K9F A;  2GVP A;  1TXX A;  4LLR A;  4Q5F A;  5DAL B;  1X9S B;  4X0X A;  3TOU A;  5IMD A;  4ECB A;  3GKX A;  1K0N A;  4GQF A;  1A2J A;  2EIQ A;  5FWG A;  2H70 A;  4NV2 A;  2VLU A;  5L71 A;  1O7U A;  2C3T A;  4KSO A;  3US3 A;  3FZ5 A;  1T7P B;  1A24 A;  1MDI A;  3DXB A;  4Z7X A;  2PER A;  4MAB A;  2YPM A;  2QC7 A;  1V58 A;  1HNA A;  3U5R E;  10GS A;  5IMC A;  5IMF A;  5H5Q A;  4F2I A;  3EVI A;  4HJM A;  3ME7 A;  4Q5N A;  3FZA A;  1O85 A;  1XW6 A;  3DRN A;  3IOS A;  3QDN A;  2FGX A;  4AJ7 A;  3FW2 A;  3IAS 2;  1DUG A;  3F0I A;  2L57 A;  1TK5 B;  1WE0 A;  3A3T A;  2IMF A;  3EC3 A;  3KM6 A;  4MK3 A;  2E7P A;  4TVE A;  2WCI A;  3ZVJ D;  3LXT A;  1UC7 A;  3IRA A;  3CRU A;  4TXV A;  4WXT A;  2I4A A;  5DAL A;  1FHE A;  1XBS A;  3BOA A;  4KUN A;  5ECL B;  3FZ4 A;  1TRW A;  1GWC A;  3ZRD A;  1TI3 A;  2V6O A;  5F07 A;  5F06 A;  1O8X A;  1SL0 B;  5A5K A;  3HY2 A;  4TR0 A;  2H01 A;  1X5E A;  4PQI A;  3U6V A;  1WOU A;  3M1G A;  4RI7 A;  3FR6 A;  4XCS A;  3KGK A;  3FYG A;  5JWO B;  4POM A;  2B5E A;  3QAG A;  2AYT A;  2JAD A;  11GS A;  4J56 E;  1E6B A;  5H5S A;  2E0Q A;  1B9X C;  4IJI A;  1F3B A;  4EC0 A;  3K8N A;  2OAD A;  14GS A;  5G5E A;  5G2Z A;  4O5R A;  3GRX A;  1XWG A;  3A2V A;  3SWL A;  1MDJ A;  3QFB C;  1A2M A;  2YZU A;  2J23 A;  1HNC A;  2VLT A;  2NVL A;  1EWX A;  5HFK A;  5DQY A;  1O8W A;  2C0E A;  1SJZ A;  4MPG A;  3GKM A;  5EL8 A;  1V40 A;  5D8I A;  1VF3 A;  1XFL A;  1EOH A;  3UBK A;  2V32 A;  1GRX A;  1XCC A;  4CW9 A;  3FZ9 A;  1XWC A;  2H1G A;  2YV7 A;  1C72 A;  2H75 A;  6GSY A;  4K7O A;  2GQK A;  5DAK B;  3E9J B;  3IA1 A;  2OE1 A;  4KDX A;  5GZZ B;  5ID2 B;  3J7Y k;  2LRT A;  1GSF A;  4IN0 A;  4ID0 A;  3MSZ A;  1X9W B;  2N5B A;  3TJF A;  1OE7 A;  3F8U A;  2V2G A;  2O89 A;  2OA7 A;  2PVO C;  1PN9 A;  2ZUP A;  4KCA A;  3VI5 A;  3VWU A;  3GV1 A;  4IJ3 A;  2H66 A;  3MAK A;  4AF2 A;  3V1W A;  4PNG A;  3KH7 A;  1B9Y C;  4KND A;  5CAX A;  3ZML A;  4AJ6 A;  3TRQ A;  2VAF A;  3FKF A;  2HSH A;  6GSS A;  1U88 A;  3KZQ A;  2EC4 A;  3ZFB A;  2FWE A;  3RBT A;  4K1F A;  1M0U A;  4PUA A;  5IOW A;  3P7X A;  2QKE A;  1A0R P;  4ML1 A;  3HZ8 A;  4PQ1 A;  3MWH A;  1YKC A;  4FYB A;  4P3Y B;  1SKS B;  2NPB A;  2G0F A;  4IQ1 A;  5GAP D;  2E2G A;  4WKW A;  5GAN D;  2PWJ A;  3GX8 A;  3L0H A;  3GH9 A;  2VL9 A;  4HDE A;  4ZL9 A;  1M9A A;  2NDO A;  2M72 A;  1EP8 A;  1R5A A;  3GL3 A;  4BVX A;  1BX9 A;  2GZZ A;  5ID2 A;  4LMV A;  3LSZ A;  3UIW A;  2LKU A;  3UVT A;  2TRC P;  4HEA 2;  2LUS A;  2D2Z A;  4MCU A;  1QGV A;  3N5O A;  4GSS A;  2YJ7 A;  1ABA A;  2YJH A;  3M0F A;  1N2A A;  4IP1 A;  2GGT A;  4ZB8 A;  4KAE A;  1QQ2 A;  1T3B A;  2VUP A;  4KW6 A;  2YN1 A;  2VL2 A;  2IIY A;  3WGD A;  3QMX A;  2X99 A;  3APQ A;  2I1U A;  1GTA A;  3DVX A;  2LEG A;  4POB A;  1B4P A;  1V2A A;  5AGY A;  4CHS A;  1JFU A;  1XWA A;  2AV4 A;  4IS0 A;  2GSQ A;  1GLQ A;  2MYG A;  2BTO T;  1JHB A;  1NHY A;  3TKS E;  1JZR A;  2KOK A;  2PU9 C;  1SJ6 A;  2C8U A;  3A5W A;  4XS4 B;  1TP9 A;  2H76 A;  1WP0 A;  5ECO B;  2WS2 A;  2GQL A;  3FEU A;  2GZY A;  4L5O A;  5IM9 A;  1XWB A;  3GN3 A;  2IN3 A;  3IPZ A;  2YAN A;  1GP1 A;  3HJP A;  4LMW A;  3I6A A;  3TJK A;  3CSH A;  3H79 A;  2YV9 A;  3GHA A;  3RDW A;  2VD0 A;  1PKZ A;  3H8Q A;  3G9B A;  2GLR A;  2KHP A;  1M7T A;  4POK A;  5CRE A;  1ZZY A;  1M2D A;  1XVQ A;  4IBP A;  3EU4 A;  5B8A A;  4GF0 A;  4FO5 A;  4TR1 A;  2GSS A;  4K0G A;  1TW9 A;  5C04 A;  1K3O A;  3PR8 A;  2LRC A;  3DYR A;  4V2M A;  4BL7 A;  1DE2 A;  1Q4J A;  2BJX A;  2HZF A;  2VO4 A;  3VWW A;  4IVF A;  2ON5 A;  5D9V A;  2YWN A;  2TRX A;  5HR2 A;  1K0M A;  1PSQ A;  3IHQ A;  5IPG A;  5CNW A;  1USB A;  5DDL A;  4F82 A;  3J7Y b;  3H93 A;  2OAC A;  1M9B A;  3UMA A;  2LQQ A;  2GSR A;  3EU3 A;  3C71 A;  2HE3 A;  1OAZ A;  1YDK A;  4YQV A;  3TJB A;  2X8C A;  3UJ1 A;  4WET A;  4EKZ A;  1XVW A;  5LNK e;  3QAV A;  3VUR A;  4TRX A;  1EZK A;  1A8L A;  5C00 A;  3D0Z A;  3L9U A;  5G5F A;  1IYI A;  5IOX A;  1HQO A;  2FD3 A;  2F8F A;  3GTU A;  1ON4 A;  5E4W A;  4KCE A;  2GQM A;  3ED3 A;  3WYW A;  5JCG A;  2O85 A;  2WRT A;  1KBN A;  3CTG A;  2L6D A;  4NV5 A;  3O3T A;  4HOJ A;  3W8S A;  1K0D A;  1UVZ A;  1LJR A;  1OKD A;  2REM A;  3BD2 A;  4GXZ A;  1GTI A;  5D73 A;  4F9Z A;  4O32 A;  1SK0 A;  5DVB A;  3TB2 A;  3CTF A;  2PPT A;  3IDV A;  12GS A;  5D9W A;  4OCF A;  1OC8 A;  1J9B A;  1ERT A;  2JAC A;  7GSS A;  1AQV A;  1G6Y A;  1KTE A;  4MP4 A;  2V6K A;  1TOF A;  1TI1 A;  4N0Z A;  3I43 A;  3FRC A;  4ZBB A;  2OE3 A;  1FB0 A;  3KD0 A;  1YEP A;  2AHE A;  1S3C A;  4WR5 A;  3LQ7 A;  5J3R A;  4IQA A;  1TRS A;  2DJ3 A;  2HRN A;  3ZVJ A;  3M8N A;  4Q5R A;  2LTK A;  2H0H A;  