2V1MA

Crystal structure of schistosoma mansoni glutathione peroxidase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
163
structure length
162
Chain Sequence
SWNSIYEFTVKDINGVDVSLEKYRGHVCLIVNVACKGATDKNYRQLQEMHTRLVGKGLRILAFPCNQFGGQEPWAEAEIKKFVTEKYGVQFDMFSKIKVNGSDADDLYKFLKSRQHGTLTNNIKWNFSKFLVDRQGQPVKRYSPTTAPYDIEGDIMELLEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUTATHIONE PEROXIDASE
publication title Combining Crystallography and Molecular Dynamics: The Case of Schistosoma Mansoni Phospholipid Glutathione Peroxidase.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 64
structure length 162
sequence length 163
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2008-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2v1mA00
1Z9HA 4X0XA 2GZYA 1JZWA 2PN8A 5B6NA 3QDNA 4L0WA 1YKCA 2N5BA 2C1YA 3D21A 1GSFA 1OE7A 4TR4A 2YOIA 3KEBA 5JCGA 1TU8A 5J3RA 3QCPA 4MJBA 1PX7A 1U6TA 2M46A 5G1LA 3QAGA 2B1LA 3DIEA 3GL5A 4EL1A 1RW1A 2L4QA 2XC2A 5DJLA 3MWHA 1B9YC 5E59A 3DGQA 3TGZA 1ML6A 1JZOA 2FWEA 3C1SA 2R2JA 1K0BA 4MP4A 5G1KA 3HVXA 4KAEA 4F82A 4OFTA 5HFGA 1A2LA 2MBSA 2LKUA 1H4OA 1TXXA 1O73A 1ZYEA 5ECPB 3P7XA 4ZB9A 1T4YA 2YCDA 3A2VA 1B4QA 1RK4A 2FNOA 5HR1A 5IO2A 4TN8A 2JL4A 5J41A 2CX3A 1GSDA 1U88A 4POMA 3M0FA 1GSQA 1H75A 1U3IA 1TDIA 5LNKe 3MAKA 1EP8A 2KLXA 4EUYA 1E6BA 2O89A 5H5QA 1LU4A 4E8EA 3HJMA 3HD5A 3F6DA 5ELAA 4MJAA 1TI3A 2H1DA 3Q74A 2MBTA 5J9CA 5D9TA 6GSWA 1TRSA 3EMPA 2NPBA 3IK7A 1K3LA 5IMCA 4WBRD 1W89A 1TJDA 2L5OA 1EOHA 1QUWA 3IE3A 1VF3A 5IIZA 4OMVA 1Q98A 3RPNA 2QGVA 4QQ7A 2OADA 1T8EB 2IPAA 1MD3A 3U6VA 3LG6A 1WIKA 1QGVA 1B4PA 2H6YA 2GVPA 2GQKA 3EWLA 3JCML 2TIRA 5L71A 1TK8B 4GCIA 3M3MA 1PX6A 2HZFA 2M72A 3KXOA 1ILOA 1FB6A 2C3NA 1JLWA 4ZBAA 2GSQA 4FYUA 2E2MA 2A2RA 1I9DA 5CREA 1T3BA 1G0TA 2FLSA 1TTZA 4TR0A 1BYEA 2IWTA 1ZGNA 3TKPA 1TRUA 4HS1A 2FY6A 2F8AA 2F8FA 3NIVA 4GRFA 4RQXA 4K1FA 1QFNA 1M2AA 2RM6A 1T7PB 1JHBA 3A2WA 2X8HA 3GA4A 5ECHB 2L59A 3IHQA 2H1AA 4HZ2A 1R7HA 2IFQB 4KCEA 5B8AA 4JEDA 1GRXA 2I9HA 3IPZA 1FW1A 3FZ9A 4AGSA 3H1NA 4WR5A 5INYA 1YZXA 1YDKA 3BCKA 1XIYA 4OFMA 5ECLB 2XBIA 5AIXA 3ZMLA 3KCMA 1ZCPA 3HYPA 5DQYA 2OKAA 4G2EA 5LCZA 3CTGA 2DIZA 5ECQB 4DEJA 2EIRA 3KZQA 3KP9A 4HI7A 1A2JA 1V57A 4KUNA 4MH2A 2OE0A 2CZ2A 2N5FA 1DE1A 3EU3A 1VRSD 22GSA 2GSTA 3GRXA 1XOAA 5C04A 3VWWA 3DYRA 3FR9A 1K0MA 4X43A 1ACVA 4F0CA 3TJKA 1AQWA 2PUKC 1BG5A 2WCIA 4Z7XA 4ECJA 3Q19A 4I97A 1SU9A 3GH9A 1M7TA 2CVBA 2H0HA 3FR3A 1TK5B 4OCEA 5IPHA 1PL2A 2H6XA 3HVSA 2X99A 3HDCA 4ZBBA 4GSTA 3QAWA 2WFCA 3A2XA 5GSTA 4G19A 5D93A 2YWMA 3FK8A 3F63A 1YF0A 3EURA 3M9JA 1V9WA 5HR2A 4NAXA 1SKRB 3H4KA 4WF4A 4HU7A 3APQA 2L57A 1AIUA 2HSHA 1K0OA 2VL3A 1O81A 4F0BA 1SYRA 4IP1A 3VWXA 1THXA 3FHKA 1X9SB 5J4UA 5E4WA 3TKQA 1VF2A 1GP1A 4FO5A 4ZXGA 11GSA 5CRGA 3D22A 1SJIA 2CVKA 3ME7A 2K6VA 3TCOA 3CSIA 4K0NA 4F2IA 4KE3A 4ML6A 1XPVA 1SENA 3VPTA 1K0DA 2O87A 4DSSB 2CA8A 2GLRA 1MEKA 1Y25A 3UVHA 1TRVA 2ZUPA 4ECCA 1YF1A 3GKXA 2CT6A 2H19A 4I2UA 1K0AA 18GSA 2LRTA 5CRDA 4TKYA 5CAXA 1O7UA 2HZEB 1C72A 3GURA 5CYYA 4MF6A 4AJ8A 5EPFA 2A2SA 1S3AA 4ZB6A 2PERA 1Z6NA 3DVWA 3LYKA 4BWQA 1PRXA 1XW6A 2FWGA 4NMUA 4XRAA 5D96A 2EC4A 3AY8A 3ZLPA 6GSYA 2TRXA 3E3EA 3FW2A 4KCAA 1MDKA 4TOPA 1UVZA 2N5AA 3MNGA 4EXJA 3VI7A 3FYGA 4IP6A 2IL3A 2LJRA 2YN1A 1X5EA 1ZYQB 16GSA 2NTOA 7GSSA 4TW5A 1Z7RA 3TJJA 2PVOC 3GSSA 4MH3A 2LNTA 1XWCA 3FZ4A 4MK3A 4RQRA 4GXZA 2GQLA 1PL1A 2G2QA 5J9BA 3TOUA 2H66A 3GYKA 5AN1A 3FKFA 2MYGA 4PX1A 4XCSA 2LRNA 4ISDA 2FCHA 1XOBA 3TRXA 1KBNA 4IJIA 2V6OA 3TKRA 2KOKA 2KUCA 3P2AA 4HU9A 1GUMA 5HR0A 3GKNA 2YJ7A 4I2TA 4POBA 3FRCA 6GSTA 1SL0B 5ABRA 2D2ZA 4WF5A 4XS1A 5IOWA 1LBKA 3TOTA 4XIHA 4XHMA 5HFIA 3IOSA 4ILFA 3L9VA 1IYHA 3DKSA 4DVCA 2LS5A 3UVTA 2RIIA 2I4AA 4YQMA 13GSA 3GKKA 4O7HA 4L8EA 3I69A 4ID0A 3UBKA 2FA8A 1EZKA 2H76A 3D4TA 1QXHA 5A4WA 3HJPA 1F37A 5JWQB 3L9UA 1X5CA 2VL2C 3ME8A 5H5RA 5FHIA 2G0FA 1SJZA 2NVLA 1T00A 3QFBC 3APOA 1A0RP 1HNAA 4EE0A 2B5EA 3ZVJD 1F3AA 4JR4A 4V1Ag 3LJRA 3ZMKA 1YQ1A 1DUGA 2AAWA 2GS3A 4EC0A 1PKWA 4IQAA 2H30A 2MMNA 3LFLA 2PWJA 1XZOA 2NDOA 2IMFA 3GHAA 2IN3A 5KN0A 3S9FA 2DJKA 3A3TA 1OE8A 3M9KA 2M80A 4O5RA 1A0FA 4J57E 3A5WA 3LXTA 1XW5A 4RUVA 5ENUA 4DSRA 2OBIA 5IMAA 2DJJA 2FD3A 2YPMA 4CDOA 2P5RA 2K9FA 2VCXA 1FG4A 3CSHA 3F0IA 3TRQA 3H93A 5ECMB 1GNWA 3NOFA 4KDXA 2DSAA 3DMLA 4GSSA 5ID2A 2VCWA 2CZ3A 2PPTA 1WWJA 1NW2A 3ERWA 5JWRB 5JCUA 1ZOFA 2GSRA 3GTUA 3HJOA 3C7MA 3GIXA 1PGTA 2LTKA 4XS4A 3CSJA 4NV5A 2XBQA 4HDEA 4BA7A 4PNFA 2YP6A 3EINA 1TW9A 4DSSA 4I8BA 2HI7A 4WXTA 1TI1A 4MPFA 3UMAA 3OR5A 5ECSA 1U3AA 1S3CA 1ERUA 1OC9A 2H73A 2PU9C 4QL7A 4MABA 5ECNB 3GNJA 2DMLA 5IMVA 3VI5A 2LEGA 3I9V2 4K2DA 2VL2A 2IJYA 1NHOA 1SJ6A 4POKA 1O8WA 1M9BA 1OVNA 1WOUA 4KX4A 3QFAC 1X9WB 3TDGA 1AAZA 3KD0A 2HZEA 3HZ8A 2CAIA 12GSA 2YWNA 3O76A 2CV4A 4PQHA 4JU5A 1M2BA 3F9UA 4IN0A 2L5LA 4AJ7A 3L4NA 4XTSA 3IDVA 1V58A 1ABAA 2H0IA 4K0GA 4XRDA 2REMA 2X64A 5AISA 3ZIVA 3GFKA 9GSSA 3EMXA 2R3XA 3UOMA 2MMOA 4WR4A 2GSSA 3ERFA 4WKWA 1W4VA 4MMMA 2YJHA 5G30A 4BL7A 1X5DA 3RBTA 2LJAA 5A4UA 1R26A 5A5KA 1URMA 3LORA 1GUKA 3CRUA 4LA1A 5J5NA 1A8LA 2P0GA 5DCHA 1UA5A 3UAPA 2B7KA 2MZCA 3FR6A 4IGJA 1PSQA 1GLQA 1SD9A 4IS0A 2F9SA 1J9BA 1KNGA 1XVWA 2ES7A 4OWYA 2GQMA 3HVVA 4HJMA 2C4JA 5A4VA 1GTIA 4HQZA 2FHEA 2QSIA 3KIJA 1J08A 4EVMA 1CQHA 2H01A 4HOJA 3HA9A 2HRFA 2H72A 1DE2A 3ZIJA 1QMVA 1ST9A 3VWVA 4IHUA 4V2MA 3GH6A 4PXOA 4BVYA 2H8LA 3GX0A 1HYUA 3UEMA 3ED3A 3TB2A 6GSVA 3F3RA 3ZZXA 5DBQA 5ECRB 4CHSA 1R5PA 5ECKB 3VWUA 5CP1A 3KH7A 2H6ZA 2R37A 2HE3A 4KGIA 1T1VA 2FGXA 3TUEA 3F4TA 1VF4A 1XBSA 1A24A 3APSA 3I43A 2K8SA 1GLPA 1SL2B 1X9MB 4FYCA 4IJ3A 3LGCA 3J7Yk 5FT3A 2BTOT 2ALBA 3EE2A 10GSA 1OKTA 4J2FA 1SK1A 1BJXA 5GSSA 2B3SA 4IVFA 3GX8A 2E7PA 4I6XA 2JZRA 4JBBA 1FAAA 4GF0A 1VF1A 4FYBA 2IMKA 2VCQA 6GSUA 5JWOB 1YY7A 3E0UA 5ID2B 5IOXA 1SD8A 3M1GA 2GTUA 2B5YA 4LMWA 3UIWA 2H1GA 1ERVA 4V2NA 3GTUB 4MA9A 4XS4B 1GTUA 1GSYA 4POLA 2LV3A 2C8UA 3PR8A 4G9HA 2P31A 3D5JA 3VPQA 2WB9A 3UJ1A 3QMXA 2YV7A 3F3QA 4I5QA 5F07A 2X8CA 2CX4A 19GSA 4E8HA 3VLNA 1GUHA 4KB3A 2WRTA 2DLXA 3EU4A 2HFDA 5DDLA 1OC9B 1RQMA 2YANA 2A4VA 2VOCA 4IELA 4BWSA 8GSSA 2IMIA 1WE0A 3N9JA 1GSEA 4AF2A 2YV9A 1WPIA 2C80A 2VUPA 5KEJA 4V1Ap 1F2EA 4ZL9A 4HZ4A 1XWAA 2GZPA 3LXZA 1XXUA 2I3YA 3DEXA 3GKMA 1PD21 2QKEA 4CW9A 2DMMA 3O6TA 4MZWA 2R6KA 1R4WA 1EV4A 1XWGA 4YQUA 2H75A 5HQPA 3ZREA 2E2GA 2GDRA 5F05A 3DRNA 4MF7A 1Z7PA 5ELGA 5IMDA 3IR4A 1G6YA 4TR1A 1BQ7A 2KP1A 3HZ4A 4IBPA 4L5OA 1GTBA 2JADA 3UL3A 3GN3A 1QK8A 4GTUA 1OYJA 5AGYA 3US3A 3KMOA 2RM5A 4TVEA 1Z5YE 3H8QA 1NHYA 5IPGA 2O8VB 2DIYA 3F6FA 1ZL9A 2V32A 1V40A 1UN2A 4YAVA 1Z3EA 1G7OA 2VO4A 4OFNA 3WD6A 5D8IA 1KEBA 5H5SA 1MDJA 3MDKA 4K7NA 1GTAA 3QAVA 3HKRA 5DCGA 2YWOA 3D4MA 3BD2A 5F06A 3IK9A 5LD0A 2YNXA 3Q6OA 2LQQA 2VD1A 2DJ2A 2V41A 1M9AA 3CTFA 1EOGA 2GZZA 5B6MA 3IA1A 2IIYA 2PVQA 1HNCA 1O85A 4HJ2A 3I6AA 1SK2A 3L0HA 2VM2A 5DAKB 17GSA 4HQSA 3IAM2 5CNWA 2OBKA 4GSNA 2AHEA 4MJCA 1TKDB 2R4VA 4JRRA 4YH2A 2WS2A 5DALB 3LYPA 4IKHA 2H0GA 5B7CA 3BCIA 3HCZA 5EL8A 3BJ5A 3G7IA 3LEFA 3CRTA 3ZFBA 5GAPD 4Q5NA 5KN2A 1FO5A 5IQYA 1BAYA 3WGEA 5ECIB 4ZL7A 2MMZA 4LLRA 1JFUA 3GV1A 3QR6A 2H1BA 4MPGA 1A2MA 1EP7A 1B48A 1N2AA 3MSZA 1EWXA 2EIOA 2B7JA 1GSUA 1K3OA 5F0GA 4LL4B 3TKSE 1JZDA 2VLUA 1A23A 4DSQA 1PMTA 2XPDA 1EGRA 1PN9A 2LUSA 5IO0A 1XWKA 5G31A 4FH8A 1GNEA 2VM1A 3W8SA 4KH7A 2AJQB 2F51A 2DJ0A 4YAPA 1YEXA 5GAND 1WRYA 5IMFA 1M99A 2CVDA 4HEA2 4Q5FA 2KP2A 4K7OA 1AQXA 1GH2A 3TKSC 2C0GA 2HRNA 3EYTA 4IQ1A 3WGDA 3HXSA 2MMAA 3E9JB 4KSMA 3ZYWA 3KP8A 3W6GA 5ECOB 4K8MA 4NV2A 2VCTA 1E2YA 2FUG2 5COHA 1EV9A 5B8BA 4XS6A 5AIVA 3L9SA 3KMNA 3RDWA 3ZTLA 4X1UA 2BJXA 2JZTA 4TXOB 2RUFA 3ZRDA 4V2LA 1U87A 2J9HA 2B5XA 3DXBA 3UARA 1YEPA 1YKAA 5IMZA 4EKZA 1OC3A 5F8BA 2H74A 2WZ9A 3RAZA 4QL9A 1F3BA 1TK0B 3F4RA 3N5OA 4D73A 2AUVA 3LSZA 4LL1B 4EF0A 3LWAA 5D9WA 1AW9A 2I81A 2XHFA 4FIWA 5CRWA 1B9XC 2I1UA 4TR1B 1TU7A 1M2DA 4JR6A 3C1RA 3V1WA 2OE3A 2L6DA 1XCCA 2VD0A 1QQ2A 2TRCP 4F03A 4H86A 3ZFLA 6GSSA 3KH9A 3IBHA 4TXVA 1V98A 4NWYA 4MLYA 3TJGA 2C0EA 2V1MA 1R5AA 3GL3A 5EVOA 3WT1A 4K7IA 2FA4A 3SBCA 3L78A 1DBYA 1T4ZA 2DJ3A 3VK9A 1FB0A 1NSWA 4NHWA 5DJMA 1HD2A 4EDZA 2HYXA 3PH9A 1K0CA 3H79A 3QPMA 4KW6A 1ZMAA 1YJ6A 2B6MA 2O85A 3QD9A 4ZILA 2K8VA 1EGOA 1SYXA 4Q5QA 4O32A 1USBA 4LMVA 1GSSA 2V6KA 2C3TA 1B8XA 2LNSA 4ZB8A 4N10A 3HHVA 2YWIA 3KTLA 3TRPA 3IXRA 1SKSB 3DD3A 1NM3A 3C73A 2IMDA 5CO3A 2H70A 4YQVA 4GQFA 3PINA 2JSYA 4OD7A 2VIMA 2GGTA 4MZBA 1AUCA 3ZL5A 3TKSA 3LQ7A 1AXDA 1IYIA 2F3MA 1XWBA 3RHBA 3NZNA 2JACA 3KTBA 5KN3A 3RHCA 4EO3A 3DVXA 1GWCA 2DJ1A 4G10A 1SKWB 5G5FA 1KTEA 4TRXA 4BVXA 1J0FA 1A8YA 4GWRA 5DAKA 2AB6A 2LRCA 2LSTA 1XW9A 1TP9A 1XFLA 3GSTA 2VAFA 4KDYA 4P3YB 1K0NA 5D73A 3VFIA 1WP0A 3EC3A 3ZVJA 4J56E 5DALA 5FWGA 1JZRA 4OO4A 5JCWA 2L4CA 3W8JA 2JZSA 4MZCA 3C71A 1DSBA 1PQNA 3IAS2 2JU5A 1AQVA 4BPYA 4O92A 2YZHA 1HNBA 1TOFA 2X8GA 2JSZA 3IC4A 2ON5A 4PQ1A 2HT9A 3FY7A 3VURA 3D6IA 4WETA 4N30A 3P8WA 3ISOA 1FVJA 1I5GA 4N0VA 2GT6A 4MF5A 4JZQA 3KJYA 5G2ZA 2HSYA 3WT2A 5D9VA 2VLTA 3F8UA 1Z6MA 2P5QA 1VGLA 2QC7A 1S3DA 3GUSA 1FHEA 5GZZB 3TJBA 1ERWA 3WYWA 4RI7A 5CRHA 1PKZA 1O8XA 2KHPA 2B1KA 3M8NA 3KGKA 1MD4A 1XVQA 2RUEA 4NXIA 3R2QA 1UC7A 1EEMA 2R5GA 3CXGA 4PGTA 3G7YA 4ULXA 1OC8A 1HQOA 2WGRA 2OE1A 3FEUA 4KNDA 4EDYA 3ERGA 2HNLA 4RI6A 1FOVA 4ECIA 5HFKA 2PMTA 3K8NA 5DQSA 3RPPA 3IV4A 2XPEA 3P90A 2H71A 1Q4JA 4D73B 4TR3A 2YZUA 4L5LA 4K6XA 2J23A 4GQCA 5IM9A 3CYNA 4OO5A 2VCZA 2EIQA 3CMIA 1EEJA 4N0ZA 1WJKA 4TXOA 2FWHA 3GMFA 4WBJA 1SK0A 1MDIA 4IW9A 1F9MA 3QOUA 4WEYA 3G7JA 4K9ZA 20GSA 1WMJA 2OA7A 2PBJA 3EVIA 1OAZA 4ACSA 2VL9A 1M0UA 3D0ZA 2ON7A 4MJEA 2C0DA 2BMXA 1MTCA 1N8JA 2AV4A 3CBUA 2DC5A 2VCVA 3O3TA 1AC1A 4ZIJA 1G6WA 2OJLA 6GSXA 2LJKA 2HXKA 4ML1A 3FZ5A 1THOA 3Q18A 2E0QA 3ZITA 2OACA 3PGTA 4MDCA 1G7EA 1OKDA 3FZAA 1FVKA 3KM6A 2FWFA 2K18A 4KSOA 3WGXA 1V2AA 4F9ZA 1CQGA 1ON4A 1GL8A 2CQ9A 4PURA 2DBCA 2GT5A 3SWLA 1GULA 5DVBA 4GLTA 5D9XA 1TRWA 2RLIA 4JE1A 2ZCTA 2NBSA 5EY6A 1BEDA 4PUFC 2C3QA 2C0FA 1PA3A 5KN1A 3C8EA 3UBLA 1SL1B 3DWVA 4KA0A 4Q5RA 2ZNMA 3F4SA 3U5RE 1O6JA 4ZBDA 4ECBA 3G9BA 4N11A 5C00A 3HY2A 2V2GA 4PQIA 4NPBA 2HLSA 2IMEA 2AYTA 3IRAA 2PGTA 4KDUA 3J7Yb 2VLVA 1LJRA 14GSA 2LQOA 1F6MC 2Z9SA 3TJFA 1K3YA 5HR3A 4MCUA 2CAQA 3BOAA 3BBYA 2O7KA 4L0UA 1ERTA 1JLVA 4PUAA 2WJUA 1Y6EA 4NHZA 4ZL8A 5G5EA 2IFQA 4OCFA 2WDUA 4AJ6A 1X0RA 2L6CA 1ZZYA 4HUAA 2WULA 1BX9A 4PNGA
