4MZCA

Atomic resolution structure of pfgrx1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
106
structure length
105
Chain Sequence
EAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIENPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title Atomic resolution crystal structure of glutaredoxin 1 from Plasmodium falciparum and comparison with other glutaredoxins.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 37
structure length 105
sequence length 106
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mzcA00
3D0ZA 3CYNA 4ZB6A 1A0RP 1HNBA 2C3NA 5DBQA 2GZYA 1DUGA 2DIZA 3UVTA 5ECMB 3KJYA 1EV9A 1O8WA 3LWAA 1TU7A 3APOA 4MPFA 2OBIA 3BJ5A 2G0FA 4POMA 4MZWA 1GUHA 1PL1A 4KH7A 2PGTA 4N0VA 4GQCA 1A8YA 4XIHA 3MAKA 2CQ9A 4RI7A 5HR1A 3F0IA 1Z3EA 3FY7A 1T4YA 5A4WA 5DAKB 3M9JA 3A2WA 5IM9A 4I5QA 1KTEA 2YNXA 3M1GA 3HZ4A 1YEPA 5B6NA 2ES7A 1FHEA 4MJBA 3QAWA 4I2TA 4L5OA 5HR0A 3M3MA 1ERUA 3GKNA 4GF0A 3LXZA 3DD3A 2GZPA 2LRNA 3ISOA 4Z7XA 3QFAC 4BL7A 1SL1B 2L6DA 4ZBBA 4LL1B 2REMA 1R4WA 2IMDA 2BMXA 2B3SA 3BD2A 2KP1A 2LSTA 3TKRA 1K3LA 3LFLA 2OKAA 3FZ4A 1PX6A 5IPHA 4NMUA 2H74A 5IO0A 3ERGA 4K0GA 3PH9A 3F3QA 1MD3A 3CTGA 1GLQA 2O85A 3FHKA 2GGTA 2VCQA 3KZQA 4AJ7A 1LU4A 3ZZXA 1Z7RA 5AISA 4D73B 2B5EA 4XRDA 1SK0A 1M99A 3FRCA 2N5AA 1VF1A 5CRGA 4K7OA 4GSSA 1GSUA 1YEXA 3EVIA 3D21A 4GTUA 2H30A 1BAYA 2NBSA 3TRQA 4OFTA 1BQ7A 5DDLA 3US3A 4OFMA 3Q74A 3A5WA 2JU5A 4TVEA 1OE8A 3PINA 3FKFA 1SENA 2CZ3A 3TJFA 3C7MA 3LEFA 2BJXA 3GHAA 3ZFBA 5IO2A 3LYKA 1THOA 2DSAA 3UOMA 5IMDA 5DQSA 4KCAA 2OJLA 3GL5A 2HXKA 3HVXA 1OYJA 1SKRB 4WKWA 4OO4A 2H1GA 5CO3A 3C8EA 2VL3A 4V2NA 1K0NA 2PWJA 1Z7PA 2DMMA 3FZ5A 1TRUA 2R2JA 2OADA 2X99A 4MH2A 3ZRDA 1OC8A 2VL2A 3IOSA 4DSQA 1S3CA 4ECBA 3UARA 2VAFA 4DSSB 1OKDA 4FIWA 3I6AA 2E2GA 2CZ2A 2VCXA 5G5EA 4N30A 2P0GA 4XRAA 1GUMA 1PD21 4KDUA 3HJPA 4HZ4A 2HLSA 3GTUA 5KN2A 3TRXA 2L57A 4XS4A 2H1AA 2FA8A 3DGQA 2DBCA 3PR8A 4WBRD 1LBKA 1TI1A 4K1FA 3FR3A 3S9FA 3VWVA 2WDUA 4O92A 2R3XA 4G10A 4I97A 1VRSD 4N10A 3UEMA 1VF3A 1ZOFA 3L78A 1SYXA 5JCGA 4V1Ap 5IMZA 1XOAA 5INYA 3FW2A 2HI7A 2Z9SA 1PRXA 4HI7A 1XVWA 4MLYA 1QFNA 1UA5A 2N5FA 5EL8A 6GSXA 1QUWA 11GSA 2I4AA 2I3YA 1X9WB 3LSZA 4ZXGA 4K2DA 3VI5A 4ECIA 1SK2A 3F63A 4ZB8A 4E8HA 1HD2A 2CVDA 1FAAA 1X9MB 1GTIA 3VI7A 2XPEA 4KDXA 5ELGA 1K3YA 1U3AA 2P5QA 5IQYA 4ULXA 4YQVA 3W6GA 4G9HA 4JZQA 2DJ2A 3GH9A 5KN0A 2E7PA 2OE3A 2H66A 1M2AA 3TCOA 3LG6A 4Q5NA 1RQMA 1VGLA 2C0FA 5IIZA 3DEXA 4YH2A 1GNWA 1YDKA 4YAVA 1ZL9A 4HU9A 2FUG2 4BWSA 2KHPA 2OE0A 4PX1A 2VLVA 4GXZA 1K0AA 2FWEA 2A2RA 3ZREA 1C72A 3DVXA 2C80A 2YJHA 1EP8A 3IPZA 1NW2A 4J56E 3GX8A 2GSQA 1OC9B 3L9VA 3O6TA 4EXJA 3FR6A 4OMVA 3CTFA 1J9BA 1AAZA 2JSYA 5D8IA 2H01A 1TU8A 4JR6A 1TOFA 1G6YA 4NV5A 2H1BA 4P3YB 2YZHA 2PU9C 2BTOT 2GSSA 3JCML 3VURA 3Q18A 5F0GA 1XWGA 3M8NA 5F06A 1T1VA 2WGRA 1TI3A 2N5BA 2GQMA 3ME8A 4IQAA 2WZ9A 4XS1A 1USBA 3KCMA 1O7UA 2K8VA 2TRXA 5CREA 2WB9A 3UVHA 1R26A 2K6VA 1HNAA 4IQ1A 1F3AA 5H5SA 1WMJA 2H73A 2LS5A 4IJIA 2FWGA 4MZBA 5A4UA 5DQYA 1A2MA 3GX0A 3HA9A 4I6XA 5ECNB 5DJLA 1YF1A 1QQ2A 2K18A 4H86A 1FVJA 4BPYA 3HZ8A 1AQVA 4WBJA 2V32A 3CXGA 2MMZA 4IVFA 4ID0A 1A24A 3FK8A 1TK8B 2H71A 3RBTA 2B7JA 3TB2A 3BCIA 3BOAA 3LJRA 4MZCA 5F07A 2IL3A 4TR1A 3QPMA 5ECHB 1ZCPA 5IOXA 1GSFA 1X5CA 3EYTA 5J41A 4GRFA 4O32A 3GUSA 3WD6A 1J08A 1T3BA 3FR9A 4F2IA 5CAXA 1HYUA 2AB6A 2R6KA 8GSSA 2OBKA 1Y6EA 2B1KA 2PN8A 2LEGA 4IN0A 1R5PA 1SD9A 2C1YA 1GNEA 4L5LA 3TRPA 3FZ9A 2VM2A 1K0MA 2X8HA 5L71A 4MK3A 5ID2A 2VCVA 2XBIA 1K0OA 3W8JA 4KGIA 3EMXA 5HFGA 3TOTA 2C0DA 1F2EA 4KSMA 3MNGA 3CSIA 2AYTA 2QC7A 3PGTA 4HUAA 1MDKA 2GSTA 4OD7A 3J7Yk 5DCGA 2H70A 5J5NA 2V6KA 2DJ3A 5CNWA 1F9MA 3ZIJA 2J9HA 2HZFA 3WYWA 2EC4A 2ALBA 4K6XA 3IDVA 2VCWA 2NPBA 4MJEA 2TIRA 1T7PB 3D22A 1XVQA 2F9SA 1EOHA 5F8BA 1ILOA 4ML1A 1TRWA 4LMWA 1WIKA 2CAIA 2FNOA 2VCTA 3C1SA 3GSTA 1VF4A 2DJKA 2K8SA 3GIXA 4JEDA 4MF6A 4OFNA 4TXOA 4FYCA 1YKAA 2VL2C 5KN1A 1O8XA 4O5RA 3IHQA 2WULA 4MABA 4KCEA 4AF2A 3GL3A 3W8SA 1ZGNA 2AAWA 4IGJA 6GSWA 2F8AA 5B6MA 3IBHA 4JR4A 4JU5A 4IBPA 2PERA 2H0IA 2RLIA 3GH6A 4KAEA 4MPGA 1NHYA 4HQSA 2CVKA 2P5RA 3KMOA 3NOFA 2EIOA 4CHSA 4NV2A 4ILFA 3KEBA 3ME7A 2IIYA 2J23A 2R37A 2VD1A 4EC0A 3I43A 3WGXA 2FD3A 5ECOB 4Q5FA 4GSTA 5CRDA 4WF4A 1F6MC 1YKCA 2OE1A 2CX4A 5H5RA 1NM3A 3ZIVA 3TOUA 4IP1A 4PQHA 1B48A 3OR5A 4NXIA 4MDCA 5G5FA 4F03A 4KA0A 5JWRB 5AIXA 4TR3A 1AIUA 2O89A 3QAGA 1TK5B 3TUEA 3HHVA 1GTAA 4MA9A 3KM6A 4WR5A 3QD9A 4NPBA 10GSA 2CT6A 20GSA 1X0RA 2GZZA 2NVLA 1EZKA 1M2BA 3NZNA 2M80A 5G30A 3H1NA 1GTBA 2LKUA 2ON7A 2O7KA 3CRUA 4BA7A 4KUNA 1SKSB 3GTUB 4XS4B 3HVSA 3TGZA 1DBYA 3IR4A 4JRRA 2KLXA 3ERWA 3HKRA 2DC5A 4X43A 3TKSE 1JZDA 4ACSA 5A4VA 4PNGA 4G19A 3RPNA 2IMEA 1QK8A 1U88A 1H75A 5F05A 3EURA 1GL8A 2YWNA 3P90A 2JL4A 2YJ7A 5EVOA 4TN8A 1HNCA 3TJGA 4LL4B 5C00A 2LNSA 2K9FA 2IWTA 4ECJA 1M9AA 4XHMA 5ABRA 4GSNA 4L0UA 4PUAA 4MCUA 2LQOA 2F51A 1ERTA 2HSHA 1XFLA 2GS3A 1O81A 1SJIA 4WR4A 1SJZA 2JZTA 3GFKA 4POBA 4ZBDA 1EEJA 3EWLA 2B7KA 2GT6A 4V2LA 3N5OA 3G7JA 1TP9A 2YP6A 2XPDA 1TK0B 2IMIA 4EO3A 4RUVA 3UJ1A 3UAPA 3VWXA 1PQNA 4EKZA 5D73A 2OACA 17GSA 4WF5A 4YQUA 3UBLA 1WJKA 2VM1A 5ELAA 1PL2A 1B9YC 2VIMA 1DE2A 1AC1A 4TW5A 1SYRA 3Q19A 3SBCA 2FY6A 2LQQA 5COHA 3LGCA 1F37A 2I9HA 4KDYA 3HD5A 1IYHA 1V2AA 1B4PA 2HRNA 1KNGA 3ZFLA 2H0HA 3GURA 2B6MA 2GT5A 5IOWA 5HR2A 2CVBA 12GSA 4GWRA 3P8WA 2GVPA 3L9UA 1WWJA 1YQ1A 4IJ3A 1T00A 3UIWA 3MSZA 2H6YA 2LUSA 2MBSA 2DLXA 4TR0A 1A2LA 2AHEA 4MP4A 1J0FA 2YN1A 16GSA 1PN9A 2ZNMA 1SL0B 2JZSA 4EF0A 2DJ1A 2PMTA 4EVMA 2H6XA 1GSDA 1OAZA 3L0HA 2LJRA 3G7YA 1MEKA 1AW9A 2YWMA 3J7Yb 1OC3A 4N0ZA 3HJMA 6GSTA 1ZYQB 2X64A 1XOBA 4OWYA 3U5RE 1EWXA 1H4OA 2FWHA 3I9V2 3QMXA 2KP2A 4QQ7A 1ABAA 4NHZA 1XIYA 1MDIA 5A5KA 2C3TA 2IFQA 1O85A 2ON5A 2MMOA 3IC4A 3SWLA 4TR1B 2F3MA 3H79A 4HJMA 3EC3A 1MD4A 1XXUA 3IV4A 1XWAA 1PA3A 2PUKC 2QSIA 5CYYA 2FGXA 5J3RA 3QAVA 1YF0A 2X8GA 2IJYA 2TRCP 4EDZA 4BVYA 5G31A 3ZLPA 1EP7A 5FWGA 5CP1A 4V2MA 1U3IA 3HVVA 3EU3A 5ID2B 4KSOA 2VO4A 4Q5RA 2HYXA 2AJQB 1Z6MA 3VPTA 4OCEA 5ECLB 1RW1A 3C1RA 3ERFA 3QCPA 2X8CA 1EGOA 3M0FA 3TKSA 2EIQA 1BYEA 1ZYEA 2GDRA 4TXVA 5B8AA 4YAPA 5DVBA 3EU4A 5IMFA 1A8LA 3M9KA 3GRXA 3KXOA 5G1KA 4FH8A 5DALA 1A2JA 5DCHA 4WXTA 2H8LA 4FO5A 2YOIA 3CRTA 2GLRA 2IMFA 1JFUA 4RQXA 4PGTA 2C0EA 4DEJA 5E4WA 5HQPA 1XW6A 3P2AA 1I9DA 3VK9A 5JWOB 1CQHA 4K9ZA 3FEUA 4PUFC 4F0CA 3VFIA 3VWWA 4TXOB 4X0XA 4TOPA 3CBUA 4ZL8A 1JLWA 4IELA 3CSJA 1SU9A 2MMNA 1S3AA 2M72A 1CQGA 5B7CA 1AQWA 4POKA 2FCHA 1NSWA 4ZL7A 3KD0A 1BJXA 1I5GA 4FYUA 3H4KA 1PGTA 1Q98A 2NTOA 1V40A 1F3BA 1O6JA 4CW9A 3A2XA 4IKHA 5D93A 1VF2A 2YPMA 3GA4A 1XCCA 3F6DA 3IAS2 1Z9HA 1ON4A 1T8EB 4NHWA 4LA1A 1ST9A 3BCKA 3F9UA 3IA1A 2WRTA 1EGRA 3WT1A 1YY7A 2YWIA 2CV4A 2AV4A 3D5JA 4RI6A 4KX4A 1FVKA 3F4TA 2WCIA 1SKWB 1WE0A 1IYIA 4ISDA 1O73A 4AJ8A 3EINA 4HOJA 2FA4A 1W4VA 1N2AA 2EIRA 2A2SA 3ZL5A 4EUYA 4IS0A 4I2UA 5D9XA 1ZZYA 2LRCA 3NIVA 2V6OA 1EEMA 1M9BA 3DXBA 3KIJA 3HYPA 2RM5A 1N8JA 1WOUA 2HZEA 3CSHA 2CA8A 4LMVA 4TRXA 4X1UA 2F8FA 2H6ZA 1A0FA 1AUCA 4FYBA 5KN3A 2V41A 2PVQA 2LV3A 3TJJA 2P31A 5AGYA 4OCFA 1HQOA 1V57A 1V98A 1XBSA 1UC7A 4IHUA 1UVZA 1PMTA 4XTSA 3DVWA 4ECCA 5IMAA 2HFDA 4NWYA 4XCSA 3KTBA 2I81A 1DSBA 4LLRA 4OO5A 1QGVA 4WEYA 2E2MA 1ERWA 1JZOA 3GYKA 2HE3A 2ZCTA 1FB6A 3TJKA 3IAM2 1FO5A 4TKYA 1Y25A 4AGSA 1S3DA 1B9XC 2DIYA 1ACVA 3ZVJD 1X5DA 4EL1A 2HSYA 2XC2A 1TDIA 4MJAA 1WRYA 2CX3A 3RAZA 1BEDA 4RQRA 4WETA 2JACA 4KNDA 2H76A 3KTLA 1ML6A 2RUFA 2VD0A 2WJUA 2LJAA 5JCWA 2H75A 3UL3A 4F0BA 2C8UA 2H1DA 3IK7A 1R5AA 2RUEA 1SL2B 3AY8A 3F3RA 2FHEA 5GZZB 14GSA 3G7IA 1FG4A 2D2ZA 1SK1A 1XWKA 1K0BA 2DJJA 1PSQA 1PX7A 3QOUA 5J9CA 3A3TA 4PXOA 3HDCA 3APSA 1EV4A 5JCUA 19GSA 3KP9A 3APQA 4HJ2A 2MBTA 3FYGA 5DAKA 2VCZA 2DMLA 4IW9A 3A2VA 4QL7A 1JLVA 4Q5QA 5IMCA 4DVCA 2KOKA 5D9VA 1R7HA 5FHIA 1GWCA 3K8NA 3GKMA 1THXA 3TJBA 1Z6NA 2OA7A 5D9TA 3H8QA 4ZB9A 1YZXA 1BX9A 1GSEA 2ZUPA 2YCDA 3N9JA 1SD8A 3ZTLA 2GTUA 1RK4A 5J4UA 5HR3A 3TKSC 1XWCA 3HCZA 1TRSA 1GLPA 2L4QA 1E6BA 3D4MA 5ECSA 5GSSA 2VLUA 3F4SA 3DYRA 2LTKA 2V1MA 3IK9A 2HNLA 4NAXA 5IMVA 4GCIA 1ZMAA 5D9WA 3E3EA 1OVNA 4D73A 3GKXA 1GSSA 1TJDA 1BG5A 3DMLA 1KBNA 4POLA 3ZYWA 2RM6A 1XPVA 2YV9A 6GSYA 4BWQA 4DSRA 4EDYA 3QR6A 3KH9A 1EOGA 2XBQA 4BVXA 1E2YA 3FZAA 2YV7A 2L5LA 1G7OA 3Q6OA 4K8MA 1UN2A 2IFQB 3LQ7A 3DRNA 5ENUA 3IXRA 1XZOA 2QGVA 2XHFA 2JSZA 3HJOA 3GNJA 2PBJA 4K0NA 2JADA 2MZCA 3KMNA 1GSYA 2M46A 3VPQA 2L59A 2C4JA 2I1UA 1DE1A 3RHBA 1FW1A 6GSSA 1B4QA 2WS2A 3F6FA 1K0CA 4HEA2 3LYPA 3F8UA 3IRAA 2YWOA 2YANA 4MF5A 5ECRB 1A23A 5HFIA 3KP8A 4N11A 5G2ZA 1K3OA 4O7HA 2PVOC 3HY2A 9GSSA 4DSSA 2CAQA 4PQIA 1TW9A 4PURA 1GTUA 4ZBAA 5CRHA 3WGEA 2LJKA 1Z5YE 1X9SB 3TKPA 1WPIA 2B5XA 1NHOA 4TR4A 2VOCA 4JE1A 1K0DA 1U87A 2AUVA 2R5GA 4ZIJA 2O87A 5GSTA 5GAPD 1M7TA 2KUCA 5DALB 4KB3A 4PQ1A 1URMA 5LCZA 4F9ZA 3E9JB 1G7EA 2L5OA 2IMKA 4MJCA 1T4ZA 1W89A 1XWBA 1TXXA 2B1LA 5HFKA 2O8VB 4L0WA 6GSVA 5C04A 2QKEA 3L4NA 2VLTA 3LXTA 1PKWA 2G2QA 1Q4JA 1QMVA 5B8BA 3ED3A 3CMIA 2RIIA 4V1Ag 4L8EA 4GQFA 1GRXA 5E59A 1V58A 4HQZA 4F82A 1ERVA 2JZRA 4ML6A 3C73A 3GKKA 4XS6A 2B5YA 5AIVA 2R4VA 5ECQB 5CRWA 1AXDA 5ECPB 3GV1A 2GSRA 18GSA 1XW5A 5AN1A 4PNFA 4AJ6A 3L9SA 1AQXA 4J2FA 1GUKA 3P7XA 5JWQB 4KE3A 22GSA 1G6WA 1LJRA 4GLTA 1B8XA 2L6CA 1GP1A 3WT2A 2IN3A 1WP0A 3O76A 2GQKA 3U6VA 5IPGA 2GQLA 3RHCA 2FLSA 1GULA 2H19A 4ZILA 4KW6A 2WFCA 3E0UA 5J9BA 3DKSA 2C0GA 5LNKe 3EE2A 3D6IA 2HRFA 1JZRA 1M0UA 1GH2A 2DJ0A 1KEBA 5FT3A 3HXSA 2A4VA 5ECIB 1OC9A 3ZMKA 1OKTA 7GSSA 2MMAA 3I69A 1SJ6A 2LRTA 2MYGA 3TKQA 3H93A 2VUPA 1JHBA 5KEJA 3VLNA 2H0GA 2YZUA 3DIEA 4YQMA 3F4RA 1OE7A 3UMAA 4ZL9A 3ZITA 13GSA 5ECKB 5H5QA 2PPTA 1M2DA 2H72A 3DWVA 5DJMA 3GMFA 3KGKA 3RDWA 1TTZA 1TKDB 2HZEB 4MF7A 1FB0A 3D4TA 3GSSA 3WGDA 4JBBA 4K7IA 3ZVJA 1G0TA 4HU7A 1MTCA 3KH7A 3R2QA 3LORA 4IP6A 3IE3A 3TDGA 3RPPA 1JZWA 2FWFA 4HDEA 1U6TA 3G9BA 4QL9A 2HT9A 4G2EA 3MDKA 4I8BA 4MMMA 1MDJA 4E8EA 5GAND 1V9WA 2L4CA 4J57E 4EE0A 2IPAA 4CDOA 1QXHA 4MH3A 3EMPA 2VL9A 1X5EA 3C71A 4HS1A 5G1LA 3BBYA 2NDOA 3QFBC 3V1WA 3UBKA 3VWUA 1GSQA 5EY6A 3ZMLA 2LNTA 1FOVA 1TRVA 2C3QA 6GSUA 1YJ6A 5D96A 1PKZA 3QDNA 1XW9A 4K7NA 5LD0A 3O3TA 4HZ2A 2V2GA 3GN3A 2E0QA 5EPFA 3MWHA