2PBJ A;  2HZE A;  4NHW A;  2FA8 A;  2V1M A;  3VWX A;  2ZNM A;  4JZQ A;  1NSW A;  4TW5 A;  1HD2 A;  3IE3 A;  5ECI B;  5B6M A;  3CXG A;  4MJB A;  2GZP A;  3HD5 A;  3IAM 2;  1ML6 A;  3TGZ A;  4RUV A;  2IMK A;  5HR0 A;  4V1A p;  2K6V A;  4IHU A;  4N30 A;  2OBK A;  1SK1 A;  2L4C A;  2CX3 A;  5J41 A;  2LNS A;  1OVN A;  1XOB A;  5AN1 A;  3NZN A;  5ECK B;  3HVS A;  5J5N A;  1WWJ A;  1M2B A;  1XOA A;  5FHI A;  1QMV A;  4MDC A;  4NWY A;  4MLY A;  2HFD A;  3F4T A;  4HZ2 A;  1CQG A;  1NHO A;  9GSS A;  2H1D A;  2YZH A;  4DSS A;  5DJM A;  2C0F A;  4BPY A;  1Z7P A;  1GSQ A;  3TKQ A;  2X64 A;  3HCZ A;  4RI6 A;  5HQP A;  5IMA A;  1G7O A;  4MMM A;  2A4V A;  2B7J A;  4EXJ A;  5EPF A;  3WGE A;  4KH7 A;  2DSA A;  1M99 A;  3KTL A;  2NBS A;  4OMV A;  3ZRE A;  5EVO A;  1Z7R A;  4QL7 A;  1N8J A;  3G7Y A;  3KH9 A;  3GFK A;  4HI7 A;  2JSZ A;  4IGJ A;  1DE1 A;  5CRW A;  4E8H A;  1F9M A;  4BWS A;  3TKS A;  2IL3 A;  3DD3 A;  4POL A;  2YWO A;  1PL2 A;  4KSM A;  2H74 A;  1F3A A;  4F0C A;  3C1R A;  2RII A;  3HZ4 A;  1R26 A;  2LV3 A;  5CRG A;  4EL1 A;  3ZFL A;  4PQH A;  2FWF A;  1VF4 A;  4LA1 A;  5KN3 A;  1TRV A;  2HLS A;  4BWQ A;  2NTO A;  4WR4 A;  5LD0 A;  3L9S A;  3CRT A;  4KDY A;  3G7I A;  1EP7 A;  1E2Y A;  1T8E B;  4CDO A;  1LU4 A;  1EV9 A;  2CX4 A;  3BCI A;  2LJA A;  3M9J A;  3CMI A;  3F63 A;  3GL5 A;  2DBC A;  3UAP A;  4FH8 A;  1OC9 B;  1JZO A;  2DJ1 A;  5CP1 A;  5G31 A;  4MJC A;  2A2S A;  4N10 A;  3KMO A;  3P2A A;  5KEJ A;  2CV4 A;  4V2N A;  2MBS A;  4IP6 A;  1PQN A;  2B5X A;  5CRH A;  1K3Y A;  2RM6 A;  2KP2 A;  2R4V A;  1YZX A;  4MJE A;  4F0B A;  3HJO A;  3N9J A;  5INY A;  3GUR A;  3CBU A;  5CRD A;  2L5O A;  2H1A A;  1WRY A;  2XHF A;  5DQS A;  4I2T A;  1Z5Y E;  3QOU A;  1XWK A;  4LL4 B;  4XTS A;  2CA8 A;  3GKK A;  2F3M A;  2B1K A;  3EWL A;  2H6X A;  2H6Y A;  3E0U A;  6GSX A;  1YJ6 A;  1AQW A;  3C7M A;  1ZYE A;  3LJR A;  1FVK A;  3ZYW A;  1SKR B;  3GH6 A;  5JCU A;  2CZ2 A;  5KN1 A;  4GCI A;  3KIJ A;  4V1A g;  1A8Y A;  4IW9 A;  3EMP A;  3TCO A;  4I5Q A;  1ZMA A;  4F03 A;  3GNJ A;  3LGC A;  5JWR B;  3EMX A;  3KJY A;  4IEL A;  3LXZ A;  3ZIJ A;  2AAW A;  1OC9 A;  2IMI A;  3DML A;  4ULX A;  1FVJ A;  1SU9 A;  1O73 A;  1GL8 A;  2P5Q A;  4RQX A;  3UOM A;  3DGQ A;  2RLI A;  1THX A;  2CAQ A;  4HS1 A;  2YWI A;  4GQC A;  1MDK A;  4OD7 A;  3QCP A;  1HYU A;  1AIU A;  5DBQ A;  1TU8 A;  4H86 A;  1I5G A;  1PX7 A;  1EV4 A;  3A2W A;  1K0O A;  1YY7 A;  3Q74 A;  4JR4 A;  5J9B A;  3BBY A;  1GUL A;  4L8E A;  3TKS C;  4K7N A;  2JSY A;  3F4R A;  2B6M A;  2K8S A;  5D93 A;  1BYE A;  3LG6 A;  4PUR A;  2VD1 A;  2C4J A;  2KLX A;  3UAR A;  2Z9S A;  4N0V A;  3E3E A;  4MZW A;  3IK9 A;  2KUC A;  2LST A;  1GTU A;  2AUV A;  4ECI A;  2DJ2 A;  3GST A;  4K2D A;  2XBQ A;  2FNO A;  5JCW A;  3APO A;  4TR1 B;  3FR9 A;  3HHV A;  5DCG A;  1ERU A;  1M2A A;  2C1Y A;  3PGT A;  4HUA A;  2CVK A;  1VGL A;  4TR4 A;  3LWA A;  5GSS A; 
#chains in the Genus database with same CATH topology
 4O7H A;  1TJD A;  4BL7 B;  5HR3 A;  1EEM A;  1FO5 A;  4MZB A;  4DEJ A;  1X5D A;  3LW9 A;  1ACV A;  3TOT A;  2LJK A;  5IIZ A;  2WDU A;  5BRT A;  1J08 A;  1K0A A;  4N11 A;  2C3Q A;  2DIY A;  4KA0 A;  2B5Y A;  2K8V A;  5CYY A;  3H4K A;  1XZO A;  5ELG A;  1GSU A;  4BA7 A;  4WF5 A;  4YAV A;  4G0K A;  5ECS A;  2HI7 A;  4WBR D;  4DSR A;  3D22 A;  4BVY B;  1BG5 A;  1KEB A;  2HYX A;  1WIK A;  4ZIL A;  4WBJ A;  2WB9 A;  3HVX A;  2VCQ A;  2IPA A;  3EE2 A;  2VLV A;  4XRD A;  5COH A;  4GLT A;  3HVN A;  2FA4 A;  3LYK A;  2O7K A;  3VWV A;  3TKP A;  1U6T A;  1AW9 A;  3GTU B;  3PH9 A;  2VM2 A;  1EGR A;  1T1V A;  2P0G A;  3AY8 A;  4XS1 A;  1XIY A;  3IXR A;  4OCE A;  2HT9 A;  1ILO A;  2HRF A;  4OO4 A;  4ECJ A;  3ZL5 A;  4MNN A;  2LNT A;  4NAX A;  4HU9 A;  1T00 A;  2IFQ B;  3GYK A;  2RUE A;  4PNF A;  4NPB A;  1TRU A;  4OWY A;  4JU5 A;  2H1B A;  4HJ2 A;  2FUG 2;  4MPF A;  2GTU A;  4NXI A;  1BQ7 A;  4OFT A;  2YWM A;  4X1U A;  1PL1 A;  2DKH A;  4LL1 B;  17GS A;  20GS A;  2VL2 C;  1R7H A;  3QR6 A;  2P5R A;  2OBI A;  2XBI A;  4BVY A;  2BMX A;  3ZMK A;  2FCH A;  2P31 A;  3DWV A;  5ECN B;  3TRP A;  3W6G A;  1AUC A;  3BJ5 A;  3TUE A;  1IYH A;  1R5P A;  3Q6O A;  1GUM A;  2HZE B;  2FWH A;  4GRF A;  1G7E A;  1HNB A;  3F6F A;  2AJQ B;  5F05 A;  2L4Q A;  1GNE A;  3L9V A;  4ZXG A;  2L6C A;  2E2M A;  4ZL7 A;  4PXO A;  1S3R A;  3O76 A;  5KN0 A;  3O6T A;  5J4U A;  1ZOF A;  3I9V 2;  3TJG A;  1B48 A;  1QK8 A;  2IFQ A;  3KEB A;  2H0G A;  4XIH A;  4D73 A;  1SEN A;  2H8L A;  3IC4 A;  2X8H A;  2R2J A;  1XW9 A;  3F9U A;  4OO5 A;  3LEF A;  6GSW A;  2A4H A;  2LRN A;  1PA3 A;  1T4Z A;  3C8E A;  4PGT A;  2H72 A;  1TDI A;  4EIQ A;  2GT6 A;  4DSS B;  1U3A A;  4QQ7 A;  1M3J A;  4Q5Q A;  4BIK A;  2RUF A;  4ZL8 A;  1V98 A;  3UBL A;  3VI7 A;  1U3I A;  4ML6 A;  3G7J A;  3ZIV A;  2DJ0 A;  1PRX A;  4YH2 A;  5G1L A;  2LJR A;  3IK7 A;  5G1K A;  22GS A;  1PFO A;  3TDG A;  4HZ4 A;  4K5R A;  3TKR A;  6GSV A;  1ZYP A;  3VLN A;  3UL3 A;  1SL1 B;  3DEX A;  2WFC A;  1Z3E A;  2PN8 A;  4HU7 A;  5A4W A;  3P8W A;  3HVV A;  5IMZ A;  1FOH A;  5DJL A;  5J9C A;  1BED A;  3R3E A;  2JL4 A;  2H0I A;  1XPV A;  2R3X A;  3F3R A;  5AIV A;  5IQY A;  2B7K A;  4J57 E;  4PTS A;  1VRS D;  4XRA A;  1G0T A;  5E59 A;  4GTU A;  4K7I A;  4QL9 A;  2EIO A;  5B8B A;  5GST A;  3APS A;  3M3M A;  2C80 A;  2IWT A;  1B8X A;  1FG4 A;  2VL3 A;  1S3D A;  1OKT A;  3GIX A;  4TR3 A;  16GS A;  1YF1 A;  4MF5 A;  1PD2 1;  1K0B A;  1GSE A;  4GSN A;  5ECP B;  4K0N A;  1GH2 A;  2ALB A;  5EY6 A;  1OYJ A;  3RHC A;  8GSS A;  1ZL9 A;  3RAZ A;  4EE0 A;  2GT5 A;  2JZT A;  2YNX A;  5IPH A;  4FQU A;  3RPP A;  4WF4 A;  3QAW A;  1GLP A;  4OFN A;  2YOI A;  1OC3 A;  3IV4 A;  3VPT A;  3I69 A;  1FW1 A;  3UEM A;  4E8E A;  4X43 A;  2J9H A;  3QPM A;  4FYC A;  1BJX A;  2I9H A;  4L5L A;  4O92 A;  3FR3 A;  1K0C A;  3D4T A;  2H30 A;  1SD8 A;  1VF1 A;  3H1N A;  1EEJ A;  3JCM L;  4EIP A;  3W8J A;  5D96 A;  4YQU A;  5IMV A;  4EDZ A;  3C1S A;  5ECM B;  2O87 A;  3QD9 A;  1G6W A;  1K3L A;  5AIX A;  4K2X A;  3KCM A;  5A4V A;  4I8B A;  2M46 A;  1FOV A;  1RQM A;  2AB6 A;  2QSI A;  2CVB A;  3OR5 A;  1XW5 A;  1QXH A;  1ZYQ B;  5A4U A;  3IR4 A;  3LYP A;  2I81 A;  1TKD B;  1GTB A;  3HKR A;  1MD3 A;  3KXO A;  1U87 A;  1X0R A;  2CVD A;  5BMU A;  5ECR B;  2DJK A;  5HFG A;  1A0F A;  1JLW A;  1AXD A;  1O6J A;  2VIM A;  2B1L A;  4YQM A;  4GWR A;  2HXK A;  2IME A;  2LQO A;  4MF6 A;  3MNG A;  4PX1 A;  5ECQ B;  2N5A A;  2MBT A;  1A2L A;  1SD9 A;  3WD6 A;  2C0D A;  4ZB6 A;  1Z6M A;  2WUL A;  3F6D A;  5G30 A;  1WMJ A;  2C3N A;  2ZCT A;  4Z2R A;  1URM A;  2N5F A;  1ZCP A;  3GKN A;  3DKS A;  19GS A;  2EIR A;  3WT2 A;  3HA9 A;  3UVH A;  4G19 A;  3HJM A;  1PX6 A;  3SBC A;  2DML A;  2HRA A;  1YKA A;  1RK4 A;  5ENU A;  5B6N A;  4I6X A;  2VCT A;  1V57 A;  2XPD A;  3MDK A;  4KB3 A;  2FHE A;  2MMO A;  1T4Y A;  4EF0 A;  4L0W A;  4ZB9 A;  4WEY A;  2ES7 A;  1UN2 A;  2JZR A;  1AAZ A;  2H71 A;  3TRX A;  4Z2U A;  2HSY A;  2R0G A;  2FY6 A;  5D9X A;  1Q98 A;  4JBB A;  3IBH A;  2F8A A;  2JZS A;  3ERW A;  3HYP A;  3GA4 A;  3EUR A;  5DCH A;  1DBY A;  3HDC A;  4YAP A;  4K8M A;  1W4V A;  2A2R A;  1GUK A;  3F4S A;  2PUK C;  1THO A;  2LS5 A;  3TJJ A;  3ISO A;  3D21 A;  1F37 A;  4XS6 A;  3ERG A;  1A23 A;  2CT6 A;  5DAK A;  5JWQ B;  1LBK A;  3Q19 A;  5B7C A;  3EIN A;  2MMA A;  4YKF A;  1S3A A;  4K6X A;  1Y25 A;  2M80 A;  1M3I A;  2L59 A;  4XHM A;  1W89 A;  1CQH A;  1YEX A;  2GST A;  3L4N A;  1EOG A;  2L5L A;  4CY8 A;  4K9Z A;  1XG8 A;  2QGV A;  1F2E A;  2VCW A;  2RM5 A;  4NHZ A;  4TOP A;  1JZD A;  3LFL A;  4RQR A;  5CO3 A;  1UA5 A;  1ERV A;  1RW1 A;  3ZIT A;  4KGI A;  1J0F A;  1X9M B;  4MZC A;  4KDU A;  1GNW A;  2PMT A;  3ERF A;  3FK8 A;  2DC5 A;  1GSY A;  1ST9 A;  2VCX A;  2R37 A;  4G9H A;  4ZIJ A;  4JR6 A;  6GSU A;  2WJU A;  5IO0 A;  4MJA A;  1X5C A;  4TKY A;  4JE1 A;  1JLV A;  3ZTL A;  4ACS A;  1FB6 A;  4ZBA A;  4HQZ A;  1NM3 A;  1O81 A;  2DIZ A;  1NW2 A;  1GSS A;  1PN0 A;  1GSD A;  3S9F A;  1KNG A;  4GST A;  2FWG A;  4AGS A;  1MEK A;  1SKW B;  2F9S A;  3BCK A;  1YQ1 A;  3ME8 A;  2O8V B;  2A2P A;  3RHB A;  1SL2 B;  3KTB A;  2R5G A;  1ERW A;  3PIN A;  6GST A;  2OE0 A;  1PGT A;  2YCD A;  4DSQ A;  2CZ3 A;  2VM1 A;  2XPE A;  3Q18 A;  4FIW A;  1B4Q A;  4DVC A;  1Z6N A;  1YF0 A;  3DIE A;  4TN8 A;  3L78 A;  3F3Q A;  3NOF A;  1PMT A;  3ZZX A;  4L0U A;  1SK2 A;  5IO2 A;  1TU7 A;  1TTZ A;  1SYX A;  4EDY A;  2IJY A;  4I97 A;  2PVQ A;  2ON7 A;  5AIS A;  1TK8 B;  3KP8 A;  4ILF A;  2KP1 A;  1ZGN A;  3R2Q A;  1V9W A;  2G2Q A;  2X8G A;  1AQX A;  1MTC A;  2QA1 A;  5ABR A;  3D5J A;  1XXU A;  4AJ8 A;  3DVW A;  2B3S A;  2GS3 A;  5F0G A;  4I2U A;  3P90 A;  4MF7 A;  5HFI A;  2PGT A;  2WZ9 A;  4TXO B;  2MMN A;  5FT3 A;  3GSS A;  1MD4 A;  3VFI A;  3GMF A;  4ZBD A;  1JZW A;  1DSB A;  3CSI A;  4HQS A;  2H19 A;  1FAA A;  2VOC A;  3WGX A;  4EUY A;  4ISD A;  4V2L A;  4D73 B;  3CYN A;  2VCZ A;  1Y6E A;  5F8B A;  2MMZ A;  4KE3 A;  2VCV A;  4G10 A;  3GX0 A;  1QUW A;  2I3Y A;  1Z9H A;  1SJI A;  4XS4 A;  1AC1 A;  3A2X A;  3VK9 A;  2C0G A;  4OFM A;  5HR1 A;  5ELA A;  3CSJ A;  1GUH A;  1SYR A;  2OKA A;  4EO3 A;  13GS A;  3PPU A;  2JU5 A;  2V41 A;  3NIV A;  2CQ9 A;  3ZLP A;  5D9T A;  2WGR A;  4PUF C;  1BAY A;  4MH3 A;  3VPQ A;  2R6K A;  1VF2 A;  4KX4 A;  1PKW A;  2H73 A;  