chains in the Genus database with same CATH superfamily
1Z9HA 4X0XA 2GZYA 1JZWA 2PN8A 5B6NA 3QDNA 4L0WA 1YKCA 2N5BA 2C1YA 3D21A 1GSFA 1OE7A 4TR4A 2YOIA 3KEBA 5JCGA 1TU8A 5J3RA 3QCPA 4MJBA 1PX7A 1U6TA 2M46A 5G1LA 3QAGA 2B1LA 3DIEA 3GL5A 4EL1A 1RW1A 2L4QA 2XC2A 5DJLA 3MWHA 1B9YC 5E59A 3DGQA 3TGZA 1ML6A 4KF9A 4A5PA 1JZOA 2FWEA 3C1SA 2R2JA 1K0BA 4MP4A 5G1KA 3HVXA 4KAEA 4F82A 4OFTA 3MIXA 5HFGA 1A2LA 2MBSA 2LKUA 1H4OA 1TXXA 1O73A 1ZYEA 5ECPB 3P7XA 4ZB9A 1T4YA 2YCDA 3A2VA 1B4QA 1RK4A 2FNOA 5HR1A 5IO2A 4TN8A 2JL4A 5J41A 2CX3A 1GSDA 1U88A 4POMA 3M0FA 1GSQA 1H75A 1U3IA 1TDIA 5LNKe 3MAKA 1EP8A 2KLXA 4EUYA 1E6BA 2O89A 2HRAA 5H5QA 1LU4A 4E8EA 3HJMA 3HD5A 3F6DA 5ELAA 4MJAA 1S3RA 1TI3A 2H1DA 3Q74A 2MBTA 5J9CA 5D9TA 6GSWA 1TRSA 3EMPA 2NPBA 3IK7A 1K3LA 5IMCA 4WBRD 1W89A 1TJDA 2L5OA 1EOHA 1QUWA 3IE3A 1VF3A 5IIZA 4OMVA 1Q98A 3RPNA 2QGVA 4QQ7A 2OADA 1T8EB 3CQFA 2IPAA 1MD3A 2DKIA 3U6VA 3LG6A 1WIKA 1QGVA 1B4PA 2H6YA 2GVPA 2GQKA 3EWLA 3JCML 2TIRA 5L71A 1TK8B 4GCIA 3M3MA 1PX6A 2HZFA 2M72A 3KXOA 1ILOA 1FB6A 2C3NA 1JLWA 4ZBAA 2GSQA 4FYUA 4O5UA 2E2MA 2A2RA 1I9DA 5CREA 1T3BA 1G0TA 2FLSA 1TTZA 4TR0A 1BYEA 2IWTA 1ZGNA 3TKPA 3FMWA 1TRUA 4HS1A 2FY6A 2F8AA 2F8FA 3NIVA 4GRFA 4RQXA 4K1FA 1QFNA 1M2AA 2RM6A 1T7PB 1JHBA 3A2WA 2X8HA 3GA4A 5ECHB 2L59A 3IHQA 2H1AA 4HZ2A 1R7HA 2IFQB 4KCEA 5B8AA 4JEDA 1GRXA 2I9HA 3IPZA 1FW1A 3FZ9A 4AGSA 3H1NA 4WR5A 5INYA 1YZXA 1YDKA 3BCKA 1XIYA 4OFMA 5ECLB 2XBIA 5AIXA 3ZMLA 3KCMA 1ZCPA 3HYPA 5DQYA 2OKAA 4G2EA 5LCZA 3CTGA 2DIZA 5ECQB 2QA2A 4DEJA 3MYDA 2EIRA 3KZQA 3KP9A 4HI7A 1A2JA 1V57A 4KUNA 4MH2A 2OE0A 2CZ2A 2N5FA 1DE1A 3EU3A 1VRSD 22GSA 1ZYPA 2GSTA 3GRXA 1XOAA 5C04A 3VWWA 3DYRA 3FR9A 1K0MA 4X43A 1ACVA 4F0CA 3TJKA 1AQWA 2PUKC 1BG5A 2WCIA 4Z7XA 4ECJA 3Q19A 4I97A 1SU9A 3GH9A 1M7TA 2CVBA 2H0HA 3FR3A 4G0LA 1TK5B 4OCEA 5IPHA 1PL2A 2H6XA 3HVSA 2X99A 3HDCA 4ZBBA 4GSTA 3QAWA 2WFCA 3A2XA 5GSTA 4O5QA 4G19A 5D93A 2YWMA 3FK8A 3F63A 1YF0A 3EURA 3M9JA 1V9WA 5HR2A 4NAXA 1SKRB 3H4KA 4WF4A 4HU7A 3APQA 2L57A 1AIUA 2HSHA 1K0OA 2VL3A 1O81A 4F0BA 5BRTA 1SYRA 4IP1A 3VWXA 1THXA 3FHKA 1X9SB 5J4UA 5E4WA 3TKQA 1VF2A 1GP1A 4FO5A 4ZXGA 11GSA 5CRGA 3D22A 1SJIA 2CVKA 3ME7A 2K6VA 3TCOA 3CSIA 4K0NA 4F2IA 4KE3A 4ML6A 4Z2UA 1XPVA 1SENA 3VPTA 1K0DA 2O87A 4DSSB 2CA8A 4K2XA 2GLRA 1MEKA 1Y25A 3UVHA 1TRVA 2ZUPA 4ECCA 1YF1A 3GKXA 2CT6A 2H19A 2DKHA 4I2UA 2R0GA 1K0AA 18GSA 2LRTA 5CRDA 4TKYA 2X49A 5CAXA 1O7UA 2HZEB 1C72A 3GURA 5CYYA 4YKFA 4MF6A 4AJ8A 5EPFA 2A2SA 1S3AA 4ZB6A 2PERA 1Z6NA 3DVWA 3LYKA 4BWQA 1PRXA 1XW6A 2FWGA 4NMUA 4XRAA 5D96A 2EC4A 3AY8A 3ZLPA 6GSYA 2TRXA 3E3EA 3FW2A 4KCAA 1MDKA 4TOPA 1UVZA 2N5AA 3MNGA 4ICYA 4EXJA 3VI7A 3FYGA 4IP6A 2IL3A 2LJRA 4EIQA 2YN1A 4USSA 1X5EA 4BL7B 1ZYQB 16GSA 2NTOA 7GSSA 4TW5A 1Z7RA 3TJJA 2PVOC 3GSSA 4MH3A 2LNTA 1XWCA 3FZ4A 4MK3A 4RQRA 4GXZA 2GQLA 1PL1A 2G2QA 5J9BA 3TOUA 2H66A 3GYKA 5AN1A 3FKFA 2MYGA 4PX1A 4XCSA 2LRNA 4CY8A 1PN0A 4ISDA 2FCHA 4K5RA 1XOBA 3TRXA 1KBNA 4IJIA 2V6OA 3TKRA 2QA1A 2KOKA 2KUCA 3P2AA 4HU9A 1GUMA 5HR0A 3GKNA 2YJ7A 4I2TA 4POBA 3FRCA 6GSTA 1SL0B 5ABRA 2D2ZA 4WF5A 4XS1A 5IOWA 1LBKA 3TOTA 4XIHA 4XHMA 5HFIA 3IOSA 4ILFA 3L9VA 1IYHA 3DKSA 4DVCA 2LS5A 3UVTA 2RIIA 2I4AA 2R0PA 4YQMA 13GSA 4BVYB 4EIPA 3GKKA 4O7HA 4L8EA 3I69A 4ID0A 3UBKA 2FA8A 1EZKA 2H76A 3D4TA 1QXHA 5A4WA 3HJPA 1F37A 5JWQB 3L9UA 1X5CA 2VL2C 3ME8A 5H5RA 5FHIA 2G0FA 1SJZA 2NVLA 1T00A 4FQUA 3QFBC 3APOA 1A0RP 1HNAA 4EE0A 2B5EA 3ZVJD 1F3AA 4JR4A 4V1Ag 1M3JA 3LJRA 3ZMKA 1YQ1A 1DUGA 2AAWA 2GS3A 4EC0A 1PKWA 4IQAA 2H30A 2MMNA 3LFLA 2PWJA 1XZOA 2NDOA 2IMFA 3GHAA 2IN3A 5KN0A 3S9FA 2DJKA 3A3TA 1OE8A 3M9KA 2M80A 4O5RA 1FOHA 1A0FA 4J57E 3A5WA 3LXTA 1XW5A 4RUVA 3R3EA 5ENUA 4DSRA 2OBIA 5IMAA 2DJJA 2FD3A 2YPMA 4CDOA 2P5RA 2K9FA 2VCXA 1FG4A 3CSHA 3F0IA 3TRQA 3H93A 5ECMB 1GNWA 3NOFA 4KDXA 2DSAA 3DMLA 4GSSA 5ID2A 2VCWA 2CZ3A 2PPTA 1WWJA 1NW2A 4MNNA 3ERWA 5JWRB 5JCUA 1ZOFA 2GSRA 3A5IA 3GTUA 3HJOA 3C7MA 4XS4A 3GIXA 1PGTA 2LTKA 3CSJA 4NV5A 2XBQA 4HDEA 4BA7A 4PNFA 2YP6A 3EINA 1TW9A 4DSSA 4I8BA 2HI7A 4WXTA 1TI1A 4MPFA 3UMAA 3OR5A 1XG8A 5ECSA 1U3AA 1S3CA 1ERUA 1OC9A 2H73A 2PU9C 4QL7A 4MABA 5ECNB 3GNJA 2DMLA 5IMVA 3VI5A 2LEGA 3I9V2 4K2DA 2VL2A 2IJYA 1NHOA 1SJ6A 4POKA 1O8WA 1M9BA 1OVNA 1WOUA 4KX4A 3QFAC 1X9WB 3TDGA 1AAZA 3KD0A 2HZEA 3HZ8A 2CAIA 12GSA 2YWNA 3O76A 2CV4A 4PQHA 4JU5A 1M2BA 3F9UA 4IN0A 2L5LA 4AJ7A 3L4NA 4XTSA 3IDVA 1V58A 1ABAA 2H0IA 4K0GA 4XRDA 2REMA 2X64A 5AISA 3ZIVA 3GFKA 9GSSA 3EMXA 2R3XA 3UOMA 2MMOA 2X4AA 4WR4A 2GSSA 3ERFA 4WKWA 1W4VA 4MMMA 2YJHA 5G30A 4BL7A 1X5DA 3RBTA 2LJAA 5A4UA 1R26A 5A5KA 1URMA 3LORA 3IC8A 1GUKA 3CRUA 4LA1A 5J5NA 1A8LA 2P0GA 5DCHA 1UA5A 3UAPA 2B7KA 2MZCA 3FR6A 4IGJA 1PSQA 1GLQA 1SD9A 4IS0A 2F9SA 1J9BA 1KNGA 1XVWA 2ES7A 4OWYA 2GQMA 3HVVA 4HJMA 2C4JA 5A4VA 1GTIA 4HQZA 2FHEA 2QSIA 3KIJA 1J08A 4EVMA 1CQHA 2H01A 4HOJA 3HA9A 2HRFA 2H72A 1DE2A 3ZIJA 1QMVA 1ST9A 3VWVA 4IHUA 4V2MA 3GH6A 4PXOA 4BVYA 2H8LA 3GX0A 1HYUA 3UEMA 3ED3A 3TB2A 6GSVA 3F3RA 3ZZXA 5DBQA 5ECRB 4CHSA 1R5PA 5ECKB 3VWUA 5CP1A 3KH7A 2H6ZA 4CY6A 2R37A 2HE3A 4KGIA 1T1VA 2FGXA 3TUEA 3F4TA 1VF4A 1XBSA 1A24A 3APSA 3I43A 2K8SA 3IHGA 1GLPA 1SL2B 1X9MB 4FYCA 4IJ3A 3LGCA 3J7Yk 5FT3A 2BTOT 2ALBA 3EE2A 4HSCX 10GSA 1OKTA 4J2FA 1SK1A 1BJXA 5GSSA 2B3SA 4IVFA 3GX8A 2E7PA 4I6XA 2JZRA 4JBBA 1FAAA 4GF0A 1VF1A 3HVNA 4FYBA 2IMKA 2VCQA 6GSUA 5JWOB 1YY7A 3E0UA 5ID2B 5IOXA 1SD8A 3M1GA 2GTUA 2B5YA 4LMWA 3UIWA 2H1GA 1ERVA 4V2NA 3GTUB 4MA9A 4XS4B 1GTUA 1GSYA 4G0IA 4POLA 2LV3A 2C8UA 3PR8A 4G9HA 2P31A 3D5JA 3VPQA 2WB9A 3UJ1A 3QMXA 2YV7A 3F3QA 4I5QA 5F07A 2X8CA 2CX4A 19GSA 4E8HA 3VLNA 1GUHA 4KB3A 2WRTA 2DLXA 3EU4A 2HFDA 5DDLA 1OC9B 1RQMA 2YANA 2A4VA 2VOCA 4IELA 4BWSA 8GSSA 2IMIA 1WE0A 3N9JA 4PTSA 1GSEA 4AF2A 2YV9A 1WPIA 2C80A 2VUPA 5KEJA 4V1Ap 1F2EA 4ZL9A 4HZ4A 1XWAA 2GZPA 3LXZA 1XXUA 2I3YA 3DEXA 3GKMA 1PD21 3LW9A 2HRKA 2QKEA 4CW9A 2DMMA 3O6TA 4MZWA 2R6KA 1R4WA 1EV4A 1XWGA 4YQUA 2H75A 5HQPA 3ZREA 2E2GA 2GDRA 5F05A 3DRNA 4MF7A 1Z7PA 5ELGA 5IMDA 3IR4A 1G6YA 4TR1A 1BQ7A 2KP1A 3HZ4A 4IBPA 4L5OA 1GTBA 2JADA 3UL3A 3PPUA 3GN3A 1QK8A 4GTUA 1OYJA 5AGYA 3US3A 3KMOA 2RM5A 4TVEA 1Z5YE 1M3IA 3H8QA 1NHYA 5IPGA 2O8VB 2DIYA 3F6FA 1ZL9A 2V32A 1V40A 1UN2A 4YAVA 1Z3EA 1G7OA 2VO4A 4OFNA 3WD6A 5D8IA 1KEBA 5H5SA 1MDJA 3MDKA 4K7NA 1GTAA 3QAVA 3HKRA 5DCGA 2YWOA 3D4MA 3BD2A 5F06A 3IK9A 5LD0A 2YNXA 3Q6OA 2LQQA 2VD1A 2DJ2A 2V41A 1M9AA 3CTFA 1EOGA 2GZZA 5B6MA 3IA1A 2IIYA 2PVQA 1HNCA 1O85A 4HJ2A 3I6AA 1SK2A 3L0HA 2VM2A 5DAKB 17GSA 4HQSA 3IAM2 5CNWA 4G0KA 2OBKA 4GSNA 2AHEA 4MJCA 1TKDB 2R4VA 4JRRA 4YH2A 2WS2A 5DALB 3LYPA 4IKHA 2H0GA 5B7CA 3BCIA 3HCZA 5EL8A 3BJ5A 3G7IA 3LEFA 3CRTA 3ZFBA 5GAPD 4Q5NA 5KN2A 1FO5A 5IQYA 1BAYA 3WGEA 5ECIB 4ZL7A 2MMZA 4LLRA 1JFUA 3GV1A 3QR6A 2H1BA 4MPGA 1A2MA 1EP7A 1B48A 1N2AA 3MSZA 1EWXA 2EIOA 2B7JA 1GSUA 1K3OA 5F0GA 4LL4B 3TKSE 1JZDA 2VLUA 1A23A 4DSQA 1PMTA 2XPDA 1EGRA 1PN9A 2LUSA 5IO0A 1XWKA 5G31A 4FH8A 1GNEA 2VM1A 3W8SA 4KH7A 2AJQB 2F51A 2DJ0A 4YAPA 1YEXA 5GAND 1WRYA 5IMFA 1M99A 2CVDA 4HEA2 4Q5FA 2KP2A 4K7OA 1AQXA 1GH2A 3TKSC 2C0GA 2HRNA 3EYTA 4IQ1A 3WGDA 3HXSA 2MMAA 3E9JB 4KSMA 3ZYWA 3KP8A 3W6GA 5ECOB 4K8MA 4NV2A 2VCTA 1E2YA 2FUG2 5COHA 1EV9A 5B8BA 5BMUA 4XS6A 5AIVA 3L9SA 3KMNA 3RDWA 3ZTLA 4X1UA 2BJXA 2JZTA 4TXOB 2RUFA 3ZRDA 4V2LA 1U87A 2J9HA 2B5XA 3DXBA 3UARA 1YEPA 1YKAA 5IMZA 4EKZA 1OC3A 5F8BA 2H74A 2WZ9A 3RAZA 4QL9A 1F3BA 1TK0B 3F4RA 3N5OA 4D73A 2AUVA 3LSZA 4LL1B 4EF0A 3LWAA 5D9WA 1AW9A 2I81A 2XHFA 4FIWA 5CRWA 1B9XC 2I1UA 4TR1B 1TU7A 1M2DA 4JR6A 3C1RA 3V1WA 2OE3A 2L6DA 1XCCA 2VD0A 1QQ2A 2TRCP 4F03A 4H86A 4X4JA 3ZFLA 6GSSA 3KH9A 3IBHA 4TXVA 1V98A 4NWYA 4MLYA 3TJGA 2C0EA 2V1MA 1R5AA 3GL3A 5EVOA 3WT1A 4K7IA 2FA4A 3SBCA 3L78A 1DBYA 1T4ZA 2DJ3A 3VK9A 1FB0A 1NSWA 4NHWA 5DJMA 1HD2A 4EDZA 2HYXA 3PH9A 1K0CA 3H79A 3QPMA 4KW6A 1ZMAA 1YJ6A 2B6MA 2O85A 3QD9A 4ZILA 2K8VA 1EGOA 1SYXA 4Q5QA 4O32A 1USBA 4LMVA 1GSSA 2V6KA 2C3TA 1B8XA 2LNSA 4ZB8A 4N10A 3HHVA 2YWIA 3KTLA 3TRPA 3IXRA 1SKSB 3DD3A 1NM3A 3C73A 2IMDA 5CO3A 2H70A 4YQVA 4GQFA 3PINA 2JSYA 4OD7A 2VIMA 2GGTA 4MZBA 1AUCA 3ZL5A 3TKSA 3LQ7A 1AXDA 1IYIA 2F3MA 1XWBA 3RHBA 3NZNA 2JACA 3KTBA 5KN3A 3RHCA 4EO3A 3DVXA 1GWCA 2DJ1A 4G10A 2HSMA 1SKWB 5G5FA 1KTEA 4TRXA 4BVXA 1J0FA 1PFOA 1A8YA 4GWRA 5DAKA 2AB6A 2LRCA 2LSTA 1XW9A 1TP9A 1XFLA 3GSTA 2VAFA 4KDYA 4P3YB 1K0NA 5D73A 3VFIA 1WP0A 3EC3A 3ZVJA 4J56E 5KOWA 5DALA 5FWGA 1JZRA 2A4HA 4OO4A 