4V2MA

Crystallographic structure of thioredoxin from litopenaeus vannamei: radiation damage effect at 34 mgy, focused in disulfide bonds.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystallographic Studies Evidencing the High Energy Tolerance to Disrupting the Interface Disulfide Bond of Thioredoxin 1 from White Leg Shrimp Litopenaeus Vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Oxidoreductase
total genus 36
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4v2mA00
3TUEA 3RPNA 1PSQA 2LNTA 3H8QA 4EUYA 4BPYA 2LS5A 1V9WA 4DSSA 4MLYA 4TXOB 3M9KA 1Z6NA 5KN1A 3APQA 4PQHA 4GXZA 2YCDA 1NHOA 3L4NA 3U5RE 1ST9A 4BVYA 1EGOA 2OACA 1OC9A 1S3CA 5CRGA 1TJDA 1Y6EA 2WRTA 1XXUA 1SJZA 2JSYA 1GUHA 2HRFA 4F82A 3ZL5A 1JLWA 4MZBA 3HKRA 1ZL9A 3A2VA 3F9UA 5ECNB 2WULA 1X9SB 2KP1A 3O3TA 4X43A 4ZB6A 1JZRA 3OR5A 2YWMA 5KN2A 1GULA 2GT6A 1XW9A 2O85A 1YKAA 3UAPA 2YWIA 2AB6A 1O7UA 3BJ5A 5DDLA 2IIYA 4KCEA 2FA4A 1A8LA 3ZMKA 5HFIA 1WPIA 3HHVA 1SYXA 3SWLA 2C4JA 3F8UA 4Q5RA 2I3YA 3QD9A 1YEPA 3IAM2 4ZL7A 2Z9SA 4H86A 1F9MA 3IHQA 3VI7A 5LNKe 2CX4A 4XRAA 3PINA 5F0GA 5JCUA 1G7EA 1OAZA 2H76A 3D6IA 2GQLA 1V40A 3KH7A 3J7Yb 4K1FA 4WF5A 2DBCA 3HVSA 1ERWA 5H5SA 3GUSA 2KHPA 3TOUA 2CZ2A 1CQGA 2HZFA 3KZQA 2K6VA 3C73A 2F51A 2VLTA 2XPEA 1ZCPA 5HR3A 4TVEA 1YQ1A 4LL4B 3O76A 1TRUA 1XWGA 4ECCA 1TRWA 2YP6A 2EIOA 1GTAA 5IMZA 3TGZA 5ID2B 2XBQA 2O87A 1PKWA 1OC3A 1SENA 4RI6A 3MDKA 2GDRA 2ES7A 3CXGA 1JFUA 1FG4A 3R2QA 2IN3A 6GSSA 1XWCA 4GSNA 2A2RA 3LEFA 1SJ6A 3KH9A 1F3BA 3IV4A 4KDXA 4BWQA 4POLA 1G7OA 2B6MA 3EC3A 2GLRA 3VI5A 5J41A 1IYHA 1M99A 2HE3A 2X8CA 6GSYA 1Q98A 2HNLA 16GSA 1GLPA 1VRSD 3KM6A 4ML1A 4HJ2A 1TK5B 4TR1A 4ISDA 3LG6A 1TOFA 3FKFA 2M80A 1BAYA 4HI7A 4NV2A 4IHUA 1NM3A 5IMDA 1GNEA 4TXVA 1VF2A 5HFKA 5AGYA 1R7HA 1O6JA 2C80A 2RUEA 1QFNA 2BTOT 1K3LA 2B1LA 1TI1A 1B48A 5F06A 4TRXA 4IN0A 3GTUA 2XHFA 4F0CA 5AN1A 3VK9A 4F2IA 9GSSA 5HR0A 3G7JA 1GSYA 1SKWB 3MNGA 5B7CA 4KCAA 3C1SA 2L5OA 3VLNA 4FO5A 1AQVA 3E0UA 3GHAA 5DALA 5EY6A 3KTLA 4IKHA 1A23A 2N5AA 1B9XC 4LMVA 2F3MA 2WDUA 1OE8A 2H74A 4IBPA 1I9DA 2L4QA 2F8AA 1T7PB 1J08A 1PMTA 2GSTA 2H73A 4POKA 2VCZA 3ZTLA 5DQYA 2TIRA 2VLVA 3N5OA 2JZSA 1SYRA 5B8AA 5ECSA 2O7KA 1KEBA 1GTBA 3UBKA 3UEMA 4IW9A 2PUKC 4ID0A 5DCHA 1MTCA 2K18A 2FWHA 4L0UA 4LL1B 3GNJA 5FHIA 3VPQA 2K8VA 2E0QA 2FA8A 4HJMA 1U6TA 2CQ9A 3VWVA 4TXOA 1B8XA 2VIMA 5DAKB 1QMVA 3RHCA 2YWNA 2P5QA 1XCCA 2OBIA 2F8FA 5AISA 1OE7A 3BCKA 2H0GA 3BOAA 2TRCP 1YKCA 2PERA 3DMLA 2H0HA 3NOFA 4AJ8A 1DUGA 3G7YA 3KMNA 1GNWA 4TR3A 3GL5A 1TRVA 5CP1A 3H93A 1U87A 2I9HA 1EWXA 1Z6MA 3CRTA 3S9FA 3ZITA 4ZILA 2IMDA 5JWRB 4TW5A 3E3EA 2X8GA 3WT1A 3DGQA 3P7XA 3ZLPA 4OMVA 5ECIB 3L9UA 4ECIA 4L5OA 3VPTA 1R5PA 3UVHA 2HI7A 2IFQB 2BMXA 2LRCA 3IA1A 3NZNA 2HYXA 2LRNA 4F0BA 1BJXA 2C0FA 1IYIA 5KN0A 1ZMAA 5DBQA 1G0TA 3DKSA 1V57A 14GSA 3MAKA 2FWEA 2HZEA 4K7IA 4L8EA 2VUPA 2VCWA 1DE2A 5GZZB 2KP2A 5IOWA 20GSA 5B8BA 4DVCA 4XTSA 2VL3A 3F4SA 1ERVA 1RW1A 3GH9A 4I2UA 4OD7A 1QGVA 4IQAA 2VAFA 4EE0A 1FVJA 1Z9HA 4G10A 2MMZA 4KB3A 1SKSB 2DMLA 1E6BA 3H4KA 5H5QA 1HNBA 2OADA 3KMOA 4QL9A 1YF0A 2DJ1A 5INYA 5IO0A 4MPGA 1OKTA 2CV4A 2FHEA 2WS2A 2H1BA 1T4ZA 5ECPB 3GKKA 2VCVA 1KTEA 4KGIA 2E2MA 4PX1A 1EV4A 3IDVA 3DXBA 4YH2A 2DMMA 3LXTA 5ABRA 2QC7A 4WF4A 4EC0A 1VF3A 3RBTA 5ID2A 3HVXA 1A2JA 2NVLA 4WXTA 2MBSA 1R5AA 4AJ6A 4MJBA 3HZ8A 3FHKA 4KAEA 4MF7A 1S3AA 4G9HA 1OC8A 1V58A 2NBSA 4ZBAA 6GSUA 2CX3A 1SD8A 3A2XA 2K8SA 1K0BA 4ML6A 2C3TA 3U6VA 1BYEA 1LBKA 1GRXA 1PL2A 4ILFA 1B4QA 5KEJA 5A4WA 1XW5A 3QDNA 1HD2A 1Z7PA 4IP6A 3LYPA 1V2AA 3L9SA 4EDYA 3DIEA 5JWQB 3DVWA 5A4VA 3ZVJA 1M2DA 2M46A 5ECQB 2I81A 5G31A 3Q18A 2GQMA 4OCEA 4EO3A 4K0NA 3CBUA 1JZDA 3H1NA 1N2AA 4YQUA 2HRNA 4ECBA 5ECLB 6GSTA 1F6MC 3F3RA 4GCIA 2R3XA 2V2GA 2GS3A 2X99A 3D4MA 2YWOA 4HQZA 4HU9A 1HNCA 2MMAA 3BBYA 3C1RA 1QK8A 2JACA 4RI7A 1VF1A 4JEDA 3GSSA 4KDYA 2LQOA 2GZZA 2C0GA 1ACVA 1H4OA 4HU7A 1TTZA 4K9ZA 4GLTA 2L6CA 3LYKA 2PN8A 4KNDA 1YZXA 3F6FA 6GSVA 4PQIA 1MDJA 1ZZYA 5ELGA 4MH2A 1E2YA 1K3OA 4NWYA 1TXXA 3WGXA 1BQ7A 3HZ4A 3KEBA 1GWCA 2A2SA 3G7IA 1SK2A 1B4PA 5CRWA 2YOIA 4K0GA 1QXHA 3QFBC 1J0FA 1QQ2A 4EXJA 2VCXA 2WJUA 5EVOA 2L6DA 2H19A 5IOXA 3LORA 4ZBBA 4O7HA 3APSA 1WJKA 5H5RA 2LJAA 3CYNA 3GURA 3C8EA 1NHYA 4KA0A 3N9JA 3CRUA 5IQYA 4Q5FA 1YF1A 4MF5A 3LXZA 3IR4A 3KP9A 5ENUA 2OE0A 2L59A 4JR4A 1RK4A 1RQMA 2LJRA 1ABAA 4AF2A 3HJMA 2H30A 2YJ7A 2CA8A 1M2BA 5E59A 1GSFA 2J9HA 5KN3A 1JZOA 2P31A 2H75A 4MP4A 3ZRDA 3RAZA 2IMKA 3DYRA 2B7KA 8GSSA 3WYWA 2FCHA 3EU3A 2GSSA 2DIZA 2V32A 4BA7A 3FY7A 5IIZA 5A5KA 2WCIA 3IBHA 1K0DA 2G2QA 2VCTA 4FYUA 3EURA 3RHBA 4LMWA 3O6TA 1XVQA 5IO2A 2MMNA 3VWUA 2QSIA 2YJHA 2JL4A 4RQXA 1WRYA 5D73A 4KX4A 1ERTA 2QKEA 2OE1A 4Q5QA 5E4WA 3TKQA 2PMTA 3IXRA 1TDIA 1XFLA 5C04A 2DSAA 3DRNA 3MWHA 4WBRD 3QFAC 3H79A 2RLIA 2GSRA 4I6XA 3EVIA 4PUFC 4EKZA 2VCQA 3TKSC 1ML6A 2XPDA 4L5LA 2FNOA 2YZHA 5EL8A 2REMA 4JZQA 1FHEA 4HUAA 1DE1A 3HJOA 2V6OA 1PD21 3ZVJD 10GSA 3GFKA 2O8VB 1AC1A 5B6MA 4N0VA 2C0DA 1X9WB 5COHA 1DBYA 3KGKA 4PGTA 3VFIA 3LSZA 4DSSB 1GUKA 2VL9A 4KSOA 5CRHA 2L5LA 3VWXA 1AQWA 3C71A 4EVMA 5CREA 3GRXA 1TU8A 1CQHA 1WIKA 4X1UA 4XS6A 2WFCA 1A2MA 4MCUA 3SBCA 3KD0A 3LJRA 3ZIVA 2WGRA 1S3DA 1OC9B 11GSA 4GSTA 4YAVA 2R2JA 4MZCA 3WD6A 4MF6A 3GKNA 4KSMA 4DSQA 4IS0A 2OE3A 2AUVA 1I5GA 3TJGA 1UVZA 2DJ2A 1W4VA 3VURA 4MPFA 5ECRB 1F2EA 2VL2C 4D73A 3D0ZA 1M7TA 4OCFA 2VOCA 4CHSA 5F8BA 2GGTA 2IWTA 2AJQB 3W8SA 2FGXA 3ED3A 1GTIA 3ZREA 1SL1B 1ZYQB 2GZPA 2LSTA 3ERGA 1XWBA 2G0FA 4XS4A 4EF0A 4NHWA 4AGSA 5GSSA 3I43A 2C1YA 2CT6A 3IK7A 4WKWA 2ON7A 4TN8A 5JCWA 1GSUA 1OYJA 2DC5A 3L9VA 3LQ7A 4HQSA 1K0OA 4K2DA 3TRQA 1YY7A 2IJYA 5J3RA 1GL8A 4V2NA 2GT5A 3HDCA 5DCGA 3TKSE 3D22A 3QR6A 4HZ2A 5IPHA 1PRXA 2DLXA 1HYUA 2NTOA 3FEUA 2AAWA 4X0XA 4PNGA 3CSHA 4RUVA 3EWLA 2VLUA 3HY2A 1R4WA 4F03A 1VGLA 3F4TA 2B7JA 2A4VA 2HFDA 3GH6A 4IVFA 2FY6A 1SL0B 1J9BA 1EOHA 1T8EB 5ECMB 4NAXA 3P2AA 4ZL8A 3ME8A 4ZB8A 2R37A 1USBA 1TK8B 1MEKA 4V1Ag 3W8JA 1TU7A 2GZYA 4JBBA 2FWGA 3FW2A 2H0IA 2LNSA 4MABA 2H72A 2P0GA 3UIWA 2LKUA 3V1WA 2PVOC 4MJCA 4IJ3A 1MDKA 2H01A 4HDEA 3QAGA 5ECHB 2H70A 4E8HA 4V2MA 4BWSA 2AHEA 3RPPA 1TK0B 3GA4A 4ZBDA 2DJKA 2VM1A 5J9CA 2C0EA 4QL7A 1ON4A 3QAVA 5G1LA 3UJ1A 4MJEA 3GKXA 1EV9A 3FRCA 4NPBA 2V1MA 4AJ7A 1F37A 1Z7RA 4TR1B 1UA5A 1A8YA 4FH8A 6GSXA 1LJRA 1PA3A 3D4TA 3FZ9A 1N8JA 2H6YA 5D9TA 2H6ZA 4FYBA 4PNFA 4OFTA 1B9YC 3IPZA 1PX7A 2MBTA 3IC4A 4ZL9A 2O89A 5J5NA 1XWKA 2J23A 5L71A 3TRXA 2HXKA 1X9MB 1K0NA 3F3QA 1JLVA 4MH3A 3GTUB 2M72A 2H1AA 5G1KA 5HR1A 5AIXA 3EE2A 1TI3A 5GSTA 3EYTA 2CAQA 5DQSA 1OVNA 1EEMA 2C3QA 2P5RA 5DALB 3ZIJA 3D5JA 4GF0A 3ERWA 3GL3A 4LA1A 1XBSA 4E8EA 2GSQA 2HSYA 2H8LA 4OO4A 3HVVA 1SD9A 4G2EA 1XW6A 1YDKA 4NXIA 1EP7A 2CAIA 4O92A 5HQPA 3W6GA 1GSQA 1T4YA 4WETA 2E2GA 2AYTA 2ZNMA 3F63A 2K9FA 5EPFA 4I2TA 5J9BA 2VL2A 2IMFA 1O85A 3EMPA 2DJJA 3IAS2 4LLRA 3M8NA 5D8IA 2LTKA 2OA7A 3DD3A 3C7MA 4WR4A 2R4VA 7GSSA 2I1UA 4JR6A 2C8UA 4XHMA 19GSA 2LJKA 1A0RP 3ME7A 1BEDA 4NMUA 4JU5A 3IK9A 4N10A 2JU5A 3KP8A 3NIVA 3FZAA 2ALBA 2PGTA 5AIVA 4J2FA 1PL1A 3DWVA 2RM6A 2HT9A 2B5EA 5G30A 4K8MA 1GTUA 3E9JB 5B6NA 4WEYA 5ECKB 3J7Yk 4NHZA 1U3IA 4XCSA 2V41A 1FOVA 4RQRA 1XOAA 2X8HA 4XIHA 1MD4A 1XIYA 3F6DA 4J57E 4XS1A 3EU4A 1YJ6A 4IJIA 3TJFA 1GUMA 3LFLA 1G6WA 5ECOB 4TKYA 3I6AA 4KE3A 3P90A 4FIWA 1SK0A 1HNAA 1Q4JA 5DJMA 3KJYA 2CVBA 1WP0A 1WMJA 3LGCA 5D9WA 4V2LA 4ACSA 12GSA 5D9XA 1K0MA 5DJLA 1YEXA 4IELA 3A2WA 2NPBA 1VF4A 2HZEB 1AXDA 1R26A 4HOJA 5DAKA 3FR6A 1XPVA 3CMIA 3F0IA 1KNGA 2N5BA 4KDUA 2ZUPA 1EP8A 1A2LA 4FYCA 1X5DA 2GTUA 1AW9A 4J56E 1Z3EA 4WBJA 3GKMA 3L0HA 1ZOFA 4MMMA 4XRDA 2C3NA 1X0RA 4YAPA 3UVTA 5G5EA 1Y25A 3A5WA 1AAZA 1PQNA 1ZYEA 3APOA 3KTBA 2LV3A 1GP1A 3I9V2 5CO3A 1TKDB 5IM9A 3IOSA 3GIXA 3KCMA 4GTUA 2IFQA 2R6KA 3EINA 4JE1A 4P3YB 5LCZA 4NV5A 2BJXA 3HYPA 1M9BA 2FUG2 2LEGA 4OO5A 5G5FA 1XOBA 3TRPA 1GSDA 2KLXA 2E7PA 4L0WA 2EIRA 1UC7A 5ELAA 2IL3A 4OFMA 4I97A 3CTFA 3FK8A 2H1DA 3M1GA 1M0UA 1PGTA 4JRRA 2B3SA 3IRAA 1O73A 4IGJA 2RM5A 3UARA 3KIJA 2V6KA 3TKPA 2JSZA 4GSSA 3MSZA 2KOKA 4CDOA 4N11A 1SK1A 3FZ4A 4F9ZA 3LWAA 3QAWA 4GRFA 3G9BA 2IMIA 3QCPA 2I4AA 5G2ZA 4V1Ap 2H66A 2EC4A 1SU9A 2RIIA 5C00A 4Z7XA 2VD1A 1EEJA 4IP1A 4YQVA 2QGVA 2YNXA 2FLSA 3GX8A 4PXOA 2LUSA 4ULXA 3VWWA 1NW2A 4EL1A 1MDIA 4GWRA 3EMXA 2L4CA 1UN2A 1ZGNA 4MK3A 1AIUA 3RDWA 4O32A 1M2AA 4ZIJA 4MZWA 2HSHA 3GMFA 1KBNA 3Q19A 3M3MA 2MYGA 1NSWA 4EDZA 1XVWA 1FB0A 3UL3A 2MMOA 2RUFA 2OBKA 2LQQA 3PGTA 3QOUA 5D9VA 3TKRA 2H71A 2EIQA 1BX9A 3M9JA 3GYKA 3DEXA 1FAAA 1H75A 2GVPA 4OWYA 1XWAA 5IMCA 1GSEA 3M0FA 4TR4A 5F05A 3FR9A 1ILOA 1A24A 2YPMA 1GSSA 1LU4A 2OJLA 3TOTA 3DVXA 3HD5A 4K6XA 5CYYA 4HS1A 5FT3A 4KUNA 5IMVA 3A3TA 4ZXGA 1U88A 5JCGA 1W89A 3US3A 5IPGA 1G6YA 3FYGA 2HLSA 4MDCA 1T1VA 4PUAA 4KH7A 3KXOA 1WOUA 1K0CA 1EGRA 4GQCA 2F9SA 3P8WA 4MJAA 1V98A 2CVKA 3TJBA 2NDOA 1PX6A 4Q5NA 2YV7A 3WGDA 4DSRA 1A0FA 1T3BA 2FD3A 3ZFBA 2H1GA 3BCIA 1M9AA 2JADA 2YN1A 1F3AA 2VD0A 3WT2A 3ZZXA 4TOPA 3UBLA 1K3YA 2YZUA 2L57A 5HFGA 3ZMLA 1BG5A 1HQOA 18GSA 2GQKA 4DEJA 2PWJA 3FZ5A 5CNWA 5LD0A 4I5QA 1K0AA 3FR3A 2WZ9A 1AQXA 4N0ZA 3GX0A 4HEA2 4PQ1A 4N30A 3UMAA 5D93A 2B1KA 5D96A 3CSJA 4OFNA 2PU9C 1AUCA 5HR2A 4CW9A 2VM2A 2PVQA 4WR5A 5IMAA 5GAPD 17GSA 3TDGA 3WGEA 4ECJA 5J4UA 4K7NA 2MZCA 2CVDA 2XBIA 2AV4A 4KW6A 2YV9A 3CTGA 3TJKA 1O8XA 2YANA 5FWGA 2B5YA 3GSTA 3ZYWA 1TW9A 3HJPA 1OKDA 3PR8A 1O81A 2JZTA 2KUCA 1FW1A 3HXSA 2ON5A 1U3AA 3GN3A 3GV1A 1X5EA 4TR0A 1SKRB 2JZRA 4YQMA 4MA9A 3ISOA 1FVKA 2XC2A 1SJIA 3QMXA 4HZ4A 2PBJA 5DVBA 1EOGA 3TCOA 3ZFLA 1MD3A 2H6XA 3JCML 1FB6A 2X64A 1TP9A 1O8WA 3TJJA 22GSA 3TKSA 3PH9A 1URMA 1JZWA 4POMA 1DSBA 5GAND 3HA9A 4PURA 1XZOA 2D2ZA 1PKZA 5JWOB 2OKAA 2IMEA 1QUWA 2ZCTA 4IQ1A 2TRXA 1PN9A 5CRDA 1X5CA 3K8NA 5F07A 2FWFA 3TB2A 3F4RA 2R5GA 4POBA 3UOMA 2CZ3A 13GSA 4K7OA 1C72A 4QQ7A 3L78A 4ZB9A 1WWJA 3QPMA 4GQFA 3I69A 2DJ0A 3ERFA 1THOA 3CSIA 2PPTA 1FO5A 2N5FA 2WB9A 1Z5YE 3Q74A 2LRTA 4O5RA 1TRSA 5IMFA 1THXA 6GSWA 4D73B 1GH2A 2B5XA 5A4UA 3AY8A 4BL7A 1EZKA 1SL2B 2DJ3A 1T00A 1GLQA 2IPAA 5CAXA 1JHBA 4BVXA 2DIYA 3D21A 2VO4A 3BD2A 1ERUA 4I8BA 1WE0A 3Q6OA 3HCZA 4G19A 3IE3A 4XS4B