5LCZ A;  2IMD A;  2DJJ A;  4G2E A;  3GUS A;  4JRR A;  5H5R A;  4IKH A;  3D4M A;  4TXO A;  3FHK A;  3M9K A;  4NMU A;  2F51 A;  1WJK A;  3RPN A;  4ECC A;  2FLS A;  2K18 A;  3A5I A;  1H75 A;  4MH2 A;  2CAI A;  2DLX A;  2H6Z A;  2XC2 A;  1R4W A;  5ECH B;  2OJL A;  1H4O A;  3KP9 A;  1I9D A;  1TK0 B;  3D6I A;  2HNL A;  2GDR A;  1F6M C;  4EVM A;  3EYT A;  1OE8 A;  3QFA C;  2TIR A;  2DMM A;  3FY7 A;  4J2F A;  4FYU A;  3WT1 A;  18GS A;  3C73 A;  4JED A;  2YP6 A;  1EGO A;  2MZC A;  3LOR A;  3HXS A;  3KMN A;  5KN2 A;  1WPI A;  4MA9 A;  1QFN A;  2K9F A;  2GVP A;  1TXX A;  4LLR A;  4Q5F A;  5DAL B;  1X9S B;  4X0X A;  3TOU A;  5IMD A;  4ECB A;  3GKX A;  1K0N A;  2QA2 A;  4GQF A;  4A5P A;  1A2J A;  2EIQ A;  5FWG A;  2H70 A;  4NV2 A;  2VLU A;  5L71 A;  1O7U A;  2C3T A;  4KSO A;  3US3 A;  3FZ5 A;  1T7P B;  1A24 A;  1MDI A;  3DXB A;  4Z7X A;  2PER A;  4MAB A;  2YPM A;  2QC7 A;  1V58 A;  1HNA A;  3U5R E;  10GS A;  3IC8 A;  5IMC A;  5KOW A;  5IMF A;  5H5Q A;  4F2I A;  3EVI A;  4HJM A;  3ME7 A;  4Q5N A;  3FZA A;  1O85 A;  1XW6 A;  3DRN A;  3IOS A;  3QDN A;  2FGX A;  4AJ7 A;  3FW2 A;  3IAS 2;  1DUG A;  3F0I A;  4G0L A;  2L57 A;  5KOX A;  1TK5 B;  1WE0 A;  3A3T A;  2IMF A;  3EC3 A;  3KM6 A;  4MK3 A;  2E7P A;  4TVE A;  4O5Q A;  2WCI A;  3ZVJ D;  3LXT A;  1UC7 A;  3IRA A;  3CRU A;  4TXV A;  4WXT A;  2I4A A;  5DAL A;  1FHE A;  1XBS A;  3BOA A;  4KUN A;  5ECL B;  3FZ4 A;  4ICY A;  1TRW A;  1GWC A;  3ZRD A;  1TI3 A;  2V6O A;  5F07 A;  5F06 A;  1O8X A;  1SL0 B;  5A5K A;  3HY2 A;  4TR0 A;  2H01 A;  1X5E A;  4PQI A;  4HSC X;  3MIX A;  3U6V A;  1WOU A;  3M1G A;  4RI7 A;  3FR6 A;  4XCS A;  3KGK A;  3FYG A;  5JWO B;  4POM A;  2B5E A;  3QAG A;  2AYT A;  2JAD A;  11GS A;  4J56 E;  1E6B A;  5H5S A;  2E0Q A;  1B9X C;  4IJI A;  1F3B A;  4EC0 A;  3K8N A;  2OAD A;  14GS A;  5G5E A;  5G2Z A;  4O5R A;  3GRX A;  1XWG A;  3A2V A;  3SWL A;  1MDJ A;  3QFB C;  1A2M A;  2YZU A;  2J23 A;  1HNC A;  2VLT A;  2NVL A;  1EWX A;  5HFK A;  5DQY A;  1O8W A;  2C0E A;  4G0I A;  1SJZ A;  4MPG A;  3GKM A;  5EL8 A;  1V40 A;  5D8I A;  1VF3 A;  1XFL A;  1EOH A;  3UBK A;  2V32 A;  1GRX A;  1XCC A;  4CW9 A;  3FZ9 A;  1XWC A;  2H1G A;  2YV7 A;  1C72 A;  2H75 A;  6GSY A;  4K7O A;  2GQK A;  5DAK B;  3E9J B;  3IA1 A;  2OE1 A;  4BVX B;  4KDX A;  5GZZ B;  5ID2 B;  3J7Y k;  2LRT A;  1GSF A;  4IN0 A;  4ID0 A;  3MSZ A;  1X9W B;  2N5B A;  3TJF A;  1OE7 A;  3F8U A;  2V2G A;  2O89 A;  2OA7 A;  2PVO C;  1PN9 A;  2ZUP A;  4KCA A;  3VI5 A;  3VWU A;  3GV1 A;  4IJ3 A;  2H66 A;  3MAK A;  4AF2 A;  3V1W A;  4PNG A;  3KH7 A;  1B9Y C;  4KND A;  5CAX A;  3ZML A;  4AJ6 A;  3TRQ A;  2VAF A;  3FKF A;  2HSH A;  6GSS A;  1U88 A;  3KZQ A;  2EC4 A;  3ZFB A;  2FWE A;  3RBT A;  4K1F A;  1M0U A;  4PUA A;  5IOW A;  3P7X A;  2QKE A;  1A0R P;  4ML1 A;  3HZ8 A;  4PQ1 A;  3MWH A;  1YKC A;  4FYB A;  4P3Y B;  1SKS B;  2NPB A;  2G0F A;  4IQ1 A;  5GAP D;  2E2G A;  4WKW A;  5GAN D;  2PWJ A;  3GX8 A;  3L0H A;  3GH9 A;  2VL9 A;  4HDE A;  4ZL9 A;  1M9A A;  2NDO A;  2M72 A;  1EP8 A;  1R5A A;  3GL3 A;  4BVX A;  1BX9 A;  2GZZ A;  5ID2 A;  4LMV A;  3LSZ A;  3UIW A;  2LKU A;  3UVT A;  2TRC P;  4HEA 2;  2LUS A;  2D2Z A;  4MCU A;  2UZ8 A;  1QGV A;  3N5O A;  4GSS A;  2YJ7 A;  1ABA A;  2YJH A;  3M0F A;  1N2A A;  4IP1 A;  2GGT A;  4ZB8 A;  4KAE A;  1QQ2 A;  1T3B A;  2VUP A;  4KW6 A;  2YN1 A;  2VL2 A;  2IIY A;  3WGD A;  3QMX A;  2X99 A;  3APQ A;  2I1U A;  1GTA A;  3DVX A;  2LEG A;  4POB A;  1B4P A;  1V2A A;  5AGY A;  4CHS A;  1JFU A;  1XWA A;  2AV4 A;  4IS0 A;  2GSQ A;  1GLQ A;  2MYG A;  2BTO T;  1JHB A;  1NHY A;  3TKS E;  1JZR A;  2KOK A;  2PU9 C;  1SJ6 A;  2C8U A;  3A5W A;  4XS4 B;  1TP9 A;  2H76 A;  1ZYN A;  1WP0 A;  5ECO B;  2WS2 A;  2GQL A;  3FEU A;  2GZY A;  4L5O A;  5IM9 A;  1XWB A;  3GN3 A;  2IN3 A;  3IPZ A;  2YAN A;  1GP1 A;  3HJP A;  4LMW A;  3I6A A;  3TJK A;  3CSH A;  3H79 A;  2YV9 A;  3GHA A;  3RDW A;  2VD0 A;  3MYD A;  1PKZ A;  3H8Q A;  3G9B A;  2GLR A;  2KHP A;  1M7T A;  4POK A;  5CRE A;  1ZZY A;  1M2D A;  1XVQ A;  4IBP A;  3EU4 A;  5B8A A;  4GF0 A;  4FO5 A;  4TR1 A;  2GSS A;  4K0G A;  1TW9 A;  5C04 A;  1K3O A;  3PR8 A;  2LRC A;  3DYR A;  4V2M A;  4BL7 A;  1DE2 A;  1Q4J A;  4USS A;  2BJX A;  2HZF A;  2VO4 A;  3VWW A;  4IVF A;  2HRK A;  2ON5 A;  5D9V A;  2YWN A;  2TRX A;  5HR2 A;  1K0M A;  1PSQ A;  3IHQ A;  5IPG A;  5CNW A;  1USB A;  5DDL A;  4F82 A;  3J7Y b;  3H93 A;  2OAC A;  1M9B A;  3UMA A;  2LQQ A;  2X49 A;  2GSR A;  3EU3 A;  3C71 A;  2HE3 A;  1OAZ A;  1YDK A;  4YQV A;  3TJB A;  2X8C A;  3UJ1 A;  4WET A;  4EKZ A;  1XVW A;  5LNK e;  3QAV A;  3VUR A;  4TRX A;  1EZK A;  1A8L A;  5C00 A;  3D0Z