4MZCA

Atomic resolution structure of pfgrx1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
106
structure length
105
Chain Sequence
EAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIENPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title Atomic resolution crystal structure of glutaredoxin 1 from Plasmodium falciparum and comparison with other glutaredoxins.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 37
structure length 105
sequence length 106
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mzcA00
1Z3EA 1C72A 3D4MA 3P8WA 1F37A 4HEA2 3C1RA 4EE0A 2YP6A 3C8EA 6GSYA 3MWHA 3TKSE 3EU3A 2WDUA 4ECIA 4ISDA 2DJJA 2HFDA 5H5RA 3VK9A 4KDUA 2CV4A 3MDKA 4JE1A 1XWGA 1V98A 1KNGA 1W4VA 2GSSA 2C80A 2JACA 4OO4A 3IHQA 4DEJA 1YQ1A 4MMMA 2AJQB 1RQMA 3I6AA 2M46A 1BYEA 2GT5A 1JZOA 4EDZA 2P31A 3TKSA 3UBLA 1TK0B 4IHUA 2XPEA 3A2XA 2H6XA 4RI7A 3EMXA 1VF2A 4MCUA 1T00A 2X8GA 3HJOA 6GSTA 5CRGA 1EV4A 5A4WA 1F6MC 6GSUA 2DMLA 2YOIA 2ALBA 2CX4A 4TXVA 4L8EA 2C4JA 1SYRA 2P5QA 1DE2A 3EINA 3GSSA 4HJMA 3ED3A 2QGVA 3GH9A 2DIYA 3HY2A 3FZ4A 3KP9A 3H1NA 2ZCTA 4GXZA 5IMZA 4OCFA 4I2UA 4MLYA 2YJHA 5A5KA 5DAKA 4I5QA 3N5OA 4V2MA 1G6WA 5EVOA 4DSSA 3WGEA 5CYYA 4K7OA 4GSNA 2C0GA 2C0FA 3O76A 3IE3A 5JCGA 2G2QA 1HD2A 1T4ZA 3P7XA 4EUYA 1SJ6A 4D73B 1THOA 2FY6A 1ST9A 2AV4A 1K0CA 3VI7A 2MMOA 3FR3A 2M72A 3APQA 1YY7A 2L4CA 2O8VB 4KDYA 1ABAA 3F4RA 1QUWA 2E0QA 2NTOA 4XRAA 1S3DA 2H1BA 1QFNA 9GSSA 4EKZA 1QMVA 5COHA 2IFQB 2RM6A 2C0EA 5C00A 5J9BA 2E7PA 2P0GA 4TVEA 4PX1A 4V2NA 2KP2A 3V1WA 2K18A 1QXHA 3CSIA 3VPTA 4HQZA 2C8UA 2QC7A 5JCUA 3G7JA 5KN3A 5JWRB 4YH2A 1FHEA 2WB9A 1AIUA 2K9FA 2LV3A 3IAM2 1G7OA 1O8XA 4MJCA 1OC3A 2YJ7A 2R4VA 2H1GA 3LQ7A 4YQUA 1SL2B 2NDOA 3LJRA 3JCML 1TXXA 2OE1A 1F3BA 2XPDA 4ILFA 4ECJA 4NV2A 3EVIA 1EGOA 4TKYA 4KAEA 3ERGA 4IP1A 4MH2A 1GSFA 3BCKA 4G19A 5LNKe 1JHBA 1GL8A 3CRTA 3IDVA 5ECQB 2VD0A 3O6TA 1ERWA 1PL2A 3K8NA 1VF1A 1WRYA 2VL2C 2REMA 4Z7XA 2C3NA 3TJKA 2H75A 2IMEA 4OO5A 1DE1A 1TU7A 4EVMA 4XRDA 4K8MA 1FVKA 4O7HA 4BVYA 4BA7A 2VCZA 5B6NA 1KBNA 1XWKA 2FCHA 3FR6A 4FYUA 1M7TA 5CRDA 1B9YC 4IELA 2L5OA 2LRCA 1LBKA 3IK9A 2X99A 2HT9A 2CZ2A 2B7JA 4D73A 2OACA 5ECPB 2B7KA 3HVVA 1CQHA 5CAXA 1PL1A 3DYRA 4MZWA 3J7Yb 3GFKA 1R7HA 2TRCP 1EOGA 1Z9HA 1R26A 3VWUA 3DRNA 3DEXA 1YKAA 2F8AA 3WYWA 2VAFA 4ULXA 1X9MB 2IJYA 3KTLA 1K0MA 2CT6A 3FHKA 4PNGA 1M2DA 2H0HA 4XS6A 2HE3A 4AJ6A 3U5RE 2IFQA 4HU9A 1R4WA 2FLSA 3BJ5A 2YWNA 3EC3A 4POMA 4WEYA 1WOUA 2V41A 1HNCA 2FWGA 1M2BA 3WT1A 2YCDA 2A4VA 1SK1A 3Q74A 1PN9A 4POLA 1O6JA 3D0ZA 4K0NA 1YZXA 4PGTA 3RBTA 3MSZA 1OYJA 2PMTA 3A2WA 3M3MA 1WWJA 3GIXA 4GLTA 2DBCA 2FHEA 2FWHA 1TW9A 4TOPA 2LUSA 3FZ9A 3KD0A 7GSSA 1ACVA 3ZTLA 1XBSA 3HYPA 3FW2A 2YZHA 4IS0A 2YANA 2YPMA 1AQWA 2FWFA 5F06A 3IK7A 4CHSA 2LSTA 4HZ4A 4QQ7A 1A2MA 4J57E 1YF1A 1NM3A 4RUVA 3PH9A 3KMNA 2DIZA 3NZNA 4AGSA 1X5EA 4OFNA 1F3AA 2BMXA 3R2QA 5DJMA 2IMDA 2LKUA 1TK8B 4L0WA 5DDLA 1GSYA 2I9HA 4TN8A 4EO3A 2LTKA 2CX3A 3UIWA 2OADA 1EZKA 4E8EA 1XWBA 3IC4A 3GYKA 4WF5A 5IMCA 4LL4B 4IJ3A 2R2JA 1NHYA 4ID0A 4HQSA 4X43A 3CTGA 2YV9A 5ECHB 2VLUA 4MF6A 4WR4A 1ML6A 3DKSA 2AYTA 2H1AA 4HU7A 18GSA 5ELAA 5IMAA 1B4PA 2R5GA 3APOA 2LNSA 4GQCA 3F6DA 2GSRA 3TRQA 4FYCA 4PUFC 11GSA 3FY7A 3QDNA 2X8HA 1Z7PA 1Y25A 4HDEA 2H01A 2GQKA 4YAVA 3IBHA 4ECCA 1M9BA 4MZCA 1ZOFA 3J7Yk 4LL1B 4PNFA 4H86A 2MMAA 5G31A 1JZDA 19GSA 3F0IA 1YF0A 1Z6NA 1K3YA 5DCHA 1QQ2A 1A2LA 2WCIA 3IR4A 1I5GA 3ZFBA 2OBKA 3DVWA 5INYA 5E59A 3CSJA 4F82A 3HKRA 2R6KA 2TRXA 4TRXA 3KM6A 1HNBA 5IO0A 4DSSB 3DD3A 2A2SA 4EC0A 4DSQA 1TK5B 1DBYA 5KN2A 4MF5A 2CZ3A 2CQ9A 5D73A 3W8JA 2YN1A 3F9UA 4TW5A 3GRXA 3BD2A 3EWLA 1GULA 2GLRA 4POKA 3GA4A 3LFLA 3QOUA 3TJGA 1JZWA 3EU4A 4YAPA 2PPTA 1PA3A 4LLRA 1U3AA 4CDOA 1KTEA 2V6KA 2VCQA 6GSSA 13GSA 3HA9A 5L71A 1Z7RA 3IPZA 5GZZB 1WP0A 2C1YA 1GNWA 4IP6A 4PQHA 4BPYA 2F8FA 2CA8A 1RK4A 2NVLA 1OVNA 3Q6OA 2VL9A 2PBJA 3TUEA 4FO5A 3HZ8A 5HR3A 2QKEA 2B5EA 3WD6A 1K0BA 5A4VA 1QK8A 5ECMB 4OMVA 1M0UA 2LNTA 5D9XA 5HR0A 1FAAA 1EEMA 4MA9A 1VGLA 2N5AA 4ZILA 3L4NA 1YDKA 1N2AA 4YQMA 1AW9A 4G9HA 1TRUA 1SL0B 2D2ZA 1Z6MA 1XIYA 1TI1A 5ABRA 2RIIA 1TKDB 2JL4A 4ZL9A 2MYGA 4WR5A 1SL1B 1XCCA 1PX7A 1VF4A 4IW9A 5H5QA 4PXOA 5HFIA 4PURA 1G6YA 2GQLA 4N0VA 4KNDA 4F2IA 4WF4A 3ME7A 4BL7A 2OJLA 4KA0A 17GSA 5F05A 1SJIA 3HVSA 2E2MA 4ZL8A 4KB3A 1WJKA 3LG6A 2F51A 1X9SB 4JRRA 1LJRA 2AAWA 1GH2A 4NMUA 4QL9A 1GLQA 2L5LA 1O81A 2GS3A 1T4YA 1K0AA 2RM5A 1GUKA 4NHZA 1TRVA 2OE3A 1ERVA 1MDJA 1X5CA 5CRWA 4KSMA 3GV1A 2FA8A 3L0HA 3GHAA 2VCTA 3PINA 4NWYA 4K1FA 2HZFA 3UBKA 4ZBBA 1J9BA 4OFMA 2VL2A 3WT2A 3GX8A 2F3MA 3L78A 3E9JB 1TRSA 2DJ1A 2AB6A 3VWWA 5CNWA 2A2RA 4CW9A 4NHWA 3DIEA 3S9FA 3MAKA 4L0UA 3H8QA 4ZXGA 1B4QA 2ON7A 3D21A 3LEFA 3DWVA 2PGTA 3VURA 1GNEA 14GSA 3QMXA 1UN2A 3ZVJD 2H71A 2OE0A 1SU9A 4TR4A 3QR6A 4MP4A 2X64A 4XHMA 2PU9C 1XWAA 1SKSB 4I97A 3QFAC 3E3EA 5GAPD 3M0FA 1FB0A 4EF0A 3E0UA 4KDXA 1XVWA 3QCPA 1MDIA 3M1GA 1ZYEA 3NIVA 3N9JA 3F3RA 3DMLA 2PVQA 5JCWA 2VO4A 2PUKC 1URMA 3ERWA 3M8NA 5HQPA 1FO5A 1G0TA 1WMJA 3H79A 5E4WA 2O7KA 1B8XA 3F63A 1PSQA 1Q98A 2YV7A 1XZOA 3HHVA 3AY8A 3GKKA 2DC5A 1GUMA 3KP8A 2PVOC 3KEBA 3HD5A 4JR4A 1FVJA 2XBIA 2Z9SA 3ZVJA 2LRNA 1SK2A 2LQOA 4RQXA 1OC9A 3HJPA 3FYGA 5FT3A 4MABA 3NOFA 10GSA 2RUFA 1GSUA 1HQOA 2HZEA 2GQMA 4GWRA 1XWCA 4JR6A 3UL3A 2I3YA 5D9VA 3OR5A 4WBRD 3TKQA 2MBSA 1MEKA 3H93A 1THXA 1JZRA 2JZTA 3UVHA 3KTBA 3U6VA 2J9HA 1MTCA 1AXDA 1O7UA 4EDYA 3ZL5A 2HRNA 3CBUA 3LGCA 1U6TA 4KGIA 1ZCPA 3RHCA 2WFCA 3M9KA 1ZL9A 5ELGA 4K7IA 2H6ZA 3HZ4A 3GH6A 4OD7A 1J08A 4O32A 3GNJA 4JU5A 3QAWA 3DVXA 1H4OA 4K9ZA 2MMZA 4V2LA 4FH8A 1T3BA 2IPAA 6GSWA 3F4SA 2K6VA 5ID2B 4WBJA 1JLVA 3KXOA 1TTZA 3VLNA 1JFUA 3EYTA 3ISOA 5CRHA 1R5AA 1GTUA 2LJAA 3ZIJA 4ZL7A 1R5PA 1TJDA 4PQ1A 1OKDA 4RQRA 2LJRA 3RPPA 3CRUA 1GSDA 5EPFA 2J23A 3QFBC 2XHFA 3A3TA 1O8WA 2WS2A 4MF7A 1AQXA 2N5BA 3LYPA 5G2ZA 4IGJA 1V40A 1BEDA 3A2VA 2OA7A 5ECKB 4MDCA 3CMIA 2CAQA 3SWLA 3TOUA 16GSA 1A8LA 3ZREA 2X8CA 2H0IA 4Q5FA 2EIRA 5G1LA 4X0XA 3EURA 5CP1A 1DUGA 1TU8A 5IMFA 4IJIA 1GTAA 6GSXA 3DXBA 5J9CA 3C73A 1K3OA 5J3RA 4MJBA 1YKCA 2V32A 1EWXA 4ZIJA 1V58A 3TJJA 3US3A 3ERFA 1IYIA 2PWJA 3L9UA 2JSYA 4NV5A 3UOMA 2PERA 1GRXA 4TR3A 4I2TA 5ECNB 1OC8A 1N8JA 4MJAA 3TGZA 2H73A 1MD4A 1XPVA 4ZB8A 4JZQA 1U88A 4MPGA 2DMMA 3QD9A 3FR9A 2H8LA 2GVPA 3C1SA 5DALB 3BBYA 5J41A 5GAND 4MPFA 4XTSA 5F0GA 2P5RA 3W8SA 2H30A 1GUHA 4ML1A 1U87A 2C3TA 3TRPA 3TKRA 2JADA 2LEGA 2XBQA 5G1KA 1K3LA 1UC7A 4IN0A 3HDCA 2VUPA 5ID2A 4AF2A 2DJ2A 3I9V2 4OWYA 2HSHA 1PQNA 2VOCA 5AN1A 4KW6A 5IQYA 4O92A 1T7PB 5HR2A 5AISA 4KCEA 4LMWA 2H0GA 4Q5QA 1M2AA 2LS5A 4TXOB 3KZQA 2H74A 2N5FA 5ECRB 4F0BA 1HNAA 4DVCA 4JBBA 2VM2A 4IQ1A 2EIQA 3MNGA 3TB2A 2H6YA 3GX0A 3RHBA 2B3SA 1A0RP 2HRFA 5IOXA 4ML6A 5CREA 3UEMA 2HYXA 5DQSA 3VFIA 5B6MA 2KP1A 4Q5RA 3F8UA 4GSTA 2QSIA 3HJMA 2CVBA 1O73A 3IRAA 1OAZA 1LU4A 5G5EA 1GP1A 3L9VA 4K0GA 2L59A 3IAS2 3KH7A 1U3IA 4V1Ap 4NAXA 3KCMA 1USBA 4MJEA 4ACSA 3LSZA 1SD9A 4N10A 1NW2A 2C0DA 2DSAA 2L6CA 4G10A 2CVKA 2MBTA 4NXIA 1XW5A 3GSTA 2NPBA 2EIOA 12GSA 5GSSA 1SENA 5D9WA 1ZGNA 4DSRA 5DALA 2R37A 3UMAA 2FGXA 1O85A 3Q18A 3APSA 2G0FA 4K7NA 1UA5A 1X0RA 2GTUA 3TDGA 1S3AA 4OFTA 3ZZXA 1F2EA 1K0DA 2KLXA 5B7CA 1SK0A 1ZMAA 2HI7A 1FG4A 1TOFA 2IWTA 5LCZA 2DJ0A 4KUNA 3TJFA 1A8YA 4BVXA 4TR1A 1YJ6A 3CXGA 5ECIB 3EE2A 2IMIA 3LWAA 1QGVA 3TJBA 5DQYA 3EMPA 1BG5A 3HCZA 5AGYA 1SD8A 1XFLA 1OC9B 2MZCA 4YQVA 4HI7A 5DBQA 3GL3A 3FZ5A 4GRFA 1YEXA 2IN3A 4HUAA 2HZEB 4TXOA 3C71A 1BJXA 5H5SA 3M9JA 2JZRA 3FEUA 1GSQA 2K8SA 4EXJA 5LD0A 4F9ZA 1HYUA 5IOWA 5IO2A 2DJKA 4OCEA 3KIJA 4KSOA 4L5OA 2LJKA 1G7EA 4HOJA 22GSA 2VCXA 3TKPA 3D5JA 4AJ8A 1F9MA 1PD21 2L4QA 3SBCA 3IXRA 2WZ9A 1MDKA 1GSEA 4ZB9A 3ZYWA 3PR8A 2B5XA 5EY6A 3GURA 3W6GA 3VPQA 5IM9A 2F9SA 1OE8A 3I69A 4MZBA 3TKSC 2ES7A 5JWQB 2R3XA 4K6XA 3LORA 4P3YB 1K0NA 2WRTA 1PRXA 3TOTA 2L57A 4N30A 3TRXA 1EGRA 3KJYA 2RUEA 4KCAA 1V2AA 2I4AA 3FRCA 20GSA 2VCWA 1TI3A 1BAYA 6GSVA 2KHPA 5G30A 4Q5NA 2BTOT 4IBPA 5FWGA 4HJ2A 3ME8A 1ILOA 3CYNA 2YWIA 5IMDA 1OE7A 4XIHA 1WE0A 5KEJA 3D4TA 5HFGA 1EEJA 2VIMA 3I43A 1EP7A 1GWCA 2MMNA 1AAZA 3WGXA 1B48A 3UVTA 3A5WA 1E2YA 3TCOA 1NHOA 2DJ3A 2GT6A 2H70A 1X9WB 3IV4A 3WGDA 4L5LA 2GZYA 4BWSA 4GCIA 2ZNMA 4GSSA 3PGTA 1PKZA 5KN1A 3RAZA 2IMKA 2YNXA 2OKAA 4TR0A 1A23A 4IVFA 1Z5YE 2KUCA 4FYBA 5DVBA 4KH7A 2HSYA 4I8BA 2JU5A 2VD1A 5GSTA 1V57A 2H1DA 3D6IA 1SKWB 1XOBA 2I81A 3ZMKA 4POBA 5A4UA 1XOAA 1T1VA 4MH3A 4HZ2A 4FIWA 2NBSA 3QPMA 1ON4A 1Q4JA 4X1UA 1A0FA 2GZPA 3ZMLA 1XVQA 5DJLA 2O87A 4GTUA 4XS4B 4J2FA 4WKWA 3QAVA 4MK3A 3F3QA 4F0CA 4QL7A 1XW9A 2OBIA 4ZBDA 3IOSA 2HLSA 4I6XA 4G2EA 2V2GA 3KH9A 3ZRDA 1W89A 1MD3A 3G7YA 5J4UA 4F03A 1EV9A 3FK8A 3KGKA 1I9DA 5FHIA 8GSSA 1GSSA 2YWOA 4IKHA 1PX6A 1VRSD 2IL3A 2FA4A 4LMVA 1CQGA 2ON5A 1XW6A 2O85A 3CSHA 1YEPA 3VWXA 2EC4A 1RW1A 1XXUA 4WXTA 2LQQA 4WETA 2AUVA 3GKNA 1GTIA 1TDIA 2TIRA 4XCSA 5IMVA 3LYKA 1M9AA 3HXSA 5J5NA 2B5YA 1BQ7A 1NSWA 1PGTA 3GL5A 3GMFA 5ENUA 2I1UA 2H72A 2AHEA 3GN3A 3HVXA 5CO3A 2B1KA 1SJZA 2BJXA 2CAIA 5F07A 3L9SA 3GKXA 2WGRA 1FW1A 5AIVA 1ERTA 1ERUA 3H4KA 3LXTA 2V1MA 4N0ZA 2VL3A 4PUAA 2FD3A 2HXKA 1ZZYA 5C04A 2H19A 1V9WA 2B6MA 2GDRA 3ZLPA 3ZFLA 2V6OA 2PN8A 3GTUB 3LXZA 1AUCA 2M80A 3RPNA 4AJ7A 3IA1A 4XS1A 1TRWA 1A24A 3UJ1A 3F6FA 2H66A 1E6BA 5D96A 2LRTA 5EL8A 2FWEA 5B8BA 3G9BA 5AIXA 2VLVA 1B9XC 4ZB6A 5D8IA 2GGTA 4KE3A 2CVDA 3BOAA 1FB6A 5KN0A 2FUG2 1BX9A 4XS4A 4E8HA 2B1LA 3F4TA 4EL1A 2WULA 3VWVA 1ZYQB 1S3CA 1GTBA 3DGQA 5IPHA 2L6DA 2YZUA 2IIYA 2HNLA 5IPGA 4ZBAA 2K8VA 2WJUA 3P2AA 3UARA 1DSBA 1T8EB 1JLWA 5F8BA 1TP9A 3O3TA 1PKWA 4N11A 5G5FA 4TR1B 2KOKA 2JZSA 1AC1A 5ECOB 3CTFA 2H76A 1J0FA 4PQIA 1K0OA 1SKRB 2VLTA 1M99A 4JEDA 2YWMA 3KMOA 5HR1A 4J56E 3P90A 2GZZA 3GKMA 5DCGA 1IYHA 2XC2A 5IIZA 1PMTA 3VI5A 4LA1A 5D93A 1EP8A 2O89A 5ECLB 1SYXA 4KX4A 1A2JA 4IQAA 3ZITA 3ZIVA 4GF0A 4V1Ag 1WPIA 4RI6A 2GSTA 3G7IA 5DAKB 1EOHA 5B8AA 2IMFA 2VCVA 3FZAA 5HFKA 3UAPA 2FNOA 3GTUA 1H75A 1OKTA 3D22A 4GQFA 1WIKA 2RLIA 1GLPA 1Y6EA 5ECSA 4K2DA 2C3QA 2ZUPA 4ECBA 3QAGA 4HS1A 3GUSA 2E2GA 4BWQA 1UVZA 2JSZA 1FOVA 1AQVA 3RDWA 5JWOB 2DLXA 3C7MA 1X5DA 3BCIA 2GSQA 5D9TA 1VF3A 3Q19A 2VM1A 4O5RA 4NPBA 1KEBA 3FKFA
chains in the Genus database with same CATH superfamily
1Z3EA 1C72A 3D4MA 3P8WA 1F37A 4HEA2 3C1RA 4EE0A 2YP6A 3C8EA 6GSYA 3MWHA 3TKSE 3EU3A 2WDUA 4ECIA 4ISDA 2DJJA 2HFDA 5H5RA 3VK9A 4KDUA 2CV4A 3MDKA 4JE1A 1XWGA 1V98A 1KNGA 1W4VA 2GSSA 2C80A 2JACA 4OO4A 3IHQA 4DEJA 1YQ1A 4MMMA 2AJQB 1RQMA 3I6AA 2M46A 1BYEA 2GT5A 1JZOA 4EDZA 2P31A 3TKSA 3UBLA 1TK0B 4IHUA 2XPEA 3A2XA 2H6XA 4RI7A 3EMXA 1VF2A 4MCUA 1T00A 2X8GA 3HJOA 6GSTA 5CRGA 1EV4A 5A4WA 1F6MC 6GSUA 2DMLA 2YOIA 1S3RA 2ALBA 2CX4A 4TXVA 4L8EA 2C4JA 1SYRA 2P5QA 1DE2A 3EINA 3GSSA 4HJMA 3ED3A 2QGVA 3GH9A 2DIYA 3HY2A 3FZ4A 3KP9A 3H1NA 2ZCTA 4GXZA 5IMZA 4OCFA 4I2UA 4MLYA 2YJHA 5A5KA 5DAKA 4I5QA 3N5OA 4V2MA 1G6WA 5EVOA 4BVYB 4DSSA 3WGEA 5CYYA 4K7OA 4GSNA 2C0GA 2C0FA 3O76A 3IE3A 5JCGA 2G2QA 1HD2A 1T4ZA 3P7XA 4EUYA 1SJ6A 4D73B 1THOA 2FY6A 1ST9A 2AV4A 1K0CA 3VI7A 2MMOA 3FR3A 2X49A 2M72A 3APQA 1YY7A 2L4CA 3PPUA 2O8VB 4KDYA 1ABAA 3F4RA 1QUWA 2E0QA 2NTOA 4XRAA 1S3DA 2H1BA 1QFNA 9GSSA 4EKZA 1QMVA 5COHA 2IFQB 2RM6A 2C0EA 5C00A 5J9BA 2E7PA 2P0GA 4TVEA 4PX1A 4V2NA 2KP2A 3V1WA 2K18A 1QXHA 3CSIA 3VPTA 4HQZA 2C8UA 2QC7A 5JCUA 3G7JA 5KN3A 5JWRB 4YH2A 1FHEA 2WB9A 1AIUA 2K9FA 2LV3A 3IAM2 1G7OA 1O8XA 4MJCA 1OC3A 2YJ7A 2R4VA 2H1GA 3LQ7A 4YQUA 1SL2B 2NDOA 3LJRA 3JCML 1TXXA 2OE1A 1F3BA 2XPDA 4ILFA 4ECJA 4NV2A 3EVIA 1EGOA 4TKYA 4KAEA 3ERGA 4IP1A 4MH2A 1GSFA 3BCKA 4G19A 5LNKe 1JHBA 1GL8A 3CRTA 3IDVA 5ECQB 2VD0A 3O6TA 1ERWA 1PL2A 3K8NA 1VF1A 1WRYA 2VL2C 2REMA 4Z7XA 2C3NA 3TJKA 2H75A 2IMEA 3IHGA 4OO5A 1DE1A 1TU7A 4EIQA 4EVMA 4XRDA 4K8MA 1FVKA 4O7HA 4BVYA 4BA7A 2VCZA 5B6NA 1KBNA 1XWKA 2FCHA 3FR6A 4FYUA 1M7TA 5CRDA 1B9YC 4IELA 2L5OA 2LRCA 1LBKA 3IK9A 2X99A 2HT9A 2CZ2A 2B7JA 4D73A 2OACA 5ECPB 2B7KA 3HVVA 1CQHA 5CAXA 1PL1A 3DYRA 4MZWA 3J7Yb 3GFKA 1R7HA 2TRCP 1EOGA 1Z9HA 1R26A 3VWUA 3DRNA 3DEXA 1YKAA 2F8AA 3WYWA 2VAFA 4ULXA 1X9MB 2IJYA 3KTLA 1K0MA 2CT6A 3FHKA 4PNGA 1M2DA 2H0HA 4XS6A 2HE3A 4AJ6A 3U5RE 2IFQA 4HU9A 1R4WA 4YKFA 2FLSA 3BJ5A 2YWNA 3EC3A 4POMA 4WEYA 1WOUA 2V41A 1HNCA 2FWGA 1M2BA 3WT1A 2YCDA 2A4VA 1SK1A 3Q74A 1PN9A 4POLA 1O6JA 3D0ZA 4K0NA 1YZXA 4PGTA 2QA1A 3RBTA 3MSZA 1OYJA 2PMTA 3A2WA 3M3MA 1WWJA 3GIXA 4GLTA 2DBCA 2FHEA 2FWHA 4MNNA 1TW9A 4TOPA 2LUSA 3FZ9A 3KD0A 7GSSA 1ACVA 3ZTLA 1XBSA 3HYPA 3FW2A 2YZHA 4IS0A 2YANA 2YPMA 1AQWA 2FWFA 5F06A 3IK7A 4CHSA 2LSTA 4HZ4A 3FMWA 4QQ7A 1A2MA 4J57E 1YF1A 1NM3A 4RUVA 3PH9A 3KMNA 2DIZA 3NZNA 4AGSA 1X5EA 4OFNA 1F3AA 2BMXA 3R2QA 5DJMA 2IMDA 2LKUA 1TK8B 4L0WA 5DDLA 5BMUA 1GSYA 2I9HA 4TN8A 4EO3A 2LTKA 2CX3A 3UIWA 2OADA 1EZKA 4E8EA 1XWBA 1XG8A 3IC4A 3GYKA 4WF5A 5IMCA 4LL4B 4IJ3A 2R2JA 1NHYA 4ID0A 4HQSA 4X43A 3CTGA 2YV9A 4KF9A 3MIXA 5ECHB 2VLUA 4MF6A 4WR4A 1ML6A 3DKSA 2AYTA 2H1AA 4HU7A 18GSA 5ELAA 5IMAA 1B4PA 2R5GA 3APOA 2LNSA 4GQCA 3F6DA 2GSRA 3TRQA 4FYCA 4PUFC 11GSA 3FY7A 3QDNA 2X8HA 1Z7PA 1Y25A 4HDEA 2H01A 2GQKA 4YAVA 3IBHA 4ECCA 1M9BA 4MZCA 1ZOFA 3J7Yk 4LL1B 4PNFA 4H86A 2MMAA 5G31A 1JZDA 19GSA 3F0IA 4BL7B 1YF0A 1Z6NA 1K3YA 5DCHA 1QQ2A 1A2LA 2WCIA 3IR4A 1I5GA 3ZFBA 2OBKA 3DVWA 5INYA 2R0GA 5E59A 3CSJA 4F82A 3HKRA 2R6KA 2TRXA 4G0LA 4TRXA 3KM6A 1HNBA 5IO0A 4DSSB 3DD3A 2A2SA 4EC0A 4DSQA 1TK5B 1DBYA 3LW9A 5KN2A 4MF5A 2CZ3A 2CQ9A 5D73A 3W8JA 2YN1A 3F9UA 4TW5A 3GRXA 3BD2A 3EWLA 1GULA 2GLRA 4POKA 3GA4A 3LFLA 3QOUA 3TJGA 1JZWA 3EU4A 4YAPA 2PPTA 1PA3A 4LLRA 1U3AA 4CDOA 1KTEA 2V6KA 2VCQA 6GSSA 13GSA 3HA9A 5L71A 1Z7RA 3IPZA 5GZZB 4K5RA 1WP0A 2C1YA 1GNWA 4IP6A 4PQHA 4BPYA 2F8FA 2CA8A 4G0IA 1RK4A 2NVLA 1OVNA 3Q6OA 2HSMA 2VL9A 1PFOA 2PBJA 3TUEA 4FO5A 3HZ8A 5HR3A 2QKEA 2B5EA 1FOHA 3WD6A 1K0BA 5A4VA 1QK8A 5ECMB 4OMVA 1M0UA 2LNTA 5D9XA 5HR0A 1FAAA 1EEMA 4MA9A 1VGLA 2N5AA 4ZILA 3L4NA 1YDKA 1N2AA 4YQMA 1AW9A 4G9HA 1TRUA 1SL0B 2D2ZA 1Z6MA 1XIYA 1TI1A 5ABRA 2RIIA 1TKDB 2JL4A 4ZL9A 2MYGA 4WR5A 1SL1B 1XCCA 1PX7A 1VF4A 4IW9A 5H5QA 4PXOA 5HFIA 4PURA 1G6YA 2GQLA 4N0VA 4KNDA 4F2IA 4WF4A 3ME7A 4BL7A 2OJLA 4KA0A 17GSA 5F05A 1SJIA 3HVSA 2E2MA 4ZL8A 4KB3A 1WJKA 3LG6A 2F51A 1X9SB 4JRRA 1LJRA 2AAWA 1GH2A 4NMUA 4QL9A 1GLQA 2L5LA 1O81A 2GS3A 1T4YA 1K0AA 2RM5A 1GUKA 4NHZA 1TRVA 2OE3A 1ERVA 1MDJA 1X5CA 5CRWA 4KSMA 3GV1A 2FA8A 3L0HA 3GHAA 2VCTA 3PINA 4NWYA 4K1FA 2HZFA 1PN0A 3UBKA 4ZBBA 1J9BA 4OFMA 2VL2A 3WT2A 3GX8A 2F3MA 3L78A 3E9JB 1TRSA 2DJ1A 2AB6A 3VWWA 2A2PA 5CNWA 2A2RA 4CW9A 4NHWA 3DIEA 3S9FA 3MAKA 4L0UA 3H8QA 4ZXGA 1B4QA 2ON7A 3D21A 3LEFA 3DWVA 2PGTA 3VURA 2R0CA 1GNEA 14GSA 3QMXA 1UN2A 3ZVJD 2H71A 2OE0A 1SU9A 4TR4A 3QR6A 4MP4A 2X64A 4XHMA 2PU9C 1XWAA 1SKSB 4I97A 3QFAC 3E3EA 5GAPD 3M0FA 3EPTA 1FB0A 4EF0A 3E0UA 4KDXA 1XVWA 3QCPA 1MDIA 3M1GA 1ZYEA 3NIVA 3R3EA 3HVNA 3N9JA 3F3RA 3DMLA 2PVQA 5JCWA 2VO4A 2PUKC 1URMA 3ERWA 3M8NA 5HQPA 1FO5A 1G0TA 1WMJA 3H79A 5E4WA 5KOWA 2O7KA 3MYDA 2DKHA 1B8XA 3F63A 3A5IA 1PSQA 1Q98A 2YV7A 2A4HA 1XZOA 4A5PA 3HHVA 3AY8A 3GKKA 2DC5A 1GUMA 3KP8A 2PVOC 3KEBA 3HD5A 4JR4A 1FVJA 2XBIA 2Z9SA 3ZVJA 2LRNA 1SK2A 2LQOA 4RQXA 1OC9A 3HJPA 3FYGA 5FT3A 4MABA 3NOFA 10GSA 2RUFA 1GSUA 1HQOA 2HZEA 2GQMA 4GWRA 1XWCA 4JR6A 3UL3A 2I3YA 5D9VA 3OR5A 4WBRD 3TKQA 2MBSA 1MEKA 3H93A 1THXA 1JZRA 2JZTA 3UVHA 3KTBA 3U6VA 2J9HA 1MTCA 1AXDA 1O7UA 4EDYA 3ZL5A 2HRNA 3CBUA 3LGCA 1U6TA 4KGIA 1ZCPA 3RHCA 2WFCA 3M9KA 1ZL9A 5ELGA 4K7IA 2H6ZA 3HZ4A 3GH6A 4OD7A 1J08A 4O32A 3GNJA 4JU5A 3QAWA 3DVXA 1H4OA 4K9ZA 2MMZA 2UZ8A 4V2LA 4FH8A 1T3BA 2IPAA 6GSWA 3F4SA 2K6VA 5ID2B 4WBJA 1JLVA 3KXOA 1TTZA 3VLNA 1JFUA 3EYTA 3ISOA 5CRHA 1R5AA 1GTUA 2LJAA 3ZIJA 4ZL7A 1R5PA 1TJDA 4PQ1A 1OKDA 4RQRA 2LJRA 3RPPA 3CRUA 1GSDA 5EPFA 2J23A 3QFBC 2XHFA 3A3TA 1O8WA 4MF7A 2WS2A 1AQXA 2N5BA 3LYPA 5G2ZA 4IGJA 1V40A 1BEDA 3A2VA 2OA7A 5ECKB 4MDCA 3CMIA 2CAQA 3SWLA 3TOUA 16GSA 1A8LA 3ZREA 2X8CA 2H0IA 4Q5FA 2EIRA 5G1LA 4X0XA 3EURA 5CP1A 1DUGA 1TU8A 5IMFA 4IJIA 1GTAA 6GSXA 3DXBA 5J9CA 3C73A 1K3OA 5J3RA 4MJBA 1YKCA 2V32A 1EWXA 4ZIJA 1V58A 3TJJA 3US3A 3ERFA 1IYIA 2PWJA 3L9UA 2JSYA 4NV5A 3UOMA 2PERA 1GRXA 4TR3A 4I2TA 5ECNB 1OC8A 1N8JA 4MJAA 3TGZA 2H73A 1MD4A 1XPVA 4ZB8A 4JZQA 1U88A 4MPGA 2DMMA 3QD9A 3FR9A 2H8LA 5BRTA 2GVPA 3C1SA 5DALB 4Z2UA 3BBYA 5J41A 5GAND 4MPFA 4XTSA 4HSCX 5F0GA 2P5RA 3W8SA 3IC8A 2H30A 1GUHA 4ML1A 1U87A 2C3TA 3TRPA 3TKRA 1M3IA 2JADA 4EIPA 2LEGA 4BVXB 2XBQA 5G1KA 1K3LA 4G0KA 1UC7A 4IN0A 3HDCA 2VUPA 5ID2A 4AF2A 2DJ2A 3I9V2 4OWYA 2HSHA 1PQNA 2VOCA 5AN1A 4KW6A 5IQYA 4O92A 1T7PB 5HR2A 5AISA 4KCEA 4LMWA 2H0GA 4Q5QA 1M2AA 2HRAA 2LS5A 4TXOB 3KZQA 2H74A 1ZYNA 2N5FA 5ECRB 4F0BA 1HNAA 4DVCA 4JBBA 2VM2A 4IQ1A 4Z2TA 2EIQA 3MNGA 3TB2A 2H6YA 3GX0A 3RHBA 2B3SA 1A0RP 4K5SA 2HRFA 5IOXA 4ML6A 5CREA 3UEMA 2HYXA 5DQSA 3VFIA 5B6MA 2KP1A 4Q5RA 3F8UA 4GSTA 2QSIA 3HJMA 2CVBA 4CY6A 1O73A 3IRAA 1OAZA 1LU4A 5G5EA 1GP1A 3L9VA 4K0GA 2L59A 3IAS2 3KH7A 1U3IA 4V1Ap 4NAXA 3KCMA 1USBA 4MJEA 4ACSA 3LSZA 1SD9A 4N10A 1NW2A 2C0DA 2DSAA 2L6CA 4G10A 2CVKA 2MBTA 4NXIA 1XW5A 3GSTA 2NPBA 4USSA 2EIOA 12GSA 5GSSA 1SENA 5D9WA 1ZGNA 4DSRA 5DALA 2R37A 3UMAA 2FGXA 1O85A 3Q18A 3APSA 2G0FA 4K7NA 1UA5A 1X0RA 2GTUA 3TDGA 1S3AA 4OFTA 3ZZXA 1F2EA 1K0DA 2KLXA 5B7CA 1SK0A 1ZMAA 2HI7A 1FG4A 1TOFA 2IWTA 5LCZA 2DJ0A 4KUNA 3TJFA 1A8YA 4BVXA 4O5UA 4Z2RA 4TR1A 1YJ6A 3CXGA 5ECIB 3EE2A 2IMIA 3LWAA 1QGVA 3TJBA 5DQYA 3EMPA 1BG5A 2X4AA 3HCZA 5AGYA 1SD8A 1XFLA 1OC9B 2MZCA 4YQVA 4HI7A 5DBQA 3GL3A 4X4JA 3FZ5A 4GRFA 1YEXA 2IN3A 4HUAA 2HZEB 4TXOA 3C71A 1BJXA 5H5SA 3M9JA 2JZRA 3FEUA 1GSQA 2K8SA 4EXJA 4ICYA 5LD0A 4F9ZA 1HYUA 5IOWA 5IO2A 2DJKA 4OCEA 3KIJA 4KSOA 4L5OA 1M3JA 2LJKA 1G7EA 4HOJA 22GSA 2VCXA 3TKPA 3D5JA 4AJ8A 1F9MA 1PD21 2L4QA 3SBCA 3IXRA 2WZ9A 1MDKA 1GSEA 4ZB9A 3ZYWA 3PR8A 2B5XA 5EY6A 3GURA 3W6GA 3VPQA 5IM9A 2F9SA 1OE8A 3I69A 4MZBA 3TKSC 2ES7A 5JWQB 2R3XA 4K6XA 3LORA 4P3YB 1K0NA 2WRTA 1PRXA 3TOTA 2L57A 4N30A 3TRXA 1EGRA 3KJYA 2RUEA 4KCAA 1V2AA 2I4AA 3FRCA 20GSA 2VCWA 1TI3A 1BAYA 6GSVA 2KHPA 5G30A 4Q5NA 2BTOT 4IBPA 5FWGA 4HJ2A 4BIKA 3ME8A 1ILOA 3CYNA 2YWIA 5IMDA 1ZYPA 1OE7A 4XIHA 1WE0A 5KEJA 3D4TA 5HFGA 2HRKA 1EEJA 2VIMA 3I43A 1EP7A 1GWCA 2QA2A 2MMNA 1AAZA 3WGXA 1B48A 3UVTA 3A5WA 1E2YA 3TCOA 1NHOA 2DJ3A 2GT6A 2H70A 1X9WB 3IV4A 3WGDA 4L5LA 2GZYA 4BWSA 4GCIA 2ZNMA 4GSSA 3PGTA 1PKZA 5KN1A 3RAZA 2IMKA 2YNXA 2OKAA 4TR0A 1A23A 4IVFA 1Z5YE 2KUCA 4FYBA 5DVBA 4KH7A 2HSYA 4I8BA 2JU5A 2VD1A 5GSTA 1V57A 2H1DA 3D6IA 1SKWB 1XOBA 2I81A 3ZMKA 5KOXA 4POBA 5A4UA 1XOAA 1T1VA 4MH3A 4HZ2A 4FIWA 2NBSA 3QPMA 1ON4A 1Q4JA 4X1UA 1A0FA 2GZPA 3ZMLA 1XVQA 5DJLA 2O87A 4GTUA 4XS4B 4J2FA 4WKWA 3QAVA 4MK3A 3F3QA 4F0CA 4QL7A 4K2XA 4PTSA 1XW9A 2OBIA 4ZBDA 4YKGA 3IOSA 2HLSA 4I6XA 4G2EA 2V2GA 3KH9A 3ZRDA 1W89A 1MD3A 3G7YA 5J4UA 4F03A 1EV9A 3FK8A 