chains in the Genus database with same CATH superfamily
3TUEA 3RPNA 1PSQA 2LNTA 3H8QA 4EUYA 4BPYA 2LS5A 1V9WA 4DSSA 4MLYA 4TXOB 3M9KA 1Z6NA 5KN1A 3APQA 4PQHA 4GXZA 2YCDA 1NHOA 3EPTA 3L4NA 3U5RE 1ST9A 4BVYA 1EGOA 2OACA 1OC9A 1S3CA 5CRGA 1TJDA 1Y6EA 2R0GA 2WRTA 1XXUA 1SJZA 2JSYA 1GUHA 2HRFA 4F82A 3ZL5A 1JLWA 4MZBA 3HKRA 4O5QA 1ZL9A 3A2VA 3F9UA 5ECNB 2WULA 1X9SB 2KP1A 3O3TA 4X43A 4ZB6A 1JZRA 3OR5A 2YWMA 5KN2A 5KOXA 1GULA 2GT6A 1XW9A 2O85A 1YKAA 3UAPA 2YWIA 2AB6A 1O7UA 3BJ5A 5DDLA 2IIYA 4KCEA 2FA4A 1A8LA 3ZMKA 5HFIA 2HSMA 4K5SA 1WPIA 3HHVA 1SYXA 3SWLA 2C4JA 3F8UA 4Q5RA 2I3YA 3QD9A 1YEPA 3IAM2 4ZL7A 4O5UA 2Z9SA 4H86A 1F9MA 3IHQA 3VI7A 5LNKe 2CX4A 4XRAA 3PINA 5F0GA 5JCUA 1G7EA 1OAZA 2H76A 3D6IA 2GQLA 1V40A 3KH7A 3J7Yb 2HRKA 4K1FA 4WF5A 2DBCA 3HVSA 1ERWA 5H5SA 3GUSA 2KHPA 3TOUA 2CZ2A 1CQGA 2HZFA 3KZQA 2K6VA 3C73A 2F51A 2VLTA 2XPEA 1ZCPA 5HR3A 4TVEA 4YKFA 1YQ1A 4LL4B 3O76A 1TRUA 1XWGA 4ECCA 1TRWA 2YP6A 2EIOA 1GTAA 5IMZA 3TGZA 5ID2B 2XBQA 2O87A 1PKWA 1OC3A 1SENA 4RI6A 3MDKA 2GDRA 2ES7A 3CXGA 1JFUA 1FG4A 3R2QA 2IN3A 6GSSA 1XWCA 4GSNA 2A2RA 3LEFA 1SJ6A 3KH9A 1F3BA 3IV4A 4KDXA 4BWQA 4POLA 1G7OA 2B6MA 3EC3A 2GLRA 3VI5A 5J41A 1IYHA 1M99A 2HE3A 2X8CA 6GSYA 1Q98A 2HNLA 16GSA 1GLPA 1VRSD 3KM6A 4ML1A 4HJ2A 1TK5B 4TR1A 4ISDA 3LG6A 1TOFA 3FKFA 2M80A 1BAYA 4HI7A 4NV2A 4IHUA 1NM3A 5IMDA 1GNEA 4TXVA 1VF2A 5HFKA 5AGYA 1R7HA 1O6JA 2C80A 2RUEA 1QFNA 2BTOT 1K3LA 2B1LA 1TI1A 1B48A 5F06A 4TRXA 4IN0A 3GTUA 2XHFA 4F0CA 5AN1A 3VK9A 4F2IA 9GSSA 5HR0A 3G7JA 1GSYA 1SKWB 3MNGA 5B7CA 4KCAA 3C1SA 2L5OA 3VLNA 4Z2TA 4FO5A 1AQVA 3E0UA 3GHAA 5DALA 5EY6A 3KTLA 4IKHA 2DKIA 1A23A 2N5AA 1B9XC 4LMVA 2F3MA 3CQFA 2WDUA 1OE8A 2H74A 4IBPA 1I9DA 2L4QA 2F8AA 1T7PB 1J08A 1PMTA 2GSTA 2H73A 4POKA 2VCZA 3ZTLA 5DQYA 2X4AA 2TIRA 2VLVA 3N5OA 2JZSA 1SYRA 5B8AA 5ECSA 4MNNA 2O7KA 1KEBA 1GTBA 3UBKA 3UEMA 4IW9A 2PUKC 4ID0A 5DCHA 1MTCA 2K18A 2FWHA 4L0UA 4ICYA 4LL1B 3GNJA 5FHIA 3MIXA 3VPQA 2K8VA 2E0QA 2FA8A 4HJMA 1U6TA 2CQ9A 3VWVA 4TXOA 1B8XA 2VIMA 5DAKB 1QMVA 4CY6A 3RHCA 2YWNA 2P5QA 1XCCA 2OBIA 2F8FA 5AISA 1OE7A 3BCKA 2H0GA 3BOAA 2TRCP 2A2PA 1YKCA 2PERA 3DMLA 2H0HA 3NOFA 4AJ8A 1DUGA 3G7YA 3KMNA 1GNWA 4TR3A 3GL5A 1TRVA 5CP1A 2QA1A 3H93A 1U87A 2I9HA 1EWXA 1Z6MA 3CRTA 3S9FA 3ZITA 4ZILA 2IMDA 5JWRB 4TW5A 3E3EA 2X8GA 3A5IA 3WT1A 3DGQA 3P7XA 3ZLPA 4OMVA 5ECIB 3L9UA 4ECIA 4L5OA 3VPTA 1R5PA 3UVHA 2HI7A 2IFQB 4Z2RA 2BMXA 2LRCA 3IA1A 1ZYNA 3NZNA 2HYXA 2LRNA 4F0BA 1BJXA 4EIQA 2C0FA 1IYIA 5KN0A 1ZMAA 5DBQA 1G0TA 3DKSA 1V57A 14GSA 3MAKA 2FWEA 2HZEA 4K7IA 4L8EA 2VUPA 2VCWA 1DE2A 5GZZB 2KP2A 5IOWA 20GSA 5B8BA 4DVCA 4XTSA 2VL3A 3F4SA 1ERVA 1RW1A 3GH9A 4I2UA 4OD7A 1QGVA 4IQAA 2VAFA 4EE0A 1FVJA 1Z9HA 4G10A 2MMZA 4KB3A 1SKSB 2DMLA 1E6BA 3H4KA 5H5QA 1HNBA 2OADA 3KMOA 4QL9A 1YF0A 2DJ1A 5INYA 5IO0A 4MPGA 1OKTA 2CV4A 2FHEA 2WS2A 2H1BA 1T4ZA 5ECPB 3GKKA 2VCVA 1KTEA 4KGIA 2E2MA 4PX1A 1EV4A 3IDVA 3DXBA 4YH2A 2DMMA 3LXTA 5ABRA 2QC7A 4WF4A 4EC0A 1VF3A 3RBTA 5ID2A 3HVXA 1A2JA 2NVLA 4WXTA 2MBSA 1R5AA 4AJ6A 4MJBA 3HZ8A 3FHKA 4KAEA 4MF7A 1S3AA 4G9HA 1OC8A 1V58A 2NBSA 4ZBAA 6GSUA 2CX3A 4G0KA 1SD8A 4KF9A 3A2XA 2K8SA 1K0BA 4ML6A 2HRAA 2C3TA 3U6VA 1BYEA 1LBKA 1GRXA 1PL2A 4ILFA 1B4QA 5KEJA 4G0IA 5A4WA 3HVNA 1XW5A 3QDNA 1HD2A 1Z7PA 4IP6A 3LYPA 1V2AA 3L9SA 4EDYA 3DIEA 5JWQB 3DVWA 5A4VA 3ZVJA 1M2DA 2M46A 5ECQB 2I81A 5G31A 3Q18A 2GQMA 4OCEA 4EO3A 4K0NA 3CBUA 1JZDA 3H1NA 1N2AA 4YQUA 2HRNA 4ECBA 5ECLB 6GSTA 1F6MC 3F3RA 4GCIA 2R3XA 2V2GA 2GS3A 2X99A 3D4MA 2YWOA 4HQZA 4HU9A 1HNCA 2MMAA 3BBYA 3C1RA 1QK8A 2JACA 4RI7A 1VF1A 4JEDA 3GSSA 4KDYA 2LQOA 2GZZA 2C0GA 1ACVA 1H4OA 4HU7A 1TTZA 4K9ZA 4GLTA 2L6CA 3LYKA 2PN8A 4KNDA 1YZXA 3F6FA 6GSVA 4PQIA 1MDJA 1ZZYA 5ELGA 4MH2A 1E2YA 1K3OA 4NWYA 1TXXA 3WGXA 1BQ7A 3HZ4A 3KEBA 1GWCA 2A2SA 3G7IA 1SK2A 1B4PA 5CRWA 2YOIA 4K0GA 1QXHA 3QFBC 1J0FA 1QQ2A 4EXJA 2VCXA 2WJUA 5EVOA 2L6DA 2H19A 5IOXA 3LORA 4ZBBA 4O7HA 3APSA 1WJKA 5H5RA 2LJAA 3CYNA 3GURA 3C8EA 1NHYA 4KA0A 3N9JA 3CRUA 5IQYA 4Q5FA 1YF1A 4MF5A 3LXZA 3IR4A 3KP9A 5ENUA 2OE0A 2L59A 4JR4A 1RK4A 1RQMA 2LJRA 1ABAA 4AF2A 3HJMA 2H30A 2YJ7A 2CA8A 1M2BA 5E59A 1GSFA 2J9HA 5KN3A 1JZOA 2P31A 2H75A 4MP4A 3ZRDA 3RAZA 2IMKA 3DYRA 2B7KA 8GSSA 3WYWA 2FCHA 3EU3A 2GSSA 2DIZA 2V32A 4BA7A 3FY7A 5IIZA 5A5KA 2WCIA 3IBHA 1K0DA 2G2QA 2VCTA 4FYUA 3EURA 3RHBA 4LMWA 3O6TA 2A4HA 1XVQA 5IO2A 2MMNA 3VWUA 2QSIA 2YJHA 2JL4A 4RQXA 1WRYA 5D73A 4KX4A 1ERTA 2QKEA 2OE1A 4Q5QA 5E4WA 3TKQA 2PMTA 3IXRA 1TDIA 1XFLA 5C04A 2DSAA 3DRNA 3MWHA 4WBRD 3QFAC 3H79A 2RLIA 4BL7B 2GSRA 4I6XA 3EVIA 4PUFC 4EKZA 2VCQA 3TKSC 1ML6A 2XPDA 4L5LA 4BVXB 2FNOA 2YZHA 5EL8A 2REMA 4JZQA 1FHEA 4HUAA 1DE1A 3HJOA 2V6OA 1PD21 3ZVJD 10GSA 3GFKA 1PN0A 2O8VB 1AC1A 5B6MA 4N0VA 2C0DA 1X9WB 5COHA 1DBYA 3KGKA 4PGTA 3VFIA 3LSZA 4DSSB 1GUKA 2VL9A 4KSOA 4A5PA 5CRHA 2L5LA 3VWXA 1AQWA 3C71A 4EVMA 5CREA 3GRXA 1TU8A 1CQHA 1WIKA 4X1UA 4XS6A 2WFCA 1A2MA 4MCUA 3SBCA 4BVYB 3KD0A 3LJRA 3ZIVA 2WGRA 1S3DA 1OC9B 11GSA 4GSTA 4YAVA 2R2JA 4MZCA 3WD6A 4MF6A 3GKNA 4KSMA 1S3RA 4DSQA 4IS0A 2OE3A 2AUVA 1I5GA 3TJGA 1UVZA 2DJ2A 1W4VA 3VURA 4MPFA 5ECRB 1F2EA 2VL2C 4D73A 3D0ZA 1M7TA 4OCFA 2VOCA 4CHSA 5F8BA 2GGTA 2IWTA 2AJQB 3W8SA 2FGXA 3ED3A 1GTIA 3ZREA 1SL1B 1ZYQB 2GZPA 2LSTA 3ERGA 1XWBA 2G0FA 4XS4A 4EF0A 4NHWA 4AGSA 5GSSA 3I43A 2C1YA 2CT6A 3IK7A 1XG8A 4WKWA 2ON7A 4TN8A 5JCWA 1GSUA 1OYJA 2DC5A 3L9VA 3LQ7A 4HQSA 4K5RA 1K0OA 4K2DA 3TRQA 1YY7A 2IJYA 5J3RA 1GL8A 4V2NA 2GT5A 3HDCA 5DCGA 3TKSE 3D22A 3QR6A 4HZ2A 5IPHA 1PRXA 2DLXA 1HYUA 2NTOA 3FEUA 2AAWA 4X0XA 4PNGA 3CSHA 4RUVA 3EWLA 2VLUA 3HY2A 1R4WA 4F03A 1VGLA 3F4TA 2B7JA 2A4VA 2HFDA 3GH6A 4IVFA 2FY6A 1SL0B 1J9BA 1EOHA 1T8EB 5ECMB 4NAXA 3P2AA 4ZL8A 3ME8A 4ZB8A 2R37A 1USBA 1TK8B 1MEKA 4V1Ag 3W8JA 1TU7A 2GZYA 4JBBA 2FWGA 3FW2A 2H0IA 2LNSA 4MABA 2H72A 2P0GA 3UIWA 2LKUA 3V1WA 2PVOC 4MJCA 4IJ3A 1MDKA 2H01A 4HDEA 3QAGA 5ECHB 2H70A 4E8HA 4V2MA 4BWSA 2AHEA 3RPPA 1TK0B 3GA4A 4ZBDA 2DJKA 2VM1A 5J9CA 1M3IA 2C0EA 4QL7A 1ON4A 3QAVA 5G1LA 3UJ1A 4MJEA 3GKXA 1EV9A 3FRCA 4NPBA 2V1MA 4AJ7A 1F37A 1Z7RA 4TR1B 1UA5A 1A8YA 4FH8A 6GSXA 1LJRA 1PA3A 3D4TA 3FZ9A 1N8JA 2H6YA 5D9TA 2H6ZA 4FYBA 4PNFA 4OFTA 1B9YC 3IPZA 1PX7A 2MBTA 3IC4A 4ZL9A 2O89A 5J5NA 1XWKA 2J23A 5L71A 3TRXA 2HXKA 1X9MB 1K0NA 3F3QA 1JLVA 4MH3A 3GTUB 5BRTA 2M72A 2H1AA 4EIPA 5G1KA 5HR1A 5AIXA 3EE2A 1TI3A 5GSTA 3EYTA 2CAQA 5DQSA 1OVNA 1EEMA 2C3QA 2P5RA 5DALB 3ZIJA 3D5JA 4GF0A 3ERWA 3GL3A 4LA1A 1XBSA 4E8EA 2GSQA 2HSYA 2H8LA 4OO4A 2UZ8A 3HVVA 1SD9A 4G2EA 1XW6A 1YDKA 4NXIA 1EP7A 2CAIA 4O92A 5HQPA 3W6GA 1GSQA 1T4YA 4WETA 2E2GA 2AYTA 2ZNMA 3F63A 2K9FA 5EPFA 4I2TA 5J9BA 2VL2A 2IMFA 1O85A 3EMPA 2DJJA 3IAS2 4LLRA 3M8NA 5D8IA 2LTKA 2OA7A 3DD3A 3C7MA 4WR4A 2R4VA 7GSSA 2I1UA 4JR6A 2C8UA 4XHMA 19GSA 2LJKA 1A0RP 3ME7A 1BEDA 4NMUA 4JU5A 3IK9A 4N10A 2JU5A 3KP8A 3NIVA 3FZAA 2ALBA 2PGTA 5AIVA 4J2FA 1PL1A 3DWVA 2RM6A 2HT9A 2B5EA 5G30A 4K8MA 1GTUA 4Z2UA 3E9JB 5B6NA 4WEYA 5ECKB 4CY8A 3J7Yk 4NHZA 1U3IA 4XCSA 2V41A 1FOVA 4BIKA 4RQRA 1XOAA 2X49A 2X8HA 4XIHA 1MD4A 1XIYA 3F6DA 4J57E 4XS1A 3EU4A 1YJ6A 4IJIA 3TJFA 1GUMA 3LFLA 1G6WA 5ECOB 4TKYA 3I6AA 4KE3A 3P90A 4FIWA 1SK0A 1HNAA 1M3JA 1Q4JA 5DJMA 3KJYA 2CVBA 1WP0A 1WMJA 3LGCA 5D9WA 4V2LA 4ACSA 5KOWA 12GSA 5D9XA 1K0MA 5DJLA 1YEXA 4IELA 3A2WA 2NPBA 1VF4A 2HZEB 1AXDA 1R26A 4HOJA 5DAKA 3FR6A 1XPVA 3CMIA 3F0IA 1KNGA 2N5BA 4KDUA 2ZUPA 1EP8A 3IC8A 1A2LA 4FYCA 1X5DA 2GTUA 1AW9A 4J56E 1Z3EA 4WBJA 3GKMA 3L0HA 1ZOFA 4FQUA 4MMMA 4XRDA 2C3NA 1X0RA 4YAPA 3UVTA 5G5EA 1Y25A 3A5WA 1AAZA 1PQNA 1ZYEA 3APOA 3KTBA 2LV3A 1GP1A 3I9V2 5CO3A 4X4JA 1TKDB 5IM9A 3IOSA 3GIXA 3KCMA 4GTUA 2IFQA 2R6KA 3EINA 4JE1A 4P3YB 5LCZA 4NV5A 2BJXA 3HYPA 1M9BA 2FUG2 2LEGA 4OO5A 5G5FA 1XOBA 3TRPA 1GSDA 2KLXA 2E7PA 4L0WA 2EIRA 1UC7A 1FOHA 4YKGA 5ELAA 2IL3A 4OFMA 4I97A 3CTFA 3FK8A 2H1DA 3M1GA 1M0UA 1PGTA 4JRRA 2B3SA 3IRAA 1O73A 4IGJA 2RM5A 3UARA 3KIJA 2V6KA 3TKPA 2JSZA 4GSSA 3MSZA 3MYDA 2KOKA 4CDOA 4N11A 1SK1A 3FZ4A 4F9ZA 3LWAA 3QAWA 4GRFA 3G9BA 2IMIA 3QCPA 2I4AA 5G2ZA 4V1Ap 2H66A 2EC4A 1SU9A 2RIIA 2R0CA 5C00A 4Z7XA 2VD1A 1EEJA 4IP1A 3PPUA 4YQVA 2QGVA 2YNXA 2FLSA 3GX8A 4PXOA 2LUSA 4ULXA 3VWWA 1NW2A 4EL1A 1MDIA 4GWRA 4G0LA 3EMXA 2L4CA 1UN2A 1ZGNA 4MK3A 1AIUA 3RDWA 4O32A 1M2AA 4ZIJA 4MZWA 2HSHA 3GMFA 1KBNA 3Q19A 3M3MA 2MYGA 1NSWA 4EDZA 1XVWA 1FB0A 3UL3A 2MMOA 2RUFA 2OBKA 2LQQA 3PGTA 3QOUA 5D9VA 3TKRA 2H71A 2EIQA 1BX9A 3M9JA 3GYKA 3DEXA 1FAAA 1H75A 2GVPA 4OWYA 1XWAA 2DKHA 1PFOA 5IMCA 1GSEA 3M0FA 4TR4A 4K2XA 5F05A 3FR9A 1ILOA 1A24A 2YPMA 1GSSA 1LU4A 2OJLA 3TOTA 3DVXA 3HD5A 4K6XA 5CYYA 4HS1A 5FT3A 4KUNA 5IMVA 3A3TA 4ZXGA 1U88A 5JCGA 1W89A 