5JCWA 2L4CA 3W8JA 4BIKA 2JZSA 4MZCA 3C71A 1DSBA 1PQNA 3IAS2 2JU5A 1AQVA 4BPYA 4O92A 2YZHA 1HNBA 1TOFA 2X8GA 2JSZA 3IC4A 2ON5A 4PQ1A 2HT9A 3FY7A 3VURA 3D6IA 4WETA 4N30A 3P8WA 3ISOA 1FVJA 1I5GA 4N0VA 2GT6A 4MF5A 4JZQA 3KJYA 5G2ZA 2HSYA 3WT2A 5D9VA 2VLTA 3F8UA 1Z6MA 2P5QA 1VGLA 2QC7A 1S3DA 3GUSA 1FHEA 5GZZB 3TJBA 1ERWA 3WYWA 4RI7A 5CRHA 1PKZA 1O8XA 2KHPA 2UZ8A 2B1KA 3M8NA 3KGKA 1MD4A 1XVQA 2RUEA 4NXIA 3R2QA 1UC7A 1EEMA 2R5GA 3CXGA 4PGTA 3G7YA 4ULXA 1OC8A 1HQOA 2WGRA 2OE1A 3FEUA 4KNDA 4EDYA 3ERGA 2HNLA 4RI6A 1FOVA 4ECIA 5HFKA 2PMTA 3K8NA 5DQSA 3RPPA 3IV4A 2XPEA 3P90A 2H71A 1Q4JA 4D73B 4TR3A 2YZUA 4L5LA 4K6XA 2J23A 4GQCA 5IM9A 3CYNA 4OO5A 2VCZA 5KOXA 2EIQA 3CMIA 1EEJA 4N0ZA 1WJKA 4TXOA 2FWHA 3GMFA 4WBJA 1SK0A 1MDIA 4IW9A 1F9MA 3QOUA 4WEYA 3G7JA 4K9ZA 20GSA 1WMJA 2OA7A 2PBJA 3EVIA 1OAZA 4ACSA 2VL9A 1M0UA 3D0ZA 2ON7A 2R0CA 4MJEA 2C0DA 2BMXA 1MTCA 1N8JA 2AV4A 3CBUA 2DC5A 2VCVA 3O3TA 1AC1A 4ZIJA 1G6WA 2OJLA 6GSXA 2LJKA 2HXKA 4ML1A 3FZ5A 1THOA 3Q18A 2E0QA 3ZITA 2OACA 3PGTA 4MDCA 1G7EA 4YKGA 1OKDA 4K5SA 3FZAA 1FVKA 3KM6A 2FWFA 2K18A 4KSOA 3WGXA 1V2AA 4F9ZA 1CQGA 1ON4A 1GL8A 2CQ9A 4PURA 2DBCA 2GT5A 3SWLA 1GULA 4Z2RA 5DVBA 4GLTA 5D9XA 1TRWA 2RLIA 4JE1A 2ZCTA 4Z2TA 2NBSA 5EY6A 1BEDA 4PUFC 2C3QA 2C0FA 1PA3A 5KN1A 3C8EA 3UBLA 1SL1B 3DWVA 4KA0A 4Q5RA 2ZNMA 3EPTA 3F4SA 3U5RE 1O6JA 4ZBDA 4ECBA 3G9BA 4N11A 5C00A 3HY2A 2V2GA 4PQIA 4NPBA 2HLSA 2IMEA 2AYTA 3IRAA 2PGTA 4KDUA 1ZYNA 3J7Yb 2VLVA 1LJRA 14GSA 2LQOA 1F6MC 4BVXB 2Z9SA 3TJFA 1K3YA 5HR3A 4MCUA 2CAQA 3BOAA 3BBYA 2O7KA 4L0UA 1ERTA 1JLVA 4PUAA 2A2PA 2WJUA 1Y6EA 4NHZA 4ZL8A 5G5EA 2IFQA 4OCFA 2WDUA 4AJ6A 1X0RA 2L6CA 1ZZYA 4HUAA 2WULA 1BX9A 4PNGA
chains in the Genus database with same CATH topology
1Z9HA 4X0XA 2GZYA 1JZWA 2PN8A 5B6NA 3QDNA 4L0WA 1YKCA 2N5BA 2C1YA 3D21A 1GSFA 1OE7A 4TR4A 2YOIA 3KEBA 5JCGA 1TU8A 5J3RA 3QCPA 4MJBA 1PX7A 1U6TA 2M46A 5G1LA 3QAGA 2B1LA 3DIEA 3GL5A 4EL1A 1RW1A 2L4QA 2XC2A 5DJLA 3MWHA 1B9YC 5E59A 3DGQA 3TGZA 1ML6A 4KF9A 4A5PA 1JZOA 2FWEA 3C1SA 2R2JA 1K0BA 4MP4A 5G1KA 3HVXA 4KAEA 4F82A 4OFTA 3MIXA 5HFGA 1A2LA 2MBSA 2LKUA 1H4OA 1TXXA 1O73A 1ZYEA 5ECPB 3P7XA 4ZB9A 1T4YA 2YCDA 3A2VA 1B4QA 1RK4A 2FNOA 5HR1A 5IO2A 4TN8A 2JL4A 5J41A 2CX3A 1GSDA 1U88A 4POMA 3M0FA 1GSQA 1H75A 1U3IA 1TDIA 5LNKe 3MAKA 1EP8A 2KLXA 4EUYA 1E6BA 2O89A 2HRAA 5H5QA 1LU4A 4E8EA 3HJMA 3HD5A 3F6DA 5ELAA 4MJAA 1TI3A 2H1DA 3Q74A 2MBTA 5J9CA 5D9TA 6GSWA 1TRSA 3EMPA 2NPBA 3IK7A 1K3LA 5IMCA 4WBRD 1W89A 1TJDA 2L5OA 1EOHA 1QUWA 3IE3A 1VF3A 5IIZA 4OMVA 1Q98A 3RPNA 2QGVA 4QQ7A 2OADA 1T8EB 2IPAA 1MD3A 2DKIA 3U6VA 3LG6A 1WIKA 1QGVA 1B4PA 2H6YA 2GVPA 2GQKA 3EWLA 3JCML 2TIRA 5L71A 1TK8B 4GCIA 3M3MA 1PX6A 2HZFA 2M72A 3KXOA 1ILOA 1FB6A 2C3NA 1JLWA 4ZBAA 2GSQA 4FYUA 4O5UA 2E2MA 2A2RA 1I9DA 5CREA 1T3BA 1G0TA 2FLSA 1TTZA 4TR0A 1BYEA 2IWTA 1ZGNA 3TKPA 3FMWA 1TRUA 4HS1A 2FY6A 2F8AA 2F8FA 3NIVA 4GRFA 4RQXA 4K1FA 1QFNA 1M2AA 2RM6A 1T7PB 1JHBA 3A2WA 2X8HA 3GA4A 5ECHB 2L59A 3IHQA 2H1AA 4HZ2A 1R7HA 2IFQB 4KCEA 5B8AA 4JEDA 1GRXA 2I9HA 3IPZA 1FW1A 3FZ9A 4AGSA 3H1NA 4WR5A 5INYA 1YZXA 1YDKA 3BCKA 1XIYA 4OFMA 5ECLB 2XBIA 5AIXA 3ZMLA 3KCMA 1ZCPA 3HYPA 5DQYA 2OKAA 4G2EA 5LCZA 3CTGA 2DIZA 5ECQB 2QA2A 4DEJA 3MYDA 2EIRA 3KZQA 3KP9A 4HI7A 1A2JA 1V57A 4KUNA 4MH2A 2OE0A 2CZ2A 2N5FA 1DE1A 3EU3A 1VRSD 22GSA 1ZYPA 2GSTA 3GRXA 1XOAA 5C04A 3VWWA 3DYRA 3FR9A 1K0MA 4X43A 1ACVA 4F0CA 3TJKA 1AQWA 2PUKC 1BG5A 2WCIA 4Z7XA 4ECJA 3Q19A 4I97A 1SU9A 3GH9A 1M7TA 2CVBA 2H0HA 3FR3A 4G0LA 1TK5B 4OCEA 5IPHA 1PL2A 2H6XA 3HVSA 2X99A 3HDCA 4ZBBA 4GSTA 3QAWA 2WFCA 3A2XA 5GSTA 4O5QA 4G19A 5D93A 2YWMA 3FK8A 3F63A 1YF0A 3EURA 3M9JA 1V9WA 5HR2A 4NAXA 1SKRB 3H4KA 4WF4A 4HU7A 3APQA 2L57A 1AIUA 2HSHA 1K0OA 2VL3A 1O81A 4F0BA 5BRTA 1SYRA 4IP1A 3VWXA 1THXA 3FHKA 1X9SB 5J4UA 5E4WA 3TKQA 1VF2A 1GP1A 4FO5A 4ZXGA 11GSA 5CRGA 3D22A 1SJIA 2CVKA 3ME7A 2K6VA 3TCOA 3CSIA 4K0NA 4F2IA 4KE3A 4ML6A 4Z2UA 1XPVA 1SENA 3VPTA 1K0DA 2O87A 4DSSB 2CA8A 4K2XA 2GLRA 1MEKA 1Y25A 3UVHA 1TRVA 2ZUPA 4ECCA 1YF1A 3GKXA 2CT6A 2H19A 2DKHA 4I2UA 2R0GA 1K0AA 18GSA 2LRTA 5CRDA 4TKYA 2X49A 5CAXA 1O7UA 2HZEB 1C72A 3GURA 5CYYA 4YKFA 4MF6A 4AJ8A 5EPFA 2A2SA 1S3AA 4ZB6A 2PERA 1Z6NA 3DVWA 3LYKA 4BWQA 1PRXA 1XW6A 2FWGA 4NMUA 4XRAA 5D96A 2EC4A 3AY8A 3ZLPA 6GSYA 2TRXA 3E3EA 3FW2A 4KCAA 1MDKA 4TOPA 1UVZA 2N5AA 3MNGA 4ICYA 4EXJA 3VI7A 3FYGA 4IP6A 2IL3A 2LJRA 4EIQA 2YN1A 4USSA 1X5EA 4BL7B 1ZYQB 16GSA 2NTOA 7GSSA 4TW5A 1Z7RA 3TJJA 2PVOC 3GSSA 4MH3A 2LNTA 1XWCA 3FZ4A 4MK3A 4RQRA 4GXZA 2GQLA 1PL1A 2G2QA 5J9BA 3TOUA 2H66A 3GYKA 5AN1A 3FKFA 2MYGA 4PX1A 4XCSA 2LRNA 4CY8A 1PN0A 4ISDA 2FCHA 4K5RA 1XOBA 3TRXA 1KBNA 4IJIA 2V6OA 3TKRA 2QA1A 2KOKA 2KUCA 3P2AA 4HU9A 1GUMA 5HR0A 3GKNA 2YJ7A 4I2TA 4POBA 3FRCA 6GSTA 1SL0B 5ABRA 2D2ZA 4WF5A 4XS1A 5IOWA 1LBKA 3TOTA 4XIHA 4XHMA 5HFIA 3IOSA 4ILFA 3L9VA 1IYHA 3DKSA 4DVCA 2LS5A 3UVTA 2RIIA 2I4AA 2R0PA 4YQMA 13GSA 4BVYB 4EIPA 3GKKA 4O7HA 4L8EA 3I69A 4ID0A 3UBKA 2FA8A 1EZKA 2H76A 3D4TA 1QXHA 5A4WA 3HJPA 1F37A 5JWQB 3L9UA 1X5CA 2VL2C 3ME8A 5H5RA 5FHIA 2G0FA 1SJZA 2NVLA 1T00A 4FQUA 3QFBC 3APOA 1A0RP 1HNAA 4EE0A 2B5EA 3ZVJD 1F3AA 4JR4A 4V1Ag 3LJRA 3ZMKA 1YQ1A 1DUGA 2AAWA 2GS3A 4EC0A 1PKWA 4IQAA 2H30A 2MMNA 3LFLA 2PWJA 1XZOA 2NDOA 2IMFA 3GHAA 2IN3A 5KN0A 3S9FA 2DJKA 3A3TA 1OE8A 3M9KA 2M80A 4O5RA 1FOHA 1A0FA 4J57E 3A5WA 3LXTA 1XW5A 4RUVA 3R3EA 5ENUA 4DSRA 2OBIA 5IMAA 2DJJA 2FD3A 2YPMA 4CDOA 2P5RA 2K9FA 2VCXA 1FG4A 3CSHA 3F0IA 3TRQA 3H93A 5ECMB 1GNWA 3NOFA 4KDXA 2DSAA 3DMLA 4GSSA 5ID2A 2VCWA 2CZ3A 2PPTA 1WWJA 1NW2A 4MNNA 3ERWA 5JWRB 5JCUA 1ZOFA 2GSRA 3A5IA 3GTUA 3HJOA 3C7MA 4XS4A 3GIXA 1PGTA 2LTKA 3CSJA 4NV5A 2XBQA 4HDEA 4BA7A 4PNFA 2YP6A 3EINA 1TW9A 4DSSA 4I8BA 2HI7A 4WXTA 1TI1A 4MPFA 3UMAA 3OR5A 5ECSA 1U3AA 1S3CA 1ERUA 1OC9A 2H73A 2PU9C 4QL7A 4MABA 5ECNB 3GNJA 2DMLA 5IMVA 3VI5A 2LEGA 3I9V2 4K2DA 2VL2A 2IJYA 1NHOA 1SJ6A 4POKA 1O8WA 1M9BA 1OVNA 1WOUA 4KX4A 3QFAC 1X9WB 3TDGA 1AAZA 3KD0A 2HZEA 3HZ8A 2CAIA 12GSA 2YWNA 3O76A 2CV4A 4PQHA 4JU5A 1M2BA 3F9UA 4IN0A 2L5LA 4AJ7A 3L4NA 4XTSA 3IDVA 1V58A 1ABAA 2H0IA 4K0GA 4XRDA 2REMA 2X64A 5AISA 3ZIVA 3GFKA 9GSSA 3EMXA 2R3XA 3UOMA 2MMOA 2X4AA 4WR4A 2GSSA 3ERFA 4WKWA 1W4VA 4MMMA 2YJHA 5G30A 4BL7A 1X5DA 3RBTA 2LJAA 5A4UA 1R26A 5A5KA 1URMA 3LORA 3IC8A 1GUKA 3CRUA 4LA1A 5J5NA 1A8LA 2P0GA 5DCHA 1UA5A 3UAPA 2B7KA 2MZCA 3FR6A 4IGJA 1PSQA 1GLQA 1SD9A 4IS0A 2F9SA 1J9BA 1KNGA 1XVWA 2ES7A 4OWYA 2GQMA 3HVVA 4HJMA 2C4JA 5A4VA 1GTIA 4HQZA 2FHEA 2QSIA 3KIJA 1J08A 4EVMA 1CQHA 2H01A 4HOJA 3HA9A 2HRFA 2H72A 1DE2A 3ZIJA 1QMVA 1ST9A 3VWVA 4IHUA 4V2MA 3GH6A 4PXOA 4BVYA 2H8LA 3GX0A 1HYUA 3UEMA 3ED3A 3TB2A 6GSVA 3F3RA 3ZZXA 5DBQA 5ECRB 4CHSA 1R5PA 5ECKB 3VWUA 5CP1A 3KH7A 2H6ZA 4CY6A 2R37A 2HE3A 4KGIA 1T1VA 2FGXA 3TUEA 3F4TA 1VF4A 1XBSA 1A24A 3APSA 3I43A 2K8SA 3IHGA 1GLPA 1SL2B 1X9MB 4FYCA 4IJ3A 3LGCA 3J7Yk 5FT3A 2BTOT 2ALBA 3EE2A 10GSA 1OKTA 4J2FA 1SK1A 1BJXA 5GSSA 2B3SA 4IVFA 3GX8A 2E7PA 4I6XA 2JZRA 4JBBA 1FAAA 4GF0A 1VF1A 4FYBA 2IMKA 2VCQA 6GSUA 5JWOB 1YY7A 3E0UA 5ID2B 5IOXA 1SD8A 3M1GA 2GTUA 2B5YA 4LMWA 3UIWA 2H1GA 1ERVA 4V2NA 3GTUB 4MA9A 4XS4B 1GTUA 1GSYA 4G0IA 4POLA 2LV3A 2C8UA 3PR8A 4G9HA 2P31A 3D5JA 3VPQA 2WB9A 3UJ1A 3QMXA 2YV7A 3F3QA 4I5QA 5F07A 2X8CA 2CX4A 19GSA 4E8HA 3VLNA 1GUHA 4KB3A 2WRTA 2DLXA 3EU4A 2HFDA 5DDLA 1OC9B 1RQMA 2YANA 2A4VA 2VOCA 4IELA 4BWSA 8GSSA 2IMIA 1WE0A 3N9JA 4PTSA 1GSEA 4AF2A 2YV9A 1WPIA 2C80A 2VUPA 5KEJA 4V1Ap 1F2EA 4ZL9A 4HZ4A 1XWAA 2GZPA 3LXZA 1XXUA 2I3YA 3DEXA 3GKMA 1PD21 3LW9A 2HRKA 2QKEA 4CW9A 2DMMA 3O6TA 4MZWA 2R6KA 1R4WA 1EV4A 1XWGA 4YQUA 2H75A 5HQPA 3ZREA 2E2GA 2GDRA 5F05A 3DRNA 4MF7A 1Z7PA 5ELGA 5IMDA 3IR4A 1G6YA 4TR1A 1BQ7A 2KP1A 3HZ4A 4IBPA 4L5OA 1GTBA 2JADA 3UL3A 3PPUA 3GN3A 1QK8A 4GTUA 1OYJA 5AGYA 3US3A 3KMOA 2RM5A 4TVEA 1Z5YE 3H8QA 1NHYA 5IPGA 2O8VB 2DIYA 3F6FA 1ZL9A 2V32A 1V40A 1UN2A 4YAVA 1Z3EA 1G7OA 2VO4A 4OFNA 3WD6A 5D8IA 1KEBA 5H5SA 1MDJA 3MDKA 4K7NA 1GTAA 3QAVA 3HKRA 5DCGA 2YWOA 3D4MA 3BD2A 5F06A 3IK9A 5LD0A 2YNXA 3Q6OA 2LQQA 2VD1A 2DJ2A 2V41A 1M9AA 3CTFA 1EOGA 2GZZA 5B6MA 3IA1A 2IIYA 2PVQA 1HNCA 1O85A 4HJ2A 3I6AA 1SK2A 3L0HA 2VM2A 5DAKB 17GSA 4HQSA 3IAM2 5CNWA 4G0KA 2OBKA 4GSNA 2AHEA 4MJCA 1TKDB 2R4VA 4JRRA 4YH2A 2WS2A 5DALB 3LYPA 4IKHA 2H0GA 5B7CA 3BCIA 3HCZA 5EL8A 3BJ5A 3G7IA 3LEFA 3CRTA 3ZFBA 5GAPD 4Q5NA 5KN2A 1FO5A 5IQYA 1BAYA 3WGEA 5ECIB 4ZL7A 2MMZA 4LLRA 1JFUA 3GV1A 3QR6A 2H1BA 4MPGA 1A2MA 1EP7A 1B48A 1N2AA 3MSZA 1EWXA 2EIOA 2B7JA 1GSUA 1K3OA 5F0GA 4LL4B 3TKSE 1JZDA 2VLUA 1A23A 4DSQA 1PMTA 2XPDA 1EGRA 1PN9A 2LUSA 5IO0A 1XWKA 5G31A 4FH8A 1GNEA 2VM1A 3W8SA 4KH7A 2AJQB 2F51A 2DJ0A 4YAPA 1YEXA 5GAND 1WRYA 5IMFA 1M99A 2CVDA 4HEA2 4Q5FA 2KP2A 4K7OA 1AQXA 1GH2A 3TKSC 2C0GA 2HRNA 3EYTA 4IQ1A 3WGDA 3HXSA 2MMAA 3E9JB 4KSMA 3ZYWA 3KP8A 3W6GA 5ECOB 4K8MA 4NV2A 2VCTA 1E2YA 2FUG2 5COHA 1EV9A 5B8BA 5BMUA 4XS6A 5AIVA 3L9SA 3KMNA 3RDWA 3ZTLA 4X1UA 2BJXA 2JZTA 4TXOB 2RUFA 3ZRDA 4V2LA 1U87A 2J9HA 2B5XA 3DXBA 3UARA 1YEPA 1YKAA 5IMZA 4EKZA 1OC3A 5F8BA 2H74A 2WZ9A 3RAZA 4QL9A 1F3BA 1TK0B 3F4RA 3N5OA 4D73A 2AUVA 3LSZA 4LL1B 4EF0A 3LWAA 5D9WA 1AW9A 2I81A 2XHFA 4FIWA 5CRWA 1B9XC 2I1UA 4TR1B 1TU7A 1M2DA 4JR6A 3C1RA 3V1WA 2OE3A 2L6DA 1XCCA 2VD0A 1QQ2A 2TRCP 4F03A 4H86A 4X4JA 3ZFLA 6GSSA 3KH9A 3IBHA 4TXVA 1V98A 4NWYA 4MLYA 3TJGA 2C0EA 2V1MA 1R5AA 3GL3A 5EVOA 3WT1A 4K7IA 2FA4A 3SBCA 3L78A 1DBYA 1T4ZA 2DJ3A 3VK9A 1FB0A 1NSWA 