A;  3L9U A;  5G5F A;  1IYI A;  5IOX A;  1HQO A;  2FD3 A;  2F8F A;  3GTU A;  1ON4 A;  5E4W A;  4KCE A;  2GQM A;  3ED3 A;  3WYW A;  5JCG A;  2O85 A;  2WRT A;  1KBN A;  3CTG A;  2L6D A;  4NV5 A;  3O3T A;  4HOJ A;  3W8S A;  1K0D A;  1UVZ A;  1LJR A;  1OKD A;  2REM A;  3BD2 A;  4GXZ A;  1GTI A;  5D73 A;  4F9Z A;  4O32 A;  1SK0 A;  5DVB A;  3TB2 A;  3CTF A;  2PPT A;  3IDV A;  12GS A;  5D9W A;  4OCF A;  1OC8 A;  1J9B A;  1ERT A;  2JAC A;  7GSS A;  1AQV A;  1G6Y A;  4O5U A;  1KTE A;  4MP4 A;  2V6K A;  1TOF A;  1TI1 A;  4N0Z A;  3I43 A;  3FRC A;  4ZBB A;  2OE3 A;  1FB0 A;  3KD0 A;  1YEP A;  2AHE A;  3CQF A;  1S3C A;  4WR5 A;  2R0C A;  3LQ7 A;  5J3R A;  4IQA A;  1TRS A;  2DJ3 A;  2HRN A;  2R0P A;  3ZVJ A;  3M8N A;  4Q5R A;  2LTK A;  2H0H A;  2PBJ A;  2HZE A;  4NHW A;  2FA8 A;  2V1M A;  3VWX A;  2ZNM A;  4JZQ A;  1NSW A;  4TW5 A;  1HD2 A;  3IE3 A;  5ECI B;  5B6M A;  3CXG A;  4MJB A;  2GZP A;  3HD5 A;  3IAM 2;  1ML6 A;  3TGZ A;  4RUV A;  2IMK A;  5HR0 A;  4V1A p;  2K6V A;  4IHU A;  4N30 A;  2OBK A;  1SK1 A;  2L4C A;  2CX3 A;  5J41 A;  2LNS A;  1OVN A;  1XOB A;  5AN1 A;  3NZN A;  5ECK B;  3HVS A;  5J5N A;  1WWJ A;  1M2B A;  1XOA A;  5FHI A;  1QMV A;  4MDC A;  4NWY A;  4MLY A;  2HFD A;  3F4T A;  4HZ2 A;  1CQG A;  1NHO A;  9GSS A;  2H1D A;  2YZH A;  4DSS A;  5DJM A;  2C0F A;  4K5S A;  4BPY A;  1Z7P A;  1GSQ A;  3TKQ A;  2X64 A;  3HCZ A;  4RI6 A;  5HQP A;  5IMA A;  1G7O A;  4YKG A;  4MMM A;  2A4V A;  2B7J A;  4EXJ A;  5EPF A;  3WGE A;  4KH7 A;  2DSA A;  1M99 A;  3KTL A;  2NBS A;  4OMV A;  3ZRE A;  4X4J A;  5EVO A;  1Z7R A;  4QL7 A;  1N8J A;  3G7Y A;  3KH9 A;  3GFK A;  4KF9 A;  4HI7 A;  2JSZ A;  4IGJ A;  1DE1 A;  5CRW A;  4E8H A;  1F9M A;  4BWS A;  2HSM A;  3TKS A;  2IL3 A;  3DD3 A;  4POL A;  4CY6 A;  2YWO A;  1PL2 A;  4KSM A;  2H74 A;  1F3A A;  4F0C A;  3C1R A;  2RII A;  3HZ4 A;  1R26 A;  2LV3 A;  5CRG A;  4EL1 A;  3ZFL A;  4PQH A;  2FWF A;  1VF4 A;  4LA1 A;  5KN3 A;  1TRV A;  2DKI A;  2HLS A;  4BWQ A;  2NTO A;  4WR4 A;  5LD0 A;  3L9S A;  3CRT A;  4KDY A;  3G7I A;  1EP7 A;  1E2Y A;  1T8E B;  4CDO A;  1LU4 A;  1EV9 A;  2CX4 A;  3BCI A;  2LJA A;  3M9J A;  3CMI A;  3F63 A;  3GL5 A;  2DBC A;  3UAP A;  4FH8 A;  1OC9 B;  1JZO A;  2DJ1 A;  5CP1 A;  5G31 A;  4MJC A;  2A2S A;  4N10 A;  3KMO A;  3P2A A;  5KEJ A;  2CV4 A;  4V2N A;  2MBS A;  4IP6 A;  1PQN A;  2B5X A;  5CRH A;  1K3Y A;  2RM6 A;  2KP2 A;  2R4V A;  1YZX A;  4MJE A;  4F0B A;  3HJO A;  3N9J A;  5INY A;  3GUR A;  3CBU A;  5CRD A;  2L5O A;  2H1A A;  1WRY A;  2XHF A;  5DQS A;  4I2T A;  1Z5Y E;  3QOU A;  1XWK A;  4LL4 B;  4XTS A;  2CA8 A;  3GKK A;  2F3M A;  2B1K A;  3EWL A;  2H6X A;  2H6Y A;  3E0U A;  6GSX A;  1YJ6 A;  1AQW A;  3C7M A;  1ZYE A;  3LJR A;  1FVK A;  3ZYW A;  1SKR B;  3GH6 A;  5JCU A;  2CZ2 A;  5KN1 A;  4GCI A;  3KIJ A;  4V1A g;  1A8Y A;  4IW9 A;  3EMP A;  3TCO A;  4I5Q A;  1ZMA A;  2X4A A;  4F03 A;  3GNJ A;  3LGC A;  5JWR B;  3EMX A;  3KJY A;  4IEL A;  3LXZ A;  3ZIJ A;  2AAW A;  1OC9 A;  2IMI A;  3DML A;  4ULX A;  1FVJ A;  1SU9 A;  1O73 A;  1GL8 A;  2P5Q A;  4RQX A;  3UOM A;  3DGQ A;  2RLI A;  1THX A;  2CAQ A;  4HS1 A;  2YWI A;  4GQC A;  1MDK A;  3IHG A;  4OD7 A;  3QCP A;  1HYU A;  1AIU A;  5DBQ A;  1TU8 A;  4H86 A;  1I5G A;  1PX7 A;  1EV4 A;  3A2W A;  1K0O A;  1YY7 A;  3Q74 A;  4JR4 A;  5J9B A;  4Z2T A;  3BBY A;  1GUL A;  4L8E A;  3TKS C;  4K7N A;  2JSY A;  3F4R A;  2B6M A;  2K8S A;  5D93 A;  1BYE A;  3LG6 A;  4PUR A;  2VD1 A;  2C4J A;  2KLX A;  3UAR A;  2Z9S A;  4N0V A;  3E3E A;  4MZW A;  3IK9 A;  2KUC A;  2LST A;  1GTU A;  2AUV A;  4ECI A;  2DJ2 A;  3GST A;  4K2D A;  2XBQ A;  2FNO A;  5JCW A;  3APO A;  3EPT A;  4TR1 B;  3FR9 A;  3HHV A;  5DCG A;  1ERU A;  1M2A A;  2C1Y A;  3FMW A;  3PGT A;  4HUA A;  2CVK A;  1VGL A;  4TR4 A;  3LWA A;  5GSS A; 
#chains in the Genus database with same CATH homology
 4O7H A;  1TJD A;  4BL7 B;  5HR3 A;  1EEM A;  1FO5 A;  4MZB A;  4DEJ A;  1X5D A;  3LW9 A;  1ACV A;  3TOT A;  2LJK A;  5IIZ A;  2WDU A;  5BRT A;  1J08 A;  1K0A A;  4N11 A;  2C3Q A;  2DIY A;  4KA0 A;  2B5Y A;  2K8V A;  5CYY A;  3H4K A;  1XZO A;  5ELG A;  1GSU A;  4BA7 A;  4WF5 A;  4YAV A;  4G0K A;  5ECS A;  2HI7 A;  4WBR D;  4DSR A;  3D22 A;  4BVY B;  1BG5 A;  1KEB A;  2HYX A;  1WIK A;  4ZIL A;  4WBJ A;  2WB9 A;  3HVX A;  2VCQ A;  2IPA A;  3EE2 A;  2VLV A;  4XRD A;  5COH A;  4GLT A;  2FA4 A;  3LYK A;  2O7K A;  3VWV A;  3TKP A;  1U6T A;  1AW9 A;  3GTU B;  3PH9 A;  2VM2 A;  1EGR A;  1T1V A;  2P0G A;  3AY8 A;  4XS1 A;  1XIY A;  3IXR A;  4OCE A;  2HT9 A;  1ILO A;  2HRF A;  4OO4 A;  4ECJ A;  3ZL5 A;  4MNN A;  2LNT A;  4NAX A;  4HU9 A;  1T00 A;  2IFQ B;  3GYK