3US3A 5IPGA 1G6YA 3FYGA 2HLSA 4MDCA 1T1VA 4PUAA 4KH7A 3KXOA 1WOUA 1K0CA 1EGRA 4GQCA 2F9SA 3P8WA 4MJAA 1V98A 2CVKA 3TJBA 2NDOA 1PX6A 4Q5NA 2YV7A 3WGDA 4DSRA 1A0FA 1T3BA 2FD3A 3ZFBA 2H1GA 3BCIA 1M9AA 2JADA 2YN1A 1F3AA 2VD0A 3WT2A 3ZZXA 4TOPA 3UBLA 1K3YA 2YZUA 2L57A 5HFGA 3ZMLA 1BG5A 1HQOA 18GSA 2GQKA 4DEJA 2PWJA 3FZ5A 5CNWA 4PTSA 5LD0A 4I5QA 1K0AA 3FMWA 3FR3A 2WZ9A 1AQXA 4N0ZA 3GX0A 4HEA2 4PQ1A 4N30A 3UMAA 5D93A 2B1KA 5D96A 4USSA 3CSJA 4OFNA 2PU9C 1AUCA 5HR2A 4CW9A 2VM2A 2PVQA 4WR5A 5IMAA 5GAPD 17GSA 3TDGA 3WGEA 4ECJA 5J4UA 4K7NA 2MZCA 2CVDA 2XBIA 2AV4A 4KW6A 2YV9A 3CTGA 3TJKA 1O8XA 2YANA 5FWGA 2B5YA 3GSTA 2QA2A 3ZYWA 1TW9A 3HJPA 1OKDA 3PR8A 1ZYPA 1O81A 2JZTA 2KUCA 1FW1A 3HXSA 2ON5A 1U3AA 3GN3A 3GV1A 1X5EA 4TR0A 1SKRB 2JZRA 4YQMA 4MA9A 3ISOA 1FVKA 2XC2A 1SJIA 3QMXA 4HZ4A 2PBJA 5DVBA 1EOGA 3TCOA 3ZFLA 1MD3A 2H6XA 3JCML 1FB6A 2X64A 1TP9A 1O8WA 3TJJA 22GSA 3TKSA 3PH9A 1URMA 1JZWA 4POMA 1DSBA 5GAND 3HA9A 4PURA 1XZOA 2D2ZA 5BMUA 1PKZA 5JWOB 2OKAA 2IMEA 1QUWA 2ZCTA 4IQ1A 2TRXA 1PN9A 5CRDA 4HSCX 1X5CA 3K8NA 3R3EA 5F07A 2FWFA 3TB2A 3F4RA 2R5GA 4POBA 3UOMA 2CZ3A 13GSA 3IHGA 4K7OA 1C72A 4QQ7A 3L78A 4ZB9A 1WWJA 3QPMA 4GQFA 3I69A 2DJ0A 3ERFA 1THOA 3CSIA 2PPTA 1FO5A 2N5FA 2WB9A 1Z5YE 3Q74A 2LRTA 4O5RA 1TRSA 5IMFA 1THXA 6GSWA 4D73B 1GH2A 2B5XA 2R0PA 5A4UA 3AY8A 4BL7A 1EZKA 1SL2B 2DJ3A 1T00A 3LW9A 1GLQA 2IPAA 5CAXA 1JHBA 4BVXA 2DIYA 3D21A 2VO4A 3BD2A 1ERUA 4I8BA 1WE0A 3Q6OA 3HCZA 4G19A 3IE3A 4XS4B
chains in the Genus database with same CATH topology
3TUEA 3RPNA 1PSQA 2LNTA 3H8QA 4EUYA 4BPYA 2LS5A 1V9WA 4DSSA 4MLYA 4TXOB 3M9KA 1Z6NA 5KN1A 3APQA 4PQHA 4GXZA 2YCDA 1NHOA 3EPTA 3L4NA 3U5RE 1ST9A 4BVYA 1EGOA 2OACA 1OC9A 1S3CA 5CRGA 1TJDA 1Y6EA 2R0GA 2WRTA 1XXUA 1SJZA 2JSYA 1GUHA 2HRFA 4F82A 3ZL5A 1JLWA 4MZBA 3HKRA 4O5QA 1ZL9A 3A2VA 3F9UA 5ECNB 2WULA 1X9SB 2KP1A 3O3TA 4X43A 4ZB6A 1JZRA 3OR5A 2YWMA 5KN2A 5KOXA 1GULA 2GT6A 1XW9A 2O85A 1YKAA 3UAPA 2YWIA 2AB6A 1O7UA 3BJ5A 5DDLA 2IIYA 4KCEA 2FA4A 1A8LA 3ZMKA 5HFIA 2HSMA 4K5SA 1WPIA 3HHVA 1SYXA 3SWLA 2C4JA 3F8UA 4Q5RA 2I3YA 3QD9A 1YEPA 3IAM2 4ZL7A 4O5UA 2Z9SA 4H86A 1F9MA 3IHQA 3VI7A 5LNKe 2CX4A 4XRAA 3PINA 5F0GA 5JCUA 1G7EA 1OAZA 2H76A 3D6IA 2GQLA 1V40A 3KH7A 3J7Yb 2HRKA 4K1FA 4WF5A 2DBCA 3HVSA 1ERWA 5H5SA 3GUSA 2KHPA 3TOUA 2CZ2A 1CQGA 2HZFA 3KZQA 2K6VA 3C73A 2F51A 2VLTA 2XPEA 1ZCPA 5HR3A 4TVEA 4YKFA 1YQ1A 4LL4B 3O76A 1TRUA 1XWGA 4ECCA 1TRWA 2YP6A 2EIOA 1GTAA 5IMZA 3TGZA 5ID2B 2XBQA 2O87A 1PKWA 1OC3A 1SENA 4RI6A 3MDKA 2GDRA 2ES7A 3CXGA 1JFUA 1FG4A 3R2QA 2IN3A 6GSSA 1XWCA 4GSNA 2A2RA 3LEFA 1SJ6A 3KH9A 1F3BA 3IV4A 4KDXA 4BWQA 4POLA 1G7OA 2B6MA 3EC3A 2GLRA 3VI5A 5J41A 1IYHA 1M99A 2HE3A 2X8CA 6GSYA 1Q98A 2HNLA 16GSA 1GLPA 1VRSD 3KM6A 4ML1A 4HJ2A 1TK5B 4TR1A 4ISDA 3LG6A 1TOFA 3FKFA 2M80A 1BAYA 4HI7A 4NV2A 4IHUA 1NM3A 5IMDA 1GNEA 4TXVA 1VF2A 5HFKA 5AGYA 1R7HA 1O6JA 2C80A 2RUEA 1QFNA 2BTOT 1K3LA 2B1LA 1TI1A 1B48A 5F06A 4TRXA 4IN0A 3GTUA 2XHFA 4F0CA 5AN1A 3VK9A 4F2IA 9GSSA 5HR0A 3G7JA 1GSYA 1SKWB 3MNGA 5B7CA 4KCAA 3C1SA 2L5OA 3VLNA 4Z2TA 4FO5A 1AQVA 3E0UA 3GHAA 5DALA 5EY6A 3KTLA 4IKHA 2DKIA 1A23A 2N5AA 1B9XC 4LMVA 2F3MA 2WDUA 1OE8A 2H74A 4IBPA 1I9DA 2L4QA 2F8AA 1T7PB 1J08A 1PMTA 2GSTA 2H73A 4POKA 2VCZA 3ZTLA 5DQYA 2X4AA 2TIRA 2VLVA 3N5OA 2JZSA 1SYRA 5B8AA 5ECSA 4MNNA 2O7KA 1KEBA 1GTBA 3UBKA 3UEMA 4IW9A 2PUKC 4ID0A 5DCHA 1MTCA 2K18A 2FWHA 4L0UA 4ICYA 4LL1B 3GNJA 5FHIA 3MIXA 3VPQA 2K8VA 2E0QA 2FA8A 4HJMA 1U6TA 2CQ9A 3VWVA 4TXOA 1B8XA 2VIMA 5DAKB 1QMVA 4CY6A 3RHCA 2YWNA 2P5QA 1XCCA 2OBIA 2F8FA 5AISA 1OE7A 3BCKA 2H0GA 3BOAA 2TRCP 2A2PA 1YKCA 2PERA 3DMLA 2H0HA 3NOFA 4AJ8A 1DUGA 3G7YA 3KMNA 1GNWA 4TR3A 3GL5A 1TRVA 5CP1A 2QA1A 3H93A 1U87A 2I9HA 1EWXA 1Z6MA 3CRTA 3S9FA 3ZITA 4ZILA 2IMDA 5JWRB 4TW5A 3E3EA 2X8GA 3A5IA 3WT1A 3DGQA 3P7XA 3ZLPA 4OMVA 5ECIB 3L9UA 4ECIA 4L5OA 3VPTA 1R5PA 3UVHA 2HI7A 2IFQB 4Z2RA 2BMXA 2LRCA 3IA1A 1ZYNA 3NZNA 2HYXA 2LRNA 4F0BA 1BJXA 4EIQA 2C0FA 1IYIA 5KN0A 1ZMAA 5DBQA 1G0TA 3DKSA 1V57A 14GSA 3MAKA 2FWEA 2HZEA 4K7IA 4L8EA 2VUPA 2VCWA 1DE2A 5GZZB 2KP2A 5IOWA 20GSA 5B8BA 4DVCA 4XTSA 2VL3A 3F4SA 1ERVA 1RW1A 3GH9A 4I2UA 4OD7A 1QGVA 4IQAA 2VAFA 4EE0A 1FVJA 1Z9HA 4G10A 2MMZA 4KB3A 1SKSB 2DMLA 1E6BA 3H4KA 5H5QA 1HNBA 2OADA 3KMOA 4QL9A 1YF0A 2DJ1A 5INYA 5IO0A 4MPGA 1OKTA 2CV4A 2FHEA 2WS2A 2H1BA 1T4ZA 5ECPB 3GKKA 2VCVA 1KTEA 4KGIA 2E2MA 4PX1A 1EV4A 3IDVA 3DXBA 4YH2A 2DMMA 3LXTA 5ABRA 2QC7A 4WF4A 4EC0A 1VF3A 3RBTA 5ID2A 3HVXA 1A2JA 2NVLA 4WXTA 2MBSA 1R5AA 4AJ6A 4MJBA 3HZ8A 3FHKA 4KAEA 4MF7A 1S3AA 4G9HA 1OC8A 1V58A 2NBSA 4ZBAA 6GSUA 2CX3A 4G0KA 1SD8A 4KF9A 3A2XA 2K8SA 1K0BA 4ML6A 2HRAA 2C3TA 3U6VA 1BYEA 1LBKA 1GRXA 1PL2A 4ILFA 1B4QA 5KEJA 4G0IA 5A4WA 1XW5A 3QDNA 1HD2A 1Z7PA 4IP6A 3LYPA 1V2AA 3L9SA 4EDYA 3DIEA 5JWQB 3DVWA 5A4VA 3ZVJA 1M2DA 2M46A 5ECQB 2I81A 5G31A 3Q18A 2GQMA 4OCEA 4EO3A 4K0NA 3CBUA 1JZDA 3H1NA 1N2AA 4YQUA 2HRNA 4ECBA 5ECLB 6GSTA 1F6MC 3F3RA 4GCIA 2R3XA 2V2GA 2GS3A 2X99A 3D4MA 2YWOA 4HQZA 4HU9A 1HNCA 2MMAA 3BBYA 3C1RA 1QK8A 2JACA 4RI7A 1VF1A 4JEDA 3GSSA 4KDYA 2LQOA 2GZZA 2C0GA 1ACVA 1H4OA 4HU7A 1TTZA 4K9ZA 4GLTA 2L6CA 3LYKA 2PN8A 4KNDA 1YZXA 3F6FA 6GSVA 4PQIA 1MDJA 1ZZYA 5ELGA 4MH2A 1E2YA 1K3OA 4NWYA 1TXXA 3WGXA 1BQ7A 3HZ4A 3KEBA 1GWCA 2A2SA 3G7IA 1SK2A 1B4PA 5CRWA 2YOIA 4K0GA 1QXHA 3QFBC 1J0FA 1QQ2A 4EXJA 2VCXA 2WJUA 5EVOA 2L6DA 2H19A 5IOXA 3LORA 4ZBBA 4O7HA 3APSA 1WJKA 5H5RA 2LJAA 3CYNA 3GURA 3C8EA 1NHYA 4KA0A 3N9JA 3CRUA 5IQYA 4Q5FA 1YF1A 4MF5A 3LXZA 3IR4A 3KP9A 5ENUA 2OE0A 2L59A 4JR4A 1RK4A 1RQMA 2LJRA 1ABAA 4AF2A 3HJMA 2H30A 2YJ7A 2CA8A 1M2BA 5E59A 1GSFA 2J9HA 5KN3A 1JZOA 2P31A 2H75A 4MP4A 3ZRDA 3RAZA 2IMKA 3DYRA 2B7KA 8GSSA 3WYWA 2FCHA 3EU3A 2GSSA 2DIZA 2V32A 4BA7A 3FY7A 5IIZA 5A5KA 2WCIA 3IBHA 1K0DA 2G2QA 2VCTA 4FYUA 3EURA 3RHBA 4LMWA 3O6TA 2A4HA 1XVQA 5IO2A 2MMNA 3VWUA 2QSIA 2YJHA 2JL4A 4RQXA 1WRYA 5D73A 4KX4A 1ERTA 2QKEA 2OE1A 4Q5QA 5E4WA 3TKQA 2PMTA 3IXRA 1TDIA 1XFLA 5C04A 2DSAA 3DRNA 3MWHA 4WBRD 3QFAC 3H79A 2RLIA 4BL7B 2GSRA 4I6XA 3EVIA 4PUFC 4EKZA 2VCQA 3TKSC 1ML6A 2XPDA 4L5LA 4BVXB 2FNOA 2YZHA 5EL8A 2REMA 4JZQA 1FHEA 4HUAA 1DE1A 3HJOA 2V6OA 1PD21 3ZVJD 10GSA 3GFKA 1PN0A 2O8VB 1AC1A 5B6MA 4N0VA 2C0DA 1X9WB 5COHA 1DBYA 3KGKA 4PGTA 3VFIA 3LSZA 4DSSB 1GUKA 2VL9A 4KSOA 4A5PA 5CRHA 2L5LA 3VWXA 1AQWA 3C71A 4EVMA 5CREA 3GRXA 1TU8A 1CQHA 1WIKA 4X1UA 4XS6A 2WFCA 1A2MA 4MCUA 3SBCA 4BVYB 3KD0A 3LJRA 3ZIVA 2WGRA 1S3DA 1OC9B 11GSA 4GSTA 4YAVA 2R2JA 4MZCA 3WD6A 4MF6A 3GKNA 4KSMA 4DSQA 4IS0A 2OE3A 2AUVA 1I5GA 3TJGA 1UVZA 2DJ2A 1W4VA 3VURA 4MPFA 5ECRB 1F2EA 2VL2C 4D73A 3D0ZA 1M7TA 4OCFA 2VOCA 4CHSA 5F8BA 2GGTA 2IWTA 2AJQB 3W8SA 2FGXA 3ED3A 1GTIA 3ZREA 1SL1B 1ZYQB 2GZPA 2LSTA 3ERGA 1XWBA 2G0FA 4XS4A 4EF0A 4NHWA 4AGSA 5GSSA 3I43A 2C1YA 2CT6A 3IK7A 4WKWA 2ON7A 4TN8A 5JCWA 1GSUA 1OYJA 2DC5A 3L9VA 3LQ7A 4HQSA 4K5RA 1K0OA 4K2DA 3TRQA 1YY7A 2IJYA 5J3RA 1GL8A 4V2NA 2GT5A 3HDCA 5DCGA 3TKSE 3D22A 3QR6A 4HZ2A 5IPHA 1PRXA 2DLXA 1HYUA 2NTOA 3FEUA 2AAWA 4X0XA 4PNGA 3CSHA 4RUVA 3EWLA 2VLUA 3HY2A 1R4WA 4F03A 1VGLA 3F4TA 2B7JA 2A4VA 2HFDA 3GH6A 4IVFA 2FY6A 1SL0B 1J9BA 1EOHA 1T8EB 5ECMB 4NAXA 3P2AA 4ZL8A 3ME8A 4ZB8A 2R37A 1USBA 1TK8B 1MEKA 4V1Ag 3W8JA 1TU7A 2GZYA 4JBBA 2FWGA 3FW2A 2H0IA 2LNSA 4MABA 2H72A 2P0GA 3UIWA 2LKUA 3V1WA 2PVOC 4MJCA 4IJ3A 1MDKA 2H01A 4HDEA 3QAGA 5ECHB 2H70A 4E8HA 4V2MA 4BWSA 2AHEA 3RPPA 1TK0B 3GA4A 4ZBDA 2DJKA 2VM1A 5J9CA 2C0EA 4QL7A 1ON4A 3QAVA 5G1LA 3UJ1A 4MJEA 3GKXA 1EV9A 3FRCA 4NPBA 2V1MA 4AJ7A 1F37A 1Z7RA 4TR1B 1UA5A 1A8YA 4FH8A 6GSXA 1LJRA 1PA3A 3D4TA 3FZ9A 1N8JA 2H6YA 5D9TA 2H6ZA 4FYBA 4PNFA 4OFTA 1B9YC 3IPZA 1PX7A 2MBTA 3IC4A 4ZL9A 2O89A 5J5NA 1XWKA 2J23A 5L71A 3TRXA 2HXKA 1X9MB 1K0NA 3F3QA 1JLVA 4MH3A 3GTUB 5BRTA 2M72A 2H1AA 4EIPA 5G1KA 5HR1A 5AIXA 3EE2A 1TI3A 5GSTA 3EYTA 2CAQA 5DQSA 1OVNA 1EEMA 2C3QA 2P5RA 5DALB 3ZIJA 3D5JA 4GF0A 3ERWA 3GL3A 4LA1A 1XBSA 4E8EA 2GSQA 2HSYA 2H8LA 4OO4A 2UZ8A 3HVVA 1SD9A 4G2EA 1XW6A 1YDKA 4NXIA 1EP7A 2CAIA 4O92A 5HQPA 3W6GA 1GSQA 1T4YA 4WETA 2E2GA 2AYTA 2ZNMA 3F63A 2K9FA 5EPFA 4I2TA 5J9BA 2VL2A 2IMFA 1O85A 3EMPA 2DJJA 3IAS2 4LLRA 3M8NA 5D8IA 2LTKA 2OA7A 3DD3A 3C7MA 4WR4A 2R4VA 7GSSA 2I1UA 4JR6A 2C8UA 4XHMA 19GSA 2LJKA 1A0RP 3ME7A 1BEDA 4NMUA 4JU5A 3IK9A 4N10A 2JU5A 3KP8A 3NIVA 3FZAA 2ALBA 2PGTA 5AIVA 4J2FA 1PL1A 3DWVA 2RM6A 2HT9A 2B5EA 5G30A 4K8MA 1GTUA 4Z2UA 3E9JB 5B6NA 4WEYA 5ECKB 4CY8A 3J7Yk 4NHZA 1U3IA 4XCSA 2V41A 1FOVA 4RQRA 1XOAA 2X49A 2X8HA 4XIHA 1MD4A 1XIYA 3F6DA 4J57E 4XS1A 3EU4A 1YJ6A 4IJIA 3TJFA 1GUMA 3LFLA 1G6WA 5ECOB 4TKYA 3I6AA 4KE3A 3P90A 4FIWA 1SK0A 1HNAA 1Q4JA 5DJMA 3KJYA 2CVBA 1WP0A 1WMJA 3LGCA 5D9WA 4V2LA 4ACSA 5KOWA 12GSA 5D9XA 1K0MA 5DJLA 1YEXA 4IELA 3A2WA 2NPBA 1VF4A 2HZEB 1AXDA 1R26A 4HOJA 5DAKA 3FR6A 1XPVA 3CMIA 3F0IA 1KNGA 2N5BA 4KDUA 2ZUPA 1EP8A 3IC8A 1A2LA 4FYCA 1X5DA 2GTUA 1AW9A 4J56E 1Z3EA 4WBJA 3GKMA 3L0HA 1ZOFA 4FQUA 4MMMA 4XRDA 2C3NA 1X0RA 4YAPA 3UVTA 5G5EA 1Y25A 3A5WA 1AAZA 1PQNA 1ZYEA 3APOA 3KTBA 2LV3A 1GP1A 3I9V2 5CO3A 4X4JA 1TKDB 5IM9A 3IOSA 3GIXA 3KCMA 4GTUA 2IFQA 2R6KA 3EINA 4JE1A 4P3YB 5LCZA 4NV5A 2BJXA 3HYPA 1M9BA 2FUG2 2LEGA 4OO5A 5G5FA 1XOBA 3TRPA 1GSDA 2KLXA 2E7PA 4L0WA 2EIRA 1UC7A 1FOHA 4YKGA 5ELAA 2IL3A 4OFMA 4I97A 3CTFA 3FK8A 2H1DA 3M1GA 1M0UA 1PGTA 4JRRA 2B3SA 3IRAA 1O73A 4IGJA 2RM5A 3UARA 3KIJA 2V6KA 3TKPA 2JSZA 4GSSA 3MSZA 3MYDA 2KOKA 4CDOA 