chains in the Genus database with same CATH superfamily
3D0ZA 3CYNA 4ZB6A 1A0RP 1HNBA 2C3NA 5DBQA 2GZYA 1DUGA 2DIZA 3UVTA 5ECMB 3KJYA 1EV9A 1O8WA 3LWAA 1TU7A 3APOA 4MPFA 2OBIA 3BJ5A 2G0FA 4POMA 4MZWA 1GUHA 1PL1A 4KH7A 2PGTA 4N0VA 4GQCA 1A8YA 4XIHA 3MAKA 2CQ9A 4RI7A 5HR1A 3F0IA 1Z3EA 3FY7A 1T4YA 5A4WA 5DAKB 3M9JA 3A2WA 5IM9A 4I5QA 1KTEA 2YNXA 3M1GA 3HZ4A 1YEPA 5B6NA 2ES7A 1FHEA 4MJBA 3QAWA 4I2TA 4L5OA 5HR0A 3M3MA 1ERUA 3GKNA 4GF0A 3LXZA 3DD3A 2GZPA 2LRNA 3ISOA 4Z7XA 3QFAC 4BL7A 1SL1B 2L6DA 4ZBBA 4LL1B 2REMA 1R4WA 2IMDA 2BMXA 2B3SA 3BD2A 2KP1A 2LSTA 3TKRA 1K3LA 3LFLA 2OKAA 3FZ4A 1PX6A 5IPHA 4NMUA 2H74A 5IO0A 3ERGA 4K0GA 3PH9A 4BIKA 2QA2A 3F3QA 1MD3A 3CTGA 1GLQA 2O85A 3FHKA 2GGTA 2VCQA 3LW9A 4HSCX 3KZQA 4AJ7A 1LU4A 3ZZXA 1Z7RA 5AISA 4D73B 2B5EA 4XRDA 1SK0A 1M99A 3FRCA 2N5AA 1VF1A 5CRGA 4K7OA 4GSSA 1GSUA 1YEXA 3EVIA 3D21A 4GTUA 2H30A 1BAYA 2NBSA 3TRQA 4OFTA 4BVXB 5BMUA 1BQ7A 5DDLA 3US3A 4OFMA 3Q74A 3A5WA 2JU5A 4TVEA 1OE8A 3PINA 3FKFA 1SENA 2CZ3A 2HRAA 3TJFA 3C7MA 3LEFA 2BJXA 3GHAA 3ZFBA 5IO2A 3LYKA 1THOA 2DSAA 3UOMA 5IMDA 5DQSA 4KCAA 2OJLA 3GL5A 2HXKA 3HVXA 1OYJA 1SKRB 4WKWA 1ZYPA 4OO4A 2H1GA 5CO3A 3C8EA 2VL3A 4V2NA 1K0NA 2PWJA 1Z7PA 2DMMA 3FZ5A 1TRUA 2R2JA 2OADA 2X99A 4MH2A 3ZRDA 1OC8A 2VL2A 3IOSA 4DSQA 1S3CA 4ECBA 3UARA 2VAFA 4DSSB 1OKDA 4FIWA 3I6AA 2E2GA 2CZ2A 2VCXA 5G5EA 4N30A 2P0GA 4XRAA 1GUMA 1PD21 4KDUA 3HJPA 4HZ4A 2HLSA 2DKHA 3GTUA 5KN2A 3TRXA 2L57A 4XS4A 2H1AA 2FA8A 3DGQA 2DBCA 3PR8A 4WBRD 1LBKA 1TI1A 4K1FA 3FR3A 3S9FA 3VWVA 2WDUA 4O92A 2R3XA 4G10A 4I97A 1VRSD 4N10A 3UEMA 1VF3A 1ZOFA 3L78A 1SYXA 5JCGA 4V1Ap 5IMZA 1XOAA 5INYA 3FW2A 2HI7A 2Z9SA 1PRXA 4HI7A 1XVWA 4MLYA 1QFNA 1UA5A 2N5FA 5EL8A 6GSXA 1QUWA 11GSA 2I4AA 2I3YA 1X9WB 3LSZA 4ZXGA 4K2DA 3VI5A 4ECIA 1SK2A 3F63A 4ZB8A 4E8HA 1HD2A 2CVDA 1FAAA 1X9MB 1GTIA 3VI7A 2XPEA 4KDXA 5ELGA 1K3YA 1U3AA 2P5QA 5IQYA 4ULXA 4YQVA 3W6GA 4G9HA 4JZQA 2DJ2A 3GH9A 5KN0A 2E7PA 3R3EA 2OE3A 2H66A 1M2AA 3TCOA 3LG6A 4Q5NA 1RQMA 1VGLA 2C0FA 5IIZA 3DEXA 4YH2A 1GNWA 1YDKA 4YAVA 1ZL9A 4HU9A 2FUG2 4BWSA 2KHPA 2OE0A 4PX1A 2VLVA 4GXZA 1K0AA 2FWEA 2A2RA 3ZREA 1C72A 3DVXA 2C80A 2YJHA 1EP8A 3IPZA 1NW2A 4J56E 3GX8A 2GSQA 1OC9B 3L9VA 3O6TA 4EXJA 3FR6A 4OMVA 3CTFA 1J9BA 1AAZA 2JSYA 3FMWA 5D8IA 2H01A 1TU8A 4JR6A 2DKIA 1TOFA 1G6YA 4NV5A 2H1BA 4P3YB 2YZHA 2PU9C 1FOHA 2BTOT 2GSSA 3JCML 3VURA 3Q18A 5F0GA 1XWGA 3M8NA 5F06A 1T1VA 2WGRA 1TI3A 2N5BA 2GQMA 3ME8A 4IQAA 2WZ9A 4XS1A 1USBA 3KCMA 1O7UA 2K8VA 2R0PA 2TRXA 5CREA 2WB9A 3UVHA 1R26A 2K6VA 1HNAA 4IQ1A 1F3AA 5H5SA 1WMJA 2H73A 2LS5A 4IJIA 2FWGA 4O5UA 4MZBA 5A4UA 5DQYA 1A2MA 3GX0A 3HA9A 4I6XA 5ECNB 5DJLA 1YF1A 1QQ2A 2K18A 4H86A 1FVJA 4BPYA 3HZ8A 1AQVA 4WBJA 2V32A 3CXGA 2MMZA 4IVFA 4ID0A 1A24A 3FK8A 1TK8B 2H71A 1M3IA 3RBTA 2B7JA 3TB2A 3BCIA 3BOAA 3LJRA 4K2XA 4MZCA 5F07A 2IL3A 4TR1A 3QPMA 5ECHB 1ZCPA 5IOXA 1GSFA 1X5CA 3EYTA 5J41A 4GRFA 4O32A 3GUSA 3WD6A 1J08A 1T3BA 3FR9A 4G0LA 4F2IA 5CAXA 2A2PA 1HYUA 2AB6A 2R6KA 8GSSA 2OBKA 1Y6EA 2B1KA 2PN8A 2LEGA 4IN0A 1R5PA 1SD9A 2C1YA 1GNEA 4L5LA 3TRPA 3FZ9A 2VM2A 1K0MA 2X8HA 5L71A 4MK3A 5ID2A 2VCVA 2XBIA 1K0OA 3W8JA 4KGIA 3PPUA 3EMXA 5HFGA 3TOTA 2C0DA 1F2EA 4KSMA 3MNGA 3CSIA 2AYTA 2QC7A 3PGTA 4HUAA 1MDKA 2GSTA 4OD7A 3J7Yk 5DCGA 2H70A 5J5NA 2V6KA 2DJ3A 5CNWA 1F9MA 3ZIJA 2J9HA 2HZFA 3WYWA 2EC4A 2ALBA 4K6XA 3IDVA 2VCWA 2NPBA 4MJEA 2TIRA 1T7PB 3D22A 1XVQA 2F9SA 1EOHA 5F8BA 1ILOA 4ML1A 1TRWA 4LMWA 1WIKA 2CAIA 2FNOA 2VCTA 3C1SA 3GSTA 1VF4A 2DJKA 2K8SA 3GIXA 4JEDA 4MF6A 4OFNA 4BL7B 4TXOA 4FYCA 4YKGA 1YKAA 2VL2C 5KN1A 1O8XA 4O5RA 3IHQA 2WULA 4MABA 4KCEA 4AF2A 1PFOA 3GL3A 3W8SA 1ZGNA 2AAWA 4IGJA 6GSWA 2F8AA 5B6MA 3IBHA 4JR4A 4JU5A 4IBPA 2PERA 2H0IA 2RLIA 3GH6A 4KAEA 4MPGA 1NHYA 4HQSA 2CVKA 2P5RA 3KMOA 3NOFA 2EIOA 4CHSA 4NV2A 4ILFA 3KEBA 3ME7A 2IIYA 2J23A 2R37A 2VD1A 4EC0A 3I43A 3WGXA 2FD3A 5ECOB 4Q5FA 4GSTA 5CRDA 4WF4A 1F6MC 1YKCA 2OE1A 2CX4A 5H5RA 4CY6A 1NM3A 3ZIVA 3TOUA 4IP1A 4PQHA 1B48A 3OR5A 4NXIA 4MDCA 5G5FA 4F03A 4KA0A 5JWRB 5AIXA 4TR3A 1AIUA 2O89A 3QAGA 1TK5B 3TUEA 3HHVA 1GTAA 4MA9A 3KM6A 3HVNA 3QD9A 4NPBA 4WR5A 10GSA 2CT6A 1M3JA 20GSA 1X0RA 2GZZA 4FQUA 2HSMA 1EZKA 2NVLA 1M2BA 5KOWA 3NZNA 2M80A 5G30A 3H1NA 1GTBA 2LKUA 2ON7A 2O7KA 3CRUA 4YKFA 4BA7A 4KUNA 1SKSB 3GTUB 4XS4B 3HVSA 3TGZA 1DBYA 3IR4A 4JRRA 2KLXA 3ERWA 3HKRA 2DC5A 4X43A 3TKSE 1JZDA 4ACSA 5A4VA 4PNGA 4EIQA 4G19A 3RPNA 2IMEA 1QK8A 1U88A 1H75A 5F05A 3EURA 1GL8A 2YWNA 3P90A 2JL4A 2YJ7A 5EVOA 4TN8A 1HNCA 3TJGA 4LL4B 5C00A 2LNSA 2K9FA 2IWTA 4ECJA 1M9AA 4XHMA 5ABRA 4GSNA 4L0UA 4PUAA 4MCUA 2LQOA 2F51A 1ERTA 2HSHA 1XFLA 2GS3A 1O81A 1SJIA 4WR4A 1SJZA 2JZTA 3GFKA 4POBA 4ZBDA 1EEJA 3EWLA 2B7KA 2GT6A 4V2LA 3N5OA 3G7JA 1TP9A 2YP6A 2XPDA 1TK0B 2IMIA 4EO3A 4RUVA 3UJ1A 3UAPA 3VWXA 1PQNA 4EKZA 5D73A 2OACA 17GSA 4WF5A 4YQUA 3UBLA 1WJKA 2VM1A 5ELAA 1PL2A 1B9YC 2VIMA 1DE2A 1AC1A 4TW5A 1SYRA 3Q19A 3SBCA 2FY6A 2LQQA 5COHA 3LGCA 1F37A 2I9HA 4KDYA 3HD5A 1IYHA 1V2AA 1B4PA 2HRNA 1KNGA 3ZFLA 2H0HA 3GURA 2B6MA 2GT5A 5IOWA 5HR2A 2CVBA 12GSA 4GWRA 3P8WA 2GVPA 3L9UA 1WWJA 1YQ1A 4IJ3A 1T00A 3UIWA 3MSZA 2H6YA 2LUSA 2MBSA 2DLXA 4TR0A 1A2LA 2AHEA 4MP4A 1J0FA 2YN1A 16GSA 1PN9A 2ZNMA 1SL0B 4O5QA 2JZSA 4EF0A 2DJ1A 2PMTA 4EVMA 2H6XA 1GSDA 1OAZA 3L0HA 2LJRA 3G7YA 1MEKA 1AW9A 2YWMA 3J7Yb 1OC3A 4N0ZA 3HJMA 6GSTA 1ZYQB 2X64A 1XOBA 4OWYA 3U5RE 1EWXA 1H4OA 2FWHA 3I9V2 3QMXA 2KP2A 4QQ7A 1ABAA 4NHZA 1XIYA 1MDIA 5A5KA 2C3TA 2IFQA 4ICYA 1O85A 2ON5A 2MMOA 3IC4A 3SWLA 4TR1B 2F3MA 3H79A 4HJMA 3EC3A 1MD4A 1XXUA 3IV4A 1XWAA 1PA3A 2PUKC 2QSIA 5CYYA 2FGXA 5J3RA 3QAVA 1YF0A 2X8GA 2IJYA 2TRCP 4EDZA 4BVYA 5G31A 3ZLPA 1EP7A 5FWGA 5CP1A 4V2MA 1U3IA 2X49A 3HVVA 3EU3A 5ID2B 4KSOA 2VO4A 4Q5RA 2HYXA 5BRTA 2AJQB 1Z6MA 3VPTA 4OCEA 5ECLB 1RW1A 3C1RA 3ERFA 3QCPA 2X8CA 1EGOA 3M0FA 3TKSA 2EIQA 1BYEA 1ZYEA 2GDRA 4TXVA 5B8AA 4YAPA 5DVBA 3EU4A 5IMFA 1A8LA 3M9KA 3GRXA 3KXOA 5G1KA 4FH8A 5DALA 1A2JA 5DCHA 4WXTA 2H8LA 4FO5A 2YOIA 3CRTA 2GLRA 2IMFA 1JFUA 4RQXA 4PGTA 2C0EA 4DEJA 5E4WA 5HQPA 2QA1A 1XW6A 3P2AA 1I9DA 3VK9A 5JWOB 1CQHA 4K9ZA 3FEUA 4PUFC 4F0CA 3VFIA 3VWWA 4TXOB 4X0XA 4TOPA 3CBUA 4ZL8A 1JLWA 4IELA 3CSJA 1SU9A 3IHGA 2MMNA 1S3AA 4USSA 2M72A 1CQGA 5B7CA 1AQWA 4POKA 2FCHA 1NSWA 4ZL7A 3KD0A 1BJXA 1I5GA 4FYUA 3H4KA 1PGTA 1Q98A 2NTOA 1V40A 1F3BA 1O6JA 4CW9A 3A2XA 4IKHA 5D93A 1VF2A 2YPMA 3GA4A 1XCCA 3F6DA 3IAS2 1Z9HA 1ON4A 1T8EB 4NHWA 4LA1A 1ST9A 3BCKA 3F9UA 3IA1A 2WRTA 1EGRA 3WT1A 1YY7A 2YWIA 2CV4A 2AV4A 3D5JA 4RI6A 4KX4A 1FVKA 3F4TA 2WCIA 1SKWB 1WE0A 1IYIA 4ISDA 1O73A 4AJ8A 3EINA 4HOJA 2FA4A 1W4VA 1N2AA 2EIRA 2A2SA 3ZL5A 4EUYA 4IS0A 4I2UA 5D9XA 1ZZYA 2LRCA 3NIVA 2R0CA 2V6OA 1EEMA 1M9BA 3DXBA 3KIJA 3HYPA 2RM5A 1N8JA 1WOUA 2HZEA 3CSHA 2CA8A 4LMVA 4TRXA 4X1UA 2F8FA 2H6ZA 1A0FA 1AUCA 4FYBA 5KN3A 2V41A 2PVQA 2LV3A 3TJJA 2P31A 5AGYA 4OCFA 1HQOA 1V57A 1V98A 1XBSA 1UC7A 4IHUA 1UVZA 1PMTA 4XTSA 3DVWA 4ECCA 5IMAA 2HFDA 4NWYA 4XCSA 3KTBA 2I81A 1DSBA 4LLRA 4OO5A 1QGVA 4WEYA 2E2MA 1ERWA 1JZOA 3GYKA 2HE3A 2ZCTA 1FB6A 3TJKA 3IAM2 3MIXA 1FO5A 4TKYA 1Y25A 4AGSA 1S3DA 1B9XC 2DIYA 1ACVA 3ZVJD 1X5DA 4EL1A 2HSYA 2XC2A 1TDIA 4MJAA 1WRYA 2CX3A 4EIPA 3RAZA 1BEDA 4RQRA 4WETA 2JACA 4G0IA 4KNDA 2H76A 3KTLA 1ML6A 2RUFA 2VD0A 2WJUA 2LJAA 5JCWA 2H75A 3MYDA 3UL3A 4F0BA 2C8UA 2H1DA 3IK7A 1R5AA 2RUEA 1SL2B 3AY8A 4Z2UA 3F3RA 2FHEA 5GZZB 14GSA 3G7IA 1FG4A 2D2ZA 1SK1A 1XWKA 1K0BA 2DJJA 5KOXA 1PSQA 1PX7A 3QOUA 5J9CA 3A3TA 4PXOA 3HDCA 3APSA 1EV4A 5JCUA 19GSA 3KP9A 3APQA 4HJ2A 2MBTA 3FYGA 5DAKA 2VCZA 2DMLA 4IW9A 3A2VA 4QL7A 1JLVA 4Q5QA 5IMCA 4DVCA 3CQFA 2KOKA 5D9VA 1R7HA 5FHIA 1GWCA 3K8NA 3GKMA 1THXA 3TJBA 1Z6NA 2OA7A 5D9TA 2A4HA 3H8QA 4ZB9A 1YZXA 1BX9A 1GSEA 2ZUPA 2YCDA 3N9JA 1SD8A 3ZTLA 2GTUA 1RK4A 5J4UA 5HR3A 3TKSC 1XWCA 3HCZA 1TRSA 1GLPA 2L4QA 1E6BA 3D4MA 5ECSA 5GSSA 2VLUA 3F4SA 3DYRA 2LTKA 2V1MA 3IK9A 2HNLA 4NAXA 5IMVA 4GCIA 1ZMAA 5D9WA 3E3EA 1OVNA 4D73A 3GKXA 1GSSA 1TJDA 1BG5A 3DMLA 1KBNA 4POLA 3ZYWA 2RM6A 1XPVA 2YV9A 6GSYA 4BWQA 4DSRA 4EDYA 3QR6A 4X4JA 3KH9A 1EOGA 2XBQA 4BVXA 1E2YA 3FZAA 2YV7A 3IC8A 2L5LA 1G7OA 3Q6OA 4K8MA 1UN2A 2IFQB 3LQ7A 3DRNA 5ENUA 3IXRA 1XZOA 2QGVA 2XHFA 2JSZA 3HJOA 3GNJA 2PBJA 4CY8A 4K0NA 2JADA 2MZCA 3KMNA 1GSYA 2M46A 3VPQA 2L59A 2C4JA 2I1UA 1DE1A 3RHBA 1FW1A 6GSSA 1XG8A 1B4QA 2WS2A 3F6FA 1K0CA 4HEA2 3LYPA 3F8UA 4BVYB 3IRAA 4KF9A 2YWOA 2YANA 4MF5A 5ECRB 1A23A 5HFIA 3KP8A 4N11A 5G2ZA 1K3OA 4O7HA 2PVOC 3HY2A 9GSSA 4DSSA 2CAQA 4PQIA 1TW9A 4PURA 1GTUA 4A5PA 4ZBAA 5CRHA 3WGEA 2LJKA 1Z5YE 1X9SB 4Z2RA 3TKPA 1WPIA 1S3RA 2B5XA 1NHOA 4TR4A 2VOCA 4JE1A 1K0DA 1U87A 2AUVA 