4V2MA

Crystallographic structure of thioredoxin from litopenaeus vannamei: radiation damage effect at 34 mgy, focused in disulfide bonds.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Crystallographic Studies Evidencing the High Energy Tolerance to Disrupting the Interface Disulfide Bond of Thioredoxin 1 from White Leg Shrimp Litopenaeus Vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 36
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4v2mA00
3FZAA 2J23A 5L71A 1O73A 3LGCA 4TXOB 3F4RA 1UC7A 1X9MB 2V32A 2L59A 1MD3A 3CSHA 1SD9A 2FHEA 1F6MC 2VM1A 3HZ8A 2GSSA 3D0ZA 4E8HA 2HXKA 1OC9A 2AB6A 1YF1A 3N9JA 4DEJA 6GSSA 2VM2A 3ISOA 3MSZA 3IC4A 4J2FA 4GQCA 1ML6A 2GQKA 1SD8A 1W89A 3GMFA 4KB3A 5DBQA 2C3NA 3H4KA 4HQSA 5LD0A 3F6FA 3I6AA 1K0DA 3US3A 3LFLA 4O7HA 3GKXA 4TXVA 5DQYA 4KDXA 1GRXA 2RUFA 2VD1A 1SL0B 3VPQA 4TW5A 4KCAA 2FWGA 4K2DA 3R2QA 1VF3A 1AQWA 1WOUA 5ABRA 2H70A 3IRAA 2I1UA 4DSSB 2A4VA 4RQXA 4XS1A 3GTUA 5CRWA 3TRQA 4XTSA 2MYGA 4N10A 2WZ9A 3ERWA 3U6VA 3W6GA 2YNXA 3O6TA 4J57E 5GZZB 2OE1A 3VURA 2VL2C 3VI5A 1ERUA 2R37A 1T4ZA 2F8AA 1ON4A 3UAPA 1ERWA 3V1WA 4XRDA 2J9HA 3TKSA 3A2XA 2M80A 4HJ2A 3QCPA 2DJ1A 5DAKA 2IL3A 3D4MA 1GTAA 1K0MA 4IJIA 2WULA 1V9WA 1K3OA 4BL7A 4E8EA 3FEUA 5HFGA 2REMA 5CRDA 2H0IA 4K9ZA 3FYGA 4MABA 1I9DA 4ECJA 4RUVA 4IS0A 4LL4B 5J41A 4LMWA 1OC9B 2JU5A 1T4YA 3FW2A 2YZUA 3APSA 3EWLA 2CQ9A 4JBBA 1QFNA 2C1YA 3FR3A 3SWLA 2VO4A 2GT5A 2VAFA 1FB6A 1ZZYA 2VCVA 4MJBA 3HVSA 2D2ZA 4WF5A 1J0FA 2I9HA 2PPTA 1XPVA 4NAXA 4Q5NA 1HQOA 4I8BA 2VCTA 2K18A 4KW6A 4HUAA 4K7NA 3GSSA 4MZCA 4IQAA 2YWIA 3U5RE 1K3LA 3IV4A 2DIZA 1J9BA 4WF4A 1M99A 3TJGA 3F3RA 1UN2A 4Q5RA 5HFKA 1DSBA 3L9SA 5AIVA 2AJQB 4F9ZA 2CVDA 2LRNA 5JCWA 1TDIA 2GSQA 1BAYA 4HJMA 4H86A 5E59A 4HOJA 2OE3A 4ZL7A 3M9JA 2CZ3A 6GSTA 3GTUB 3EMPA 4RI6A 2P5RA 1JFUA 1XVQA 5ECIB 2MMAA 5A4WA 4FIWA 1H75A 5DDLA 4O32A 2DLXA 3CMIA 1Z3EA 3HCZA 3FRCA 3FZ4A 5D9XA 2FUG2 2YWMA 2IMEA 5D9VA 4NHZA 5EL8A 2V1MA 4WR4A 3GUSA 4ZILA 4FYUA 3UEMA 3CBUA 4POLA 1X5CA 2MZCA 1EOGA 1IYHA 3W8SA 1GSQA 4K1FA 2F3MA 4XIHA 1A2JA 4P3YB 2AYTA 4XS4A 5DAKB 3EU4A 1HNCA 3C8EA 2LRTA 2LJRA 2VD0A 2AUVA 2C4JA 1YKAA 2V2GA 5ECKB 3BBYA 4NXIA 2QC7A 3WD6A 4O5RA 3P2AA 2IWTA 1QUWA 1FVJA 2PERA 2JSYA 1KBNA 2DSAA 1A8LA 3FZ9A 3CRTA 3MWHA 4MJEA 2H1GA 2JACA 4NPBA 5AISA 4HI7A 3NIVA 3QMXA 3FHKA 3AY8A 1K0NA 1K0AA 3UARA 3GKKA 4L0UA 1S3AA 5IO0A 5IPHA 4GSSA 2HRNA 5G5EA 3ERFA 3KTLA 2EIOA 3ERGA 2B5XA 2DIYA 2LQOA 17GSA 4PQHA 5DJMA 3G9BA 3MAKA 2LNTA 5D73A 3H8QA 22GSA 1E2YA 2CAQA 2IMIA 4KGIA 4IJ3A 1JZRA 3FR6A 2IJYA 1F9MA 2MMNA 5DALA 4KCEA 3MDKA 3QPMA 2R4VA 2WFCA 1EEMA 1BJXA 4OFNA 1FHEA 2TRXA 5DCGA 4L5LA 3VWWA 4JEDA 3DIEA 3IE3A 4TN8A 4ML1A 2JZRA 1GNWA 4IQ1A 1Q98A 4MF7A 2LTKA 3KJYA 4YQVA 2H0GA 1TRWA 4MDCA 2EC4A 4MZBA 5IOWA 4XS4B 1H4OA 1Y6EA 3UIWA 2DC5A 6GSVA 4KDYA 5JWQB 2QSIA 4PQIA 4KA0A 1U87A 2IFQA 3FR9A 3KH7A 3K8NA 1X5DA 3KD0A 5CP1A 2OBKA 5J9CA 3SBCA 2KOKA 1PKWA 3GL3A 3ZIJA 4GWRA 3D5JA 5AGYA 2FLSA 3M3MA 2K8VA 1SENA 3LXTA 4ZB8A 4ECBA 2KUCA 4MLYA 1PX7A 5J9BA 5G31A 1X0RA 1XWBA 3TKRA 1U88A 2GTUA 3F9UA 4I5QA 4ECIA 1K0BA 1Z5YE 3VFIA 3KCMA 1OE8A 2OADA 3EC3A 2YPMA 3CSIA 2PVQA 2YJHA 2IMFA 4MCUA 3MNGA 3UJ1A 1AW9A 2VCQA 4G9HA 1RQMA 1T00A 5D93A 3P7XA 4ZL9A 4BPYA 4TR1A 1B9XC 1FVKA 2VL9A 4OFMA 1TI1A 1T7PB 5DALB 3QAVA 3KZQA 4TR3A 3ZITA 1J08A 5FWGA 4KDUA 1XVWA 3RHCA 4EUYA 1WRYA 2NDOA 5AIXA 1PX6A 1VGLA 1G6WA 4OD7A 4FH8A 4MF5A 2FWEA 1R5AA 4PUFC 4FO5A 1WPIA 1QXHA 2XBIA 4WBRD 4HEA2 2LV3A 2TRCP 4NV2A 1M7TA 4TOPA 5G5FA 4QL7A 1ZMAA 3BD2A 2GQMA 5A4VA 2O85A 1T3BA 4ULXA 3KP8A 1YQ1A 5C00A 5F05A 5ECOB 4MF6A 3F3QA 4XHMA 2C3QA 1YF0A 1OC8A 3KIJA 1AC1A 3DRNA 4Q5FA 2L5LA 1V40A 2WS2A 4ZB6A 4ECCA 1PQNA 1GSEA 4AGSA 2IFQB 1MTCA 1GTIA 4EXJA 3HYPA 4JU5A 3TJKA 4WXTA 1F3AA 3VPTA 2B6MA 2LRCA 4K0GA 4X1UA 1YY7A 1THOA 1WE0A 1PSQA 4MH3A 3E3EA 5D96A 3VI7A 1ACVA 3GSTA 5J5NA 1A0RP 2E0QA 3F4TA 2H76A 1DUGA 5IMDA 5GSSA 1M0UA 1E6BA 8GSSA 4NWYA 1GTUA 3KXOA 5LCZA 1SK2A 1IYIA 2CA8A 4V1Ag 2FD3A 4V1Ap 4EDYA 2XC2A 4N0ZA 4ZXGA 1XIYA 1KEBA 1PMTA 2LQQA 3D21A 2B5YA 4GLTA 3DWVA 3HDCA 3KTBA 3BOAA 2L57A 1F2EA 1KNGA 2TIRA 1PL1A 4TR1B 3GA4A 4GSNA 4MJCA 2C8UA 1O6JA 1Q4JA 1SL1B 1G0TA 2GS3A 12GSA 5IM9A 1SYRA 1USBA 5D9WA 4HS1A 2XBQA 1PA3A 4WR5A 1R4WA 4JE1A 4IHUA 2I3YA 4K8MA 4FYCA 3IR4A 3HXSA 1BYEA 1SL2B 5D9TA 4HU7A 1TTZA 2B5EA 3J7Yk 5KEJA 1SJZA 2AV4A 4HQZA 3TGZA 3ZL5A 4WKWA 4MK3A 4WEYA 4EE0A 4L8EA 4G2EA 1ERVA 1OYJA 3EU3A 4CDOA 3IOSA 2K9FA 3WT2A 3TOTA 2LEGA 4HU9A 2CZ2A 5IOXA 2O87A 5IPGA 3TJBA 5INYA 4PXOA 2A2RA 1GUHA 3UBKA 1Z7PA 2BTOT 3C7MA 18GSA 1ILOA 2OACA 1NW2A 1A8YA 4X43A 1O8WA 1SK0A 1ERTA 3A3TA 1YDKA 3DVWA 1YZXA 3RPNA 5IMAA 5G30A 2K6VA 2ON5A 2VIMA 4BWSA 1FOVA 1PGTA 2HZFA 4KX4A 1F37A 3Q19A 3TB2A 4F2IA 3TRPA 1XWGA 2C80A 2GZPA 5J4UA 4EVMA 2WJUA 3L9VA 3IHQA 2NBSA 1JHBA 4DSQA 2HYXA 2R6KA 3QFAC 1ZYEA 3LJRA 2AHEA 1DE1A 2P5QA 4KSOA 2I81A 4OFTA 2FY6A 3I69A 5ECRB 1NSWA 5IO2A 2E7PA 5ECQB 2GZZA 2OBIA 1Z6MA 3GH6A 4ISDA 1HYUA 5HR1A 3M1GA 4GQFA 3D6IA 4FYBA 2OJLA 4K7IA 2YN1A 1N2AA 3KMOA 1FAAA 3GL5A 2LS5A 1FW1A 5ENUA 1TK8B 2L6DA 1V58A 1U6TA 5HFIA 1URMA 3CRUA 1X9WB 2C0DA 4N30A 5HQPA 5ECHB 1SJIA 4I2TA 4PNGA 2NTOA 2FGXA 4ZBBA 5COHA 2IMDA 2AAWA 2LNSA 4TKYA 2XPDA 2H74A 1A2LA 4AF2A 1M2BA 3VLNA 4K6XA 3CTGA 2R3XA 4Q5QA 4I2UA 4IKHA 2H6XA 3ZVJD 2HLSA 2H1AA 3UOMA 2HZEA 4MP4A 1XWAA 5JWOB 2MBTA 14GSA 4JZQA 2OA7A 3WYWA 3RHBA 2F9SA 1GLQA 3EYTA 2OKAA 3C1RA 2B7JA 5A4UA 3KH9A 6GSYA 4V2MA 2VCZA 2DJKA 5IMFA 3G7JA 3CSJA 4NV5A 2YZHA 4EDZA 2PUKC 2WCIA 1G7OA 2YWOA 1GSSA 2KLXA 2YJ7A 6GSWA 1B48A 2CT6A 2N5FA 3WT1A 3WGXA 4EC0A 3BJ5A 2LJKA 2DJJA 1PL2A 3P90A 3UVTA 1BG5A 3TKSE 1QGVA 3P8WA 1JZDA 5IMCA 3OR5A 3TKPA 5AN1A 3FK8A 2VUPA 4PURA 3ZTLA 4IN0A 3QDNA 2YANA 4KH7A 3GRXA 4OO4A 1SK1A 2FWHA 1EEJA 2IIYA 2GVPA 2JZTA 4G10A 2FCHA 2DMLA 9GSSA 2L6CA 2GSTA 3RDWA 1AAZA 1ST9A 4F03A 3M9KA 1QK8A 3ZFLA 3FY7A 3QFBC 1B9YC 5ELGA 4WBJA 3GKMA 5H5RA 4EO3A 4BVXA 3TRXA 5B8BA 3ZRDA 5ECNB 2HZEB 2RLIA 1GL8A 5CNWA 1WP0A 3LORA 1RW1A 4GTUA 2G2QA 1K0OA 1PKZA 3O76A 3L4NA 2K8SA 4I97A 1EOHA 2CV4A 4POMA 4OCEA 5ID2A 3F63A 1LJRA 2O89A 3A5WA 1X5EA 5CRGA 4JR4A 5F8BA 5D8IA 1Z9HA 3IAS2 3E0UA 3KEBA 2H01A 2JADA 3HY2A 3TOUA 3HD5A 2JSZA 5B6MA 1W4VA 3EMXA 1G6YA 4EKZA 3ZMLA 2HFDA 3CTFA 1LBKA 3RAZA 6GSUA 4POKA 4V2NA 3EINA 1GSFA 5DJLA 2CAIA 1OAZA 1GUKA 2CX3A 3ZFBA 2H75A 2ES7A 3KP9A 5B8AA 3E9JB 1B4QA 3TKSC 2MMZA 2LKUA 1TW9A 2RM6A 5HR3A 3G7IA 2GLRA 5FT3A 2H6YA 2X99A 5CYYA 1TJDA 1WWJA 2QGVA 5HR2A 1VF4A 1SKRB 4PGTA 1M9AA 3HJMA 1QQ2A 2ALBA 3TDGA 2N5BA 3QAWA 2IN3A 3GX8A 3DD3A 3LWAA 3HHVA 2F8FA 2VLUA 5C04A 2VOCA 3LG6A 1HNBA 1JZOA 5H5SA 2H71A 2EIRA 3DGQA 2JL4A 3APQA 1TK5B 1GNEA 1EV4A 1O8XA 2H6ZA 2B1KA 1C72A 1MD4A 3DYRA 4L0WA 5ECSA 3WGEA 19GSA 3ZVJA 1NHYA 1TU7A 2OE0A 1BX9A 3GHAA 1WJKA 4MPGA 5B6NA 2FNOA 2MMOA 5LNKe 1OC3A 4KUNA 3I9V2 4MZWA 1YEXA 4YQUA 2Z9SA 3EE2A 2HI7A 4PNFA 1AXDA 2LJAA 2H72A 1NM3A 1XCCA 1EV9A 2GQLA 1VF2A 5ID2B 4LMVA 5DQSA 2X8HA 4PUAA 6GSXA 3GV1A 4IVFA 20GSA 3LYPA 2GGTA 1CQGA 2YOIA 3GURA 3N5OA 4TRXA 2P0GA 3IK9A 4V2LA 2C0GA 1EGRA 2A2SA 1X9SB 1ZL9A 1V2AA 4ZBDA 3JCML 4HZ2A 2LUSA 2V41A 1DE2A 4F0CA 3L0HA 1UVZA 3VK9A 4F82A 4N11A 1MDKA 1GH2A 2FA4A 3RPPA 2YV9A 3KM6A 3LEFA 3UVHA 1M9BA 4XS6A 1XWCA 1HNAA 2V6OA 2HT9A 3PR8A 3ME7A 5CRHA 1SKWB 4K7OA 4MMMA 2IPAA 1EP7A 3FKFA 5E4WA 3BCIA 1AUCA 5ECMB 3EVIA 4G19A 1G7EA 3L9UA 3Q18A 1TI3A 1SKSB 1TKDB 3GKNA 4ILFA 1OKDA 1AQXA 1TU8A 1N8JA 2DJ3A 2E2MA 3GIXA 1ZGNA 2PN8A 2VCWA 1TRSA 5JCUA 2GSRA 2CVBA 1AIUA 2F51A 2WGRA 4O92A 4F0BA 1A2MA 2H0HA 3PH9A 5ECLB 1PN9A 2HSYA 2ON7A 3GYKA 4RQRA 3F4SA 1TRUA 4KSMA 1GSUA 3UBLA 2R5GA 3IK7A 2YV7A 3DEXA 13GSA 3EURA 3WGDA 4BVYA 4DSRA 3QR6A 7GSSA 2WB9A 3LSZA 4DVCA 1AQVA 1EWXA 2DBCA 3PGTA 1ZOFA 2O8VB 4GXZA 2DJ0A 5CO3A 1YEPA 2FWFA 2R2JA 1MDIA 1RK4A 4LLRA 5J3RA 3C1SA 4I6XA 4ACSA 3ZMKA 4GRFA 5FHIA 1SJ6A 10GSA 3ZREA 1WMJA 3GNJA 1QMVA 4L5OA 1S3CA 2PU9C 3W8JA 1NHOA 2YWNA 1JLVA 1PRXA 1ZCPA 4IELA 3TJJA 3PINA 1BQ7A 3HA9A 2MBSA 4KAEA 3KGKA 2VCXA 1R26A 2DMMA 5CREA 1VRSD 4EL1A 5HR0A 2RIIA 4J56E 2PVOC 5IIZA 2BJXA 3TUEA 2KHPA 2XHFA 3LXZA 4YH2A 1LU4A 4ZB9A 1GULA 4HDEA 5F07A 3NZNA 5ECPB 2KP2A 4GCIA 3GH9A 3S9FA 2NVLA 4EF0A 2O7KA 1TRVA 3UL3A 2HRFA 4IBPA 3UMAA 5A5KA 1MEKA 3DXBA 4IP6A 1XOAA 4KNDA 3H93A 2EIQA 3DKSA 4MPFA 5DVBA 2H66A 2L5OA 5IMVA 2XPEA 3GFKA 4NMUA 4YQMA 2H73A 1GLPA 1THXA 4IW9A 2BMXA 1K3YA 1S3DA 3H79A 5G2ZA 2M46A 3ED3A 4TVEA 2NPBA 4POBA 5KN3A 1CQHA 3TCOA 1M2DA 3VWVA 1FO5A 2WDUA 4ML6A 3CYNA 4MH2A 4OO5A 1XZOA 1T8EB 5EPFA 1OVNA 3ZLPA 1TK0B 3D22A 3LQ7A 4CHSA 3DMLA 5KN2A 3GX0A 4ZIJA 16GSA 5IQYA 2ZCTA 2L4CA 4LL1B 1ZYQB 3HVXA 3O3TA 1EZKA 2G0FA 3KMNA 1XWKA 5EVOA 2E2GA 4XCSA 4ID0A 1Y25A 1HD2A 3J7Yb 3IAM2 1O81A 2B7KA 5IMZA 1XOBA 3BCKA 5F06A 1OE7A 4ZL8A 1U3AA 1KTEA 4NHWA 3RBTA 1TXXA 1GSDA 2FA8A 1BEDA 3TKQA 4RI7A 1GUMA 2X8CA 1OKTA 2GZYA 1Z6NA 5JWRB 1FB0A 4HZ4A 2V6KA 2C3TA 3G7YA 2CVKA 1GSYA 2VL2A 5GSTA 2C0EA 2M72A 3IA1A 1B8XA 4K0NA 5EY6A 2H19A 2PGTA 3IPZA 3M8NA 3I43A 4PX1A 1XFLA 2GDRA 3DVXA 1Z7RA 2HSHA 4MA9A 4D73A 3QOUA 3ZZXA 2QKEA 2JZSA 1EP8A 2IMKA 4N0VA 1R7HA 1A23A 4YAPA 1M2AA 3Q6OA 3IDVA 2H30A 1VF1A 1WIKA 5KN1A 5G1KA 2KP1A 3HKRA 3M0FA 11GSA 1PD21 1TP9A 3C73A 1GP1A 1JZWA 2H1DA 2YCDA 2RUEA 1B4PA 3ME8A 4WETA 1K0CA 2N5AA 3A2WA 2VLTA 3D4TA 1V98A 2P31A 2DJ2A 4JR6A 1TOFA 2B3SA 3H1NA 1A0FA 3VWXA 3HZ4A 5KN0A 2H1BA 1XW5A 2RM5A 3TJFA 3CXGA 2ZNMA 3GN3A 2X64A 4ZBAA 2I4AA 5B7CA 4Z7XA 3QAGA 4TXOA 3C71A 1ABAA 3F6DA 4XRAA 3ZIVA 5CAXA 1UA5A 4LA1A 2HE3A 4IGJA 4BA7A 3L78A 4AJ7A 2VL3A 2PMTA 4MJAA 1F3BA 5F0GA 4BWQA 3APOA 2WRTA 5G1LA 5H5QA 1R5PA 1GWCA 2VLVA 2L4QA 3ZYWA 2CX4A 4TR0A 5GAND 4IP1A 1MDJA 2PWJA 4GF0A 3NOFA 1DBYA 4QL9A 1YJ6A 3FZ5A 1T1VA 4JRRA 2HNLA 1FG4A 2LSTA 1I5GA 1A24A 4OCFA 4QQ7A 2C0FA 1O85A 2PBJA 1YKCA 4D73B 4PQ1A 1XW6A 1XBSA 4OMVA 1SU9A 4KE3A 5JCGA 1GTBA 3VWUA 3F8UA 4DSSA 4YAVA 4AJ6A 1O7UA 4AJ8A 1EGOA 5ELAA 3HJPA 1XW9A 4TR4A 4X0XA 4CW9A 2X8GA 1V57A 4OWYA 1JLWA 3A2VA 2YP6A 3QD9A 2GT6A 1SYXA 3F0IA 3HVVA 3LYKA 5GAPD 1U3IA 3HJOA 2H8LA 5DCHA 3Q74A 3IXRA 2ZUPA 3IBHA 2B1LA 1XXUA 4GSTA