4N11A 1SK1A 3FZ4A 4F9ZA 3LWAA 3QAWA 4GRFA 3G9BA 2IMIA 3QCPA 2I4AA 5G2ZA 4V1Ap 2H66A 2EC4A 1SU9A 2RIIA 2R0CA 5C00A 4Z7XA 2VD1A 1EEJA 4IP1A 3PPUA 4YQVA 2QGVA 2YNXA 2FLSA 3GX8A 4PXOA 2LUSA 4ULXA 3VWWA 1NW2A 4EL1A 1MDIA 4GWRA 4G0LA 3EMXA 2L4CA 1UN2A 1ZGNA 4MK3A 1AIUA 3RDWA 4O32A 1M2AA 4ZIJA 4MZWA 2HSHA 3GMFA 1KBNA 3Q19A 3M3MA 2MYGA 1NSWA 4EDZA 1XVWA 1FB0A 3UL3A 2MMOA 2RUFA 2OBKA 2LQQA 3PGTA 3QOUA 5D9VA 3TKRA 2H71A 2EIQA 1BX9A 3M9JA 3GYKA 3DEXA 1FAAA 1H75A 2GVPA 4OWYA 1XWAA 2DKHA 5IMCA 1GSEA 3M0FA 4TR4A 4K2XA 5F05A 3FR9A 1ILOA 1A24A 2YPMA 1GSSA 1LU4A 2OJLA 3TOTA 3DVXA 3HD5A 4K6XA 5CYYA 4HS1A 5FT3A 4KUNA 5IMVA 3A3TA 4ZXGA 1U88A 5JCGA 1W89A 3US3A 5IPGA 1G6YA 3FYGA 2HLSA 4MDCA 1T1VA 4PUAA 4KH7A 3KXOA 1WOUA 1K0CA 1EGRA 4GQCA 2F9SA 3P8WA 4MJAA 1V98A 2CVKA 3TJBA 2NDOA 1PX6A 4Q5NA 2YV7A 3WGDA 4DSRA 1A0FA 1T3BA 2FD3A 3ZFBA 2H1GA 3BCIA 1M9AA 2JADA 2YN1A 1F3AA 2VD0A 3WT2A 3ZZXA 4TOPA 3UBLA 1K3YA 2YZUA 2L57A 5HFGA 3ZMLA 1BG5A 1HQOA 18GSA 2GQKA 4DEJA 2PWJA 3FZ5A 5CNWA 4PTSA 5LD0A 4I5QA 1K0AA 3FMWA 3FR3A 2WZ9A 1AQXA 4N0ZA 3GX0A 4HEA2 4PQ1A 4N30A 3UMAA 5D93A 2B1KA 5D96A 4USSA 3CSJA 4OFNA 2PU9C 1AUCA 5HR2A 4CW9A 2VM2A 2PVQA 4WR5A 5IMAA 5GAPD 17GSA 3TDGA 3WGEA 4ECJA 5J4UA 4K7NA 2MZCA 2CVDA 2XBIA 2AV4A 4KW6A 2YV9A 3CTGA 3TJKA 1O8XA 2YANA 5FWGA 2B5YA 3GSTA 2QA2A 3ZYWA 1TW9A 3HJPA 1OKDA 3PR8A 1ZYPA 1O81A 2JZTA 2KUCA 1FW1A 3HXSA 2ON5A 1U3AA 3GN3A 3GV1A 1X5EA 4TR0A 1SKRB 2JZRA 4YQMA 4MA9A 3ISOA 1FVKA 2XC2A 1SJIA 3QMXA 4HZ4A 2PBJA 5DVBA 1EOGA 3TCOA 3ZFLA 1MD3A 2H6XA 3JCML 1FB6A 2X64A 1TP9A 1O8WA 3TJJA 22GSA 3TKSA 3PH9A 1URMA 1JZWA 4POMA 1DSBA 5GAND 3HA9A 4PURA 1XZOA 2D2ZA 5BMUA 1PKZA 5JWOB 2OKAA 2IMEA 1QUWA 2ZCTA 4IQ1A 2TRXA 1PN9A 5CRDA 1X5CA 3K8NA 3R3EA 5F07A 2FWFA 3TB2A 3F4RA 2R5GA 4POBA 3UOMA 2CZ3A 13GSA 3IHGA 4K7OA 1C72A 4QQ7A 3L78A 4ZB9A 1WWJA 3QPMA 4GQFA 3I69A 2DJ0A 3ERFA 1THOA 3CSIA 2PPTA 1FO5A 2N5FA 2WB9A 1Z5YE 3Q74A 2LRTA 4O5RA 1TRSA 5IMFA 1THXA 6GSWA 4D73B 1GH2A 2B5XA 2R0PA 5A4UA 3AY8A 4BL7A 1EZKA 1SL2B 2DJ3A 1T00A 3LW9A 1GLQA 2IPAA 5CAXA 1JHBA 4BVXA 2DIYA 3D21A 2VO4A 3BD2A 1ERUA 4I8BA 1WE0A 3Q6OA 3HCZA 4G19A 3IE3A 4XS4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUE A;  3RPN A;  1PSQ A;  2LNT A;  3H8Q A;  4EUY A;  4BPY A;  2LS5 A;  1V9W A;  4DSS A;  4MLY A;  4TXO B;  3M9K A;  1Z6N A;  5KN1 A;  3APQ A;  4PQH A;  4GXZ A;  2YCD A;  1NHO A;  3L4N A;  3U5R E;  1ST9 A;  4BVY A;  1EGO A;  2OAC A;  1OC9 A;  1S3C A;  5CRG A;  1TJD A;  1Y6E A;  2WRT A;  1XXU A;  1SJZ A;  2JSY A;  1GUH A;  2HRF A;  4F82 A;  3ZL5 A;  1JLW A;  4MZB A;  3HKR A;  1ZL9 A;  3A2V A;  3F9U A;  5ECN B;  2WUL A;  1X9S B;  2KP1 A;  3O3T A;  4X43 A;  4ZB6 A;  1JZR A;  3OR5 A;  2YWM A;  5KN2 A;  1GUL A;  2GT6 A;  1XW9 A;  2O85 A;  1YKA A;  3UAP A;  2YWI A;  2AB6 A;  1O7U A;  3BJ5 A;  5DDL A;  2IIY A;  4KCE A;  2FA4 A;  1A8L A;  3ZMK A;  5HFI A;  1WPI A;  3HHV A;  1SYX A;  3SWL A;  2C4J A;  3F8U A;  4Q5R A;  2I3Y A;  3QD9 A;  1YEP A;  3IAM 2;  4ZL7 A;  2Z9S A;  4H86 A;  1F9M A;  3IHQ A;  3VI7 A;  5LNK e;  2CX4 A;  4XRA A;  3PIN A;  5F0G A;  5JCU A;  1G7E A;  1OAZ A;  2H76 A;  3D6I A;  2GQL A;  1V40 A;  3KH7 A;  3J7Y b;  4K1F A;  4WF5 A;  2DBC A;  3HVS A;  1ERW A;  5H5S A;  3GUS A;  2KHP A;  3TOU A;  2CZ2 A;  1CQG A;  2HZF A;  3KZQ A;  2K6V A;  3C73 A;  2F51 A;  2VLT A;  2XPE A;  1ZCP A;  5HR3 A;  4TVE A;  1YQ1 A;  4LL4 B;  3O76 A;  1TRU A;  1XWG A;  4ECC A;  1TRW A;  2YP6 A;  2EIO A;  1GTA A;  5IMZ A;  3TGZ A;  5ID2 B;  2XBQ A;  2O87 A;  1PKW A;  1OC3 A;  1SEN A;  4RI6 A;  3MDK A;  2GDR A;  2ES7 A;  3CXG A;  1JFU A;  1FG4 A;  3R2Q A;  2IN3 A;  6GSS A;  1XWC A;  4GSN A;  2A2R A;  3LEF A;  1SJ6 A;  3KH9 A;  1F3B A;  3IV4 A;  4KDX A;  4BWQ A;  4POL A;  1G7O A;  2B6M A;  3EC3 A;  2GLR A;  3VI5 A;  5J41 A;  1IYH A;  1M99 A;  2HE3 A;  2X8C A;  6GSY A;  1Q98 A;  2HNL A;  16GS A;  1GLP A;  1VRS D;  3KM6 A;  4ML1 A;  4HJ2 A;  1TK5 B;  4TR1 A;  4ISD A;  3LG6 A;  1TOF A;  3FKF A;  2M80 A;  1BAY A;  4HI7 A;  4NV2 A;  4IHU A;  1NM3 A;  5IMD A;  1GNE A;  4TXV A;  1VF2 A;  5HFK A;  5AGY A;  1R7H A;  1O6J A;  2C80 A;  2RUE A;  1QFN A;  2BTO T;  1K3L A;  2B1L A;  1TI1 A;  1B48 A;  5F06 A;  4TRX A;  4IN0 A;  3GTU A;  2XHF A;  4F0C A;  5AN1 A;  3VK9 A;  4F2I A;  9GSS A;  5HR0 A;  3G7J A;  1GSY A;  1SKW B;  3MNG A;  5B7C A;  4KCA A;  3C1S A;  2L5O A;  3VLN A;  4FO5 A;  1AQV A;  3E0U A;  3GHA A;  5DAL A;  5EY6 A;  3KTL A;  4IKH A;  1A23 A;  2N5A A;  1B9X C;  4LMV A;  2F3M A;  2WDU A;  1OE8 A;  2H74 A;  4IBP A;  1I9D A;  2L4Q A;  2F8A A;  1T7P B;  1J08 A;  1PMT A;  2GST A;  2H73 A;  4POK A;  2VCZ A;  3ZTL A;  5DQY A;  2TIR A;  2VLV A;  3N5O A;  2JZS A;  1SYR A;  5B8A A;  5ECS A;  2O7K A;  1KEB A;  1GTB A;  3UBK A;  3UEM A;  4IW9 A;  2PUK C;  4ID0 A;  5DCH A;  1MTC A;  2K18 A;  2FWH A;  4L0U A;  4LL1 B;  3GNJ A;  5FHI A;  3VPQ A;  2K8V A;  2E0Q A;  2FA8 A;  4HJM A;  1U6T A;  2CQ9 A;  3VWV A;  4TXO A;  1B8X A;  2VIM A;  5DAK B;  1QMV A;  3RHC A;  2YWN A;  2P5Q A;  1XCC A;  2OBI A;  2F8F A;  5AIS A;  1OE7 A;  3BCK A;  2H0G A;  3BOA A;  2TRC P;  1YKC A;  2PER A;  3DML A;  2H0H A;  3NOF A;  4AJ8 A;  1DUG A;  3G7Y A;  3KMN A;  1GNW A;  4TR3 A;  3GL5 A;  1TRV A;  5CP1 A;  3H93 A;  1U87 A;  2I9H A;  1EWX A;  1Z6M A;  3CRT A;  3S9F A;  3ZIT A;  4ZIL A;  2IMD A;  5JWR B;  4TW5 A;  3E3E A;  2X8G A;  3WT1 A;  3DGQ A;  3P7X A;  3ZLP A;  4OMV A;  5ECI B;  3L9U A;  4ECI A;  4L5O A;  3VPT A;  1R5P A;  3UVH A;  2HI7 A;  2IFQ B;  2BMX A;  2LRC A;  3IA1 A;  3NZN A;  2HYX A;  2LRN A;  4F0B A;  1BJX A;  2C0F A;  1IYI A;  5KN0 A;  1ZMA A;  5DBQ A;  1G0T A;  3DKS A;  1V57 A;  14GS A;  3MAK A;  2FWE A;  2HZE A;  4K7I A;  4L8E A;  2VUP A;  2VCW A;  1DE2 A;  5GZZ B;  2KP2 A;  5IOW A;  20GS A;  5B8B A;  4DVC A;  4XTS A;  2VL3 A;  3F4S A;  1ERV A;  1RW1 A;  3GH9 A;  4I2U A;  4OD7 A;  1QGV A;  4IQA A;  2VAF A;  4EE0 A;  1FVJ A;  1Z9H A;  4G10 A;  2MMZ A;  4KB3 A;  1SKS B;  2DML A;  1E6B A;  3H4K A;  5H5Q A;  1HNB A;  2OAD A;  3KMO A;  4QL9 A;  1YF0 A;  2DJ1 A;  5INY A;  5IO0 A;  4MPG A;  1OKT A;  2CV4 A;  2FHE A;  2WS2 A;  2H1B A;  1T4Z A;  5ECP B;  3GKK A;  2VCV A;  1KTE A;  4KGI A;  2E2M A;  4PX1 A;  1EV4 A;  3IDV A;  3DXB A;  4YH2 A;  2DMM A;  3LXT A;  5ABR A;  2QC7 A;  4WF4 A;  4EC0 A;  1VF3 A;  3RBT A;  5ID2 A;  3HVX A;  1A2J A;  2NVL A;  4WXT A;  2MBS A;  1R5A A;  4AJ6 A;  4MJB A;  3HZ8 A;  3FHK A;  4KAE A;  4MF7 A;  1S3A A;  4G9H A;  1OC8 A;  1V58 A;  2NBS A;  4ZBA A;  6GSU A;  2CX3 A;  1SD8 A;  3A2X A;  2K8S A;  1K0B A;  4ML6 A;  2C3T A;  3U6V A;  1BYE A;  1LBK A;  1GRX A;  1PL2 A;  4ILF A;  1B4Q A;  5KEJ A;  5A4W A;  1XW5 A;  3QDN A;  1HD2 A;  1Z7P A;  4IP6 A;  3LYP A;  1V2A A;  3L9S A;  4EDY A;  3DIE A;  5JWQ B;  3DVW A;  5A4V A;  3ZVJ A;  1M2D A;  2M46 A;  5ECQ B;  2I81 A;  5G31 A;  3Q18 A;  2GQM A;  4OCE A;  4EO3 A;  4K0N A;  3CBU A;  1JZD A;  3H1N A;  1N2A A;  4YQU A;  2HRN A;  4ECB A;  5ECL B;  6GST A;  1F6M C;  3F3R A;  4GCI A;  2R3X A;  2V2G A;  2GS3 A;  2X99 A;  3D4M A;  2YWO A;  4HQZ A;  4HU9 A;  1HNC A;  2MMA A;  3BBY A;  3C1R A;  1QK8 A;  2JAC A;  4RI7 A;  1VF1 A;  4JED A;  3GSS A;  4KDY A;  2LQO A;  2GZZ A;  2C0G A;  1ACV A;  1H4O A;  4HU7 A;  1TTZ A;  4K9Z A;  4GLT A;  2L6C A;  3LYK A;  2PN8 A;  4KND A;  1YZX A;  3F6F A;  6GSV A;  4PQI A;  1MDJ A;  1ZZY A;  5ELG A;  4MH2 A;  1E2Y A;  1K3O A;  4NWY A;  1TXX A;  3WGX A;  1BQ7 A;  3HZ4 A;  3KEB A;  1GWC A;  2A2S A;  3G7I A;  1SK2 A;  1B4P A;  5CRW A;  2YOI A;  4K0G A;  1QXH A;  3QFB C;  1J0F A;  1QQ2 A;  4EXJ A;  2VCX A;  2WJU A;  5EVO A;  2L6D A;  2H19 A;  5IOX A;  3LOR A;  4ZBB A;  4O7H A;  3APS A;  1WJK A;  5H5R A;  2LJA A;  3CYN A;  3GUR A;  3C8E A;  1NHY A;  4KA0 A;  3N9J A;  3CRU A;  5IQY A;  4Q5F A;  1YF1 A;  4MF5 A;  3LXZ A;  3IR4 A;  3KP9 A;  5ENU A;  2OE0 A;  2L59 A;  4JR4 A;  1RK4 A;  1RQM A;  2LJR A;  1ABA A;  4AF2 A;  3HJM A;  2H30 A;  2YJ7 A;  2CA8 A;  1M2B A;  5E59 A;  1GSF A;  2J9H A;  5KN3 A;  1JZO A;  2P31 A;  2H75 A;  4MP4 A;  3ZRD A;  3RAZ A;  2IMK A;  3DYR A;  2B7K A;  8GSS A;  3WYW A;  2FCH A;  3EU3 A;  2GSS A;  2DIZ A;  2V32 A;  4BA7 A;  3FY7 A;  5IIZ A;  5A5K A;  2WCI A;  3IBH A;  1K0D A;  2G2Q A;  2VCT A;  4FYU A;  3EUR A;  3RHB A;  4LMW A;  3O6T A;  1XVQ A;  5IO2 A;  2MMN A;  3VWU A;  2QSI A;  2YJH A;  2JL4 A;  4RQX A;  1WRY A;  5D73 A;  4KX4 A;  1ERT A;  2QKE A;  2OE1 A;  4Q5Q A;  5E4W A;  3TKQ A;  2PMT A;  3IXR A;  1TDI A;  1XFL A;  5C04 A;  2DSA A;  3DRN A;  3MWH A;  4WBR D;  3QFA C;  3H79 A;  2RLI A;  2GSR A;  4I6X A;  3EVI A;  4PUF C;  4EKZ A;  2VCQ A;  3TKS C;  1ML6 A;  2XPD A;  4L5L A;  2FNO A;  2YZH A;  5EL8 A;  2REM A;  4JZQ A;  1FHE A;  4HUA A;  1DE1 A;  3HJO A;  2V6O A;  1PD2 1;  3ZVJ D;  10GS A;  3GFK A;  2O8V B;  1AC1 A;  5B6M A;  4N0V A;  2C0D A;  1X9W B;  5COH A;  1DBY A;  3KGK A;  4PGT A;  3VFI A;  3LSZ A;  4DSS B;  1GUK A;  2VL9 A;  4KSO A;  5CRH A;  2L5L A;  3VWX A;  1AQW A;  3C71 A;  4EVM A;  5CRE A;  3GRX A;  1TU8 A;  1CQH A;  1WIK A;  4X1U A;  4XS6 A;  2WFC A;  1A2M A;  4MCU A;  3SBC A;  3KD0 A;  3LJR A;  3ZIV A;  2WGR A;  1S3D A;  1OC9 B;  11GS A;  4GST A;  4YAV A;  2R2J A;  4MZC A;  3WD6 A;  4MF6 A;  3GKN A;  4KSM A;  4DSQ A;  4IS0 A;  2OE3 