2R5GA 4G0KA 4ZIJA 2O87A 5GSTA 5GAPD 1M7TA 2KUCA 5DALB 4KB3A 4PQ1A 1URMA 5LCZA 4F9ZA 3E9JB 1G7EA 2L5OA 2IMKA 4MJCA 1T4ZA 1W89A 1XWBA 1TXXA 2B1LA 5HFKA 2O8VB 4L0WA 6GSVA 5C04A 2QKEA 3L4NA 2VLTA 3LXTA 1PKWA 2G2QA 1Q4JA 1QMVA 5B8BA 3ED3A 3CMIA 1ZYNA 2RIIA 4V1Ag 4L8EA 4GQFA 1GRXA 5E59A 1V58A 4HQZA 4F82A 1ERVA 2JZRA 4ML6A 3C73A 3GKKA 4XS6A 2B5YA 5AIVA 2R4VA 5ECQB 5CRWA 1AXDA 5ECPB 3GV1A 2GSRA 18GSA 1XW5A 5AN1A 4PNFA 4AJ6A 3L9SA 1AQXA 4J2FA 3EPTA 1GUKA 3P7XA 5JWQB 4KE3A 22GSA 1G6WA 1LJRA 4GLTA 1B8XA 2L6CA 1GP1A 3WT2A 2IN3A 1WP0A 3O76A 2GQKA 4K5RA 3U6VA 5IPGA 2GQLA 3RHCA 2FLSA 1GULA 2H19A 4ZILA 4KW6A 2WFCA 3E0UA 5J9BA 3DKSA 2C0GA 5LNKe 3EE2A 3D6IA 2HRFA 1PN0A 1JZRA 1M0UA 1GH2A 2DJ0A 1KEBA 5FT3A 3HXSA 2A4VA 5ECIB 1OC9A 3ZMKA 1OKTA 7GSSA 2MMAA 3I69A 1SJ6A 4K5SA 2LRTA 2MYGA 3TKQA 3H93A 2VUPA 1JHBA 5KEJA 3VLNA 2H0GA 2YZUA 3DIEA 4YQMA 3F4RA 1OE7A 3UMAA 4ZL9A 3ZITA 13GSA 5ECKB 5H5QA 2PPTA 1M2DA 2H72A 3DWVA 5DJMA 4Z2TA 3GMFA 3KGKA 3RDWA 1TTZA 4PTSA 1TKDB 2HZEB 4MF7A 1FB0A 3D4TA 3GSSA 3WGDA 4JBBA 4K7IA 3ZVJA 1G0TA 4HU7A 1MTCA 3KH7A 3R2QA 3LORA 4IP6A 3IE3A 3TDGA 3A5IA 3RPPA 1JZWA 2FWFA 4HDEA 1U6TA 3G9BA 4QL9A 2HT9A 4G2EA 3MDKA 4I8BA 4MMMA 1MDJA 4E8EA 5GAND 1V9WA 2L4CA 4J57E 4EE0A 2IPAA 4CDOA 1QXHA 4MH3A 3EMPA 2VL9A 1X5EA 2X4AA 3C71A 4HS1A 5G1LA 3BBYA 2UZ8A 2NDOA 3QFBC 3V1WA 3UBKA 3VWUA 1GSQA 2HRKA 5EY6A 3ZMLA 2LNTA 1FOVA 1TRVA 2C3QA 4MNNA 6GSUA 1YJ6A 5D96A 1PKZA 3QDNA 1XW9A 4K7NA 5LD0A 3O3TA 4HZ2A 2R0GA 2V2GA 3GN3A 2E0QA 5EPFA 3MWHA
chains in the Genus database with same CATH topology
3D0ZA 3CYNA 4ZB6A 1A0RP 1HNBA 2C3NA 5DBQA 2GZYA 1DUGA 2DIZA 3UVTA 5ECMB 3KJYA 1EV9A 1O8WA 3LWAA 1TU7A 3APOA 4MPFA 2OBIA 3BJ5A 2G0FA 4POMA 4MZWA 1GUHA 1PL1A 4KH7A 2PGTA 4N0VA 4GQCA 1A8YA 4XIHA 3MAKA 2CQ9A 4RI7A 5HR1A 3F0IA 1Z3EA 3FY7A 1T4YA 5A4WA 5DAKB 3M9JA 3A2WA 5IM9A 4I5QA 1KTEA 2YNXA 3M1GA 3HZ4A 1YEPA 5B6NA 2ES7A 1FHEA 4MJBA 3QAWA 4I2TA 4L5OA 5HR0A 3M3MA 1ERUA 3GKNA 4GF0A 3LXZA 3DD3A 2GZPA 2LRNA 3ISOA 4Z7XA 3QFAC 4BL7A 1SL1B 2L6DA 4ZBBA 4LL1B 2REMA 1R4WA 2IMDA 2BMXA 2B3SA 3BD2A 2KP1A 2LSTA 3TKRA 1K3LA 3LFLA 2OKAA 3FZ4A 1PX6A 5IPHA 4NMUA 2H74A 5IO0A 3ERGA 4K0GA 3PH9A 2QA2A 3F3QA 1MD3A 3CTGA 1GLQA 2O85A 3FHKA 2GGTA 2VCQA 3LW9A 3KZQA 4AJ7A 1LU4A 3ZZXA 1Z7RA 5AISA 4D73B 2B5EA 4XRDA 1SK0A 1M99A 3FRCA 2N5AA 1VF1A 5CRGA 4K7OA 4GSSA 1GSUA 1YEXA 3EVIA 3D21A 4GTUA 2H30A 1BAYA 2NBSA 3TRQA 4OFTA 4BVXB 5BMUA 1BQ7A 5DDLA 3US3A 4OFMA 3Q74A 3A5WA 2JU5A 4TVEA 1OE8A 3PINA 3FKFA 1SENA 2CZ3A 2HRAA 3TJFA 3C7MA 3LEFA 2BJXA 3GHAA 3ZFBA 5IO2A 3LYKA 1THOA 2DSAA 3UOMA 5IMDA 5DQSA 4KCAA 2OJLA 3GL5A 2HXKA 3HVXA 1OYJA 1SKRB 4WKWA 1ZYPA 4OO4A 2H1GA 5CO3A 3C8EA 2VL3A 4V2NA 1K0NA 2PWJA 1Z7PA 2DMMA 3FZ5A 1TRUA 2R2JA 2OADA 2X99A 4MH2A 3ZRDA 1OC8A 2VL2A 3IOSA 4DSQA 1S3CA 4ECBA 3UARA 2VAFA 4DSSB 1OKDA 4FIWA 3I6AA 2E2GA 2CZ2A 2VCXA 5G5EA 4N30A 2P0GA 4XRAA 1GUMA 1PD21 4KDUA 3HJPA 4HZ4A 2HLSA 2DKHA 3GTUA 5KN2A 3TRXA 2L57A 4XS4A 2H1AA 2FA8A 3DGQA 2DBCA 3PR8A 4WBRD 1LBKA 1TI1A 4K1FA 3FR3A 3S9FA 3VWVA 2WDUA 4O92A 2R3XA 4G10A 4I97A 1VRSD 4N10A 3UEMA 1VF3A 1ZOFA 3L78A 1SYXA 5JCGA 4V1Ap 5IMZA 1XOAA 5INYA 3FW2A 2HI7A 2Z9SA 1PRXA 4HI7A 1XVWA 4MLYA 1QFNA 1UA5A 2N5FA 5EL8A 6GSXA 1QUWA 11GSA 2I4AA 2I3YA 1X9WB 3LSZA 4ZXGA 4K2DA 3VI5A 4ECIA 1SK2A 3F63A 4ZB8A 4E8HA 1HD2A 2CVDA 1FAAA 1X9MB 1GTIA 3VI7A 2XPEA 4KDXA 5ELGA 1K3YA 1U3AA 2P5QA 5IQYA 4ULXA 4YQVA 3W6GA 4G9HA 4JZQA 2DJ2A 3GH9A 5KN0A 2E7PA 3R3EA 2OE3A 2H66A 1M2AA 3TCOA 3LG6A 4Q5NA 1RQMA 1VGLA 2C0FA 5IIZA 3DEXA 4YH2A 1GNWA 1YDKA 4YAVA 1ZL9A 4HU9A 2FUG2 4BWSA 2KHPA 2OE0A 4PX1A 2VLVA 4GXZA 1K0AA 2FWEA 2A2RA 3ZREA 1C72A 3DVXA 2C80A 2YJHA 1EP8A 3IPZA 1NW2A 4J56E 3GX8A 2GSQA 1OC9B 3L9VA 3O6TA 4EXJA 3FR6A 4OMVA 3CTFA 1J9BA 1AAZA 2JSYA 3FMWA 5D8IA 2H01A 1TU8A 4JR6A 2DKIA 1TOFA 1G6YA 4NV5A 2H1BA 4P3YB 2YZHA 2PU9C 1FOHA 2BTOT 2GSSA 3JCML 3VURA 3Q18A 5F0GA 1XWGA 3M8NA 5F06A 1T1VA 2WGRA 1TI3A 2N5BA 2GQMA 3ME8A 4IQAA 2WZ9A 4XS1A 1USBA 3KCMA 1O7UA 2K8VA 2R0PA 2TRXA 5CREA 2WB9A 3UVHA 1R26A 2K6VA 1HNAA 4IQ1A 1F3AA 5H5SA 1WMJA 2H73A 2LS5A 4IJIA 2FWGA 4O5UA 4MZBA 5A4UA 5DQYA 1A2MA 3GX0A 3HA9A 4I6XA 5ECNB 5DJLA 1YF1A 1QQ2A 2K18A 4H86A 1FVJA 4BPYA 3HZ8A 1AQVA 4WBJA 2V32A 3CXGA 2MMZA 4IVFA 4ID0A 1A24A 3FK8A 1TK8B 2H71A 3RBTA 2B7JA 3TB2A 3BCIA 3BOAA 3LJRA 4K2XA 4MZCA 5F07A 2IL3A 4TR1A 3QPMA 5ECHB 1ZCPA 5IOXA 1GSFA 1X5CA 3EYTA 5J41A 4GRFA 4O32A 3GUSA 3WD6A 1J08A 1T3BA 3FR9A 4G0LA 4F2IA 5CAXA 2A2PA 1HYUA 2AB6A 2R6KA 8GSSA 2OBKA 1Y6EA 2B1KA 2PN8A 2LEGA 4IN0A 1R5PA 1SD9A 2C1YA 1GNEA 4L5LA 3TRPA 3FZ9A 2VM2A 1K0MA 2X8HA 5L71A 4MK3A 5ID2A 2VCVA 2XBIA 1K0OA 3W8JA 4KGIA 3PPUA 3EMXA 5HFGA 3TOTA 2C0DA 1F2EA 4KSMA 3MNGA 3CSIA 2AYTA 2QC7A 3PGTA 4HUAA 1MDKA 2GSTA 4OD7A 3J7Yk 5DCGA 2H70A 5J5NA 2V6KA 2DJ3A 5CNWA 1F9MA 3ZIJA 2J9HA 2HZFA 3WYWA 2EC4A 2ALBA 4K6XA 3IDVA 2VCWA 2NPBA 4MJEA 2TIRA 1T7PB 3D22A 1XVQA 2F9SA 1EOHA 5F8BA 1ILOA 4ML1A 1TRWA 4LMWA 1WIKA 2CAIA 2FNOA 2VCTA 3C1SA 3GSTA 1VF4A 2DJKA 2K8SA 3GIXA 4JEDA 4MF6A 4OFNA 4BL7B 4TXOA 4FYCA 4YKGA 1YKAA 2VL2C 5KN1A 1O8XA 4O5RA 3IHQA 2WULA 4MABA 4KCEA 4AF2A 3GL3A 3W8SA 1ZGNA 2AAWA 4IGJA 6GSWA 2F8AA 5B6MA 3IBHA 4JR4A 4JU5A 4IBPA 2PERA 2H0IA 2RLIA 3GH6A 4KAEA 4MPGA 1NHYA 4HQSA 2CVKA 2P5RA 3KMOA 3NOFA 2EIOA 4CHSA 4NV2A 4ILFA 3KEBA 3ME7A 2IIYA 2J23A 2R37A 2VD1A 4EC0A 3I43A 3WGXA 2FD3A 5ECOB 4Q5FA 4GSTA 5CRDA 4WF4A 1F6MC 1YKCA 2OE1A 2CX4A 5H5RA 4CY6A 1NM3A 3ZIVA 3TOUA 4IP1A 4PQHA 1B48A 3OR5A 4NXIA 4MDCA 5G5FA 4F03A 4KA0A 5JWRB 5AIXA 4TR3A 1AIUA 2O89A 3QAGA 1TK5B 3TUEA 3HHVA 1GTAA 4MA9A 3KM6A 4WR5A 3QD9A 4NPBA 10GSA 2CT6A 20GSA 1X0RA 2GZZA 4FQUA 2HSMA 1EZKA 2NVLA 1M2BA 5KOWA 3NZNA 2M80A 5G30A 3H1NA 1GTBA 2LKUA 2ON7A 2O7KA 3CRUA 4YKFA 4BA7A 4KUNA 1SKSB 3GTUB 4XS4B 3HVSA 3TGZA 1DBYA 3IR4A 4JRRA 2KLXA 3ERWA 3HKRA 2DC5A 4X43A 3TKSE 1JZDA 4ACSA 5A4VA 4PNGA 4EIQA 4G19A 3RPNA 2IMEA 1QK8A 1U88A 1H75A 5F05A 3EURA 1GL8A 2YWNA 3P90A 2JL4A 2YJ7A 5EVOA 4TN8A 1HNCA 3TJGA 4LL4B 5C00A 2LNSA 2K9FA 2IWTA 4ECJA 1M9AA 4XHMA 5ABRA 4GSNA 4L0UA 4PUAA 4MCUA 2LQOA 2F51A 1ERTA 2HSHA 1XFLA 2GS3A 1O81A 1SJIA 4WR4A 1SJZA 2JZTA 3GFKA 4POBA 4ZBDA 1EEJA 3EWLA 2B7KA 2GT6A 4V2LA 3N5OA 3G7JA 1TP9A 2YP6A 2XPDA 1TK0B 2IMIA 4EO3A 4RUVA 3UJ1A 3UAPA 3VWXA 1PQNA 4EKZA 5D73A 2OACA 17GSA 4WF5A 4YQUA 3UBLA 1WJKA 2VM1A 5ELAA 1PL2A 1B9YC 2VIMA 1DE2A 1AC1A 4TW5A 1SYRA 3Q19A 3SBCA 2FY6A 2LQQA 5COHA 3LGCA 1F37A 2I9HA 4KDYA 3HD5A 1IYHA 1V2AA 1B4PA 2HRNA 1KNGA 3ZFLA 2H0HA 3GURA 2B6MA 2GT5A 5IOWA 5HR2A 2CVBA 12GSA 4GWRA 3P8WA 2GVPA 3L9UA 1WWJA 1YQ1A 4IJ3A 1T00A 3UIWA 3MSZA 2H6YA 2LUSA 2MBSA 2DLXA 4TR0A 1A2LA 2AHEA 4MP4A 1J0FA 2YN1A 16GSA 1PN9A 2ZNMA 1SL0B 4O5QA 2JZSA 4EF0A 2DJ1A 2PMTA 4EVMA 2H6XA 1GSDA 1OAZA 3L0HA 2LJRA 3G7YA 1MEKA 1AW9A 2YWMA 3J7Yb 1OC3A 4N0ZA 3HJMA 6GSTA 1ZYQB 2X64A 1XOBA 4OWYA 3U5RE 1EWXA 1H4OA 2FWHA 3I9V2 3QMXA 2KP2A 4QQ7A 1ABAA 4NHZA 1XIYA 1MDIA 5A5KA 2C3TA 2IFQA 4ICYA 1O85A 2ON5A 2MMOA 3IC4A 3SWLA 4TR1B 2F3MA 3H79A 4HJMA 3EC3A 1MD4A 1XXUA 3IV4A 1XWAA 1PA3A 2PUKC 2QSIA 5CYYA 2FGXA 5J3RA 3QAVA 1YF0A 2X8GA 2IJYA 2TRCP 4EDZA 4BVYA 5G31A 3ZLPA 1EP7A 5FWGA 5CP1A 4V2MA 1U3IA 2X49A 3HVVA 3EU3A 5ID2B 4KSOA 2VO4A 4Q5RA 2HYXA 5BRTA 2AJQB 1Z6MA 3VPTA 4OCEA 5ECLB 1RW1A 3C1RA 3ERFA 3QCPA 2X8CA 1EGOA 3M0FA 3TKSA 2EIQA 1BYEA 1ZYEA 2GDRA 4TXVA 5B8AA 4YAPA 5DVBA 3EU4A 5IMFA 1A8LA 3M9KA 3GRXA 3KXOA 5G1KA 4FH8A 5DALA 1A2JA 5DCHA 4WXTA 2H8LA 4FO5A 2YOIA 3CRTA 2GLRA 2IMFA 1JFUA 4RQXA 4PGTA 2C0EA 4DEJA 5E4WA 5HQPA 2QA1A 1XW6A 3P2AA 1I9DA 3VK9A 5JWOB 1CQHA 4K9ZA 3FEUA 4PUFC 4F0CA 3VFIA 3VWWA 4TXOB 4X0XA 4TOPA 3CBUA 4ZL8A 1JLWA 4IELA 3CSJA 1SU9A 3IHGA 2MMNA 1S3AA 4USSA 2M72A 1CQGA 5B7CA 1AQWA 4POKA 2FCHA 1NSWA 4ZL7A 3KD0A 1BJXA 1I5GA 4FYUA 3H4KA 1PGTA 1Q98A 2NTOA 1V40A 1F3BA 1O6JA 4CW9A 3A2XA 4IKHA 5D93A 1VF2A 2YPMA 3GA4A 1XCCA 3F6DA 3IAS2 1Z9HA 1ON4A 1T8EB 4NHWA 4LA1A 1ST9A 3BCKA 3F9UA 3IA1A 2WRTA 1EGRA 3WT1A 1YY7A 2YWIA 2CV4A 2AV4A 3D5JA 4RI6A 4KX4A 1FVKA 3F4TA 2WCIA 1SKWB 1WE0A 1IYIA 4ISDA 1O73A 4AJ8A 3EINA 4HOJA 2FA4A 1W4VA 1N2AA 2EIRA 2A2SA 3ZL5A 4EUYA 4IS0A 4I2UA 5D9XA 1ZZYA 2LRCA 3NIVA 2R0CA 2V6OA 1EEMA 1M9BA 3DXBA 3KIJA 3HYPA 2RM5A 1N8JA 1WOUA 2HZEA 3CSHA 2CA8A 4LMVA 4TRXA 4X1UA 2F8FA 2H6ZA 1A0FA 1AUCA 4FYBA 5KN3A 2V41A 2PVQA 2LV3A 3TJJA 2P31A 5AGYA 4OCFA 1HQOA 1V57A 1V98A 1XBSA 1UC7A 4IHUA 1UVZA 1PMTA 4XTSA 3DVWA 4ECCA 5IMAA 2HFDA 4NWYA 4XCSA 3KTBA 2I81A 1DSBA 4LLRA 4OO5A 1QGVA 4WEYA 2E2MA 1ERWA 1JZOA 3GYKA 2HE3A 2ZCTA 1FB6A 3TJKA 3IAM2 3MIXA 1FO5A 4TKYA 1Y25A 4AGSA 1S3DA 1B9XC 2DIYA 1ACVA 3ZVJD 1X5DA 4EL1A 2HSYA 2XC2A 1TDIA 4MJAA 1WRYA 2CX3A 4EIPA 3RAZA 1BEDA 4RQRA 4WETA 2JACA 4G0IA 4KNDA 2H76A 3KTLA 1ML6A 2RUFA 2VD0A 2WJUA 2LJAA 5JCWA 2H75A 3MYDA 3UL3A 4F0BA 2C8UA 2H1DA 3IK7A 1R5AA 2RUEA 1SL2B 3AY8A 4Z2UA 3F3RA 2FHEA 5GZZB 14GSA 3G7IA 1FG4A 2D2ZA 1SK1A 1XWKA 1K0BA 2DJJA 5KOXA 1PSQA 1PX7A 3QOUA 5J9CA 3A3TA 4PXOA 3HDCA 3APSA 1EV4A 5JCUA 19GSA 3KP9A 3APQA 4HJ2A 2MBTA 3FYGA 5DAKA 2VCZA 2DMLA 4IW9A 3A2VA 4QL7A 1JLVA 4Q5QA 5IMCA 4DVCA 2KOKA 5D9VA 1R7HA 5FHIA 1GWCA 3K8NA 3GKMA 1THXA 3TJBA 1Z6NA 2OA7A 5D9TA 2A4HA 3H8QA 4ZB9A 1YZXA 1BX9A 1GSEA 2ZUPA 2YCDA 3N9JA 1SD8A 3ZTLA 2GTUA 1RK4A 5J4UA 5HR3A 3TKSC 1XWCA 3HCZA 1TRSA 1GLPA 2L4QA 1E6BA 3D4MA 5ECSA 5GSSA 2VLUA 3F4SA 3DYRA 2LTKA 2V1MA 3IK9A 2HNLA 4NAXA 5IMVA 4GCIA 1ZMAA 5D9WA 3E3EA 1OVNA 4D73A 