3KGKA 1I9DA 5FHIA 8GSSA 1GSSA 2YWOA 4IKHA 1PX6A 1VRSD 2IL3A 2FA4A 4LMVA 1CQGA 2ON5A 1XW6A 2O85A 3CSHA 1YEPA 3VWXA 2EC4A 3CQFA 1RW1A 1XXUA 4WXTA 2LQQA 4WETA 2AUVA 3GKNA 1GTIA 1TDIA 2TIRA 4XCSA 5IMVA 3LYKA 1M9AA 3HXSA 4FQUA 5J5NA 2B5YA 1BQ7A 1NSWA 1PGTA 3GL5A 3GMFA 5ENUA 2I1UA 2H72A 2AHEA 3GN3A 3HVXA 5CO3A 2B1KA 4CY8A 1SJZA 2BJXA 2CAIA 5F07A 3L9SA 3GKXA 2WGRA 1FW1A 5AIVA 1ERTA 1ERUA 3H4KA 3LXTA 2V1MA 4N0ZA 2VL3A 4PUAA 2FD3A 2HXKA 1ZZYA 5C04A 2H19A 1V9WA 2B6MA 2GDRA 3ZLPA 3ZFLA 2V6OA 2PN8A 3GTUB 3LXZA 1AUCA 2M80A 3RPNA 4AJ7A 3IA1A 4XS1A 1TRWA 1A24A 3UJ1A 3F6FA 2H66A 1E6BA 5D96A 2LRTA 5EL8A 2FWEA 5B8BA 3G9BA 5AIXA 2VLVA 1B9XC 4ZB6A 5D8IA 2GGTA 4KE3A 2CVDA 3BOAA 1FB6A 5KN0A 2FUG2 1BX9A 4XS4A 4E8HA 2B1LA 3F4TA 4EL1A 2WULA 3VWVA 1ZYQB 2R0PA 1S3CA 1GTBA 3DGQA 5IPHA 2L6DA 2YZUA 2IIYA 2HNLA 5IPGA 4ZBAA 2K8VA 2WJUA 3P2AA 3UARA 1DSBA 1T8EB 1JLWA 5F8BA 1TP9A 3O3TA 1PKWA 4N11A 5G5FA 4TR1B 2KOKA 2JZSA 1AC1A 5ECOB 3CTFA 2H76A 1J0FA 4PQIA 1K0OA 1SKRB 2VLTA 1M99A 4JEDA 2YWMA 3KMOA 5HR1A 4J56E 3P90A 2GZZA 3GKMA 5DCGA 1IYHA 2XC2A 5IIZA 1PMTA 3VI5A 4LA1A 5D93A 1EP8A 2O89A 5ECLB 1SYXA 4KX4A 1A2JA 4IQAA 3ZITA 3ZIVA 4GF0A 4V1Ag 1WPIA 4RI6A 2GSTA 4O5QA 3G7IA 5DAKB 1EOHA 5B8AA 2IMFA 2VCVA 3FZAA 5HFKA 3UAPA 2FNOA 3GTUA 1H75A 1OKTA 3D22A 4GQFA 1WIKA 2RLIA 1GLPA 1Y6EA 5ECSA 4K2DA 2C3QA 2ZUPA 4ECBA 3QAGA 4HS1A 3GUSA 2DKIA 2E2GA 4BWQA 1UVZA 2JSZA 1FOVA 1AQVA 3RDWA 5JWOB 2DLXA 3C7MA 1X5DA 3BCIA 2GSQA 5D9TA 1VF3A 3Q19A 2VM1A 4O5RA 4NPBA 1KEBA 3FKFA
chains in the Genus database with same CATH topology
1Z3EA 1C72A 3D4MA 3P8WA 1F37A 4HEA2 3C1RA 4EE0A 2YP6A 3C8EA 6GSYA 3MWHA 3TKSE 3EU3A 2WDUA 4ECIA 4ISDA 2DJJA 2HFDA 5H5RA 3VK9A 4KDUA 2CV4A 3MDKA 4JE1A 1XWGA 1V98A 1KNGA 1W4VA 2GSSA 2C80A 2JACA 4OO4A 3IHQA 4DEJA 1YQ1A 4MMMA 2AJQB 1RQMA 3I6AA 2M46A 1BYEA 2GT5A 1JZOA 4EDZA 2P31A 3TKSA 3UBLA 1TK0B 4IHUA 2XPEA 3A2XA 2H6XA 4RI7A 3EMXA 1VF2A 4MCUA 1T00A 2X8GA 3HJOA 6GSTA 5CRGA 1EV4A 5A4WA 1F6MC 6GSUA 2DMLA 2YOIA 2ALBA 2CX4A 4TXVA 4L8EA 2C4JA 1SYRA 2P5QA 1DE2A 3EINA 3GSSA 4HJMA 3ED3A 2QGVA 3GH9A 2DIYA 3HY2A 3FZ4A 3KP9A 3H1NA 2ZCTA 4GXZA 5IMZA 4OCFA 4I2UA 4MLYA 2YJHA 5A5KA 5DAKA 4I5QA 3N5OA 4V2MA 1G6WA 5EVOA 4BVYB 4DSSA 3WGEA 5CYYA 4K7OA 4GSNA 2C0GA 2C0FA 3O76A 3IE3A 5JCGA 2G2QA 1HD2A 1T4ZA 3P7XA 4EUYA 1SJ6A 4D73B 1THOA 2FY6A 1ST9A 2AV4A 1K0CA 3VI7A 2MMOA 3FR3A 2X49A 2M72A 3APQA 1YY7A 2L4CA 3PPUA 2O8VB 4KDYA 1ABAA 3F4RA 1QUWA 2E0QA 2NTOA 4XRAA 1S3DA 2H1BA 1QFNA 9GSSA 4EKZA 1QMVA 5COHA 2IFQB 2RM6A 2C0EA 5C00A 5J9BA 2E7PA 2P0GA 4TVEA 4PX1A 4V2NA 2KP2A 3V1WA 2K18A 1QXHA 3CSIA 3VPTA 4HQZA 2C8UA 2QC7A 5JCUA 3G7JA 5KN3A 5JWRB 4YH2A 1FHEA 2WB9A 1AIUA 2K9FA 2LV3A 3IAM2 1G7OA 1O8XA 4MJCA 1OC3A 2YJ7A 2R4VA 2H1GA 3LQ7A 4YQUA 1SL2B 2NDOA 3LJRA 3JCML 1TXXA 2OE1A 1F3BA 2XPDA 4ILFA 4ECJA 4NV2A 3EVIA 1EGOA 4TKYA 4KAEA 3ERGA 4IP1A 4MH2A 1GSFA 3BCKA 4G19A 5LNKe 1JHBA 1GL8A 3CRTA 3IDVA 5ECQB 2VD0A 3O6TA 1ERWA 1PL2A 3K8NA 1VF1A 1WRYA 2VL2C 2REMA 4Z7XA 2C3NA 3TJKA 2H75A 2IMEA 3IHGA 4OO5A 1DE1A 1TU7A 4EIQA 4EVMA 4XRDA 4K8MA 1FVKA 4O7HA 4BVYA 4BA7A 2VCZA 5B6NA 1KBNA 1XWKA 2FCHA 3FR6A 4FYUA 1M7TA 5CRDA 1B9YC 4IELA 2L5OA 2LRCA 1LBKA 3IK9A 2X99A 2HT9A 2CZ2A 2B7JA 4D73A 2OACA 5ECPB 2B7KA 3HVVA 1CQHA 5CAXA 1PL1A 3DYRA 4MZWA 3J7Yb 3GFKA 1R7HA 2TRCP 1EOGA 1Z9HA 1R26A 3VWUA 3DRNA 3DEXA 1YKAA 2F8AA 3WYWA 2VAFA 4ULXA 1X9MB 2IJYA 3KTLA 1K0MA 2CT6A 3FHKA 4PNGA 1M2DA 2H0HA 4XS6A 2HE3A 4AJ6A 3U5RE 2IFQA 4HU9A 1R4WA 4YKFA 2FLSA 3BJ5A 2YWNA 3EC3A 4POMA 4WEYA 1WOUA 2V41A 1HNCA 2FWGA 1M2BA 3WT1A 2YCDA 2A4VA 1SK1A 3Q74A 1PN9A 4POLA 1O6JA 3D0ZA 4K0NA 1YZXA 4PGTA 2QA1A 3RBTA 3MSZA 1OYJA 2PMTA 3A2WA 3M3MA 1WWJA 3GIXA 4GLTA 2DBCA 2FHEA 2FWHA 4MNNA 1TW9A 4TOPA 2LUSA 3FZ9A 3KD0A 7GSSA 1ACVA 3ZTLA 1XBSA 3HYPA 3FW2A 2YZHA 4IS0A 2YANA 2YPMA 1AQWA 2FWFA 5F06A 3IK7A 4CHSA 2LSTA 4HZ4A 3FMWA 4QQ7A 1A2MA 4J57E 1YF1A 1NM3A 4RUVA 3PH9A 3KMNA 2DIZA 3NZNA 4AGSA 1X5EA 4OFNA 1F3AA 2BMXA 3R2QA 5DJMA 2IMDA 2LKUA 1TK8B 4L0WA 5DDLA 5BMUA 1GSYA 2I9HA 4TN8A 4EO3A 2LTKA 2CX3A 3UIWA 2OADA 1EZKA 4E8EA 1XWBA 3IC4A 3GYKA 4WF5A 5IMCA 4LL4B 4IJ3A 2R2JA 1NHYA 4ID0A 4HQSA 4X43A 3CTGA 2YV9A 4KF9A 3MIXA 5ECHB 2VLUA 4MF6A 4WR4A 1ML6A 3DKSA 2AYTA 2H1AA 4HU7A 18GSA 5ELAA 5IMAA 1B4PA 2R5GA 3APOA 2LNSA 4GQCA 3F6DA 2GSRA 3TRQA 4FYCA 4PUFC 11GSA 3FY7A 3QDNA 2X8HA 1Z7PA 1Y25A 4HDEA 2H01A 2GQKA 4YAVA 3IBHA 4ECCA 1M9BA 4MZCA 1ZOFA 3J7Yk 4LL1B 4PNFA 4H86A 2MMAA 5G31A 1JZDA 19GSA 3F0IA 4BL7B 1YF0A 1Z6NA 1K3YA 5DCHA 1QQ2A 1A2LA 2WCIA 3IR4A 1I5GA 3ZFBA 2OBKA 3DVWA 5INYA 2R0GA 5E59A 3CSJA 4F82A 3HKRA 2R6KA 2TRXA 4G0LA 4TRXA 3KM6A 1HNBA 5IO0A 4DSSB 3DD3A 2A2SA 4EC0A 4DSQA 1TK5B 1DBYA 3LW9A 5KN2A 4MF5A 2CZ3A 2CQ9A 5D73A 3W8JA 2YN1A 3F9UA 4TW5A 3GRXA 3BD2A 3EWLA 1GULA 2GLRA 4POKA 3GA4A 3LFLA 3QOUA 3TJGA 1JZWA 3EU4A 4YAPA 2PPTA 1PA3A 4LLRA 1U3AA 4CDOA 1KTEA 2V6KA 2VCQA 6GSSA 13GSA 3HA9A 5L71A 1Z7RA 3IPZA 5GZZB 4K5RA 1WP0A 2C1YA 1GNWA 4IP6A 4PQHA 4BPYA 2F8FA 2CA8A 4G0IA 1RK4A 2NVLA 1OVNA 3Q6OA 2HSMA 2VL9A 2PBJA 3TUEA 4FO5A 3HZ8A 5HR3A 2QKEA 2B5EA 1FOHA 3WD6A 1K0BA 5A4VA 1QK8A 5ECMB 4OMVA 1M0UA 2LNTA 5D9XA 5HR0A 1FAAA 1EEMA 4MA9A 1VGLA 2N5AA 4ZILA 3L4NA 1YDKA 1N2AA 4YQMA 1AW9A 4G9HA 1TRUA 1SL0B 2D2ZA 1Z6MA 1XIYA 1TI1A 5ABRA 2RIIA 1TKDB 2JL4A 4ZL9A 2MYGA 4WR5A 1SL1B 1XCCA 1PX7A 1VF4A 4IW9A 5H5QA 4PXOA 5HFIA 4PURA 1G6YA 2GQLA 4N0VA 4KNDA 4F2IA 4WF4A 3ME7A 4BL7A 2OJLA 4KA0A 17GSA 5F05A 1SJIA 3HVSA 2E2MA 4ZL8A 4KB3A 1WJKA 3LG6A 2F51A 1X9SB 4JRRA 1LJRA 2AAWA 1GH2A 4NMUA 4QL9A 1GLQA 2L5LA 1O81A 2GS3A 1T4YA 1K0AA 2RM5A 1GUKA 4NHZA 1TRVA 2OE3A 1ERVA 1MDJA 1X5CA 5CRWA 4KSMA 3GV1A 2FA8A 3L0HA 3GHAA 2VCTA 3PINA 4NWYA 4K1FA 2HZFA 1PN0A 3UBKA 4ZBBA 1J9BA 4OFMA 2VL2A 3WT2A 3GX8A 2F3MA 3L78A 3E9JB 1TRSA 2DJ1A 2AB6A 3VWWA 2A2PA 5CNWA 2A2RA 4CW9A 4NHWA 3DIEA 3S9FA 3MAKA 4L0UA 3H8QA 4ZXGA 1B4QA 2ON7A 3D21A 3LEFA 3DWVA 2PGTA 3VURA 2R0CA 1GNEA 14GSA 3QMXA 1UN2A 3ZVJD 2H71A 2OE0A 1SU9A 4TR4A 3QR6A 4MP4A 2X64A 4XHMA 2PU9C 1XWAA 1SKSB 4I97A 3QFAC 3E3EA 5GAPD 3M0FA 3EPTA 1FB0A 4EF0A 3E0UA 4KDXA 1XVWA 3QCPA 1MDIA 3M1GA 1ZYEA 3NIVA 3R3EA 3N9JA 3F3RA 3DMLA 2PVQA 5JCWA 2VO4A 2PUKC 1URMA 3ERWA 3M8NA 5HQPA 1FO5A 1G0TA 1WMJA 3H79A 5E4WA 5KOWA 2O7KA 3MYDA 2DKHA 1B8XA 3F63A 3A5IA 1PSQA 1Q98A 2YV7A 2A4HA 1XZOA 4A5PA 3HHVA 3AY8A 3GKKA 2DC5A 1GUMA 3KP8A 2PVOC 3KEBA 3HD5A 4JR4A 1FVJA 2XBIA 2Z9SA 3ZVJA 2LRNA 1SK2A 2LQOA 4RQXA 1OC9A 3HJPA 3FYGA 5FT3A 4MABA 3NOFA 10GSA 2RUFA 1GSUA 1HQOA 2HZEA 2GQMA 4GWRA 1XWCA 4JR6A 3UL3A 2I3YA 5D9VA 3OR5A 4WBRD 3TKQA 2MBSA 1MEKA 3H93A 1THXA 1JZRA 2JZTA 3UVHA 3KTBA 3U6VA 2J9HA 1MTCA 1AXDA 1O7UA 4EDYA 3ZL5A 2HRNA 3CBUA 3LGCA 1U6TA 4KGIA 1ZCPA 3RHCA 2WFCA 3M9KA 1ZL9A 5ELGA 4K7IA 2H6ZA 3HZ4A 3GH6A 4OD7A 1J08A 4O32A 3GNJA 4JU5A 3QAWA 3DVXA 1H4OA 4K9ZA 2MMZA 2UZ8A 4V2LA 4FH8A 1T3BA 2IPAA 6GSWA 3F4SA 2K6VA 5ID2B 4WBJA 1JLVA 3KXOA 1TTZA 3VLNA 1JFUA 3EYTA 3ISOA 5CRHA 1R5AA 1GTUA 2LJAA 3ZIJA 4ZL7A 1R5PA 1TJDA 4PQ1A 1OKDA 4RQRA 2LJRA 3RPPA 3CRUA 1GSDA 5EPFA 2J23A 3QFBC 2XHFA 3A3TA 1O8WA 4MF7A 2WS2A 1AQXA 2N5BA 3LYPA 5G2ZA 4IGJA 1V40A 1BEDA 3A2VA 2OA7A 5ECKB 4MDCA 3CMIA 2CAQA 3SWLA 3TOUA 16GSA 1A8LA 3ZREA 2X8CA 2H0IA 4Q5FA 2EIRA 5G1LA 4X0XA 3EURA 5CP1A 1DUGA 1TU8A 5IMFA 4IJIA 1GTAA 6GSXA 3DXBA 5J9CA 3C73A 1K3OA 5J3RA 4MJBA 1YKCA 2V32A 1EWXA 4ZIJA 1V58A 3TJJA 3US3A 3ERFA 1IYIA 2PWJA 3L9UA 2JSYA 4NV5A 3UOMA 2PERA 1GRXA 4TR3A 4I2TA 5ECNB 1OC8A 1N8JA 4MJAA 3TGZA 2H73A 1MD4A 1XPVA 4ZB8A 4JZQA 1U88A 4MPGA 2DMMA 3QD9A 3FR9A 2H8LA 5BRTA 2GVPA 3C1SA 5DALB 4Z2UA 3BBYA 5J41A 5GAND 4MPFA 4XTSA 5F0GA 2P5RA 3W8SA 3IC8A 2H30A 1GUHA 4ML1A 1U87A 2C3TA 3TRPA 3TKRA 2JADA 4EIPA 2LEGA 4BVXB 2XBQA 5G1KA 1K3LA 4G0KA 1UC7A 4IN0A 3HDCA 2VUPA 5ID2A 4AF2A 2DJ2A 3I9V2 4OWYA 2HSHA 1PQNA 2VOCA 5AN1A 4KW6A 5IQYA 4O92A 1T7PB 5HR2A 5AISA 4KCEA 4LMWA 2H0GA 4Q5QA 1M2AA 2HRAA 2LS5A 4TXOB 3KZQA 2H74A 1ZYNA 2N5FA 5ECRB 4F0BA 1HNAA 4DVCA 4JBBA 2VM2A 4IQ1A 4Z2TA 2EIQA 3MNGA 3TB2A 2H6YA 3GX0A 3RHBA 2B3SA 1A0RP 4K5SA 2HRFA 5IOXA 4ML6A 5CREA 3UEMA 2HYXA 5DQSA 3VFIA 5B6MA 2KP1A 4Q5RA 3F8UA 4GSTA 2QSIA 3HJMA 2CVBA 4CY6A 1O73A 3IRAA 1OAZA 1LU4A 5G5EA 1GP1A 3L9VA 4K0GA 2L59A 3IAS2 3KH7A 1U3IA 4V1Ap 4NAXA 3KCMA 1USBA 4MJEA 4ACSA 3LSZA 1SD9A 4N10A 1NW2A 2C0DA 2DSAA 2L6CA 4G10A 2CVKA 2MBTA 4NXIA 1XW5A 3GSTA 2NPBA 4USSA 2EIOA 12GSA 5GSSA 1SENA 5D9WA 1ZGNA 4DSRA 5DALA 2R37A 3UMAA 2FGXA 1O85A 3Q18A 3APSA 2G0FA 4K7NA 1UA5A 1X0RA 2GTUA 3TDGA 1S3AA 4OFTA 3ZZXA 1F2EA 1K0DA 2KLXA 5B7CA 1SK0A 1ZMAA 2HI7A 1FG4A 1TOFA 2IWTA 5LCZA 2DJ0A 4KUNA 3TJFA 1A8YA 4BVXA 4O5UA 4Z2RA 4TR1A 1YJ6A 3CXGA 5ECIB 3EE2A 2IMIA 3LWAA 1QGVA 3TJBA 5DQYA 3EMPA 1BG5A 2X4AA 3HCZA 5AGYA 1SD8A 1XFLA 1OC9B 2MZCA 4YQVA 4HI7A 5DBQA 3GL3A 4X4JA 3FZ5A 4GRFA 1YEXA 2IN3A 4HUAA 2HZEB 4TXOA 3C71A 1BJXA 5H5SA 3M9JA 2JZRA 3FEUA 1GSQA 2K8SA 4EXJA 4ICYA 5LD0A 4F9ZA 1HYUA 5IOWA 5IO2A 2DJKA 4OCEA 3KIJA 4KSOA 4L5OA 2LJKA 1G7EA 4HOJA 22GSA 2VCXA 3TKPA 3D5JA 4AJ8A 1F9MA 1PD21 2L4QA 3SBCA 3IXRA 2WZ9A 1MDKA 1GSEA 4ZB9A 3ZYWA 3PR8A 2B5XA 5EY6A 3GURA 3W6GA 3VPQA 5IM9A 2F9SA 1OE8A 3I69A 4MZBA 3TKSC 2ES7A 5JWQB 2R3XA 4K6XA 3LORA 4P3YB 1K0NA 2WRTA 1PRXA 3TOTA 2L57A 4N30A 3TRXA 1EGRA 3KJYA 2RUEA 4KCAA 1V2AA 2I4AA 3FRCA 20GSA 2VCWA 1TI3A 1BAYA 6GSVA 2KHPA 5G30A 4Q5NA 2BTOT 4IBPA 5FWGA 4HJ2A 3ME8A 1ILOA 3CYNA 2YWIA 5IMDA 1ZYPA 1OE7A 4XIHA 1WE0A 