chains in the Genus database with same CATH superfamily
3FZAA 2J23A 5L71A 1O73A 3LGCA 4TXOB 4CY8A 3F4RA 1UC7A 1X9MB 2V32A 2L59A 1MD3A 3CSHA 1SD9A 2FHEA 1F6MC 2VM1A 3HZ8A 2GSSA 3D0ZA 4E8HA 2HXKA 1OC9A 2AB6A 1YF1A 3N9JA 4DEJA 6GSSA 2VM2A 3ISOA 3MSZA 3IC4A 4J2FA 4GQCA 1ML6A 2GQKA 1SD8A 1W89A 3GMFA 4KB3A 5DBQA 2C3NA 3H4KA 4HQSA 5LD0A 3F6FA 3I6AA 1K0DA 3US3A 3LFLA 4O7HA 3GKXA 4TXVA 5DQYA 1XG8A 4KDXA 1GRXA 2RUFA 2VD1A 1SL0B 3VPQA 4TW5A 4KCAA 2FWGA 4K2DA 3R2QA 1VF3A 1AQWA 1WOUA 5ABRA 2H70A 3IRAA 2I1UA 4DSSB 2A4VA 4RQXA 4XS1A 3GTUA 5CRWA 3TRQA 4XTSA 2MYGA 4N10A 2WZ9A 3ERWA 3U6VA 3W6GA 2YNXA 3O6TA 4J57E 5GZZB 2OE1A 3VURA 2VL2C 3VI5A 2X49A 1ERUA 2R37A 1T4ZA 2F8AA 1ON4A 3UAPA 1ERWA 3V1WA 4XRDA 2J9HA 3TKSA 3A2XA 2M80A 4HJ2A 3QCPA 2DJ1A 2QA1A 5DAKA 2IL3A 3D4MA 1GTAA 1K0MA 4IJIA 2WULA 1V9WA 1M3IA 1K3OA 4BL7A 4E8EA 3FEUA 5HFGA 2REMA 5CRDA 2H0IA 4K9ZA 3FYGA 4MABA 4CY6A 1I9DA 4ECJA 4RUVA 4IS0A 4LL4B 5J41A 4LMWA 1OC9B 2JU5A 4PTSA 1T4YA 3FW2A 2YZUA 3APSA 3EWLA 2CQ9A 4JBBA 1QFNA 2C1YA 3FR3A 3SWLA 2VO4A 2GT5A 2VAFA 1FB6A 1ZZYA 2VCVA 4MJBA 3HVSA 2D2ZA 4WF5A 1J0FA 2I9HA 2PPTA 1XPVA 4NAXA 4Q5NA 1HQOA 4I8BA 2VCTA 2K18A 4KW6A 4HUAA 4K7NA 3GSSA 4MZCA 4IQAA 2YWIA 3U5RE 1K3LA 3IV4A 2DIZA 1J9BA 4WF4A 1M99A 3TJGA 3F3RA 1UN2A 4Q5RA 5HFKA 1DSBA 3L9SA 5AIVA 2AJQB 4F9ZA 2CVDA 2LRNA 5JCWA 1TDIA 2GSQA 1BAYA 4HJMA 4H86A 5E59A 4HOJA 2OE3A 4ZL7A 3M9JA 2CZ3A 2R0GA 6GSTA 3GTUB 3EMPA 4RI6A 2P5RA 1JFUA 1XVQA 5ECIB 2MMAA 4K5RA 5A4WA 4FIWA 1H75A 5DDLA 4O32A 2DLXA 3CMIA 1Z3EA 3HCZA 3FRCA 3FZ4A 5D9XA 2FUG2 2YWMA 2IMEA 5D9VA 4NHZA 5EL8A 2V1MA 4WR4A 2R0PA 3IC8A 3GUSA 4ZILA 3IHGA 4FYUA 3UEMA 3CBUA 4POLA 1X5CA 2MZCA 1EOGA 1IYHA 3W8SA 1GSQA 4K1FA 2F3MA 4XIHA 1A2JA 4P3YB 2AYTA 4XS4A 5DAKB 1FOHA 3EU4A 1HNCA 3C8EA 2LRTA 2LJRA 4BL7B 2VD0A 2AUVA 2C4JA 1YKAA 2V2GA 4FQUA 5ECKB 3BBYA 4NXIA 2QC7A 3WD6A 4O5RA 3P2AA 2IWTA 1QUWA 1FVJA 2PERA 2JSYA 2HRAA 1KBNA 5BMUA 2DSAA 1A8LA 3FZ9A 3CRTA 3MWHA 4MJEA 4K2XA 2H1GA 2JACA 4NPBA 5AISA 3FMWA 4HI7A 3NIVA 3QMXA 3CQFA 3FHKA 3AY8A 1K0NA 1K0AA 3UARA 3GKKA 4L0UA 1S3AA 5IO0A 5IPHA 4GSSA 2HRNA 5G5EA 3ERFA 3KTLA 2EIOA 3ERGA 2B5XA 2DIYA 2LQOA 17GSA 4PQHA 5DJMA 3G9BA 3MAKA 2LNTA 5D73A 3H8QA 22GSA 1E2YA 2CAQA 2IMIA 4KGIA 4IJ3A 1JZRA 3FR6A 2IJYA 1F9MA 2MMNA 5DALA 4KCEA 3MDKA 3QPMA 2R4VA 2WFCA 1EEMA 1BJXA 4OFNA 1FHEA 2TRXA 5DCGA 4L5LA 3EPTA 3VWWA 4JEDA 3DIEA 3IE3A 4TN8A 4ML1A 2JZRA 1GNWA 4IQ1A 1Q98A 4MF7A 2LTKA 3KJYA 4YQVA 2H0GA 1TRWA 4MDCA 4G0LA 2EC4A 4MZBA 5IOWA 4XS4B 1H4OA 1Y6EA 3UIWA 2DC5A 6GSVA 4KDYA 5JWQB 2QSIA 4PQIA 4KA0A 1U87A 2IFQA 3FR9A 3KH7A 3LW9A 3K8NA 1X5DA 3KD0A 5CP1A 2OBKA 5J9CA 3SBCA 2KOKA 1PKWA 3GL3A 3ZIJA 4GWRA 3D5JA 5AGYA 2FLSA 3M3MA 2K8VA 1SENA 3LXTA 4ZB8A 4ECBA 2KUCA 4MLYA 1PX7A 5J9BA 5G31A 1X0RA 1XWBA 3TKRA 1U88A 2GTUA 3F9UA 4I5QA 4ECIA 1K0BA 1Z5YE 3VFIA 3KCMA 1OE8A 2OADA 3EC3A 2YPMA 3CSIA 2PVQA 2YJHA 2IMFA 4MCUA 3MNGA 3UJ1A 1AW9A 2VCQA 4G9HA 1RQMA 1T00A 5D93A 3P7XA 4ZL9A 4BPYA 4TR1A 1B9XC 1FVKA 2VL9A 4OFMA 1TI1A 1T7PB 5DALB 3QAVA 3KZQA 4TR3A 3ZITA 1J08A 5FWGA 4KDUA 1XVWA 3RHCA 4EUYA 1WRYA 2NDOA 5AIXA 1PX6A 1VGLA 1G6WA 4OD7A 4FH8A 4MF5A 2FWEA 1R5AA 4PUFC 4FO5A 1WPIA 1QXHA 2XBIA 4WBRD 4HEA2 2LV3A 2TRCP 4NV2A 1M7TA 4TOPA 5G5FA 4G0IA 4QL7A 1ZMAA 3BD2A 2GQMA 5A4VA 2O85A 1T3BA 4ULXA 3KP8A 1YQ1A 5C00A 5F05A 5ECOB 4MF6A 3F3QA 4XHMA 2C3QA 1YF0A 1OC8A 1PFOA 3KIJA 1AC1A 3DRNA 4Q5FA 2L5LA 1V40A 2WS2A 4ZB6A 4ECCA 1PQNA 1GSEA 4AGSA 2IFQB 1MTCA 1GTIA 4EXJA 3HYPA 4JU5A 3TJKA 4WXTA 1F3AA 3VPTA 2B6MA 2LRCA 4K0GA 4X1UA 1YY7A 1THOA 1WE0A 1PSQA 4MH3A 3E3EA 5D96A 3MYDA 3VI7A 1ACVA 3GSTA 5J5NA 1A0RP 2E0QA 3F4TA 2H76A 1DUGA 5IMDA 5GSSA 1M0UA 1E6BA 3HVNA 8GSSA 4NWYA 1GTUA 3KXOA 5LCZA 1SK2A 1IYIA 2CA8A 4V1Ag 2FD3A 4V1Ap 4EDYA 2XC2A 4N0ZA 4ZXGA 1XIYA 1KEBA 1PMTA 2LQQA 3D21A 2B5YA 4GLTA 3DWVA 3HDCA 3KTBA 3BOAA 2L57A 1F2EA 1KNGA 2TIRA 1PL1A 4TR1B 3GA4A 4GSNA 4MJCA 2C8UA 1O6JA 1Q4JA 1SL1B 1G0TA 2GS3A 12GSA 5IM9A 1SYRA 1USBA 5D9WA 4HS1A 2XBQA 1PA3A 4WR5A 1R4WA 4JE1A 4IHUA 2I3YA 4K8MA 4FYCA 3IR4A 3HXSA 1BYEA 1SL2B 5D9TA 4HU7A 1TTZA 2B5EA 3J7Yk 5KEJA 1SJZA 2AV4A 4HQZA 2X4AA 3TGZA 3ZL5A 4WKWA 4MK3A 4WEYA 4EE0A 4L8EA 4G2EA 1ERVA 1OYJA 3EU3A 4CDOA 3IOSA 2K9FA 3WT2A 3TOTA 2LEGA 4HU9A 2CZ2A 5IOXA 2O87A 2DKHA 5IPGA 3TJBA 5INYA 4PXOA 2A2RA 1GUHA 3UBKA 1Z7PA 2BTOT 3C7MA 18GSA 1ILOA 2OACA 1NW2A 1A8YA 4X43A 1O8WA 1SK0A 1ERTA 3A3TA 1YDKA 3DVWA 1YZXA 3RPNA 5IMAA 5G30A 2K6VA 2ON5A 2VIMA 4BWSA 1FOVA 1PGTA 2HZFA 4KX4A 1F37A 3Q19A 3TB2A 4F2IA 3TRPA 1XWGA 2C80A 2GZPA 5J4UA 4EVMA 2WJUA 3L9VA 3IHQA 2NBSA 1JHBA 4DSQA 2HYXA 2R6KA 3QFAC 1ZYEA 3LJRA 2AHEA 1DE1A 2P5QA 4KSOA 2I81A 4OFTA 2FY6A 3I69A 5ECRB 1NSWA 5IO2A 2E7PA 5ECQB 2GZZA 2OBIA 3R3EA 1Z6MA 3GH6A 4ISDA 1HYUA 5HR1A 3M1GA 4O5UA 4GQFA 3D6IA 4FYBA 2OJLA 4K7IA 2YN1A 1N2AA 3KMOA 1FAAA 3GL5A 2LS5A 1FW1A 5ENUA 1TK8B 2L6DA 1V58A 1U6TA 5HFIA 1URMA 3CRUA 1X9WB 2C0DA 4N30A 5HQPA 5ECHB 1SJIA 4I2TA 4PNGA 2NTOA 2FGXA 4ZBBA 4Z2UA 5COHA 2QA2A 2IMDA 2AAWA 2LNSA 4TKYA 2XPDA 2H74A 1A2LA 4AF2A 1M2BA 3VLNA 4K6XA 3CTGA 2R3XA 4Q5QA 4I2UA 4IKHA 2H6XA 3ZVJD 2HLSA 2H1AA 3UOMA 2HZEA 4MP4A 1XWAA 5JWOB 2MBTA 14GSA 4K5SA 4JZQA 2OA7A 3WYWA 3RHBA 2F9SA 1GLQA 3EYTA 2OKAA 3C1RA 2B7JA 5A4UA 3KH9A 6GSYA 4V2MA 2VCZA 2DJKA 5IMFA 3G7JA 3CSJA 4NV5A 2YZHA 4EDZA 2PUKC 2WCIA 1G7OA 2YWOA 1GSSA 2KLXA 2YJ7A 6GSWA 1B48A 2CT6A 2N5FA 3WT1A 3WGXA 1ZYNA 4EC0A 4Z2TA 3BJ5A 2LJKA 2DJJA 1PL2A 3P90A 2HRKA 3UVTA 1BG5A 3TKSE 1QGVA 3P8WA 1JZDA 5IMCA 3OR5A 3TKPA 5AN1A 3FK8A 2VUPA 4PURA 3ZTLA 4IN0A 3QDNA 2YANA 4KH7A 3GRXA 4OO4A 1SK1A 2FWHA 1EEJA 2IIYA 2GVPA 2JZTA 4G10A 2FCHA 2DMLA 9GSSA 2L6CA 2GSTA 3RDWA 1AAZA 1ST9A 4Z2RA 4F03A 3M9KA 1QK8A 3ZFLA 3FY7A 3QFBC 1B9YC 5ELGA 4WBJA 3GKMA 5H5RA 4EO3A 4BVXA 3TRXA 5B8BA 3ZRDA 5ECNB 2HZEB 2RLIA 1GL8A 4MNNA 1WP0A 3LORA 1RW1A 5CNWA 4GTUA 2G2QA 1K0OA 1PKZA 3O76A 3L4NA 2K8SA 4I97A 1EOHA 2CV4A 4POMA 4OCEA 5ID2A 3F63A 1LJRA 2O89A 3A5WA 1X5EA 5CRGA 4JR4A 5F8BA 5D8IA 1Z9HA 3IAS2 3E0UA 3KEBA 2H01A 2JADA 3HY2A 3TOUA 3HD5A 2JSZA 5B6MA 1W4VA 3EMXA 1G6YA 4EKZA 3ZMLA 2HFDA 3CTFA 1LBKA 3RAZA 6GSUA 4POKA 4V2NA 3EINA 1GSFA 5DJLA 2CAIA 1OAZA 1GUKA 2CX3A 3ZFBA 2H75A 2ES7A 4HSCX 3KP9A 5B8AA 3E9JB 1B4QA 3TKSC 2MMZA 4BIKA 2LKUA 1TW9A 2RM6A 4EIQA 5HR3A 3G7IA 2GLRA 5FT3A 2H6YA 2X99A 5CYYA 1TJDA 1WWJA 2QGVA 5HR2A 1VF4A 1SKRB 4PGTA 1M9AA 3HJMA 1QQ2A 2ALBA 3TDGA 2N5BA 3QAWA 2IN3A 3GX8A 3DD3A 3LWAA 3HHVA 2F8FA 2A4HA 2VLUA 5C04A 2VOCA 3LG6A 1HNBA 1JZOA 5H5SA 2H71A 2EIRA 3DGQA 2JL4A 3APQA 1TK5B 1GNEA 1EV4A 1O8XA 2H6ZA 2B1KA 1C72A 1MD4A 3DYRA 4L0WA 5ECSA 3WGEA 19GSA 3ZVJA 1NHYA 1TU7A 2OE0A 1BX9A 4BVXB 3GHAA 1WJKA 4MPGA 5B6NA 2FNOA 2MMOA 5LNKe 1OC3A 4KUNA 3I9V2 4MZWA 1YEXA 4YQUA 2Z9SA 3EE2A 2HI7A 4PNFA 1AXDA 2LJAA 2H72A 1NM3A 1XCCA 1EV9A 2GQLA 1VF2A 5ID2B 4LMVA 5DQSA 2X8HA 4PUAA 6GSXA 3GV1A 4IVFA 20GSA 3LYPA 2GGTA 1CQGA 2YOIA 3GURA 3N5OA 4TRXA 2P0GA 3IK9A 4V2LA 2C0GA 1EGRA 2A2SA 1X9SB 1ZL9A 1V2AA 4ZBDA 4G0KA 3JCML 4HZ2A 2LUSA 2V41A 1DE2A 4F0CA 3L0HA 1UVZA 3VK9A 4F82A 4N11A 1MDKA 1GH2A 2FA4A 3RPPA 2YV9A 3KM6A 3LEFA 3A5IA 3UVHA 1M9BA 4XS6A 1XWCA 1HNAA 2V6OA 2HT9A 3PR8A 3ME7A 5CRHA 1SKWB 4K7OA 4MMMA 2IPAA 1EP7A 3FKFA 5E4WA 3BCIA 1AUCA 5ECMB 3EVIA 4G19A 1G7EA 3L9UA 3Q18A 1TI3A 1SKSB 1TKDB 3GKNA 4ILFA 1OKDA 1AQXA 1TU8A 1N8JA 4A5PA 2DJ3A 2HSMA 2E2MA 3GIXA 1ZGNA 3PPUA 2PN8A 2VCWA 1TRSA 5JCUA 2GSRA 2CVBA 1AIUA 2F51A 2WGRA 4O92A 4F0BA 1A2MA 2H0HA 3PH9A 5ECLB 1PN9A 2HSYA 4X4JA 2ON7A 1M3JA 3GYKA 4RQRA 3F4SA 1TRUA 5KOXA 4KSMA 2DKIA 1GSUA 3UBLA 2R5GA 1S3RA 3IK7A 2YV7A 3DEXA 13GSA 3EURA 3WGDA 4BVYA 4DSRA 3QR6A 7GSSA 2WB9A 3LSZA 4DVCA 5KOWA 1AQVA 1EWXA 2DBCA 3PGTA 1ZOFA 2O8VB 4GXZA 2DJ0A 4O5QA 5CO3A 1YEPA 2FWFA 2R2JA 1MDIA 1RK4A 4LLRA 5J3RA 3C1SA 4I6XA 4YKFA 4ACSA 3ZMKA 4GRFA 5FHIA 1SJ6A 10GSA 3ZREA 1WMJA 3GNJA 1QMVA 4L5OA 1S3CA 2PU9C 3W8JA 1NHOA 2YWNA 1JLVA 1PRXA 1ZCPA 4IELA 3TJJA 3PINA 1BQ7A 3HA9A 2MBSA 4KAEA 3KGKA 2VCXA 1R26A 2DMMA 5CREA 1VRSD 2UZ8A 4EL1A 5HR0A 2RIIA 4J56E 2PVOC 5IIZA 2BJXA 3TUEA 2KHPA 2XHFA 3LXZA 4YH2A 1LU4A 4ZB9A 1GULA 4HDEA 5F07A 3NZNA 5ECPB 2KP2A 4GCIA 3GH9A 3S9FA 2NVLA 4EF0A 2O7KA 1TRVA 3UL3A 2HRFA 4IBPA 4YKGA 3UMAA 5A5KA 1MEKA 3DXBA 4IP6A 1XOAA 4KNDA 3H93A 2EIQA 3DKSA 4MPFA 5DVBA 2H66A 2L5OA 5IMVA 2XPEA 3GFKA 4NMUA 4YQMA 2H73A 1GLPA 1THXA 4IW9A 2BMXA 1K3YA 1S3DA 3H79A 5G2ZA 2M46A 3ED3A 4TVEA 2NPBA 4POBA 5KN3A 1CQHA 3TCOA 1M2DA 3VWVA 1FO5A 2WDUA 4ML6A 3CYNA 4MH2A 4OO5A 1XZOA 2A2PA 1T8EB 5EPFA 1OVNA 3ZLPA 1TK0B 3D22A 3LQ7A 4BVYB 4CHSA 3DMLA 5KN2A 3GX0A 4ZIJA 16GSA 5IQYA 2ZCTA 2L4CA 4LL1B 1ZYQB 3HVXA 3O3TA 1EZKA 2G0FA 3KMNA 1XWKA 5EVOA 