3GKXA 1GSSA 1TJDA 1BG5A 3DMLA 1KBNA 4POLA 3ZYWA 2RM6A 1XPVA 2YV9A 6GSYA 4BWQA 4DSRA 4EDYA 3QR6A 4X4JA 3KH9A 1EOGA 2XBQA 4BVXA 1E2YA 3FZAA 2YV7A 3IC8A 2L5LA 1G7OA 3Q6OA 4K8MA 1UN2A 2IFQB 3LQ7A 3DRNA 5ENUA 3IXRA 1XZOA 2QGVA 2XHFA 2JSZA 3HJOA 3GNJA 2PBJA 4CY8A 4K0NA 2JADA 2MZCA 3KMNA 1GSYA 2M46A 3VPQA 2L59A 2C4JA 2I1UA 1DE1A 3RHBA 1FW1A 6GSSA 1B4QA 2WS2A 3F6FA 1K0CA 4HEA2 3LYPA 3F8UA 4BVYB 3IRAA 4KF9A 2YWOA 2YANA 4MF5A 5ECRB 1A23A 5HFIA 3KP8A 4N11A 5G2ZA 1K3OA 4O7HA 2PVOC 3HY2A 9GSSA 4DSSA 2CAQA 4PQIA 1TW9A 4PURA 1GTUA 4A5PA 4ZBAA 5CRHA 3WGEA 2LJKA 1Z5YE 1X9SB 4Z2RA 3TKPA 1WPIA 2B5XA 1NHOA 4TR4A 2VOCA 4JE1A 1K0DA 1U87A 2AUVA 2R5GA 4G0KA 4ZIJA 2O87A 5GSTA 5GAPD 1M7TA 2KUCA 5DALB 4KB3A 4PQ1A 1URMA 5LCZA 4F9ZA 3E9JB 1G7EA 2L5OA 2IMKA 4MJCA 1T4ZA 1W89A 1XWBA 1TXXA 2B1LA 5HFKA 2O8VB 4L0WA 6GSVA 5C04A 2QKEA 3L4NA 2VLTA 3LXTA 1PKWA 2G2QA 1Q4JA 1QMVA 5B8BA 3ED3A 3CMIA 1ZYNA 2RIIA 4V1Ag 4L8EA 4GQFA 1GRXA 5E59A 1V58A 4HQZA 4F82A 1ERVA 2JZRA 4ML6A 3C73A 3GKKA 4XS6A 2B5YA 5AIVA 2R4VA 5ECQB 5CRWA 1AXDA 5ECPB 3GV1A 2GSRA 18GSA 1XW5A 5AN1A 4PNFA 4AJ6A 3L9SA 1AQXA 4J2FA 3EPTA 1GUKA 3P7XA 5JWQB 4KE3A 22GSA 1G6WA 1LJRA 4GLTA 1B8XA 2L6CA 1GP1A 3WT2A 2IN3A 1WP0A 3O76A 2GQKA 4K5RA 3U6VA 5IPGA 2GQLA 3RHCA 2FLSA 1GULA 2H19A 4ZILA 4KW6A 2WFCA 3E0UA 5J9BA 3DKSA 2C0GA 5LNKe 3EE2A 3D6IA 2HRFA 1PN0A 1JZRA 1M0UA 1GH2A 2DJ0A 1KEBA 5FT3A 3HXSA 2A4VA 5ECIB 1OC9A 3ZMKA 1OKTA 7GSSA 2MMAA 3I69A 1SJ6A 4K5SA 2LRTA 2MYGA 3TKQA 3H93A 2VUPA 1JHBA 5KEJA 3VLNA 2H0GA 2YZUA 3DIEA 4YQMA 3F4RA 1OE7A 3UMAA 4ZL9A 3ZITA 13GSA 5ECKB 5H5QA 2PPTA 1M2DA 2H72A 3DWVA 5DJMA 4Z2TA 3GMFA 3KGKA 3RDWA 1TTZA 4PTSA 1TKDB 2HZEB 4MF7A 1FB0A 3D4TA 3GSSA 3WGDA 4JBBA 4K7IA 3ZVJA 1G0TA 4HU7A 1MTCA 3KH7A 3R2QA 3LORA 4IP6A 3IE3A 3TDGA 3A5IA 3RPPA 1JZWA 2FWFA 4HDEA 1U6TA 3G9BA 4QL9A 2HT9A 4G2EA 3MDKA 4I8BA 4MMMA 1MDJA 4E8EA 5GAND 1V9WA 2L4CA 4J57E 4EE0A 2IPAA 4CDOA 1QXHA 4MH3A 3EMPA 2VL9A 1X5EA 2X4AA 3C71A 4HS1A 5G1LA 3BBYA 2UZ8A 2NDOA 3QFBC 3V1WA 3UBKA 3VWUA 1GSQA 2HRKA 5EY6A 3ZMLA 2LNTA 1FOVA 1TRVA 2C3QA 4MNNA 6GSUA 5D96A 1YJ6A 1PKZA 3QDNA 1XW9A 4K7NA 5LD0A 3O3TA 4HZ2A 2R0GA 2V2GA 3GN3A 2E0QA 5EPFA 3MWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Z A;  3CYN A;  4ZB6 A;  1A0R P;  1HNB A;  2C3N A;  5DBQ A;  2GZY A;  1DUG A;  2DIZ A;  3UVT A;  5ECM B;  3KJY A;  1EV9 A;  1O8W A;  3LWA A;  1TU7 A;  3APO A;  4MPF A;  2OBI A;  3BJ5 A;  2G0F A;  4POM A;  4MZW A;  1GUH A;  1PL1 A;  4KH7 A;  2PGT A;  4N0V A;  4GQC A;  1A8Y A;  4XIH A;  3MAK A;  2CQ9 A;  4RI7 A;  5HR1 A;  3F0I A;  1Z3E A;  3FY7 A;  1T4Y A;  5A4W A;  5DAK B;  3M9J A;  3A2W A;  5IM9 A;  4I5Q A;  1KTE A;  2YNX A;  3M1G A;  3HZ4 A;  1YEP A;  5B6N A;  2ES7 A;  1FHE A;  4MJB A;  3QAW A;  4I2T A;  4L5O A;  5HR0 A;  3M3M A;  1ERU A;  3GKN A;  4GF0 A;  3LXZ A;  3DD3 A;  2GZP A;  2LRN A;  3ISO A;  4Z7X A;  3QFA C;  4BL7 A;  1SL1 B;  2L6D A;  4ZBB A;  4LL1 B;  2REM A;  1R4W A;  2IMD A;  2BMX A;  2B3S A;  3BD2 A;  2KP1 A;  2LST A;  3TKR A;  1K3L A;  3LFL A;  2OKA A;  3FZ4 A;  1PX6 A;  5IPH A;  4NMU A;  2H74 A;  5IO0 A;  3ERG A;  4K0G A;  3PH9 A;  3F3Q A;  1MD3 A;  3CTG A;  1GLQ A;  2O85 A;  3FHK A;  2GGT A;  2VCQ A;  3KZQ A;  4AJ7 A;  1LU4 A;  3ZZX A;  1Z7R A;  5AIS A;  4D73 B;  2B5E A;  4XRD A;  1SK0 A;  1M99 A;  3FRC A;  2N5A A;  1VF1 A;  5CRG A;  4K7O A;  4GSS A;  1GSU A;  1YEX A;  3EVI A;  3D21 A;  4GTU A;  2H30 A;  1BAY A;  2NBS A;  3TRQ A;  4OFT A;  1BQ7 A;  5DDL A;  3US3 A;  4OFM A;  3Q74 A;  3A5W A;  2JU5 A;  4TVE A;  1OE8 A;  3PIN A;  3FKF A;  1SEN A;  2CZ3 A;  3TJF A;  3C7M A;  3LEF A;  2BJX A;  3GHA A;  3ZFB A;  5IO2 A;  3LYK A;  1THO A;  2DSA A;  3UOM A;  5IMD A;  5DQS A;  4KCA A;  2OJL A;  3GL5 A;  2HXK A;  3HVX A;  1OYJ A;  1SKR B;  4WKW A;  4OO4 A;  2H1G A;  5CO3 A;  3C8E A;  2VL3 A;  4V2N A;  1K0N A;  2PWJ A;  1Z7P A;  2DMM A;  3FZ5 A;  1TRU A;  2R2J A;  2OAD A;  2X99 A;  4MH2 A;  3ZRD A;  1OC8 A;  2VL2 A;  3IOS A;  4DSQ A;  1S3C A;  4ECB A;  3UAR A;  2VAF A;  4DSS B;  1OKD A;  4FIW A;  3I6A A;  2E2G A;  2CZ2 A;  2VCX A;  5G5E A;  4N30 A;  2P0G A;  4XRA A;  1GUM A;  1PD2 1;  4KDU A;  3HJP A;  4HZ4 A;  2HLS A;  3GTU A;  5KN2 A;  3TRX A;  2L57 A;  4XS4 A;  2H1A A;  2FA8 A;  3DGQ A;  2DBC A;  3PR8 A;  4WBR D;  1LBK A;  1TI1 A;  4K1F A;  3FR3 A;  3S9F A;  3VWV A;  2WDU A;  4O92 A;  2R3X A;  4G10 A;  4I97 A;  1VRS D;  4N10 A;  3UEM A;  1VF3 A;  1ZOF A;  3L78 A;  1SYX A;  5JCG A;  4V1A p;  5IMZ A;  1XOA A;  5INY A;  3FW2 A;  2HI7 A;  2Z9S A;  1PRX A;  4HI7 A;  1XVW A;  4MLY A;  1QFN A;  1UA5 A;  2N5F A;  5EL8 A;  6GSX A;  1QUW A;  11GS A;  2I4A A;  2I3Y A;  1X9W B;  3LSZ A;  4ZXG A;  4K2D A;  3VI5 A;  4ECI A;  1SK2 A;  3F63 A;  4ZB8 A;  4E8H A;  1HD2 A;  2CVD A;  1FAA A;  1X9M B;  1GTI A;  3VI7 A;  2XPE A;  4KDX A;  5ELG A;  1K3Y A;  1U3A A;  2P5Q A;  5IQY A;  4ULX A;  4YQV A;  3W6G A;  4G9H A;  4JZQ A;  2DJ2 A;  3GH9 A;  5KN0 A;  2E7P A;  2OE3 A;  2H66 A;  1M2A A;  3TCO A;  3LG6 A;  4Q5N A;  1RQM A;  1VGL A;  2C0F A;  5IIZ A;  3DEX A;  4YH2 A;  1GNW A;  1YDK A;  4YAV A;  1ZL9 A;  4HU9 A;  2FUG 2;  4BWS A;  2KHP A;  2OE0 A;  4PX1 A;  2VLV A;  4GXZ A;  1K0A A;  2FWE A;  2A2R A;  3ZRE A;  1C72 A;  3DVX A;  2C80 A;  2YJH A;  1EP8 A;  3IPZ A;  1NW2 A;  4J56 E;  3GX8 A;  2GSQ A;  1OC9 B;  3L9V A;  3O6T A;  4EXJ A;  3FR6 A;  4OMV A;  3CTF A;  1J9B A;  1AAZ A;  2JSY A;  5D8I A;  2H01 A;  1TU8 A;  4JR6 A;  1TOF A;  1G6Y A;  4NV5 A;  2H1B A;  4P3Y B;  2YZH A;  2PU9 C;  2BTO T;  2GSS A;  3JCM L;  3VUR A;  3Q18 A;  5F0G A;  1XWG A;  3M8N A;  5F06 A;  1T1V A;  2WGR A;  1TI3 A;  2N5B A;  2GQM A;  3ME8 A;  4IQA A;  2WZ9 A;  4XS1 A;  1USB A;  3KCM A;  1O7U A;  2K8V A;  2TRX A;  5CRE A;  2WB9 A;  3UVH A;  1R26 A;  2K6V A;  1HNA A;  4IQ1 A;  1F3A A;  5H5S A;  1WMJ A;  2H73 A;  2LS5 A;  4IJI A;  2FWG A;  4MZB A;  5A4U A;  5DQY A;  1A2M A;  3GX0 A;  3HA9 A;  4I6X A;  5ECN B;  5DJL A;  1YF1 A;  1QQ2 A;  2K18 A;  4H86 A;  1FVJ A;  4BPY A;  3HZ8 A;  1AQV A;  4WBJ A;  2V32 A;  3CXG A;  2MMZ A;  4IVF A;  4ID0 A;  1A24 A;  3FK8 A;  1TK8 B;  2H71 A;  3RBT A;  2B7J A;  3TB2 A;  3BCI A;  3BOA A;  3LJR A;  4MZC A;  5F07 A;  2IL3 A;  4TR1 A;  3QPM A;  5ECH B;  1ZCP A;  5IOX A;  1GSF A;  1X5C A;  3EYT A;  5J41 A;  4GRF A;  4O32 A;  3GUS A;  3WD6 A;  1J08 A;  1T3B A;  3FR9 A;  4F2I A;  5CAX A;  1HYU A;  2AB6 A;  2R6K A;  8GSS A;  2OBK A;  1Y6E A;  2B1K A;  2PN8 A;  2LEG A;  4IN0 A;  1R5P A;  1SD9 A;  2C1Y A;  1GNE A;  4L5L A;  3TRP A;  3FZ9 A;  2VM2 A;  1K0M A;  2X8H A;  5L71 A;  4MK3 A;  5ID2 A;  2VCV A;  2XBI A;  1K0O A;  3W8J A;  4KGI A;  3EMX A;  5HFG A;  3TOT A;  2C0D A;  1F2E A;  4KSM A;  3MNG A;  3CSI A;  2AYT A;  2QC7 A;  3PGT A;  4HUA A;  1MDK A;  2GST A;  4OD7 A;  3J7Y k;  5DCG A;  2H70 A;  5J5N A;  2V6K A;  2DJ3 A;  5CNW A;  1F9M A;  3ZIJ A;  2J9H A;  2HZF A;  3WYW A;  2EC4 A;  2ALB A;  4K6X A;  3IDV A;  2VCW A;  2NPB A;  4MJE A;  2TIR A;  1T7P B;  3D22 A;  1XVQ A;  2F9S A;  1EOH A;  5F8B A;  1ILO A;  4ML1 A;  1TRW A;  4LMW A;  1WIK A;  2CAI A;  2FNO A;  2VCT A;  3C1S A;  3GST A;  1VF4 A;  2DJK A;  2K8S A;  3GIX A;  4JED A;  4MF6 A;  4OFN A;  4TXO A;  4FYC A;  1YKA A;  2VL2 C;  5KN1 A;  1O8X A;  4O5R A;  3IHQ A;  2WUL A;  4MAB A;  4KCE A;  4AF2 A;  3GL3 A;  3W8S A;  1ZGN A;  2AAW A;  4IGJ A;  6GSW A;  2F8A A;  5B6M A;  3IBH A;  4JR4 A;  4JU5 A;  4IBP A;  2PER A;  2H0I A;  2RLI A;  3GH6 A;  4KAE A;  4MPG A;  1NHY A;  4HQS A;  2CVK A;  2P5R A;  3KMO A;  3NOF A;  2EIO A;  4CHS A;  4NV2 A;  4ILF A;  3KEB A;  3ME7 A;  2IIY A;  2J23 A;  2R37 A;  2VD1 A;  4EC0 A;  3I43 A;  3WGX A;  2FD3 A;  5ECO B;  4Q5F A;  4GST A;  5CRD A;  4WF4 A;  1F6M C;  1YKC A;  2OE1 A;  2CX4 A;  5H5R A;  1NM3 A;  3ZIV A;  3TOU A;  4IP1 A;  4PQH A;  1B48 A;  3OR5 A;  4NXI A;  4MDC A;  5G5F A;  4F03 A;  4KA0 A;  5JWR B;  5AIX A;  4TR3 A;  1AIU A;  2O89 A;  3QAG A;  1TK5 B;  3TUE A;  3HHV A;  1GTA A;  4MA9 A;  3KM6 A;  4WR5 A;  3QD9 A;  4NPB A;  10GS A;  2CT6 A;  20GS A;  1X0R A;  2GZZ A;  2NVL A;  1EZK A;  1M2B A;  3NZN A;  2M80 A;  5G30 A;  3H1N A;  1GTB A;  2LKU A;  2ON7 A;  2O7K A;  3CRU A;  4BA7 A;  4KUN A;  1SKS B;  3GTU B;  4XS4 B;  3HVS A;  3TGZ A;  1DBY A;  3IR4 A;  4JRR A;  2KLX A;  3ERW A;  3HKR A;  2DC5 A;  4X43 A;  3TKS E;  1JZD A;  4ACS A;  5A4V A;  4PNG A;  4G19 A;  3RPN A;  2IME A;  1QK8 A;  1U88 A;  1H75 A;  5F05 A;  3EUR A;  1GL8 A;  2YWN A;  3P90 A;  2JL4 A;  2YJ7 A;  5EVO A;  4TN8 A;  1HNC A;  3TJG A;  4LL4 B;  5C00 A;  2LNS A;  2K9F A;  2IWT A;  4ECJ A;  1M9A A;  4XHM A;  5ABR A;  4GSN A;  4L0U A;  4PUA A;  4MCU A;  2LQO A;  2F51 A;  1ERT A;  2HSH A;  1XFL A;  2GS3 A;  1O81 A;  1SJI A;  4WR4 A;  1SJZ A;  2JZT A;  3GFK A;  4POB A;  4ZBD A;  1EEJ A;  3EWL A;  2B7K A;  2GT6 A;  4V2L A;  3N5O A;  3G7J A;  1TP9 A;  2YP6 A;  2XPD A;  1TK0 B;  2IMI A;  4EO3 A;  4RUV A;  3UJ1 A;  3UAP A;  3VWX A;  1PQN A;  4EKZ A;  5D73 A;  2OAC A;  17GS A;  4WF5 A;  4YQU A;  3UBL A;  1WJK A;  2VM1 A;  5ELA A;  1PL2 A;  1B9Y C;  2VIM A;  1DE2 A;  1AC1 A;  4TW5 A;  1SYR A;  3Q19 A;  3SBC A;  2FY6 A;  2LQQ A;  5COH A;  3LGC A;  1F37 A;  2I9H A;  4KDY A;  3HD5 A;  1IYH A;  1V2A A;  1B4P A;  2HRN A;  1KNG A;  3ZFL A;  2H0H A;  3GUR A;  2B6M