A;  2RUE A;  4PNF A;  4NPB A;  1TRU A;  4OWY A;  4JU5 A;  2H1B A;  4HJ2 A;  2FUG 2;  4MPF A;  2GTU A;  4NXI A;  1BQ7 A;  4OFT A;  2YWM A;  4X1U A;  1PL1 A;  2DKH A;  4LL1 B;  17GS A;  20GS A;  2VL2 C;  1R7H A;  3QR6 A;  2P5R A;  2OBI A;  2XBI A;  4BVY A;  2BMX A;  3ZMK A;  2FCH A;  2P31 A;  3DWV A;  5ECN B;  3TRP A;  3W6G A;  1AUC A;  3BJ5 A;  3TUE A;  1IYH A;  1R5P A;  3Q6O A;  1GUM A;  2HZE B;  2FWH A;  4GRF A;  1G7E A;  1HNB A;  3F6F A;  2AJQ B;  5F05 A;  2L4Q A;  1GNE A;  3L9V A;  4ZXG A;  2L6C A;  2E2M A;  4ZL7 A;  4PXO A;  3O76 A;  5KN0 A;  3O6T A;  5J4U A;  1ZOF A;  3I9V 2;  3TJG A;  1B48 A;  1QK8 A;  2IFQ A;  3KEB A;  2H0G A;  4XIH A;  4D73 A;  1SEN A;  2H8L A;  3IC4 A;  2X8H A;  2R2J A;  1XW9 A;  3F9U A;  4OO5 A;  3LEF A;  6GSW A;  2A4H A;  2LRN A;  1PA3 A;  1T4Z A;  3C8E A;  4PGT A;  2H72 A;  1TDI A;  4EIQ A;  2GT6 A;  4DSS B;  1U3A A;  4QQ7 A;  4Q5Q A;  2RUF A;  4ZL8 A;  1V98 A;  3UBL A;  3VI7 A;  1U3I A;  4ML6 A;  3G7J A;  3ZIV A;  2DJ0 A;  1PRX A;  4YH2 A;  5G1L A;  2LJR A;  3IK7 A;  5G1K A;  22GS A;  3TDG A;  4HZ4 A;  4K5R A;  3TKR A;  6GSV A;  1ZYP A;  3VLN A;  3UL3 A;  1SL1 B;  3DEX A;  2WFC A;  1Z3E A;  2PN8 A;  4HU7 A;  5A4W A;  3P8W A;  3HVV A;  5IMZ A;  1FOH A;  5DJL A;  5J9C A;  1BED A;  3R3E A;  2JL4 A;  2H0I A;  1XPV A;  2R3X A;  3F3R A;  5AIV A;  5IQY A;  2B7K A;  4J57 E;  4PTS A;  1VRS D;  4XRA A;  1G0T A;  5E59 A;  4GTU A;  4K7I A;  4QL9 A;  2EIO A;  5B8B A;  5GST A;  3APS A;  3M3M A;  2C80 A;  2IWT A;  1B8X A;  1FG4 A;  2VL3 A;  1S3D A;  1OKT A;  3GIX A;  4TR3 A;  16GS A;  1YF1 A;  4MF5 A;  1PD2 1;  1K0B A;  1GSE A;  4GSN A;  5ECP B;  4K0N A;  1GH2 A;  2ALB A;  5EY6 A;  1OYJ A;  3RHC A;  8GSS A;  1ZL9 A;  3RAZ A;  4EE0 A;  2GT5 A;  2JZT A;  2YNX A;  5IPH A;  4FQU A;  3RPP A;  4WF4 A;  3QAW A;  1GLP A;  4OFN A;  2YOI A;  1OC3 A;  3IV4 A;  3VPT A;  3I69 A;  1FW1 A;  3UEM A;  4E8E A;  4X43 A;  2J9H A;  3QPM A;  4FYC A;  1BJX A;  2I9H A;  4L5L A;  4O92 A;  3FR3 A;  1K0C A;  3D4T A;  2H30 A;  1SD8 A;  1VF1 A;  3H1N A;  1EEJ A;  3JCM L;  4EIP A;  3W8J A;  5D96 A;  4YQU A;  5IMV A;  4EDZ A;  3C1S A;  5ECM B;  2O87 A;  3QD9 A;  1G6W A;  1K3L A;  5AIX A;  4K2X A;  3KCM A;  5A4V A;  4I8B A;  2M46 A;  1FOV A;  1RQM A;  2AB6 A;  2QSI A;  2CVB A;  3OR5 A;  1XW5 A;  1QXH A;  1ZYQ B;  5A4U A;  3IR4 A;  3LYP A;  2I81 A;  1TKD B;  1GTB A;  3HKR A;  1MD3 A;  3KXO A;  1U87 A;  1X0R A;  2CVD A;  5BMU A;  5ECR B;  2DJK A;  5HFG A;  1A0F A;  1JLW A;  1AXD A;  1O6J A;  2VIM A;  2B1L A;  4YQM A;  4GWR A;  2HXK A;  2IME A;  2LQO A;  4MF6 A;  3MNG A;  4PX1 A;  5ECQ B;  2N5A A;  2MBT A;  1A2L A;  1SD9 A;  3WD6 A;  2C0D A;  4ZB6 A;  1Z6M A;  2WUL A;  3F6D A;  5G30 A;  1WMJ A;  2C3N A;  2ZCT A;  4Z2R A;  1URM A;  2N5F A;  1ZCP A;  3GKN A;  3DKS A;  19GS A;  2EIR A;  3WT2 A;  3HA9 A;  3UVH A;  4G19 A;  3HJM A;  1PX6 A;  3SBC A;  2DML A;  2HRA A;  1YKA A;  1RK4 A;  5ENU A;  5B6N A;  4I6X A;  2VCT A;  1V57 A;  2XPD A;  3MDK A;  4KB3 A;  2FHE A;  2MMO A;  1T4Y A;  4EF0 A;  4L0W A;  4ZB9 A;  4WEY A;  2ES7 A;  1UN2 A;  2JZR A;  1AAZ A;  2H71 A;  3TRX A;  4Z2U A;  2HSY A;  2R0G A;  2FY6 A;  5D9X A;  1Q98 A;  4JBB A;  3IBH A;  2F8A A;  2JZS A;  3ERW A;  3HYP A;  3GA4 A;  3EUR A;  5DCH A;  1DBY A;  3HDC A;  4YAP A;  4K8M A;  1W4V A;  2A2R A;  1GUK A;  3F4S A;  2PUK C;  1THO A;  2LS5 A;  3TJJ A;  3ISO A;  3D21 A;  1F37 A;  4XS6 A;  3ERG A;  1A23 A;  2CT6 A;  5DAK A;  5JWQ B;  1LBK A;  3Q19 A;  5B7C A;  3EIN A;  2MMA A;  4YKF A;  1S3A A;  4K6X A;  1Y25 A;  2M80 A;  2L59 A;  4XHM A;  1W89 A;  1CQH A;  1YEX A;  2GST A;  3L4N A;  1EOG A;  2L5L A;  4CY8 A;  4K9Z A;  2QGV A;  1F2E A;  2VCW A;  2RM5 A;  4NHZ A;  4TOP A;  1JZD A;  3LFL A;  4RQR A;  5CO3 A;  1UA5 A;  1ERV A;  1RW1 A;  3ZIT A;  4KGI A;  1J0F A;  1X9M B;  4MZC A;  4KDU A;  1GNW A;  2PMT A;  3ERF A;  3FK8 A;  2DC5 A;  1GSY A;  1ST9 A;  2VCX A;  2R37 A;  4G9H A;  4ZIJ A;  4JR6 A;  6GSU A;  2WJU A;  5IO0 A;  4MJA A;  1X5C A;  4TKY A;  4JE1 A;  1JLV A;  3ZTL A;  4ACS A;  1FB6 A;  4ZBA A;  4HQZ A;  1NM3 A;  1O81 A;  2DIZ A;  1NW2 A;  1GSS A;  1PN0 A;  1GSD A;  3S9F A;  1KNG A;  4GST A;  2FWG A;  4AGS A;  1MEK A;  1SKW B;  2F9S A;  3BCK A;  1YQ1 A;  3ME8 A;  2O8V B;  2A2P A;  3RHB A;  1SL2 B;  3KTB A;  2R5G A;  1ERW A;  3PIN A;  6GST A;  2OE0 A;  1PGT A;  2YCD A;  4DSQ A;  2CZ3 A;  2VM1 A;  2XPE A;  3Q18 A;  4FIW A;  1B4Q A;  4DVC A;  1Z6N A;  1YF0 A;  3DIE A;  4TN8 A;  3L78 A;  3F3Q A;  3NOF A;  1PMT A;  3ZZX A;  4L0U A;  1SK2 A;  5IO2 A;  1TU7 A;  1TTZ A;  1SYX A;  4EDY A;  2IJY A;  4I97 A;  2PVQ A;  2ON7 A;  5AIS A;  1TK8 B;  3KP8 A;  4ILF A;  