2E2GA 4XCSA 1PN0A 1Y25A 4ID0A 1HD2A 3J7Yb 3IAM2 1O81A 2B7KA 5IMZA 1XOBA 3BCKA 5F06A 1OE7A 4ZL8A 1U3AA 1KTEA 4NHWA 3RBTA 1TXXA 1GSDA 2FA8A 1BEDA 3TKQA 4RI7A 1GUMA 2X8CA 1OKTA 2GZYA 1Z6NA 5JWRB 1FB0A 4HZ4A 4EIPA 2V6KA 2C3TA 3G7YA 2CVKA 1GSYA 2VL2A 5GSTA 2C0EA 2M72A 3IA1A 1B8XA 4K0NA 5EY6A 2H19A 2PGTA 3IPZA 2R0CA 3M8NA 3I43A 4PX1A 1XFLA 2GDRA 3DVXA 1Z7RA 2HSHA 4MA9A 4D73A 3QOUA 3ZZXA 4ICYA 2QKEA 2JZSA 1EP8A 2IMKA 4N0VA 1R7HA 1A23A 4YAPA 1M2AA 3Q6OA 3IDVA 2H30A 1VF1A 1WIKA 5KN1A 5G1KA 2KP1A 3HKRA 3M0FA 11GSA 1PD21 1TP9A 3C73A 1GP1A 1JZWA 2H1DA 2YCDA 2RUEA 1B4PA 3ME8A 4WETA 1K0CA 2N5AA 3A2WA 2VLTA 3D4TA 1V98A 2P31A 2DJ2A 4JR6A 1TOFA 2B3SA 3H1NA 1A0FA 3VWXA 3HZ4A 5KN0A 2H1BA 1XW5A 2RM5A 3TJFA 3CXGA 2ZNMA 3GN3A 2X64A 4ZBAA 2I4AA 5B7CA 4Z7XA 3QAGA 3MIXA 3C71A 1ABAA 4TXOA 3F6DA 4XRAA 3ZIVA 5CAXA 1ZYPA 1UA5A 4LA1A 2HE3A 4IGJA 4BA7A 3L78A 4AJ7A 2VL3A 2PMTA 4MJAA 1F3BA 5F0GA 4BWQA 5BRTA 3APOA 2WRTA 5G1LA 5H5QA 1R5PA 1GWCA 2VLVA 2L4QA 3ZYWA 2CX4A 4TR0A 5GAND 4IP1A 4KF9A 1MDJA 2PWJA 4GF0A 3NOFA 1DBYA 4QL9A 1YJ6A 3FZ5A 1T1VA 4JRRA 2HNLA 1FG4A 2LSTA 1I5GA 1A24A 4OCFA 4QQ7A 2C0FA 1O85A 2PBJA 1YKCA 4D73B 4PQ1A 1XW6A 1XBSA 4OMVA 1SU9A 4KE3A 5JCGA 1GTBA 3VWUA 3F8UA 4DSSA 4YAVA 4AJ6A 1O7UA 4AJ8A 1EGOA 5ELAA 3HJPA 1XW9A 4TR4A 4X0XA 4CW9A 2X8GA 1V57A 4OWYA 4USSA 1JLWA 3A2VA 2YP6A 3QD9A 2GT6A 1SYXA 3F0IA 3HVVA 3LYKA 5GAPD 1U3IA 3HJOA 2H8LA 5DCHA 3Q74A 3IXRA 2ZUPA 3IBHA 2B1LA 1XXUA 4GSTA
chains in the Genus database with same CATH topology
3FZAA 2J23A 5L71A 1O73A 3LGCA 4TXOB 4CY8A 3F4RA 1UC7A 1X9MB 2V32A 2L59A 1MD3A 3CSHA 1SD9A 2FHEA 1F6MC 2VM1A 3HZ8A 2GSSA 3D0ZA 4E8HA 2HXKA 1OC9A 2AB6A 1YF1A 3N9JA 4DEJA 6GSSA 2VM2A 3ISOA 3MSZA 3IC4A 4J2FA 4GQCA 1ML6A 2GQKA 1SD8A 1W89A 3GMFA 4KB3A 5DBQA 2C3NA 3H4KA 4HQSA 5LD0A 3F6FA 3I6AA 1K0DA 3US3A 3LFLA 4O7HA 3GKXA 4TXVA 5DQYA 4KDXA 1GRXA 2RUFA 2VD1A 1SL0B 3VPQA 4TW5A 4KCAA 2FWGA 4K2DA 3R2QA 1VF3A 1AQWA 1WOUA 5ABRA 2H70A 3IRAA 2I1UA 4DSSB 2A4VA 4RQXA 4XS1A 3GTUA 5CRWA 3TRQA 4XTSA 2MYGA 4N10A 2WZ9A 3ERWA 3U6VA 3W6GA 2YNXA 3O6TA 4J57E 5GZZB 2OE1A 3VURA 2VL2C 3VI5A 2X49A 1ERUA 2R37A 1T4ZA 2F8AA 1ON4A 3UAPA 1ERWA 3V1WA 4XRDA 2J9HA 3TKSA 3A2XA 2M80A 4HJ2A 3QCPA 2DJ1A 2QA1A 5DAKA 2IL3A 3D4MA 1GTAA 1K0MA 4IJIA 2WULA 1V9WA 1K3OA 4BL7A 4E8EA 3FEUA 5HFGA 2REMA 5CRDA 2H0IA 4K9ZA 3FYGA 4MABA 4CY6A 1I9DA 4ECJA 4RUVA 4IS0A 4LL4B 5J41A 4LMWA 1OC9B 2JU5A 4PTSA 1T4YA 3FW2A 2YZUA 3APSA 3EWLA 2CQ9A 4JBBA 1QFNA 2C1YA 3FR3A 3SWLA 2VO4A 2GT5A 2VAFA 1FB6A 1ZZYA 2VCVA 4MJBA 3HVSA 2D2ZA 4WF5A 1J0FA 2I9HA 2PPTA 1XPVA 4NAXA 4Q5NA 1HQOA 4I8BA 2VCTA 2K18A 4KW6A 4HUAA 4K7NA 3GSSA 4MZCA 4IQAA 2YWIA 3U5RE 1K3LA 3IV4A 2DIZA 1J9BA 4WF4A 1M99A 3TJGA 3F3RA 1UN2A 4Q5RA 5HFKA 1DSBA 3L9SA 5AIVA 2AJQB 4F9ZA 2CVDA 2LRNA 5JCWA 1TDIA 2GSQA 1BAYA 4HJMA 4H86A 5E59A 4HOJA 2OE3A 4ZL7A 3M9JA 2CZ3A 2R0GA 6GSTA 3GTUB 3EMPA 4RI6A 2P5RA 1JFUA 1XVQA 5ECIB 2MMAA 4K5RA 5A4WA 4FIWA 1H75A 5DDLA 4O32A 2DLXA 3CMIA 1Z3EA 3HCZA 3FRCA 3FZ4A 5D9XA 2FUG2 2YWMA 2IMEA 5D9VA 4NHZA 5EL8A 2V1MA 4WR4A 2R0PA 3IC8A 3GUSA 4ZILA 3IHGA 4FYUA 3UEMA 3CBUA 4POLA 1X5CA 2MZCA 1EOGA 1IYHA 3W8SA 1GSQA 4K1FA 2F3MA 4XIHA 1A2JA 4P3YB 2AYTA 4XS4A 5DAKB 1FOHA 3EU4A 1HNCA 3C8EA 2LRTA 2LJRA 4BL7B 2VD0A 2AUVA 2C4JA 1YKAA 2V2GA 4FQUA 5ECKB 3BBYA 4NXIA 2QC7A 3WD6A 4O5RA 3P2AA 2IWTA 1QUWA 1FVJA 2PERA 2JSYA 2HRAA 1KBNA 5BMUA 2DSAA 1A8LA 3FZ9A 3CRTA 3MWHA 4MJEA 4K2XA 2H1GA 2JACA 4NPBA 5AISA 3FMWA 4HI7A 3NIVA 3QMXA 3FHKA 3AY8A 1K0NA 1K0AA 3UARA 3GKKA 4L0UA 1S3AA 5IO0A 5IPHA 4GSSA 2HRNA 5G5EA 3ERFA 3KTLA 2EIOA 3ERGA 2B5XA 2DIYA 2LQOA 17GSA 4PQHA 5DJMA 3G9BA 3MAKA 2LNTA 5D73A 3H8QA 22GSA 1E2YA 2CAQA 2IMIA 4KGIA 4IJ3A 1JZRA 3FR6A 2IJYA 1F9MA 2MMNA 5DALA 4KCEA 3MDKA 3QPMA 2R4VA 2WFCA 1EEMA 1BJXA 4OFNA 1FHEA 2TRXA 5DCGA 4L5LA 3EPTA 3VWWA 4JEDA 3DIEA 3IE3A 4TN8A 4ML1A 2JZRA 1GNWA 4IQ1A 1Q98A 4MF7A 2LTKA 3KJYA 4YQVA 2H0GA 1TRWA 4MDCA 4G0LA 2EC4A 4MZBA 5IOWA 4XS4B 1H4OA 1Y6EA 3UIWA 2DC5A 6GSVA 4KDYA 5JWQB 2QSIA 4PQIA 4KA0A 1U87A 2IFQA 3FR9A 3KH7A 3LW9A 3K8NA 1X5DA 3KD0A 5CP1A 2OBKA 5J9CA 3SBCA 2KOKA 1PKWA 3GL3A 3ZIJA 4GWRA 3D5JA 5AGYA 2FLSA 3M3MA 2K8VA 1SENA 3LXTA 4ZB8A 4ECBA 2KUCA 4MLYA 1PX7A 5J9BA 5G31A 1X0RA 1XWBA 3TKRA 1U88A 2GTUA 3F9UA 4I5QA 4ECIA 1K0BA 1Z5YE 3VFIA 3KCMA 1OE8A 2OADA 3EC3A 2YPMA 3CSIA 2PVQA 2YJHA 2IMFA 4MCUA 3MNGA 3UJ1A 1AW9A 2VCQA 4G9HA 1RQMA 1T00A 5D93A 3P7XA 4ZL9A 4BPYA 4TR1A 1B9XC 1FVKA 2VL9A 4OFMA 1TI1A 1T7PB 5DALB 3QAVA 3KZQA 4TR3A 3ZITA 1J08A 5FWGA 4KDUA 1XVWA 3RHCA 4EUYA 1WRYA 2NDOA 5AIXA 1PX6A 1VGLA 1G6WA 4OD7A 4FH8A 4MF5A 2FWEA 1R5AA 4PUFC 4FO5A 1WPIA 1QXHA 2XBIA 4WBRD 4HEA2 2LV3A 2TRCP 4NV2A 1M7TA 4TOPA 5G5FA 4G0IA 4QL7A 1ZMAA 3BD2A 2GQMA 5A4VA 2O85A 1T3BA 4ULXA 3KP8A 1YQ1A 5C00A 5F05A 5ECOB 4MF6A 3F3QA 4XHMA 2C3QA 1YF0A 1OC8A 3KIJA 1AC1A 3DRNA 4Q5FA 2L5LA 1V40A 2WS2A 4ZB6A 4ECCA 1PQNA 1GSEA 4AGSA 2IFQB 1MTCA 1GTIA 4EXJA 3HYPA 4JU5A 3TJKA 4WXTA 1F3AA 3VPTA 2B6MA 2LRCA 4K0GA 4X1UA 1YY7A 1THOA 1WE0A 1PSQA 4MH3A 3E3EA 5D96A 3MYDA 3VI7A 1ACVA 3GSTA 5J5NA 1A0RP 2E0QA 3F4TA 2H76A 1DUGA 5IMDA 5GSSA 1M0UA 1E6BA 8GSSA 4NWYA 1GTUA 3KXOA 5LCZA 1SK2A 1IYIA 2CA8A 4V1Ag 2FD3A 4V1Ap 4EDYA 2XC2A 4N0ZA 4ZXGA 1XIYA 1KEBA 1PMTA 2LQQA 3D21A 2B5YA 4GLTA 3DWVA 3HDCA 3KTBA 3BOAA 2L57A 1F2EA 1KNGA 2TIRA 1PL1A 4TR1B 3GA4A 4GSNA 4MJCA 2C8UA 1O6JA 1Q4JA 1SL1B 1G0TA 2GS3A 12GSA 5IM9A 1SYRA 1USBA 5D9WA 4HS1A 2XBQA 1PA3A 4WR5A 1R4WA 4JE1A 4IHUA 2I3YA 4K8MA 4FYCA 3IR4A 3HXSA 1BYEA 1SL2B 5D9TA 4HU7A 1TTZA 2B5EA 3J7Yk 5KEJA 1SJZA 2AV4A 4HQZA 2X4AA 3TGZA 3ZL5A 4WKWA 4MK3A 4WEYA 4EE0A 4L8EA 4G2EA 1ERVA 1OYJA 3EU3A 4CDOA 3IOSA 2K9FA 3WT2A 3TOTA 2LEGA 4HU9A 2CZ2A 5IOXA 2O87A 2DKHA 5IPGA 3TJBA 5INYA 4PXOA 2A2RA 1GUHA 3UBKA 1Z7PA 2BTOT 3C7MA 18GSA 1ILOA 2OACA 1NW2A 1A8YA 4X43A 1O8WA 1SK0A 1ERTA 3A3TA 1YDKA 3DVWA 1YZXA 3RPNA 5IMAA 5G30A 2K6VA 2ON5A 2VIMA 4BWSA 1FOVA 1PGTA 2HZFA 4KX4A 1F37A 3Q19A 3TB2A 4F2IA 3TRPA 1XWGA 2C80A 2GZPA 5J4UA 4EVMA 2WJUA 3L9VA 3IHQA 2NBSA 1JHBA 4DSQA 2HYXA 2R6KA 3QFAC 1ZYEA 3LJRA 2AHEA 1DE1A 2P5QA 4KSOA 2I81A 4OFTA 2FY6A 3I69A 5ECRB 1NSWA 5IO2A 2E7PA 5ECQB 2GZZA 2OBIA 3R3EA 1Z6MA 3GH6A 4ISDA 1HYUA 5HR1A 3M1GA 4O5UA 4GQFA 3D6IA 4FYBA 2OJLA 4K7IA 2YN1A 1N2AA 3KMOA 1FAAA 3GL5A 2LS5A 1FW1A 5ENUA 1TK8B 2L6DA 1V58A 1U6TA 5HFIA 1URMA 3CRUA 1X9WB 2C0DA 4N30A 5HQPA 5ECHB 1SJIA 4I2TA 4PNGA 2NTOA 2FGXA 4ZBBA 4Z2UA 5COHA 2QA2A 2IMDA 2AAWA 2LNSA 4TKYA 2XPDA 2H74A 1A2LA 4AF2A 1M2BA 3VLNA 4K6XA 3CTGA 2R3XA 4Q5QA 4I2UA 4IKHA 2H6XA 3ZVJD 2HLSA 2H1AA 3UOMA 2HZEA 4MP4A 1XWAA 5JWOB 2MBTA 14GSA 4K5SA 4JZQA 2OA7A 3WYWA 3RHBA 2F9SA 1GLQA 3EYTA 2OKAA 3C1RA 2B7JA 5A4UA 3KH9A 6GSYA 4V2MA 2VCZA 2DJKA 5IMFA 3G7JA 3CSJA 4NV5A 2YZHA 4EDZA 2PUKC 2WCIA 1G7OA 2YWOA 1GSSA 2KLXA 2YJ7A 6GSWA 1B48A 2CT6A 2N5FA 3WT1A 3WGXA 1ZYNA 4EC0A 4Z2TA 3BJ5A 2LJKA 2DJJA 1PL2A 3P90A 2HRKA 3UVTA 1BG5A 3TKSE 1QGVA 3P8WA 1JZDA 5IMCA 3OR5A 3TKPA 5AN1A 3FK8A 2VUPA 4PURA 3ZTLA 4IN0A 3QDNA 2YANA 4KH7A 3GRXA 4OO4A 1SK1A 2FWHA 1EEJA 2IIYA 2GVPA 2JZTA 4G10A 2FCHA 2DMLA 9GSSA 2L6CA 2GSTA 3RDWA 1AAZA 1ST9A 4Z2RA 4F03A 3M9KA 1QK8A 3ZFLA 3FY7A 3QFBC 1B9YC 5ELGA 4WBJA 3GKMA 5H5RA 4EO3A 4BVXA 3TRXA 5B8BA 3ZRDA 5ECNB 2HZEB 2RLIA 1GL8A 4MNNA 1WP0A 3LORA 1RW1A 5CNWA 4GTUA 2G2QA 1K0OA 1PKZA 3O76A 3L4NA 2K8SA 4I97A 1EOHA 2CV4A 4POMA 4OCEA 5ID2A 3F63A 1LJRA 2O89A 3A5WA 1X5EA 5CRGA 4JR4A 5F8BA 5D8IA 1Z9HA 3IAS2 3E0UA 3KEBA 2H01A 2JADA 3HY2A 3TOUA 3HD5A 2JSZA 5B6MA 1W4VA 3EMXA 1G6YA 4EKZA 3ZMLA 2HFDA 3CTFA 1LBKA 3RAZA 6GSUA 4POKA 4V2NA 3EINA 1GSFA 5DJLA 2CAIA 1OAZA 1GUKA 2CX3A 3ZFBA 2H75A 2ES7A 3KP9A 5B8AA 3E9JB 1B4QA 3TKSC 2MMZA 2LKUA 1TW9A 2RM6A 4EIQA 5HR3A 3G7IA 2GLRA 5FT3A 2H6YA 2X99A 5CYYA 1TJDA 1WWJA 2QGVA 5HR2A 1VF4A 1SKRB 4PGTA 1M9AA 3HJMA 1QQ2A 2ALBA 3TDGA 2N5BA 3QAWA 2IN3A 3GX8A 3DD3A 3LWAA 3HHVA 2F8FA 2A4HA 2VLUA 5C04A 2VOCA 3LG6A 1HNBA 1JZOA 5H5SA 2H71A 2EIRA 3DGQA 2JL4A 3APQA 1TK5B 1GNEA 1EV4A 1O8XA 2H6ZA 2B1KA 1C72A 1MD4A 3DYRA 4L0WA 5ECSA 3WGEA 19GSA 3ZVJA 1NHYA 1TU7A 2OE0A 1BX9A 4BVXB 3GHAA 1WJKA 4MPGA 5B6NA 2FNOA 2MMOA 5LNKe 1OC3A 4KUNA 3I9V2 4MZWA 1YEXA 4YQUA 2Z9SA 3EE2A 2HI7A 4PNFA 1AXDA 2LJAA 2H72A 1NM3A 1XCCA 1EV9A 2GQLA 1VF2A 5ID2B 4LMVA 5DQSA 2X8HA 4PUAA 6GSXA 3GV1A 4IVFA 20GSA 3LYPA 2GGTA 1CQGA 2YOIA 3GURA 3N5OA 4TRXA 2P0GA 3IK9A 4V2LA 2C0GA 1EGRA 2A2SA 1X9SB 1ZL9A 1V2AA 4ZBDA 4G0KA 3JCML 4HZ2A 2LUSA 2V41A 1DE2A 4F0CA 3L0HA 1UVZA 3VK9A 4F82A 4N11A 1MDKA 1GH2A 2FA4A 3RPPA 2YV9A 3KM6A 3LEFA 3A5IA 3UVHA 1M9BA 4XS6A 1XWCA 1HNAA 2V6OA 2HT9A 3PR8A 3ME7A 5CRHA 1SKWB 4K7OA 4MMMA 2IPAA 1EP7A 3FKFA 5E4WA 3BCIA 1AUCA 5ECMB 3EVIA 4G19A 1G7EA 3L9UA 3Q18A 1TI3A 1SKSB 1TKDB 3GKNA 4ILFA 1OKDA 1AQXA 1TU8A 1N8JA 4A5PA 2DJ3A 2HSMA 2E2MA 3GIXA 1ZGNA 3PPUA 2PN8A 2VCWA 1TRSA 5JCUA 2GSRA 2CVBA 1AIUA 2F51A 2WGRA 4O92A 4F0BA 1A2MA 2H0HA 3PH9A 5ECLB 1PN9A 2HSYA 4X4JA 2ON7A 3GYKA 4RQRA 3F4SA 1TRUA 5KOXA 4KSMA 2DKIA 1GSUA 3UBLA 2R5GA 3IK7A 2YV7A 3DEXA 13GSA 3EURA 3WGDA 4BVYA 4DSRA 3QR6A 7GSSA 2WB9A 3LSZA 4DVCA 5KOWA 1AQVA 1EWXA 2DBCA 3PGTA 1ZOFA 2O8VB 4GXZA 2DJ0A 4O5QA 5CO3A 1YEPA 2FWFA 2R2JA 1MDIA 1RK4A 4LLRA 5J3RA 3C1SA 4I6XA 4YKFA 4ACSA 3ZMKA 4GRFA 5FHIA 1SJ6A 10GSA 3ZREA 1WMJA 3GNJA 1QMVA 4L5OA 1S3CA 2PU9C 3W8JA 1NHOA 2YWNA 1JLVA 1PRXA 1ZCPA 4IELA 3TJJA 3PINA 1BQ7A 3HA9A 2MBSA 4KAEA 3KGKA 2VCXA 1R26A 