5KEJA 3D4TA 5HFGA 2HRKA 1EEJA 2VIMA 3I43A 1EP7A 1GWCA 2QA2A 2MMNA 1AAZA 3WGXA 1B48A 3UVTA 3A5WA 1E2YA 3TCOA 1NHOA 2DJ3A 2GT6A 2H70A 1X9WB 3IV4A 3WGDA 4L5LA 2GZYA 4BWSA 4GCIA 2ZNMA 4GSSA 3PGTA 1PKZA 5KN1A 3RAZA 2IMKA 2YNXA 2OKAA 4TR0A 1A23A 4IVFA 1Z5YE 2KUCA 4FYBA 5DVBA 4KH7A 2HSYA 4I8BA 2JU5A 2VD1A 5GSTA 1V57A 2H1DA 3D6IA 1SKWB 1XOBA 2I81A 3ZMKA 5KOXA 4POBA 5A4UA 1XOAA 1T1VA 4MH3A 4HZ2A 4FIWA 2NBSA 3QPMA 1ON4A 1Q4JA 4X1UA 1A0FA 2GZPA 3ZMLA 1XVQA 5DJLA 2O87A 4GTUA 4XS4B 4J2FA 4WKWA 3QAVA 4MK3A 3F3QA 4F0CA 4QL7A 4K2XA 4PTSA 1XW9A 2OBIA 4ZBDA 4YKGA 3IOSA 2HLSA 4I6XA 4G2EA 2V2GA 3KH9A 3ZRDA 1W89A 1MD3A 3G7YA 5J4UA 4F03A 1EV9A 3FK8A 3KGKA 1I9DA 5FHIA 8GSSA 1GSSA 2YWOA 4IKHA 1PX6A 1VRSD 2IL3A 2FA4A 4LMVA 1CQGA 2ON5A 1XW6A 2O85A 3CSHA 1YEPA 3VWXA 2EC4A 1RW1A 1XXUA 4WXTA 2LQQA 4WETA 2AUVA 3GKNA 1GTIA 1TDIA 2TIRA 4XCSA 5IMVA 3LYKA 1M9AA 3HXSA 4FQUA 5J5NA 2B5YA 1BQ7A 1NSWA 1PGTA 3GL5A 3GMFA 5ENUA 2I1UA 2H72A 2AHEA 3GN3A 3HVXA 5CO3A 2B1KA 4CY8A 1SJZA 2BJXA 2CAIA 5F07A 3L9SA 3GKXA 2WGRA 1FW1A 5AIVA 1ERTA 1ERUA 3H4KA 3LXTA 2V1MA 4N0ZA 2VL3A 4PUAA 2FD3A 2HXKA 1ZZYA 5C04A 2H19A 1V9WA 2B6MA 2GDRA 3ZLPA 3ZFLA 2V6OA 2PN8A 3GTUB 3LXZA 1AUCA 2M80A 3RPNA 4AJ7A 3IA1A 4XS1A 1TRWA 1A24A 3UJ1A 3F6FA 2H66A 1E6BA 5D96A 2LRTA 5EL8A 2FWEA 5B8BA 3G9BA 5AIXA 2VLVA 1B9XC 4ZB6A 5D8IA 2GGTA 4KE3A 2CVDA 3BOAA 1FB6A 5KN0A 2FUG2 1BX9A 4XS4A 4E8HA 2B1LA 3F4TA 4EL1A 2WULA 3VWVA 1ZYQB 2R0PA 1S3CA 1GTBA 3DGQA 5IPHA 2L6DA 2YZUA 2IIYA 2HNLA 5IPGA 4ZBAA 2K8VA 2WJUA 3P2AA 3UARA 1DSBA 1T8EB 1JLWA 5F8BA 1TP9A 3O3TA 1PKWA 4N11A 5G5FA 4TR1B 2KOKA 2JZSA 1AC1A 5ECOB 3CTFA 2H76A 1J0FA 4PQIA 1K0OA 1SKRB 2VLTA 1M99A 4JEDA 2YWMA 3KMOA 5HR1A 4J56E 3P90A 2GZZA 3GKMA 5DCGA 1IYHA 2XC2A 5IIZA 1PMTA 3VI5A 4LA1A 5D93A 1EP8A 2O89A 5ECLB 1SYXA 4KX4A 1A2JA 4IQAA 3ZITA 3ZIVA 4GF0A 4V1Ag 1WPIA 4RI6A 2GSTA 4O5QA 3G7IA 5DAKB 1EOHA 5B8AA 2IMFA 2VCVA 3FZAA 5HFKA 3UAPA 2FNOA 3GTUA 1H75A 1OKTA 3D22A 4GQFA 1WIKA 2RLIA 1GLPA 1Y6EA 5ECSA 4K2DA 2C3QA 2ZUPA 4ECBA 3QAGA 4HS1A 3GUSA 2DKIA 2E2GA 4BWQA 1UVZA 2JSZA 1FOVA 1AQVA 3RDWA 5JWOB 2DLXA 3C7MA 1X5DA 3BCIA 2GSQA 5D9TA 1VF3A 3Q19A 2VM1A 4O5RA 4NPBA 1KEBA 3FKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3E A;  1C72 A;  3D4M A;  3P8W A;  1F37 A;  4HEA 2;  3C1R A;  4EE0 A;  2YP6 A;  3C8E A;  6GSY A;  3MWH A;  3TKS E;  3EU3 A;  2WDU A;  4ECI A;  4ISD A;  2DJJ A;  2HFD A;  5H5R A;  3VK9 A;  4KDU A;  2CV4 A;  3MDK A;  4JE1 A;  1XWG A;  1V98 A;  1KNG A;  1W4V A;  2GSS A;  2C80 A;  2JAC A;  4OO4 A;  3IHQ A;  4DEJ A;  1YQ1 A;  4MMM A;  2AJQ B;  1RQM A;  3I6A A;  2M46 A;  1BYE A;  2GT5 A;  1JZO A;  4EDZ A;  2P31 A;  3TKS A;  3UBL A;  1TK0 B;  4IHU A;  2XPE A;  3A2X A;  2H6X A;  4RI7 A;  3EMX A;  1VF2 A;  4MCU A;  1T00 A;  2X8G A;  3HJO A;  6GST A;  5CRG A;  1EV4 A;  5A4W A;  1F6M C;  6GSU A;  2DML A;  2YOI A;  2ALB A;  2CX4 A;  4TXV A;  4L8E A;  2C4J A;  1SYR A;  2P5Q A;  1DE2 A;  3EIN A;  3GSS A;  4HJM A;  3ED3 A;  2QGV A;  3GH9 A;  2DIY A;  3HY2 A;  3FZ4 A;  3KP9 A;  3H1N A;  2ZCT A;  4GXZ A;  5IMZ A;  4OCF A;  4I2U A;  4MLY A;  2YJH A;  5A5K A;  5DAK A;  4I5Q A;  3N5O A;  4V2M A;  1G6W A;  5EVO A;  4DSS A;  3WGE A;  5CYY A;  4K7O A;  4GSN A;  2C0G A;  2C0F A;  3O76 A;  3IE3 A;  5JCG A;  2G2Q A;  1HD2 A;  1T4Z A;  3P7X A;  4EUY A;  1SJ6 A;  4D73 B;  1THO A;  2FY6 A;  1ST9 A;  2AV4 A;  1K0C A;  3VI7 A;  2MMO A;  3FR3 A;  2M72 A;  3APQ A;  1YY7 A;  2L4C A;  2O8V B;  4KDY A;  1ABA A;  3F4R A;  1QUW A;  2E0Q A;  2NTO A;  4XRA A;  1S3D A;  2H1B A;  1QFN A;  9GSS A;  4EKZ A;  1QMV A;  5COH A;  2IFQ B;  2RM6 A;  2C0E A;  5C00 A;  5J9B A;  2E7P A;  2P0G A;  4TVE A;  4PX1 A;  4V2N A;  2KP2 A;  3V1W A;  2K18 A;  1QXH A;  3CSI A;  3VPT A;  4HQZ A;  2C8U A;  2QC7 A;  5JCU A;  3G7J A;  5KN3 A;  5JWR B;  4YH2 A;  1FHE A;  2WB9 A;  1AIU A;  2K9F A;  2LV3 A;  3IAM 2;  1G7O A;  1O8X A;  4MJC A;  1OC3 A;  2YJ7 A;  2R4V A;  2H1G A;  3LQ7 A;  4YQU A;  1SL2 B;  2NDO A;  3LJR A;  3JCM L;  1TXX A;  2OE1 A;  1F3B A;  2XPD A;  4ILF A;  4ECJ A;  4NV2 A;  3EVI A;  1EGO A;  4TKY A;  4KAE A;  3ERG A;  4IP1 A;  4MH2 A;  1GSF A;  3BCK A;  4G19 A;  5LNK e;  1JHB A;  1GL8 A;  3CRT A;  3IDV A;  5ECQ B;  2VD0 A;  3O6T A;  1ERW A;  1PL2 A;  3K8N A;  1VF1 A;  1WRY A;  2VL2 C;  2REM A;  4Z7X A;  2C3N A;  3TJK A;  2H75 A;  2IME A;  4OO5 A;  1DE1 A;  1TU7 A;  4EVM A;  4XRD A;  4K8M A;  1FVK A;  4O7H A;  4BVY A;  4BA7 A;  2VCZ A;  5B6N A;  1KBN A;  1XWK A;  2FCH A;  3FR6 A;  4FYU A;  1M7T A;  5CRD A;  1B9Y C;  4IEL A;  2L5O A;  2LRC A;  1LBK A;  3IK9 A;  2X99 A;  2HT9 A;  2CZ2 A;  2B7J A;  4D73 A;  2OAC A;  5ECP B;  2B7K A;  3HVV A;  1CQH A;  5CAX A;  1PL1 A;  3DYR A;  4MZW A;  3J7Y b;  3GFK A;  1R7H A;  2TRC P;  1EOG A;  1Z9H A;  1R26 A;  3VWU A;  3DRN A;  3DEX A;  1YKA A;  2F8A A;  3WYW A;  2VAF A;  4ULX A;  1X9M B;  2IJY A;  3KTL A;  1K0M A;  2CT6 A;  3FHK A;  4PNG A;  1M2D A;  2H0H A;  4XS6 A;  2HE3 A;  4AJ6 A;  3U5R E;  2IFQ A;  4HU9 A;  1R4W A;  2FLS A;  3BJ5 A;  2YWN A;  3EC3 A;  4POM A;  4WEY A;  1WOU A;  2V41 A;  1HNC A;  2FWG A;  1M2B A;  3WT1 A;  2YCD A;  2A4V A;  1SK1 A;  3Q74 A;  1PN9 A;  4POL A;  1O6J A;  3D0Z A;  4K0N A;  1YZX A;  4PGT A;  3RBT A;  3MSZ A;  1OYJ A;  2PMT A;  3A2W A;  3M3M A;  1WWJ A;  3GIX A;  4GLT A;  2DBC A;  2FHE A;  2FWH A;  1TW9 A;  4TOP A;  2LUS A;  3FZ9 A;  3KD0 A;  7GSS A;  1ACV A;  3ZTL A;  1XBS A;  3HYP A;  3FW2 A;  2YZH A;  4IS0 A;  2YAN A;  2YPM A;  1AQW A;  2FWF A;  5F06 A;  3IK7 A;  4CHS A;  2LST A;  4HZ4 A;  4QQ7 A;  1A2M A;  4J57 E;  1YF1 A;  1NM3 A;  4RUV A;  3PH9 A;  3KMN A;  2DIZ A;  3NZN A;  4AGS A;  1X5E A;  4OFN A;  1F3A A;  2BMX A;  3R2Q A;  5DJM A;  2IMD A;  2LKU A;  1TK8 B;  4L0W A;  5DDL A;  1GSY A;  2I9H A;  4TN8 A;  4EO3 A;  2LTK A;  2CX3 A;  3UIW A;  2OAD A;  1EZK A;  4E8E A;  1XWB A;  3IC4 A;  3GYK A;  4WF5 A;  5IMC A;  4LL4 B;  4IJ3 A;  2R2J A;  1NHY A;  4ID0 A;  4HQS A;  4X43 A;  3CTG A;  2YV9 A;  5ECH B;  2VLU A;  4MF6 A;  4WR4 A;  1ML6 A;  3DKS A;  2AYT A;  2H1A A;  4HU7 A;  18GS A;  5ELA A;  5IMA A;  1B4P A;  2R5G A;  3APO A;  2LNS A;  4GQC A;  3F6D A;  2GSR A;  3TRQ A;  4FYC A;  4PUF C;  11GS A;  3FY7 A;  3QDN A;  2X8H A;  1Z7P A;  1Y25 A;  4HDE A;  2H01 A;  2GQK A;  4YAV A;  3IBH A;  4ECC A;  1M9B A;  4MZC A;  1ZOF A;  3J7Y k;  4LL1 B;  4PNF A;  4H86 A;  2MMA A;  5G31 A;  1JZD A;  19GS A;  3F0I A;  1YF0 A;  1Z6N A;  1K3Y A;  5DCH A;  1QQ2 A;  1A2L A;  2WCI A;  3IR4 A;  1I5G A;  3ZFB A;  2OBK A;  3DVW A;  5INY A;  5E59 A;  3CSJ A;  4F82 A;  3HKR A;  2R6K A;  2TRX A;  4TRX A;  3KM6 A;  1HNB A;  5IO0 A;  4DSS B;  3DD3 A;  2A2S A;  4EC0 A;  4DSQ A;  1TK5 B;  1DBY A;  5KN2 A;  4MF5 A;  2CZ3 A;  2CQ9 A;  5D73 A;  3W8J A;  2YN1 A;  3F9U A;  4TW5 A;  3GRX A;  3BD2 A;  3EWL A;  1GUL A;  2GLR A;  4POK A;  3GA4 A;  3LFL A;  3QOU A;  3TJG A;  1JZW A;  3EU4 A;  4YAP A;  2PPT A;  1PA3 A;  4LLR A;  1U3A A;  4CDO A;  1KTE A;  2V6K A;  2VCQ A;  6GSS A;  13GS A;  3HA9 A;  5L71 A;  1Z7R A;  3IPZ A;  5GZZ B;  1WP0 A;  2C1Y A;  1GNW A;  4IP6 A;  4PQH A;  4BPY A;  2F8F A;  2CA8 A;  1RK4 A;  2NVL A;  1OVN A;  3Q6O A;  2VL9 A;  2PBJ A;  3TUE A;  4FO5 A;  3HZ8 A;  5HR3 A;  2QKE A;  2B5E A;  3WD6 A;  1K0B A;  5A4V A;  1QK8 A;  5ECM B;  4OMV A;  1M0U A;  2LNT A;  5D9X A;  5HR0 A;  1FAA A;  1EEM A;  4MA9 A;  1VGL A;  2N5A A;  4ZIL A;  3L4N A;  1YDK A;  1N2A A;  4YQM A;  1AW9 A;  4G9H A;  1TRU A;  1SL0 B;  2D2Z A;  1Z6M A;  1XIY A;  1TI1 A;  5ABR A;  2RII A;  1TKD B;  2JL4 A;  4ZL9 A;  2MYG A;  4WR5 A;  1SL1 B;  1XCC A;  1PX7 A;  1VF4 A;  4IW9 A;  5H5Q A;  4PXO A;  5HFI A;  4PUR A;  1G6Y A;  2GQL A;  4N0V A;  4KND A;  4F2I A;  4WF4 A;  3ME7 A;  4BL7 A;  2OJL A;  4KA0 A;  17GS A;  5F05 A;  1SJI A;  3HVS A;  2E2M A;  4ZL8 A;  4KB3 A;  1WJK A;  3LG6 A;  2F51 A;  1X9S B;  4JRR A;  1LJR A;  2AAW A;  1GH2 A;  4NMU A;  4QL9 A;  1GLQ A;  2L5L A;  1O81 A;  2GS3 A;  1T4Y A;  1K0A A;  2RM5 A;  1GUK A;  4NHZ A;  1TRV A;  2OE3 A;  1ERV A;  1MDJ A;  1X5C A;  5CRW A;  4KSM A;  3GV1 A;  2FA8 A;  3L0H A;  3GHA A;  2VCT A;  3PIN A;  4NWY A;  4K1F A;  2HZF A;  3UBK A;  4ZBB A;  1J9B A;  4OFM A;  2VL2 A;  3WT2 A;  3GX8 A;  2F3M A;  3L78 A;  3E9J B;  1TRS A;  2DJ1 A;  2AB6 A;  3VWW A;  5CNW A;  2A2R A;  4CW9 A;  4NHW A;  3DIE A;  3S9F A;  3MAK A;  4L0U A;  3H8Q A;  4ZXG A;  1B4Q A;  2ON7 A;  3D21 A;  3LEF A;  3DWV A;  2PGT A;  3VUR A;  1GNE A;  14GS A;  3QMX A;  1UN2 A;  3ZVJ D;  2H71 A;  2OE0 A;  1SU9 A;  4TR4 A;  3QR6 A;  4MP4 A;  2X64 A;  4XHM A;  2PU9 C;  1XWA A;  1SKS B;  4I97 A;  3QFA C;  3E3E A;  5GAP D;  3M0F A;  1FB0 A;  4EF0 A;  3E0U A;  4KDX A;  1XVW A;  3QCP A;  1MDI A;  3M1G A;  1ZYE A;  3NIV A;  3N9J A;  3F3R A;  3DML A;  2PVQ A;  5JCW A;  2VO4 A;  2PUK C;  1URM A;  3ERW A;  3M8N A;  5HQP A;  1FO5 A;  1G0T A;  1WMJ A;  3H79 A;  5E4W A;  2O7K A;  1B8X A;  3F63 A;  1PSQ A;  1Q98 A;  2YV7 A;  1XZO A;  3HHV A;  3AY8 A;  3GKK A;  2DC5 A;  1GUM A;  3KP8 A;  2PVO C;  3KEB A;  3HD5 A;  4JR4 A;  1FVJ A;  2XBI A;  2Z9S A;  3ZVJ A;  2LRN A;  1SK2 A;  2LQO A;  4RQX A;  1OC9 A;  3HJP A;  3FYG A;  5FT3 A;  4MAB A;  3NOF A;  10GS A;  2RUF A;  1GSU A;  1HQO A;  2HZE A;  2GQM A;  4GWR A;  1XWC A;  4JR6 A;  3UL3 A;  