2KP1 A;  1ZGN A;  3R2Q A;  1V9W A;  2G2Q A;  2X8G A;  1AQX A;  1MTC A;  2QA1 A;  5ABR A;  3D5J A;  1XXU A;  4AJ8 A;  3DVW A;  2B3S A;  2GS3 A;  5F0G A;  4I2U A;  3P90 A;  4MF7 A;  5HFI A;  2PGT A;  2WZ9 A;  4TXO B;  2MMN A;  5FT3 A;  3GSS A;  1MD4 A;  3VFI A;  3GMF A;  4ZBD A;  1JZW A;  1DSB A;  3CSI A;  4HQS A;  2H19 A;  1FAA A;  2VOC A;  3WGX A;  4EUY A;  4ISD A;  4V2L A;  4D73 B;  3CYN A;  2VCZ A;  1Y6E A;  5F8B A;  2MMZ A;  4KE3 A;  2VCV A;  4G10 A;  3GX0 A;  1QUW A;  2I3Y A;  1Z9H A;  1SJI A;  4XS4 A;  1AC1 A;  3A2X A;  3VK9 A;  2C0G A;  4OFM A;  5HR1 A;  5ELA A;  3CSJ A;  1GUH A;  1SYR A;  2OKA A;  4EO3 A;  13GS A;  3PPU A;  2JU5 A;  2V41 A;  3NIV A;  2CQ9 A;  3ZLP A;  5D9T A;  2WGR A;  4PUF C;  1BAY A;  4MH3 A;  3VPQ A;  2R6K A;  1VF2 A;  4KX4 A;  1PKW A;  2H73 A;  5LCZ A;  2IMD A;  2DJJ A;  4G2E A;  3GUS A;  4JRR A;  5H5R A;  4IKH A;  3D4M A;  4TXO A;  3FHK A;  3M9K A;  4NMU A;  2F51 A;  1WJK A;  3RPN A;  4ECC A;  2FLS A;  2K18 A;  3A5I A;  1H75 A;  4MH2 A;  2CAI A;  2DLX A;  2H6Z A;  2XC2 A;  1R4W A;  5ECH B;  2OJL A;  1H4O A;  3KP9 A;  1I9D A;  1TK0 B;  3D6I A;  2HNL A;  2GDR A;  1F6M C;  4EVM A;  3EYT A;  1OE8 A;  3QFA C;  2TIR A;  2DMM A;  3FY7 A;  4J2F A;  4FYU A;  3WT1 A;  18GS A;  3C73 A;  4JED A;  2YP6 A;  1EGO A;  2MZC A;  3LOR A;  3HXS A;  3KMN A;  5KN2 A;  1WPI A;  4MA9 A;  1QFN A;  2K9F A;  2GVP A;  1TXX A;  4LLR A;  4Q5F A;  5DAL B;  1X9S B;  4X0X A;  3TOU A;  5IMD A;  4ECB A;  3GKX A;  1K0N A;  2QA2 A;  4GQF A;  4A5P A;  1A2J A;  2EIQ A;  5FWG A;  2H70 A;  4NV2 A;  2VLU A;  5L71 A;  1O7U A;  2C3T A;  4KSO A;  3US3 A;  3FZ5 A;  1T7P B;  1A24 A;  1MDI A;  3DXB A;  4Z7X A;  2PER A;  4MAB A;  2YPM A;  2QC7 A;  1V58 A;  1HNA A;  3U5R E;  10GS A;  3IC8 A;  5IMC A;  5KOW A;  5IMF A;  5H5Q A;  4F2I A;  3EVI A;  4HJM A;  3ME7 A;  4Q5N A;  3FZA A;  1O85 A;  1XW6 A;  3DRN A;  3IOS A;  3QDN A;  2FGX A;  4AJ7 A;  3FW2 A;  3IAS 2;  1DUG A;  3F0I A;  4G0L A;  2L57 A;  5KOX A;  1TK5 B;  1WE0 A;  3A3T A;  2IMF A;  3EC3 A;  3KM6 A;  4MK3 A;  2E7P A;  4TVE A;  4O5Q A;  2WCI A;  3ZVJ D;  3LXT A;  1UC7 A;  3IRA A;  3CRU A;  4TXV A;  4WXT A;  2I4A A;  5DAL A;  1FHE A;  1XBS A;  3BOA A;  4KUN A;  5ECL B;  3FZ4 A;  4ICY A;  1TRW A;  1GWC A;  3ZRD A;  1TI3 A;  2V6O A;  5F07 A;  5F06 A;  1O8X A;  1SL0 B;  5A5K A;  3HY2 A;  4TR0 A;  2H01 A;  1X5E A;  4PQI A;  3MIX A;  3U6V A;  1WOU A;  3M1G A;  4RI7 A;  3FR6 A;  4XCS A;  3KGK A;  3FYG A;  5JWO B;  4POM A;  2B5E A;  3QAG A;  2AYT A;  2JAD A;  11GS A;  4J56 E;  1E6B A;  5H5S A;  2E0Q A;  1B9X C;  4IJI A;  1F3B A;  4EC0 A;  3K8N A;  2OAD A;  14GS A;  5G5E A;  5G2Z A;  4O5R A;  3GRX A;  1XWG A;  3A2V A;  3SWL A;  1MDJ A;  3QFB C;  1A2M A;  2YZU A;  2J23 A;  1HNC A;  2VLT A;  2NVL A;  1EWX A;  5HFK A;  5DQY A;  1O8W A;  2C0E A;  4G0I A;  1SJZ A;  4MPG A;  3GKM A;  5EL8 A;  1V40 A;  5D8I A;  1VF3 A;  1XFL A;  1EOH A;  3UBK A;  2V32 A;  1GRX A;  1XCC A;  4CW9 A;  3FZ9 A;  1XWC A;  2H1G A;  2YV7 A;  1C72 A;  2H75 A;  6GSY A;  4K7O A;  2GQK A;  5DAK B;  3E9J B;  3IA1 A;  2OE1 A;  4BVX B;  4KDX A;  5GZZ B;  5ID2 B;  3J7Y k;  2LRT A;  1GSF A;  4IN0 A;  4ID0 A;  3MSZ A;  1X9W B;  2N5B A;  3TJF A;  1OE7 A;  3F8U A;  2V2G A;  2O89 A;  2OA7 A;  2PVO C;  1PN9 A;  2ZUP A;  4KCA A;  3VI5 A;  3VWU A;  3GV1 A;  4IJ3 A;  2H66 A;  3MAK A;  4AF2 A;  3V1W A;  4PNG A;  3KH7 A;  1B9Y C;  4KND A;  5CAX A;  3ZML A;  4AJ6 A;  3TRQ A;  2VAF A;  3FKF A;  2HSH A;  6GSS A;  1U88 A;  3KZQ A;  2EC4 A;  3ZFB A;  2FWE A;  3RBT A;  4K1F A;  1M0U A;  4PUA A;  5IOW A;  3P7X A;  2QKE A;  1A0R P;  4ML1 A;  3HZ8 A;  4PQ1 A;  3MWH A;  1YKC A;  4FYB A;  4P3Y B;  1SKS B;  2NPB A;  2G0F A;  4IQ1 A;  5GAP D;  2E2G A;  4WKW A;  5GAN D;  2PWJ A;  3GX8 A;  3L0H A;  3GH9 A;  2VL9 A;  4HDE A;  4ZL9 A;  1M9A A;  2NDO A;  2M72 A;  1EP8 A;  1R5A A;  3GL3 A;  4BVX A;  1BX9 A;  2GZZ A;  5ID2 A;  4LMV A;  3LSZ A;  3UIW A;  2LKU A;  3UVT A;  2TRC P;  4HEA 2;  2LUS A;  2D2Z A;  4MCU A;  2UZ8 A;  1QGV A;  3N5O A;  4GSS A;  2YJ7 A;  1ABA A;  2YJH A;  3M0F A;  1N2A A;  4IP1 A;  2GGT A;  4ZB8 A;  4KAE A;  1QQ2 A;  1T3B A;  2VUP A;  4KW6 A;  2YN1 A;  2VL2 A;  2IIY A;  3WGD A;  3QMX A;  2X99 A;  3APQ A;  2I1U A;  1GTA A;  3DVX A;  2LEG A;  4POB A;  1B4P A;  1V2A A;  5AGY A;  4CHS A;  1JFU A;  1XWA A;  2AV4 A;  4IS0 A;  2GSQ A;  1GLQ A;  2MYG A;  2BTO T;  1JHB A;  1NHY A;  3TKS E;  1JZR A;  2KOK A;  2PU9 C;  1SJ6 A;  2C8U A;  3A5W A;  4XS4 B;  1TP9 A;  2H76 A;  1ZYN A;  1WP0 A;  5ECO B;  2WS2 A;  2GQL A;  3FEU A;  2GZY A;  4L5O A;  5IM9 A;  1XWB A;  3GN3 A;  2IN3 A;  3IPZ A;  2YAN A;  1GP1 A;  3HJP A;  4LMW