4NHWA 5DJMA 1HD2A 4EDZA 2HYXA 3PH9A 1K0CA 3H79A 3QPMA 4KW6A 1ZMAA 1YJ6A 2B6MA 2O85A 3QD9A 4ZILA 2K8VA 1EGOA 1SYXA 4Q5QA 4O32A 1USBA 4LMVA 1GSSA 2V6KA 2C3TA 1B8XA 2LNSA 4ZB8A 4N10A 3HHVA 2YWIA 3KTLA 3TRPA 3IXRA 1SKSB 3DD3A 1NM3A 3C73A 2IMDA 5CO3A 2H70A 4YQVA 4GQFA 3PINA 2JSYA 4OD7A 2VIMA 2GGTA 4MZBA 1AUCA 3ZL5A 3TKSA 3LQ7A 1AXDA 1IYIA 2F3MA 1XWBA 3RHBA 3NZNA 2JACA 3KTBA 5KN3A 3RHCA 4EO3A 3DVXA 1GWCA 2DJ1A 4G10A 2HSMA 1SKWB 5G5FA 1KTEA 4TRXA 4BVXA 1J0FA 1A8YA 4GWRA 5DAKA 2AB6A 2LRCA 2LSTA 1XW9A 1TP9A 1XFLA 3GSTA 2VAFA 4KDYA 4P3YB 1K0NA 5D73A 3VFIA 1WP0A 3EC3A 3ZVJA 4J56E 5KOWA 5DALA 5FWGA 1JZRA 2A4HA 4OO4A 5JCWA 2L4CA 3W8JA 2JZSA 4MZCA 3C71A 1DSBA 1PQNA 3IAS2 2JU5A 1AQVA 4BPYA 4O92A 2YZHA 1HNBA 1TOFA 2X8GA 2JSZA 3IC4A 2ON5A 4PQ1A 2HT9A 3FY7A 3VURA 3D6IA 4WETA 4N30A 3P8WA 3ISOA 1FVJA 1I5GA 4N0VA 2GT6A 4MF5A 4JZQA 3KJYA 5G2ZA 2HSYA 3WT2A 5D9VA 2VLTA 3F8UA 1Z6MA 2P5QA 1VGLA 2QC7A 1S3DA 3GUSA 1FHEA 5GZZB 3TJBA 1ERWA 3WYWA 4RI7A 5CRHA 1PKZA 1O8XA 2KHPA 2UZ8A 2B1KA 3M8NA 3KGKA 1MD4A 1XVQA 2RUEA 4NXIA 3R2QA 1UC7A 1EEMA 2R5GA 3CXGA 4PGTA 3G7YA 4ULXA 1OC8A 1HQOA 2WGRA 2OE1A 3FEUA 4KNDA 4EDYA 3ERGA 2HNLA 4RI6A 1FOVA 4ECIA 5HFKA 2PMTA 3K8NA 5DQSA 3RPPA 3IV4A 2XPEA 3P90A 2H71A 1Q4JA 4D73B 4TR3A 2YZUA 4L5LA 4K6XA 2J23A 4GQCA 5IM9A 3CYNA 4OO5A 2VCZA 5KOXA 2EIQA 3CMIA 1EEJA 4N0ZA 1WJKA 4TXOA 2FWHA 3GMFA 4WBJA 1SK0A 1MDIA 4IW9A 1F9MA 3QOUA 4WEYA 3G7JA 4K9ZA 20GSA 1WMJA 2OA7A 2PBJA 3EVIA 1OAZA 4ACSA 2VL9A 1M0UA 3D0ZA 2ON7A 2R0CA 4MJEA 2C0DA 2BMXA 1MTCA 1N8JA 2AV4A 3CBUA 2DC5A 2VCVA 3O3TA 1AC1A 4ZIJA 1G6WA 2OJLA 6GSXA 2LJKA 2HXKA 4ML1A 3FZ5A 1THOA 3Q18A 2E0QA 3ZITA 2OACA 3PGTA 4MDCA 1G7EA 4YKGA 1OKDA 4K5SA 3FZAA 1FVKA 3KM6A 2FWFA 2K18A 4KSOA 3WGXA 1V2AA 4F9ZA 1CQGA 1ON4A 1GL8A 2CQ9A 4PURA 2DBCA 2GT5A 3SWLA 1GULA 4Z2RA 5DVBA 4GLTA 5D9XA 1TRWA 2RLIA 4JE1A 2ZCTA 4Z2TA 2NBSA 5EY6A 1BEDA 4PUFC 2C3QA 2C0FA 1PA3A 5KN1A 3C8EA 3UBLA 1SL1B 3DWVA 4KA0A 4Q5RA 2ZNMA 3EPTA 3F4SA 3U5RE 1O6JA 4ZBDA 4ECBA 3G9BA 4N11A 5C00A 3HY2A 2V2GA 4PQIA 4NPBA 2HLSA 2IMEA 2AYTA 3IRAA 2PGTA 4KDUA 1ZYNA 3J7Yb 2VLVA 1LJRA 14GSA 2LQOA 1F6MC 4BVXB 2Z9SA 3TJFA 1K3YA 5HR3A 4MCUA 2CAQA 3BOAA 3BBYA 2O7KA 4L0UA 1ERTA 1JLVA 4PUAA 2A2PA 2WJUA 1Y6EA 4NHZA 4ZL8A 5G5EA 2IFQA 4OCFA 2WDUA 4AJ6A 1X0RA 2L6CA 1ZZYA 4HUAA 2WULA 1BX9A 4PNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9H A;  4X0X A;  2GZY A;  1JZW A;  2PN8 A;  5B6N A;  3QDN A;  4L0W A;  1YKC A;  2N5B A;  2C1Y A;  3D21 A;  1GSF A;  1OE7 A;  4TR4 A;  2YOI A;  3KEB A;  5JCG A;  1TU8 A;  5J3R A;  3QCP A;  4MJB A;  1PX7 A;  1U6T A;  2M46 A;  5G1L A;  3QAG A;  2B1L A;  3DIE A;  3GL5 A;  4EL1 A;  1RW1 A;  2L4Q A;  2XC2 A;  5DJL A;  3MWH A;  1B9Y C;  5E59 A;  3DGQ A;  3TGZ A;  1ML6 A;  1JZO A;  2FWE A;  3C1S A;  2R2J A;  1K0B A;  4MP4 A;  5G1K A;  3HVX A;  4KAE A;  4F82 A;  4OFT A;  5HFG A;  1A2L A;  2MBS A;  2LKU A;  1H4O A;  1TXX A;  1O73 A;  1ZYE A;  5ECP B;  3P7X A;  4ZB9 A;  1T4Y A;  2YCD A;  3A2V A;  1B4Q A;  1RK4 A;  2FNO A;  5HR1 A;  5IO2 A;  4TN8 A;  2JL4 A;  5J41 A;  2CX3 A;  1GSD A;  1U88 A;  4POM A;  3M0F A;  1GSQ A;  1H75 A;  1U3I A;  1TDI A;  5LNK e;  3MAK A;  1EP8 A;  2KLX A;  4EUY A;  1E6B A;  2O89 A;  5H5Q A;  1LU4 A;  4E8E A;  3HJM A;  3HD5 A;  3F6D A;  5ELA A;  4MJA A;  1TI3 A;  2H1D A;  3Q74 A;  2MBT A;  5J9C A;  5D9T A;  6GSW A;  1TRS A;  3EMP A;  2NPB A;  3IK7 A;  1K3L A;  5IMC A;  4WBR D;  1W89 A;  1TJD A;  2L5O A;  1EOH A;  1QUW A;  3IE3 A;  1VF3 A;  5IIZ A;  4OMV A;  1Q98 A;  3RPN A;  2QGV A;  4QQ7 A;  2OAD A;  1T8E B;  2IPA A;  1MD3 A;  3U6V A;  3LG6 A;  1WIK A;  1QGV A;  1B4P A;  2H6Y A;  2GVP A;  2GQK A;  3EWL A;  3JCM L;  2TIR A;  5L71 A;  1TK8 B;  4GCI A;  3M3M A;  1PX6 A;  2HZF A;  2M72 A;  3KXO A;  1ILO A;  1FB6 A;  2C3N A;  1JLW A;  4ZBA A;  2GSQ A;  4FYU A;  2E2M A;  2A2R A;  1I9D A;  5CRE A;  1T3B A;  1G0T A;  2FLS A;  1TTZ A;  4TR0 A;  1BYE A;  2IWT A;  1ZGN A;  3TKP A;  1TRU A;  4HS1 A;  2FY6 A;  2F8A A;  2F8F A;  3NIV A;  4GRF A;  4RQX A;  4K1F A;  1QFN A;  1M2A A;  2RM6 A;  1T7P B;  1JHB A;  3A2W A;  2X8H A;  3GA4 A;  5ECH B;  2L59 A;  3IHQ A;  2H1A A;  4HZ2 A;  1R7H A;  2IFQ B;  4KCE A;  5B8A A;  4JED A;  1GRX A;  2I9H A;  3IPZ A;  1FW1 A;  3FZ9 A;  4AGS A;  3H1N A;  4WR5 A;  5INY A;  1YZX A;  1YDK A;  3BCK A;  1XIY A;  4OFM A;  5ECL B;  2XBI A;  5AIX A;  3ZML A;  3KCM A;  1ZCP A;  3HYP A;  5DQY A;  2OKA A;  4G2E A;  5LCZ A;  3CTG A;  2DIZ A;  5ECQ B;  4DEJ A;  2EIR A;  3KZQ A;  3KP9 A;  4HI7 A;  1A2J A;  1V57 A;  4KUN A;  4MH2 A;  2OE0 A;  2CZ2 A;  2N5F A;  1DE1 A;  3EU3 A;  1VRS D;  22GS A;  2GST A;  3GRX A;  1XOA A;  5C04 A;  3VWW A;  3DYR A;  3FR9 A;  1K0M A;  4X43 A;  1ACV A;  4F0C A;  3TJK A;  1AQW A;  2PUK C;  1BG5 A;  2WCI A;  4Z7X A;  4ECJ A;  3Q19 A;  4I97 A;  1SU9 A;  3GH9 A;  1M7T A;  2CVB A;  2H0H A;  3FR3 A;  1TK5 B;  4OCE A;  5IPH A;  1PL2 A;  2H6X A;  3HVS A;  2X99 A;  3HDC A;  4ZBB A;  4GST A;  3QAW A;  2WFC A;  3A2X A;  5GST A;  4G19 A;  5D93 A;  2YWM A;  3FK8 A;  3F63 A;  1YF0 A;  3EUR A;  3M9J A;  1V9W A;  5HR2 A;  4NAX A;  1SKR B;  3H4K A;  4WF4 A;  4HU7 A;  3APQ A;  2L57 A;  1AIU A;  2HSH A;  1K0O A;  2VL3 A;  1O81 A;  4F0B A;  1SYR A;  4IP1 A;  3VWX A;  1THX A;  3FHK A;  1X9S B;  5J4U A;  5E4W A;  3TKQ A;  1VF2 A;  1GP1 A;  4FO5 A;  4ZXG A;  11GS A;  5CRG A;  3D22 A;  1SJI A;  2CVK A;  3ME7 A;  2K6V A;  3TCO A;  3CSI A;  4K0N A;  4F2I A;  4KE3 A;  4ML6 A;  1XPV A;  1SEN A;  3VPT A;  1K0D A;  2O87 A;  4DSS B;  2CA8 A;  2GLR A;  1MEK A;  1Y25 A;  3UVH A;  1TRV A;  2ZUP A;  4ECC A;  1YF1 A;  3GKX A;  2CT6 A;  2H19 A;  4I2U A;  1K0A A;  18GS A;  2LRT A;  5CRD A;  4TKY A;  5CAX A;  1O7U A;  2HZE B;  1C72 A;  3GUR A;  5CYY A;  4MF6 A;  4AJ8 A;  5EPF A;  2A2S A;  1S3A A;  4ZB6 A;  2PER A;  1Z6N A;  3DVW A;  3LYK A;  4BWQ A;  1PRX A;  1XW6 A;  2FWG A;  4NMU A;  4XRA A;  5D96 A;  2EC4 A;  3AY8 A;  3ZLP A;  6GSY A;  2TRX A;  3E3E A;  3FW2 A;  4KCA A;  1MDK A;  4TOP A;  1UVZ A;  2N5A A;  3MNG A;  4EXJ A;  3VI7 A;  3FYG A;  4IP6 A;  2IL3 A;  2LJR A;  2YN1 A;  1X5E A;  1ZYQ B;  16GS A;  2NTO A;  7GSS A;  4TW5 A;  1Z7R A;  3TJJ A;  2PVO C;  3GSS A;  4MH3 A;  2LNT A;  1XWC A;  3FZ4 A;  4MK3 A;  4RQR A;  4GXZ A;  2GQL A;  1PL1 A;  2G2Q A;  5J9B A;  3TOU A;  2H66 A;  3GYK A;  5AN1 A;  3FKF A;  2MYG A;  4PX1 A;  4XCS A;  2LRN A;  4ISD A;  2FCH A;  1XOB A;  3TRX A;  1KBN A;  4IJI A;  2V6O A;  3TKR A;  2KOK A;  2KUC A;  3P2A A;  4HU9 A;  1GUM A;  5HR0 A;  3GKN A;  2YJ7 A;  4I2T A;  4POB A;  3FRC A;  6GST A;  1SL0 B;  5ABR A;  2D2Z A;  4WF5 A;  4XS1 A;  5IOW A;  1LBK A;  3TOT A;  4XIH A;  4XHM A;  5HFI A;  3IOS A;  4ILF A;  3L9V A;  1IYH A;  3DKS A;  4DVC A;  2LS5 A;  3UVT A;  2RII A;  2I4A A;  4YQM A;  13GS A;  3GKK A;  4O7H A;  4L8E A;  3I69 A;  4ID0 A;  3UBK A;  2FA8 A;  1EZK A;  2H76 A;  3D4T A;  1QXH A;  5A4W A;  3HJP A;  1F37 A;  5JWQ B;  3L9U A;  1X5C A;  2VL2 C;  3ME8 A;  5H5R A;  5FHI A;  2G0F A;  1SJZ A;  2NVL A;  1T00 A;  3QFB C;  3APO A;  1A0R P;  1HNA A;  4EE0 A;  2B5E A;  3ZVJ D;  1F3A A;  4JR4 A;  4V1A g;  3LJR A;  3ZMK A;  1YQ1 A;  1DUG A;  2AAW A;  2GS3 A;  4EC0 A;  1PKW A;  4IQA A;  2H30 A;  2MMN A;  3LFL A;  2PWJ A;  1XZO A;  2NDO A;  2IMF A;  3GHA A;  2IN3 A;  5KN0 A;  3S9F A;  2DJK A;  3A3T A;  1OE8 A;  3M9K A;  2M80 A;  4O5R A;  1A0F A;  4J57 E;  3A5W A;  3LXT A;  1XW5 A;  4RUV A;  5ENU A;  4DSR A;  2OBI A;  5IMA A;  2DJJ A;  2FD3 A;  2YPM A;  4CDO A;  2P5R A;  2K9F A;  2VCX A;  1FG4 A;  3CSH A;  3F0I A;  3TRQ A;  3H93 A;  5ECM B;  1GNW A;  3NOF A;  4KDX A;  2DSA A;  3DML A;  4GSS A;  5ID2 A;  2VCW A;  2CZ3 A;  2PPT A;  1WWJ A;  1NW2 A;  3ERW A;  5JWR B;  5JCU A;  1ZOF A;  2GSR A;  3GTU A;  3HJO A;  3C7M A;  3GIX A;  1PGT A;  2LTK A;  4XS4 A;  3CSJ A;  4NV5 A;  2XBQ A;  4HDE A;  4BA7 A;  4PNF A;  2YP6 A;  3EIN A;  1TW9 A;  4DSS A;  4I8B A;  2HI7 A;  4WXT A;  1TI1 A;  4MPF A;  3UMA A;  3OR5 A;  5ECS A;  1U3A A;  1S3C A;  1ERU A;  1OC9 A;  2H73 A;  2PU9 C;  4QL7 A;  4MAB A;  5ECN B;  3GNJ A;  2DML A;  5IMV A;  3VI5 A;  2LEG A;  3I9V 2;  4K2D A;  2VL2 A;  2IJY A;  1NHO A;  1SJ6 A;  4POK A;  1O8W A;  1M9B A;  1OVN A;  1WOU A;  4KX4 A;  3QFA C;  1X9W B;  3TDG A;  1AAZ A;  3KD0 A;  2HZE A;  3HZ8 A;  2CAI A;  12GS A;  2YWN A;  3O76 A;  2CV4 A;  4PQH A;  4JU5 A;  1M2B A;  3F9U A;  4IN0 A;  2L5L A;  4AJ7 A;  3L4N A;  4XTS A;  3IDV A;  1V58 A;  1ABA A;  2H0I A;  4K0G A;  4XRD A;  2REM A;  2X64 A;  5AIS A;  3ZIV A;  3GFK A;  9GSS A;  3EMX A;  2R3X A;  3UOM A;  2MMO A;  4WR4 A;  2GSS A;  3ERF A;  4WKW A;  1W4V A;  4MMM A;  2YJH A;  5G30 A;  4BL7 A;  1X5D A;  3RBT A;  2LJA A;  5A4U A;  1R26 A;  5A5K A;  1URM A;  3LOR A;  1GUK A;  3CRU A;  4LA1 A;  5J5N A;  1A8L A;  2P0G A;  5DCH A;  1UA5 A;  3UAP A;  2B7K A;  2MZC A;  3FR6 A;  4IGJ A;  1PSQ A;  1GLQ A;  1SD9 A;  4IS0 A;  2F9S A;  1J9B A;  1KNG A;  1XVW A;  2ES7 A;  4OWY A;  2GQM A;  3HVV A;  4HJM A;  2C4J A;  5A4V A;  1GTI A;  4HQZ A;  2FHE A;  2QSI A;  3KIJ A;  1J08 A;  4EVM A;  1CQH A;  2H01 A;  4HOJ A;  3HA9 A;  2HRF A;  2H72 A;  1DE2 A;  3ZIJ A;  1QMV A;  1ST9 A;  3VWV A;  4IHU A;  4V2M A;  3GH6 A;  4PXO A;  4BVY A;  2H8L A;  3GX0 A;  1HYU A;  3UEM A;  3ED3 A;  3TB2 A;  6GSV A;  3F3R A;  3ZZX A;  