2DMMA 5CREA 1VRSD 2UZ8A 4EL1A 5HR0A 2RIIA 4J56E 2PVOC 5IIZA 2BJXA 3TUEA 2KHPA 2XHFA 3LXZA 4YH2A 1LU4A 4ZB9A 1GULA 4HDEA 5F07A 3NZNA 5ECPB 2KP2A 4GCIA 3GH9A 3S9FA 2NVLA 4EF0A 2O7KA 1TRVA 3UL3A 2HRFA 4IBPA 4YKGA 3UMAA 5A5KA 1MEKA 3DXBA 4IP6A 1XOAA 4KNDA 3H93A 2EIQA 3DKSA 4MPFA 5DVBA 2H66A 2L5OA 5IMVA 2XPEA 3GFKA 4NMUA 4YQMA 2H73A 1GLPA 1THXA 4IW9A 2BMXA 1K3YA 1S3DA 3H79A 5G2ZA 2M46A 3ED3A 4TVEA 2NPBA 4POBA 5KN3A 1CQHA 3TCOA 1M2DA 3VWVA 1FO5A 2WDUA 4ML6A 3CYNA 4MH2A 4OO5A 1XZOA 2A2PA 1T8EB 5EPFA 1OVNA 3ZLPA 1TK0B 3D22A 3LQ7A 4BVYB 4CHSA 3DMLA 5KN2A 3GX0A 4ZIJA 16GSA 5IQYA 2ZCTA 2L4CA 4LL1B 1ZYQB 3HVXA 3O3TA 1EZKA 2G0FA 3KMNA 1XWKA 5EVOA 2E2GA 4XCSA 1PN0A 1Y25A 4ID0A 1HD2A 3J7Yb 3IAM2 1O81A 2B7KA 5IMZA 1XOBA 3BCKA 5F06A 1OE7A 4ZL8A 1U3AA 1KTEA 4NHWA 3RBTA 1TXXA 1GSDA 2FA8A 1BEDA 3TKQA 4RI7A 1GUMA 2X8CA 1OKTA 2GZYA 1Z6NA 5JWRB 1FB0A 4HZ4A 4EIPA 2V6KA 2C3TA 3G7YA 2CVKA 1GSYA 2VL2A 5GSTA 2C0EA 2M72A 3IA1A 1B8XA 4K0NA 5EY6A 2H19A 2PGTA 3IPZA 2R0CA 3M8NA 3I43A 4PX1A 1XFLA 2GDRA 3DVXA 1Z7RA 2HSHA 4MA9A 4D73A 3QOUA 3ZZXA 4ICYA 2QKEA 2JZSA 1EP8A 2IMKA 4N0VA 1R7HA 1A23A 4YAPA 1M2AA 3Q6OA 3IDVA 2H30A 1VF1A 1WIKA 5KN1A 5G1KA 2KP1A 3HKRA 3M0FA 11GSA 1PD21 1TP9A 3C73A 1GP1A 1JZWA 2H1DA 2YCDA 2RUEA 1B4PA 3ME8A 4WETA 1K0CA 2N5AA 3A2WA 2VLTA 3D4TA 1V98A 2P31A 2DJ2A 4JR6A 1TOFA 2B3SA 3H1NA 1A0FA 3VWXA 3HZ4A 5KN0A 2H1BA 1XW5A 2RM5A 3TJFA 3CXGA 2ZNMA 3GN3A 2X64A 4ZBAA 2I4AA 5B7CA 4Z7XA 3QAGA 3MIXA 3C71A 1ABAA 4TXOA 3F6DA 4XRAA 3ZIVA 5CAXA 1ZYPA 1UA5A 4LA1A 2HE3A 4IGJA 4BA7A 3L78A 4AJ7A 2VL3A 2PMTA 4MJAA 1F3BA 5F0GA 4BWQA 5BRTA 3APOA 2WRTA 5G1LA 5H5QA 1R5PA 1GWCA 2VLVA 2L4QA 3ZYWA 2CX4A 4TR0A 5GAND 4IP1A 4KF9A 1MDJA 2PWJA 4GF0A 3NOFA 1DBYA 4QL9A 1YJ6A 3FZ5A 1T1VA 4JRRA 2HNLA 1FG4A 2LSTA 1I5GA 1A24A 4OCFA 4QQ7A 2C0FA 1O85A 2PBJA 1YKCA 4D73B 4PQ1A 1XW6A 1XBSA 4OMVA 1SU9A 4KE3A 5JCGA 1GTBA 3VWUA 3F8UA 4DSSA 4YAVA 4AJ6A 1O7UA 4AJ8A 1EGOA 5ELAA 3HJPA 1XW9A 4TR4A 4X0XA 4CW9A 2X8GA 1V57A 4OWYA 4USSA 1JLWA 3A2VA 2YP6A 3QD9A 2GT6A 1SYXA 3F0IA 3HVVA 3LYKA 5GAPD 1U3IA 3HJOA 2H8LA 5DCHA 3Q74A 3IXRA 2ZUPA 3IBHA 2B1LA 1XXUA 4GSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZA A;  2J23 A;  5L71 A;  1O73 A;  3LGC A;  4TXO B;  3F4R A;  1UC7 A;  1X9M B;  2V32 A;  2L59 A;  1MD3 A;  3CSH A;  1SD9 A;  2FHE A;  1F6M C;  2VM1 A;  3HZ8 A;  2GSS A;  3D0Z A;  4E8H A;  2HXK A;  1OC9 A;  2AB6 A;  1YF1 A;  3N9J A;  4DEJ A;  6GSS A;  2VM2 A;  3ISO A;  3MSZ A;  3IC4 A;  4J2F A;  4GQC A;  1ML6 A;  2GQK A;  1SD8 A;  1W89 A;  3GMF A;  4KB3 A;  5DBQ A;  2C3N A;  3H4K A;  4HQS A;  5LD0 A;  3F6F A;  3I6A A;  1K0D A;  3US3 A;  3LFL A;  4O7H A;  3GKX A;  4TXV A;  5DQY A;  4KDX A;  1GRX A;  2RUF A;  2VD1 A;  1SL0 B;  3VPQ A;  4TW5 A;  4KCA A;  2FWG A;  4K2D A;  3R2Q A;  1VF3 A;  1AQW A;  1WOU A;  5ABR A;  2H70 A;  3IRA A;  2I1U A;  4DSS B;  2A4V A;  4RQX A;  4XS1 A;  3GTU A;  5CRW A;  3TRQ A;  4XTS A;  2MYG A;  4N10 A;  2WZ9 A;  3ERW A;  3U6V A;  3W6G A;  2YNX A;  3O6T A;  4J57 E;  5GZZ B;  2OE1 A;  3VUR A;  2VL2 C;  3VI5 A;  1ERU A;  2R37 A;  1T4Z A;  2F8A A;  1ON4 A;  3UAP A;  1ERW A;  3V1W A;  4XRD A;  2J9H A;  3TKS A;  3A2X A;  2M80 A;  4HJ2 A;  3QCP A;  2DJ1 A;  5DAK A;  2IL3 A;  3D4M A;  1GTA A;  1K0M A;  4IJI A;  2WUL A;  1V9W A;  1K3O A;  4BL7 A;  4E8E A;  3FEU A;  5HFG A;  2REM A;  5CRD A;  2H0I A;  4K9Z A;  3FYG A;  4MAB A;  1I9D A;  4ECJ A;  4RUV A;  4IS0 A;  4LL4 B;  5J41 A;  4LMW A;  1OC9 B;  2JU5 A;  1T4Y A;  3FW2 A;  2YZU A;  3APS A;  3EWL A;  2CQ9 A;  4JBB A;  1QFN A;  2C1Y A;  3FR3 A;  3SWL A;  2VO4 A;  2GT5 A;  2VAF A;  1FB6 A;  1ZZY A;  2VCV A;  4MJB A;  3HVS A;  2D2Z A;  4WF5 A;  1J0F A;  2I9H A;  2PPT A;  1XPV A;  4NAX A;  4Q5N A;  1HQO A;  4I8B A;  2VCT A;  2K18 A;  4KW6 A;  4HUA A;  4K7N A;  3GSS A;  4MZC A;  4IQA A;  2YWI A;  3U5R E;  1K3L A;  3IV4 A;  2DIZ A;  1J9B A;  4WF4 A;  1M99 A;  3TJG A;  3F3R A;  1UN2 A;  4Q5R A;  5HFK A;  1DSB A;  3L9S A;  5AIV A;  2AJQ B;  4F9Z A;  2CVD A;  2LRN A;  5JCW A;  1TDI A;  2GSQ A;  1BAY A;  4HJM A;  4H86 A;  5E59 A;  4HOJ A;  2OE3 A;  4ZL7 A;  3M9J A;  2CZ3 A;  6GST A;  3GTU B;  3EMP A;  4RI6 A;  2P5R A;  1JFU A;  1XVQ A;  5ECI B;  2MMA A;  5A4W A;  4FIW A;  1H75 A;  5DDL A;  4O32 A;  2DLX A;  3CMI A;  1Z3E A;  3HCZ A;  3FRC A;  3FZ4 A;  5D9X A;  2FUG 2;  2YWM A;  2IME A;  5D9V A;  4NHZ A;  5EL8 A;  2V1M A;  4WR4 A;  3GUS A;  4ZIL A;  4FYU A;  3UEM A;  3CBU A;  4POL A;  1X5C A;  2MZC A;  1EOG A;  1IYH A;  3W8S A;  1GSQ A;  4K1F A;  2F3M A;  4XIH A;  1A2J A;  4P3Y B;  2AYT A;  4XS4 A;  5DAK B;  3EU4 A;  1HNC A;  3C8E A;  2LRT A;  2LJR A;  2VD0 A;  2AUV A;  2C4J A;  1YKA A;  2V2G A;  5ECK B;  3BBY A;  4NXI A;  2QC7 A;  3WD6 A;  4O5R A;  3P2A A;  2IWT A;  1QUW A;  1FVJ A;  2PER A;  2JSY A;  1KBN A;  2DSA A;  1A8L A;  3FZ9 A;  3CRT A;  3MWH A;  4MJE A;  2H1G A;  2JAC A;  4NPB A;  5AIS A;  4HI7 A;  3NIV A;  3QMX A;  3FHK A;  3AY8 A;  1K0N A;  1K0A A;  3UAR A;  3GKK A;  4L0U A;  1S3A A;  5IO0 A;  5IPH A;  4GSS A;  2HRN A;  5G5E A;  3ERF A;  3KTL A;  2EIO A;  3ERG A;  2B5X A;  2DIY A;  2LQO A;  17GS A;  4PQH A;  5DJM A;  3G9B A;  3MAK A;  2LNT A;  5D73 A;  3H8Q A;  22GS A;  1E2Y A;  2CAQ A;  2IMI A;  4KGI A;  4IJ3 A;  1JZR A;  3FR6 A;  2IJY A;  1F9M A;  2MMN A;  5DAL A;  4KCE A;  3MDK A;  3QPM A;  2R4V A;  2WFC A;  1EEM A;  1BJX A;  4OFN A;  1FHE A;  2TRX A;  5DCG A;  4L5L A;  3VWW A;  4JED A;  3DIE A;  3IE3 A;  4TN8 A;  4ML1 A;  2JZR A;  1GNW A;  4IQ1 A;  1Q98 A;  4MF7 A;  2LTK A;  3KJY A;  4YQV A;  2H0G A;  1TRW A;  4MDC A;  2EC4 A;  4MZB A;  5IOW A;  4XS4 B;  1H4O A;  1Y6E A;  3UIW A;  2DC5 A;  6GSV A;  4KDY A;  5JWQ B;  2QSI A;  4PQI A;  4KA0 A;  1U87 A;  2IFQ A;  3FR9 A;  3KH7 A;  3K8N A;  1X5D A;  3KD0 A;  5CP1 A;  2OBK A;  5J9C A;  3SBC A;  2KOK A;  1PKW A;  3GL3 A;  3ZIJ A;  4GWR A;  3D5J A;  5AGY A;  2FLS A;  3M3M A;  2K8V A;  1SEN A;  3LXT A;  4ZB8 A;  4ECB A;  2KUC A;  4MLY A;  1PX7 A;  5J9B A;  5G31 A;  1X0R A;  1XWB A;  3TKR A;  1U88 A;  2GTU A;  3F9U A;  4I5Q A;  4ECI A;  1K0B A;  1Z5Y E;  3VFI A;  3KCM A;  1OE8 A;  2OAD A;  3EC3 A;  2YPM A;  3CSI A;  2PVQ A;  2YJH A;  2IMF A;  4MCU A;  3MNG A;  3UJ1 A;  1AW9 A;  2VCQ A;  4G9H A;  1RQM A;  1T00 A;  5D93 A;  3P7X A;  4ZL9 A;  4BPY A;  4TR1 A;  1B9X C;  1FVK A;  2VL9 A;  4OFM A;  1TI1 A;  1T7P B;  5DAL B;  3QAV A;  3KZQ A;  4TR3 A;  3ZIT A;  1J08 A;  5FWG A;  4KDU A;  1XVW A;  3RHC A;  4EUY A;  1WRY A;  2NDO A;  5AIX A;  1PX6 A;  1VGL A;  1G6W A;  4OD7 A;  4FH8 A;  4MF5 A;  2FWE A;  1R5A A;  4PUF C;  4FO5 A;  1WPI A;  1QXH A;  2XBI A;  4WBR D;  4HEA 2;  2LV3 A;  2TRC P;  4NV2 A;  1M7T A;  4TOP A;  5G5F A;  4QL7 A;  1ZMA A;  3BD2 A;  2GQM A;  5A4V A;  2O85 A;  1T3B A;  4ULX A;  3KP8 A;  1YQ1 A;  5C00 A;  5F05 A;  5ECO B;  4MF6 A;  3F3Q A;  4XHM A;  2C3Q A;  1YF0 A;  1OC8 A;  3KIJ A;  1AC1 A;  3DRN A;  4Q5F A;  2L5L A;  1V40 A;  2WS2 A;  4ZB6 A;  4ECC A;  1PQN A;  1GSE A;  4AGS A;  2IFQ B;  1MTC A;  1GTI A;  4EXJ A;  3HYP A;  4JU5 A;  3TJK A;  4WXT A;  1F3A A;  3VPT A;  2B6M A;  2LRC A;  4K0G A;  4X1U A;  1YY7 A;  1THO A;  1WE0 A;  1PSQ A;  4MH3 A;  3E3E A;  5D96 A;  3VI7 A;  1ACV A;  3GST A;  5J5N A;  1A0R P;  2E0Q A;  3F4T A;  2H76 A;  1DUG A;  5IMD A;  5GSS A;  1M0U A;  1E6B A;  8GSS A;  4NWY A;  1GTU A;  3KXO A;  5LCZ A;  1SK2 A;  1IYI A;  2CA8 A;  4V1A g;  2FD3 A;  4V1A p;  4EDY A;  2XC2 A;  4N0Z A;  4ZXG A;  1XIY A;  1KEB A;  1PMT A;  2LQQ A;  3D21 A;  2B5Y A;  4GLT A;  3DWV A;  3HDC A;  3KTB A;  3BOA A;  2L57 A;  1F2E A;  1KNG A;  2TIR A;  1PL1 A;  4TR1 B;  3GA4 A;  4GSN A;  4MJC A;  2C8U A;  1O6J A;  1Q4J A;  1SL1 B;  1G0T A;  2GS3 A;  12GS A;  5IM9 A;  1SYR A;  1USB A;  5D9W A;  4HS1 A;  2XBQ A;  1PA3 A;  4WR5 A;  1R4W A;  4JE1 A;  4IHU A;  2I3Y A;  4K8M A;  4FYC A;  3IR4 A;  3HXS A;  1BYE A;  1SL2 B;  5D9T A;  4HU7 A;  1TTZ A;  2B5E A;  3J7Y k;  5KEJ A;  1SJZ A;  2AV4 A;  4HQZ A;  3TGZ A;  3ZL5 A;  4WKW A;  4MK3 A;  4WEY A;  4EE0 A;  4L8E A;  4G2E A;  1ERV A;  1OYJ A;  3EU3 A;  4CDO A;  3IOS A;  2K9F A;  3WT2 A;  3TOT A;  2LEG A;  4HU9 A;  2CZ2 A;  5IOX A;  2O87 A;  5IPG A;  3TJB A;  5INY A;  4PXO A;  2A2R A;  1GUH A;  3UBK A;  1Z7P A;  2BTO T;  3C7M A;  18GS A;  1ILO A;  2OAC A;  1NW2 A;  1A8Y A;  4X43 A;  1O8W A;  1SK0 A;  1ERT A;  3A3T A;  1YDK A;  3DVW A;  1YZX A;  3RPN A;  5IMA A;  5G30 A;  2K6V A;  2ON5 A;  2VIM A;  4BWS A;  1FOV A;  1PGT A;  2HZF A;  4KX4 A;  1F37 A;  3Q19 A;  3TB2 A;  4F2I A;  3TRP A;  1XWG A;  2C80 A;  2GZP A;  5J4U A;  4EVM A;  2WJU A;  3L9V A;  3IHQ A;  2NBS A;  1JHB A;  4DSQ A;  2HYX A;  2R6K A;  3QFA C;  1ZYE A;  3LJR A;  2AHE A;  1DE1 A;  2P5Q A;  4KSO A;  2I81 A;  4OFT A;  2FY6 A;  3I69 A;  5ECR B;  1NSW A;  5IO2 A;  2E7P A;  5ECQ B;  2GZZ A;  2OBI A;  1Z6M A;  3GH6 A;  4ISD A;  1HYU A;  5HR1 A;  3M1G A;  4GQF A;  3D6I A;  4FYB A;  2OJL A;  4K7I A;  2YN1 A;  1N2A A;  3KMO A;  1FAA A;  3GL5 A;  2LS5 A;  1FW1 A;  5ENU A;  1TK8 B;  2L6D A;  1V58 A;  1U6T A;  5HFI A;  1URM A;  3CRU A;  1X9W B;  2C0D A;  4N30 A;  5HQP A;  5ECH B;  1SJI A;  4I2T A;  4PNG A;  2NTO A;  2FGX A;  4ZBB A;  5COH A;  2IMD A;  2AAW A;  2LNS A;  4TKY A;  2XPD A;  2H74 A;  1A2L A;  4AF2 A;  