A;  3I6A A;  3TJK A;  3CSH A;  3H79 A;  2YV9 A;  3GHA A;  3RDW A;  2VD0 A;  3MYD A;  1PKZ A;  3H8Q A;  3G9B A;  2GLR A;  2KHP A;  1M7T A;  4POK A;  5CRE A;  1ZZY A;  1M2D A;  1XVQ A;  4IBP A;  3EU4 A;  5B8A A;  4GF0 A;  4FO5 A;  4TR1 A;  2GSS A;  4K0G A;  1TW9 A;  5C04 A;  1K3O A;  3PR8 A;  2LRC A;  3DYR A;  4V2M A;  4BL7 A;  1DE2 A;  1Q4J A;  4USS A;  2BJX A;  2HZF A;  2VO4 A;  3VWW A;  4IVF A;  2HRK A;  2ON5 A;  5D9V A;  2YWN A;  2TRX A;  5HR2 A;  1K0M A;  1PSQ A;  3IHQ A;  5IPG A;  5CNW A;  1USB A;  5DDL A;  4F82 A;  3J7Y b;  3H93 A;  2OAC A;  1M9B A;  3UMA A;  2LQQ A;  2X49 A;  2GSR A;  3EU3 A;  3C71 A;  2HE3 A;  1OAZ A;  1YDK A;  4YQV A;  3TJB A;  2X8C A;  3UJ1 A;  4WET A;  4EKZ A;  1XVW A;  5LNK e;  3QAV A;  3VUR A;  4TRX A;  1EZK A;  1A8L A;  5C00 A;  3D0Z A;  3L9U A;  5G5F A;  1IYI A;  5IOX A;  1HQO A;  2FD3 A;  2F8F A;  3GTU A;  1ON4 A;  5E4W A;  4KCE A;  2GQM A;  3ED3 A;  3WYW A;  5JCG A;  2O85 A;  2WRT A;  1KBN A;  3CTG A;  2L6D A;  4NV5 A;  3O3T A;  4HOJ A;  3W8S A;  1K0D A;  1UVZ A;  1LJR A;  1OKD A;  2REM A;  3BD2 A;  4GXZ A;  1GTI A;  5D73 A;  4F9Z A;  4O32 A;  1SK0 A;  5DVB A;  3TB2 A;  3CTF A;  2PPT A;  3IDV A;  12GS A;  5D9W A;  4OCF A;  1OC8 A;  1J9B A;  1ERT A;  2JAC A;  7GSS A;  1AQV A;  1G6Y A;  4O5U A;  1KTE A;  4MP4 A;  2V6K A;  1TOF A;  1TI1 A;  4N0Z A;  3I43 A;  3FRC A;  4ZBB A;  2OE3 A;  1FB0 A;  3KD0 A;  1YEP A;  2AHE A;  1S3C A;  4WR5 A;  2R0C A;  3LQ7 A;  5J3R A;  4IQA A;  1TRS A;  2DJ3 A;  2HRN A;  2R0P A;  3ZVJ A;  3M8N A;  4Q5R A;  2LTK A;  2H0H A;  2PBJ A;  2HZE A;  4NHW A;  2FA8 A;  2V1M A;  3VWX A;  2ZNM A;  4JZQ A;  1NSW A;  4TW5 A;  1HD2 A;  3IE3 A;  5ECI B;  5B6M A;  3CXG A;  4MJB A;  2GZP A;  3HD5 A;  3IAM 2;  1ML6 A;  3TGZ A;  4RUV A;  2IMK A;  5HR0 A;  4V1A p;  2K6V A;  4IHU A;  4N30 A;  2OBK A;  1SK1 A;  2L4C A;  2CX3 A;  5J41 A;  2LNS A;  1OVN A;  1XOB A;  5AN1 A;  3NZN A;  5ECK B;  3HVS A;  5J5N A;  1WWJ A;  1M2B A;  1XOA A;  5FHI A;  1QMV A;  4MDC A;  4NWY A;  4MLY A;  2HFD A;  3F4T A;  4HZ2 A;  1CQG A;  1NHO A;  9GSS A;  2H1D A;  2YZH A;  4DSS A;  5DJM A;  2C0F A;  4K5S A;  4BPY A;  1Z7P A;  1GSQ A;  3TKQ A;  2X64 A;  3HCZ A;  4RI6 A;  5HQP A;  5IMA A;  1G7O A;  4YKG A;  4MMM A;  2A4V A;  2B7J A;  4EXJ A;  5EPF A;  3WGE A;  4KH7 A;  2DSA A;  1M99 A;  3KTL A;  2NBS A;  4OMV A;  3ZRE A;  4X4J A;  5EVO A;  1Z7R A;  4QL7 A;  1N8J A;  3G7Y A;  3KH9 A;  3GFK A;  4KF9 A;  4HI7 A;  2JSZ A;  4IGJ A;  1DE1 A;  5CRW A;  4E8H A;  1F9M A;  4BWS A;  2HSM A;  3TKS A;  2IL3 A;  3DD3 A;  4POL A;  4CY6 A;  2YWO A;  1PL2 A;  4KSM A;  2H74 A;  1F3A A;  4F0C A;  3C1R A;  2RII A;  3HZ4 A;  1R26 A;  2LV3 A;  5CRG A;  4EL1 A;  3ZFL A;  4PQH A;  2FWF A;  1VF4 A;  4LA1 A;  5KN3 A;  1TRV A;  2DKI A;  2HLS A;  4BWQ A;  2NTO A;  4WR4 A;  5LD0 A;  3L9S A;  3CRT A;  4KDY A;  3G7I A;  1EP7 A;  1E2Y A;  1T8E B;  4CDO A;  1LU4 A;  1EV9 A;  2CX4 A;  3BCI A;  2LJA A;  3M9J A;  3CMI A;  3F63 A;  3GL5 A;  2DBC A;  3UAP A;  4FH8 A;  1OC9 B;  1JZO A;  2DJ1 A;  5CP1 A;  5G31 A;  4MJC A;  2A2S A;  4N10 A;  3KMO A;  3P2A A;  5KEJ A;  2CV4 A;  4V2N A;  2MBS A;  4IP6 A;  1PQN A;  2B5X A;  5CRH A;  1K3Y A;  2RM6 A;  2KP2 A;  2R4V A;  1YZX A;  4MJE A;  4F0B A;  3HJO A;  3N9J A;  5INY A;  3GUR A;  3CBU A;  5CRD A;  2L5O A;  2H1A A;  1WRY A;  2XHF A;  5DQS A;  4I2T A;  1Z5Y E;  3QOU A;  1XWK A;  4LL4 B;  4XTS A;  2CA8 A;  3GKK A;  2F3M A;  2B1K A;  3EWL A;  2H6X A;  2H6Y A;  3E0U A;  6GSX A;  1YJ6 A;  1AQW A;  3C7M A;  1ZYE A;  3LJR A;  1FVK A;  3ZYW A;  1SKR B;  3GH6 A;  5JCU A;  2CZ2 A;  5KN1 A;  4GCI A;  3KIJ A;  4V1A g;  1A8Y A;  4IW9 A;  3EMP A;  3TCO A;  4I5Q A;  1ZMA A;  2X4A A;  4F03 A;  3GNJ A;  3LGC A;  5JWR B;  3EMX A;  3KJY A;  4IEL A;  3LXZ A;  3ZIJ A;  2AAW A;  1OC9 A;  2IMI A;  3DML A;  4ULX A;  1FVJ A;  1SU9 A;  1O73 A;  1GL8 A;  2P5Q A;  4RQX A;  3UOM A;  3DGQ A;  2RLI A;  1THX A;  2CAQ A;  4HS1 A;  2YWI A;  4GQC A;  1MDK A;  3IHG A;  4OD7 A;  3QCP A;  1HYU A;  1AIU A;  5DBQ A;  1TU8 A;  4H86 A;  1I5G A;  1PX7 A;  1EV4 A;  3A2W A;  1K0O A;  1YY7 A;  3Q74 A;  4JR4 A;  5J9B A;  4Z2T A;  3BBY A;  1GUL A;  4L8E A;  3TKS C;  4K7N A;  2JSY A;  3F4R A;  2B6M A;  2K8S A;  5D93 A;  1BYE A;  3LG6 A;  4PUR A;  2VD1 A;  2C4J A;  2KLX A;  3UAR A;  2Z9S A;  4N0V A;  3E3E A;  4MZW A;  3IK9 A;  2KUC A;  2LST A;  1GTU A;  2AUV A;  4ECI A;  2DJ2 A;  3GST A;  4K2D A;  2XBQ A;  2FNO A;  5JCW A;  3APO A;  3EPT A;  4TR1 B;  3FR9 A;  3HHV A;  5DCG A;  1ERU A;  1M2A A;  2C1Y A;  3FMW A;  3PGT A;  4HUA A;  2CVK A;  1VGL A;  4TR4 A;  3LWA A;  5GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...