5DBQ A;  5ECR B;  4CHS A;  1R5P A;  5ECK B;  3VWU A;  5CP1 A;  3KH7 A;  2H6Z A;  2R37 A;  2HE3 A;  4KGI A;  1T1V A;  2FGX A;  3TUE A;  3F4T A;  1VF4 A;  1XBS A;  1A24 A;  3APS A;  3I43 A;  2K8S A;  1GLP A;  1SL2 B;  1X9M B;  4FYC A;  4IJ3 A;  3LGC A;  3J7Y k;  5FT3 A;  2BTO T;  2ALB A;  3EE2 A;  10GS A;  1OKT A;  4J2F A;  1SK1 A;  1BJX A;  5GSS A;  2B3S A;  4IVF A;  3GX8 A;  2E7P A;  4I6X A;  2JZR A;  4JBB A;  1FAA A;  4GF0 A;  1VF1 A;  4FYB A;  2IMK A;  2VCQ A;  6GSU A;  5JWO B;  1YY7 A;  3E0U A;  5ID2 B;  5IOX A;  1SD8 A;  3M1G A;  2GTU A;  2B5Y A;  4LMW A;  3UIW A;  2H1G A;  1ERV A;  4V2N A;  3GTU B;  4MA9 A;  4XS4 B;  1GTU A;  1GSY A;  4POL A;  2LV3 A;  2C8U A;  3PR8 A;  4G9H A;  2P31 A;  3D5J A;  3VPQ A;  2WB9 A;  3UJ1 A;  3QMX A;  2YV7 A;  3F3Q A;  4I5Q A;  5F07 A;  2X8C A;  2CX4 A;  19GS A;  4E8H A;  3VLN A;  1GUH A;  4KB3 A;  2WRT A;  2DLX A;  3EU4 A;  2HFD A;  5DDL A;  1OC9 B;  1RQM A;  2YAN A;  2A4V A;  2VOC A;  4IEL A;  4BWS A;  8GSS A;  2IMI A;  1WE0 A;  3N9J A;  1GSE A;  4AF2 A;  2YV9 A;  1WPI A;  2C80 A;  2VUP A;  5KEJ A;  4V1A p;  1F2E A;  4ZL9 A;  4HZ4 A;  1XWA A;  2GZP A;  3LXZ A;  1XXU A;  2I3Y A;  3DEX A;  3GKM A;  1PD2 1;  2QKE A;  4CW9 A;  2DMM A;  3O6T A;  4MZW A;  2R6K A;  1R4W A;  1EV4 A;  1XWG A;  4YQU A;  2H75 A;  5HQP A;  3ZRE A;  2E2G A;  2GDR A;  5F05 A;  3DRN A;  4MF7 A;  1Z7P A;  5ELG A;  5IMD A;  3IR4 A;  1G6Y A;  4TR1 A;  1BQ7 A;  2KP1 A;  3HZ4 A;  4IBP A;  4L5O A;  1GTB A;  2JAD A;  3UL3 A;  3GN3 A;  1QK8 A;  4GTU A;  1OYJ A;  5AGY A;  3US3 A;  3KMO A;  2RM5 A;  4TVE A;  1Z5Y E;  3H8Q A;  1NHY A;  5IPG A;  2O8V B;  2DIY A;  3F6F A;  1ZL9 A;  2V32 A;  1V40 A;  1UN2 A;  4YAV A;  1Z3E A;  1G7O A;  2VO4 A;  4OFN A;  3WD6 A;  5D8I A;  1KEB A;  5H5S A;  1MDJ A;  3MDK A;  4K7N A;  1GTA A;  3QAV A;  3HKR A;  5DCG A;  2YWO A;  3D4M A;  3BD2 A;  5F06 A;  3IK9 A;  5LD0 A;  2YNX A;  3Q6O A;  2LQQ A;  2VD1 A;  2DJ2 A;  2V41 A;  1M9A A;  3CTF A;  1EOG A;  2GZZ A;  5B6M A;  3IA1 A;  2IIY A;  2PVQ A;  1HNC A;  1O85 A;  4HJ2 A;  3I6A A;  1SK2 A;  3L0H A;  2VM2 A;  5DAK B;  17GS A;  4HQS A;  3IAM 2;  5CNW A;  2OBK A;  4GSN A;  2AHE A;  4MJC A;  1TKD B;  2R4V A;  4JRR A;  4YH2 A;  2WS2 A;  5DAL B;  3LYP A;  4IKH A;  2H0G A;  5B7C A;  3BCI A;  3HCZ A;  5EL8 A;  3BJ5 A;  3G7I A;  3LEF A;  3CRT A;  3ZFB A;  5GAP D;  4Q5N A;  5KN2 A;  1FO5 A;  5IQY A;  1BAY A;  3WGE A;  5ECI B;  4ZL7 A;  2MMZ A;  4LLR A;  1JFU A;  3GV1 A;  3QR6 A;  2H1B A;  4MPG A;  1A2M A;  1EP7 A;  1B48 A;  1N2A A;  3MSZ A;  1EWX A;  2EIO A;  2B7J A;  1GSU A;  1K3O A;  5F0G A;  4LL4 B;  3TKS E;  1JZD A;  2VLU A;  1A23 A;  4DSQ A;  1PMT A;  2XPD A;  1EGR A;  1PN9 A;  2LUS A;  5IO0 A;  1XWK A;  5G31 A;  4FH8 A;  1GNE A;  2VM1 A;  3W8S A;  4KH7 A;  2AJQ B;  2F51 A;  2DJ0 A;  4YAP A;  1YEX A;  5GAN D;  1WRY A;  5IMF A;  1M99 A;  2CVD A;  4HEA 2;  4Q5F A;  2KP2 A;  4K7O A;  1AQX A;  1GH2 A;  3TKS C;  2C0G A;  2HRN A;  3EYT A;  4IQ1 A;  3WGD A;  3HXS A;  2MMA A;  3E9J B;  4KSM A;  3ZYW A;  3KP8 A;  3W6G A;  5ECO B;  4K8M A;  4NV2 A;  2VCT A;  1E2Y A;  2FUG 2;  5COH A;  1EV9 A;  5B8B A;  4XS6 A;  5AIV A;  3L9S A;  3KMN A;  3RDW A;  3ZTL A;  4X1U A;  2BJX A;  2JZT A;  4TXO B;  2RUF A;  3ZRD A;  4V2L A;  1U87 A;  2J9H A;  2B5X A;  3DXB A;  3UAR A;  1YEP A;  1YKA A;  5IMZ A;  4EKZ A;  1OC3 A;  5F8B A;  2H74 A;  2WZ9 A;  3RAZ A;  4QL9 A;  1F3B A;  1TK0 B;  3F4R A;  3N5O A;  4D73 A;  2AUV A;  3LSZ A;  4LL1 B;  4EF0 A;  3LWA A;  5D9W A;  1AW9 A;  2I81 A;  2XHF A;  4FIW A;  5CRW A;  1B9X C;  2I1U A;  4TR1 B;  1TU7 A;  1M2D A;  4JR6 A;  3C1R A;  3V1W A;  2OE3 A;  2L6D A;  1XCC A;  2VD0 A;  1QQ2 A;  2TRC P;  4F03 A;  4H86 A;  3ZFL A;  6GSS A;  3KH9 A;  3IBH A;  4TXV A;  1V98 A;  4NWY A;  4MLY A;  3TJG A;  2C0E A;  2V1M A;  1R5A A;  3GL3 A;  5EVO A;  3WT1 A;  4K7I A;  2FA4 A;  3SBC A;  3L78 A;  1DBY A;  1T4Z A;  2DJ3 A;  3VK9 A;  1FB0 A;  1NSW A;  4NHW A;  5DJM A;  1HD2 A;  4EDZ A;  2HYX A;  3PH9 A;  1K0C A;  3H79 A;  3QPM A;  4KW6 A;  1ZMA A;  1YJ6 A;  2B6M A;  2O85 A;  3QD9 A;  4ZIL A;  2K8V A;  1EGO A;  1SYX A;  4Q5Q A;  4O32 A;  1USB A;  4LMV A;  1GSS A;  2V6K A;  2C3T A;  1B8X A;  2LNS A;  4ZB8 A;  4N10 A;  3HHV A;  2YWI A;  3KTL A;  3TRP A;  3IXR A;  1SKS B;  3DD3 A;  1NM3 A;  3C73 A;  2IMD A;  5CO3 A;  2H70 A;  4YQV A;  4GQF A;  3PIN A;  2JSY A;  4OD7 A;  2VIM A;  2GGT A;  4MZB A;  1AUC A;  3ZL5 A;  3TKS A;  3LQ7 A;  1AXD A;  1IYI A;  2F3M A;  1XWB A;  3RHB A;  3NZN A;  2JAC A;  3KTB A;  5KN3 A;  3RHC A;  4EO3 A;  3DVX A;  1GWC A;  2DJ1 A;  4G10 A;  1SKW B;  5G5F A;  1KTE A;  4TRX A;  4BVX A;  1J0F A;  1A8Y A;  4GWR A;  5DAK A;  2AB6 A;  2LRC A;  2LST A;  1XW9 A;  1TP9 A;  1XFL A;  3GST A;  2VAF A;  4KDY A;  4P3Y B;  1K0N A;  5D73 A;  3VFI A;  1WP0 A;  3EC3 A;  3ZVJ A;  4J56 E;  5DAL A;  5FWG A;  1JZR A;  4OO4 A;  5JCW A;  2L4C A;  3W8J A;  2JZS A;  4MZC A;  3C71 A;  1DSB A;  1PQN A;  3IAS 2;  2JU5 A;  1AQV A;  4BPY A;  4O92 A;  2YZH A;  1HNB A;  1TOF A;  2X8G A;  2JSZ A;  3IC4 A;  2ON5 A;  4PQ1 A;  2HT9 A;  3FY7 A;  3VUR A;  3D6I A;  4WET A;  4N30 A;  3P8W A;  3ISO A;  1FVJ A;  1I5G A;  4N0V A;  2GT6 A;  4MF5 A;  4JZQ A;  3KJY A;  5G2Z A;  2HSY A;  3WT2 A;  5D9V A;  2VLT A;  3F8U A;  1Z6M A;  2P5Q A;  1VGL A;  2QC7 A;  1S3D A;  3GUS A;  1FHE A;  5GZZ B;  3TJB A;  1ERW A;  3WYW A;  4RI7 A;  5CRH A;  1PKZ A;  1O8X A;  2KHP A;  2B1K A;  3M8N A;  3KGK A;  1MD4 A;  1XVQ A;  2RUE A;  4NXI A;  3R2Q A;  1UC7 A;  1EEM A;  2R5G A;  3CXG A;  4PGT A;  3G7Y A;  4ULX A;  1OC8 A;  1HQO A;  2WGR A;  2OE1 A;  3FEU A;  4KND A;  4EDY A;  3ERG A;  2HNL A;  4RI6 A;  1FOV A;  4ECI A;  5HFK A;  2PMT A;  3K8N A;  5DQS A;  3RPP A;  3IV4 A;  2XPE A;  3P90 A;  2H71 A;  1Q4J A;  4D73 B;  4TR3 A;  2YZU A;  4L5L A;  4K6X A;  2J23 A;  4GQC A;  5IM9 A;  3CYN A;  4OO5 A;  2VCZ A;  2EIQ A;  3CMI A;  1EEJ A;  4N0Z A;  1WJK A;  4TXO A;  2FWH A;  3GMF A;  4WBJ A;  1SK0 A;  1MDI A;  4IW9 A;  1F9M A;  3QOU A;  4WEY A;  3G7J A;  4K9Z A;  20GS A;  1WMJ A;  2OA7 A;  2PBJ A;  3EVI A;  1OAZ A;  4ACS A;  2VL9 A;  1M0U A;  3D0Z A;  2ON7 A;  4MJE A;  2C0D A;  2BMX A;  1MTC A;  1N8J A;  2AV4 A;  3CBU A;  2DC5 A;  2VCV A;  3O3T A;  1AC1 A;  4ZIJ A;  1G6W A;  2OJL A;  6GSX A;  2LJK A;  2HXK A;  4ML1 A;  3FZ5 A;  1THO A;  3Q18 A;  2E0Q A;  3ZIT A;  2OAC A;  3PGT A;  4MDC A;  1G7E A;  1OKD A;  3FZA A;  1FVK A;  3KM6 A;  2FWF A;  2K18 A;  4KSO A;  3WGX A;  1V2A A;  4F9Z A;  1CQG A;  1ON4 A;  1GL8 A;  2CQ9 A;  4PUR A;  2DBC A;  2GT5 A;  3SWL A;  1GUL A;  5DVB A;  4GLT A;  5D9X A;  1TRW A;  2RLI A;  4JE1 A;  2ZCT A;  2NBS A;  5EY6 A;  1BED A;  4PUF C;  2C3Q A;  2C0F A;  1PA3 A;  5KN1 A;  3C8E A;  3UBL A;  1SL1 B;  3DWV A;  4KA0 A;  4Q5R A;  2ZNM A;  3F4S A;  3U5R E;  1O6J A;  4ZBD A;  4ECB A;  3G9B A;  4N11 A;  5C00 A;  3HY2 A;  2V2G A;  4PQI A;  4NPB A;  2HLS A;  2IME A;  2AYT A;  3IRA A;  2PGT A;  4KDU A;  3J7Y b;  2VLV A;  1LJR A;  14GS A;  2LQO A;  1F6M C;  2Z9S A;  3TJF A;  1K3Y A;  5HR3 A;  4MCU A;  2CAQ A;  3BOA A;  3BBY A;  2O7K A;  4L0U A;  1ERT A;  1JLV A;  4PUA A;  2WJU A;  1Y6E A;  4NHZ A;  4ZL8 A;  5G5E A;  2IFQ A;  4OCF A;  2WDU A;  4AJ6 A;  1X0R A;  2L6C A;  1ZZY A;  4HUA A;  2WUL A;  1BX9 A;  4PNG A; 
#chains in the Genus database with same CATH topology
 1Z9H A;  4X0X A;  2GZY A;  1JZW A;  2PN8 A;  5B6N A;  3QDN A;  4L0W A;  1YKC A;  2N5B A;  2C1Y A;  3D21 A;  1GSF A;  1OE7 A;  4TR4 A;  2YOI A;  3KEB A;  5JCG A;  1TU8 A;  5J3R A;  3QCP A;  4MJB A;  1PX7 A;  1U6T A;  2M46 A;  5G1L A;  3QAG A;  2B1L A;  3DIE A;  3GL5 A;  4EL1 A;  1RW1 A;  2L4Q A;  2XC2 A;  5DJL A;  3MWH A;  1B9Y C;  5E59 A;  3DGQ A;  3TGZ A;  1ML6 A;  4KF9 A;  4A5P A;  1JZO A;  2FWE A;  3C1S A;  2R2J A;  1K0B A;  4MP4 A;  5G1K A;  3HVX A;  4KAE A;  4F82 A;  4OFT A;  3MIX A;  5HFG A;  1A2L A;  2MBS A;  2LKU A;  1H4O A;  1TXX A;  1O73 A;  1ZYE A;  5ECP B;  3P7X A;  4ZB9 A;  1T4Y A;  2YCD A;  3A2V A;  1B4Q A;  1RK4 A;  2FNO A;  5HR1 A;  5IO2 A;  4TN8 A;  2JL4 A;  5J41 A;  2CX3 A;  1GSD A;  1U88 A;  4POM A;  3M0F A;  1GSQ A;  1H75 A;  1U3I A;  1TDI A;  5LNK e;  3MAK A;  1EP8 A;  2KLX A;  4EUY A;  1E6B A;  2O89 A;  2HRA A;  5H5Q A;  1LU4 A;  4E8E A;  3HJM A;  3HD5 A;  3F6D A;  5ELA A;  4MJA A;  1S3R A;  1TI3 A;  2H1D A;  3Q74 A;  2MBT A;  5J9C A;  5D9T A;  6GSW A;  1TRS A;  3EMP A;  2NPB A;  3IK7 A;  1K3L A;  5IMC A;  4WBR D;  1W89 A;  1TJD A;  2L5O A;  1EOH A;  1QUW A;  3IE3 A;  1VF3 A;  5IIZ A;  4OMV A;  1Q98 A;  3RPN A;  2QGV A;  4QQ7 A;  2OAD A;  1T8E B;  3CQF A;  2IPA A;  1MD3 A;  2DKI A;  3U6V A;  3LG6 A;  1WIK A;  1QGV A;  1B4P A;  2H6Y A;  2GVP A;  2GQK A;  3EWL A;  3JCM L;  2TIR A;  5L71 A;  1TK8 B;  4GCI A;  3M3M A;  1PX6 A;  2HZF A;  2M72 A;  3KXO A;  1ILO A;  1FB6 A;  2C3N A;  1JLW A;  4ZBA A;  2GSQ A;  4FYU A;  4O5U A;  2E2M A;  2A2R A;  1I9D A;  5CRE A;  1T3B A;  1G0T A;  2FLS A;  1TTZ A;  4TR0 A;  1BYE A;  2IWT A;  1ZGN A;  3TKP A;  3FMW A;  1TRU A;  4HS1 A;  2FY6 A;  2F8A A;  2F8F A;  3NIV A;  4GRF A;  4RQX A;  4K1F A;  1QFN A;  1M2A A;  2RM6 A;  1T7P B;  1JHB A;  3A2W A;  2X8H A;  3GA4 A;  5ECH B;  2L59 A;  3IHQ A;  2H1A A;  4HZ2 A;  1R7H A;  2IFQ B;  4KCE A;  5B8A A;  4JED A;  1GRX A;  