2I3Y A;  5D9V A;  3OR5 A;  4WBR D;  3TKQ A;  2MBS A;  1MEK A;  3H93 A;  1THX A;  1JZR A;  2JZT A;  3UVH A;  3KTB A;  3U6V A;  2J9H A;  1MTC A;  1AXD A;  1O7U A;  4EDY A;  3ZL5 A;  2HRN A;  3CBU A;  3LGC A;  1U6T A;  4KGI A;  1ZCP A;  3RHC A;  2WFC A;  3M9K A;  1ZL9 A;  5ELG A;  4K7I A;  2H6Z A;  3HZ4 A;  3GH6 A;  4OD7 A;  1J08 A;  4O32 A;  3GNJ A;  4JU5 A;  3QAW A;  3DVX A;  1H4O A;  4K9Z A;  2MMZ A;  4V2L A;  4FH8 A;  1T3B A;  2IPA A;  6GSW A;  3F4S A;  2K6V A;  5ID2 B;  4WBJ A;  1JLV A;  3KXO A;  1TTZ A;  3VLN A;  1JFU A;  3EYT A;  3ISO A;  5CRH A;  1R5A A;  1GTU A;  2LJA A;  3ZIJ A;  4ZL7 A;  1R5P A;  1TJD A;  4PQ1 A;  1OKD A;  4RQR A;  2LJR A;  3RPP A;  3CRU A;  1GSD A;  5EPF A;  2J23 A;  3QFB C;  2XHF A;  3A3T A;  1O8W A;  2WS2 A;  4MF7 A;  1AQX A;  2N5B A;  3LYP A;  5G2Z A;  4IGJ A;  1V40 A;  1BED A;  3A2V A;  2OA7 A;  5ECK B;  4MDC A;  3CMI A;  2CAQ A;  3SWL A;  3TOU A;  16GS A;  1A8L A;  3ZRE A;  2X8C A;  2H0I A;  4Q5F A;  2EIR A;  5G1L A;  4X0X A;  3EUR A;  5CP1 A;  1DUG A;  1TU8 A;  5IMF A;  4IJI A;  1GTA A;  6GSX A;  3DXB A;  5J9C A;  3C73 A;  1K3O A;  5J3R A;  4MJB A;  1YKC A;  2V32 A;  1EWX A;  4ZIJ A;  1V58 A;  3TJJ A;  3US3 A;  3ERF A;  1IYI A;  2PWJ A;  3L9U A;  2JSY A;  4NV5 A;  3UOM A;  2PER A;  1GRX A;  4TR3 A;  4I2T A;  5ECN B;  1OC8 A;  1N8J A;  4MJA A;  3TGZ A;  2H73 A;  1MD4 A;  1XPV A;  4ZB8 A;  4JZQ A;  1U88 A;  4MPG A;  2DMM A;  3QD9 A;  3FR9 A;  2H8L A;  2GVP A;  3C1S A;  5DAL B;  3BBY A;  5J41 A;  5GAN D;  4MPF A;  4XTS A;  5F0G A;  2P5R A;  3W8S A;  2H30 A;  1GUH A;  4ML1 A;  1U87 A;  2C3T A;  3TRP A;  3TKR A;  2JAD A;  2LEG A;  2XBQ A;  5G1K A;  1K3L A;  1UC7 A;  4IN0 A;  3HDC A;  2VUP A;  5ID2 A;  4AF2 A;  2DJ2 A;  3I9V 2;  4OWY A;  2HSH A;  1PQN A;  2VOC A;  5AN1 A;  4KW6 A;  5IQY A;  4O92 A;  1T7P B;  5HR2 A;  5AIS A;  4KCE A;  4LMW A;  2H0G A;  4Q5Q A;  1M2A A;  2LS5 A;  4TXO B;  3KZQ A;  2H74 A;  2N5F A;  5ECR B;  4F0B A;  1HNA A;  4DVC A;  4JBB A;  2VM2 A;  4IQ1 A;  2EIQ A;  3MNG A;  3TB2 A;  2H6Y A;  3GX0 A;  3RHB A;  2B3S A;  1A0R P;  2HRF A;  5IOX A;  4ML6 A;  5CRE A;  3UEM A;  2HYX A;  5DQS A;  3VFI A;  5B6M A;  2KP1 A;  4Q5R A;  3F8U A;  4GST A;  2QSI A;  3HJM A;  2CVB A;  1O73 A;  3IRA A;  1OAZ A;  1LU4 A;  5G5E A;  1GP1 A;  3L9V A;  4K0G A;  2L59 A;  3IAS 2;  3KH7 A;  1U3I A;  4V1A p;  4NAX A;  3KCM A;  1USB A;  4MJE A;  4ACS A;  3LSZ A;  1SD9 A;  4N10 A;  1NW2 A;  2C0D A;  2DSA A;  2L6C A;  4G10 A;  2CVK A;  2MBT A;  4NXI A;  1XW5 A;  3GST A;  2NPB A;  2EIO A;  12GS A;  5GSS A;  1SEN A;  5D9W A;  1ZGN A;  4DSR A;  5DAL A;  2R37 A;  3UMA A;  2FGX A;  1O85 A;  3Q18 A;  3APS A;  2G0F A;  4K7N A;  1UA5 A;  1X0R A;  2GTU A;  3TDG A;  1S3A A;  4OFT A;  3ZZX A;  1F2E A;  1K0D A;  2KLX A;  5B7C A;  1SK0 A;  1ZMA A;  2HI7 A;  1FG4 A;  1TOF A;  2IWT A;  5LCZ A;  2DJ0 A;  4KUN A;  3TJF A;  1A8Y A;  4BVX A;  4TR1 A;  1YJ6 A;  3CXG A;  5ECI B;  3EE2 A;  2IMI A;  3LWA A;  1QGV A;  3TJB A;  5DQY A;  3EMP A;  1BG5 A;  3HCZ A;  5AGY A;  1SD8 A;  1XFL A;  1OC9 B;  2MZC A;  4YQV A;  4HI7 A;  5DBQ A;  3GL3 A;  3FZ5 A;  4GRF A;  1YEX A;  2IN3 A;  4HUA A;  2HZE B;  4TXO A;  3C71 A;  1BJX A;  5H5S A;  3M9J A;  2JZR A;  3FEU A;  1GSQ A;  2K8S A;  4EXJ A;  5LD0 A;  4F9Z A;  1HYU A;  5IOW A;  5IO2 A;  2DJK A;  4OCE A;  3KIJ A;  4KSO A;  4L5O A;  2LJK A;  1G7E A;  4HOJ A;  22GS A;  2VCX A;  3TKP A;  3D5J A;  4AJ8 A;  1F9M A;  1PD2 1;  2L4Q A;  3SBC A;  3IXR A;  2WZ9 A;  1MDK A;  1GSE A;  4ZB9 A;  3ZYW A;  3PR8 A;  2B5X A;  5EY6 A;  3GUR A;  3W6G A;  3VPQ A;  5IM9 A;  2F9S A;  1OE8 A;  3I69 A;  4MZB A;  3TKS C;  2ES7 A;  5JWQ B;  2R3X A;  4K6X A;  3LOR A;  4P3Y B;  1K0N A;  2WRT A;  1PRX A;  3TOT A;  2L57 A;  4N30 A;  3TRX A;  1EGR A;  3KJY A;  2RUE A;  4KCA A;  1V2A A;  2I4A A;  3FRC A;  20GS A;  2VCW A;  1TI3 A;  1BAY A;  6GSV A;  2KHP A;  5G30 A;  4Q5N A;  2BTO T;  4IBP A;  5FWG A;  4HJ2 A;  3ME8 A;  1ILO A;  3CYN A;  2YWI A;  5IMD A;  1OE7 A;  4XIH A;  1WE0 A;  5KEJ A;  3D4T A;  5HFG A;  1EEJ A;  2VIM A;  3I43 A;  1EP7 A;  1GWC A;  2MMN A;  1AAZ A;  3WGX A;  1B48 A;  3UVT A;  3A5W A;  1E2Y A;  3TCO A;  1NHO A;  2DJ3 A;  2GT6 A;  2H70 A;  1X9W B;  3IV4 A;  3WGD A;  4L5L A;  2GZY A;  4BWS A;  4GCI A;  2ZNM A;  4GSS A;  3PGT A;  1PKZ A;  5KN1 A;  3RAZ A;  2IMK A;  2YNX A;  2OKA A;  4TR0 A;  1A23 A;  4IVF A;  1Z5Y E;  2KUC A;  4FYB A;  5DVB A;  4KH7 A;  2HSY A;  4I8B A;  2JU5 A;  2VD1 A;  5GST A;  1V57 A;  2H1D A;  3D6I A;  1SKW B;  1XOB A;  2I81 A;  3ZMK A;  4POB A;  5A4U A;  1XOA A;  1T1V A;  4MH3 A;  4HZ2 A;  4FIW A;  2NBS A;  3QPM A;  1ON4 A;  1Q4J A;  4X1U A;  1A0F A;  2GZP A;  3ZML A;  1XVQ A;  5DJL A;  2O87 A;  4GTU A;  4XS4 B;  4J2F A;  4WKW A;  3QAV A;  4MK3 A;  3F3Q A;  4F0C A;  4QL7 A;  1XW9 A;  2OBI A;  4ZBD A;  3IOS A;  2HLS A;  4I6X A;  4G2E A;  2V2G A;  3KH9 A;  3ZRD A;  1W89 A;  1MD3 A;  3G7Y A;  5J4U A;  4F03 A;  1EV9 A;  3FK8 A;  3KGK A;  1I9D A;  5FHI A;  8GSS A;  1GSS A;  2YWO A;  4IKH A;  1PX6 A;  1VRS D;  2IL3 A;  2FA4 A;  4LMV A;  1CQG A;  2ON5 A;  1XW6 A;  2O85 A;  3CSH A;  1YEP A;  3VWX A;  2EC4 A;  1RW1 A;  1XXU A;  4WXT A;  2LQQ A;  4WET A;  2AUV A;  3GKN A;  1GTI A;  1TDI A;  2TIR A;  4XCS A;  5IMV A;  3LYK A;  1M9A A;  3HXS A;  5J5N A;  2B5Y A;  1BQ7 A;  1NSW A;  1PGT A;  3GL5 A;  3GMF A;  5ENU A;  2I1U A;  2H72 A;  2AHE A;  3GN3 A;  3HVX A;  5CO3 A;  2B1K A;  1SJZ A;  2BJX A;  2CAI A;  5F07 A;  3L9S A;  3GKX A;  2WGR A;  1FW1 A;  5AIV A;  1ERT A;  1ERU A;  3H4K A;  3LXT A;  2V1M A;  4N0Z A;  2VL3 A;  4PUA A;  2FD3 A;  2HXK A;  1ZZY A;  5C04 A;  2H19 A;  1V9W A;  2B6M A;  2GDR A;  3ZLP A;  3ZFL A;  2V6O A;  2PN8 A;  3GTU B;  3LXZ A;  1AUC A;  2M80 A;  3RPN A;  4AJ7 A;  3IA1 A;  4XS1 A;  1TRW A;  1A24 A;  3UJ1 A;  3F6F A;  2H66 A;  1E6B A;  5D96 A;  2LRT A;  5EL8 A;  2FWE A;  5B8B A;  3G9B A;  5AIX A;  2VLV A;  1B9X C;  4ZB6 A;  5D8I A;  2GGT A;  4KE3 A;  2CVD A;  3BOA A;  1FB6 A;  5KN0 A;  2FUG 2;  1BX9 A;  4XS4 A;  4E8H A;  2B1L A;  3F4T A;  4EL1 A;  2WUL A;  3VWV A;  1ZYQ B;  1S3C A;  1GTB A;  3DGQ A;  5IPH A;  2L6D A;  2YZU A;  2IIY A;  2HNL A;  5IPG A;  4ZBA A;  2K8V A;  2WJU A;  3P2A A;  3UAR A;  1DSB A;  1T8E B;  1JLW A;  5F8B A;  1TP9 A;  3O3T A;  1PKW A;  4N11 A;  5G5F A;  4TR1 B;  2KOK A;  2JZS A;  1AC1 A;  5ECO B;  3CTF A;  2H76 A;  1J0F A;  4PQI A;  1K0O A;  1SKR B;  2VLT A;  1M99 A;  4JED A;  2YWM A;  3KMO A;  5HR1 A;  4J56 E;  3P90 A;  2GZZ A;  3GKM A;  5DCG A;  1IYH A;  2XC2 A;  5IIZ A;  1PMT A;  3VI5 A;  4LA1 A;  5D93 A;  1EP8 A;  2O89 A;  5ECL B;  1SYX A;  4KX4 A;  1A2J A;  4IQA A;  3ZIT A;  3ZIV A;  4GF0 A;  4V1A g;  1WPI A;  4RI6 A;  2GST A;  3G7I A;  5DAK B;  1EOH A;  5B8A A;  2IMF A;  2VCV A;  3FZA A;  5HFK A;  3UAP A;  2FNO A;  3GTU A;  1H75 A;  1OKT A;  3D22 A;  4GQF A;  1WIK A;  2RLI A;  1GLP A;  1Y6E A;  5ECS A;  4K2D A;  2C3Q A;  2ZUP A;  4ECB A;  3QAG A;  4HS1 A;  3GUS A;  2E2G A;  4BWQ A;  1UVZ A;  2JSZ A;  1FOV A;  1AQV A;  3RDW A;  5JWO B;  2DLX A;  3C7M A;  1X5D A;  3BCI A;  2GSQ A;  5D9T A;  1VF3 A;  3Q19 A;  2VM1 A;  4O5R A;  4NPB A;  1KEB A;  3FKF A; 
#chains in the Genus database with same CATH topology
 1Z3E A;  1C72 A;  3D4M A;  3P8W A;  1F37 A;  4HEA 2;  3C1R A;  4EE0 A;  2YP6 A;  3C8E A;  6GSY A;  3MWH A;  3TKS E;  3EU3 A;  2WDU A;  4ECI A;  4ISD A;  2DJJ A;  2HFD A;  5H5R A;  3VK9 A;  4KDU A;  2CV4 A;  3MDK A;  4JE1 A;  1XWG A;  1V98 A;  1KNG A;  1W4V A;  2GSS A;  2C80 A;  2JAC A;  4OO4 A;  3IHQ A;  4DEJ A;  1YQ1 A;  4MMM A;  2AJQ B;  1RQM A;  3I6A A;  2M46 A;  1BYE A;  2GT5 A;  1JZO A;  4EDZ A;  2P31 A;  3TKS A;  3UBL A;  1TK0 B;  4IHU A;  2XPE A;  3A2X A;  2H6X A;  4RI7 A;  3EMX A;  1VF2 A;  4MCU A;  1T00 A;  2X8G A;  3HJO A;  6GST A;  5CRG A;  1EV4 A;  5A4W A;  1F6M C;  6GSU A;  2DML A;  2YOI A;  1S3R A;  2ALB A;  2CX4 A;  4TXV A;  4L8E A;  2C4J A;  1SYR A;  2P5Q A;  1DE2 A;  3EIN A;  3GSS A;  4HJM A;  3ED3 A;  2QGV A;  3GH9 A;  2DIY A;  3HY2 A;  3FZ4 A;  3KP9 A;  3H1N A;  2ZCT A;  4GXZ A;  5IMZ A;  4OCF A;  4I2U A;  4MLY A;  2YJH A;  5A5K A;  5DAK A;  4I5Q A;  3N5O A;  4V2M A;  1G6W A;  5EVO A;  4BVY B;  4DSS A;  3WGE A;  5CYY A;  4K7O A;  4GSN A;  2C0G A;  2C0F A;  3O76 A;  3IE3 A;  5JCG A;  2G2Q A;  1HD2 A;  1T4Z A;  3P7X A;  4EUY A;  1SJ6 A;  4D73 B;  1THO A;  2FY6 A;  1ST9 A;  2AV4 A;  1K0C A;  3VI7 A;  2MMO A;  3FR3 A;  2X49 A;  2M72 A;  3APQ A;  1YY7 A;  2L4C A;  3PPU A;  2O8V B;  4KDY A;  1ABA A;  3F4R A;  1QUW A;  2E0Q A;  2NTO A;  4XRA A;  1S3D A;  2H1B A;  1QFN A;  9GSS A;  4EKZ A;  1QMV A;  5COH A;  2IFQ B;  2RM6 A;  2C0E A;  5C00 A;  5J9B A;  2E7P A;  2P0G A;  4TVE A;  4PX1 A;  4V2N A;  2KP2 A;  3V1W A;  2K18 A;  1QXH A;  3CSI A;  3VPT A;  4HQZ A;  2C8U A;  2QC7 A;  5JCU A;  3G7J A;  5KN3 A;  5JWR B;  4YH2 A;  1FHE A;  2WB9 A;  1AIU A;  2K9F A;  2LV3 A;  3IAM 2;  1G7O A;  1O8X A;  4MJC A;  1OC3 A;  2YJ7 A;  2R4V A;  2H1G A;  3LQ7 A;  4YQU A;  1SL2 B;  2NDO A;  3LJR A;  3JCM L;  1TXX A;  2OE1 A;  1F3B A;  2XPD A;  4ILF A;  4ECJ A;  4NV2 A;  3EVI A;  1EGO A;  4TKY A;  4KAE A;  3ERG A;  4IP1 A;  4MH2 A;  1GSF A;  3BCK A;  4G19 A;  5LNK e;  1JHB A;  1GL8 A;  3CRT A;  3IDV A;  