A;  2GT5 A;  5IOW A;  5HR2 A;  2CVB A;  12GS A;  4GWR A;  3P8W A;  2GVP A;  3L9U A;  1WWJ A;  1YQ1 A;  4IJ3 A;  1T00 A;  3UIW A;  3MSZ A;  2H6Y A;  2LUS A;  2MBS A;  2DLX A;  4TR0 A;  1A2L A;  2AHE A;  4MP4 A;  1J0F A;  2YN1 A;  16GS A;  1PN9 A;  2ZNM A;  1SL0 B;  2JZS A;  4EF0 A;  2DJ1 A;  2PMT A;  4EVM A;  2H6X A;  1GSD A;  1OAZ A;  3L0H A;  2LJR A;  3G7Y A;  1MEK A;  1AW9 A;  2YWM A;  3J7Y b;  1OC3 A;  4N0Z A;  3HJM A;  6GST A;  1ZYQ B;  2X64 A;  1XOB A;  4OWY A;  3U5R E;  1EWX A;  1H4O A;  2FWH A;  3I9V 2;  3QMX A;  2KP2 A;  4QQ7 A;  1ABA A;  4NHZ A;  1XIY A;  1MDI A;  5A5K A;  2C3T A;  2IFQ A;  1O85 A;  2ON5 A;  2MMO A;  3IC4 A;  3SWL A;  4TR1 B;  2F3M A;  3H79 A;  4HJM A;  3EC3 A;  1MD4 A;  1XXU A;  3IV4 A;  1XWA A;  1PA3 A;  2PUK C;  2QSI A;  5CYY A;  2FGX A;  5J3R A;  3QAV A;  1YF0 A;  2X8G A;  2IJY A;  2TRC P;  4EDZ A;  4BVY A;  5G31 A;  3ZLP A;  1EP7 A;  5FWG A;  5CP1 A;  4V2M A;  1U3I A;  3HVV A;  3EU3 A;  5ID2 B;  4KSO A;  2VO4 A;  4Q5R A;  2HYX A;  2AJQ B;  1Z6M A;  3VPT A;  4OCE A;  5ECL B;  1RW1 A;  3C1R A;  3ERF A;  3QCP A;  2X8C A;  1EGO A;  3M0F A;  3TKS A;  2EIQ A;  1BYE A;  1ZYE A;  2GDR A;  4TXV A;  5B8A A;  4YAP A;  5DVB A;  3EU4 A;  5IMF A;  1A8L A;  3M9K A;  3GRX A;  3KXO A;  5G1K A;  4FH8 A;  5DAL A;  1A2J A;  5DCH A;  4WXT A;  2H8L A;  4FO5 A;  2YOI A;  3CRT A;  2GLR A;  2IMF A;  1JFU A;  4RQX A;  4PGT A;  2C0E A;  4DEJ A;  5E4W A;  5HQP A;  1XW6 A;  3P2A A;  1I9D A;  3VK9 A;  5JWO B;  1CQH A;  4K9Z A;  3FEU A;  4PUF C;  4F0C A;  3VFI A;  3VWW A;  4TXO B;  4X0X A;  4TOP A;  3CBU A;  4ZL8 A;  1JLW A;  4IEL A;  3CSJ A;  1SU9 A;  2MMN A;  1S3A A;  2M72 A;  1CQG A;  5B7C A;  1AQW A;  4POK A;  2FCH A;  1NSW A;  4ZL7 A;  3KD0 A;  1BJX A;  1I5G A;  4FYU A;  3H4K A;  1PGT A;  1Q98 A;  2NTO A;  1V40 A;  1F3B A;  1O6J A;  4CW9 A;  3A2X A;  4IKH A;  5D93 A;  1VF2 A;  2YPM A;  3GA4 A;  1XCC A;  3F6D A;  3IAS 2;  1Z9H A;  1ON4 A;  1T8E B;  4NHW A;  4LA1 A;  1ST9 A;  3BCK A;  3F9U A;  3IA1 A;  2WRT A;  1EGR A;  3WT1 A;  1YY7 A;  2YWI A;  2CV4 A;  2AV4 A;  3D5J A;  4RI6 A;  4KX4 A;  1FVK A;  3F4T A;  2WCI A;  1SKW B;  1WE0 A;  1IYI A;  4ISD A;  1O73 A;  4AJ8 A;  3EIN A;  4HOJ A;  2FA4 A;  1W4V A;  1N2A A;  2EIR A;  2A2S A;  3ZL5 A;  4EUY A;  4IS0 A;  4I2U A;  5D9X A;  1ZZY A;  2LRC A;  3NIV A;  2V6O A;  1EEM A;  1M9B A;  3DXB A;  3KIJ A;  3HYP A;  2RM5 A;  1N8J A;  1WOU A;  2HZE A;  3CSH A;  2CA8 A;  4LMV A;  4TRX A;  4X1U A;  2F8F A;  2H6Z A;  1A0F A;  1AUC A;  4FYB A;  5KN3 A;  2V41 A;  2PVQ A;  2LV3 A;  3TJJ A;  2P31 A;  5AGY A;  4OCF A;  1HQO A;  1V57 A;  1V98 A;  1XBS A;  1UC7 A;  4IHU A;  1UVZ A;  1PMT A;  4XTS A;  3DVW A;  4ECC A;  5IMA A;  2HFD A;  4NWY A;  4XCS A;  3KTB A;  2I81 A;  1DSB A;  4LLR A;  4OO5 A;  1QGV A;  4WEY A;  2E2M A;  1ERW A;  1JZO A;  3GYK A;  2HE3 A;  2ZCT A;  1FB6 A;  3TJK A;  3IAM 2;  1FO5 A;  4TKY A;  1Y25 A;  4AGS A;  1S3D A;  1B9X C;  2DIY A;  1ACV A;  3ZVJ D;  1X5D A;  4EL1 A;  2HSY A;  2XC2 A;  1TDI A;  4MJA A;  1WRY A;  2CX3 A;  3RAZ A;  1BED A;  4RQR A;  4WET A;  2JAC A;  4KND A;  2H76 A;  3KTL A;  1ML6 A;  2RUF A;  2VD0 A;  2WJU A;  2LJA A;  5JCW A;  2H75 A;  3UL3 A;  4F0B A;  2C8U A;  2H1D A;  3IK7 A;  1R5A A;  2RUE A;  1SL2 B;  3AY8 A;  3F3R A;  2FHE A;  5GZZ B;  14GS A;  3G7I A;  1FG4 A;  2D2Z A;  1SK1 A;  1XWK A;  1K0B A;  2DJJ A;  1PSQ A;  1PX7 A;  3QOU A;  5J9C A;  3A3T A;  4PXO A;  3HDC A;  3APS A;  1EV4 A;  5JCU A;  19GS A;  3KP9 A;  3APQ A;  4HJ2 A;  2MBT A;  3FYG A;  5DAK A;  2VCZ A;  2DML A;  4IW9 A;  3A2V A;  4QL7 A;  1JLV A;  4Q5Q A;  5IMC A;  4DVC A;  2KOK A;  5D9V A;  1R7H A;  5FHI A;  1GWC A;  3K8N A;  3GKM A;  1THX A;  3TJB A;  1Z6N A;  2OA7 A;  5D9T A;  3H8Q A;  4ZB9 A;  1YZX A;  1BX9 A;  1GSE A;  2ZUP A;  2YCD A;  3N9J A;  1SD8 A;  3ZTL A;  2GTU A;  1RK4 A;  5J4U A;  5HR3 A;  3TKS C;  1XWC A;  3HCZ A;  1TRS A;  1GLP A;  2L4Q A;  1E6B A;  3D4M A;  5ECS A;  5GSS A;  2VLU A;  3F4S A;  3DYR A;  2LTK A;  2V1M A;  3IK9 A;  2HNL A;  4NAX A;  5IMV A;  4GCI A;  1ZMA A;  5D9W A;  3E3E A;  1OVN A;  4D73 A;  3GKX A;  1GSS A;  1TJD A;  1BG5 A;  3DML A;  1KBN A;  4POL A;  3ZYW A;  2RM6 A;  1XPV A;  2YV9 A;  6GSY A;  4BWQ A;  4DSR A;  4EDY A;  3QR6 A;  3KH9 A;  1EOG A;  2XBQ A;  4BVX A;  1E2Y A;  3FZA A;  2YV7 A;  2L5L A;  1G7O A;  3Q6O A;  4K8M A;  1UN2 A;  2IFQ B;  3LQ7 A;  3DRN A;  5ENU A;  3IXR A;  1XZO A;  2QGV A;  2XHF A;  2JSZ A;  3HJO A;  3GNJ A;  2PBJ A;  4K0N A;  2JAD A;  2MZC A;  3KMN A;  1GSY A;  2M46 A;  3VPQ A;  2L59 A;  2C4J A;  2I1U A;  1DE1 A;  3RHB A;  1FW1 A;  6GSS A;  1B4Q A;  2WS2 A;  3F6F A;  1K0C A;  4HEA 2;  3LYP A;  3F8U A;  3IRA A;  2YWO A;  2YAN A;  4MF5 A;  5ECR B;  1A23 A;  5HFI A;  3KP8 A;  4N11 A;  5G2Z A;  1K3O A;  4O7H A;  2PVO C;  3HY2 A;  9GSS A;  4DSS A;  2CAQ A;  4PQI A;  1TW9 A;  4PUR A;  1GTU A;  4ZBA A;  5CRH A;  3WGE A;  2LJK A;  1Z5Y E;  1X9S B;  3TKP A;  1WPI A;  2B5X A;  1NHO A;  4TR4 A;  2VOC A;  4JE1 A;  1K0D A;  1U87 A;  2AUV A;  2R5G A;  4ZIJ A;  2O87 A;  5GST A;  5GAP D;  1M7T A;  2KUC A;  5DAL B;  4KB3 A;  4PQ1 A;  1URM A;  5LCZ A;  4F9Z A;  3E9J B;  1G7E A;  2L5O A;  2IMK A;  4MJC A;  1T4Z A;  1W89 A;  1XWB A;  1TXX A;  2B1L A;  5HFK A;  2O8V B;  4L0W A;  6GSV A;  5C04 A;  2QKE A;  3L4N A;  2VLT A;  3LXT A;  1PKW A;  2G2Q A;  1Q4J A;  1QMV A;  5B8B A;  3ED3 A;  3CMI A;  2RII A;  4V1A g;  4L8E A;  4GQF A;  1GRX A;  5E59 A;  1V58 A;  4HQZ A;  4F82 A;  1ERV A;  2JZR A;  4ML6 A;  3C73 A;  3GKK A;  4XS6 A;  2B5Y A;  5AIV A;  2R4V A;  5ECQ B;  5CRW A;  1AXD A;  5ECP B;  3GV1 A;  2GSR A;  18GS A;  1XW5 A;  5AN1 A;  4PNF A;  4AJ6 A;  3L9S A;  1AQX A;  4J2F A;  1GUK A;  3P7X A;  5JWQ B;  4KE3 A;  22GS A;  1G6W A;  1LJR A;  4GLT A;  1B8X A;  2L6C A;  1GP1 A;  3WT2 A;  2IN3 A;  1WP0 A;  3O76 A;  2GQK A;  3U6V A;  5IPG A;  2GQL A;  3RHC A;  2FLS A;  1GUL A;  2H19 A;  4ZIL A;  4KW6 A;  2WFC A;  3E0U A;  5J9B A;  3DKS A;  2C0G A;  5LNK e;  3EE2 A;  3D6I A;  2HRF A;  1JZR A;  1M0U A;  1GH2 A;  2DJ0 A;  1KEB A;  5FT3 A;  3HXS A;  2A4V A;  5ECI B;  1OC9 A;  3ZMK A;  1OKT A;  7GSS A;  2MMA A;  3I69 A;  1SJ6 A;  2LRT A;  2MYG A;  3TKQ A;  3H93 A;  2VUP A;  1JHB A;  5KEJ A;  3VLN A;  2H0G A;  2YZU A;  3DIE A;  4YQM A;  3F4R A;  1OE7 A;  3UMA A;  4ZL9 A;  3ZIT A;  13GS A;  5ECK B;  5H5Q A;  2PPT A;  1M2D A;  2H72 A;  3DWV A;  5DJM A;  3GMF A;  3KGK A;  3RDW A;  1TTZ A;  1TKD B;  2HZE B;  4MF7 A;  1FB0 A;  3D4T A;  3GSS A;  3WGD A;  4JBB A;  4K7I A;  3ZVJ A;  1G0T A;  4HU7 A;  1MTC A;  3KH7 A;  3R2Q A;  3LOR A;  4IP6 A;  3IE3 A;  3TDG A;  3RPP A;  1JZW A;  2FWF A;  4HDE A;  1U6T A;  3G9B A;  4QL9 A;  2HT9 A;  4G2E A;  3MDK A;  4I8B A;  4MMM A;  1MDJ A;  4E8E A;  5GAN D;  1V9W A;  2L4C A;  4J57 E;  4EE0 A;  2IPA A;  4CDO A;  1QXH A;  4MH3 A;  3EMP A;  2VL9 A;  1X5E A;  3C71 A;  4HS1 A;  5G1L A;  3BBY A;  2NDO A;  3QFB C;  3V1W A;  3UBK A;  3VWU A;  1GSQ A;  5EY6 A;  3ZML A;  2LNT A;  1FOV A;  1TRV A;  2C3Q A;  6GSU A;  1YJ6 A;  5D96 A;  1PKZ A;  3QDN A;  1XW9 A;  4K7N A;  5LD0 A;  3O3T A;  4HZ2 A;  2V2G A;  3GN3 A;  2E0Q A;  5EPF A;  3MWH A; 
#chains in the Genus database with same CATH topology
 3D0Z A;  3CYN A;  4ZB6 A;  1A0R P;  1HNB A;  2C3N A;  5DBQ A;  2GZY A;  1DUG A;  2DIZ A;  3UVT A;  5ECM B;  3KJY A;  1EV9 A;  1O8W A;  3LWA A;  1TU7 A;  3APO A;  4MPF A;  2OBI A;  3BJ5 A;  2G0F A;  4POM A;  4MZW A;  1GUH A;  1PL1 A;  4KH7 A;  2PGT A;  4N0V A;  4GQC A;  1A8Y A;  4XIH A;  3MAK A;  2CQ9 A;  4RI7 A;  5HR1 A;  3F0I A;  1Z3E A;  3FY7 A;  1T4Y A;  5A4W A;  5DAK B;  3M9J A;  3A2W A;  5IM9 A;  4I5Q A;  1KTE A;  2YNX A;  3M1G A;  3HZ4 A;  1YEP A;  5B6N A;  2ES7 A;  1FHE A;  4MJB A;  3QAW A;  4I2T A;  4L5O A;  5HR0 A;  3M3M A;  1ERU A;  3GKN A;  4GF0 A;  3LXZ A;  3DD3 A;  2GZP A;  2LRN A;  3ISO A;  4Z7X A;  3QFA C;  4BL7 A;  1SL1 B;  2L6D A;  4ZBB A;  4LL1 B;  2REM A;  1R4W A;  2IMD A;  2BMX A;  2B3S A;  3BD2 A;  2KP1 A;  2LST A;  3TKR A;  1K3L A;  3LFL A;  2OKA A;  3FZ4 A;  1PX6 A;  5IPH A;  4NMU A;  2H74 A;  5IO0 A;  3ERG A;  4K0G A;  3PH9 A;  4BIK A;  2QA2 A;  3F3Q A;  1MD3 A;  3CTG A;  1GLQ A;  2O85 A;  3FHK A;  2GGT A;  2VCQ A;  3LW9 A;  4HSC X;  3KZQ A;  4AJ7 A;  1LU4 A;  3ZZX A;  1Z7R A;  5AIS A;  4D73 B;  2B5E A;  4XRD A;  1SK0 A;  1M99 A;  3FRC A;  2N5A A;  1VF1 A;  5CRG A;  4K7O A;  4GSS A;  1GSU A;  1YEX A;  3EVI A;  3D21 A;  4GTU A;  2H30 A;  1BAY A;  2NBS A;  3TRQ A;  4OFT A;  4BVX B;  5BMU A;  1BQ7 A;  5DDL A;  3US3 A;  4OFM A;  3Q74 A;  3A5W A;  2JU5 A;  4TVE A;  1OE8 A;  3PIN A;  3FKF A;  1SEN A;  2CZ3 A;  2HRA A;  3TJF A;  3C7M A;  3LEF A;  2BJX A;  3GHA A;  3ZFB A;  5IO2 A;  3LYK A;  1THO A;  2DSA A;  3UOM A;  5IMD A;  5DQS A;  4KCA A;  2OJL A;  3GL5 A;  2HXK A;  3HVX A;  1OYJ A;  1SKR B;  4WKW A;  1ZYP A;  4OO4 A;  2H1G A;  5CO3 A;  3C8E A;  2VL3 A;  4V2N A;  1K0N A;  2PWJ A;  1Z7P A;  2DMM A;  3FZ5 A;  1TRU A;  2R2J A;  2OAD A;  2X99 A;  4MH2 A;  3ZRD A;  1OC8 A;  2VL2 A;  3IOS A;  4DSQ A;  1S3C A;  4ECB A;  3UAR A;  2VAF A;  4DSS B;  1OKD A;  4FIW A;  3I6A A;  2E2G A;  2CZ2 A;  2VCX A;  5G5E A;  4N30 A;  2P0G A;  4XRA A;  1GUM A;  1PD2 1;  4KDU A;  3HJP A;  4HZ4 A;  