2I9H A;  3IPZ A;  1FW1 A;  3FZ9 A;  4AGS A;  3H1N A;  4WR5 A;  5INY A;  1YZX A;  1YDK A;  3BCK A;  1XIY A;  4OFM A;  5ECL B;  2XBI A;  5AIX A;  3ZML A;  3KCM A;  1ZCP A;  3HYP A;  5DQY A;  2OKA A;  4G2E A;  5LCZ A;  3CTG A;  2DIZ A;  5ECQ B;  2QA2 A;  4DEJ A;  3MYD A;  2EIR A;  3KZQ A;  3KP9 A;  4HI7 A;  1A2J A;  1V57 A;  4KUN A;  4MH2 A;  2OE0 A;  2CZ2 A;  2N5F A;  1DE1 A;  3EU3 A;  1VRS D;  22GS A;  1ZYP A;  2GST A;  3GRX A;  1XOA A;  5C04 A;  3VWW A;  3DYR A;  3FR9 A;  1K0M A;  4X43 A;  1ACV A;  4F0C A;  3TJK A;  1AQW A;  2PUK C;  1BG5 A;  2WCI A;  4Z7X A;  4ECJ A;  3Q19 A;  4I97 A;  1SU9 A;  3GH9 A;  1M7T A;  2CVB A;  2H0H A;  3FR3 A;  4G0L A;  1TK5 B;  4OCE A;  5IPH A;  1PL2 A;  2H6X A;  3HVS A;  2X99 A;  3HDC A;  4ZBB A;  4GST A;  3QAW A;  2WFC A;  3A2X A;  5GST A;  4O5Q A;  4G19 A;  5D93 A;  2YWM A;  3FK8 A;  3F63 A;  1YF0 A;  3EUR A;  3M9J A;  1V9W A;  5HR2 A;  4NAX A;  1SKR B;  3H4K A;  4WF4 A;  4HU7 A;  3APQ A;  2L57 A;  1AIU A;  2HSH A;  1K0O A;  2VL3 A;  1O81 A;  4F0B A;  5BRT A;  1SYR A;  4IP1 A;  3VWX A;  1THX A;  3FHK A;  1X9S B;  5J4U A;  5E4W A;  3TKQ A;  1VF2 A;  1GP1 A;  4FO5 A;  4ZXG A;  11GS A;  5CRG A;  3D22 A;  1SJI A;  2CVK A;  3ME7 A;  2K6V A;  3TCO A;  3CSI A;  4K0N A;  4F2I A;  4KE3 A;  4ML6 A;  4Z2U A;  1XPV A;  1SEN A;  3VPT A;  1K0D A;  2O87 A;  4DSS B;  2CA8 A;  4K2X A;  2GLR A;  1MEK A;  1Y25 A;  3UVH A;  1TRV A;  2ZUP A;  4ECC A;  1YF1 A;  3GKX A;  2CT6 A;  2H19 A;  2DKH A;  4I2U A;  2R0G A;  1K0A A;  18GS A;  2LRT A;  5CRD A;  4TKY A;  2X49 A;  5CAX A;  1O7U A;  2HZE B;  1C72 A;  3GUR A;  5CYY A;  4YKF A;  4MF6 A;  4AJ8 A;  5EPF A;  2A2S A;  1S3A A;  4ZB6 A;  2PER A;  1Z6N A;  3DVW A;  3LYK A;  4BWQ A;  1PRX A;  1XW6 A;  2FWG A;  4NMU A;  4XRA A;  5D96 A;  2EC4 A;  3AY8 A;  3ZLP A;  6GSY A;  2TRX A;  3E3E A;  3FW2 A;  4KCA A;  1MDK A;  4TOP A;  1UVZ A;  2N5A A;  3MNG A;  4ICY A;  4EXJ A;  3VI7 A;  3FYG A;  4IP6 A;  2IL3 A;  2LJR A;  4EIQ A;  2YN1 A;  4USS A;  1X5E A;  4BL7 B;  1ZYQ B;  16GS A;  2NTO A;  7GSS A;  4TW5 A;  1Z7R A;  3TJJ A;  2PVO C;  3GSS A;  4MH3 A;  2LNT A;  1XWC A;  3FZ4 A;  4MK3 A;  4RQR A;  4GXZ A;  2GQL A;  1PL1 A;  2G2Q A;  5J9B A;  3TOU A;  2H66 A;  3GYK A;  5AN1 A;  3FKF A;  2MYG A;  4PX1 A;  4XCS A;  2LRN A;  4CY8 A;  1PN0 A;  4ISD A;  2FCH A;  4K5R A;  1XOB A;  3TRX A;  1KBN A;  4IJI A;  2V6O A;  3TKR A;  2QA1 A;  2KOK A;  2KUC A;  3P2A A;  4HU9 A;  1GUM A;  5HR0 A;  3GKN A;  2YJ7 A;  4I2T A;  4POB A;  3FRC A;  6GST A;  1SL0 B;  5ABR A;  2D2Z A;  4WF5 A;  4XS1 A;  5IOW A;  1LBK A;  3TOT A;  4XIH A;  4XHM A;  5HFI A;  3IOS A;  4ILF A;  3L9V A;  1IYH A;  3DKS A;  4DVC A;  2LS5 A;  3UVT A;  2RII A;  2I4A A;  2R0P A;  4YQM A;  13GS A;  4BVY B;  4EIP A;  3GKK A;  4O7H A;  4L8E A;  3I69 A;  4ID0 A;  3UBK A;  2FA8 A;  1EZK A;  2H76 A;  3D4T A;  1QXH A;  5A4W A;  3HJP A;  1F37 A;  5JWQ B;  3L9U A;  1X5C A;  2VL2 C;  3ME8 A;  5H5R A;  5FHI A;  2G0F A;  1SJZ A;  2NVL A;  1T00 A;  4FQU A;  3QFB C;  3APO A;  1A0R P;  1HNA A;  4EE0 A;  2B5E A;  3ZVJ D;  1F3A A;  4JR4 A;  4V1A g;  1M3J A;  3LJR A;  3ZMK A;  1YQ1 A;  1DUG A;  2AAW A;  2GS3 A;  4EC0 A;  1PKW A;  4IQA A;  2H30 A;  2MMN A;  3LFL A;  2PWJ A;  1XZO A;  2NDO A;  2IMF A;  3GHA A;  2IN3 A;  5KN0 A;  3S9F A;  2DJK A;  3A3T A;  1OE8 A;  3M9K A;  2M80 A;  4O5R A;  1FOH A;  1A0F A;  4J57 E;  3A5W A;  3LXT A;  1XW5 A;  4RUV A;  3R3E A;  5ENU A;  4DSR A;  2OBI A;  5IMA A;  2DJJ A;  2FD3 A;  2YPM A;  4CDO A;  2P5R A;  2K9F A;  2VCX A;  1FG4 A;  3CSH A;  3F0I A;  3TRQ A;  3H93 A;  5ECM B;  1GNW A;  3NOF A;  4KDX A;  2DSA A;  3DML A;  4GSS A;  5ID2 A;  2VCW A;  2CZ3 A;  2PPT A;  1WWJ A;  1NW2 A;  4MNN A;  3ERW A;  5JWR B;  5JCU A;  1ZOF A;  2GSR A;  3A5I A;  3GTU A;  3HJO A;  3C7M A;  4XS4 A;  3GIX A;  1PGT A;  2LTK A;  3CSJ A;  4NV5 A;  2XBQ A;  4HDE A;  4BA7 A;  4PNF A;  2YP6 A;  3EIN A;  1TW9 A;  4DSS A;  4I8B A;  2HI7 A;  4WXT A;  1TI1 A;  4MPF A;  3UMA A;  3OR5 A;  1XG8 A;  5ECS A;  1U3A A;  1S3C A;  1ERU A;  1OC9 A;  2H73 A;  2PU9 C;  4QL7 A;  4MAB A;  5ECN B;  3GNJ A;  2DML A;  5IMV A;  3VI5 A;  2LEG A;  3I9V 2;  4K2D A;  2VL2 A;  2IJY A;  1NHO A;  1SJ6 A;  4POK A;  1O8W A;  1M9B A;  1OVN A;  1WOU A;  4KX4 A;  3QFA C;  1X9W B;  3TDG A;  1AAZ A;  3KD0 A;  2HZE A;  3HZ8 A;  2CAI A;  12GS A;  2YWN A;  3O76 A;  2CV4 A;  4PQH A;  4JU5 A;  1M2B A;  3F9U A;  4IN0 A;  2L5L A;  4AJ7 A;  3L4N A;  4XTS A;  3IDV A;  1V58 A;  1ABA A;  2H0I A;  4K0G A;  4XRD A;  2REM A;  2X64 A;  5AIS A;  3ZIV A;  3GFK A;  9GSS A;  3EMX A;  2R3X A;  3UOM A;  2MMO A;  2X4A A;  4WR4 A;  2GSS A;  3ERF A;  4WKW A;  1W4V A;  4MMM A;  2YJH A;  5G30 A;  4BL7 A;  1X5D A;  3RBT A;  2LJA A;  5A4U A;  1R26 A;  5A5K A;  1URM A;  3LOR A;  3IC8 A;  1GUK A;  3CRU A;  4LA1 A;  5J5N A;  1A8L A;  2P0G A;  5DCH A;  1UA5 A;  3UAP A;  2B7K A;  2MZC A;  3FR6 A;  4IGJ A;  1PSQ A;  1GLQ A;  1SD9 A;  4IS0 A;  2F9S A;  1J9B A;  1KNG A;  1XVW A;  2ES7 A;  4OWY A;  2GQM A;  3HVV A;  4HJM A;  2C4J A;  5A4V A;  1GTI A;  4HQZ A;  2FHE A;  2QSI A;  3KIJ A;  1J08 A;  4EVM A;  1CQH A;  2H01 A;  4HOJ A;  3HA9 A;  2HRF A;  2H72 A;  1DE2 A;  3ZIJ A;  1QMV A;  1ST9 A;  3VWV A;  4IHU A;  4V2M A;  3GH6 A;  4PXO A;  4BVY A;  2H8L A;  3GX0 A;  1HYU A;  3UEM A;  3ED3 A;  3TB2 A;  6GSV A;  3F3R A;  3ZZX A;  5DBQ A;  5ECR B;  4CHS A;  1R5P A;  5ECK B;  3VWU A;  5CP1 A;  3KH7 A;  2H6Z A;  4CY6 A;  2R37 A;  2HE3 A;  4KGI A;  1T1V A;  2FGX A;  3TUE A;  3F4T A;  1VF4 A;  1XBS A;  1A24 A;  3APS A;  3I43 A;  2K8S A;  3IHG A;  1GLP A;  1SL2 B;  1X9M B;  4FYC A;  4IJ3 A;  3LGC A;  3J7Y k;  5FT3 A;  2BTO T;  2ALB A;  3EE2 A;  4HSC X;  10GS A;  1OKT A;  4J2F A;  1SK1 A;  1BJX A;  5GSS A;  2B3S A;  4IVF A;  3GX8 A;  2E7P A;  4I6X A;  2JZR A;  4JBB A;  1FAA A;  4GF0 A;  1VF1 A;  3HVN A;  4FYB A;  2IMK A;  2VCQ A;  6GSU A;  5JWO B;  1YY7 A;  3E0U A;  5ID2 B;  5IOX A;  1SD8 A;  3M1G A;  2GTU A;  2B5Y A;  4LMW A;  3UIW A;  2H1G A;  1ERV A;  4V2N A;  3GTU B;  4MA9 A;  4XS4 B;  1GTU A;  1GSY A;  4G0I A;  4POL A;  2LV3 A;  2C8U A;  3PR8 A;  4G9H A;  2P31 A;  3D5J A;  3VPQ A;  2WB9 A;  3UJ1 A;  3QMX A;  2YV7 A;  3F3Q A;  4I5Q A;  5F07 A;  2X8C A;  2CX4 A;  19GS A;  4E8H A;  3VLN A;  1GUH A;  4KB3 A;  2WRT A;  2DLX A;  3EU4 A;  2HFD A;  5DDL A;  1OC9 B;  1RQM A;  2YAN A;  2A4V A;  2VOC A;  4IEL A;  4BWS A;  8GSS A;  2IMI A;  1WE0 A;  3N9J A;  4PTS A;  1GSE A;  4AF2 A;  2YV9 A;  1WPI A;  2C80 A;  2VUP A;  5KEJ A;  4V1A p;  1F2E A;  4ZL9 A;  4HZ4 A;  1XWA A;  2GZP A;  3LXZ A;  1XXU A;  2I3Y A;  3DEX A;  3GKM A;  1PD2 1;  3LW9 A;  2HRK A;  2QKE A;  4CW9 A;  2DMM A;  3O6T A;  4MZW A;  2R6K A;  1R4W A;  1EV4 A;  1XWG A;  4YQU A;  2H75 A;  5HQP A;  3ZRE A;  2E2G A;  2GDR A;  5F05 A;  3DRN A;  4MF7 A;  1Z7P A;  5ELG A;  5IMD A;  3IR4 A;  1G6Y A;  4TR1 A;  1BQ7 A;  2KP1 A;  3HZ4 A;  4IBP A;  4L5O A;  1GTB A;  2JAD A;  3UL3 A;  3PPU A;  3GN3 A;  1QK8 A;  4GTU A;  1OYJ A;  5AGY A;  3US3 A;  3KMO A;  2RM5 A;  4TVE A;  1Z5Y E;  1M3I A;  3H8Q A;  1NHY A;  5IPG A;  2O8V B;  2DIY A;  3F6F A;  1ZL9 A;  2V32 A;  1V40 A;  1UN2 A;  4YAV A;  1Z3E A;  1G7O A;  2VO4 A;  4OFN A;  3WD6 A;  5D8I A;  1KEB A;  5H5S A;  1MDJ A;  3MDK A;  4K7N A;  1GTA A;  3QAV A;  3HKR A;  5DCG A;  2YWO A;  3D4M A;  3BD2 A;  5F06 A;  3IK9 A;  5LD0 A;  2YNX A;  3Q6O A;  2LQQ A;  2VD1 A;  2DJ2 A;  2V41 A;  1M9A A;  3CTF A;  1EOG A;  2GZZ A;  5B6M A;  3IA1 A;  2IIY A;  2PVQ A;  1HNC A;  1O85 A;  4HJ2 A;  3I6A A;  1SK2 A;  3L0H A;  2VM2 A;  5DAK B;  17GS A;  4HQS A;  3IAM 2;  5CNW A;  4G0K A;  2OBK A;  4GSN A;  2AHE A;  4MJC A;  1TKD B;  2R4V A;  4JRR A;  4YH2 A;  2WS2 A;  5DAL B;  3LYP A;  4IKH A;  2H0G A;  5B7C A;  3BCI A;  3HCZ A;  5EL8 A;  3BJ5 A;  3G7I A;  3LEF A;  3CRT A;  3ZFB A;  5GAP D;  4Q5N A;  5KN2 A;  1FO5 A;  5IQY A;  1BAY A;  3WGE A;  5ECI B;  4ZL7 A;  2MMZ A;  4LLR A;  1JFU A;  3GV1 A;  3QR6 A;  2H1B A;  4MPG A;  1A2M A;  1EP7 A;  1B48 A;  1N2A A;  3MSZ A;  1EWX A;  2EIO A;  2B7J A;  1GSU A;  1K3O A;  5F0G A;  4LL4 B;  3TKS E;  1JZD A;  2VLU A;  1A23 A;  4DSQ A;  1PMT A;  2XPD A;  1EGR A;  1PN9 A;  2LUS A;  5IO0 A;  1XWK A;  5G31 A;  4FH8 A;  1GNE A;  2VM1 A;  3W8S A;  4KH7 A;  2AJQ B;  2F51 A;  2DJ0 A;  4YAP A;  1YEX A;  5GAN D;  1WRY A;  5IMF A;  1M99 A;  2CVD A;  4HEA 2;  4Q5F A;  2KP2 A;  4K7O A;  1AQX A;  1GH2 A;  3TKS C;  2C0G A;  2HRN A;  3EYT A;  4IQ1 A;  3WGD A;  3HXS A;  2MMA A;  3E9J B;  4KSM A;  3ZYW A;  3KP8 A;  3W6G A;  5ECO B;  4K8M A;  4NV2 A;  2VCT A;  1E2Y A;  2FUG 2;  5COH A;  1EV9 A;  5B8B A;  5BMU A;  4XS6 A;  5AIV A;  3L9S A;  3KMN A;  3RDW A;  3ZTL A;  4X1U A;  2BJX A;  2JZT A;  4TXO B;  2RUF A;  3ZRD A;  4V2L A;  1U87 A;  2J9H A;  2B5X A;  3DXB A;  3UAR A;  1YEP A;  1YKA A;  5IMZ A;  4EKZ A;  1OC3 A;  5F8B A;  2H74 A;  2WZ9 A;  3RAZ A;  4QL9 A;  1F3B A;  1TK0 B;  3F4R A;  3N5O A;  4D73 A;  2AUV A;  3LSZ A;  4LL1 B;  4EF0 A;  3LWA A;  5D9W A;  1AW9 A;  2I81 A;  2XHF A;  4FIW A;  5CRW A;  1B9X C;  2I1U A;  4TR1 B;  1TU7 A;  1M2D A;  4JR6 A;  3C1R A;  3V1W A;  2OE3 A;  2L6D A;  1XCC A;  2VD0 A;  1QQ2 A;  2TRC P;  4F03 A;  4H86 A;  4X4J A;  3ZFL A;  6GSS A;  3KH9 A;  3IBH A;  4TXV A;  1V98 A;  4NWY