A;  2AUV A;  1I5G A;  3TJG A;  1UVZ A;  2DJ2 A;  1W4V A;  3VUR A;  4MPF A;  5ECR B;  1F2E A;  2VL2 C;  4D73 A;  3D0Z A;  1M7T A;  4OCF A;  2VOC A;  4CHS A;  5F8B A;  2GGT A;  2IWT A;  2AJQ B;  3W8S A;  2FGX A;  3ED3 A;  1GTI A;  3ZRE A;  1SL1 B;  1ZYQ B;  2GZP A;  2LST A;  3ERG A;  1XWB A;  2G0F A;  4XS4 A;  4EF0 A;  4NHW A;  4AGS A;  5GSS A;  3I43 A;  2C1Y A;  2CT6 A;  3IK7 A;  4WKW A;  2ON7 A;  4TN8 A;  5JCW A;  1GSU A;  1OYJ A;  2DC5 A;  3L9V A;  3LQ7 A;  4HQS A;  1K0O A;  4K2D A;  3TRQ A;  1YY7 A;  2IJY A;  5J3R A;  1GL8 A;  4V2N A;  2GT5 A;  3HDC A;  5DCG A;  3TKS E;  3D22 A;  3QR6 A;  4HZ2 A;  5IPH A;  1PRX A;  2DLX A;  1HYU A;  2NTO A;  3FEU A;  2AAW A;  4X0X A;  4PNG A;  3CSH A;  4RUV A;  3EWL A;  2VLU A;  3HY2 A;  1R4W A;  4F03 A;  1VGL A;  3F4T A;  2B7J A;  2A4V A;  2HFD A;  3GH6 A;  4IVF A;  2FY6 A;  1SL0 B;  1J9B A;  1EOH A;  1T8E B;  5ECM B;  4NAX A;  3P2A A;  4ZL8 A;  3ME8 A;  4ZB8 A;  2R37 A;  1USB A;  1TK8 B;  1MEK A;  4V1A g;  3W8J A;  1TU7 A;  2GZY A;  4JBB A;  2FWG A;  3FW2 A;  2H0I A;  2LNS A;  4MAB A;  2H72 A;  2P0G A;  3UIW A;  2LKU A;  3V1W A;  2PVO C;  4MJC A;  4IJ3 A;  1MDK A;  2H01 A;  4HDE A;  3QAG A;  5ECH B;  2H70 A;  4E8H A;  4V2M A;  4BWS A;  2AHE A;  3RPP A;  1TK0 B;  3GA4 A;  4ZBD A;  2DJK A;  2VM1 A;  5J9C A;  2C0E A;  4QL7 A;  1ON4 A;  3QAV A;  5G1L A;  3UJ1 A;  4MJE A;  3GKX A;  1EV9 A;  3FRC A;  4NPB A;  2V1M A;  4AJ7 A;  1F37 A;  1Z7R A;  4TR1 B;  1UA5 A;  1A8Y A;  4FH8 A;  6GSX A;  1LJR A;  1PA3 A;  3D4T A;  3FZ9 A;  1N8J A;  2H6Y A;  5D9T A;  2H6Z A;  4FYB A;  4PNF A;  4OFT A;  1B9Y C;  3IPZ A;  1PX7 A;  2MBT A;  3IC4 A;  4ZL9 A;  2O89 A;  5J5N A;  1XWK A;  2J23 A;  5L71 A;  3TRX A;  2HXK A;  1X9M B;  1K0N A;  3F3Q A;  1JLV A;  4MH3 A;  3GTU B;  2M72 A;  2H1A A;  5G1K A;  5HR1 A;  5AIX A;  3EE2 A;  1TI3 A;  5GST A;  3EYT A;  2CAQ A;  5DQS A;  1OVN A;  1EEM A;  2C3Q A;  2P5R A;  5DAL B;  3ZIJ A;  3D5J A;  4GF0 A;  3ERW A;  3GL3 A;  4LA1 A;  1XBS A;  4E8E A;  2GSQ A;  2HSY A;  2H8L A;  4OO4 A;  3HVV A;  1SD9 A;  4G2E A;  1XW6 A;  1YDK A;  4NXI A;  1EP7 A;  2CAI A;  4O92 A;  5HQP A;  3W6G A;  1GSQ A;  1T4Y A;  4WET A;  2E2G A;  2AYT A;  2ZNM A;  3F63 A;  2K9F A;  5EPF A;  4I2T A;  5J9B A;  2VL2 A;  2IMF A;  1O85 A;  3EMP A;  2DJJ A;  3IAS 2;  4LLR A;  3M8N A;  5D8I A;  2LTK A;  2OA7 A;  3DD3 A;  3C7M A;  4WR4 A;  2R4V A;  7GSS A;  2I1U A;  4JR6 A;  2C8U A;  4XHM A;  19GS A;  2LJK A;  1A0R P;  3ME7 A;  1BED A;  4NMU A;  4JU5 A;  3IK9 A;  4N10 A;  2JU5 A;  3KP8 A;  3NIV A;  3FZA A;  2ALB A;  2PGT A;  5AIV A;  4J2F A;  1PL1 A;  3DWV A;  2RM6 A;  2HT9 A;  2B5E A;  5G30 A;  4K8M A;  1GTU A;  3E9J B;  5B6N A;  4WEY A;  5ECK B;  3J7Y k;  4NHZ A;  1U3I A;  4XCS A;  2V41 A;  1FOV A;  4RQR A;  1XOA A;  2X8H A;  4XIH A;  1MD4 A;  1XIY A;  3F6D A;  4J57 E;  4XS1 A;  3EU4 A;  1YJ6 A;  4IJI A;  3TJF A;  1GUM A;  3LFL A;  1G6W A;  5ECO B;  4TKY A;  3I6A A;  4KE3 A;  3P90 A;  4FIW A;  1SK0 A;  1HNA A;  1Q4J A;  5DJM A;  3KJY A;  2CVB A;  1WP0 A;  1WMJ A;  3LGC A;  5D9W A;  4V2L A;  4ACS A;  12GS A;  5D9X A;  1K0M A;  5DJL A;  1YEX A;  4IEL A;  3A2W A;  2NPB A;  1VF4 A;  2HZE B;  1AXD A;  1R26 A;  4HOJ A;  5DAK A;  3FR6 A;  1XPV A;  3CMI A;  3F0I A;  1KNG A;  2N5B A;  4KDU A;  2ZUP A;  1EP8 A;  1A2L A;  4FYC A;  1X5D A;  2GTU A;  1AW9 A;  4J56 E;  1Z3E A;  4WBJ A;  3GKM A;  3L0H A;  1ZOF A;  4MMM A;  4XRD A;  2C3N A;  1X0R A;  4YAP A;  3UVT A;  5G5E A;  1Y25 A;  3A5W A;  1AAZ A;  1PQN A;  1ZYE A;  3APO A;  3KTB A;  2LV3 A;  1GP1 A;  3I9V 2;  5CO3 A;  1TKD B;  5IM9 A;  3IOS A;  3GIX A;  3KCM A;  4GTU A;  2IFQ A;  2R6K A;  3EIN A;  4JE1 A;  4P3Y B;  5LCZ A;  4NV5 A;  2BJX A;  3HYP A;  1M9B A;  2FUG 2;  2LEG A;  4OO5 A;  5G5F A;  1XOB A;  3TRP A;  1GSD A;  2KLX A;  2E7P A;  4L0W A;  2EIR A;  1UC7 A;  5ELA A;  2IL3 A;  4OFM A;  4I97 A;  3CTF A;  3FK8 A;  2H1D A;  3M1G A;  1M0U A;  1PGT A;  4JRR A;  2B3S A;  3IRA A;  1O73 A;  4IGJ A;  2RM5 A;  3UAR A;  3KIJ A;  2V6K A;  3TKP A;  2JSZ A;  4GSS A;  3MSZ A;  2KOK A;  4CDO A;  4N11 A;  1SK1 A;  3FZ4 A;  4F9Z A;  3LWA A;  3QAW A;  4GRF A;  3G9B A;  2IMI A;  3QCP A;  2I4A A;  5G2Z A;  4V1A p;  2H66 A;  2EC4 A;  1SU9 A;  2RII A;  5C00 A;  4Z7X A;  2VD1 A;  1EEJ A;  4IP1 A;  4YQV A;  2QGV A;  2YNX A;  2FLS A;  3GX8 A;  4PXO A;  2LUS A;  4ULX A;  3VWW A;  1NW2 A;  4EL1 A;  1MDI A;  4GWR A;  3EMX A;  2L4C A;  1UN2 A;  1ZGN A;  4MK3 A;  1AIU A;  3RDW A;  4O32 A;  1M2A A;  4ZIJ A;  4MZW A;  2HSH A;  3GMF A;  1KBN A;  3Q19 A;  3M3M A;  2MYG A;  1NSW A;  4EDZ A;  1XVW A;  1FB0 A;  3UL3 A;  2MMO A;  2RUF A;  2OBK A;  2LQQ A;  3PGT A;  3QOU A;  5D9V A;  3TKR A;  2H71 A;  2EIQ A;  1BX9 A;  3M9J A;  3GYK A;  3DEX A;  1FAA A;  1H75 A;  2GVP A;  4OWY A;  1XWA A;  5IMC A;  1GSE A;  3M0F A;  4TR4 A;  5F05 A;  3FR9 A;  1ILO A;  1A24 A;  2YPM A;  1GSS A;  1LU4 A;  2OJL A;  3TOT A;  3DVX A;  3HD5 A;  4K6X A;  5CYY A;  4HS1 A;  5FT3 A;  4KUN A;  5IMV A;  3A3T A;  4ZXG A;  1U88 A;  5JCG A;  1W89 A;  3US3 A;  5IPG A;  1G6Y A;  3FYG A;  2HLS A;  4MDC A;  1T1V A;  4PUA A;  4KH7 A;  3KXO A;  1WOU A;  1K0C A;  1EGR A;  4GQC A;  2F9S A;  3P8W A;  4MJA A;  1V98 A;  2CVK A;  3TJB A;  2NDO A;  1PX6 A;  4Q5N A;  2YV7 A;  3WGD A;  4DSR A;  1A0F A;  1T3B A;  2FD3 A;  3ZFB A;  2H1G A;  3BCI A;  1M9A A;  2JAD A;  2YN1 A;  1F3A A;  2VD0 A;  3WT2 A;  3ZZX A;  4TOP A;  3UBL A;  1K3Y A;  2YZU A;  2L57 A;  5HFG A;  3ZML A;  1BG5 A;  1HQO A;  18GS A;  2GQK A;  4DEJ A;  2PWJ A;  3FZ5 A;  5CNW A;  5LD0 A;  4I5Q A;  1K0A A;  3FR3 A;  2WZ9 A;  1AQX A;  4N0Z A;  3GX0 A;  4HEA 2;  4PQ1 A;  4N30 A;  3UMA A;  5D93 A;  2B1K A;  5D96 A;  3CSJ A;  4OFN A;  2PU9 C;  1AUC A;  5HR2 A;  4CW9 A;  2VM2 A;  2PVQ A;  4WR5 A;  5IMA A;  5GAP D;  17GS A;  3TDG A;  3WGE A;  4ECJ A;  5J4U A;  4K7N A;  2MZC A;  2CVD A;  2XBI A;  2AV4 A;  4KW6 A;  2YV9 A;  3CTG A;  3TJK A;  1O8X A;  2YAN A;  5FWG A;  2B5Y A;  3GST A;  3ZYW A;  1TW9 A;  3HJP A;  1OKD A;  3PR8 A;  1O81 A;  2JZT A;  2KUC A;  1FW1 A;  3HXS A;  2ON5 A;  1U3A A;  3GN3 A;  3GV1 A;  1X5E A;  4TR0 A;  1SKR B;  2JZR A;  4YQM A;  4MA9 A;  3ISO A;  1FVK A;  2XC2 A;  1SJI A;  3QMX A;  4HZ4 A;  2PBJ A;  5DVB A;  1EOG A;  3TCO A;  3ZFL A;  1MD3 A;  2H6X A;  3JCM L;  1FB6 A;  2X64 A;  1TP9 A;  1O8W A;  3TJJ A;  22GS A;  3TKS A;  3PH9 A;  1URM A;  1JZW A;  4POM A;  1DSB A;  5GAN D;  3HA9 A;  4PUR A;  1XZO A;  2D2Z A;  1PKZ A;  5JWO B;  2OKA A;  2IME A;  1QUW A;  2ZCT A;  4IQ1 A;  2TRX A;  1PN9 A;  5CRD A;  1X5C A;  3K8N A;  5F07 A;  2FWF A;  3TB2 A;  3F4R A;  2R5G A;  4POB A;  3UOM A;  2CZ3 A;  13GS A;  4K7O A;  1C72 A;  4QQ7 A;  3L78 A;  4ZB9 A;  1WWJ A;  3QPM A;  4GQF A;  3I69 A;  2DJ0 A;  3ERF A;  1THO A;  3CSI A;  2PPT A;  1FO5 A;  2N5F A;  2WB9 A;  1Z5Y E;  3Q74 A;  2LRT A;  4O5R A;  1TRS A;  5IMF A;  1THX A;  6GSW A;  4D73 B;  1GH2 A;  2B5X A;  5A4U A;  3AY8 A;  4BL7 A;  1EZK A;  1SL2 B;  2DJ3 A;  1T00 A;  1GLQ A;  2IPA A;  5CAX A;  1JHB A;  4BVX A;  2DIY A;  3D21 A;  2VO4 A;  3BD2 A;  1ERU A;  4I8B A;  1WE0 A;  3Q6O A;  3HCZ A;  4G19 A;  3IE3 A;  4XS4 B; 
#chains in the Genus database with same CATH topology
 3TUE A;  3RPN A;  1PSQ A;  2LNT A;  3H8Q A;  4EUY A;  4BPY A;  2LS5 A;  1V9W A;  4DSS A;  4MLY A;  4TXO B;  3M9K A;  1Z6N A;  5KN1 A;  3APQ A;  4PQH A;  4GXZ A;  2YCD A;  1NHO A;  3EPT A;  3L4N A;  3U5R E;  1ST9 A;  4BVY A;  1EGO A;  2OAC A;  1OC9 A;  1S3C A;  5CRG A;  1TJD A;  1Y6E A;  2R0G A;  2WRT A;  1XXU A;  1SJZ A;  2JSY A;  1GUH A;  2HRF A;  4F82 A;  3ZL5 A;  1JLW A;  4MZB A;  3HKR A;  4O5Q A;  1ZL9 A;  3A2V A;  3F9U A;  5ECN B;  2WUL A;  1X9S B;  2KP1 A;  3O3T A;  4X43 A;  4ZB6 A;  1JZR A;  3OR5 A;  2YWM A;  5KN2 A;  5KOX A;  1GUL A;  2GT6 A;  1XW9 A;  2O85 A;  1YKA A;  3UAP A;  2YWI A;  2AB6 A;  1O7U A;  3BJ5 A;  5DDL A;  2IIY A;  4KCE A;  2FA4 A;  1A8L A;  3ZMK A;  5HFI A;  2HSM A;  4K5S A;  1WPI A;  3HHV A;  1SYX A;  3SWL A;  2C4J A;  3F8U A;  4Q5R A;  2I3Y A;  3QD9 A;  1YEP A;  3IAM 2;  4ZL7 A;  4O5U A;  2Z9S A;  4H86 A;  1F9M A;  3IHQ A;  3VI7 A;  5LNK e;  2CX4 A;  4XRA A;  3PIN A;  5F0G A;  5JCU A;  1G7E A;  1OAZ A;  2H76 A;  3D6I A;  2GQL A;  1V40 A;  3KH7 A;  3J7Y b;  2HRK A;  4K1F A;  4WF5 A;  2DBC A;  3HVS A;  1ERW A;  5H5S A;  3GUS A;  2KHP A;  3TOU A;  2CZ2 A;  1CQG A;  2HZF A;  3KZQ A;  2K6V A;  3C73 A;  2F51 A;  2VLT A;  2XPE A;  1ZCP A;  5HR3 A;  4TVE A;  4YKF A;  1YQ1 A;  4LL4 B;  3O76 A;  1TRU A;  1XWG A;  4ECC A;  1TRW A;  2YP6 A;  2EIO A;  1GTA A;  5IMZ A;  3TGZ A;  5ID2 B;  2XBQ A;  2O87 A;  1PKW A;  1OC3 A;  1SEN A;  4RI6 A;  3MDK A;  2GDR A;  2ES7 A;  3CXG A;  1JFU A;  1FG4 A;  3R2Q A;  2IN3 A;  6GSS A;  1XWC A;  4GSN A;  2A2R A;  3LEF A;  1SJ6 A;  3KH9 A;  1F3B A;  3IV4 A;  4KDX A;  4BWQ A;  4POL A;  1G7O A;  2B6M A;  3EC3 A;  2GLR A;  3VI5 A;  5J41 A;  1IYH A;  1M99 A;  2HE3 A;  2X8C A;  6GSY A;  1Q98 A;  2HNL A;  16GS A;  1GLP A;  1VRS D;  3KM6 A;  4ML1 A;  4HJ2 A;  1TK5 B;  4TR1 A;  4ISD A;  3LG6 A;  1TOF A;  3FKF A;  2M80 A;  1BAY A;  4HI7 A;  4NV2 A;  4IHU A;  1NM3 A;  5IMD A;  1GNE A;  4TXV A;  1VF2 A;  5HFK A;  5AGY A;  1R7H A;  1O6J A;  2C80 A;  2RUE A;  1QFN A;  2BTO