2HLS A;  2DKH A;  3GTU A;  5KN2 A;  3TRX A;  2L57 A;  4XS4 A;  2H1A A;  2FA8 A;  3DGQ A;  2DBC A;  3PR8 A;  4WBR D;  1LBK A;  1TI1 A;  4K1F A;  3FR3 A;  3S9F A;  3VWV A;  2WDU A;  4O92 A;  2R3X A;  4G10 A;  4I97 A;  1VRS D;  4N10 A;  3UEM A;  1VF3 A;  1ZOF A;  3L78 A;  1SYX A;  5JCG A;  4V1A p;  5IMZ A;  1XOA A;  5INY A;  3FW2 A;  2HI7 A;  2Z9S A;  1PRX A;  4HI7 A;  1XVW A;  4MLY A;  1QFN A;  1UA5 A;  2N5F A;  5EL8 A;  6GSX A;  1QUW A;  11GS A;  2I4A A;  2I3Y A;  1X9W B;  3LSZ A;  4ZXG A;  4K2D A;  3VI5 A;  4ECI A;  1SK2 A;  3F63 A;  4ZB8 A;  4E8H A;  1HD2 A;  2CVD A;  1FAA A;  1X9M B;  1GTI A;  3VI7 A;  2XPE A;  4KDX A;  5ELG A;  1K3Y A;  1U3A A;  2P5Q A;  5IQY A;  4ULX A;  4YQV A;  3W6G A;  4G9H A;  4JZQ A;  2DJ2 A;  3GH9 A;  5KN0 A;  2E7P A;  3R3E A;  2OE3 A;  2H66 A;  1M2A A;  3TCO A;  3LG6 A;  4Q5N A;  1RQM A;  1VGL A;  2C0F A;  5IIZ A;  3DEX A;  4YH2 A;  1GNW A;  1YDK A;  4YAV A;  1ZL9 A;  4HU9 A;  2FUG 2;  4BWS A;  2KHP A;  2OE0 A;  4PX1 A;  2VLV A;  4GXZ A;  1K0A A;  2FWE A;  2A2R A;  3ZRE A;  1C72 A;  3DVX A;  2C80 A;  2YJH A;  1EP8 A;  3IPZ A;  1NW2 A;  4J56 E;  3GX8 A;  2GSQ A;  1OC9 B;  3L9V A;  3O6T A;  4EXJ A;  3FR6 A;  4OMV A;  3CTF A;  1J9B A;  1AAZ A;  2JSY A;  3FMW A;  5D8I A;  2H01 A;  1TU8 A;  4JR6 A;  2DKI A;  1TOF A;  1G6Y A;  4NV5 A;  2H1B A;  4P3Y B;  2YZH A;  2PU9 C;  1FOH A;  2BTO T;  2GSS A;  3JCM L;  3VUR A;  3Q18 A;  5F0G A;  1XWG A;  3M8N A;  5F06 A;  1T1V A;  2WGR A;  1TI3 A;  2N5B A;  2GQM A;  3ME8 A;  4IQA A;  2WZ9 A;  4XS1 A;  1USB A;  3KCM A;  1O7U A;  2K8V A;  2R0P A;  2TRX A;  5CRE A;  2WB9 A;  3UVH A;  1R26 A;  2K6V A;  1HNA A;  4IQ1 A;  1F3A A;  5H5S A;  1WMJ A;  2H73 A;  2LS5 A;  4IJI A;  2FWG A;  4O5U A;  4MZB A;  5A4U A;  5DQY A;  1A2M A;  3GX0 A;  3HA9 A;  4I6X A;  5ECN B;  5DJL A;  1YF1 A;  1QQ2 A;  2K18 A;  4H86 A;  1FVJ A;  4BPY A;  3HZ8 A;  1AQV A;  4WBJ A;  2V32 A;  3CXG A;  2MMZ A;  4IVF A;  4ID0 A;  1A24 A;  3FK8 A;  1TK8 B;  2H71 A;  1M3I A;  3RBT A;  2B7J A;  3TB2 A;  3BCI A;  3BOA A;  3LJR A;  4K2X A;  4MZC A;  5F07 A;  2IL3 A;  4TR1 A;  3QPM A;  5ECH B;  1ZCP A;  5IOX A;  1GSF A;  1X5C A;  3EYT A;  5J41 A;  4GRF A;  4O32 A;  3GUS A;  3WD6 A;  1J08 A;  1T3B A;  3FR9 A;  4G0L A;  4F2I A;  5CAX A;  2A2P A;  1HYU A;  2AB6 A;  2R6K A;  8GSS A;  2OBK A;  1Y6E A;  2B1K A;  2PN8 A;  2LEG A;  4IN0 A;  1R5P A;  1SD9 A;  2C1Y A;  1GNE A;  4L5L A;  3TRP A;  3FZ9 A;  2VM2 A;  1K0M A;  2X8H A;  5L71 A;  4MK3 A;  5ID2 A;  2VCV A;  2XBI A;  1K0O A;  3W8J A;  4KGI A;  3PPU A;  3EMX A;  5HFG A;  3TOT A;  2C0D A;  1F2E A;  4KSM A;  3MNG A;  3CSI A;  2AYT A;  2QC7 A;  3PGT A;  4HUA A;  1MDK A;  2GST A;  4OD7 A;  3J7Y k;  5DCG A;  2H70 A;  5J5N A;  2V6K A;  2DJ3 A;  5CNW A;  1F9M A;  3ZIJ A;  2J9H A;  2HZF A;  3WYW A;  2EC4 A;  2ALB A;  4K6X A;  3IDV A;  2VCW A;  2NPB A;  4MJE A;  2TIR A;  1T7P B;  3D22 A;  1XVQ A;  2F9S A;  1EOH A;  5F8B A;  1ILO A;  4ML1 A;  1TRW A;  4LMW A;  1WIK A;  2CAI A;  2FNO A;  2VCT A;  3C1S A;  3GST A;  1VF4 A;  2DJK A;  2K8S A;  3GIX A;  4JED A;  4MF6 A;  4OFN A;  4BL7 B;  4TXO A;  4FYC A;  4YKG A;  1YKA A;  2VL2 C;  5KN1 A;  1O8X A;  4O5R A;  3IHQ A;  2WUL A;  4MAB A;  4KCE A;  4AF2 A;  1PFO A;  3GL3 A;  3W8S A;  1ZGN A;  2AAW A;  4IGJ A;  6GSW A;  2F8A A;  5B6M A;  3IBH A;  4JR4 A;  4JU5 A;  4IBP A;  2PER A;  2H0I A;  2RLI A;  3GH6 A;  4KAE A;  4MPG A;  1NHY A;  4HQS A;  2CVK A;  2P5R A;  3KMO A;  3NOF A;  2EIO A;  4CHS A;  4NV2 A;  4ILF A;  3KEB A;  3ME7 A;  2IIY A;  2J23 A;  2R37 A;  2VD1 A;  4EC0 A;  3I43 A;  3WGX A;  2FD3 A;  5ECO B;  4Q5F A;  4GST A;  5CRD A;  4WF4 A;  1F6M C;  1YKC A;  2OE1 A;  2CX4 A;  5H5R A;  4CY6 A;  1NM3 A;  3ZIV A;  3TOU A;  4IP1 A;  4PQH A;  1B48 A;  3OR5 A;  4NXI A;  4MDC A;  5G5F A;  4F03 A;  4KA0 A;  5JWR B;  5AIX A;  4TR3 A;  1AIU A;  2O89 A;  3QAG A;  1TK5 B;  3TUE A;  3HHV A;  1GTA A;  4MA9 A;  3KM6 A;  3HVN A;  3QD9 A;  4NPB A;  4WR5 A;  10GS A;  2CT6 A;  1M3J A;  20GS A;  1X0R A;  2GZZ A;  4FQU A;  2HSM A;  1EZK A;  2NVL A;  1M2B A;  5KOW A;  3NZN A;  2M80 A;  5G30 A;  3H1N A;  1GTB A;  2LKU A;  2ON7 A;  2O7K A;  3CRU A;  4YKF A;  4BA7 A;  4KUN A;  1SKS B;  3GTU B;  4XS4 B;  3HVS A;  3TGZ A;  1DBY A;  3IR4 A;  4JRR A;  2KLX A;  3ERW A;  3HKR A;  2DC5 A;  4X43 A;  3TKS E;  1JZD A;  4ACS A;  5A4V A;  4PNG A;  4EIQ A;  4G19 A;  3RPN A;  2IME A;  1QK8 A;  1U88 A;  1H75 A;  5F05 A;  3EUR A;  1GL8 A;  2YWN A;  3P90 A;  2JL4 A;  2YJ7 A;  5EVO A;  4TN8 A;  1HNC A;  3TJG A;  4LL4 B;  5C00 A;  2LNS A;  2K9F A;  2IWT A;  4ECJ A;  1M9A A;  4XHM A;  5ABR A;  4GSN A;  4L0U A;  4PUA A;  4MCU A;  2LQO A;  2F51 A;  1ERT A;  2HSH A;  1XFL A;  2GS3 A;  1O81 A;  1SJI A;  4WR4 A;  1SJZ A;  2JZT A;  3GFK A;  4POB A;  4ZBD A;  1EEJ A;  3EWL A;  2B7K A;  2GT6 A;  4V2L A;  3N5O A;  3G7J A;  1TP9 A;  2YP6 A;  2XPD A;  1TK0 B;  2IMI A;  4EO3 A;  4RUV A;  3UJ1 A;  3UAP A;  3VWX A;  1PQN A;  4EKZ A;  5D73 A;  2OAC A;  17GS A;  4WF5 A;  4YQU A;  3UBL A;  1WJK A;  2VM1 A;  5ELA A;  1PL2 A;  1B9Y C;  2VIM A;  1DE2 A;  1AC1 A;  4TW5 A;  1SYR A;  3Q19 A;  3SBC A;  2FY6 A;  2LQQ A;  5COH A;  3LGC A;  1F37 A;  2I9H A;  4KDY A;  3HD5 A;  1IYH A;  1V2A A;  1B4P A;  2HRN A;  1KNG A;  3ZFL A;  2H0H A;  3GUR A;  2B6M A;  2GT5 A;  5IOW A;  5HR2 A;  2CVB A;  12GS A;  4GWR A;  3P8W A;  2GVP A;  3L9U A;  1WWJ A;  1YQ1 A;  4IJ3 A;  1T00 A;  3UIW A;  3MSZ A;  2H6Y A;  2LUS A;  2MBS A;  2DLX A;  4TR0 A;  1A2L A;  2AHE A;  4MP4 A;  1J0F A;  2YN1 A;  16GS A;  1PN9 A;  2ZNM A;  1SL0 B;  4O5Q A;  2JZS A;  4EF0 A;  2DJ1 A;  2PMT A;  4EVM A;  2H6X A;  1GSD A;  1OAZ A;  3L0H A;  2LJR A;  3G7Y A;  1MEK A;  1AW9 A;  2YWM A;  3J7Y b;  1OC3 A;  4N0Z A;  3HJM A;  6GST A;  1ZYQ B;  2X64 A;  1XOB A;  4OWY A;  3U5R E;  1EWX A;  1H4O A;  2FWH A;  3I9V 2;  3QMX A;  2KP2 A;  4QQ7 A;  1ABA A;  4NHZ A;  1XIY A;  1MDI A;  5A5K A;  2C3T A;  2IFQ A;  4ICY A;  1O85 A;  2ON5 A;  2MMO A;  3IC4 A;  3SWL A;  4TR1 B;  2F3M A;  3H79 A;  4HJM A;  3EC3 A;  1MD4 A;  1XXU A;  3IV4 A;  1XWA A;  1PA3 A;  2PUK C;  2QSI A;  5CYY A;  2FGX A;  5J3R A;  3QAV A;  1YF0 A;  2X8G A;  2IJY A;  2TRC P;  4EDZ A;  4BVY A;  5G31 A;  3ZLP A;  1EP7 A;  5FWG A;  5CP1 A;  4V2M A;  1U3I A;  2X49 A;  3HVV A;  3EU3 A;  5ID2 B;  4KSO A;  2VO4 A;  4Q5R A;  2HYX A;  5BRT A;  2AJQ B;  1Z6M A;  3VPT A;  4OCE A;  5ECL B;  1RW1 A;  3C1R A;  3ERF A;  3QCP A;  2X8C A;  1EGO A;  3M0F A;  3TKS A;  2EIQ A;  1BYE A;  1ZYE A;  2GDR A;  4TXV A;  5B8A A;  4YAP A;  5DVB A;  3EU4 A;  5IMF A;  1A8L A;  3M9K A;  3GRX A;  3KXO A;  5G1K A;  4FH8 A;  5DAL A;  1A2J A;  5DCH A;  4WXT A;  2H8L A;  4FO5 A;  2YOI A;  3CRT A;  2GLR A;  2IMF A;  1JFU A;  4RQX A;  4PGT A;  2C0E A;  4DEJ A;  5E4W A;  5HQP A;  2QA1 A;  1XW6 A;  3P2A A;  1I9D A;  3VK9 A;  5JWO B;  1CQH A;  4K9Z A;  3FEU A;  4PUF C;  4F0C A;  3VFI A;  3VWW A;  4TXO B;  4X0X A;  4TOP A;  3CBU A;  4ZL8 A;  1JLW A;  4IEL A;  3CSJ A;  1SU9 A;  3IHG A;  2MMN A;  1S3A A;  4USS A;  2M72 A;  1CQG A;  5B7C A;  1AQW A;  4POK A;  2FCH A;  1NSW A;  4ZL7 A;  3KD0 A;  1BJX A;  1I5G A;  4FYU A;  3H4K A;  1PGT A;  1Q98 A;  2NTO A;  1V40 A;  1F3B A;  1O6J A;  4CW9 A;  3A2X A;  4IKH A;  5D93 A;  1VF2 A;  2YPM A;  3GA4 A;  1XCC A;  3F6D A;  3IAS 2;  1Z9H A;  1ON4 A;  1T8E B;  4NHW A;  4LA1 A;  1ST9 A;  3BCK A;  3F9U A;  3IA1 A;  2WRT A;  1EGR A;  3WT1 A;  1YY7 A;  2YWI A;  2CV4 A;  2AV4 A;  3D5J A;  4RI6 A;  4KX4 A;  1FVK A;  3F4T A;  2WCI A;  1SKW B;  1WE0 A;  1IYI A;  4ISD A;  1O73 A;  4AJ8 A;  3EIN A;  4HOJ A;  2FA4 A;  1W4V A;  1N2A A;  2EIR A;  2A2S A;  3ZL5 A;  4EUY A;  4IS0 A;  4I2U A;  5D9X A;  1ZZY A;  2LRC A;  3NIV A;  2R0C A;  2V6O A;  1EEM A;  1M9B A;  3DXB A;  3KIJ A;  3HYP A;  2RM5 A;  1N8J A;  1WOU A;  2HZE A;  3CSH A;  2CA8 A;  4LMV A;  4TRX A;  4X1U A;  2F8F A;  2H6Z A;  1A0F A;  1AUC A;  4FYB A;  5KN3 A;  2V41 A;  2PVQ A;  2LV3 A;  3TJJ A;  2P31 A;  5AGY A;  4OCF A;  1HQO A;  1V57 A;  1V98 A;  1XBS A;  1UC7 A;  4IHU A;  1UVZ A;  1PMT A;  4XTS A;  3DVW A;  4ECC A;  5IMA A;  2HFD A;  4NWY A;  4XCS A;  3KTB A;  2I81 A;  1DSB A;  4LLR A;  4OO5 A;  1QGV A;  4WEY A;  2E2M A;  1ERW A;  1JZO A;  3GYK A;  2HE3 A;  2ZCT A;  1FB6 A;  3TJK A;  3IAM 2;  3MIX A;  1FO5 A;  4TKY A;  1Y25 A;  4AGS A;  1S3D A;  1B9X C;  2DIY A;  1ACV A;  3ZVJ D;  1X5D A;  4EL1 A;  2HSY A;  2XC2 A;  1TDI A;  4MJA A;  1WRY A;  2CX3 A;  4EIP A;  3RAZ A;  1BED A;  4RQR A;  4WET A;  2JAC A;  4G0I A;  4KND A;  2H76 A;  3KTL A;  1ML6 A;  2RUF A;  2VD0 A;  2WJU A;  2LJA A;  5JCW A;  2H75 A;  3MYD A;  3UL3 A;  4F0B A;  2C8U A;  2H1D A;  3IK7 A;  1R5A A;  2RUE A;  1SL2 B;  3AY8 A;  4Z2U A;  3F3R A;  2FHE A;  5GZZ B;  14GS A;  3G7I A;  1FG4 A;  2D2Z A;  1SK1 A;  1XWK A;  1K0B A;  2DJJ A;  5KOX A;  1PSQ A;  1PX7 A;  3QOU A;  5J9C A;  3A3T A;  4PXO A;  3HDC A;  3APS A;  1EV4 A;  5JCU A;  19GS A;  3KP9 A;  3APQ A;  4HJ2 A;  2MBT A;  3FYG A;  5DAK A;  2VCZ A;  2DML A;  4IW9 A;  3A2V A;  4QL7 A;  1JLV A;  4Q5Q A;  5IMC A;  4DVC A;  3CQF A;  2KOK A;  5D9V A;  1R7H A;  5FHI A;  1GWC A;  3K8N A;  3GKM A;  1THX A;  3TJB A;  1Z6N A;  2OA7 A;  5D9T A;  2A4H A;  3H8Q A;  4ZB9 A;  1YZX A;  1BX9 