A;  4MLY A;  3TJG A;  2C0E A;  2V1M A;  1R5A A;  3GL3 A;  5EVO A;  3WT1 A;  4K7I A;  2FA4 A;  3SBC A;  3L78 A;  1DBY A;  1T4Z A;  2DJ3 A;  3VK9 A;  1FB0 A;  1NSW A;  4NHW A;  5DJM A;  1HD2 A;  4EDZ A;  2HYX A;  3PH9 A;  1K0C A;  3H79 A;  3QPM A;  4KW6 A;  1ZMA A;  1YJ6 A;  2B6M A;  2O85 A;  3QD9 A;  4ZIL A;  2K8V A;  1EGO A;  1SYX A;  4Q5Q A;  4O32 A;  1USB A;  4LMV A;  1GSS A;  2V6K A;  2C3T A;  1B8X A;  2LNS A;  4ZB8 A;  4N10 A;  3HHV A;  2YWI A;  3KTL A;  3TRP A;  3IXR A;  1SKS B;  3DD3 A;  1NM3 A;  3C73 A;  2IMD A;  5CO3 A;  2H70 A;  4YQV A;  4GQF A;  3PIN A;  2JSY A;  4OD7 A;  2VIM A;  2GGT A;  4MZB A;  1AUC A;  3ZL5 A;  3TKS A;  3LQ7 A;  1AXD A;  1IYI A;  2F3M A;  1XWB A;  3RHB A;  3NZN A;  2JAC A;  3KTB A;  5KN3 A;  3RHC A;  4EO3 A;  3DVX A;  1GWC A;  2DJ1 A;  4G10 A;  2HSM A;  1SKW B;  5G5F A;  1KTE A;  4TRX A;  4BVX A;  1J0F A;  1PFO A;  1A8Y A;  4GWR A;  5DAK A;  2AB6 A;  2LRC A;  2LST A;  1XW9 A;  1TP9 A;  1XFL A;  3GST A;  2VAF A;  4KDY A;  4P3Y B;  1K0N A;  5D73 A;  3VFI A;  1WP0 A;  3EC3 A;  3ZVJ A;  4J56 E;  5KOW A;  5DAL A;  5FWG A;  1JZR A;  2A4H A;  4OO4 A;  5JCW A;  2L4C A;  3W8J A;  4BIK A;  2JZS A;  4MZC A;  3C71 A;  1DSB A;  1PQN A;  3IAS 2;  2JU5 A;  1AQV A;  4BPY A;  4O92 A;  2YZH A;  1HNB A;  1TOF A;  2X8G A;  2JSZ A;  3IC4 A;  2ON5 A;  4PQ1 A;  2HT9 A;  3FY7 A;  3VUR A;  3D6I A;  4WET A;  4N30 A;  3P8W A;  3ISO A;  1FVJ A;  1I5G A;  4N0V A;  2GT6 A;  4MF5 A;  4JZQ A;  3KJY A;  5G2Z A;  2HSY A;  3WT2 A;  5D9V A;  2VLT A;  3F8U A;  1Z6M A;  2P5Q A;  1VGL A;  2QC7 A;  1S3D A;  3GUS A;  1FHE A;  5GZZ B;  3TJB A;  1ERW A;  3WYW A;  4RI7 A;  5CRH A;  1PKZ A;  1O8X A;  2KHP A;  2UZ8 A;  2B1K A;  3M8N A;  3KGK A;  1MD4 A;  1XVQ A;  2RUE A;  4NXI A;  3R2Q A;  1UC7 A;  1EEM A;  2R5G A;  3CXG A;  4PGT A;  3G7Y A;  4ULX A;  1OC8 A;  1HQO A;  2WGR A;  2OE1 A;  3FEU A;  4KND A;  4EDY A;  3ERG A;  2HNL A;  4RI6 A;  1FOV A;  4ECI A;  5HFK A;  2PMT A;  3K8N A;  5DQS A;  3RPP A;  3IV4 A;  2XPE A;  3P90 A;  2H71 A;  1Q4J A;  4D73 B;  4TR3 A;  2YZU A;  4L5L A;  4K6X A;  2J23 A;  4GQC A;  5IM9 A;  3CYN A;  4OO5 A;  2VCZ A;  5KOX A;  2EIQ A;  3CMI A;  1EEJ A;  4N0Z A;  1WJK A;  4TXO A;  2FWH A;  3GMF A;  4WBJ A;  1SK0 A;  1MDI A;  4IW9 A;  1F9M A;  3QOU A;  4WEY A;  3G7J A;  4K9Z A;  20GS A;  1WMJ A;  2OA7 A;  2PBJ A;  3EVI A;  1OAZ A;  4ACS A;  2VL9 A;  1M0U A;  3D0Z A;  2ON7 A;  2R0C A;  4MJE A;  2C0D A;  2BMX A;  1MTC A;  1N8J A;  2AV4 A;  3CBU A;  2DC5 A;  2VCV A;  3O3T A;  1AC1 A;  4ZIJ A;  1G6W A;  2OJL A;  6GSX A;  2LJK A;  2HXK A;  4ML1 A;  3FZ5 A;  1THO A;  3Q18 A;  2E0Q A;  3ZIT A;  2OAC A;  3PGT A;  4MDC A;  1G7E A;  4YKG A;  1OKD A;  4K5S A;  3FZA A;  1FVK A;  3KM6 A;  2FWF A;  2K18 A;  4KSO A;  3WGX A;  1V2A A;  4F9Z A;  1CQG A;  1ON4 A;  1GL8 A;  2CQ9 A;  4PUR A;  2DBC A;  2GT5 A;  3SWL A;  1GUL A;  4Z2R A;  5DVB A;  4GLT A;  5D9X A;  1TRW A;  2RLI A;  4JE1 A;  2ZCT A;  4Z2T A;  2NBS A;  5EY6 A;  1BED A;  4PUF C;  2C3Q A;  2C0F A;  1PA3 A;  5KN1 A;  3C8E A;  3UBL A;  1SL1 B;  3DWV A;  4KA0 A;  4Q5R A;  2ZNM A;  3EPT A;  3F4S A;  3U5R E;  1O6J A;  4ZBD A;  4ECB A;  3G9B A;  4N11 A;  5C00 A;  3HY2 A;  2V2G A;  4PQI A;  4NPB A;  2HLS A;  2IME A;  2AYT A;  3IRA A;  2PGT A;  4KDU A;  1ZYN A;  3J7Y b;  2VLV A;  1LJR A;  14GS A;  2LQO A;  1F6M C;  4BVX B;  2Z9S A;  3TJF A;  1K3Y A;  5HR3 A;  4MCU A;  2CAQ A;  3BOA A;  3BBY A;  2O7K A;  4L0U A;  1ERT A;  1JLV A;  4PUA A;  2A2P A;  2WJU A;  1Y6E A;  4NHZ A;  4ZL8 A;  5G5E A;  2IFQ A;  4OCF A;  2WDU A;  4AJ6 A;  1X0R A;  2L6C A;  1ZZY A;  4HUA A;  2WUL A;  1BX9 A;  4PNG A; 
#chains in the Genus database with same CATH homology
 1Z9H A;  4X0X A;  2GZY A;  1JZW A;  2PN8 A;  5B6N A;  3QDN A;  4L0W A;  1YKC A;  2N5B A;  2C1Y A;  3D21 A;  1GSF A;  1OE7 A;  4TR4 A;  2YOI A;  3KEB A;  5JCG A;  1TU8 A;  5J3R A;  3QCP A;  4MJB A;  1PX7 A;  1U6T A;  2M46 A;  5G1L A;  3QAG A;  2B1L A;  3DIE A;  3GL5 A;  4EL1 A;  1RW1 A;  2L4Q A;  2XC2 A;  5DJL A;  3MWH A;  1B9Y C;  5E59 A;  3DGQ A;  3TGZ A;  1ML6 A;  4KF9 A;  4A5P A;  1JZO A;  2FWE A;  3C1S A;  2R2J A;  1K0B A;  4MP4 A;  5G1K A;  3HVX A;  4KAE A;  4F82 A;  4OFT A;  3MIX A;  5HFG A;  1A2L A;  2MBS A;  2LKU A;  1H4O A;  1TXX A;  1O73 A;  1ZYE A;  5ECP B;  3P7X A;  4ZB9 A;  1T4Y A;  2YCD A;  3A2V A;  1B4Q A;  1RK4 A;  2FNO A;  5HR1 A;  5IO2 A;  4TN8 A;  2JL4 A;  5J41 A;  2CX3 A;  1GSD A;  1U88 A;  4POM A;  3M0F A;  1GSQ A;  1H75 A;  1U3I A;  1TDI A;  5LNK e;  3MAK A;  1EP8 A;  2KLX A;  4EUY A;  1E6B A;  2O89 A;  2HRA A;  5H5Q A;  1LU4 A;  4E8E A;  3HJM A;  3HD5 A;  3F6D A;  5ELA A;  4MJA A;  1TI3 A;  2H1D A;  3Q74 A;  2MBT A;  5J9C A;  5D9T A;  6GSW A;  1TRS A;  3EMP A;  2NPB A;  3IK7 A;  1K3L A;  5IMC A;  4WBR D;  1W89 A;  1TJD A;  2L5O A;  1EOH A;  1QUW A;  3IE3 A;  1VF3 A;  5IIZ A;  4OMV A;  1Q98 A;  3RPN A;  2QGV A;  4QQ7 A;  2OAD A;  1T8E B;  2IPA A;  1MD3 A;  2DKI A;  3U6V A;  3LG6 A;  1WIK A;  1QGV A;  1B4P A;  2H6Y A;  2GVP A;  2GQK A;  3EWL A;  3JCM L;  2TIR A;  5L71 A;  1TK8 B;  4GCI A;  3M3M A;  1PX6 A;  2HZF A;  2M72 A;  3KXO A;  1ILO A;  1FB6 A;  2C3N A;  1JLW A;  4ZBA A;  2GSQ A;  4FYU A;  4O5U A;  2E2M A;  2A2R A;  1I9D A;  5CRE A;  1T3B A;  1G0T A;  2FLS A;  1TTZ A;  4TR0 A;  1BYE A;  2IWT A;  1ZGN A;  3TKP A;  3FMW A;  1TRU A;  4HS1 A;  2FY6 A;  2F8A A;  2F8F A;  3NIV A;  4GRF A;  4RQX A;  4K1F A;  1QFN A;  1M2A A;  2RM6 A;  1T7P B;  1JHB A;  3A2W A;  2X8H A;  3GA4 A;  5ECH B;  2L59 A;  3IHQ A;  2H1A A;  4HZ2 A;  1R7H A;  2IFQ B;  4KCE A;  5B8A A;  4JED A;  1GRX A;  2I9H A;  3IPZ A;  1FW1 A;  3FZ9 A;  4AGS A;  3H1N A;  4WR5 A;  5INY A;  1YZX A;  1YDK A;  3BCK A;  1XIY A;  4OFM A;  5ECL B;  2XBI A;  5AIX A;  3ZML A;  3KCM A;  1ZCP A;  3HYP A;  5DQY A;  2OKA A;  4G2E A;  5LCZ A;  3CTG A;  2DIZ A;  5ECQ B;  2QA2 A;  4DEJ A;  3MYD A;  2EIR A;  3KZQ A;  3KP9 A;  4HI7 A;  1A2J A;  1V57 A;  4KUN A;  4MH2 A;  2OE0 A;  2CZ2 A;  2N5F A;  1DE1 A;  3EU3 A;  1VRS D;  22GS A;  1ZYP A;  2GST A;  3GRX A;  1XOA A;  5C04 A;  3VWW A;  3DYR A;  3FR9 A;  1K0M A;  4X43 A;  1ACV A;  4F0C A;  3TJK A;  1AQW A;  2PUK C;  1BG5 A;  2WCI A;  4Z7X A;  4ECJ A;  3Q19 A;  4I97 A;  1SU9 A;  3GH9 A;  1M7T A;  2CVB A;  2H0H A;  3FR3 A;  4G0L A;  1TK5 B;  4OCE A;  5IPH A;  1PL2 A;  2H6X A;  3HVS A;  2X99 A;  3HDC A;  4ZBB A;  4GST A;  3QAW A;  2WFC A;  3A2X A;  5GST A;  4O5Q A;  4G19 A;  5D93 A;  2YWM A;  3FK8 A;  3F63 A;  1YF0 A;  3EUR A;  3M9J A;  1V9W A;  5HR2 A;  4NAX A;  1SKR B;  3H4K A;  4WF4 A;  4HU7 A;  3APQ A;  2L57 A;  1AIU A;  2HSH A;  1K0O A;  2VL3 A;  1O81 A;  4F0B A;  5BRT A;  1SYR A;  4IP1 A;  3VWX A;  1THX A;  3FHK A;  1X9S B;  5J4U A;  5E4W A;  3TKQ A;  1VF2 A;  1GP1 A;  4FO5 A;  4ZXG A;  11GS A;  5CRG A;  3D22 A;  1SJI A;  2CVK A;  3ME7 A;  2K6V A;  3TCO A;  3CSI A;  4K0N A;  4F2I A;  4KE3 A;  4ML6 A;  4Z2U A;  1XPV A;  1SEN A;  3VPT A;  1K0D A;  2O87 A;  4DSS B;  2CA8 A;  4K2X A;  2GLR A;  1MEK A;  1Y25 A;  3UVH A;  1TRV A;  2ZUP A;  4ECC A;  1YF1 A;  3GKX A;  2CT6 A;  2H19 A;  2DKH A;  4I2U A;  2R0G A;  1K0A A;  18GS A;  2LRT A;  5CRD A;  4TKY A;  2X49 A;  5CAX A;  1O7U A;  2HZE B;  1C72 A;  3GUR A;  5CYY A;  4YKF A;  4MF6 A;  4AJ8 A;  5EPF A;  2A2S A;  1S3A A;  4ZB6 A;  2PER A;  1Z6N A;  3DVW A;  3LYK A;  4BWQ A;  1PRX A;  1XW6 A;  2FWG A;  4NMU A;  4XRA A;  5D96 A;  2EC4 A;  3AY8 A;  3ZLP A;  6GSY A;  2TRX A;  3E3E A;  3FW2 A;  4KCA A;  1MDK A;  4TOP A;  1UVZ A;  2N5A A;  3MNG A;  4ICY A;  4EXJ A;  3VI7 A;  3FYG A;  4IP6 A;  2IL3 A;  2LJR A;  4EIQ A;  2YN1 A;  4USS A;  1X5E A;  4BL7 B;  1ZYQ B;  16GS A;  2NTO A;  7GSS A;  4TW5 A;  1Z7R A;  3TJJ A;  2PVO C;  3GSS A;  4MH3 A;  2LNT A;  1XWC A;  3FZ4 A;  4MK3 A;  4RQR A;  4GXZ A;  2GQL A;  1PL1 A;  2G2Q A;  5J9B A;  3TOU A;  2H66 A;  3GYK A;  5AN1 A;  3FKF A;  2MYG A;  4PX1 A;  4XCS A;  2LRN A;  4CY8 A;  1PN0 A;  4ISD A;  2FCH A;  4K5R A;  1XOB A;  3TRX A;  1KBN A;  4IJI A;  2V6O A;  3TKR A;  2QA1 A;  2KOK A;  2KUC A;  3P2A A;  4HU9 A;  1GUM A;  5HR0 A;  3GKN A;  2YJ7 A;  4I2T A;  4POB A;  3FRC A;  6GST A;  1SL0 B;  5ABR A;  2D2Z A;  4WF5 A;  4XS1 A;  5IOW A;  1LBK A;  3TOT A;  4XIH A;  4XHM A;  5HFI A;  3IOS A;  4ILF A;  3L9V A;  1IYH A;  3DKS A;  4DVC A;  2LS5 A;  3UVT A;  2RII A;  2I4A A;  2R0P A;  4YQM A;  13GS A;  4BVY B;  4EIP A;  3GKK A;  4O7H A;  4L8E A;  3I69 A;  4ID0 A;  3UBK A;  2FA8 A;  1EZK A;  2H76 A;  3D4T A;  1QXH A;  5A4W A;  3HJP A;  1F37 A;  5JWQ B;  3L9U A;  1X5C A;  2VL2 C;  3ME8 A;  5H5R A;  5FHI A;  2G0F A;  1SJZ A;  2NVL A;  1T00 A;  4FQU A;  3QFB C;  3APO A;  1A0R P;  1HNA A;  4EE0 A;  2B5E A;  3ZVJ D;  1F3A A;  4JR4 A;  4V1A g;  3LJR A;  3ZMK A;  1YQ1 A;  1DUG A;  2AAW A;  2GS3 A;  4EC0 A;  1PKW A;  4IQA A;  2H30 A;  2MMN A;  3LFL A;  2PWJ A;  1XZO A;  2NDO A;  2IMF A;  3GHA A;  2IN3 A;  5KN0 A;  3S9F A;  2DJK A;  3A3T A;  1OE8 A;  3M9K A;  2M80 A;  4O5R A;  1FOH A;  1A0F A;  4J57 E;  3A5W A;  3LXT A;  1XW5 A;  4RUV A;  3R3E A;  5ENU A;  4DSR A;  2OBI A;  5IMA A;  2DJJ A;  2FD3 A;  2YPM A;  4CDO A;  2P5R A;  2K9F A;  2VCX A;  1FG4 A;  3CSH A;  3F0I A;  3TRQ A;  3H93 A;  5ECM B;  1GNW A;  3NOF A;  4KDX A;  2DSA A;  3DML A;  