5ECQ B;  2VD0 A;  3O6T A;  1ERW A;  1PL2 A;  3K8N A;  1VF1 A;  1WRY A;  2VL2 C;  2REM A;  4Z7X A;  2C3N A;  3TJK A;  2H75 A;  2IME A;  3IHG A;  4OO5 A;  1DE1 A;  1TU7 A;  4EIQ A;  4EVM A;  4XRD A;  4K8M A;  1FVK A;  4O7H A;  4BVY A;  4BA7 A;  2VCZ A;  5B6N A;  1KBN A;  1XWK A;  2FCH A;  3FR6 A;  4FYU A;  1M7T A;  5CRD A;  1B9Y C;  4IEL A;  2L5O A;  2LRC A;  1LBK A;  3IK9 A;  2X99 A;  2HT9 A;  2CZ2 A;  2B7J A;  4D73 A;  2OAC A;  5ECP B;  2B7K A;  3HVV A;  1CQH A;  5CAX A;  1PL1 A;  3DYR A;  4MZW A;  3J7Y b;  3GFK A;  1R7H A;  2TRC P;  1EOG A;  1Z9H A;  1R26 A;  3VWU A;  3DRN A;  3DEX A;  1YKA A;  2F8A A;  3WYW A;  2VAF A;  4ULX A;  1X9M B;  2IJY A;  3KTL A;  1K0M A;  2CT6 A;  3FHK A;  4PNG A;  1M2D A;  2H0H A;  4XS6 A;  2HE3 A;  4AJ6 A;  3U5R E;  2IFQ A;  4HU9 A;  1R4W A;  4YKF A;  2FLS A;  3BJ5 A;  2YWN A;  3EC3 A;  4POM A;  4WEY A;  1WOU A;  2V41 A;  1HNC A;  2FWG A;  1M2B A;  3WT1 A;  2YCD A;  2A4V A;  1SK1 A;  3Q74 A;  1PN9 A;  4POL A;  1O6J A;  3D0Z A;  4K0N A;  1YZX A;  4PGT A;  2QA1 A;  3RBT A;  3MSZ A;  1OYJ A;  2PMT A;  3A2W A;  3M3M A;  1WWJ A;  3GIX A;  4GLT A;  2DBC A;  2FHE A;  2FWH A;  4MNN A;  1TW9 A;  4TOP A;  2LUS A;  3FZ9 A;  3KD0 A;  7GSS A;  1ACV A;  3ZTL A;  1XBS A;  3HYP A;  3FW2 A;  2YZH A;  4IS0 A;  2YAN A;  2YPM A;  1AQW A;  2FWF A;  5F06 A;  3IK7 A;  4CHS A;  2LST A;  4HZ4 A;  3FMW A;  4QQ7 A;  1A2M A;  4J57 E;  1YF1 A;  1NM3 A;  4RUV A;  3PH9 A;  3KMN A;  2DIZ A;  3NZN A;  4AGS A;  1X5E A;  4OFN A;  1F3A A;  2BMX A;  3R2Q A;  5DJM A;  2IMD A;  2LKU A;  1TK8 B;  4L0W A;  5DDL A;  5BMU A;  1GSY A;  2I9H A;  4TN8 A;  4EO3 A;  2LTK A;  2CX3 A;  3UIW A;  2OAD A;  1EZK A;  4E8E A;  1XWB A;  1XG8 A;  3IC4 A;  3GYK A;  4WF5 A;  5IMC A;  4LL4 B;  4IJ3 A;  2R2J A;  1NHY A;  4ID0 A;  4HQS A;  4X43 A;  3CTG A;  2YV9 A;  4KF9 A;  3MIX A;  5ECH B;  2VLU A;  4MF6 A;  4WR4 A;  1ML6 A;  3DKS A;  2AYT A;  2H1A A;  4HU7 A;  18GS A;  5ELA A;  5IMA A;  1B4P A;  2R5G A;  3APO A;  2LNS A;  4GQC A;  3F6D A;  2GSR A;  3TRQ A;  4FYC A;  4PUF C;  11GS A;  3FY7 A;  3QDN A;  2X8H A;  1Z7P A;  1Y25 A;  4HDE A;  2H01 A;  2GQK A;  4YAV A;  3IBH A;  4ECC A;  1M9B A;  4MZC A;  1ZOF A;  3J7Y k;  4LL1 B;  4PNF A;  4H86 A;  2MMA A;  5G31 A;  1JZD A;  19GS A;  3F0I A;  4BL7 B;  1YF0 A;  1Z6N A;  1K3Y A;  5DCH A;  1QQ2 A;  1A2L A;  2WCI A;  3IR4 A;  1I5G A;  3ZFB A;  2OBK A;  3DVW A;  5INY A;  2R0G A;  5E59 A;  3CSJ A;  4F82 A;  3HKR A;  2R6K A;  2TRX A;  4G0L A;  4TRX A;  3KM6 A;  1HNB A;  5IO0 A;  4DSS B;  3DD3 A;  2A2S A;  4EC0 A;  4DSQ A;  1TK5 B;  1DBY A;  3LW9 A;  5KN2 A;  4MF5 A;  2CZ3 A;  2CQ9 A;  5D73 A;  3W8J A;  2YN1 A;  3F9U A;  4TW5 A;  3GRX A;  3BD2 A;  3EWL A;  1GUL A;  2GLR A;  4POK A;  3GA4 A;  3LFL A;  3QOU A;  3TJG A;  1JZW A;  3EU4 A;  4YAP A;  2PPT A;  1PA3 A;  4LLR A;  1U3A A;  4CDO A;  1KTE A;  2V6K A;  2VCQ A;  6GSS A;  13GS A;  3HA9 A;  5L71 A;  1Z7R A;  3IPZ A;  5GZZ B;  4K5R A;  1WP0 A;  2C1Y A;  1GNW A;  4IP6 A;  4PQH A;  4BPY A;  2F8F A;  2CA8 A;  4G0I A;  1RK4 A;  2NVL A;  1OVN A;  3Q6O A;  2HSM A;  2VL9 A;  1PFO A;  2PBJ A;  3TUE A;  4FO5 A;  3HZ8 A;  5HR3 A;  2QKE A;  2B5E A;  1FOH A;  3WD6 A;  1K0B A;  5A4V A;  1QK8 A;  5ECM B;  4OMV A;  1M0U A;  2LNT A;  5D9X A;  5HR0 A;  1FAA A;  1EEM A;  4MA9 A;  1VGL A;  2N5A A;  4ZIL A;  3L4N A;  1YDK A;  1N2A A;  4YQM A;  1AW9 A;  4G9H A;  1TRU A;  1SL0 B;  2D2Z A;  1Z6M A;  1XIY A;  1TI1 A;  5ABR A;  2RII A;  1TKD B;  2JL4 A;  4ZL9 A;  2MYG A;  4WR5 A;  1SL1 B;  1XCC A;  1PX7 A;  1VF4 A;  4IW9 A;  5H5Q A;  4PXO A;  5HFI A;  4PUR A;  1G6Y A;  2GQL A;  4N0V A;  4KND A;  4F2I A;  4WF4 A;  3ME7 A;  4BL7 A;  2OJL A;  4KA0 A;  17GS A;  5F05 A;  1SJI A;  3HVS A;  2E2M A;  4ZL8 A;  4KB3 A;  1WJK A;  3LG6 A;  2F51 A;  1X9S B;  4JRR A;  1LJR A;  2AAW A;  1GH2 A;  4NMU A;  4QL9 A;  1GLQ A;  2L5L A;  1O81 A;  2GS3 A;  1T4Y A;  1K0A A;  2RM5 A;  1GUK A;  4NHZ A;  1TRV A;  2OE3 A;  1ERV A;  1MDJ A;  1X5C A;  5CRW A;  4KSM A;  3GV1 A;  2FA8 A;  3L0H A;  3GHA A;  2VCT A;  3PIN A;  4NWY A;  4K1F A;  2HZF A;  1PN0 A;  3UBK A;  4ZBB A;  1J9B A;  4OFM A;  2VL2 A;  3WT2 A;  3GX8 A;  2F3M A;  3L78 A;  3E9J B;  1TRS A;  2DJ1 A;  2AB6 A;  3VWW A;  2A2P A;  5CNW A;  2A2R A;  4CW9 A;  4NHW A;  3DIE A;  3S9F A;  3MAK A;  4L0U A;  3H8Q A;  4ZXG A;  1B4Q A;  2ON7 A;  3D21 A;  3LEF A;  3DWV A;  2PGT A;  3VUR A;  2R0C A;  1GNE A;  14GS A;  3QMX A;  1UN2 A;  3ZVJ D;  2H71 A;  2OE0 A;  1SU9 A;  4TR4 A;  3QR6 A;  4MP4 A;  2X64 A;  4XHM A;  2PU9 C;  1XWA A;  1SKS B;  4I97 A;  3QFA C;  3E3E A;  5GAP D;  3M0F A;  3EPT A;  1FB0 A;  4EF0 A;  3E0U A;  4KDX A;  1XVW A;  3QCP A;  1MDI A;  3M1G A;  1ZYE A;  3NIV A;  3R3E A;  3HVN A;  3N9J A;  3F3R A;  3DML A;  2PVQ A;  5JCW A;  2VO4 A;  2PUK C;  1URM A;  3ERW A;  3M8N A;  5HQP A;  1FO5 A;  1G0T A;  1WMJ A;  3H79 A;  5E4W A;  5KOW A;  2O7K A;  3MYD A;  2DKH A;  1B8X A;  3F63 A;  3A5I A;  1PSQ A;  1Q98 A;  2YV7 A;  2A4H A;  1XZO A;  4A5P A;  3HHV A;  3AY8 A;  3GKK A;  2DC5 A;  1GUM A;  3KP8 A;  2PVO C;  3KEB A;  3HD5 A;  4JR4 A;  1FVJ A;  2XBI A;  2Z9S A;  3ZVJ A;  2LRN A;  1SK2 A;  2LQO A;  4RQX A;  1OC9 A;  3HJP A;  3FYG A;  5FT3 A;  4MAB A;  3NOF A;  10GS A;  2RUF A;  1GSU A;  1HQO A;  2HZE A;  2GQM A;  4GWR A;  1XWC A;  4JR6 A;  3UL3 A;  2I3Y A;  5D9V A;  3OR5 A;  4WBR D;  3TKQ A;  2MBS A;  1MEK A;  3H93 A;  1THX A;  1JZR A;  2JZT A;  3UVH A;  3KTB A;  3U6V A;  2J9H A;  1MTC A;  1AXD A;  1O7U A;  4EDY A;  3ZL5 A;  2HRN A;  3CBU A;  3LGC A;  1U6T A;  4KGI A;  1ZCP A;  3RHC A;  2WFC A;  3M9K A;  1ZL9 A;  5ELG A;  4K7I A;  2H6Z A;  3HZ4 A;  3GH6 A;  4OD7 A;  1J08 A;  4O32 A;  3GNJ A;  4JU5 A;  3QAW A;  3DVX A;  1H4O A;  4K9Z A;  2MMZ A;  2UZ8 A;  4V2L A;  4FH8 A;  1T3B A;  2IPA A;  6GSW A;  3F4S A;  2K6V A;  5ID2 B;  4WBJ A;  1JLV A;  3KXO A;  1TTZ A;  3VLN A;  1JFU A;  3EYT A;  3ISO A;  5CRH A;  1R5A A;  1GTU A;  2LJA A;  3ZIJ A;  4ZL7 A;  1R5P A;  1TJD A;  4PQ1 A;  1OKD A;  4RQR A;  2LJR A;  3RPP A;  3CRU A;  1GSD A;  5EPF A;  2J23 A;  3QFB C;  2XHF A;  3A3T A;  1O8W A;  4MF7 A;  2WS2 A;  1AQX A;  2N5B A;  3LYP A;  5G2Z A;  4IGJ A;  1V40 A;  1BED A;  3A2V A;  2OA7 A;  5ECK B;  4MDC A;  3CMI A;  2CAQ A;  3SWL A;  3TOU A;  16GS A;  1A8L A;  3ZRE A;  2X8C A;  2H0I A;  4Q5F A;  2EIR A;  5G1L A;  4X0X A;  3EUR A;  5CP1 A;  1DUG A;  1TU8 A;  5IMF A;  4IJI A;  1GTA A;  6GSX A;  3DXB A;  5J9C A;  3C73 A;  1K3O A;  5J3R A;  4MJB A;  1YKC A;  2V32 A;  1EWX A;  4ZIJ A;  1V58 A;  3TJJ A;  3US3 A;  3ERF A;  1IYI A;  2PWJ A;  3L9U A;  2JSY A;  4NV5 A;  3UOM A;  2PER A;  1GRX A;  4TR3 A;  4I2T A;  5ECN B;  1OC8 A;  1N8J A;  4MJA A;  3TGZ A;  2H73 A;  1MD4 A;  1XPV A;  4ZB8 A;  4JZQ A;  1U88 A;  4MPG A;  2DMM A;  3QD9 A;  3FR9 A;  2H8L A;  5BRT A;  2GVP A;  3C1S A;  5DAL B;  4Z2U A;  3BBY A;  5J41 A;  5GAN D;  4MPF A;  4XTS A;  4HSC X;  5F0G A;  2P5R A;  3W8S A;  3IC8 A;  2H30 A;  1GUH A;  4ML1 A;  1U87 A;  2C3T A;  3TRP A;  3TKR A;  1M3I A;  2JAD A;  4EIP A;  2LEG A;  4BVX B;  2XBQ A;  5G1K A;  1K3L A;  4G0K A;  1UC7 A;  4IN0 A;  3HDC A;  2VUP A;  5ID2 A;  4AF2 A;  2DJ2 A;  3I9V 2;  4OWY A;  2HSH A;  1PQN A;  2VOC A;  5AN1 A;  4KW6 A;  5IQY A;  4O92 A;  1T7P B;  5HR2 A;  5AIS A;  4KCE A;  4LMW A;  2H0G A;  4Q5Q A;  1M2A A;  2HRA A;  2LS5 A;  4TXO B;  3KZQ A;  2H74 A;  1ZYN A;  2N5F A;  5ECR B;  4F0B A;  1HNA A;  4DVC A;  4JBB A;  2VM2 A;  4IQ1 A;  4Z2T A;  2EIQ A;  3MNG A;  3TB2 A;  2H6Y A;  3GX0 A;  3RHB A;  2B3S A;  1A0R P;  4K5S A;  2HRF A;  5IOX A;  4ML6 A;  5CRE A;  3UEM A;  2HYX A;  5DQS A;  3VFI A;  5B6M A;  2KP1 A;  4Q5R A;  3F8U A;  4GST A;  2QSI A;  3HJM A;  2CVB A;  4CY6 A;  1O73 A;  3IRA A;  1OAZ A;  1LU4 A;  5G5E A;  1GP1 A;  3L9V A;  4K0G A;  2L59 A;  3IAS 2;  3KH7 A;  1U3I A;  4V1A p;  4NAX A;  3KCM A;  1USB A;  4MJE A;  4ACS A;  3LSZ A;  1SD9 A;  4N10 A;  1NW2 A;  2C0D A;  2DSA A;  2L6C A;  4G10 A;  2CVK A;  2MBT A;  4NXI A;  1XW5 A;  3GST A;  2NPB A;  4USS A;  2EIO A;  12GS A;  5GSS A;  1SEN A;  5D9W A;  1ZGN A;  4DSR A;  5DAL A;  2R37 A;  3UMA A;  2FGX A;  1O85 A;  3Q18 A;  3APS A;  2G0F A;  4K7N A;  1UA5 A;  1X0R A;  2GTU A;  3TDG A;  1S3A A;  4OFT A;  3ZZX A;  1F2E A;  1K0D A;  2KLX A;  5B7C A;  1SK0 A;  1ZMA A;  2HI7 A;  1FG4 A;  1TOF A;  2IWT A;  5LCZ A;  2DJ0 A;  4KUN A;  3TJF A;  1A8Y A;  4BVX A;  4O5U A;  4Z2R A;  4TR1 A;  1YJ6 A;  3CXG A;  5ECI B;  3EE2 A;  2IMI A;  3LWA A;  1QGV A;  3TJB A;  5DQY A;  3EMP A;  1BG5 A;  2X4A A;  3HCZ A;  5AGY A;  1SD8 A;  1XFL A;  1OC9 B;  2MZC A;  4YQV A;  4HI7 A;  5DBQ A;  3GL3 A;  4X4J A;  3FZ5 A;  4GRF A;  1YEX A;  2IN3 A;  4HUA A;  2HZE B;  4TXO A;  3C71 A;  1BJX A;  5H5S A;  3M9J A;  2JZR A;  3FEU A;  1GSQ A;  2K8S A;  4EXJ A;  4ICY A;  5LD0 A;  4F9Z A;  1HYU A;  5IOW A;  5IO2 A;  2DJK A;  4OCE A;  3KIJ A;  4KSO A;  4L5O A;  1M3J A;  2LJK A;  1G7E A;  4HOJ A;  22GS A;  2VCX A;  3TKP A;  3D5J A;  4AJ8 A;  1F9M A;  1PD2 1;  2L4Q A;  3SBC A;  3IXR A;  2WZ9 A;  1MDK A;  1GSE A;  4ZB9 A;  3ZYW A;  3PR8 A;  2B5X A;  5EY6 A;  3GUR A;  3W6G A;  3VPQ A;  5IM9 A;  2F9S A;  1OE8 A;  3I69 A;  4MZB A;  3TKS C;  2ES7 A;  5JWQ B;  2R3X A;  4K6X A;  3LOR A;  4P3Y B;  1K0N A;  2WRT A;  1PRX A;  3TOT A;  2L57 A;  4N30 A;  3TRX A;  1EGR A;  3KJY A;  2RUE A;  4KCA A;  1V2A A;  2I4A A;  3FRC A;  20GS A;  2VCW A;  1TI3 A;  1BAY A;  6GSV A;  2KHP A;  5G30 A;  4Q5N A;  2BTO T;  4IBP A;  5FWG A;  4HJ2 A;  4BIK A;  3ME8 A;  1ILO A;  3CYN A;  2YWI A;  5IMD A;  1ZYP A;  1OE7 A;  4XIH A;  1WE0 A;  5KEJ A;  3D4T A;  5HFG A;  2HRK A;  1EEJ A;  2VIM A;  3I43 A;  1EP7 A;  1GWC A;  2QA2 A;  2MMN A;  1AAZ A;  3WGX A;  1B48 A;  3UVT A;  3A5W A;  1E2Y A;  3TCO A;  1NHO A;  2DJ3 A;  2GT6 A;  2H70 A;  1X9W B;  3IV4 A;  3WGD A;  4L5L A;  2GZY A;  4BWS A;  4GCI A;  2ZNM A;  4GSS A;  3PGT A;  1PKZ A;  5KN1 A;  3RAZ A;  2IMK A;  2YNX A;  2OKA A;  4TR0 A;  1A23 A;  4IVF A;  1Z5Y E;  2KUC A;  4FYB A;  5DVB A;  4KH7 A;  2HSY A;  4I8B A;  2JU5 A;  2VD1 A;  5GST A;  1V57 A;  2H1D A;  3D6I A;  1SKW B;  1XOB A;  2I81 A;  3ZMK A;  5KOX A;  4POB A;  5A4U A;  1XOA A;  1T1V A;  4MH3 A;  4HZ2 A;  4FIW A;  2NBS A;  3QPM A;  1ON4 A;  1Q4J A;  4X1U A;  1A0F A;  2GZP A;  3ZML A;  1XVQ A;  5DJL A;  2O87 A;  4GTU A;  4XS4 B;  4J2F A;  4WKW A;  3QAV A;  4MK3 A;  3F3Q A;  4F0C A;  4QL7 A;  4K2X A;  4PTS A;  1XW9 A;  2OBI A;  4ZBD A;  4YKG A;  3IOS A;  2HLS A;  4I6X A;  4G2E A;  2V2G A;  3KH9 A;  3ZRD A;  1W89 A;  1MD3 A;  3G7Y A;  5J4U A;  4F03 A;  1EV9 A;  3FK8 A;  3KGK A;  1I9D A;  5FHI A;  8GSS A;  1GSS A;  2YWO A;  4IKH A;  1PX6 A;  1VRS D;  2IL3 A;  2FA4 A;  4LMV A;  1CQG A;  2ON5 A;  1XW6 A;  2O85 A;  3CSH A;  1YEP A;  3VWX A;  2EC4 A;  3CQF A;  1RW1 A;  1XXU A;  4WXT A;  2LQQ A;  4WET A;  2AUV A;  3GKN A;  1GTI A;  1TDI A;  2TIR A;  4XCS A;  5IMV A;  3LYK A;  1M9A A;  3HXS A;  4FQU A;  5J5N A;  2B5Y A;  1BQ7 A;  1NSW A;  1PGT A;  3GL5 A;  3GMF A;  5ENU A;  2I1U A;  2H72 A;  2AHE A;  3GN3 A;  3HVX A;  5CO3 A;  2B1K A;  4CY8 A;  1SJZ A;  2BJX A;  2CAI A;  5F07 A;  3L9S A;  3GKX A;  2WGR A;  1FW1 A;  5AIV A;  1ERT A;  1ERU A;  3H4K A;  3LXT A;  2V1M A;  4N0Z A;  2VL3 A;  4PUA A;  2FD3 A;  2HXK A;  1ZZY A;  5C04 A;  2H19 A;  1V9W A;  2B6M A;  2GDR A;  3ZLP A;  3ZFL A;  2V6O A;  2PN8 A;  3GTU B;  3LXZ A;  1AUC A;  2M80 A;  3RPN A;  4AJ7 A;  3IA1 A;  4XS1 A;  1TRW A;  1A24 A;  3UJ1 A;  3F6F A;  2H66 A;  1E6B A;  5D96 A;  2LRT A;  5EL8 A;  2FWE A;  5B8B A;  3G9B A;  5AIX A;  2VLV A;  1B9X C;  4ZB6 A;  5D8I A;  2GGT A;  4KE3 A;  2CVD A;  3BOA A;  1FB6 A;  5KN0 A;  2FUG 2;  1BX9 A;  4XS4 A;  4E8H A;  2B1L A;  3F4T A;  4EL1 A;  2WUL A;  3VWV A;  1ZYQ B;  2R0P A;  1S3C A;  1GTB A;  3DGQ A;  5IPH A;  2L6D A;  2YZU A;  2IIY A;  2HNL A;  5IPG A;  4ZBA A;  2K8V A;  2WJU A;  3P2A A;  3UAR A;  1DSB A;  1T8E B;  1JLW A;  5F8B A;  1TP9 A;  3O3T A;  1PKW A;  4N11 A;  5G5F A;  4TR1 B;  2KOK A;  2JZS A;  1AC1 A;  5ECO B;  3CTF A;  2H76 A;  1J0F A;  4PQI A;  1K0O A;  1SKR B;  2VLT A;  1M99 A;  4JED A;  2YWM A;  3KMO A;  5HR1 A;  4J56 E;  3P90 A;  2GZZ A;  3GKM A;  5DCG A;  1IYH A;  2XC2 A;  5IIZ A;  1PMT A;  3VI5 A;  4LA1 A;  5D93 A;  1EP8 A;  2O89 A;  5ECL B;  1SYX A;  4KX4 A;  1A2J A;  4IQA A;  3ZIT A;  3ZIV A;  4GF0 A;  4V1A g;  1WPI A;  4RI6 A;  2GST A;  4O5Q A;  3G7I A;  5DAK B;  1EOH A;  5B8A A;  2IMF A;  2VCV A;  3FZA A;  5HFK A;  3UAP A;  2FNO A;  3GTU A;  1H75 A;  1OKT A;  3D22 A;  4GQF A;  1WIK A;  2RLI A;  1GLP A;  1Y6E A;  5ECS A;  4K2D A;  2C3Q A;  2ZUP A;  4ECB A;  3QAG A;  4HS1 A;  3GUS A;  2DKI A;  2E2G A;  4BWQ A;  1UVZ A;  2JSZ A;  1FOV A;  1AQV A;  3RDW A;  5JWO B;  2DLX A;  3C7M A;  1X5D A;  3BCI A;  2GSQ A;  5D9T A;  1VF3 A;  3Q19 A;  2VM1 A;  4O5R A;  4NPB A;  1KEB A;  3FKF A; 
#chains in the Genus database with same CATH homology
 1Z3E A;  1C72 A;  3D4M A;  3P8W A;  1F37 A;  4HEA 2;  3C1R A;  4EE0 A;  2YP6 A;  3C8E A;  6GSY A;  3MWH A;  3TKS E;  3EU3 A;  2WDU A;  4ECI A;  4ISD A;  2DJJ A;  2HFD A;  5H5R A;  3VK9 A;  4KDU A;  2CV4 A;  3MDK A;  4JE1 A;  1XWG A;  1V98 A;  1KNG A;  1W4V A;  2GSS A;  2C80 A;  2JAC A;  4OO4 A;  3IHQ A;  4DEJ A;  1YQ1 A;  4MMM A;  2AJQ B;  1RQM A;  3I6A A;  2M46 A;  1BYE A;  2GT5 A;  1JZO A;  4EDZ A;  2P31 A;  3TKS A;  3UBL A;  1TK0 B;  4IHU A;  2XPE A;  3A2X A;  2H6X A;  4RI7 A;  3EMX A;  1VF2 A;  4MCU A;  1T00 A;  2X8G A;  3HJO A;  6GST A;  5CRG A;  1EV4 A;  5A4W A;  1F6M C;  6GSU A;  2DML A;  2YOI A;  2ALB A;  2CX4 A;  4TXV A;  4L8E A;  2C4J A;  1SYR A;  2P5Q A;  1DE2 A;  3EIN A;  3GSS A;  4HJM A;  3ED3 A;  2QGV A;  3GH9 A;  2DIY A;  3HY2 A;  3FZ4 A;  3KP9 A;  3H1N A;  2ZCT A;  4GXZ A;  5IMZ A;  4OCF A;  4I2U A;  4MLY A;  2YJH A;  5A5K A;  5DAK A;  4I5Q A;  3N5O A;  4V2M A;  1G6W A;  5EVO A;  4BVY B;  4DSS A;  3WGE A;  5CYY A;  4K7O A;  4GSN A;  2C0G A;  2C0F A;  3O76 A;  3IE3 A;  5JCG A;  2G2Q A;  1HD2 A;  1T4Z A;  3P7X A;  4EUY A;  1SJ6 A;  4D73 B;  1THO A;  2FY6 A;  1ST9 A;  2AV4 A;  1K0C A;  3VI7 A;  2MMO A;  3FR3 A;  2X49 A;  2M72 A;  3APQ A;  1YY7 A;  2L4C A;  3PPU A;  2O8V B;  4KDY A;  1ABA A;  3F4R A;  1QUW A;  2E0Q A;  2NTO A;  4XRA A;  1S3D A;  2H1B A;  1QFN A;  9GSS A;  4EKZ A;  1QMV A;  5COH A;  2IFQ B;  2RM6 A;  2C0E A;  5C00 A;  5J9B A;  2E7P A;  2P0G A;  4TVE A;  4PX1 A;  4V2N A;  2KP2 A;  3V1W A;  2K18 A;  1QXH A;  3CSI A;  3VPT A;  4HQZ A;  2C8U A;  2QC7 A;  5JCU A;  3G7J A;  5KN3 A;  5JWR B;  4YH2 A;  1FHE A;  2WB9 A;  1AIU A;  2K9F A;  2LV3 A;  3IAM 2;  1G7O A;  1O8X A;  4MJC A;  1OC3 A;  2YJ7 A;  2R4V A;  2H1G A;  3LQ7 A;  4YQU A;  1SL2 B;  2NDO A;  3LJR A;  3JCM L;  1TXX A;  2OE1 A;  1F3B A;  2XPD A;  4ILF A;  4ECJ A;  4NV2 A;  3EVI A;  1EGO A;  4TKY A;  4KAE A;  3ERG A;  4IP1 A;  4MH2 A;  1GSF A;  3BCK A;  4G19 A;  5LNK e;  1JHB A;  1GL8 A;  3CRT A;  3IDV A;  5ECQ B;  2VD0 A;  3O6T A;  1ERW A;  1PL2 A;  3K8N A;  1VF1 A;  1WRY A;  2VL2 C;  2REM A;  4Z7X A;  2C3N A;  3TJK A;  2H75 A;  2IME A;  3IHG A;  4OO5 A;  1DE1 A;  1TU7 A;  4EIQ A;  4EVM A;  4XRD A;  4K8M A;  1FVK A;  4O7H A;  4BVY A;  4BA7 A;  2VCZ A;  5B6N A;  1KBN A;  1XWK A;  2FCH A;  3FR6 A;  4FYU A;  1M7T A;  5CRD A;  1B9Y C;  4IEL A;  2L5O A;  2LRC A;  1LBK A;  3IK9 A;  2X99 A;  2HT9 A;  2CZ2 A;  2B7J A;  4D73 A;  2OAC A;  5ECP B;  2B7K A;  3HVV A;  1CQH A;  5CAX A;  1PL1 A;  3DYR A;  4MZW A;  3J7Y b;  3GFK A;  1R7H A;  2TRC P;  1EOG A;  1Z9H A;  1R26 A;  3VWU A;  3DRN A;  3DEX A;  1YKA A;  2F8A A;  3WYW A;  2VAF A;  4ULX A;  1X9M B;  2IJY A;  3KTL A;  1K0M A;  2CT6 A;  3FHK A;  4PNG A;  1M2D A;  2H0H A;  4XS6 A;  2HE3 A;  4AJ6 A;  3U5R E;  2IFQ A;  4HU9 A;  1R4W A;  4YKF A;  2FLS A;  3BJ5 A;  2YWN A;  3EC3 A;  4POM A;  4WEY A;  1WOU A;  2V41 A;  1HNC A;  2FWG A;  1M2B A;  3WT1 A;  2YCD A;  2A4V A;  1SK1 A;  3Q74 A;  1PN9 A;  4POL A;  1O6J A;  3D0Z A;  4K0N A;  1YZX A;  4PGT A;  2QA1 A;  3RBT A;  3MSZ A;  1OYJ A;  2PMT A;  3A2W A;  3M3M A;  1WWJ A;  3GIX A;  4GLT A;  2DBC A;  2FHE A;  2FWH A;  4MNN A;  1TW9 A;  4TOP A;  2LUS A;  3FZ9 A;  3KD0 A;  7GSS A;  1ACV A;  3ZTL A;  1XBS A;  3HYP A;  3FW2 A;  2YZH A;  4IS0 A;  2YAN A;  2YPM A;  1AQW A;  2FWF A;  5F06 A;  3IK7 A;  4CHS A;  2LST A;  4HZ4 A;  3FMW A;  4QQ7 A;  1A2M A;  4J57 E;  1YF1 A;  1NM3 A;  4RUV A;  3PH9 A;  3KMN A;  2DIZ A;  3NZN A;  4AGS A;  1X5E A;  4OFN A;  1F3A A;  2BMX A;  3R2Q A;  5DJM A;  2IMD A;  2LKU A;  1TK8 B;  4L0W A;  5DDL A;  5BMU A;  1GSY A;  2I9H A;  4TN8 A;  4EO3 A;  2LTK A;  2CX3 A;  3UIW A;  2OAD A;  1EZK A;  4E8E A;  1XWB A;  3IC4 A;  3GYK A;  4WF5 A;  5IMC A;  4LL4 B;  4IJ3 A;  2R2J A;  1NHY A;  4ID0 A;  4HQS A;  4X43 A;  3CTG A;  2YV9 A;  4KF9 A;  3MIX A;  5ECH B;  2VLU A;  4MF6 A;  4WR4 A;  1ML6 A;  3DKS A;  2AYT A;  2H1A A;  4HU7 A;  18GS A;  5ELA A;  5IMA A;  1B4P A;  2R5G A;  3APO A;  2LNS A;  4GQC A;  3F6D A;  2GSR A;  3TRQ A;  4FYC A;  4PUF C;  11GS A;  3FY7 A;  3QDN A;  2X8H A;  1Z7P A;  1Y25 A;  4HDE A;  2H01 A;  2GQK A;  4YAV A;  3IBH A;  4ECC A;  1M9B A;  4MZC A;  1ZOF A;  3J7Y k;  4LL1 B;  4PNF A;  4H86 A;  2MMA A;  5G31 A;  1JZD A;  19GS A;  3F0I A;  4BL7 B;  1YF0 A;  1Z6N A;  1K3Y A;  5DCH A;  1QQ2 A;  1A2L A;  2WCI A;  3IR4 A;  1I5G A;  3ZFB A;  2OBK A;  3DVW A;  5INY A;  2R0G A;  5E59 A;  3CSJ A;  4F82 A;  3HKR A;  2R6K A;  2TRX A;  4G0L A;  4TRX A;  3KM6 A;  1HNB A;  5IO0 A;  4DSS B;  3DD3 A;  2A2S A;  4EC0 A;  4DSQ A;  1TK5 B;  1DBY A;  3LW9 A;  5KN2 A;  4MF5 A;  2CZ3 A;  2CQ9 A;  5D73 A;  3W8J A;  2YN1 A;  3F9U A;  4TW5 A;  3GRX A;  3BD2 A;  3EWL A;  1GUL A;  2GLR A;  4POK A;  3GA4 A;  3LFL A;  3QOU A;  3TJG A;  1JZW A;  3EU4 A;  4YAP A;  2PPT A;  1PA3 A;  4LLR A;  1U3A A;  4CDO A;  1KTE A;  2V6K A;  2VCQ A;  6GSS A;  13GS A;  3HA9 A;  5L71 A;  1Z7R A;  3IPZ A;  5GZZ B;  4K5R A;  1WP0 A;  2C1Y A;  1GNW A;  4IP6 A;  4PQH A;  4BPY A;  2F8F A;  2CA8 A;  4G0I A;  1RK4 A;  2NVL A;  1OVN A;  3Q6O A;  2HSM A;  2VL9 A;  2PBJ A;  3TUE A;  4FO5 A;  3HZ8 A;  5HR3 A;  2QKE A;  2B5E A;  1FOH A;  3WD6 A;  1K0B A;  5A4V A;  1QK8 A;  5ECM B;  4OMV A;  1M0U A;  2LNT A;  5D9X A;  5HR0 A;  1FAA A;  1EEM A;  4MA9 A;  1VGL A;  2N5A A;  4ZIL A;  3L4N A;  1YDK A;  1N2A A;  4YQM A;  1AW9 A;  4G9H A;  1TRU A;  1SL0 B;  2D2Z A;  1Z6M A;  1XIY A;  1TI1 A;  5ABR A;  2RII A;  1TKD B;  2JL4 A;  4ZL9 A;  2MYG A;  4WR5 A;  1SL1 B;  1XCC A;  1PX7 A;  1VF4 A;  4IW9 A;  5H5Q A;  4PXO A;  