1M2B A;  3VLN A;  4K6X A;  3CTG A;  2R3X A;  4Q5Q A;  4I2U A;  4IKH A;  2H6X A;  3ZVJ D;  2HLS A;  2H1A A;  3UOM A;  2HZE A;  4MP4 A;  1XWA A;  5JWO B;  2MBT A;  14GS A;  4JZQ A;  2OA7 A;  3WYW A;  3RHB A;  2F9S A;  1GLQ A;  3EYT A;  2OKA A;  3C1R A;  2B7J A;  5A4U A;  3KH9 A;  6GSY A;  4V2M A;  2VCZ A;  2DJK A;  5IMF A;  3G7J A;  3CSJ A;  4NV5 A;  2YZH A;  4EDZ A;  2PUK C;  2WCI A;  1G7O A;  2YWO A;  1GSS A;  2KLX A;  2YJ7 A;  6GSW A;  1B48 A;  2CT6 A;  2N5F A;  3WT1 A;  3WGX A;  4EC0 A;  3BJ5 A;  2LJK A;  2DJJ A;  1PL2 A;  3P90 A;  3UVT A;  1BG5 A;  3TKS E;  1QGV A;  3P8W A;  1JZD A;  5IMC A;  3OR5 A;  3TKP A;  5AN1 A;  3FK8 A;  2VUP A;  4PUR A;  3ZTL A;  4IN0 A;  3QDN A;  2YAN A;  4KH7 A;  3GRX A;  4OO4 A;  1SK1 A;  2FWH A;  1EEJ A;  2IIY A;  2GVP A;  2JZT A;  4G10 A;  2FCH A;  2DML A;  9GSS A;  2L6C A;  2GST A;  3RDW A;  1AAZ A;  1ST9 A;  4F03 A;  3M9K A;  1QK8 A;  3ZFL A;  3FY7 A;  3QFB C;  1B9Y C;  5ELG A;  4WBJ A;  3GKM A;  5H5R A;  4EO3 A;  4BVX A;  3TRX A;  5B8B A;  3ZRD A;  5ECN B;  2HZE B;  2RLI A;  1GL8 A;  5CNW A;  1WP0 A;  3LOR A;  1RW1 A;  4GTU A;  2G2Q A;  1K0O A;  1PKZ A;  3O76 A;  3L4N A;  2K8S A;  4I97 A;  1EOH A;  2CV4 A;  4POM A;  4OCE A;  5ID2 A;  3F63 A;  1LJR A;  2O89 A;  3A5W A;  1X5E A;  5CRG A;  4JR4 A;  5F8B A;  5D8I A;  1Z9H A;  3IAS 2;  3E0U A;  3KEB A;  2H01 A;  2JAD A;  3HY2 A;  3TOU A;  3HD5 A;  2JSZ A;  5B6M A;  1W4V A;  3EMX A;  1G6Y A;  4EKZ A;  3ZML A;  2HFD A;  3CTF A;  1LBK A;  3RAZ A;  6GSU A;  4POK A;  4V2N A;  3EIN A;  1GSF A;  5DJL A;  2CAI A;  1OAZ A;  1GUK A;  2CX3 A;  3ZFB A;  2H75 A;  2ES7 A;  3KP9 A;  5B8A A;  3E9J B;  1B4Q A;  3TKS C;  2MMZ A;  2LKU A;  1TW9 A;  2RM6 A;  5HR3 A;  3G7I A;  2GLR A;  5FT3 A;  2H6Y A;  2X99 A;  5CYY A;  1TJD A;  1WWJ A;  2QGV A;  5HR2 A;  1VF4 A;  1SKR B;  4PGT A;  1M9A A;  3HJM A;  1QQ2 A;  2ALB A;  3TDG A;  2N5B A;  3QAW A;  2IN3 A;  3GX8 A;  3DD3 A;  3LWA A;  3HHV A;  2F8F A;  2VLU A;  5C04 A;  2VOC A;  3LG6 A;  1HNB A;  1JZO A;  5H5S A;  2H71 A;  2EIR A;  3DGQ A;  2JL4 A;  3APQ A;  1TK5 B;  1GNE A;  1EV4 A;  1O8X A;  2H6Z A;  2B1K A;  1C72 A;  1MD4 A;  3DYR A;  4L0W A;  5ECS A;  3WGE A;  19GS A;  3ZVJ A;  1NHY A;  1TU7 A;  2OE0 A;  1BX9 A;  3GHA A;  1WJK A;  4MPG A;  5B6N A;  2FNO A;  2MMO A;  5LNK e;  1OC3 A;  4KUN A;  3I9V 2;  4MZW A;  1YEX A;  4YQU A;  2Z9S A;  3EE2 A;  2HI7 A;  4PNF A;  1AXD A;  2LJA A;  2H72 A;  1NM3 A;  1XCC A;  1EV9 A;  2GQL A;  1VF2 A;  5ID2 B;  4LMV A;  5DQS A;  2X8H A;  4PUA A;  6GSX A;  3GV1 A;  4IVF A;  20GS A;  3LYP A;  2GGT A;  1CQG A;  2YOI A;  3GUR A;  3N5O A;  4TRX A;  2P0G A;  3IK9 A;  4V2L A;  2C0G A;  1EGR A;  2A2S A;  1X9S B;  1ZL9 A;  1V2A A;  4ZBD A;  3JCM L;  4HZ2 A;  2LUS A;  2V41 A;  1DE2 A;  4F0C A;  3L0H A;  1UVZ A;  3VK9 A;  4F82 A;  4N11 A;  1MDK A;  1GH2 A;  2FA4 A;  3RPP A;  2YV9 A;  3KM6 A;  3LEF A;  3UVH A;  1M9B A;  4XS6 A;  1XWC A;  1HNA A;  2V6O A;  2HT9 A;  3PR8 A;  3ME7 A;  5CRH A;  1SKW B;  4K7O A;  4MMM A;  2IPA A;  1EP7 A;  3FKF A;  5E4W A;  3BCI A;  1AUC A;  5ECM B;  3EVI A;  4G19 A;  1G7E A;  3L9U A;  3Q18 A;  1TI3 A;  1SKS B;  1TKD B;  3GKN A;  4ILF A;  1OKD A;  1AQX A;  1TU8 A;  1N8J A;  2DJ3 A;  2E2M A;  3GIX A;  1ZGN A;  2PN8 A;  2VCW A;  1TRS A;  5JCU A;  2GSR A;  2CVB A;  1AIU A;  2F51 A;  2WGR A;  4O92 A;  4F0B A;  1A2M A;  2H0H A;  3PH9 A;  5ECL B;  1PN9 A;  2HSY A;  2ON7 A;  3GYK A;  4RQR A;  3F4S A;  1TRU A;  4KSM A;  1GSU A;  3UBL A;  2R5G A;  3IK7 A;  2YV7 A;  3DEX A;  13GS A;  3EUR A;  3WGD A;  4BVY A;  4DSR A;  3QR6 A;  7GSS A;  2WB9 A;  3LSZ A;  4DVC A;  1AQV A;  1EWX A;  2DBC A;  3PGT A;  1ZOF A;  2O8V B;  4GXZ A;  2DJ0 A;  5CO3 A;  1YEP A;  2FWF A;  2R2J A;  1MDI A;  1RK4 A;  4LLR A;  5J3R A;  3C1S A;  4I6X A;  4ACS A;  3ZMK A;  4GRF A;  5FHI A;  1SJ6 A;  10GS A;  3ZRE A;  1WMJ A;  3GNJ A;  1QMV A;  4L5O A;  1S3C A;  2PU9 C;  3W8J A;  1NHO A;  2YWN A;  1JLV A;  1PRX A;  1ZCP A;  4IEL A;  3TJJ A;  3PIN A;  1BQ7 A;  3HA9 A;  2MBS A;  4KAE A;  3KGK A;  2VCX A;  1R26 A;  2DMM A;  5CRE A;  1VRS D;  4EL1 A;  5HR0 A;  2RII A;  4J56 E;  2PVO C;  5IIZ A;  2BJX A;  3TUE A;  2KHP A;  2XHF A;  3LXZ A;  4YH2 A;  1LU4 A;  4ZB9 A;  1GUL A;  4HDE A;  5F07 A;  3NZN A;  5ECP B;  2KP2 A;  4GCI A;  3GH9 A;  3S9F A;  2NVL A;  4EF0 A;  2O7K A;  1TRV A;  3UL3 A;  2HRF A;  4IBP A;  3UMA A;  5A5K A;  1MEK A;  3DXB A;  4IP6 A;  1XOA A;  4KND A;  3H93 A;  2EIQ A;  3DKS A;  4MPF A;  5DVB A;  2H66 A;  2L5O A;  5IMV A;  2XPE A;  3GFK A;  4NMU A;  4YQM A;  2H73 A;  1GLP A;  1THX A;  4IW9 A;  2BMX A;  1K3Y A;  1S3D A;  3H79 A;  5G2Z A;  2M46 A;  3ED3 A;  4TVE A;  2NPB A;  4POB A;  5KN3 A;  1CQH A;  3TCO A;  1M2D A;  3VWV A;  1FO5 A;  2WDU A;  4ML6 A;  3CYN A;  4MH2 A;  4OO5 A;  1XZO A;  1T8E B;  5EPF A;  1OVN A;  3ZLP A;  1TK0 B;  3D22 A;  3LQ7 A;  4CHS A;  3DML A;  5KN2 A;  3GX0 A;  4ZIJ A;  16GS A;  5IQY A;  2ZCT A;  2L4C A;  4LL1 B;  1ZYQ B;  3HVX A;  3O3T A;  1EZK A;  2G0F A;  3KMN A;  1XWK A;  5EVO A;  2E2G A;  4XCS A;  4ID0 A;  1Y25 A;  1HD2 A;  3J7Y b;  3IAM 2;  1O81 A;  2B7K A;  5IMZ A;  1XOB A;  3BCK A;  5F06 A;  1OE7 A;  4ZL8 A;  1U3A A;  1KTE A;  4NHW A;  3RBT A;  1TXX A;  1GSD A;  2FA8 A;  1BED A;  3TKQ A;  4RI7 A;  1GUM A;  2X8C A;  1OKT A;  2GZY A;  1Z6N A;  5JWR B;  1FB0 A;  4HZ4 A;  2V6K A;  2C3T A;  3G7Y A;  2CVK A;  1GSY A;  2VL2 A;  5GST A;  2C0E A;  2M72 A;  3IA1 A;  1B8X A;  4K0N A;  5EY6 A;  2H19 A;  2PGT A;  3IPZ A;  3M8N A;  3I43 A;  4PX1 A;  1XFL A;  2GDR A;  3DVX A;  1Z7R A;  2HSH A;  4MA9 A;  4D73 A;  3QOU A;  3ZZX A;  2QKE A;  2JZS A;  1EP8 A;  2IMK A;  4N0V A;  1R7H A;  1A23 A;  4YAP A;  1M2A A;  3Q6O A;  3IDV A;  2H30 A;  1VF1 A;  1WIK A;  5KN1 A;  5G1K A;  2KP1 A;  3HKR A;  3M0F A;  11GS A;  1PD2 1;  1TP9 A;  3C73 A;  1GP1 A;  1JZW A;  2H1D A;  2YCD A;  2RUE A;  1B4P A;  3ME8 A;  4WET A;  1K0C A;  2N5A A;  3A2W A;  2VLT A;  3D4T A;  1V98 A;  2P31 A;  2DJ2 A;  4JR6 A;  1TOF A;  2B3S A;  3H1N A;  1A0F A;  3VWX A;  3HZ4 A;  5KN0 A;  2H1B A;  1XW5 A;  2RM5 A;  3TJF A;  3CXG A;  2ZNM A;  3GN3 A;  2X64 A;  4ZBA A;  2I4A A;  5B7C A;  4Z7X A;  3QAG A;  4TXO A;  3C71 A;  1ABA A;  3F6D A;  4XRA A;  3ZIV A;  5CAX A;  1UA5 A;  4LA1 A;  2HE3 A;  4IGJ A;  4BA7 A;  3L78 A;  4AJ7 A;  2VL3 A;  2PMT A;  4MJA A;  1F3B A;  5F0G A;  4BWQ A;  3APO A;  2WRT A;  5G1L A;  5H5Q A;  1R5P A;  1GWC A;  2VLV A;  2L4Q A;  3ZYW A;  2CX4 A;  4TR0 A;  5GAN D;  4IP1 A;  1MDJ A;  2PWJ A;  4GF0 A;  3NOF A;  1DBY A;  4QL9 A;  1YJ6 A;  3FZ5 A;  1T1V A;  4JRR A;  2HNL A;  1FG4 A;  2LST A;  1I5G A;  1A24 A;  4OCF A;  4QQ7 A;  2C0F A;  1O85 A;  2PBJ A;  1YKC A;  4D73 B;  4PQ1 A;  1XW6 A;  1XBS A;  4OMV A;  1SU9 A;  4KE3 A;  5JCG A;  1GTB A;  3VWU A;  3F8U A;  4DSS A;  4YAV A;  4AJ6 A;  1O7U A;  4AJ8 A;  1EGO A;  5ELA A;  3HJP A;  1XW9 A;  4TR4 A;  4X0X A;  4CW9 A;  2X8G A;  1V57 A;  4OWY A;  1JLW A;  3A2V A;  2YP6 A;  3QD9 A;  2GT6 A;  1SYX A;  3F0I A;  3HVV A;  3LYK A;  5GAP D;  1U3I A;  3HJO A;  2H8L A;  5DCH A;  3Q74 A;  3IXR A;  2ZUP A;  3IBH A;  2B1L A;  1XXU A;  4GST A; 
#chains in the Genus database with same CATH topology
 3FZA A;  2J23 A;  5L71 A;  1O73 A;  3LGC A;  4TXO B;  4CY8 A;  3F4R A;  1UC7 A;  1X9M B;  2V32 A;  2L59 A;  1MD3 A;  3CSH A;  1SD9 A;  2FHE A;  1F6M C;  2VM1 A;  3HZ8 A;  2GSS A;  3D0Z A;  4E8H A;  2HXK A;  1OC9 A;  2AB6 A;  1YF1 A;  3N9J A;  4DEJ A;  6GSS A;  2VM2 A;  3ISO A;  3MSZ A;  3IC4 A;  4J2F A;  4GQC A;  1ML6 A;  2GQK A;  1SD8 A;  1W89 A;  3GMF A;  4KB3 A;  5DBQ A;  2C3N A;  3H4K A;  4HQS A;  5LD0 A;  3F6F A;  3I6A A;  1K0D A;  3US3 A;  3LFL A;  4O7H A;  3GKX A;  4TXV A;  5DQY A;  1XG8 A;  4KDX A;  1GRX A;  2RUF A;  2VD1 A;  1SL0 B;  3VPQ A;  4TW5 A;  4KCA A;  2FWG A;  4K2D A;  3R2Q A;  1VF3 A;  1AQW A;  1WOU A;  5ABR A;  2H70 A;  3IRA A;  2I1U A;  4DSS B;  2A4V A;  4RQX A;  4XS1 A;  3GTU A;  5CRW A;  3TRQ A;  4XTS A;  2MYG A;  4N10 A;  2WZ9 A;  3ERW A;  3U6V A;  3W6G A;  2YNX A;  3O6T A;  4J57 E;  5GZZ B;  2OE1 A;  3VUR A;  2VL2 C;  3VI5 A;  2X49 A;  1ERU A;  2R37 A;  1T4Z A;  2F8A A;  1ON4 A;  3UAP A;  1ERW A;  3V1W A;  4XRD A;  2J9H A;  3TKS A;  3A2X A;  2M80 A;  4HJ2 A;  3QCP A;  2DJ1 A;  2QA1 A;  5DAK A;  2IL3 A;  3D4M A;  1GTA A;  1K0M A;  4IJI A;  2WUL A;  1V9W A;  1M3I A;  1K3O A;  4BL7 A;  4E8E A;  3FEU A;  5HFG A;  2REM A;  5CRD A;  2H0I A;  4K9Z A;  3FYG A;  4MAB A;  4CY6 A;  1I9D A;  4ECJ A;  4RUV A;  4IS0 A;  4LL4 B;  5J41 A;  4LMW A;  1OC9 B;  2JU5 A;  4PTS A;  1T4Y A;  3FW2 A;  2YZU A;  3APS A;  3EWL A;  2CQ9 A;  4JBB A;  1QFN A;  2C1Y A;  3FR3 A;  3SWL A;  2VO4 A;  2GT5 A;  2VAF A;  1FB6 A;  1ZZY A;  2VCV A;  4MJB A;  3HVS A;  2D2Z A;  4WF5 A;  1J0F A;  2I9H A;  2PPT A;  1XPV A;  4NAX A;  4Q5N A;  1HQO A;  4I8B A;  2VCT A;  2K18 A;  4KW6 A;  4HUA A;  4K7N A;  3GSS A;  4MZC A;  4IQA A;  2YWI A;  3U5R E;  1K3L A;  3IV4 A;  2DIZ A;  1J9B A;  4WF4 A;  1M99 A;  3TJG A;  3F3R A;  1UN2 A;  4Q5R A;  5HFK A;  1DSB A;  3L9S A;  5AIV A;  2AJQ B;  4F9Z A;  2CVD A;  2LRN A;  5JCW A;  1TDI A;  2GSQ A;  1BAY A;  4HJM A;  4H86 A;  5E59 A;  4HOJ A;  2OE3 A;  4ZL7 A;  3M9J A;  2CZ3 A;  2R0G A;  6GST A;  3GTU