T;  1K3L A;  2B1L A;  1TI1 A;  1B48 A;  5F06 A;  4TRX A;  4IN0 A;  3GTU A;  2XHF A;  4F0C A;  5AN1 A;  3VK9 A;  4F2I A;  9GSS A;  5HR0 A;  3G7J A;  1GSY A;  1SKW B;  3MNG A;  5B7C A;  4KCA A;  3C1S A;  2L5O A;  3VLN A;  4Z2T A;  4FO5 A;  1AQV A;  3E0U A;  3GHA A;  5DAL A;  5EY6 A;  3KTL A;  4IKH A;  2DKI A;  1A23 A;  2N5A A;  1B9X C;  4LMV A;  2F3M A;  3CQF A;  2WDU A;  1OE8 A;  2H74 A;  4IBP A;  1I9D A;  2L4Q A;  2F8A A;  1T7P B;  1J08 A;  1PMT A;  2GST A;  2H73 A;  4POK A;  2VCZ A;  3ZTL A;  5DQY A;  2X4A A;  2TIR A;  2VLV A;  3N5O A;  2JZS A;  1SYR A;  5B8A A;  5ECS A;  4MNN A;  2O7K A;  1KEB A;  1GTB A;  3UBK A;  3UEM A;  4IW9 A;  2PUK C;  4ID0 A;  5DCH A;  1MTC A;  2K18 A;  2FWH A;  4L0U A;  4ICY A;  4LL1 B;  3GNJ A;  5FHI A;  3MIX A;  3VPQ A;  2K8V A;  2E0Q A;  2FA8 A;  4HJM A;  1U6T A;  2CQ9 A;  3VWV A;  4TXO A;  1B8X A;  2VIM A;  5DAK B;  1QMV A;  4CY6 A;  3RHC A;  2YWN A;  2P5Q A;  1XCC A;  2OBI A;  2F8F A;  5AIS A;  1OE7 A;  3BCK A;  2H0G A;  3BOA A;  2TRC P;  2A2P A;  1YKC A;  2PER A;  3DML A;  2H0H A;  3NOF A;  4AJ8 A;  1DUG A;  3G7Y A;  3KMN A;  1GNW A;  4TR3 A;  3GL5 A;  1TRV A;  5CP1 A;  2QA1 A;  3H93 A;  1U87 A;  2I9H A;  1EWX A;  1Z6M A;  3CRT A;  3S9F A;  3ZIT A;  4ZIL A;  2IMD A;  5JWR B;  4TW5 A;  3E3E A;  2X8G A;  3A5I A;  3WT1 A;  3DGQ A;  3P7X A;  3ZLP A;  4OMV A;  5ECI B;  3L9U A;  4ECI A;  4L5O A;  3VPT A;  1R5P A;  3UVH A;  2HI7 A;  2IFQ B;  4Z2R A;  2BMX A;  2LRC A;  3IA1 A;  1ZYN A;  3NZN A;  2HYX A;  2LRN A;  4F0B A;  1BJX A;  4EIQ A;  2C0F A;  1IYI A;  5KN0 A;  1ZMA A;  5DBQ A;  1G0T A;  3DKS A;  1V57 A;  14GS A;  3MAK A;  2FWE A;  2HZE A;  4K7I A;  4L8E A;  2VUP A;  2VCW A;  1DE2 A;  5GZZ B;  2KP2 A;  5IOW A;  20GS A;  5B8B A;  4DVC A;  4XTS A;  2VL3 A;  3F4S A;  1ERV A;  1RW1 A;  3GH9 A;  4I2U A;  4OD7 A;  1QGV A;  4IQA A;  2VAF A;  4EE0 A;  1FVJ A;  1Z9H A;  4G10 A;  2MMZ A;  4KB3 A;  1SKS B;  2DML A;  1E6B A;  3H4K A;  5H5Q A;  1HNB A;  2OAD A;  3KMO A;  4QL9 A;  1YF0 A;  2DJ1 A;  5INY A;  5IO0 A;  4MPG A;  1OKT A;  2CV4 A;  2FHE A;  2WS2 A;  2H1B A;  1T4Z A;  5ECP B;  3GKK A;  2VCV A;  1KTE A;  4KGI A;  2E2M A;  4PX1 A;  1EV4 A;  3IDV A;  3DXB A;  4YH2 A;  2DMM A;  3LXT A;  5ABR A;  2QC7 A;  4WF4 A;  4EC0 A;  1VF3 A;  3RBT A;  5ID2 A;  3HVX A;  1A2J A;  2NVL A;  4WXT A;  2MBS A;  1R5A A;  4AJ6 A;  4MJB A;  3HZ8 A;  3FHK A;  4KAE A;  4MF7 A;  1S3A A;  4G9H A;  1OC8 A;  1V58 A;  2NBS A;  4ZBA A;  6GSU A;  2CX3 A;  4G0K A;  1SD8 A;  4KF9 A;  3A2X A;  2K8S A;  1K0B A;  4ML6 A;  2HRA A;  2C3T A;  3U6V A;  1BYE A;  1LBK A;  1GRX A;  1PL2 A;  4ILF A;  1B4Q A;  5KEJ A;  4G0I A;  5A4W A;  3HVN A;  1XW5 A;  3QDN A;  1HD2 A;  1Z7P A;  4IP6 A;  3LYP A;  1V2A A;  3L9S A;  4EDY A;  3DIE A;  5JWQ B;  3DVW A;  5A4V A;  3ZVJ A;  1M2D A;  2M46 A;  5ECQ B;  2I81 A;  5G31 A;  3Q18 A;  2GQM A;  4OCE A;  4EO3 A;  4K0N A;  3CBU A;  1JZD A;  3H1N A;  1N2A A;  4YQU A;  2HRN A;  4ECB A;  5ECL B;  6GST A;  1F6M C;  3F3R A;  4GCI A;  2R3X A;  2V2G A;  2GS3 A;  2X99 A;  3D4M A;  2YWO A;  4HQZ A;  4HU9 A;  1HNC A;  2MMA A;  3BBY A;  3C1R A;  1QK8 A;  2JAC A;  4RI7 A;  1VF1 A;  4JED A;  3GSS A;  4KDY A;  2LQO A;  2GZZ A;  2C0G A;  1ACV A;  1H4O A;  4HU7 A;  1TTZ A;  4K9Z A;  4GLT A;  2L6C A;  3LYK A;  2PN8 A;  4KND A;  1YZX A;  3F6F A;  6GSV A;  4PQI A;  1MDJ A;  1ZZY A;  5ELG A;  4MH2 A;  1E2Y A;  1K3O A;  4NWY A;  1TXX A;  3WGX A;  1BQ7 A;  3HZ4 A;  3KEB A;  1GWC A;  2A2S A;  3G7I A;  1SK2 A;  1B4P A;  5CRW A;  2YOI A;  4K0G A;  1QXH A;  3QFB C;  1J0F A;  1QQ2 A;  4EXJ A;  2VCX A;  2WJU A;  5EVO A;  2L6D A;  2H19 A;  5IOX A;  3LOR A;  4ZBB A;  4O7H A;  3APS A;  1WJK A;  5H5R A;  2LJA A;  3CYN A;  3GUR A;  3C8E A;  1NHY A;  4KA0 A;  3N9J A;  3CRU A;  5IQY A;  4Q5F A;  1YF1 A;  4MF5 A;  3LXZ A;  3IR4 A;  3KP9 A;  5ENU A;  2OE0 A;  2L59 A;  4JR4 A;  1RK4 A;  1RQM A;  2LJR A;  1ABA A;  4AF2 A;  3HJM A;  2H30 A;  2YJ7 A;  2CA8 A;  1M2B A;  5E59 A;  1GSF A;  2J9H A;  5KN3 A;  1JZO A;  2P31 A;  2H75 A;  4MP4 A;  3ZRD A;  3RAZ A;  2IMK A;  3DYR A;  2B7K A;  8GSS A;  3WYW A;  2FCH A;  3EU3 A;  2GSS A;  2DIZ A;  2V32 A;  4BA7 A;  3FY7 A;  5IIZ A;  5A5K A;  2WCI A;  3IBH A;  1K0D A;  2G2Q A;  2VCT A;  4FYU A;  3EUR A;  3RHB A;  4LMW A;  3O6T A;  2A4H A;  1XVQ A;  5IO2 A;  2MMN A;  3VWU A;  2QSI A;  2YJH A;  2JL4 A;  4RQX A;  1WRY A;  5D73 A;  4KX4 A;  1ERT A;  2QKE A;  2OE1 A;  4Q5Q A;  5E4W A;  3TKQ A;  2PMT A;  3IXR A;  1TDI A;  1XFL A;  5C04 A;  2DSA A;  3DRN A;  3MWH A;  4WBR D;  3QFA C;  3H79 A;  2RLI A;  4BL7 B;  2GSR A;  4I6X A;  3EVI A;  4PUF C;  4EKZ A;  2VCQ A;  3TKS C;  1ML6 A;  2XPD A;  4L5L A;  4BVX B;  2FNO A;  2YZH A;  5EL8 A;  2REM A;  4JZQ A;  1FHE A;  4HUA A;  1DE1 A;  3HJO A;  2V6O A;  1PD2 1;  3ZVJ D;  10GS A;  3GFK A;  1PN0 A;  2O8V B;  1AC1 A;  5B6M A;  4N0V A;  2C0D A;  1X9W B;  5COH A;  1DBY A;  3KGK A;  4PGT A;  3VFI A;  3LSZ A;  4DSS B;  1GUK A;  2VL9 A;  4KSO A;  4A5P A;  5CRH A;  2L5L A;  3VWX A;  1AQW A;  3C71 A;  4EVM A;  5CRE A;  3GRX A;  1TU8 A;  1CQH A;  1WIK A;  4X1U A;  4XS6 A;  2WFC A;  1A2M A;  4MCU A;  3SBC A;  4BVY B;  3KD0 A;  3LJR A;  3ZIV A;  2WGR A;  1S3D A;  1OC9 B;  11GS A;  4GST A;  4YAV A;  2R2J A;  4MZC A;  3WD6 A;  4MF6 A;  3GKN A;  4KSM A;  1S3R A;  4DSQ A;  4IS0 A;  2OE3 A;  2AUV A;  1I5G A;  3TJG A;  1UVZ A;  2DJ2 A;  1W4V A;  3VUR A;  4MPF A;  5ECR B;  1F2E A;  2VL2 C;  4D73 A;  3D0Z A;  1M7T A;  4OCF A;  2VOC A;  4CHS A;  5F8B A;  2GGT A;  2IWT A;  2AJQ B;  3W8S A;  2FGX A;  3ED3 A;  1GTI A;  3ZRE A;  1SL1 B;  1ZYQ B;  2GZP A;  2LST A;  3ERG A;  1XWB A;  2G0F A;  4XS4 A;  4EF0 A;  4NHW A;  4AGS A;  5GSS A;  3I43 A;  2C1Y A;  2CT6 A;  3IK7 A;  1XG8 A;  4WKW A;  2ON7 A;  4TN8 A;  5JCW A;  1GSU A;  1OYJ A;  2DC5 A;  3L9V A;  3LQ7 A;  4HQS A;  4K5R A;  1K0O A;  4K2D A;  3TRQ A;  1YY7 A;  2IJY A;  5J3R A;  1GL8 A;  4V2N A;  2GT5 A;  3HDC A;  5DCG A;  3TKS E;  3D22 A;  3QR6 A;  4HZ2 A;  5IPH A;  1PRX A;  2DLX A;  1HYU A;  2NTO A;  3FEU A;  2AAW A;  4X0X A;  4PNG A;  3CSH A;  4RUV A;  3EWL A;  2VLU A;  3HY2 A;  1R4W A;  4F03 A;  1VGL A;  3F4T A;  2B7J A;  2A4V A;  2HFD A;  3GH6 A;  4IVF A;  2FY6 A;  1SL0 B;  1J9B A;  1EOH A;  1T8E B;  5ECM B;  4NAX A;  3P2A A;  4ZL8 A;  3ME8 A;  4ZB8 A;  2R37 A;  1USB A;  1TK8 B;  1MEK A;  4V1A g;  3W8J A;  1TU7 A;  2GZY A;  4JBB A;  2FWG A;  3FW2 A;  2H0I A;  2LNS A;  4MAB A;  2H72 A;  2P0G A;  3UIW A;  2LKU A;  3V1W A;  2PVO C;  4MJC A;  4IJ3 A;  1MDK A;  2H01 A;  4HDE A;  3QAG A;  5ECH B;  2H70 A;  4E8H A;  4V2M A;  4BWS A;  2AHE A;  3RPP A;  1TK0 B;  3GA4 A;  4ZBD A;  2DJK A;  2VM1 A;  5J9C A;  1M3I A;  2C0E A;  4QL7 A;  1ON4 A;  3QAV A;  5G1L A;  3UJ1 A;  4MJE A;  3GKX A;  1EV9 A;  3FRC A;  4NPB A;  2V1M A;  4AJ7 A;  1F37 A;  1Z7R A;  4TR1 B;  1UA5 A;  1A8Y A;  4FH8 A;  6GSX A;  1LJR A;  1PA3 A;  3D4T A;  3FZ9 A;  1N8J A;  2H6Y A;  5D9T A;  2H6Z A;  4FYB A;  4PNF A;  4OFT A;  1B9Y C;  3IPZ A;  1PX7 A;  2MBT A;  3IC4 A;  4ZL9 A;  2O89 A;  5J5N A;  1XWK A;  2J23 A;  5L71 A;  3TRX A;  2HXK A;  1X9M B;  1K0N A;  3F3Q A;  1JLV A;  4MH3 A;  3GTU B;  5BRT A;  2M72 A;  2H1A A;  4EIP A;  5G1K A;  5HR1 A;  5AIX A;  3EE2 A;  1TI3 A;  5GST A;  3EYT A;  2CAQ A;  5DQS A;  1OVN A;  1EEM A;  2C3Q A;  2P5R A;  5DAL B;  3ZIJ A;  3D5J A;  4GF0 A;  3ERW A;  3GL3 A;  4LA1 A;  1XBS A;  4E8E A;  2GSQ A;  2HSY A;  2H8L A;  4OO4 A;  2UZ8 A;  3HVV A;  1SD9 A;  4G2E A;  1XW6 A;  1YDK A;  4NXI A;  1EP7 A;  2CAI A;  4O92 A;  5HQP A;  3W6G A;  1GSQ A;  1T4Y A;  4WET A;  2E2G A;  2AYT A;  2ZNM A;  3F63 A;  2K9F A;  5EPF A;  4I2T A;  5J9B A;  2VL2 A;  2IMF A;  1O85 A;  3EMP A;  2DJJ A;  3IAS 2;  4LLR A;  3M8N A;  5D8I A;  2LTK A;  2OA7 A;  3DD3 A;  3C7M A;  4WR4 A;  2R4V A;  7GSS A;  2I1U A;  4JR6 A;  2C8U A;  4XHM A;  19GS A;  2LJK A;  1A0R P;  3ME7 A;  1BED A;  4NMU A;  4JU5 A;  3IK9 A;  4N10 A;  2JU5 A;  3KP8 A;  3NIV A;  3FZA A;  2ALB A;  2PGT A;  5AIV A;  4J2F A;  1PL1 A;  3DWV A;  2RM6 A;  2HT9 A;  2B5E A;  5G30 A;  4K8M A;  1GTU A;  4Z2U A;  3E9J B;  5B6N A;  4WEY A;  5ECK B;  4CY8 A;  3J7Y k;  4NHZ A;  1U3I A;  4XCS A;  2V41 A;  1FOV A;  4BIK A;  4RQR A;  1XOA A;  2X49 A;  2X8H A;  4XIH A;  1MD4 A;  1XIY A;  3F6D A;  4J57 E;  4XS1 A;  3EU4 A;  1YJ6 A;  4IJI A;  3TJF A;  1GUM A;  3LFL A;  1G6W A;  5ECO B;  4TKY A;  3I6A A;  4KE3 A;  3P90 A;  4FIW A;  1SK0 A;  1HNA A;  1M3J A;  1Q4J A;  5DJM A;  3KJY A;  2CVB A;  1WP0 A;  1WMJ A;  3LGC A;  5D9W A;  4V2L A;  4ACS A;  5KOW A;  12GS A;  5D9X A;  1K0M A;  5DJL A;  1YEX A;  4IEL A;  3A2W A;  2NPB A;  1VF4 A;  2HZE B;  1AXD A;  1R26 A;  4HOJ A;  5DAK A;  3FR6 A;  1XPV A;  3CMI A;  3F0I A;  1KNG A;  2N5B A;  4KDU A;  2ZUP A;  1EP8 A;  3IC8 A;  1A2L A;  4FYC A;  1X5D A;  2GTU A;  1AW9 A;  4J56 E;  1Z3E A;  4WBJ A;  3GKM A;  3L0H A;  1ZOF A;  4FQU A;  4MMM A;  4XRD A;  2C3N A;  1X0R A;  4YAP A;  3UVT A;  5G5E A;  1Y25 A;  3A5W A;  1AAZ A;  1PQN A;  1ZYE A;  3APO A;  3KTB A;  2LV3 A;  1GP1 A;  3I9V 2;  5CO3 A;  4X4J A;  1TKD B;  5IM9 A;  3IOS A;  3GIX A;  3KCM A;  4GTU A;  2IFQ A;  2R6K A;  3EIN A;  4JE1 A;  4P3Y B;  5LCZ A;  4NV5 A;  2BJX A;  3HYP A;  1M9B A;  2FUG 