A;  1GSE A;  2ZUP A;  2YCD A;  3N9J A;  1SD8 A;  3ZTL A;  2GTU A;  1RK4 A;  5J4U A;  5HR3 A;  3TKS C;  1XWC A;  3HCZ A;  1TRS A;  1GLP A;  2L4Q A;  1E6B A;  3D4M A;  5ECS A;  5GSS A;  2VLU A;  3F4S A;  3DYR A;  2LTK A;  2V1M A;  3IK9 A;  2HNL A;  4NAX A;  5IMV A;  4GCI A;  1ZMA A;  5D9W A;  3E3E A;  1OVN A;  4D73 A;  3GKX A;  1GSS A;  1TJD A;  1BG5 A;  3DML A;  1KBN A;  4POL A;  3ZYW A;  2RM6 A;  1XPV A;  2YV9 A;  6GSY A;  4BWQ A;  4DSR A;  4EDY A;  3QR6 A;  4X4J A;  3KH9 A;  1EOG A;  2XBQ A;  4BVX A;  1E2Y A;  3FZA A;  2YV7 A;  3IC8 A;  2L5L A;  1G7O A;  3Q6O A;  4K8M A;  1UN2 A;  2IFQ B;  3LQ7 A;  3DRN A;  5ENU A;  3IXR A;  1XZO A;  2QGV A;  2XHF A;  2JSZ A;  3HJO A;  3GNJ A;  2PBJ A;  4CY8 A;  4K0N A;  2JAD A;  2MZC A;  3KMN A;  1GSY A;  2M46 A;  3VPQ A;  2L59 A;  2C4J A;  2I1U A;  1DE1 A;  3RHB A;  1FW1 A;  6GSS A;  1XG8 A;  1B4Q A;  2WS2 A;  3F6F A;  1K0C A;  4HEA 2;  3LYP A;  3F8U A;  4BVY B;  3IRA A;  4KF9 A;  2YWO A;  2YAN A;  4MF5 A;  5ECR B;  1A23 A;  5HFI A;  3KP8 A;  4N11 A;  5G2Z A;  1K3O A;  4O7H A;  2PVO C;  3HY2 A;  9GSS A;  4DSS A;  2CAQ A;  4PQI A;  1TW9 A;  4PUR A;  1GTU A;  4A5P A;  4ZBA A;  5CRH A;  3WGE A;  2LJK A;  1Z5Y E;  1X9S B;  4Z2R A;  3TKP A;  1WPI A;  1S3R A;  2B5X A;  1NHO A;  4TR4 A;  2VOC A;  4JE1 A;  1K0D A;  1U87 A;  2AUV A;  2R5G A;  4G0K A;  4ZIJ A;  2O87 A;  5GST A;  5GAP D;  1M7T A;  2KUC A;  5DAL B;  4KB3 A;  4PQ1 A;  1URM A;  5LCZ A;  4F9Z A;  3E9J B;  1G7E A;  2L5O A;  2IMK A;  4MJC A;  1T4Z A;  1W89 A;  1XWB A;  1TXX A;  2B1L A;  5HFK A;  2O8V B;  4L0W A;  6GSV A;  5C04 A;  2QKE A;  3L4N A;  2VLT A;  3LXT A;  1PKW A;  2G2Q A;  1Q4J A;  1QMV A;  5B8B A;  3ED3 A;  3CMI A;  1ZYN A;  2RII A;  4V1A g;  4L8E A;  4GQF A;  1GRX A;  5E59 A;  1V58 A;  4HQZ A;  4F82 A;  1ERV A;  2JZR A;  4ML6 A;  3C73 A;  3GKK A;  4XS6 A;  2B5Y A;  5AIV A;  2R4V A;  5ECQ B;  5CRW A;  1AXD A;  5ECP B;  3GV1 A;  2GSR A;  18GS A;  1XW5 A;  5AN1 A;  4PNF A;  4AJ6 A;  3L9S A;  1AQX A;  4J2F A;  3EPT A;  1GUK A;  3P7X A;  5JWQ B;  4KE3 A;  22GS A;  1G6W A;  1LJR A;  4GLT A;  1B8X A;  2L6C A;  1GP1 A;  3WT2 A;  2IN3 A;  1WP0 A;  3O76 A;  2GQK A;  4K5R A;  3U6V A;  5IPG A;  2GQL A;  3RHC A;  2FLS A;  1GUL A;  2H19 A;  4ZIL A;  4KW6 A;  2WFC A;  3E0U A;  5J9B A;  3DKS A;  2C0G A;  5LNK e;  3EE2 A;  3D6I A;  2HRF A;  1PN0 A;  1JZR A;  1M0U A;  1GH2 A;  2DJ0 A;  1KEB A;  5FT3 A;  3HXS A;  2A4V A;  5ECI B;  1OC9 A;  3ZMK A;  1OKT A;  7GSS A;  2MMA A;  3I69 A;  1SJ6 A;  4K5S A;  2LRT A;  2MYG A;  3TKQ A;  3H93 A;  2VUP A;  1JHB A;  5KEJ A;  3VLN A;  2H0G A;  2YZU A;  3DIE A;  4YQM A;  3F4R A;  1OE7 A;  3UMA A;  4ZL9 A;  3ZIT A;  13GS A;  5ECK B;  5H5Q A;  2PPT A;  1M2D A;  2H72 A;  3DWV A;  5DJM A;  4Z2T A;  3GMF A;  3KGK A;  3RDW A;  1TTZ A;  4PTS A;  1TKD B;  2HZE B;  4MF7 A;  1FB0 A;  3D4T A;  3GSS A;  3WGD A;  4JBB A;  4K7I A;  3ZVJ A;  1G0T A;  4HU7 A;  1MTC A;  3KH7 A;  3R2Q A;  3LOR A;  4IP6 A;  3IE3 A;  3TDG A;  3A5I A;  3RPP A;  1JZW A;  2FWF A;  4HDE A;  1U6T A;  3G9B A;  4QL9 A;  2HT9 A;  4G2E A;  3MDK A;  4I8B A;  4MMM A;  1MDJ A;  4E8E A;  5GAN D;  1V9W A;  2L4C A;  4J57 E;  4EE0 A;  2IPA A;  4CDO A;  1QXH A;  4MH3 A;  3EMP A;  2VL9 A;  1X5E A;  2X4A A;  3C71 A;  4HS1 A;  5G1L A;  3BBY A;  2UZ8 A;  2NDO A;  3QFB C;  3V1W A;  3UBK A;  3VWU A;  1GSQ A;  2HRK A;  5EY6 A;  3ZML A;  2LNT A;  1FOV A;  1TRV A;  2C3Q A;  4MNN A;  6GSU A;  1YJ6 A;  5D96 A;  1PKZ A;  3QDN A;  1XW9 A;  4K7N A;  5LD0 A;  3O3T A;  4HZ2 A;  2R0G A;  2V2G A;  3GN3 A;  2E0Q A;  5EPF A;  3MWH A; 
#chains in the Genus database with same CATH homology
 3D0Z A;  3CYN A;  4ZB6 A;  1A0R P;  1HNB A;  2C3N A;  5DBQ A;  2GZY A;  1DUG A;  2DIZ A;  3UVT A;  5ECM B;  3KJY A;  1EV9 A;  1O8W A;  3LWA A;  1TU7 A;  3APO A;  4MPF A;  2OBI A;  3BJ5 A;  2G0F A;  4POM A;  4MZW A;  1GUH A;  1PL1 A;  4KH7 A;  2PGT A;  4N0V A;  4GQC A;  1A8Y A;  4XIH A;  3MAK A;  2CQ9 A;  4RI7 A;  5HR1 A;  3F0I A;  1Z3E A;  3FY7 A;  1T4Y A;  5A4W A;  5DAK B;  3M9J A;  3A2W A;  5IM9 A;  4I5Q A;  1KTE A;  2YNX A;  3M1G A;  3HZ4 A;  1YEP A;  5B6N A;  2ES7 A;  1FHE A;  4MJB A;  3QAW A;  4I2T A;  4L5O A;  5HR0 A;  3M3M A;  1ERU A;  3GKN A;  4GF0 A;  3LXZ A;  3DD3 A;  2GZP A;  2LRN A;  3ISO A;  4Z7X A;  3QFA C;  4BL7 A;  1SL1 B;  2L6D A;  4ZBB A;  4LL1 B;  2REM A;  1R4W A;  2IMD A;  2BMX A;  2B3S A;  3BD2 A;  2KP1 A;  2LST A;  3TKR A;  1K3L A;  3LFL A;  2OKA A;  3FZ4 A;  1PX6 A;  5IPH A;  4NMU A;  2H74 A;  5IO0 A;  3ERG A;  4K0G A;  3PH9 A;  2QA2 A;  3F3Q A;  1MD3 A;  3CTG A;  1GLQ A;  2O85 A;  3FHK A;  2GGT A;  2VCQ A;  3LW9 A;  3KZQ A;  4AJ7 A;  1LU4 A;  3ZZX A;  1Z7R A;  5AIS A;  4D73 B;  2B5E A;  4XRD A;  1SK0 A;  1M99 A;  3FRC A;  2N5A A;  1VF1 A;  5CRG A;  4K7O A;  4GSS A;  1GSU A;  1YEX A;  3EVI A;  3D21 A;  4GTU A;  2H30 A;  1BAY A;  2NBS A;  3TRQ A;  4OFT A;  4BVX B;  5BMU A;  1BQ7 A;  5DDL A;  3US3 A;  4OFM A;  3Q74 A;  3A5W A;  2JU5 A;  4TVE A;  1OE8 A;  3PIN A;  3FKF A;  1SEN A;  2CZ3 A;  2HRA A;  3TJF A;  3C7M A;  3LEF A;  2BJX A;  3GHA A;  3ZFB A;  5IO2 A;  3LYK A;  1THO A;  2DSA A;  3UOM A;  5IMD A;  5DQS A;  4KCA A;  2OJL A;  3GL5 A;  2HXK A;  3HVX A;  1OYJ A;  1SKR B;  4WKW A;  1ZYP A;  4OO4 A;  2H1G A;  5CO3 A;  3C8E A;  2VL3 A;  4V2N A;  1K0N A;  2PWJ A;  1Z7P A;  2DMM A;  3FZ5 A;  1TRU A;  2R2J A;  2OAD A;  2X99 A;  4MH2 A;  3ZRD A;  1OC8 A;  2VL2 A;  3IOS A;  4DSQ A;  1S3C A;  4ECB A;  3UAR A;  2VAF A;  4DSS B;  1OKD A;  4FIW A;  3I6A A;  2E2G A;  2CZ2 A;  2VCX A;  5G5E A;  4N30 A;  2P0G A;  4XRA A;  1GUM A;  1PD2 1;  4KDU A;  3HJP A;  4HZ4 A;  2HLS A;  2DKH A;  3GTU A;  5KN2 A;  3TRX A;  2L57 A;  4XS4 A;  2H1A A;  2FA8 A;  3DGQ A;  2DBC A;  3PR8 A;  4WBR D;  1LBK A;  1TI1 A;  4K1F A;  3FR3 A;  3S9F A;  3VWV A;  2WDU A;  4O92 A;  2R3X A;  4G10 A;  4I97 A;  1VRS D;  4N10 A;  3UEM A;  1VF3 A;  1ZOF A;  3L78 A;  1SYX A;  5JCG A;  4V1A p;  5IMZ A;  1XOA A;  5INY A;  3FW2 A;  2HI7 A;  2Z9S A;  1PRX A;  4HI7 A;  1XVW A;  4MLY A;  1QFN A;  1UA5 A;  2N5F A;  5EL8 A;  6GSX A;  1QUW A;  11GS A;  2I4A A;  2I3Y A;  1X9W B;  3LSZ A;  4ZXG A;  4K2D A;  3VI5 A;  4ECI A;  1SK2 A;  3F63 A;  4ZB8 A;  4E8H A;  1HD2 A;  2CVD A;  1FAA A;  1X9M B;  1GTI A;  3VI7 A;  2XPE A;  4KDX A;  5ELG A;  1K3Y A;  1U3A A;  2P5Q A;  5IQY A;  4ULX A;  4YQV A;  3W6G A;  4G9H A;  4JZQ A;  2DJ2 A;  3GH9 A;  5KN0 A;  2E7P A;  3R3E A;  2OE3 A;  2H66 A;  1M2A A;  3TCO A;  3LG6 A;  4Q5N A;  1RQM A;  1VGL A;  2C0F A;  5IIZ A;  3DEX A;  4YH2 A;  1GNW A;  1YDK A;  4YAV A;  1ZL9 A;  4HU9 A;  2FUG 2;  4BWS A;  2KHP A;  2OE0 A;  4PX1 A;  2VLV A;  4GXZ A;  1K0A A;  2FWE A;  2A2R A;  3ZRE A;  1C72 A;  3DVX A;  2C80 A;  2YJH A;  1EP8 A;  3IPZ A;  1NW2 A;  4J56 E;  3GX8 A;  2GSQ A;  1OC9 B;  3L9V A;  3O6T A;  4EXJ A;  3FR6 A;  4OMV A;  3CTF A;  1J9B A;  1AAZ A;  2JSY A;  3FMW A;  5D8I A;  2H01 A;  1TU8 A;  4JR6 A;  2DKI A;  1TOF A;  1G6Y A;  4NV5 A;  2H1B A;  4P3Y B;  2YZH A;  2PU9 C;  1FOH A;  2BTO T;  2GSS A;  3JCM L;  3VUR A;  3Q18 A;  5F0G A;  1XWG A;  3M8N A;  5F06 A;  1T1V A;  2WGR A;  1TI3 A;  2N5B A;  2GQM A;  3ME8 A;  4IQA A;  2WZ9 A;  4XS1 A;  1USB A;  3KCM A;  1O7U A;  2K8V A;  2R0P A;  2TRX A;  5CRE A;  2WB9 A;  3UVH A;  1R26 A;  2K6V A;  1HNA A;  4IQ1 A;  1F3A A;  5H5S A;  1WMJ A;  2H73 A;  2LS5 A;  4IJI A;  2FWG A;  4O5U A;  4MZB A;  5A4U A;  5DQY A;  1A2M A;  3GX0 A;  3HA9 A;  4I6X A;  5ECN B;  5DJL A;  1YF1 A;  1QQ2 A;  2K18 A;  4H86 A;  1FVJ A;  4BPY A;  3HZ8 A;  1AQV A;  4WBJ A;  2V32 A;  3CXG A;  2MMZ A;  4IVF A;  4ID0 A;  1A24 A;  3FK8 A;  1TK8 B;  2H71 A;  3RBT A;  2B7J A;  3TB2 A;  3BCI A;  3BOA A;  3LJR A;  4K2X A;  4MZC A;  5F07 A;  2IL3 A;  4TR1 A;  3QPM A;  5ECH B;  1ZCP A;  5IOX A;  1GSF A;  1X5C A;  3EYT A;  5J41 A;  4GRF A;  4O32 A;  3GUS A;  3WD6 A;  1J08 A;  1T3B A;  3FR9 A;  4G0L A;  4F2I A;  5CAX A;  2A2P A;  1HYU A;  2AB6 A;  2R6K A;  8GSS A;  2OBK A;  1Y6E A;  2B1K A;  2PN8 A;  2LEG A;  4IN0 A;  1R5P A;  1SD9 A;  2C1Y A;  1GNE A;  4L5L A;  3TRP A;  3FZ9 A;  2VM2 A;  1K0M A;  2X8H A;  5L71 A;  4MK3 A;  5ID2 A;  2VCV A;  2XBI A;  1K0O A;  3W8J A;  4KGI A;  3PPU A;  3EMX A;  5HFG A;  3TOT A;  2C0D A;  1F2E A;  4KSM A;  3MNG A;  3CSI A;  2AYT A;  2QC7 A;  3PGT A;  4HUA A;  1MDK A;  2GST A;  4OD7 A;  3J7Y k;  5DCG A;  2H70 A;  5J5N A;  2V6K A;  2DJ3 A;  5CNW A;  1F9M A;  3ZIJ A;  2J9H A;  2HZF A;  3WYW A;  2EC4 A;  2ALB A;  4K6X A;  3IDV A;  2VCW A;  2NPB A;  4MJE A;  2TIR A;  1T7P B;  3D22 A;  1XVQ A;  2F9S A;  1EOH A;  5F8B A;  1ILO A;  4ML1 A;  1TRW A;  4LMW A;  1WIK A;  2CAI A;  2FNO A;  2VCT A;  3C1S A;  3GST A;  1VF4 A;  2DJK A;  2K8S A;  3GIX A;  4JED A;  4MF6 A;  4OFN A;  4BL7 B;  4TXO A;  4FYC A;  4YKG A;  1YKA A;  2VL2 C;  5KN1 A;  1O8X A;  4O5R A;  3IHQ A;  2WUL A;  4MAB A;  4KCE A;  4AF2 A;  3GL3 A;  3W8S A;  1ZGN A;  2AAW A;  4IGJ A;  6GSW A;  2F8A A;  5B6M A;  3IBH A;  4JR4 A;  4JU5 A;  4IBP A;  2PER A;  2H0I A;  2RLI A;  3GH6 A;  4KAE A;  4MPG A;  1NHY A;  4HQS A;  2CVK A;  2P5R A;  3KMO A;  3NOF A;  2EIO A;  4CHS A;  4NV2 A;  4ILF A;  3KEB A;  3ME7 A;  2IIY A;  2J23 A;  2R37 A;  2VD1 A;  4EC0 A;  3I43 A;  3WGX A;  