B;  3EMP A;  4RI6 A;  2P5R A;  1JFU A;  1XVQ A;  5ECI B;  2MMA A;  4K5R A;  5A4W A;  4FIW A;  1H75 A;  5DDL A;  4O32 A;  2DLX A;  3CMI A;  1Z3E A;  3HCZ A;  3FRC A;  3FZ4 A;  5D9X A;  2FUG 2;  2YWM A;  2IME A;  5D9V A;  4NHZ A;  5EL8 A;  2V1M A;  4WR4 A;  2R0P A;  3IC8 A;  3GUS A;  4ZIL A;  3IHG A;  4FYU A;  3UEM A;  3CBU A;  4POL A;  1X5C A;  2MZC A;  1EOG A;  1IYH A;  3W8S A;  1GSQ A;  4K1F A;  2F3M A;  4XIH A;  1A2J A;  4P3Y B;  2AYT A;  4XS4 A;  5DAK B;  1FOH A;  3EU4 A;  1HNC A;  3C8E A;  2LRT A;  2LJR A;  4BL7 B;  2VD0 A;  2AUV A;  2C4J A;  1YKA A;  2V2G A;  4FQU A;  5ECK B;  3BBY A;  4NXI A;  2QC7 A;  3WD6 A;  4O5R A;  3P2A A;  2IWT A;  1QUW A;  1FVJ A;  2PER A;  2JSY A;  2HRA A;  1KBN A;  5BMU A;  2DSA A;  1A8L A;  3FZ9 A;  3CRT A;  3MWH A;  4MJE A;  4K2X A;  2H1G A;  2JAC A;  4NPB A;  5AIS A;  3FMW A;  4HI7 A;  3NIV A;  3QMX A;  3CQF A;  3FHK A;  3AY8 A;  1K0N A;  1K0A A;  3UAR A;  3GKK A;  4L0U A;  1S3A A;  5IO0 A;  5IPH A;  4GSS A;  2HRN A;  5G5E A;  3ERF A;  3KTL A;  2EIO A;  3ERG A;  2B5X A;  2DIY A;  2LQO A;  17GS A;  4PQH A;  5DJM A;  3G9B A;  3MAK A;  2LNT A;  5D73 A;  3H8Q A;  22GS A;  1E2Y A;  2CAQ A;  2IMI A;  4KGI A;  4IJ3 A;  1JZR A;  3FR6 A;  2IJY A;  1F9M A;  2MMN A;  5DAL A;  4KCE A;  3MDK A;  3QPM A;  2R4V A;  2WFC A;  1EEM A;  1BJX A;  4OFN A;  1FHE A;  2TRX A;  5DCG A;  4L5L A;  3EPT A;  3VWW A;  4JED A;  3DIE A;  3IE3 A;  4TN8 A;  4ML1 A;  2JZR A;  1GNW A;  4IQ1 A;  1Q98 A;  4MF7 A;  2LTK A;  3KJY A;  4YQV A;  2H0G A;  1TRW A;  4MDC A;  4G0L A;  2EC4 A;  4MZB A;  5IOW A;  4XS4 B;  1H4O A;  1Y6E A;  3UIW A;  2DC5 A;  6GSV A;  4KDY A;  5JWQ B;  2QSI A;  4PQI A;  4KA0 A;  1U87 A;  2IFQ A;  3FR9 A;  3KH7 A;  3LW9 A;  3K8N A;  1X5D A;  3KD0 A;  5CP1 A;  2OBK A;  5J9C A;  3SBC A;  2KOK A;  1PKW A;  3GL3 A;  3ZIJ A;  4GWR A;  3D5J A;  5AGY A;  2FLS A;  3M3M A;  2K8V A;  1SEN A;  3LXT A;  4ZB8 A;  4ECB A;  2KUC A;  4MLY A;  1PX7 A;  5J9B A;  5G31 A;  1X0R A;  1XWB A;  3TKR A;  1U88 A;  2GTU A;  3F9U A;  4I5Q A;  4ECI A;  1K0B A;  1Z5Y E;  3VFI A;  3KCM A;  1OE8 A;  2OAD A;  3EC3 A;  2YPM A;  3CSI A;  2PVQ A;  2YJH A;  2IMF A;  4MCU A;  3MNG A;  3UJ1 A;  1AW9 A;  2VCQ A;  4G9H A;  1RQM A;  1T00 A;  5D93 A;  3P7X A;  4ZL9 A;  4BPY A;  4TR1 A;  1B9X C;  1FVK A;  2VL9 A;  4OFM A;  1TI1 A;  1T7P B;  5DAL B;  3QAV A;  3KZQ A;  4TR3 A;  3ZIT A;  1J08 A;  5FWG A;  4KDU A;  1XVW A;  3RHC A;  4EUY A;  1WRY A;  2NDO A;  5AIX A;  1PX6 A;  1VGL A;  1G6W A;  4OD7 A;  4FH8 A;  4MF5 A;  2FWE A;  1R5A A;  4PUF C;  4FO5 A;  1WPI A;  1QXH A;  2XBI A;  4WBR D;  4HEA 2;  2LV3 A;  2TRC P;  4NV2 A;  1M7T A;  4TOP A;  5G5F A;  4G0I A;  4QL7 A;  1ZMA A;  3BD2 A;  2GQM A;  5A4V A;  2O85 A;  1T3B A;  4ULX A;  3KP8 A;  1YQ1 A;  5C00 A;  5F05 A;  5ECO B;  4MF6 A;  3F3Q A;  4XHM A;  2C3Q A;  1YF0 A;  1OC8 A;  1PFO A;  3KIJ A;  1AC1 A;  3DRN A;  4Q5F A;  2L5L A;  1V40 A;  2WS2 A;  4ZB6 A;  4ECC A;  1PQN A;  1GSE A;  4AGS A;  2IFQ B;  1MTC A;  1GTI A;  4EXJ A;  3HYP A;  4JU5 A;  3TJK A;  4WXT A;  1F3A A;  3VPT A;  2B6M A;  2LRC A;  4K0G A;  4X1U A;  1YY7 A;  1THO A;  1WE0 A;  1PSQ A;  4MH3 A;  3E3E A;  5D96 A;  3MYD A;  3VI7 A;  1ACV A;  3GST A;  5J5N A;  1A0R P;  2E0Q A;  3F4T A;  2H76 A;  1DUG A;  5IMD A;  5GSS A;  1M0U A;  1E6B A;  3HVN A;  8GSS A;  4NWY A;  1GTU A;  3KXO A;  5LCZ A;  1SK2 A;  1IYI A;  2CA8 A;  4V1A g;  2FD3 A;  4V1A p;  4EDY A;  2XC2 A;  4N0Z A;  4ZXG A;  1XIY A;  1KEB A;  1PMT A;  2LQQ A;  3D21 A;  2B5Y A;  4GLT A;  3DWV A;  3HDC A;  3KTB A;  3BOA A;  2L57 A;  1F2E A;  1KNG A;  2TIR A;  1PL1 A;  4TR1 B;  3GA4 A;  4GSN A;  4MJC A;  2C8U A;  1O6J A;  1Q4J A;  1SL1 B;  1G0T A;  2GS3 A;  12GS A;  5IM9 A;  1SYR A;  1USB A;  5D9W A;  4HS1 A;  2XBQ A;  1PA3 A;  4WR5 A;  1R4W A;  4JE1 A;  4IHU A;  2I3Y A;  4K8M A;  4FYC A;  3IR4 A;  3HXS A;  1BYE A;  1SL2 B;  5D9T A;  4HU7 A;  1TTZ A;  2B5E A;  3J7Y k;  5KEJ A;  1SJZ A;  2AV4 A;  4HQZ A;  2X4A A;  3TGZ A;  3ZL5 A;  4WKW A;  4MK3 A;  4WEY A;  4EE0 A;  4L8E A;  4G2E A;  1ERV A;  1OYJ A;  3EU3 A;  4CDO A;  3IOS A;  2K9F A;  3WT2 A;  3TOT A;  2LEG A;  4HU9 A;  2CZ2 A;  5IOX A;  2O87 A;  2DKH A;  5IPG A;  3TJB A;  5INY A;  4PXO A;  2A2R A;  1GUH A;  3UBK A;  1Z7P A;  2BTO T;  3C7M A;  18GS A;  1ILO A;  2OAC A;  1NW2 A;  1A8Y A;  4X43 A;  1O8W A;  1SK0 A;  1ERT A;  3A3T A;  1YDK A;  3DVW A;  1YZX A;  3RPN A;  5IMA A;  5G30 A;  2K6V A;  2ON5 A;  2VIM A;  4BWS A;  1FOV A;  1PGT A;  2HZF A;  4KX4 A;  1F37 A;  3Q19 A;  3TB2 A;  4F2I A;  3TRP A;  1XWG A;  2C80 A;  2GZP A;  5J4U A;  4EVM A;  2WJU A;  3L9V A;  3IHQ A;  2NBS A;  1JHB A;  4DSQ A;  2HYX A;  2R6K A;  3QFA C;  1ZYE A;  3LJR A;  2AHE A;  1DE1 A;  2P5Q A;  4KSO A;  2I81 A;  4OFT A;  2FY6 A;  3I69 A;  5ECR B;  1NSW A;  5IO2 A;  2E7P A;  5ECQ B;  2GZZ A;  2OBI A;  3R3E A;  1Z6M A;  3GH6 A;  4ISD A;  1HYU A;  5HR1 A;  3M1G A;  4O5U A;  4GQF A;  3D6I A;  4FYB A;  2OJL A;  4K7I A;  2YN1 A;  1N2A A;  3KMO A;  1FAA A;  3GL5 A;  2LS5 A;  1FW1 A;  5ENU A;  1TK8 B;  2L6D A;  1V58 A;  1U6T A;  5HFI A;  1URM A;  3CRU A;  1X9W B;  2C0D A;  4N30 A;  5HQP A;  5ECH B;  1SJI A;  4I2T A;  4PNG A;  2NTO A;  2FGX A;  4ZBB A;  4Z2U A;  5COH A;  2QA2 A;  2IMD A;  2AAW A;  2LNS A;  4TKY A;  2XPD A;  2H74 A;  1A2L A;  4AF2 A;  1M2B A;  3VLN A;  4K6X A;  3CTG A;  2R3X A;  4Q5Q A;  4I2U A;  4IKH A;  2H6X A;  3ZVJ D;  2HLS A;  2H1A A;  3UOM A;  2HZE A;  4MP4 A;  1XWA A;  5JWO B;  2MBT A;  14GS A;  4K5S A;  4JZQ A;  2OA7 A;  3WYW A;  3RHB A;  2F9S A;  1GLQ A;  3EYT A;  2OKA A;  3C1R A;  2B7J A;  5A4U A;  3KH9 A;  6GSY A;  4V2M A;  2VCZ A;  2DJK A;  5IMF A;  3G7J A;  3CSJ A;  4NV5 A;  2YZH A;  4EDZ A;  2PUK C;  2WCI A;  1G7O A;  2YWO A;  1GSS A;  2KLX A;  2YJ7 A;  6GSW A;  1B48 A;  2CT6 A;  2N5F A;  3WT1 A;  3WGX A;  1ZYN A;  4EC0 A;  4Z2T A;  3BJ5 A;  2LJK A;  2DJJ A;  1PL2 A;  3P90 A;  2HRK A;  3UVT A;  1BG5 A;  3TKS E;  1QGV A;  3P8W A;  1JZD A;  5IMC A;  3OR5 A;  3TKP A;  5AN1 A;  3FK8 A;  2VUP A;  4PUR A;  3ZTL A;  4IN0 A;  3QDN A;  2YAN A;  4KH7 A;  3GRX A;  4OO4 A;  1SK1 A;  2FWH A;  1EEJ A;  2IIY A;  2GVP A;  2JZT A;  4G10 A;  2FCH A;  2DML A;  9GSS A;  2L6C A;  2GST A;  3RDW A;  1AAZ A;  1ST9 A;  4Z2R A;  4F03 A;  3M9K A;  1QK8 A;  3ZFL A;  3FY7 A;  3QFB C;  1B9Y C;  5ELG A;  4WBJ A;  3GKM A;  5H5R A;  4EO3 A;  4BVX A;  3TRX A;  5B8B A;  3ZRD A;  5ECN B;  2HZE B;  2RLI A;  1GL8 A;  4MNN A;  1WP0 A;  3LOR A;  1RW1 A;  5CNW A;  4GTU A;  2G2Q A;  1K0O A;  1PKZ A;  3O76 A;  3L4N A;  2K8S A;  4I97 A;  1EOH A;  2CV4 A;  4POM A;  4OCE A;  5ID2 A;  3F63 A;  1LJR A;  2O89 A;  3A5W A;  1X5E A;  5CRG A;  4JR4 A;  5F8B A;  5D8I A;  1Z9H A;  3IAS 2;  3E0U A;  3KEB A;  2H01 A;  2JAD A;  3HY2 A;  3TOU A;  3HD5 A;  2JSZ A;  5B6M A;  1W4V A;  3EMX A;  1G6Y A;  4EKZ A;  3ZML A;  2HFD A;  3CTF A;  1LBK A;  3RAZ A;  6GSU A;  4POK A;  4V2N A;  3EIN A;  1GSF A;  5DJL A;  2CAI A;  1OAZ A;  1GUK A;  2CX3 A;  3ZFB A;  2H75 A;  2ES7 A;  4HSC X;  3KP9 A;  5B8A A;  3E9J B;  1B4Q A;  3TKS C;  2MMZ A;  4BIK A;  2LKU A;  1TW9 A;  2RM6 A;  4EIQ A;  5HR3 A;  3G7I A;  2GLR A;  5FT3 A;  2H6Y A;  2X99 A;  5CYY A;  1TJD A;  1WWJ A;  2QGV A;  5HR2 A;  1VF4 A;  1SKR B;  4PGT A;  1M9A A;  3HJM A;  1QQ2 A;  2ALB A;  3TDG A;  2N5B A;  3QAW A;  2IN3 A;  3GX8 A;  3DD3 A;  3LWA A;  3HHV A;  2F8F A;  2A4H A;  2VLU A;  5C04 A;  2VOC A;  3LG6 A;  1HNB A;  1JZO A;  5H5S A;  2H71 A;  2EIR A;  3DGQ A;  2JL4 A;  3APQ A;  1TK5 B;  1GNE A;  1EV4 A;  1O8X A;  2H6Z A;  2B1K A;  1C72 A;  1MD4 A;  3DYR A;  4L0W A;  5ECS A;  3WGE A;  19GS A;  3ZVJ A;  1NHY A;  1TU7 A;  2OE0 A;  1BX9 A;  4BVX B;  3GHA A;  1WJK A;  4MPG A;  5B6N A;  2FNO A;  2MMO A;  5LNK e;  1OC3 A;  4KUN A;  3I9V 2;  4MZW A;  1YEX A;  4YQU A;  2Z9S A;  3EE2 A;  2HI7 A;  4PNF A;  1AXD A;  2LJA A;  2H72 A;  1NM3 A;  1XCC A;  1EV9 A;  2GQL A;  1VF2 A;  5ID2 B;  4LMV A;  5DQS A;  2X8H A;  4PUA A;  6GSX A;  3GV1 A;  4IVF A;  20GS A;  3LYP A;  2GGT A;  1CQG A;  2YOI A;  3GUR A;  3N5O A;  4TRX A;  2P0G A;  3IK9 A;  4V2L A;  2C0G A;  1EGR A;  2A2S A;  1X9S B;  1ZL9 A;  1V2A A;  4ZBD A;  4G0K A;  3JCM L;  4HZ2 A;  2LUS A;  2V41 A;  1DE2 A;  4F0C A;  3L0H A;  1UVZ A;  3VK9 A;  4F82 A;  4N11 A;  1MDK A;  1GH2 A;  2FA4 A;  3RPP A;  2YV9 A;  3KM6 A;  3LEF A;  3A5I A;  3UVH A;  1M9B A;  4XS6 A;  1XWC A;  1HNA A;  2V6O A;  2HT9 A;  3PR8 A;  3ME7 A;  5CRH A;  1SKW B;  4K7O A;  4MMM A;  2IPA A;  1EP7 A;  3FKF A;  5E4W A;  3BCI A;  1AUC A;  5ECM B;  3EVI A;  4G19 A;  1G7E A;  3L9U A;  3Q18 A;  1TI3 A;  1SKS B;  1TKD B;  3GKN A;  4ILF A;  1OKD A;  1AQX A;  1TU8 A;  1N8J A;  4A5P A;  2DJ3 A;  2HSM A;  2E2M A;  3GIX A;  1ZGN A;  3PPU A;  2PN8 A;  2VCW A;  1TRS A;  5JCU A;  2GSR A;  2CVB A;  1AIU A;  2F51 A;  2WGR A;  4O92 A;  4F0B A;  1A2M A;  2H0H A;  3PH9 A;  5ECL B;  1PN9 A;  2HSY A;  4X4J A;  2ON7 A;  1M3J A;  3GYK A;  4RQR A;  3F4S A;  1TRU A;  5KOX A;  4KSM A;  2DKI A;  1GSU A;  3UBL A;  2R5G A;  1S3R A;  3IK7 A;  2YV7 A;  3DEX A;  13GS A;  3EUR A;  3WGD A;  4BVY A;  4DSR A;  3QR6 A;  7GSS A;  2WB9 A;  3LSZ A;  4DVC A;  5KOW A;  1AQV A;  1EWX A;  2DBC A;  3PGT A;  1ZOF A;  2O8V B;  4GXZ A;  2DJ0 A;  4O5Q A;  5CO3 A;  1YEP A;  2FWF A;  2R2J A;  1MDI A;  1RK4 A;  4LLR A;  5J3R A;  3C1S A;  4I6X A;  4YKF A;  4ACS A;  3ZMK A;  4GRF A;  5FHI A;  1SJ6 A;  10GS A;  3ZRE A;  1WMJ A;  3GNJ A;  1QMV A;  4L5O A;  1S3C A;  2PU9 C;  3W8J A;  1NHO A;  2YWN A;  1JLV A;  1PRX A;  1ZCP A;  4IEL A;  3TJJ A;  3PIN A;  1BQ7 A;  3HA9 A;  2MBS A;  4KAE A;  3KGK A;  2VCX A;  1R26 A;  2DMM A;  5CRE A;  1VRS D;  2UZ8 A;  4EL1 A;  5HR0 A;  2RII A;  4J56 E;  2PVO C;  5IIZ A;  2BJX A;  3TUE A;  2KHP A;  2XHF A;  3LXZ A;  4YH2 A;  1LU4 A;  4ZB9 A;  1GUL A;  4HDE A;  5F07 A;  3NZN A;  5ECP B;  2KP2 A;  4GCI A;  3GH9 A;  3S9F A;  2NVL A;  4EF0 A;  2O7K A;  1TRV A;  3UL3 A;  2HRF A;  4IBP A;  4YKG A;  3UMA A;  5A5K A;  1MEK A;  3DXB A;  4IP6 A;  1XOA A;  4KND A;  3H93 A;  2EIQ A;  3DKS A;  4MPF A;  5DVB A;  2H66 A;  2L5O A;  5IMV A;  2XPE A;  3GFK A;  4NMU A;  4YQM A;  2H73 A;  1GLP A;  1THX A;  4IW9 A;  2BMX A;  1K3Y A;  1S3D A;  3H79 A;  5G2Z A;  2M46 A;  3ED3 A;  4TVE A;  2NPB A;  4POB A;  5KN3 A;  1CQH A;  3TCO A;  1M2D A;  3VWV A;  1FO5 A;  2WDU A;  4ML6 A;  3CYN A;  4MH2 A;  4OO5 A;  1XZO A;  2A2P A;  1T8E B;  5EPF A;  1OVN A;  3ZLP A;  1TK0 B;  3D22 A;  3LQ7 A;  4BVY B;  4CHS A;  3DML A;  5KN2 A;  3GX0 A;  4ZIJ A;  16GS A;  5IQY A;  2ZCT A;  2L4C A;  4LL1 B;  1ZYQ B;  3HVX A;  3O3T A;  1EZK A;  2G0F A;  3KMN A;  1XWK A;  5EVO A;  2E2G A;  4XCS A;  1PN0 A;  1Y25 A;  4ID0 A;  1HD2 A;  3J7Y b;  3IAM 2;  1O81 A;  2B7K A;  5IMZ A;  1XOB A;  3BCK A;  5F06 A;  1OE7 A;  4ZL8 A;  1U3A A;  1KTE A;  4NHW A;  3RBT A;  1TXX A;  1GSD A;  2FA8 A;  1BED A;  3TKQ A;  4RI7 A;  1GUM A;  2X8C A;  1OKT A;  2GZY A;  1Z6N A;  5JWR B;  1FB0 A;  4HZ4 A;  4EIP A;  2V6K A;  2C3T A;  3G7Y A;  2CVK A;  1GSY A;  2VL2 A;  5GST A;  2C0E A;  2M72 A;  3IA1 A;  1B8X A;  4K0N A;  5EY6 A;  2H19 A;  2PGT A;  3IPZ A;  2R0C A;  3M8N A;  3I43 A;  4PX1 A;  1XFL A;  2GDR A;  3DVX A;  1Z7R A;  2HSH A;  4MA9 A;  4D73 A;  3QOU A;  3ZZX A;  4ICY A;  2QKE A;  2JZS A;  1EP8 A;  2IMK A;  4N0V A;  1R7H A;  1A23 A;  4YAP A;  1M2A A;  3Q6O A;  3IDV A;  2H30 A;  1VF1 A;  1WIK A;  5KN1 A;  5G1K A;  2KP1 A;  3HKR A;  3M0F A;  11GS A;  1PD2 1;  1TP9 A;  3C73 A;  1GP1 A;  1JZW A;  2H1D A;  2YCD A;  2RUE A;  1B4P A;  3ME8 A;  4WET A;  1K0C A;  2N5A A;  3A2W A;  2VLT A;  3D4T A;  1V98 A;  2P31 A;  2DJ2 A;  4JR6 A;  1TOF A;  2B3S A;  3H1N A;  1A0F A;  3VWX A;  3HZ4 A;  5KN0 A;  2H1B A;  1XW5 A;  2RM5 A;  3TJF A;  3CXG A;  2ZNM A;  3GN3 A;  2X64 A;  4ZBA A;  2I4A A;  5B7C A;  4Z7X A;  3QAG A;  3MIX A;  3C71 A;  1ABA A;  4TXO A;  3F6D A;  4XRA A;  3ZIV A;  5CAX A;  1ZYP A;  1UA5 A;  4LA1 A;  2HE3 A;  4IGJ A;  4BA7 A;  3L78 A;  4AJ7 A;  2VL3 A;  2PMT A;  4MJA A;  1F3B A;  5F0G A;  4BWQ A;  5BRT A;  3APO A;  2WRT A;  5G1L A;  5H5Q A;  1R5P A;  1GWC A;  2VLV A;  2L4Q A;  3ZYW A;  2CX4 A;  4TR0 A;  5GAN D;  4IP1 A;  4KF9 A;  1MDJ A;  2PWJ A;  4GF0 A;  3NOF A;  1DBY A;  4QL9 A;  1YJ6 A;  3FZ5 A;  1T1V A;  4JRR A;  2HNL A;  1FG4 A;  2LST A;  1I5G A;  1A24 A;  4OCF A;  4QQ7 A;  2C0F A;  1O85 A;  2PBJ A;  1YKC A;  4D73 B;  4PQ1 A;  1XW6 A;  1XBS A;  4OMV A;  1SU9 A;  4KE3 A;  5JCG A;  1GTB A;  3VWU A;  3F8U A;  4DSS A;  4YAV A;  4AJ6 A;  1O7U A;  4AJ8 A;  1EGO A;  5ELA A;  3HJP A;  1XW9 A;  4TR4 A;  4X0X A;  4CW9 A;  2X8G A;  1V57 A;  4OWY A;  4USS A;  1JLW A;  3A2V A;  2YP6 A;  3QD9 A;  2GT6 A;  1SYX A;  3F0I A;  3HVV A;  3LYK A;  5GAP D;  1U3I A;  3HJO A;  2H8L A;  5DCH A;  3Q74 A;  3IXR A;  2ZUP A;  3IBH A;  2B1L A;  1XXU A;  4GST A; 
#chains in the Genus database with same CATH homology
 3FZA A;  2J23 A;  5L71 A;  1O73 A;  3LGC A;  4TXO B;  4CY8 A;  3F4R A;  1UC7 A;  1X9M B;  2V32 A;  2L59 A;  1MD3 A;  3CSH A;  1SD9 A;  2FHE A;  1F6M C;  2VM1 A;  3HZ8 A;  2GSS A;  3D0Z A;  4E8H A;  2HXK A;  1OC9 A;  2AB6 A;  1YF1 A;  3N9J A;  4DEJ A;  6GSS A;  2VM2 A;  3ISO A;  3MSZ A;  3IC4 A;  4J2F A;  4GQC A;  1ML6 A;  2GQK A;  1SD8 A;  1W89 A;  3GMF A;  4KB3 A;  5DBQ A;  2C3N A;  3H4K A;  4HQS A;  5LD0 A;  3F6F A;  3I6A A;  1K0D A;  3US3 A;  3LFL A;  4O7H A;  3GKX A;  4TXV A;  5DQY A;  4KDX A;  1GRX A;  2RUF A;  2VD1 A;  1SL0 B;  3VPQ A;  4TW5 A;  4KCA A;  2FWG A;  4K2D A;  3R2Q A;  1VF3 A;  1AQW A;  1WOU A;  5ABR A;  2H70 A;  3IRA A;  2I1U A;  4DSS B;  2A4V A;  4RQX A;  4XS1 A;  3GTU A;  5CRW A;  3TRQ A;  4XTS A;  2MYG A;  4N10 A;  2WZ9 A;  3ERW A;  3U6V A;  3W6G A;  2YNX A;  3O6T A;  4J57 E;  5GZZ B;  2OE1 A;  3VUR A;  2VL2 C;  3VI5 A;  2X49 A;  1ERU A;  2R37 A;  1T4Z A;  2F8A A;  1ON4 A;  3UAP A;  1ERW A;  3V1W A;  4XRD A;  2J9H A;  3TKS A;  3A2X A;  2M80 A;  4HJ2 A;  3QCP A;  2DJ1 A;  2QA1 A;  5DAK A;  2IL3 A;  3D4M A;  1GTA A;  1K0M A;  4IJI A;  2WUL A;  1V9W A;  1K3O A;  4BL7 A;  4E8E A;  3FEU A;  5HFG A;  2REM A;  5CRD A;  2H0I A;  4K9Z A;  3FYG A;  4MAB A;  4CY6 A;  1I9D A;  4ECJ A;  4RUV A;  4IS0 A;  4LL4 B;  5J41 A;  4LMW A;  1OC9 B;  2JU5 A;  4PTS A;  1T4Y A;  3FW2 A;  2YZU A;  3APS A;  3EWL A;  2CQ9 A;  4JBB A;  1QFN A;  2C1Y A;  3FR3 A;  3SWL A;  2VO4 A;  2GT5 A;  2VAF A;  1FB6 A;  1ZZY A;  2VCV A;  4MJB A;  3HVS A;  2D2Z A;  4WF5 A;  1J0F A;  2I9H A;  2PPT A;  1XPV A;  4NAX A;  4Q5N A;  1HQO A;  4I8B A;  2VCT A;  2K18 A;  4KW6 A;  4HUA A;  4K7N A;  3GSS A;  4MZC A;  4IQA A;  2YWI A;  3U5R E;  1K3L A;  3IV4 A;  2DIZ A;  1J9B A;  4WF4 A;  1M99 A;  3TJG A;  3F3R A;  1UN2 A;  4Q5R A;  5HFK A;  1DSB A;  3L9S A;  5AIV A;  2AJQ B;  4F9Z A;  2CVD A;  2LRN A;  5JCW A;  1TDI A;  2GSQ A;  1BAY A;  4HJM A;  4H86 A;  5E59 A;  4HOJ A;  2OE3 A;  4ZL7 A;  3M9J A;  2CZ3 A;  2R0G A;  6GST A;  3GTU B;  3EMP A;  4RI6 A;  2P5R A;  1JFU A;  1XVQ A;  5ECI B;  2MMA A;  4K5R A;  5A4W A;  4FIW A;  1H75 A;  5DDL A;  4O32 A;  2DLX A;  3CMI A;  1Z3E A;  3HCZ A;  3FRC A;  3FZ4 A;  5D9X A;  2FUG 2;  2YWM A;  2IME A;  5D9V A;  4NHZ A;  5EL8 A;  2V1M A;  4WR4 A;  2R0P A;  3IC8 A;  3GUS A;  4ZIL A;  3IHG A;  4FYU A;  3UEM A;  3CBU A;  4POL A;  1X5C A;  2MZC A;  1EOG A;  1IYH A;  3W8S A;  1GSQ A;  4K1F A;  2F3M A;  4XIH A;  1A2J A;  4P3Y B;  2AYT A;  4XS4 A;  5DAK B;  1FOH A;  3EU4 A;  1HNC A;  3C8E A;  2LRT A;  2LJR A;  4BL7 B;  2VD0 A;  2AUV A;  2C4J A;  1YKA A;  2V2G A;  4FQU A;  5ECK B;  3BBY A;  4NXI A;  2QC7 A;  3WD6 A;  4O5R A;  3P2A A;  2IWT A;  1QUW A;  1FVJ A;  2PER A;  2JSY A;  2HRA A;  1KBN A;  5BMU A;  2DSA A;  1A8L A;  3FZ9 A;  3CRT A;  3MWH A;  4MJE A;  4K2X A;  2H1G A;  2JAC A;  4NPB A;  5AIS A;  3FMW A;  4HI7 A;  3NIV A;  3QMX A;  3FHK A;  3AY8 A;  1K0N A;  1K0A A;  3UAR A;  3GKK A;  4L0U A;  1S3A A;  5IO0 A;  5IPH A;  4GSS A;  2HRN A;  5G5E A;  3ERF A;  3KTL A;  2EIO A;  3ERG A;  2B5X A;  2DIY A;  2LQO A;  17GS A;  4PQH A;  5DJM A;  3G9B A;  3MAK A;  2LNT A;  5D73 A;  3H8Q A;  22GS A;  1E2Y A;  2CAQ A;  2IMI A;  4KGI A;  4IJ3 A;  1JZR A;  3FR6 A;  2IJY A;  1F9M A;  2MMN A;  5DAL A;  4KCE A;  3MDK A;  3QPM A;  2R4V A;  2WFC A;  1EEM A;  1BJX A;  4OFN A;  1FHE A;  2TRX A;  5DCG A;  4L5L A;  3EPT A;  3VWW A;  4JED A;  3DIE A;  3IE3 A;  4TN8 A;  4ML1 A;  2JZR A;  1GNW A;  4IQ1 A;  1Q98 A;  4MF7 A;  2LTK A;  3KJY A;  4YQV A;  2H0G A;  1TRW A;  4MDC A;  4G0L A;  2EC4 A;  4MZB A;  5IOW A;  4XS4 B;  1H4O A;  1Y6E A;  3UIW A;  2DC5 A;  6GSV A;  4KDY A;  5JWQ B;  2QSI A;  4PQI A;  4KA0 A;  1U87 A;  2IFQ A;  3FR9 A;  3KH7 A;  3LW9 A;  3K8N A;  1X5D A;  3KD0 A;  5CP1 A;  2OBK A;  5J9C A;  3SBC A;  2KOK A;  1PKW A;  3GL3 A;  3ZIJ A;  4GWR A;  3D5J A;  5AGY A;  2FLS A;  3M3M A;  2K8V A;  1SEN A;  3LXT A;  4ZB8 A;  4ECB A;  2KUC A;  4MLY A;  1PX7 A;  5J9B A;  5G31 A;  1X0R A;  1XWB A;  3TKR A;  1U88 A;  2GTU A;  3F9U A;  4I5Q A;  4ECI A;  1K0B A;  1Z5Y E;  3VFI A;  3KCM A;  1OE8 A;  2OAD A;  3EC3 A;  2YPM A;  3CSI A;  2PVQ A;  2YJH A;  2IMF A;  4MCU A;  3MNG A;  3UJ1 A;  1AW9 A;  2VCQ A;  4G9H A;  1RQM A;  1T00 A;  5D93 A;  3P7X A;  4ZL9 A;  4BPY A;  4TR1 A;  1B9X C;  1FVK A;  2VL9 A;  4OFM A;  1TI1 A;  1T7P B;  5DAL B;  3QAV A;  3KZQ A;  4TR3 A;  3ZIT A;  1J08 A;  5FWG A;  4KDU A;  1XVW A;  3RHC A;  4EUY A;  1WRY A;  2NDO A;  5AIX A;  1PX6 A;  1VGL A;  1G6W A;  4OD7 A;  4FH8 A;  4MF5 A;  2FWE A;  1R5A A;  4PUF C;  4FO5 A;  1WPI A;  1QXH A;  2XBI A;  4WBR D;  4HEA 2;  2LV3 A;  2TRC P;  4NV2 A;  1M7T A;  4TOP A;  5G5F A;  4G0I A;  4QL7 A;  1ZMA A;  3BD2 A;  2GQM A;  5A4V A;  2O85 A;  1T3B A;  4ULX A;  3KP8 A;  1YQ1 A;  5C00 A;  5F05 A;  5ECO B;  4MF6 A;  3F3Q A;  4XHM A;  2C3Q A;  1YF0 A;  1OC8 A;  3KIJ A;  1AC1 A;  3DRN A;  4Q5F A;  2L5L A;  1V40 A;  2WS2 A;  4ZB6 A;  4ECC A;  1PQN A;  1GSE A;  4AGS A;  2IFQ B;  1MTC A;  1GTI A;  4EXJ A;  3HYP A;  4JU5 A;  3TJK A;  4WXT A;  1F3A A;  3VPT A;  2B6M A;  2LRC A;  4K0G A;  4X1U A;  1YY7 A;  1THO A;  1WE0 A;  1PSQ A;  4MH3 A;  3E3E A;  5D96 A;  3MYD A;  3VI7 A;  1ACV A;  3GST A;  5J5N A;  1A0R P;  2E0Q A;  3F4T A;  2H76 A;  1DUG A;  5IMD A;  5GSS A;  1M0U A;  1E6B A;  8GSS A;  4NWY A;  1GTU A;  3KXO A;  5LCZ A;  1SK2 A;  1IYI A;  2CA8 A;  4V1A g;  2FD3 A;  4V1A p;  4EDY A;  2XC2 A;  4N0Z A;  4ZXG A;  1XIY A;  1KEB A;  1PMT A;  2LQQ A;  3D21 A;  2B5Y A;  4GLT A;  3DWV A;  3HDC A;  3KTB A;  3BOA A;  2L57 A;  1F2E A;  