2;  2LEG A;  4OO5 A;  5G5F A;  1XOB A;  3TRP A;  1GSD A;  2KLX A;  2E7P A;  4L0W A;  2EIR A;  1UC7 A;  1FOH A;  4YKG A;  5ELA A;  2IL3 A;  4OFM A;  4I97 A;  3CTF A;  3FK8 A;  2H1D A;  3M1G A;  1M0U A;  1PGT A;  4JRR A;  2B3S A;  3IRA A;  1O73 A;  4IGJ A;  2RM5 A;  3UAR A;  3KIJ A;  2V6K A;  3TKP A;  2JSZ A;  4GSS A;  3MSZ A;  3MYD A;  2KOK A;  4CDO A;  4N11 A;  1SK1 A;  3FZ4 A;  4F9Z A;  3LWA A;  3QAW A;  4GRF A;  3G9B A;  2IMI A;  3QCP A;  2I4A A;  5G2Z A;  4V1A p;  2H66 A;  2EC4 A;  1SU9 A;  2RII A;  2R0C A;  5C00 A;  4Z7X A;  2VD1 A;  1EEJ A;  4IP1 A;  3PPU A;  4YQV A;  2QGV A;  2YNX A;  2FLS A;  3GX8 A;  4PXO A;  2LUS A;  4ULX A;  3VWW A;  1NW2 A;  4EL1 A;  1MDI A;  4GWR A;  4G0L A;  3EMX A;  2L4C A;  1UN2 A;  1ZGN A;  4MK3 A;  1AIU A;  3RDW A;  4O32 A;  1M2A A;  4ZIJ A;  4MZW A;  2HSH A;  3GMF A;  1KBN A;  3Q19 A;  3M3M A;  2MYG A;  1NSW A;  4EDZ A;  1XVW A;  1FB0 A;  3UL3 A;  2MMO A;  2RUF A;  2OBK A;  2LQQ A;  3PGT A;  3QOU A;  5D9V A;  3TKR A;  2H71 A;  2EIQ A;  1BX9 A;  3M9J A;  3GYK A;  3DEX A;  1FAA A;  1H75 A;  2GVP A;  4OWY A;  1XWA A;  2DKH A;  1PFO A;  5IMC A;  1GSE A;  3M0F A;  4TR4 A;  4K2X A;  5F05 A;  3FR9 A;  1ILO A;  1A24 A;  2YPM A;  1GSS A;  1LU4 A;  2OJL A;  3TOT A;  3DVX A;  3HD5 A;  4K6X A;  5CYY A;  4HS1 A;  5FT3 A;  4KUN A;  5IMV A;  3A3T A;  4ZXG A;  1U88 A;  5JCG A;  1W89 A;  3US3 A;  5IPG A;  1G6Y A;  3FYG A;  2HLS A;  4MDC A;  1T1V A;  4PUA A;  4KH7 A;  3KXO A;  1WOU A;  1K0C A;  1EGR A;  4GQC A;  2F9S A;  3P8W A;  4MJA A;  1V98 A;  2CVK A;  3TJB A;  2NDO A;  1PX6 A;  4Q5N A;  2YV7 A;  3WGD A;  4DSR A;  1A0F A;  1T3B A;  2FD3 A;  3ZFB A;  2H1G A;  3BCI A;  1M9A A;  2JAD A;  2YN1 A;  1F3A A;  2VD0 A;  3WT2 A;  3ZZX A;  4TOP A;  3UBL A;  1K3Y A;  2YZU A;  2L57 A;  5HFG A;  3ZML A;  1BG5 A;  1HQO A;  18GS A;  2GQK A;  4DEJ A;  2PWJ A;  3FZ5 A;  5CNW A;  4PTS A;  5LD0 A;  4I5Q A;  1K0A A;  3FMW A;  3FR3 A;  2WZ9 A;  1AQX A;  4N0Z A;  3GX0 A;  4HEA 2;  4PQ1 A;  4N30 A;  3UMA A;  5D93 A;  2B1K A;  5D96 A;  4USS A;  3CSJ A;  4OFN A;  2PU9 C;  1AUC A;  5HR2 A;  4CW9 A;  2VM2 A;  2PVQ A;  4WR5 A;  5IMA A;  5GAP D;  17GS A;  3TDG A;  3WGE A;  4ECJ A;  5J4U A;  4K7N A;  2MZC A;  2CVD A;  2XBI A;  2AV4 A;  4KW6 A;  2YV9 A;  3CTG A;  3TJK A;  1O8X A;  2YAN A;  5FWG A;  2B5Y A;  3GST A;  2QA2 A;  3ZYW A;  1TW9 A;  3HJP A;  1OKD A;  3PR8 A;  1ZYP A;  1O81 A;  2JZT A;  2KUC A;  1FW1 A;  3HXS A;  2ON5 A;  1U3A A;  3GN3 A;  3GV1 A;  1X5E A;  4TR0 A;  1SKR B;  2JZR A;  4YQM A;  4MA9 A;  3ISO A;  1FVK A;  2XC2 A;  1SJI A;  3QMX A;  4HZ4 A;  2PBJ A;  5DVB A;  1EOG A;  3TCO A;  3ZFL A;  1MD3 A;  2H6X A;  3JCM L;  1FB6 A;  2X64 A;  1TP9 A;  1O8W A;  3TJJ A;  22GS A;  3TKS A;  3PH9 A;  1URM A;  1JZW A;  4POM A;  1DSB A;  5GAN D;  3HA9 A;  4PUR A;  1XZO A;  2D2Z A;  5BMU A;  1PKZ A;  5JWO B;  2OKA A;  2IME A;  1QUW A;  2ZCT A;  4IQ1 A;  2TRX A;  1PN9 A;  5CRD A;  4HSC X;  1X5C A;  3K8N A;  3R3E A;  5F07 A;  2FWF A;  3TB2 A;  3F4R A;  2R5G A;  4POB A;  3UOM A;  2CZ3 A;  13GS A;  3IHG A;  4K7O A;  1C72 A;  4QQ7 A;  3L78 A;  4ZB9 A;  1WWJ A;  3QPM A;  4GQF A;  3I69 A;  2DJ0 A;  3ERF A;  1THO A;  3CSI A;  2PPT A;  1FO5 A;  2N5F A;  2WB9 A;  1Z5Y E;  3Q74 A;  2LRT A;  4O5R A;  1TRS A;  5IMF A;  1THX A;  6GSW A;  4D73 B;  1GH2 A;  2B5X A;  2R0P A;  5A4U A;  3AY8 A;  4BL7 A;  1EZK A;  1SL2 B;  2DJ3 A;  1T00 A;  3LW9 A;  1GLQ A;  2IPA A;  5CAX A;  1JHB A;  4BVX A;  2DIY A;  3D21 A;  2VO4 A;  3BD2 A;  1ERU A;  4I8B A;  1WE0 A;  3Q6O A;  3HCZ A;  4G19 A;  3IE3 A;  4XS4 B; 
#chains in the Genus database with same CATH homology
 3TUE A;  3RPN A;  1PSQ A;  2LNT A;  3H8Q A;  4EUY A;  4BPY A;  2LS5 A;  1V9W A;  4DSS A;  4MLY A;  4TXO B;  3M9K A;  1Z6N A;  5KN1 A;  3APQ A;  4PQH A;  4GXZ A;  2YCD A;  1NHO A;  3EPT A;  3L4N A;  3U5R E;  1ST9 A;  4BVY A;  1EGO A;  2OAC A;  1OC9 A;  1S3C A;  5CRG A;  1TJD A;  1Y6E A;  2R0G A;  2WRT A;  1XXU A;  1SJZ A;  2JSY A;  1GUH A;  2HRF A;  4F82 A;  3ZL5 A;  1JLW A;  4MZB A;  3HKR A;  4O5Q A;  1ZL9 A;  3A2V A;  3F9U A;  5ECN B;  2WUL A;  1X9S B;  2KP1 A;  3O3T A;  4X43 A;  4ZB6 A;  1JZR A;  3OR5 A;  2YWM A;  5KN2 A;  5KOX A;  1GUL A;  2GT6 A;  1XW9 A;  2O85 A;  1YKA A;  3UAP A;  2YWI A;  2AB6 A;  1O7U A;  3BJ5 A;  5DDL A;  2IIY A;  4KCE A;  2FA4 A;  1A8L A;  3ZMK A;  5HFI A;  2HSM A;  4K5S A;  1WPI A;  3HHV A;  1SYX A;  3SWL A;  2C4J A;  3F8U A;  4Q5R A;  2I3Y A;  3QD9 A;  1YEP A;  3IAM 2;  4ZL7 A;  4O5U A;  2Z9S A;  4H86 A;  1F9M A;  3IHQ A;  3VI7 A;  5LNK e;  2CX4 A;  4XRA A;  3PIN A;  5F0G A;  5JCU A;  1G7E A;  1OAZ A;  2H76 A;  3D6I A;  2GQL A;  1V40 A;  3KH7 A;  3J7Y b;  2HRK A;  4K1F A;  4WF5 A;  2DBC A;  3HVS A;  1ERW A;  5H5S A;  3GUS A;  2KHP A;  3TOU A;  2CZ2 A;  1CQG A;  2HZF A;  3KZQ A;  2K6V A;  3C73 A;  2F51 A;  2VLT A;  2XPE A;  1ZCP A;  5HR3 A;  4TVE A;  4YKF A;  1YQ1 A;  4LL4 B;  3O76 A;  1TRU A;  1XWG A;  4ECC A;  1TRW A;  2YP6 A;  2EIO A;  1GTA A;  5IMZ A;  3TGZ A;  5ID2 B;  2XBQ A;  2O87 A;  1PKW A;  1OC3 A;  1SEN A;  4RI6 A;  3MDK A;  2GDR A;  2ES7 A;  3CXG A;  1JFU A;  1FG4 A;  3R2Q A;  2IN3 A;  6GSS A;  1XWC A;  4GSN A;  2A2R A;  3LEF A;  1SJ6 A;  3KH9 A;  1F3B A;  3IV4 A;  4KDX A;  4BWQ A;  4POL A;  1G7O A;  2B6M A;  3EC3 A;  2GLR A;  3VI5 A;  5J41 A;  1IYH A;  1M99 A;  2HE3 A;  2X8C A;  6GSY A;  1Q98 A;  2HNL A;  16GS A;  1GLP A;  1VRS D;  3KM6 A;  4ML1 A;  4HJ2 A;  1TK5 B;  4TR1 A;  4ISD A;  3LG6 A;  1TOF A;  3FKF A;  2M80 A;  1BAY A;  4HI7 A;  4NV2 A;  4IHU A;  1NM3 A;  5IMD A;  1GNE A;  4TXV A;  1VF2 A;  5HFK A;  5AGY A;  1R7H A;  1O6J A;  2C80 A;  2RUE A;  1QFN A;  2BTO T;  1K3L A;  2B1L A;  1TI1 A;  1B48 A;  5F06 A;  4TRX A;  4IN0 A;  3GTU A;  2XHF A;  4F0C A;  5AN1 A;  3VK9 A;  4F2I A;  9GSS A;  5HR0 A;  3G7J A;  1GSY A;  1SKW B;  3MNG A;  5B7C A;  4KCA A;  3C1S A;  2L5O A;  3VLN A;  4Z2T A;  4FO5 A;  1AQV A;  3E0U A;  3GHA A;  5DAL A;  5EY6 A;  3KTL A;  4IKH A;  2DKI A;  1A23 A;  2N5A A;  1B9X C;  4LMV A;  2F3M A;  2WDU A;  1OE8 A;  2H74 A;  4IBP A;  1I9D A;  2L4Q A;  2F8A A;  1T7P B;  1J08 A;  1PMT A;  2GST A;  2H73 A;  4POK A;  2VCZ A;  3ZTL A;  5DQY A;  2X4A A;  2TIR A;  2VLV A;  3N5O A;  2JZS A;  1SYR A;  5B8A A;  5ECS A;  4MNN A;  2O7K A;  1KEB A;  1GTB A;  3UBK A;  3UEM A;  4IW9 A;  2PUK C;  4ID0 A;  5DCH A;  1MTC A;  2K18 A;  2FWH A;  4L0U A;  4ICY A;  4LL1 B;  3GNJ A;  5FHI A;  3MIX A;  3VPQ A;  2K8V A;  2E0Q A;  2FA8 A;  4HJM A;  1U6T A;  2CQ9 A;  3VWV A;  4TXO A;  1B8X A;  2VIM A;  5DAK B;  1QMV A;  4CY6 A;  3RHC A;  2YWN A;  2P5Q A;  1XCC A;  2OBI A;  2F8F A;  5AIS A;  1OE7 A;  3BCK A;  2H0G A;  3BOA A;  2TRC P;  2A2P A;  1YKC A;  2PER A;  3DML A;  2H0H A;  3NOF A;  4AJ8 A;  1DUG A;  3G7Y A;  3KMN A;  1GNW A;  4TR3 A;  3GL5 A;  1TRV A;  5CP1 A;  2QA1 A;  3H93 A;  1U87 A;  2I9H A;  1EWX A;  1Z6M A;  3CRT A;  3S9F A;  3ZIT A;  4ZIL A;  2IMD A;  5JWR B;  4TW5 A;  3E3E A;  2X8G A;  3A5I A;  3WT1 A;  3DGQ A;  3P7X A;  3ZLP A;  4OMV A;  5ECI B;  3L9U A;  4ECI A;  4L5O A;  3VPT A;  1R5P A;  3UVH A;  2HI7 A;  2IFQ B;  4Z2R A;  2BMX A;  2LRC A;  3IA1 A;  1ZYN A;  3NZN A;  2HYX A;  2LRN A;  4F0B A;  1BJX A;  4EIQ A;  2C0F A;  1IYI A;  5KN0 A;  1ZMA A;  5DBQ A;  1G0T A;  3DKS A;  1V57 A;  14GS A;  3MAK A;  2FWE A;  2HZE A;  4K7I A;  4L8E A;  2VUP A;  2VCW A;  1DE2 A;  5GZZ B;  2KP2 A;  5IOW A;  20GS A;  5B8B A;  4DVC A;  4XTS A;  2VL3 A;  3F4S A;  1ERV A;  1RW1 A;  3GH9 A;  4I2U A;  4OD7 A;  1QGV A;  4IQA A;  2VAF A;  4EE0 A;  1FVJ A;  1Z9H A;  4G10 A;  2MMZ A;  4KB3 A;  1SKS B;  2DML A;  1E6B A;  3H4K A;  5H5Q A;  1HNB A;  2OAD A;  3KMO A;  4QL9 A;  1YF0 A;  2DJ1 A;  5INY A;  5IO0 A;  4MPG A;  1OKT A;  2CV4 A;  2FHE A;  2WS2 A;  2H1B A;  1T4Z A;  5ECP B;  3GKK A;  2VCV A;  1KTE A;  4KGI A;  2E2M A;  4PX1 A;  1EV4 A;  3IDV A;  3DXB A;  4YH2 A;  2DMM A;  3LXT A;  5ABR A;  2QC7 A;  4WF4 A;  4EC0 A;  1VF3 A;  3RBT A;  5ID2 A;  3HVX A;  1A2J A;  2NVL A;  4WXT A;  2MBS A;  1R5A A;  4AJ6 A;  4MJB A;  3HZ8 A;  3FHK A;  4KAE A;  4MF7 A;  1S3A A;  4G9H A;  1OC8 A;  1V58 A;  2NBS A;  4ZBA A;  6GSU A;  2CX3 A;  4G0K A;  1SD8 A;  4KF9 A;  3A2X A;  2K8S A;  1K0B A;  4ML6 A;  2HRA A;  2C3T A;  3U6V A;  1BYE A;  1LBK A;  1GRX A;  1PL2 A;  4ILF A;  1B4Q A;  5KEJ A;  4G0I A;  5A4W A;  1XW5 A;  3QDN A;  1HD2 A;  1Z7P A;  4IP6 A;  3LYP A;  1V2A A;  3L9S A;  4EDY A;  3DIE A;  5JWQ B;  3DVW A;  5A4V A;  3ZVJ A;  1M2D A;  2M46 A;  5ECQ B;  2I81 A;  5G31 A;  3Q18 A;  2GQM A;  4OCE A;  4EO3 A;  4K0N A;  3CBU A;  1JZD A;  3H1N A;  1N2A A;  4YQU A;  2HRN A;  4ECB A;  5ECL B;  6GST A;  1F6M C;  3F3R A;  4GCI A;  2R3X A;  2V2G A;  2GS3 A;  2X99 A;  3D4M A;  2YWO A;  4HQZ A;  4HU9 A;  1HNC A;  2MMA A;  3BBY A;  3C1R A;  1QK8 A;  2JAC A;  4RI7 A;  1VF1 A;  4JED A;  3GSS A;  4KDY A;  2LQO A;  2GZZ A;  2C0G A;  1ACV A;  1H4O A;  4HU7 A;  1TTZ A;  4K9Z A;  4GLT A;  2L6C A;  3LYK A;  2PN8 A;  4KND A;  1YZX A;  3F6F A;  6GSV A;  4PQI A;  1MDJ A;  1ZZY A;  5ELG A;  4MH2 A;  1E2Y A;  1K3O A;  4NWY A;  1TXX A;  3WGX A;  1BQ7 A;  3HZ4 A;  3KEB A;  1GWC A;  2A2S A;  3G7I A;  1SK2 A;  1B4P A;  5CRW A;  2YOI A;  4K0G A;  1QXH A;  3QFB C;  1J0F