4GSS A;  5ID2 A;  2VCW A;  2CZ3 A;  2PPT A;  1WWJ A;  1NW2 A;  4MNN A;  3ERW A;  5JWR B;  5JCU A;  1ZOF A;  2GSR A;  3A5I A;  3GTU A;  3HJO A;  3C7M A;  4XS4 A;  3GIX A;  1PGT A;  2LTK A;  3CSJ A;  4NV5 A;  2XBQ A;  4HDE A;  4BA7 A;  4PNF A;  2YP6 A;  3EIN A;  1TW9 A;  4DSS A;  4I8B A;  2HI7 A;  4WXT A;  1TI1 A;  4MPF A;  3UMA A;  3OR5 A;  5ECS A;  1U3A A;  1S3C A;  1ERU A;  1OC9 A;  2H73 A;  2PU9 C;  4QL7 A;  4MAB A;  5ECN B;  3GNJ A;  2DML A;  5IMV A;  3VI5 A;  2LEG A;  3I9V 2;  4K2D A;  2VL2 A;  2IJY A;  1NHO A;  1SJ6 A;  4POK A;  1O8W A;  1M9B A;  1OVN A;  1WOU A;  4KX4 A;  3QFA C;  1X9W B;  3TDG A;  1AAZ A;  3KD0 A;  2HZE A;  3HZ8 A;  2CAI A;  12GS A;  2YWN A;  3O76 A;  2CV4 A;  4PQH A;  4JU5 A;  1M2B A;  3F9U A;  4IN0 A;  2L5L A;  4AJ7 A;  3L4N A;  4XTS A;  3IDV A;  1V58 A;  1ABA A;  2H0I A;  4K0G A;  4XRD A;  2REM A;  2X64 A;  5AIS A;  3ZIV A;  3GFK A;  9GSS A;  3EMX A;  2R3X A;  3UOM A;  2MMO A;  2X4A A;  4WR4 A;  2GSS A;  3ERF A;  4WKW A;  1W4V A;  4MMM A;  2YJH A;  5G30 A;  4BL7 A;  1X5D A;  3RBT A;  2LJA A;  5A4U A;  1R26 A;  5A5K A;  1URM A;  3LOR A;  3IC8 A;  1GUK A;  3CRU A;  4LA1 A;  5J5N A;  1A8L A;  2P0G A;  5DCH A;  1UA5 A;  3UAP A;  2B7K A;  2MZC A;  3FR6 A;  4IGJ A;  1PSQ A;  1GLQ A;  1SD9 A;  4IS0 A;  2F9S A;  1J9B A;  1KNG A;  1XVW A;  2ES7 A;  4OWY A;  2GQM A;  3HVV A;  4HJM A;  2C4J A;  5A4V A;  1GTI A;  4HQZ A;  2FHE A;  2QSI A;  3KIJ A;  1J08 A;  4EVM A;  1CQH A;  2H01 A;  4HOJ A;  3HA9 A;  2HRF A;  2H72 A;  1DE2 A;  3ZIJ A;  1QMV A;  1ST9 A;  3VWV A;  4IHU A;  4V2M A;  3GH6 A;  4PXO A;  4BVY A;  2H8L A;  3GX0 A;  1HYU A;  3UEM A;  3ED3 A;  3TB2 A;  6GSV A;  3F3R A;  3ZZX A;  5DBQ A;  5ECR B;  4CHS A;  1R5P A;  5ECK B;  3VWU A;  5CP1 A;  3KH7 A;  2H6Z A;  4CY6 A;  2R37 A;  2HE3 A;  4KGI A;  1T1V A;  2FGX A;  3TUE A;  3F4T A;  1VF4 A;  1XBS A;  1A24 A;  3APS A;  3I43 A;  2K8S A;  3IHG A;  1GLP A;  1SL2 B;  1X9M B;  4FYC A;  4IJ3 A;  3LGC A;  3J7Y k;  5FT3 A;  2BTO T;  2ALB A;  3EE2 A;  10GS A;  1OKT A;  4J2F A;  1SK1 A;  1BJX A;  5GSS A;  2B3S A;  4IVF A;  3GX8 A;  2E7P A;  4I6X A;  2JZR A;  4JBB A;  1FAA A;  4GF0 A;  1VF1 A;  4FYB A;  2IMK A;  2VCQ A;  6GSU A;  5JWO B;  1YY7 A;  3E0U A;  5ID2 B;  5IOX A;  1SD8 A;  3M1G A;  2GTU A;  2B5Y A;  4LMW A;  3UIW A;  2H1G A;  1ERV A;  4V2N A;  3GTU B;  4MA9 A;  4XS4 B;  1GTU A;  1GSY A;  4G0I A;  4POL A;  2LV3 A;  2C8U A;  3PR8 A;  4G9H A;  2P31 A;  3D5J A;  3VPQ A;  2WB9 A;  3UJ1 A;  3QMX A;  2YV7 A;  3F3Q A;  4I5Q A;  5F07 A;  2X8C A;  2CX4 A;  19GS A;  4E8H A;  3VLN A;  1GUH A;  4KB3 A;  2WRT A;  2DLX A;  3EU4 A;  2HFD A;  5DDL A;  1OC9 B;  1RQM A;  2YAN A;  2A4V A;  2VOC A;  4IEL A;  4BWS A;  8GSS A;  2IMI A;  1WE0 A;  3N9J A;  4PTS A;  1GSE A;  4AF2 A;  2YV9 A;  1WPI A;  2C80 A;  2VUP A;  5KEJ A;  4V1A p;  1F2E A;  4ZL9 A;  4HZ4 A;  1XWA A;  2GZP A;  3LXZ A;  1XXU A;  2I3Y A;  3DEX A;  3GKM A;  1PD2 1;  3LW9 A;  2HRK A;  2QKE A;  4CW9 A;  2DMM A;  3O6T A;  4MZW A;  2R6K A;  1R4W A;  1EV4 A;  1XWG A;  4YQU A;  2H75 A;  5HQP A;  3ZRE A;  2E2G A;  2GDR A;  5F05 A;  3DRN A;  4MF7 A;  1Z7P A;  5ELG A;  5IMD A;  3IR4 A;  1G6Y A;  4TR1 A;  1BQ7 A;  2KP1 A;  3HZ4 A;  4IBP A;  4L5O A;  1GTB A;  2JAD A;  3UL3 A;  3PPU A;  3GN3 A;  1QK8 A;  4GTU A;  1OYJ A;  5AGY A;  3US3 A;  3KMO A;  2RM5 A;  4TVE A;  1Z5Y E;  3H8Q A;  1NHY A;  5IPG A;  2O8V B;  2DIY A;  3F6F A;  1ZL9 A;  2V32 A;  1V40 A;  1UN2 A;  4YAV A;  1Z3E A;  1G7O A;  2VO4 A;  4OFN A;  3WD6 A;  5D8I A;  1KEB A;  5H5S A;  1MDJ A;  3MDK A;  4K7N A;  1GTA A;  3QAV A;  3HKR A;  5DCG A;  2YWO A;  3D4M A;  3BD2 A;  5F06 A;  3IK9 A;  5LD0 A;  2YNX A;  3Q6O A;  2LQQ A;  2VD1 A;  2DJ2 A;  2V41 A;  1M9A A;  3CTF A;  1EOG A;  2GZZ A;  5B6M A;  3IA1 A;  2IIY A;  2PVQ A;  1HNC A;  1O85 A;  4HJ2 A;  3I6A A;  1SK2 A;  3L0H A;  2VM2 A;  5DAK B;  17GS A;  4HQS A;  3IAM 2;  5CNW A;  4G0K A;  2OBK A;  4GSN A;  2AHE A;  4MJC A;  1TKD B;  2R4V A;  4JRR A;  4YH2 A;  2WS2 A;  5DAL B;  3LYP A;  4IKH A;  2H0G A;  5B7C A;  3BCI A;  3HCZ A;  5EL8 A;  3BJ5 A;  3G7I A;  3LEF A;  3CRT A;  3ZFB A;  5GAP D;  4Q5N A;  5KN2 A;  1FO5 A;  5IQY A;  1BAY A;  3WGE A;  5ECI B;  4ZL7 A;  2MMZ A;  4LLR A;  1JFU A;  3GV1 A;  3QR6 A;  2H1B A;  4MPG A;  1A2M A;  1EP7 A;  1B48 A;  1N2A A;  3MSZ A;  1EWX A;  2EIO A;  2B7J A;  1GSU A;  1K3O A;  5F0G A;  4LL4 B;  3TKS E;  1JZD A;  2VLU A;  1A23 A;  4DSQ A;  1PMT A;  2XPD A;  1EGR A;  1PN9 A;  2LUS A;  5IO0 A;  1XWK A;  5G31 A;  4FH8 A;  1GNE A;  2VM1 A;  3W8S A;  4KH7 A;  2AJQ B;  2F51 A;  2DJ0 A;  4YAP A;  1YEX A;  5GAN D;  1WRY A;  5IMF A;  1M99 A;  2CVD A;  4HEA 2;  4Q5F A;  2KP2 A;  4K7O A;  1AQX A;  1GH2 A;  3TKS C;  2C0G A;  2HRN A;  3EYT A;  4IQ1 A;  3WGD A;  3HXS A;  2MMA A;  3E9J B;  4KSM A;  3ZYW A;  3KP8 A;  3W6G A;  5ECO B;  4K8M A;  4NV2 A;  2VCT A;  1E2Y A;  2FUG 2;  5COH A;  1EV9 A;  5B8B A;  5BMU A;  4XS6 A;  5AIV A;  3L9S A;  3KMN A;  3RDW A;  3ZTL A;  4X1U A;  2BJX A;  2JZT A;  4TXO B;  2RUF A;  3ZRD A;  4V2L A;  1U87 A;  2J9H A;  2B5X A;  3DXB A;  3UAR A;  1YEP A;  1YKA A;  5IMZ A;  4EKZ A;  1OC3 A;  5F8B A;  2H74 A;  2WZ9 A;  3RAZ A;  4QL9 A;  1F3B A;  1TK0 B;  3F4R A;  3N5O A;  4D73 A;  2AUV A;  3LSZ A;  4LL1 B;  4EF0 A;  3LWA A;  5D9W A;  1AW9 A;  2I81 A;  2XHF A;  4FIW A;  5CRW A;  1B9X C;  2I1U A;  4TR1 B;  1TU7 A;  1M2D A;  4JR6 A;  3C1R A;  3V1W A;  2OE3 A;  2L6D A;  1XCC A;  2VD0 A;  1QQ2 A;  2TRC P;  4F03 A;  4H86 A;  4X4J A;  3ZFL A;  6GSS A;  3KH9 A;  3IBH A;  4TXV A;  1V98 A;  4NWY A;  4MLY A;  3TJG A;  2C0E A;  2V1M A;  1R5A A;  3GL3 A;  5EVO A;  3WT1 A;  4K7I A;  2FA4 A;  3SBC A;  3L78 A;  1DBY A;  1T4Z A;  2DJ3 A;  3VK9 A;  1FB0 A;  1NSW A;  4NHW A;  5DJM A;  1HD2 A;  4EDZ A;  2HYX A;  3PH9 A;  1K0C A;  3H79 A;  3QPM A;  4KW6 A;  1ZMA A;  1YJ6 A;  2B6M A;  2O85 A;  3QD9 A;  4ZIL A;  2K8V A;  1EGO A;  1SYX A;  4Q5Q A;  4O32 A;  1USB A;  4LMV A;  1GSS A;  2V6K A;  2C3T A;  1B8X A;  2LNS A;  4ZB8 A;  4N10 A;  3HHV A;  2YWI A;  3KTL A;  3TRP A;  3IXR A;  1SKS B;  3DD3 A;  1NM3 A;  3C73 A;  2IMD A;  5CO3 A;  2H70 A;  4YQV A;  4GQF A;  3PIN A;  2JSY A;  4OD7 A;  2VIM A;  2GGT A;  4MZB A;  1AUC A;  3ZL5 A;  3TKS A;  3LQ7 A;  1AXD A;  1IYI A;  2F3M A;  1XWB A;  3RHB A;  3NZN A;  2JAC A;  3KTB A;  5KN3 A;  3RHC A;  4EO3 A;  3DVX A;  1GWC A;  2DJ1 A;  4G10 A;  2HSM A;  1SKW B;  5G5F A;  1KTE A;  4TRX A;  4BVX A;  1J0F A;  1A8Y A;  4GWR A;  5DAK A;  2AB6 A;  2LRC A;  2LST A;  1XW9 A;  1TP9 A;  1XFL A;  3GST A;  2VAF A;  4KDY A;  4P3Y B;  1K0N A;  5D73 A;  3VFI A;  1WP0 A;  3EC3 A;  3ZVJ A;  4J56 E;  5KOW A;  5DAL A;  5FWG A;  1JZR A;  2A4H A;  4OO4 A;  5JCW A;  2L4C A;  3W8J A;  2JZS A;  4MZC A;  3C71 A;  1DSB A;  1PQN A;  3IAS 2;  2JU5 A;  1AQV A;  4BPY A;  4O92 A;  2YZH A;  1HNB A;  1TOF A;  2X8G A;  2JSZ A;  3IC4 A;  2ON5 A;  4PQ1 A;  2HT9 A;  3FY7 A;  3VUR A;  3D6I A;  4WET A;  4N30 A;  3P8W A;  3ISO A;  1FVJ A;  1I5G A;  4N0V A;  2GT6 A;  4MF5 A;  4JZQ A;  3KJY A;  5G2Z A;  2HSY A;  3WT2 A;  5D9V A;  2VLT A;  3F8U A;  1Z6M A;  2P5Q A;  1VGL A;  2QC7 A;  1S3D A;  3GUS A;  1FHE A;  5GZZ B;  3TJB A;  1ERW A;  3WYW A;  4RI7 A;  5CRH A;  1PKZ A;  1O8X A;  2KHP A;  2UZ8 A;  2B1K A;  3M8N A;  3KGK A;  1MD4 A;  1XVQ A;  2RUE A;  4NXI A;  3R2Q A;  1UC7 A;  1EEM A;  2R5G A;  3CXG A;  4PGT A;  3G7Y A;  4ULX A;  1OC8 A;  1HQO A;  2WGR A;  2OE1 A;  3FEU A;  4KND A;  4EDY A;  3ERG A;  2HNL A;  4RI6 A;  1FOV A;  4ECI A;  5HFK A;  2PMT A;  3K8N A;  5DQS A;  3RPP A;  3IV4 A;  2XPE A;  3P90 A;  2H71 A;  1Q4J A;  4D73 B;  4TR3 A;  2YZU A;  4L5L A;  4K6X A;  2J23 A;  4GQC A;  5IM9 A;  3CYN A;  4OO5 A;  2VCZ A;  5KOX A;  2EIQ A;  3CMI A;  1EEJ A;  4N0Z A;  1WJK A;  4TXO A;  2FWH A;  3GMF A;  4WBJ A;  1SK0 A;  1MDI A;  4IW9 A;  1F9M A;  3QOU A;  4WEY A;  3G7J A;  4K9Z A;  20GS A;  1WMJ A;  2OA7 A;  2PBJ A;  3EVI A;  1OAZ A;  4ACS A;  2VL9 A;  1M0U A;  3D0Z A;  2ON7 A;  2R0C A;  4MJE A;  2C0D A;  2BMX A;  1MTC A;  1N8J A;  2AV4 A;  3CBU A;  2DC5 A;  2VCV A;  3O3T A;  1AC1 A;  4ZIJ A;  1G6W A;  2OJL A;  6GSX A;  2LJK A;  2HXK A;  4ML1 A;  3FZ5 A;  1THO A;  3Q18 A;  2E0Q A;  3ZIT A;  2OAC A;  3PGT A;  4MDC A;  1G7E A;  4YKG A;  1OKD A;  4K5S A;  3FZA A;  1FVK A;  3KM6 A;  2FWF A;  2K18 A;  4KSO A;  3WGX A;  1V2A A;  4F9Z A;  1CQG A;  1ON4 A;  1GL8 A;  2CQ9 A;  4PUR A;  2DBC A;  2GT5 A;  3SWL A;  1GUL A;  4Z2R A;  5DVB A;  4GLT A;  5D9X A;  1TRW A;  2RLI A;  4JE1 A;  2ZCT A;  4Z2T A;  2NBS A;  5EY6 A;  1BED A;  4PUF C;  2C3Q A;  2C0F A;  1PA3 A;  5KN1 A;  3C8E A;  3UBL A;  1SL1 B;  3DWV A;  4KA0 A;  4Q5R A;  2ZNM A;  3EPT A;  3F4S A;  3U5R E;  1O6J A;  4ZBD A;  4ECB A;  3G9B A;  4N11 A;  5C00 A;  3HY2 A;  2V2G A;  4PQI A;  4NPB A;  2HLS A;  2IME A;  2AYT A;  3IRA A;  2PGT A;  4KDU A;  1ZYN A;  3J7Y b;  2VLV A;  1LJR A;  14GS A;  2LQO A;  1F6M C;  4BVX B;  2Z9S A;  3TJF A;  1K3Y A;  5HR3 A;  4MCU A;  2CAQ A;  3BOA A;  3BBY A;  2O7K A;  4L0U A;  1ERT A;  1JLV A;  4PUA A;  2A2P A;  2WJU A;  1Y6E A;  4NHZ A;  4ZL8 A;  5G5E A;  2IFQ A;  4OCF A;  2WDU A;  4AJ6 A;  1X0R A;  2L6C A;  1ZZY A;  4HUA A;  2WUL A;  1BX9 A;  4PNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...