5HFI A;  4PUR A;  1G6Y A;  2GQL A;  4N0V A;  4KND A;  4F2I A;  4WF4 A;  3ME7 A;  4BL7 A;  2OJL A;  4KA0 A;  17GS A;  5F05 A;  1SJI A;  3HVS A;  2E2M A;  4ZL8 A;  4KB3 A;  1WJK A;  3LG6 A;  2F51 A;  1X9S B;  4JRR A;  1LJR A;  2AAW A;  1GH2 A;  4NMU A;  4QL9 A;  1GLQ A;  2L5L A;  1O81 A;  2GS3 A;  1T4Y A;  1K0A A;  2RM5 A;  1GUK A;  4NHZ A;  1TRV A;  2OE3 A;  1ERV A;  1MDJ A;  1X5C A;  5CRW A;  4KSM A;  3GV1 A;  2FA8 A;  3L0H A;  3GHA A;  2VCT A;  3PIN A;  4NWY A;  4K1F A;  2HZF A;  1PN0 A;  3UBK A;  4ZBB A;  1J9B A;  4OFM A;  2VL2 A;  3WT2 A;  3GX8 A;  2F3M A;  3L78 A;  3E9J B;  1TRS A;  2DJ1 A;  2AB6 A;  3VWW A;  2A2P A;  5CNW A;  2A2R A;  4CW9 A;  4NHW A;  3DIE A;  3S9F A;  3MAK A;  4L0U A;  3H8Q A;  4ZXG A;  1B4Q A;  2ON7 A;  3D21 A;  3LEF A;  3DWV A;  2PGT A;  3VUR A;  2R0C A;  1GNE A;  14GS A;  3QMX A;  1UN2 A;  3ZVJ D;  2H71 A;  2OE0 A;  1SU9 A;  4TR4 A;  3QR6 A;  4MP4 A;  2X64 A;  4XHM A;  2PU9 C;  1XWA A;  1SKS B;  4I97 A;  3QFA C;  3E3E A;  5GAP D;  3M0F A;  3EPT A;  1FB0 A;  4EF0 A;  3E0U A;  4KDX A;  1XVW A;  3QCP A;  1MDI A;  3M1G A;  1ZYE A;  3NIV A;  3R3E A;  3N9J A;  3F3R A;  3DML A;  2PVQ A;  5JCW A;  2VO4 A;  2PUK C;  1URM A;  3ERW A;  3M8N A;  5HQP A;  1FO5 A;  1G0T A;  1WMJ A;  3H79 A;  5E4W A;  5KOW A;  2O7K A;  3MYD A;  2DKH A;  1B8X A;  3F63 A;  3A5I A;  1PSQ A;  1Q98 A;  2YV7 A;  2A4H A;  1XZO A;  4A5P A;  3HHV A;  3AY8 A;  3GKK A;  2DC5 A;  1GUM A;  3KP8 A;  2PVO C;  3KEB A;  3HD5 A;  4JR4 A;  1FVJ A;  2XBI A;  2Z9S A;  3ZVJ A;  2LRN A;  1SK2 A;  2LQO A;  4RQX A;  1OC9 A;  3HJP A;  3FYG A;  5FT3 A;  4MAB A;  3NOF A;  10GS A;  2RUF A;  1GSU A;  1HQO A;  2HZE A;  2GQM A;  4GWR A;  1XWC A;  4JR6 A;  3UL3 A;  2I3Y A;  5D9V A;  3OR5 A;  4WBR D;  3TKQ A;  2MBS A;  1MEK A;  3H93 A;  1THX A;  1JZR A;  2JZT A;  3UVH A;  3KTB A;  3U6V A;  2J9H A;  1MTC A;  1AXD A;  1O7U A;  4EDY A;  3ZL5 A;  2HRN A;  3CBU A;  3LGC A;  1U6T A;  4KGI A;  1ZCP A;  3RHC A;  2WFC A;  3M9K A;  1ZL9 A;  5ELG A;  4K7I A;  2H6Z A;  3HZ4 A;  3GH6 A;  4OD7 A;  1J08 A;  4O32 A;  3GNJ A;  4JU5 A;  3QAW A;  3DVX A;  1H4O A;  4K9Z A;  2MMZ A;  2UZ8 A;  4V2L A;  4FH8 A;  1T3B A;  2IPA A;  6GSW A;  3F4S A;  2K6V A;  5ID2 B;  4WBJ A;  1JLV A;  3KXO A;  1TTZ A;  3VLN A;  1JFU A;  3EYT A;  3ISO A;  5CRH A;  1R5A A;  1GTU A;  2LJA A;  3ZIJ A;  4ZL7 A;  1R5P A;  1TJD A;  4PQ1 A;  1OKD A;  4RQR A;  2LJR A;  3RPP A;  3CRU A;  1GSD A;  5EPF A;  2J23 A;  3QFB C;  2XHF A;  3A3T A;  1O8W A;  4MF7 A;  2WS2 A;  1AQX A;  2N5B A;  3LYP A;  5G2Z A;  4IGJ A;  1V40 A;  1BED A;  3A2V A;  2OA7 A;  5ECK B;  4MDC A;  3CMI A;  2CAQ A;  3SWL A;  3TOU A;  16GS A;  1A8L A;  3ZRE A;  2X8C A;  2H0I A;  4Q5F A;  2EIR A;  5G1L A;  4X0X A;  3EUR A;  5CP1 A;  1DUG A;  1TU8 A;  5IMF A;  4IJI A;  1GTA A;  6GSX A;  3DXB A;  5J9C A;  3C73 A;  1K3O A;  5J3R A;  4MJB A;  1YKC A;  2V32 A;  1EWX A;  4ZIJ A;  1V58 A;  3TJJ A;  3US3 A;  3ERF A;  1IYI A;  2PWJ A;  3L9U A;  2JSY A;  4NV5 A;  3UOM A;  2PER A;  1GRX A;  4TR3 A;  4I2T A;  5ECN B;  1OC8 A;  1N8J A;  4MJA A;  3TGZ A;  2H73 A;  1MD4 A;  1XPV A;  4ZB8 A;  4JZQ A;  1U88 A;  4MPG A;  2DMM A;  3QD9 A;  3FR9 A;  2H8L A;  5BRT A;  2GVP A;  3C1S A;  5DAL B;  4Z2U A;  3BBY A;  5J41 A;  5GAN D;  4MPF A;  4XTS A;  5F0G A;  2P5R A;  3W8S A;  3IC8 A;  2H30 A;  1GUH A;  4ML1 A;  1U87 A;  2C3T A;  3TRP A;  3TKR A;  2JAD A;  4EIP A;  2LEG A;  4BVX B;  2XBQ A;  5G1K A;  1K3L A;  4G0K A;  1UC7 A;  4IN0 A;  3HDC A;  2VUP A;  5ID2 A;  4AF2 A;  2DJ2 A;  3I9V 2;  4OWY A;  2HSH A;  1PQN A;  2VOC A;  5AN1 A;  4KW6 A;  5IQY A;  4O92 A;  1T7P B;  5HR2 A;  5AIS A;  4KCE A;  4LMW A;  2H0G A;  4Q5Q A;  1M2A A;  2HRA A;  2LS5 A;  4TXO B;  3KZQ A;  2H74 A;  1ZYN A;  2N5F A;  5ECR B;  4F0B A;  1HNA A;  4DVC A;  4JBB A;  2VM2 A;  4IQ1 A;  4Z2T A;  2EIQ A;  3MNG A;  3TB2 A;  2H6Y A;  3GX0 A;  3RHB A;  2B3S A;  1A0R P;  4K5S A;  2HRF A;  5IOX A;  4ML6 A;  5CRE A;  3UEM A;  2HYX A;  5DQS A;  3VFI A;  5B6M A;  2KP1 A;  4Q5R A;  3F8U A;  4GST A;  2QSI A;  3HJM A;  2CVB A;  4CY6 A;  1O73 A;  3IRA A;  1OAZ A;  1LU4 A;  5G5E A;  1GP1 A;  3L9V A;  4K0G A;  2L59 A;  3IAS 2;  3KH7 A;  1U3I A;  4V1A p;  4NAX A;  3KCM A;  1USB A;  4MJE A;  4ACS A;  3LSZ A;  1SD9 A;  4N10 A;  1NW2 A;  2C0D A;  2DSA A;  2L6C A;  4G10 A;  2CVK A;  2MBT A;  4NXI A;  1XW5 A;  3GST A;  2NPB A;  4USS A;  2EIO A;  12GS A;  5GSS A;  1SEN A;  5D9W A;  1ZGN A;  4DSR A;  5DAL A;  2R37 A;  3UMA A;  2FGX A;  1O85 A;  3Q18 A;  3APS A;  2G0F A;  4K7N A;  1UA5 A;  1X0R A;  2GTU A;  3TDG A;  1S3A A;  4OFT A;  3ZZX A;  1F2E A;  1K0D A;  2KLX A;  5B7C A;  1SK0 A;  1ZMA A;  2HI7 A;  1FG4 A;  1TOF A;  2IWT A;  5LCZ A;  2DJ0 A;  4KUN A;  3TJF A;  1A8Y A;  4BVX A;  4O5U A;  4Z2R A;  4TR1 A;  1YJ6 A;  3CXG A;  5ECI B;  3EE2 A;  2IMI A;  3LWA A;  1QGV A;  3TJB A;  5DQY A;  3EMP A;  1BG5 A;  2X4A A;  3HCZ A;  5AGY A;  1SD8 A;  1XFL A;  1OC9 B;  2MZC A;  4YQV A;  4HI7 A;  5DBQ A;  3GL3 A;  4X4J A;  3FZ5 A;  4GRF A;  1YEX A;  2IN3 A;  4HUA A;  2HZE B;  4TXO A;  3C71 A;  1BJX A;  5H5S A;  3M9J A;  2JZR A;  3FEU A;  1GSQ A;  2K8S A;  4EXJ A;  4ICY A;  5LD0 A;  4F9Z A;  1HYU A;  5IOW A;  5IO2 A;  2DJK A;  4OCE A;  3KIJ A;  4KSO A;  4L5O A;  2LJK A;  1G7E A;  4HOJ A;  22GS A;  2VCX A;  3TKP A;  3D5J A;  4AJ8 A;  1F9M A;  1PD2 1;  2L4Q A;  3SBC A;  3IXR A;  2WZ9 A;  1MDK A;  1GSE A;  4ZB9 A;  3ZYW A;  3PR8 A;  2B5X A;  5EY6 A;  3GUR A;  3W6G A;  3VPQ A;  5IM9 A;  2F9S A;  1OE8 A;  3I69 A;  4MZB A;  3TKS C;  2ES7 A;  5JWQ B;  2R3X A;  4K6X A;  3LOR A;  4P3Y B;  1K0N A;  2WRT A;  1PRX A;  3TOT A;  2L57 A;  4N30 A;  3TRX A;  1EGR A;  3KJY A;  2RUE A;  4KCA A;  1V2A A;  2I4A A;  3FRC A;  20GS A;  2VCW A;  1TI3 A;  1BAY A;  6GSV A;  2KHP A;  5G30 A;  4Q5N A;  2BTO T;  4IBP A;  5FWG A;  4HJ2 A;  3ME8 A;  1ILO A;  3CYN A;  2YWI A;  5IMD A;  1ZYP A;  1OE7 A;  4XIH A;  1WE0 A;  5KEJ A;  3D4T A;  5HFG A;  2HRK A;  1EEJ A;  2VIM A;  3I43 A;  1EP7 A;  1GWC A;  2QA2 A;  2MMN A;  1AAZ A;  3WGX A;  1B48 A;  3UVT A;  3A5W A;  1E2Y A;  3TCO A;  1NHO A;  2DJ3 A;  2GT6 A;  2H70 A;  1X9W B;  3IV4 A;  3WGD A;  4L5L A;  2GZY A;  4BWS A;  4GCI A;  2ZNM A;  4GSS A;  3PGT A;  1PKZ A;  5KN1 A;  3RAZ A;  2IMK A;  2YNX A;  2OKA A;  4TR0 A;  1A23 A;  4IVF A;  1Z5Y E;  2KUC A;  4FYB A;  5DVB A;  4KH7 A;  2HSY A;  4I8B A;  2JU5 A;  2VD1 A;  5GST A;  1V57 A;  2H1D A;  3D6I A;  1SKW B;  1XOB A;  2I81 A;  3ZMK A;  5KOX A;  4POB A;  5A4U A;  1XOA A;  1T1V A;  4MH3 A;  4HZ2 A;  4FIW A;  2NBS A;  3QPM A;  1ON4 A;  1Q4J A;  4X1U A;  1A0F A;  2GZP A;  3ZML A;  1XVQ A;  5DJL A;  2O87 A;  4GTU A;  4XS4 B;  4J2F A;  4WKW A;  3QAV A;  4MK3 A;  3F3Q A;  4F0C A;  4QL7 A;  4K2X A;  4PTS A;  1XW9 A;  2OBI A;  4ZBD A;  4YKG A;  3IOS A;  2HLS A;  4I6X A;  4G2E A;  2V2G A;  3KH9 A;  3ZRD A;  1W89 A;  1MD3 A;  3G7Y A;  5J4U A;  4F03 A;  1EV9 A;  3FK8 A;  3KGK A;  1I9D A;  5FHI A;  8GSS A;  1GSS A;  2YWO A;  4IKH A;  1PX6 A;  1VRS D;  2IL3 A;  2FA4 A;  4LMV A;  1CQG A;  2ON5 A;  1XW6 A;  2O85 A;  3CSH A;  1YEP A;  3VWX A;  2EC4 A;  1RW1 A;  1XXU A;  4WXT A;  2LQQ A;  4WET A;  2AUV A;  3GKN A;  1GTI A;  1TDI A;  2TIR A;  4XCS A;  5IMV A;  3LYK A;  1M9A A;  3HXS A;  4FQU A;  5J5N A;  2B5Y A;  1BQ7 A;  1NSW A;  1PGT A;  3GL5 A;  3GMF A;  5ENU A;  2I1U A;  2H72 A;  2AHE A;  3GN3 A;  3HVX A;  5CO3 A;  2B1K A;  4CY8 A;  1SJZ A;  2BJX A;  2CAI A;  5F07 A;  3L9S A;  3GKX A;  2WGR A;  1FW1 A;  5AIV A;  1ERT A;  1ERU A;  3H4K A;  3LXT A;  2V1M A;  4N0Z A;  2VL3 A;  4PUA A;  2FD3 A;  2HXK A;  1ZZY A;  5C04 A;  2H19 A;  1V9W A;  2B6M A;  2GDR A;  3ZLP A;  3ZFL A;  2V6O A;  2PN8 A;  3GTU B;  3LXZ A;  1AUC A;  2M80 A;  3RPN A;  4AJ7 A;  3IA1 A;  4XS1 A;  1TRW A;  1A24 A;  3UJ1 A;  3F6F A;  2H66 A;  1E6B A;  5D96 A;  2LRT A;  5EL8 A;  2FWE A;  5B8B A;  3G9B A;  5AIX A;  2VLV A;  1B9X C;  4ZB6 A;  5D8I A;  2GGT A;  4KE3 A;  2CVD A;  3BOA A;  1FB6 A;  5KN0 A;  2FUG 2;  1BX9 A;  4XS4 A;  4E8H A;  2B1L A;  3F4T A;  4EL1 A;  2WUL A;  3VWV A;  1ZYQ B;  2R0P A;  1S3C A;  1GTB A;  3DGQ A;  5IPH A;  2L6D A;  2YZU A;  2IIY A;  2HNL A;  5IPG A;  4ZBA A;  2K8V A;  2WJU A;  3P2A A;  3UAR A;  1DSB A;  1T8E B;  1JLW A;  5F8B A;  1TP9 A;  3O3T A;  1PKW A;  4N11 A;  5G5F A;  4TR1 B;  2KOK A;  2JZS A;  1AC1 A;  5ECO B;  3CTF A;  2H76 A;  1J0F A;  4PQI A;  1K0O A;  1SKR B;  2VLT A;  1M99 A;  4JED A;  2YWM A;  3KMO A;  5HR1 A;  4J56 E;  3P90 A;  2GZZ A;  3GKM A;  5DCG A;  1IYH A;  2XC2 A;  5IIZ A;  1PMT A;  3VI5 A;  4LA1 A;  5D93 A;  1EP8 A;  2O89 A;  5ECL B;  1SYX A;  4KX4 A;  1A2J A;  4IQA A;  3ZIT A;  3ZIV A;  4GF0 A;  4V1A g;  1WPI A;  4RI6 A;  2GST A;  4O5Q A;  3G7I A;  5DAK B;  1EOH A;  5B8A A;  2IMF A;  2VCV A;  3FZA A;  5HFK A;  3UAP A;  2FNO A;  3GTU A;  1H75 A;  1OKT A;  3D22 A;  4GQF A;  1WIK A;  2RLI A;  1GLP A;  1Y6E A;  5ECS A;  4K2D A;  2C3Q A;  2ZUP A;  4ECB A;  3QAG A;  4HS1 A;  3GUS A;  2DKI A;  2E2G A;  4BWQ A;  1UVZ A;  2JSZ A;  1FOV A;  1AQV A;  3RDW A;  5JWO B;  2DLX A;  3C7M A;  1X5D A;  3BCI A;  2GSQ A;  5D9T A;  1VF3 A;  3Q19 A;  2VM1 A;  4O5R A;  4NPB A;  1KEB A;  3FKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...