A;  1QQ2 A;  4EXJ A;  2VCX A;  2WJU A;  5EVO A;  2L6D A;  2H19 A;  5IOX A;  3LOR A;  4ZBB A;  4O7H A;  3APS A;  1WJK A;  5H5R A;  2LJA A;  3CYN A;  3GUR A;  3C8E A;  1NHY A;  4KA0 A;  3N9J A;  3CRU A;  5IQY A;  4Q5F A;  1YF1 A;  4MF5 A;  3LXZ A;  3IR4 A;  3KP9 A;  5ENU A;  2OE0 A;  2L59 A;  4JR4 A;  1RK4 A;  1RQM A;  2LJR A;  1ABA A;  4AF2 A;  3HJM A;  2H30 A;  2YJ7 A;  2CA8 A;  1M2B A;  5E59 A;  1GSF A;  2J9H A;  5KN3 A;  1JZO A;  2P31 A;  2H75 A;  4MP4 A;  3ZRD A;  3RAZ A;  2IMK A;  3DYR A;  2B7K A;  8GSS A;  3WYW A;  2FCH A;  3EU3 A;  2GSS A;  2DIZ A;  2V32 A;  4BA7 A;  3FY7 A;  5IIZ A;  5A5K A;  2WCI A;  3IBH A;  1K0D A;  2G2Q A;  2VCT A;  4FYU A;  3EUR A;  3RHB A;  4LMW A;  3O6T A;  2A4H A;  1XVQ A;  5IO2 A;  2MMN A;  3VWU A;  2QSI A;  2YJH A;  2JL4 A;  4RQX A;  1WRY A;  5D73 A;  4KX4 A;  1ERT A;  2QKE A;  2OE1 A;  4Q5Q A;  5E4W A;  3TKQ A;  2PMT A;  3IXR A;  1TDI A;  1XFL A;  5C04 A;  2DSA A;  3DRN A;  3MWH A;  4WBR D;  3QFA C;  3H79 A;  2RLI A;  4BL7 B;  2GSR A;  4I6X A;  3EVI A;  4PUF C;  4EKZ A;  2VCQ A;  3TKS C;  1ML6 A;  2XPD A;  4L5L A;  4BVX B;  2FNO A;  2YZH A;  5EL8 A;  2REM A;  4JZQ A;  1FHE A;  4HUA A;  1DE1 A;  3HJO A;  2V6O A;  1PD2 1;  3ZVJ D;  10GS A;  3GFK A;  1PN0 A;  2O8V B;  1AC1 A;  5B6M A;  4N0V A;  2C0D A;  1X9W B;  5COH A;  1DBY A;  3KGK A;  4PGT A;  3VFI A;  3LSZ A;  4DSS B;  1GUK A;  2VL9 A;  4KSO A;  4A5P A;  5CRH A;  2L5L A;  3VWX A;  1AQW A;  3C71 A;  4EVM A;  5CRE A;  3GRX A;  1TU8 A;  1CQH A;  1WIK A;  4X1U A;  4XS6 A;  2WFC A;  1A2M A;  4MCU A;  3SBC A;  4BVY B;  3KD0 A;  3LJR A;  3ZIV A;  2WGR A;  1S3D A;  1OC9 B;  11GS A;  4GST A;  4YAV A;  2R2J A;  4MZC A;  3WD6 A;  4MF6 A;  3GKN A;  4KSM A;  4DSQ A;  4IS0 A;  2OE3 A;  2AUV A;  1I5G A;  3TJG A;  1UVZ A;  2DJ2 A;  1W4V A;  3VUR A;  4MPF A;  5ECR B;  1F2E A;  2VL2 C;  4D73 A;  3D0Z A;  1M7T A;  4OCF A;  2VOC A;  4CHS A;  5F8B A;  2GGT A;  2IWT A;  2AJQ B;  3W8S A;  2FGX A;  3ED3 A;  1GTI A;  3ZRE A;  1SL1 B;  1ZYQ B;  2GZP A;  2LST A;  3ERG A;  1XWB A;  2G0F A;  4XS4 A;  4EF0 A;  4NHW A;  4AGS A;  5GSS A;  3I43 A;  2C1Y A;  2CT6 A;  3IK7 A;  4WKW A;  2ON7 A;  4TN8 A;  5JCW A;  1GSU A;  1OYJ A;  2DC5 A;  3L9V A;  3LQ7 A;  4HQS A;  4K5R A;  1K0O A;  4K2D A;  3TRQ A;  1YY7 A;  2IJY A;  5J3R A;  1GL8 A;  4V2N A;  2GT5 A;  3HDC A;  5DCG A;  3TKS E;  3D22 A;  3QR6 A;  4HZ2 A;  5IPH A;  1PRX A;  2DLX A;  1HYU A;  2NTO A;  3FEU A;  2AAW A;  4X0X A;  4PNG A;  3CSH A;  4RUV A;  3EWL A;  2VLU A;  3HY2 A;  1R4W A;  4F03 A;  1VGL A;  3F4T A;  2B7J A;  2A4V A;  2HFD A;  3GH6 A;  4IVF A;  2FY6 A;  1SL0 B;  1J9B A;  1EOH A;  1T8E B;  5ECM B;  4NAX A;  3P2A A;  4ZL8 A;  3ME8 A;  4ZB8 A;  2R37 A;  1USB A;  1TK8 B;  1MEK A;  4V1A g;  3W8J A;  1TU7 A;  2GZY A;  4JBB A;  2FWG A;  3FW2 A;  2H0I A;  2LNS A;  4MAB A;  2H72 A;  2P0G A;  3UIW A;  2LKU A;  3V1W A;  2PVO C;  4MJC A;  4IJ3 A;  1MDK A;  2H01 A;  4HDE A;  3QAG A;  5ECH B;  2H70 A;  4E8H A;  4V2M A;  4BWS A;  2AHE A;  3RPP A;  1TK0 B;  3GA4 A;  4ZBD A;  2DJK A;  2VM1 A;  5J9C A;  2C0E A;  4QL7 A;  1ON4 A;  3QAV A;  5G1L A;  3UJ1 A;  4MJE A;  3GKX A;  1EV9 A;  3FRC A;  4NPB A;  2V1M A;  4AJ7 A;  1F37 A;  1Z7R A;  4TR1 B;  1UA5 A;  1A8Y A;  4FH8 A;  6GSX A;  1LJR A;  1PA3 A;  3D4T A;  3FZ9 A;  1N8J A;  2H6Y A;  5D9T A;  2H6Z A;  4FYB A;  4PNF A;  4OFT A;  1B9Y C;  3IPZ A;  1PX7 A;  2MBT A;  3IC4 A;  4ZL9 A;  2O89 A;  5J5N A;  1XWK A;  2J23 A;  5L71 A;  3TRX A;  2HXK A;  1X9M B;  1K0N A;  3F3Q A;  1JLV A;  4MH3 A;  3GTU B;  5BRT A;  2M72 A;  2H1A A;  4EIP A;  5G1K A;  5HR1 A;  5AIX A;  3EE2 A;  1TI3 A;  5GST A;  3EYT A;  2CAQ A;  5DQS A;  1OVN A;  1EEM A;  2C3Q A;  2P5R A;  5DAL B;  3ZIJ A;  3D5J A;  4GF0 A;  3ERW A;  3GL3 A;  4LA1 A;  1XBS A;  4E8E A;  2GSQ A;  2HSY A;  2H8L A;  4OO4 A;  2UZ8 A;  3HVV A;  1SD9 A;  4G2E A;  1XW6 A;  1YDK A;  4NXI A;  1EP7 A;  2CAI A;  4O92 A;  5HQP A;  3W6G A;  1GSQ A;  1T4Y A;  4WET A;  2E2G A;  2AYT A;  2ZNM A;  3F63 A;  2K9F A;  5EPF A;  4I2T A;  5J9B A;  2VL2 A;  2IMF A;  1O85 A;  3EMP A;  2DJJ A;  3IAS 2;  4LLR A;  3M8N A;  5D8I A;  2LTK A;  2OA7 A;  3DD3 A;  3C7M A;  4WR4 A;  2R4V A;  7GSS A;  2I1U A;  4JR6 A;  2C8U A;  4XHM A;  19GS A;  2LJK A;  1A0R P;  3ME7 A;  1BED A;  4NMU A;  4JU5 A;  3IK9 A;  4N10 A;  2JU5 A;  3KP8 A;  3NIV A;  3FZA A;  2ALB A;  2PGT A;  5AIV A;  4J2F A;  1PL1 A;  3DWV A;  2RM6 A;  2HT9 A;  2B5E A;  5G30 A;  4K8M A;  1GTU A;  4Z2U A;  3E9J B;  5B6N A;  4WEY A;  5ECK B;  4CY8 A;  3J7Y k;  4NHZ A;  1U3I A;  4XCS A;  2V41 A;  1FOV A;  4RQR A;  1XOA A;  2X49 A;  2X8H A;  4XIH A;  1MD4 A;  1XIY A;  3F6D A;  4J57 E;  4XS1 A;  3EU4 A;  1YJ6 A;  4IJI A;  3TJF A;  1GUM A;  3LFL A;  1G6W A;  5ECO B;  4TKY A;  3I6A A;  4KE3 A;  3P90 A;  4FIW A;  1SK0 A;  1HNA A;  1Q4J A;  5DJM A;  3KJY A;  2CVB A;  1WP0 A;  1WMJ A;  3LGC A;  5D9W A;  4V2L A;  4ACS A;  5KOW A;  12GS A;  5D9X A;  1K0M A;  5DJL A;  1YEX A;  4IEL A;  3A2W A;  2NPB A;  1VF4 A;  2HZE B;  1AXD A;  1R26 A;  4HOJ A;  5DAK A;  3FR6 A;  1XPV A;  3CMI A;  3F0I A;  1KNG A;  2N5B A;  4KDU A;  2ZUP A;  1EP8 A;  3IC8 A;  1A2L A;  4FYC A;  1X5D A;  2GTU A;  1AW9 A;  4J56 E;  1Z3E A;  4WBJ A;  3GKM A;  3L0H A;  1ZOF A;  4FQU A;  4MMM A;  4XRD A;  2C3N A;  1X0R A;  4YAP A;  3UVT A;  5G5E A;  1Y25 A;  3A5W A;  1AAZ A;  1PQN A;  1ZYE A;  3APO A;  3KTB A;  2LV3 A;  1GP1 A;  3I9V 2;  5CO3 A;  4X4J A;  1TKD B;  5IM9 A;  3IOS A;  3GIX A;  3KCM A;  4GTU A;  2IFQ A;  2R6K A;  3EIN A;  4JE1 A;  4P3Y B;  5LCZ A;  4NV5 A;  2BJX A;  3HYP A;  1M9B A;  2FUG 2;  2LEG A;  4OO5 A;  5G5F A;  1XOB A;  3TRP A;  1GSD A;  2KLX A;  2E7P A;  4L0W A;  2EIR A;  1UC7 A;  1FOH A;  4YKG A;  5ELA A;  2IL3 A;  4OFM A;  4I97 A;  3CTF A;  3FK8 A;  2H1D A;  3M1G A;  1M0U A;  1PGT A;  4JRR A;  2B3S A;  3IRA A;  1O73 A;  4IGJ A;  2RM5 A;  3UAR A;  3KIJ A;  2V6K A;  3TKP A;  2JSZ A;  4GSS A;  3MSZ A;  3MYD A;  2KOK A;  4CDO A;  4N11 A;  1SK1 A;  3FZ4 A;  4F9Z A;  3LWA A;  3QAW A;  4GRF A;  3G9B A;  2IMI A;  3QCP A;  2I4A A;  5G2Z A;  4V1A p;  2H66 A;  2EC4 A;  1SU9 A;  2RII A;  2R0C A;  5C00 A;  4Z7X A;  2VD1 A;  1EEJ A;  4IP1 A;  3PPU A;  4YQV A;  2QGV A;  2YNX A;  2FLS A;  3GX8 A;  4PXO A;  2LUS A;  4ULX A;  3VWW A;  1NW2 A;  4EL1 A;  1MDI A;  4GWR A;  4G0L A;  3EMX A;  2L4C A;  1UN2 A;  1ZGN A;  4MK3 A;  1AIU A;  3RDW A;  4O32 A;  1M2A A;  4ZIJ A;  4MZW A;  2HSH A;  3GMF A;  1KBN A;  3Q19 A;  3M3M A;  2MYG A;  1NSW A;  4EDZ A;  1XVW A;  1FB0 A;  3UL3 A;  2MMO A;  2RUF A;  2OBK A;  2LQQ A;  3PGT A;  3QOU A;  5D9V A;  3TKR A;  2H71 A;  2EIQ A;  1BX9 A;  3M9J A;  3GYK A;  3DEX A;  1FAA A;  1H75 A;  2GVP A;  4OWY A;  1XWA A;  2DKH A;  5IMC A;  1GSE A;  3M0F A;  4TR4 A;  4K2X A;  5F05 A;  3FR9 A;  1ILO A;  1A24 A;  2YPM A;  1GSS A;  1LU4 A;  2OJL A;  3TOT A;  3DVX A;  3HD5 A;  4K6X A;  5CYY A;  4HS1 A;  5FT3 A;  4KUN A;  5IMV A;  3A3T A;  4ZXG A;  1U88 A;  5JCG A;  1W89 A;  3US3 A;  5IPG A;  1G6Y A;  3FYG A;  2HLS A;  4MDC A;  1T1V A;  4PUA A;  4KH7 A;  3KXO A;  1WOU A;  1K0C A;  1EGR A;  4GQC A;  2F9S A;  3P8W A;  4MJA A;  1V98 A;  2CVK A;  3TJB A;  2NDO A;  1PX6 A;  4Q5N A;  2YV7 A;  3WGD A;  4DSR A;  1A0F A;  1T3B A;  2FD3 A;  3ZFB A;  2H1G A;  3BCI A;  1M9A A;  2JAD A;  2YN1 A;  1F3A A;  2VD0 A;  3WT2 A;  3ZZX A;  4TOP A;  3UBL A;  1K3Y A;  2YZU A;  2L57 A;  5HFG A;  3ZML A;  1BG5 A;  1HQO A;  18GS A;  2GQK A;  4DEJ A;  2PWJ A;  3FZ5 A;  5CNW A;  4PTS A;  5LD0 A;  4I5Q A;  1K0A A;  3FMW A;  3FR3 A;  2WZ9 A;  1AQX A;  4N0Z A;  3GX0 A;  4HEA 2;  4PQ1 A;  4N30 A;  3UMA A;  5D93 A;  2B1K A;  5D96 A;  4USS A;  3CSJ A;  4OFN A;  2PU9 C;  1AUC A;  5HR2 A;  4CW9 A;  2VM2 A;  2PVQ A;  4WR5 A;  5IMA A;  5GAP D;  17GS A;  3TDG A;  3WGE A;  4ECJ A;  5J4U A;  4K7N A;  2MZC A;  2CVD A;  2XBI A;  2AV4 A;  4KW6 A;  2YV9 A;  3CTG A;  3TJK A;  1O8X A;  2YAN A;  5FWG A;  2B5Y A;  3GST A;  2QA2 A;  3ZYW A;  1TW9 A;  3HJP A;  1OKD A;  3PR8 A;  1ZYP A;  1O81 A;  2JZT A;  2KUC A;  1FW1 A;  3HXS A;  2ON5 A;  1U3A A;  3GN3 A;  3GV1 A;  1X5E A;  4TR0 A;  1SKR B;  2JZR A;  4YQM A;  4MA9 A;  3ISO A;  1FVK A;  2XC2 A;  1SJI A;  3QMX A;  4HZ4 A;  2PBJ A;  5DVB A;  1EOG A;  3TCO A;  3ZFL A;  1MD3 A;  2H6X A;  3JCM L;  1FB6 A;  2X64 A;  1TP9 A;  1O8W A;  3TJJ A;  22GS A;  3TKS A;  3PH9 A;  1URM A;  1JZW A;  4POM A;  1DSB A;  5GAN D;  3HA9 A;  4PUR A;  1XZO A;  2D2Z A;  5BMU A;  1PKZ A;  5JWO B;  2OKA A;  2IME A;  1QUW A;  2ZCT A;  4IQ1 A;  2TRX A;  1PN9 A;  5CRD A;  1X5C A;  3K8N A;  3R3E A;  5F07 A;  2FWF A;  3TB2 A;  3F4R A;  2R5G A;  4POB A;  3UOM A;  2CZ3 A;  13GS A;  3IHG A;  4K7O A;  1C72 A;  4QQ7 A;  3L78 A;  4ZB9 A;  1WWJ A;  3QPM A;  4GQF A;  3I69 A;  2DJ0 A;  3ERF A;  1THO A;  3CSI A;  2PPT A;  1FO5 A;  2N5F A;  2WB9 A;  1Z5Y E;  3Q74 A;  2LRT A;  4O5R A;  1TRS A;  5IMF A;  1THX A;  6GSW A;  4D73 B;  1GH2 A;  2B5X A;  2R0P A;  5A4U A;  3AY8 A;  4BL7 A;  1EZK A;  1SL2 B;  2DJ3 A;  1T00 A;  3LW9 A;  1GLQ A;  2IPA A;  5CAX A;  1JHB A;  4BVX A;  2DIY A;  3D21 A;  2VO4 A;  3BD2 A;  1ERU A;  4I8B A;  1WE0 A;  3Q6O A;  3HCZ A;  4G19 A;  3IE3 A;  4XS4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...