1KNG A;  2TIR A;  1PL1 A;  4TR1 B;  3GA4 A;  4GSN A;  4MJC A;  2C8U A;  1O6J A;  1Q4J A;  1SL1 B;  1G0T A;  2GS3 A;  12GS A;  5IM9 A;  1SYR A;  1USB A;  5D9W A;  4HS1 A;  2XBQ A;  1PA3 A;  4WR5 A;  1R4W A;  4JE1 A;  4IHU A;  2I3Y A;  4K8M A;  4FYC A;  3IR4 A;  3HXS A;  1BYE A;  1SL2 B;  5D9T A;  4HU7 A;  1TTZ A;  2B5E A;  3J7Y k;  5KEJ A;  1SJZ A;  2AV4 A;  4HQZ A;  2X4A A;  3TGZ A;  3ZL5 A;  4WKW A;  4MK3 A;  4WEY A;  4EE0 A;  4L8E A;  4G2E A;  1ERV A;  1OYJ A;  3EU3 A;  4CDO A;  3IOS A;  2K9F A;  3WT2 A;  3TOT A;  2LEG A;  4HU9 A;  2CZ2 A;  5IOX A;  2O87 A;  2DKH A;  5IPG A;  3TJB A;  5INY A;  4PXO A;  2A2R A;  1GUH A;  3UBK A;  1Z7P A;  2BTO T;  3C7M A;  18GS A;  1ILO A;  2OAC A;  1NW2 A;  1A8Y A;  4X43 A;  1O8W A;  1SK0 A;  1ERT A;  3A3T A;  1YDK A;  3DVW A;  1YZX A;  3RPN A;  5IMA A;  5G30 A;  2K6V A;  2ON5 A;  2VIM A;  4BWS A;  1FOV A;  1PGT A;  2HZF A;  4KX4 A;  1F37 A;  3Q19 A;  3TB2 A;  4F2I A;  3TRP A;  1XWG A;  2C80 A;  2GZP A;  5J4U A;  4EVM A;  2WJU A;  3L9V A;  3IHQ A;  2NBS A;  1JHB A;  4DSQ A;  2HYX A;  2R6K A;  3QFA C;  1ZYE A;  3LJR A;  2AHE A;  1DE1 A;  2P5Q A;  4KSO A;  2I81 A;  4OFT A;  2FY6 A;  3I69 A;  5ECR B;  1NSW A;  5IO2 A;  2E7P A;  5ECQ B;  2GZZ A;  2OBI A;  3R3E A;  1Z6M A;  3GH6 A;  4ISD A;  1HYU A;  5HR1 A;  3M1G A;  4O5U A;  4GQF A;  3D6I A;  4FYB A;  2OJL A;  4K7I A;  2YN1 A;  1N2A A;  3KMO A;  1FAA A;  3GL5 A;  2LS5 A;  1FW1 A;  5ENU A;  1TK8 B;  2L6D A;  1V58 A;  1U6T A;  5HFI A;  1URM A;  3CRU A;  1X9W B;  2C0D A;  4N30 A;  5HQP A;  5ECH B;  1SJI A;  4I2T A;  4PNG A;  2NTO A;  2FGX A;  4ZBB A;  4Z2U A;  5COH A;  2QA2 A;  2IMD A;  2AAW A;  2LNS A;  4TKY A;  2XPD A;  2H74 A;  1A2L A;  4AF2 A;  1M2B A;  3VLN A;  4K6X A;  3CTG A;  2R3X A;  4Q5Q A;  4I2U A;  4IKH A;  2H6X A;  3ZVJ D;  2HLS A;  2H1A A;  3UOM A;  2HZE A;  4MP4 A;  1XWA A;  5JWO B;  2MBT A;  14GS A;  4K5S A;  4JZQ A;  2OA7 A;  3WYW A;  3RHB A;  2F9S A;  1GLQ A;  3EYT A;  2OKA A;  3C1R A;  2B7J A;  5A4U A;  3KH9 A;  6GSY A;  4V2M A;  2VCZ A;  2DJK A;  5IMF A;  3G7J A;  3CSJ A;  4NV5 A;  2YZH A;  4EDZ A;  2PUK C;  2WCI A;  1G7O A;  2YWO A;  1GSS A;  2KLX A;  2YJ7 A;  6GSW A;  1B48 A;  2CT6 A;  2N5F A;  3WT1 A;  3WGX A;  1ZYN A;  4EC0 A;  4Z2T A;  3BJ5 A;  2LJK A;  2DJJ A;  1PL2 A;  3P90 A;  2HRK A;  3UVT A;  1BG5 A;  3TKS E;  1QGV A;  3P8W A;  1JZD A;  5IMC A;  3OR5 A;  3TKP A;  5AN1 A;  3FK8 A;  2VUP A;  4PUR A;  3ZTL A;  4IN0 A;  3QDN A;  2YAN A;  4KH7 A;  3GRX A;  4OO4 A;  1SK1 A;  2FWH A;  1EEJ A;  2IIY A;  2GVP A;  2JZT A;  4G10 A;  2FCH A;  2DML A;  9GSS A;  2L6C A;  2GST A;  3RDW A;  1AAZ A;  1ST9 A;  4Z2R A;  4F03 A;  3M9K A;  1QK8 A;  3ZFL A;  3FY7 A;  3QFB C;  1B9Y C;  5ELG A;  4WBJ A;  3GKM A;  5H5R A;  4EO3 A;  4BVX A;  3TRX A;  5B8B A;  3ZRD A;  5ECN B;  2HZE B;  2RLI A;  1GL8 A;  4MNN A;  1WP0 A;  3LOR A;  1RW1 A;  5CNW A;  4GTU A;  2G2Q A;  1K0O A;  1PKZ A;  3O76 A;  3L4N A;  2K8S A;  4I97 A;  1EOH A;  2CV4 A;  4POM A;  4OCE A;  5ID2 A;  3F63 A;  1LJR A;  2O89 A;  3A5W A;  1X5E A;  5CRG A;  4JR4 A;  5F8B A;  5D8I A;  1Z9H A;  3IAS 2;  3E0U A;  3KEB A;  2H01 A;  2JAD A;  3HY2 A;  3TOU A;  3HD5 A;  2JSZ A;  5B6M A;  1W4V A;  3EMX A;  1G6Y A;  4EKZ A;  3ZML A;  2HFD A;  3CTF A;  1LBK A;  3RAZ A;  6GSU A;  4POK A;  4V2N A;  3EIN A;  1GSF A;  5DJL A;  2CAI A;  1OAZ A;  1GUK A;  2CX3 A;  3ZFB A;  2H75 A;  2ES7 A;  3KP9 A;  5B8A A;  3E9J B;  1B4Q A;  3TKS C;  2MMZ A;  2LKU A;  1TW9 A;  2RM6 A;  4EIQ A;  5HR3 A;  3G7I A;  2GLR A;  5FT3 A;  2H6Y A;  2X99 A;  5CYY A;  1TJD A;  1WWJ A;  2QGV A;  5HR2 A;  1VF4 A;  1SKR B;  4PGT A;  1M9A A;  3HJM A;  1QQ2 A;  2ALB A;  3TDG A;  2N5B A;  3QAW A;  2IN3 A;  3GX8 A;  3DD3 A;  3LWA A;  3HHV A;  2F8F A;  2A4H A;  2VLU A;  5C04 A;  2VOC A;  3LG6 A;  1HNB A;  1JZO A;  5H5S A;  2H71 A;  2EIR A;  3DGQ A;  2JL4 A;  3APQ A;  1TK5 B;  1GNE A;  1EV4 A;  1O8X A;  2H6Z A;  2B1K A;  1C72 A;  1MD4 A;  3DYR A;  4L0W A;  5ECS A;  3WGE A;  19GS A;  3ZVJ A;  1NHY A;  1TU7 A;  2OE0 A;  1BX9 A;  4BVX B;  3GHA A;  1WJK A;  4MPG A;  5B6N A;  2FNO A;  2MMO A;  5LNK e;  1OC3 A;  4KUN A;  3I9V 2;  4MZW A;  1YEX A;  4YQU A;  2Z9S A;  3EE2 A;  2HI7 A;  4PNF A;  1AXD A;  2LJA A;  2H72 A;  1NM3 A;  1XCC A;  1EV9 A;  2GQL A;  1VF2 A;  5ID2 B;  4LMV A;  5DQS A;  2X8H A;  4PUA A;  6GSX A;  3GV1 A;  4IVF A;  20GS A;  3LYP A;  2GGT A;  1CQG A;  2YOI A;  3GUR A;  3N5O A;  4TRX A;  2P0G A;  3IK9 A;  4V2L A;  2C0G A;  1EGR A;  2A2S A;  1X9S B;  1ZL9 A;  1V2A A;  4ZBD A;  4G0K A;  3JCM L;  4HZ2 A;  2LUS A;  2V41 A;  1DE2 A;  4F0C A;  3L0H A;  1UVZ A;  3VK9 A;  4F82 A;  4N11 A;  1MDK A;  1GH2 A;  2FA4 A;  3RPP A;  2YV9 A;  3KM6 A;  3LEF A;  3A5I A;  3UVH A;  1M9B A;  4XS6 A;  1XWC A;  1HNA A;  2V6O A;  2HT9 A;  3PR8 A;  3ME7 A;  5CRH A;  1SKW B;  4K7O A;  4MMM A;  2IPA A;  1EP7 A;  3FKF A;  5E4W A;  3BCI A;  1AUC A;  5ECM B;  3EVI A;  4G19 A;  1G7E A;  3L9U A;  3Q18 A;  1TI3 A;  1SKS B;  1TKD B;  3GKN A;  4ILF A;  1OKD A;  1AQX A;  1TU8 A;  1N8J A;  4A5P A;  2DJ3 A;  2HSM A;  2E2M A;  3GIX A;  1ZGN A;  3PPU A;  2PN8 A;  2VCW A;  1TRS A;  5JCU A;  2GSR A;  2CVB A;  1AIU A;  2F51 A;  2WGR A;  4O92 A;  4F0B A;  1A2M A;  2H0H A;  3PH9 A;  5ECL B;  1PN9 A;  2HSY A;  4X4J A;  2ON7 A;  3GYK A;  4RQR A;  3F4S A;  1TRU A;  5KOX A;  4KSM A;  2DKI A;  1GSU A;  3UBL A;  2R5G A;  3IK7 A;  2YV7 A;  3DEX A;  13GS A;  3EUR A;  3WGD A;  4BVY A;  4DSR A;  3QR6 A;  7GSS A;  2WB9 A;  3LSZ A;  4DVC A;  5KOW A;  1AQV A;  1EWX A;  2DBC A;  3PGT A;  1ZOF A;  2O8V B;  4GXZ A;  2DJ0 A;  4O5Q A;  5CO3 A;  1YEP A;  2FWF A;  2R2J A;  1MDI A;  1RK4 A;  4LLR A;  5J3R A;  3C1S A;  4I6X A;  4YKF A;  4ACS A;  3ZMK A;  4GRF A;  5FHI A;  1SJ6 A;  10GS A;  3ZRE A;  1WMJ A;  3GNJ A;  1QMV A;  4L5O A;  1S3C A;  2PU9 C;  3W8J A;  1NHO A;  2YWN A;  1JLV A;  1PRX A;  1ZCP A;  4IEL A;  3TJJ A;  3PIN A;  1BQ7 A;  3HA9 A;  2MBS A;  4KAE A;  3KGK A;  2VCX A;  1R26 A;  2DMM A;  5CRE A;  1VRS D;  2UZ8 A;  4EL1 A;  5HR0 A;  2RII A;  4J56 E;  2PVO C;  5IIZ A;  2BJX A;  3TUE A;  2KHP A;  2XHF A;  3LXZ A;  4YH2 A;  1LU4 A;  4ZB9 A;  1GUL A;  4HDE A;  5F07 A;  3NZN A;  5ECP B;  2KP2 A;  4GCI A;  3GH9 A;  3S9F A;  2NVL A;  4EF0 A;  2O7K A;  1TRV A;  3UL3 A;  2HRF A;  4IBP A;  4YKG A;  3UMA A;  5A5K A;  1MEK A;  3DXB A;  4IP6 A;  1XOA A;  4KND A;  3H93 A;  2EIQ A;  3DKS A;  4MPF A;  5DVB A;  2H66 A;  2L5O A;  5IMV A;  2XPE A;  3GFK A;  4NMU A;  4YQM A;  2H73 A;  1GLP A;  1THX A;  4IW9 A;  2BMX A;  1K3Y A;  1S3D A;  3H79 A;  5G2Z A;  2M46 A;  3ED3 A;  4TVE A;  2NPB A;  4POB A;  5KN3 A;  1CQH A;  3TCO A;  1M2D A;  3VWV A;  1FO5 A;  2WDU A;  4ML6 A;  3CYN A;  4MH2 A;  4OO5 A;  1XZO A;  2A2P A;  1T8E B;  5EPF A;  1OVN A;  3ZLP A;  1TK0 B;  3D22 A;  3LQ7 A;  4BVY B;  4CHS A;  3DML A;  5KN2 A;  3GX0 A;  4ZIJ A;  16GS A;  5IQY A;  2ZCT A;  2L4C A;  4LL1 B;  1ZYQ B;  3HVX A;  3O3T A;  1EZK A;  2G0F A;  3KMN A;  1XWK A;  5EVO A;  2E2G A;  4XCS A;  1PN0 A;  1Y25 A;  4ID0 A;  1HD2 A;  3J7Y b;  3IAM 2;  1O81 A;  2B7K A;  5IMZ A;  1XOB A;  3BCK A;  5F06 A;  1OE7 A;  4ZL8 A;  1U3A A;  1KTE A;  4NHW A;  3RBT A;  1TXX A;  1GSD A;  2FA8 A;  1BED A;  3TKQ A;  4RI7 A;  1GUM A;  2X8C A;  1OKT A;  2GZY A;  1Z6N A;  5JWR B;  1FB0 A;  4HZ4 A;  4EIP A;  2V6K A;  2C3T A;  3G7Y A;  2CVK A;  1GSY A;  2VL2 A;  5GST A;  2C0E A;  2M72 A;  3IA1 A;  1B8X A;  4K0N A;  5EY6 A;  2H19 A;  2PGT A;  3IPZ A;  2R0C A;  3M8N A;  3I43 A;  4PX1 A;  1XFL A;  2GDR A;  3DVX A;  1Z7R A;  2HSH A;  4MA9 A;  4D73 A;  3QOU A;  3ZZX A;  4ICY A;  2QKE A;  2JZS A;  1EP8 A;  2IMK A;  4N0V A;  1R7H A;  1A23 A;  4YAP A;  1M2A A;  3Q6O A;  3IDV A;  2H30 A;  1VF1 A;  1WIK A;  5KN1 A;  5G1K A;  2KP1 A;  3HKR A;  3M0F A;  11GS A;  1PD2 1;  1TP9 A;  3C73 A;  1GP1 A;  1JZW A;  2H1D A;  2YCD A;  2RUE A;  1B4P A;  3ME8 A;  4WET A;  1K0C A;  2N5A A;  3A2W A;  2VLT A;  3D4T A;  1V98 A;  2P31 A;  2DJ2 A;  4JR6 A;  1TOF A;  2B3S A;  3H1N A;  1A0F A;  3VWX A;  3HZ4 A;  5KN0 A;  2H1B A;  1XW5 A;  2RM5 A;  3TJF A;  3CXG A;  2ZNM A;  3GN3 A;  2X64 A;  4ZBA A;  2I4A A;  5B7C A;  4Z7X A;  3QAG A;  3MIX A;  3C71 A;  1ABA A;  4TXO A;  3F6D A;  4XRA A;  3ZIV A;  5CAX A;  1ZYP A;  1UA5 A;  4LA1 A;  2HE3 A;  4IGJ A;  4BA7 A;  3L78 A;  4AJ7 A;  2VL3 A;  2PMT A;  4MJA A;  1F3B A;  5F0G A;  4BWQ A;  5BRT A;  3APO A;  2WRT A;  5G1L A;  5H5Q A;  1R5P A;  1GWC A;  2VLV A;  2L4Q A;  3ZYW A;  2CX4 A;  4TR0 A;  5GAN D;  4IP1 A;  4KF9 A;  1MDJ A;  2PWJ A;  4GF0 A;  3NOF A;  1DBY A;  4QL9 A;  1YJ6 A;  3FZ5 A;  1T1V A;  4JRR A;  2HNL A;  1FG4 A;  2LST A;  1I5G A;  1A24 A;  4OCF A;  4QQ7 A;  2C0F A;  1O85 A;  2PBJ A;  1YKC A;  4D73 B;  4PQ1 A;  1XW6 A;  1XBS A;  4OMV A;  1SU9 A;  4KE3 A;  5JCG A;  1GTB A;  3VWU A;  3F8U A;  4DSS A;  4YAV A;  4AJ6 A;  1O7U A;  4AJ8 A;  1EGO A;  5ELA A;  3HJP A;  1XW9 A;  4TR4 A;  4X0X A;  4CW9 A;  2X8G A;  1V57 A;  4OWY A;  4USS A;  1JLW A;  3A2V A;  2YP6 A;  3QD9 A;  2GT6 A;  1SYX A;  3F0I A;  3HVV A;  3LYK A;  5GAP D;  1U3I A;  3HJO A;  2H8L A;  5DCH A;  3Q74 A;  3IXR A;  2ZUP A;  3IBH A;  2B1L A;  1XXU A;  4GST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...