2FD3 A;  5ECO B;  4Q5F A;  4GST A;  5CRD A;  4WF4 A;  1F6M C;  1YKC A;  2OE1 A;  2CX4 A;  5H5R A;  4CY6 A;  1NM3 A;  3ZIV A;  3TOU A;  4IP1 A;  4PQH A;  1B48 A;  3OR5 A;  4NXI A;  4MDC A;  5G5F A;  4F03 A;  4KA0 A;  5JWR B;  5AIX A;  4TR3 A;  1AIU A;  2O89 A;  3QAG A;  1TK5 B;  3TUE A;  3HHV A;  1GTA A;  4MA9 A;  3KM6 A;  4WR5 A;  3QD9 A;  4NPB A;  10GS A;  2CT6 A;  20GS A;  1X0R A;  2GZZ A;  4FQU A;  2HSM A;  1EZK A;  2NVL A;  1M2B A;  5KOW A;  3NZN A;  2M80 A;  5G30 A;  3H1N A;  1GTB A;  2LKU A;  2ON7 A;  2O7K A;  3CRU A;  4YKF A;  4BA7 A;  4KUN A;  1SKS B;  3GTU B;  4XS4 B;  3HVS A;  3TGZ A;  1DBY A;  3IR4 A;  4JRR A;  2KLX A;  3ERW A;  3HKR A;  2DC5 A;  4X43 A;  3TKS E;  1JZD A;  4ACS A;  5A4V A;  4PNG A;  4EIQ A;  4G19 A;  3RPN A;  2IME A;  1QK8 A;  1U88 A;  1H75 A;  5F05 A;  3EUR A;  1GL8 A;  2YWN A;  3P90 A;  2JL4 A;  2YJ7 A;  5EVO A;  4TN8 A;  1HNC A;  3TJG A;  4LL4 B;  5C00 A;  2LNS A;  2K9F A;  2IWT A;  4ECJ A;  1M9A A;  4XHM A;  5ABR A;  4GSN A;  4L0U A;  4PUA A;  4MCU A;  2LQO A;  2F51 A;  1ERT A;  2HSH A;  1XFL A;  2GS3 A;  1O81 A;  1SJI A;  4WR4 A;  1SJZ A;  2JZT A;  3GFK A;  4POB A;  4ZBD A;  1EEJ A;  3EWL A;  2B7K A;  2GT6 A;  4V2L A;  3N5O A;  3G7J A;  1TP9 A;  2YP6 A;  2XPD A;  1TK0 B;  2IMI A;  4EO3 A;  4RUV A;  3UJ1 A;  3UAP A;  3VWX A;  1PQN A;  4EKZ A;  5D73 A;  2OAC A;  17GS A;  4WF5 A;  4YQU A;  3UBL A;  1WJK A;  2VM1 A;  5ELA A;  1PL2 A;  1B9Y C;  2VIM A;  1DE2 A;  1AC1 A;  4TW5 A;  1SYR A;  3Q19 A;  3SBC A;  2FY6 A;  2LQQ A;  5COH A;  3LGC A;  1F37 A;  2I9H A;  4KDY A;  3HD5 A;  1IYH A;  1V2A A;  1B4P A;  2HRN A;  1KNG A;  3ZFL A;  2H0H A;  3GUR A;  2B6M A;  2GT5 A;  5IOW A;  5HR2 A;  2CVB A;  12GS A;  4GWR A;  3P8W A;  2GVP A;  3L9U A;  1WWJ A;  1YQ1 A;  4IJ3 A;  1T00 A;  3UIW A;  3MSZ A;  2H6Y A;  2LUS A;  2MBS A;  2DLX A;  4TR0 A;  1A2L A;  2AHE A;  4MP4 A;  1J0F A;  2YN1 A;  16GS A;  1PN9 A;  2ZNM A;  1SL0 B;  4O5Q A;  2JZS A;  4EF0 A;  2DJ1 A;  2PMT A;  4EVM A;  2H6X A;  1GSD A;  1OAZ A;  3L0H A;  2LJR A;  3G7Y A;  1MEK A;  1AW9 A;  2YWM A;  3J7Y b;  1OC3 A;  4N0Z A;  3HJM A;  6GST A;  1ZYQ B;  2X64 A;  1XOB A;  4OWY A;  3U5R E;  1EWX A;  1H4O A;  2FWH A;  3I9V 2;  3QMX A;  2KP2 A;  4QQ7 A;  1ABA A;  4NHZ A;  1XIY A;  1MDI A;  5A5K A;  2C3T A;  2IFQ A;  4ICY A;  1O85 A;  2ON5 A;  2MMO A;  3IC4 A;  3SWL A;  4TR1 B;  2F3M A;  3H79 A;  4HJM A;  3EC3 A;  1MD4 A;  1XXU A;  3IV4 A;  1XWA A;  1PA3 A;  2PUK C;  2QSI A;  5CYY A;  2FGX A;  5J3R A;  3QAV A;  1YF0 A;  2X8G A;  2IJY A;  2TRC P;  4EDZ A;  4BVY A;  5G31 A;  3ZLP A;  1EP7 A;  5FWG A;  5CP1 A;  4V2M A;  1U3I A;  2X49 A;  3HVV A;  3EU3 A;  5ID2 B;  4KSO A;  2VO4 A;  4Q5R A;  2HYX A;  5BRT A;  2AJQ B;  1Z6M A;  3VPT A;  4OCE A;  5ECL B;  1RW1 A;  3C1R A;  3ERF A;  3QCP A;  2X8C A;  1EGO A;  3M0F A;  3TKS A;  2EIQ A;  1BYE A;  1ZYE A;  2GDR A;  4TXV A;  5B8A A;  4YAP A;  5DVB A;  3EU4 A;  5IMF A;  1A8L A;  3M9K A;  3GRX A;  3KXO A;  5G1K A;  4FH8 A;  5DAL A;  1A2J A;  5DCH A;  4WXT A;  2H8L A;  4FO5 A;  2YOI A;  3CRT A;  2GLR A;  2IMF A;  1JFU A;  4RQX A;  4PGT A;  2C0E A;  4DEJ A;  5E4W A;  5HQP A;  2QA1 A;  1XW6 A;  3P2A A;  1I9D A;  3VK9 A;  5JWO B;  1CQH A;  4K9Z A;  3FEU A;  4PUF C;  4F0C A;  3VFI A;  3VWW A;  4TXO B;  4X0X A;  4TOP A;  3CBU A;  4ZL8 A;  1JLW A;  4IEL A;  3CSJ A;  1SU9 A;  3IHG A;  2MMN A;  1S3A A;  4USS A;  2M72 A;  1CQG A;  5B7C A;  1AQW A;  4POK A;  2FCH A;  1NSW A;  4ZL7 A;  3KD0 A;  1BJX A;  1I5G A;  4FYU A;  3H4K A;  1PGT A;  1Q98 A;  2NTO A;  1V40 A;  1F3B A;  1O6J A;  4CW9 A;  3A2X A;  4IKH A;  5D93 A;  1VF2 A;  2YPM A;  3GA4 A;  1XCC A;  3F6D A;  3IAS 2;  1Z9H A;  1ON4 A;  1T8E B;  4NHW A;  4LA1 A;  1ST9 A;  3BCK A;  3F9U A;  3IA1 A;  2WRT A;  1EGR A;  3WT1 A;  1YY7 A;  2YWI A;  2CV4 A;  2AV4 A;  3D5J A;  4RI6 A;  4KX4 A;  1FVK A;  3F4T A;  2WCI A;  1SKW B;  1WE0 A;  1IYI A;  4ISD A;  1O73 A;  4AJ8 A;  3EIN A;  4HOJ A;  2FA4 A;  1W4V A;  1N2A A;  2EIR A;  2A2S A;  3ZL5 A;  4EUY A;  4IS0 A;  4I2U A;  5D9X A;  1ZZY A;  2LRC A;  3NIV A;  2R0C A;  2V6O A;  1EEM A;  1M9B A;  3DXB A;  3KIJ A;  3HYP A;  2RM5 A;  1N8J A;  1WOU A;  2HZE A;  3CSH A;  2CA8 A;  4LMV A;  4TRX A;  4X1U A;  2F8F A;  2H6Z A;  1A0F A;  1AUC A;  4FYB A;  5KN3 A;  2V41 A;  2PVQ A;  2LV3 A;  3TJJ A;  2P31 A;  5AGY A;  4OCF A;  1HQO A;  1V57 A;  1V98 A;  1XBS A;  1UC7 A;  4IHU A;  1UVZ A;  1PMT A;  4XTS A;  3DVW A;  4ECC A;  5IMA A;  2HFD A;  4NWY A;  4XCS A;  3KTB A;  2I81 A;  1DSB A;  4LLR A;  4OO5 A;  1QGV A;  4WEY A;  2E2M A;  1ERW A;  1JZO A;  3GYK A;  2HE3 A;  2ZCT A;  1FB6 A;  3TJK A;  3IAM 2;  3MIX A;  1FO5 A;  4TKY A;  1Y25 A;  4AGS A;  1S3D A;  1B9X C;  2DIY A;  1ACV A;  3ZVJ D;  1X5D A;  4EL1 A;  2HSY A;  2XC2 A;  1TDI A;  4MJA A;  1WRY A;  2CX3 A;  4EIP A;  3RAZ A;  1BED A;  4RQR A;  4WET A;  2JAC A;  4G0I A;  4KND A;  2H76 A;  3KTL A;  1ML6 A;  2RUF A;  2VD0 A;  2WJU A;  2LJA A;  5JCW A;  2H75 A;  3MYD A;  3UL3 A;  4F0B A;  2C8U A;  2H1D A;  3IK7 A;  1R5A A;  2RUE A;  1SL2 B;  3AY8 A;  4Z2U A;  3F3R A;  2FHE A;  5GZZ B;  14GS A;  3G7I A;  1FG4 A;  2D2Z A;  1SK1 A;  1XWK A;  1K0B A;  2DJJ A;  5KOX A;  1PSQ A;  1PX7 A;  3QOU A;  5J9C A;  3A3T A;  4PXO A;  3HDC A;  3APS A;  1EV4 A;  5JCU A;  19GS A;  3KP9 A;  3APQ A;  4HJ2 A;  2MBT A;  3FYG A;  5DAK A;  2VCZ A;  2DML A;  4IW9 A;  3A2V A;  4QL7 A;  1JLV A;  4Q5Q A;  5IMC A;  4DVC A;  2KOK A;  5D9V A;  1R7H A;  5FHI A;  1GWC A;  3K8N A;  3GKM A;  1THX A;  3TJB A;  1Z6N A;  2OA7 A;  5D9T A;  2A4H A;  3H8Q A;  4ZB9 A;  1YZX A;  1BX9 A;  1GSE A;  2ZUP A;  2YCD A;  3N9J A;  1SD8 A;  3ZTL A;  2GTU A;  1RK4 A;  5J4U A;  5HR3 A;  3TKS C;  1XWC A;  3HCZ A;  1TRS A;  1GLP A;  2L4Q A;  1E6B A;  3D4M A;  5ECS A;  5GSS A;  2VLU A;  3F4S A;  3DYR A;  2LTK A;  2V1M A;  3IK9 A;  2HNL A;  4NAX A;  5IMV A;  4GCI A;  1ZMA A;  5D9W A;  3E3E A;  1OVN A;  4D73 A;  3GKX A;  1GSS A;  1TJD A;  1BG5 A;  3DML A;  1KBN A;  4POL A;  3ZYW A;  2RM6 A;  1XPV A;  2YV9 A;  6GSY A;  4BWQ A;  4DSR A;  4EDY A;  3QR6 A;  4X4J A;  3KH9 A;  1EOG A;  2XBQ A;  4BVX A;  1E2Y A;  3FZA A;  2YV7 A;  3IC8 A;  2L5L A;  1G7O A;  3Q6O A;  4K8M A;  1UN2 A;  2IFQ B;  3LQ7 A;  3DRN A;  5ENU A;  3IXR A;  1XZO A;  2QGV A;  2XHF A;  2JSZ A;  3HJO A;  3GNJ A;  2PBJ A;  4CY8 A;  4K0N A;  2JAD A;  2MZC A;  3KMN A;  1GSY A;  2M46 A;  3VPQ A;  2L59 A;  2C4J A;  2I1U A;  1DE1 A;  3RHB A;  1FW1 A;  6GSS A;  1B4Q A;  2WS2 A;  3F6F A;  1K0C A;  4HEA 2;  3LYP A;  3F8U A;  4BVY B;  3IRA A;  4KF9 A;  2YWO A;  2YAN A;  4MF5 A;  5ECR B;  1A23 A;  5HFI A;  3KP8 A;  4N11 A;  5G2Z A;  1K3O A;  4O7H A;  2PVO C;  3HY2 A;  9GSS A;  4DSS A;  2CAQ A;  4PQI A;  1TW9 A;  4PUR A;  1GTU A;  4A5P A;  4ZBA A;  5CRH A;  3WGE A;  2LJK A;  1Z5Y E;  1X9S B;  4Z2R A;  3TKP A;  1WPI A;  2B5X A;  1NHO A;  4TR4 A;  2VOC A;  4JE1 A;  1K0D A;  1U87 A;  2AUV A;  2R5G A;  4G0K A;  4ZIJ A;  2O87 A;  5GST A;  5GAP D;  1M7T A;  2KUC A;  5DAL B;  4KB3 A;  4PQ1 A;  1URM A;  5LCZ A;  4F9Z A;  3E9J B;  1G7E A;  2L5O A;  2IMK A;  4MJC A;  1T4Z A;  1W89 A;  1XWB A;  1TXX A;  2B1L A;  5HFK A;  2O8V B;  4L0W A;  6GSV A;  5C04 A;  2QKE A;  3L4N A;  2VLT A;  3LXT A;  1PKW A;  2G2Q A;  1Q4J A;  1QMV A;  5B8B A;  3ED3 A;  3CMI A;  1ZYN A;  2RII A;  4V1A g;  4L8E A;  4GQF A;  1GRX A;  5E59 A;  1V58 A;  4HQZ A;  4F82 A;  1ERV A;  2JZR A;  4ML6 A;  3C73 A;  3GKK A;  4XS6 A;  2B5Y A;  5AIV A;  2R4V A;  5ECQ B;  5CRW A;  1AXD A;  5ECP B;  3GV1 A;  2GSR A;  18GS A;  1XW5 A;  5AN1 A;  4PNF A;  4AJ6 A;  3L9S A;  1AQX A;  4J2F A;  3EPT A;  1GUK A;  3P7X A;  5JWQ B;  4KE3 A;  22GS A;  1G6W A;  1LJR A;  4GLT A;  1B8X A;  2L6C A;  1GP1 A;  3WT2 A;  2IN3 A;  1WP0 A;  3O76 A;  2GQK A;  4K5R A;  3U6V A;  5IPG A;  2GQL A;  3RHC A;  2FLS A;  1GUL A;  2H19 A;  4ZIL A;  4KW6 A;  2WFC A;  3E0U A;  5J9B A;  3DKS A;  2C0G A;  5LNK e;  3EE2 A;  3D6I A;  2HRF A;  1PN0 A;  1JZR A;  1M0U A;  1GH2 A;  2DJ0 A;  1KEB A;  5FT3 A;  3HXS A;  2A4V A;  5ECI B;  1OC9 A;  3ZMK A;  1OKT A;  7GSS A;  2MMA A;  3I69 A;  1SJ6 A;  4K5S A;  2LRT A;  2MYG A;  3TKQ A;  3H93 A;  2VUP A;  1JHB A;  5KEJ A;  3VLN A;  2H0G A;  2YZU A;  3DIE A;  4YQM A;  3F4R A;  1OE7 A;  3UMA A;  4ZL9 A;  3ZIT A;  13GS A;  5ECK B;  5H5Q A;  2PPT A;  1M2D A;  2H72 A;  3DWV A;  5DJM A;  4Z2T A;  3GMF A;  3KGK A;  3RDW A;  1TTZ A;  4PTS A;  1TKD B;  2HZE B;  4MF7 A;  1FB0 A;  3D4T A;  3GSS A;  3WGD A;  4JBB A;  4K7I A;  3ZVJ A;  1G0T A;  4HU7 A;  1MTC A;  3KH7 A;  3R2Q A;  3LOR A;  4IP6 A;  3IE3 A;  3TDG A;  3A5I A;  3RPP A;  1JZW A;  2FWF A;  4HDE A;  1U6T A;  3G9B A;  4QL9 A;  2HT9 A;  4G2E A;  3MDK A;  4I8B A;  4MMM A;  1MDJ A;  4E8E A;  5GAN D;  1V9W A;  2L4C A;  4J57 E;  4EE0 A;  2IPA A;  4CDO A;  1QXH A;  4MH3 A;  3EMP A;  2VL9 A;  1X5E A;  2X4A A;  3C71 A;  4HS1 A;  5G1L A;  3BBY A;  2UZ8 A;  2NDO A;  3QFB C;  3V1W A;  3UBK A;  3VWU A;  1GSQ A;  2HRK A;  5EY6 A;  3ZML A;  2LNT A;  1FOV A;  1TRV A;  2C3Q A;  4MNN A;  6GSU A;  5D96 A;  1YJ6 A;  1PKZ A;  3QDN A;  1XW9 A;  4K7N A;  5LD0 A;  3O3T A;  4HZ2 A;  2R0G A;  2V2G A;  3GN3 A;  2E0Q A;  5EPF A;  3MWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...