3TUEA

The structure of tryparedoxin peroxidase i from leishmania major
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
GNAKINSPAPSFEEVALMPNGSFKKISLSSYKGKWVVLFFYPLDFTFVCPTEVIAFSDSVSRFNELNCEVLACSIDSEYAHLQWTLQDRKKGGLGTMAIPILADKTKNIARSYGVLEESQGVAYRGLFIIDPHGMLRQITVNDMPVGRSVEEVLRLLEAFQFVEKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Tryparedoxin peroxidase
publication title The crystal structures of the tryparedoxin-tryparedoxin peroxidase couple unveil the structural determinants of leishmania detoxification pathway.
pubmed doi rcsb
source organism Leishmania major
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tueA00
3QCPA 1TRVA 3TJKA 4F2IA 4GSSA 4KSMA 3HJOA 3DMLA 4KGIA 3TRPA 3QPMA 4NWYA 1ON4A 2C3QA 4KA0A 3VWWA 3L78A 5HFGA 1YQ1A 3W8JA 1GNWA 3MSZA 3MDKA 4NHZA 1EV4A 1MDIA 3SBCA 2VLVA 5IMZA 2C1YA 3TKSA 1O81A 3FHKA 1GNEA 4HDEA 4IBPA 5DALA 4FYCA 1SKWB 2B1KA 1M99A 2C80A 2GT5A 3Q6OA 3BBYA 5B8AA 2HRFA 4F0CA 3WT1A 3N5OA 4O7HA 2V1MA 4XHMA 1R5PA 3G9BA 2PU9C 3CTFA 5A5KA 2X64A 2GVPA 5IO0A 4TVEA 3LXTA 4ID0A 3GURA 2PVQA 2AYTA 1FB0A 1SK1A 4BWSA 1JFUA 2DJ3A 2BMXA 1G7OA 4WKWA 5AN1A 3FZAA 4J2FA 2DMLA 1DUGA 1UA5A 2CX3A 3IOSA 1K0DA 1ZMAA 2TIRA 4K0NA 3CYNA 4EF0A 4KE3A 2IMFA 2A2SA 1C72A 1AQWA 5IO2A 3ZITA 3HJPA 2CZ2A 1YEXA 3GKNA 4O32A 1PRXA 2GSQA 2OA7A 1A2LA 4EE0A 2AV4A 1SD8A 1GH2A 1GSYA 4EC0A 4QQ7A 5AGYA 2CAQA 3M1GA 2OBKA 4WBRD 1WIKA 3E9JB 3KTBA 3FEUA 2ZUPA 5ID2B 19GSA 4KDYA 2YV7A 5C04A 2VCQA 3P7XA 3ZTLA 2DJKA 4RUVA 2TRCP 1URMA 2J9HA 1SU9A 2P5QA 1XIYA 3VK9A 1XZOA 5GZZB 1Y25A 1K0MA 1J9BA 3ZVJD 1HNAA 1FVJA 5G1KA 2OKAA 1K3LA 1WE0A 3HA9A 1X5DA 2H1AA 1GL8A 5ECPB 1U3AA 2MBSA 6GSWA 1K0BA 1T7PB 3F3QA 2JACA 3TDGA 1A8LA 3H1NA 2YP6A 2ES7A 2P5RA 3EU3A 2RUEA 3TRXA 4L0UA 4MCUA 3QAGA 3ME8A 4MZBA 5JWQB 2KUCA 4XRDA 4K1FA 3H8QA 1XWBA 5D73A 1M2AA 4EKZA 5ELAA 1X9MB 2H66A 4EO3A 3ZFBA 1SJZA 1HD2A 3UAPA 4FH8A 4RQXA 4ML6A 4N30A 5ECSA 3PR8A 1EZKA 1B8XA 1TXXA 2D2ZA 2YJ7A 2TRXA 3KH9A 3LQ7A 1B9XC 1BAYA 3OR5A 1HYUA 4TKYA 1RK4A 3IK9A 2VD0A 2HYXA 3HVXA 1O73A 3IAS2 2OBIA 1EWXA 5CO3A 3I43A 3U6VA 1BYEA 5A4UA 3GKMA 4KH7A 3W8SA 2FUG2 2FWHA 4KDXA 3TOUA 4MDCA 2JZTA 1A23A 4V2NA 3FR9A 1TKDB 2H72A 1AQVA 3BCKA 1PL1A 1AAZA 4K6XA 5E59A 1ACVA 4NAXA 1Z7PA 3NIVA 2O8VB 2H6XA 4TR4A 1E6BA 1BJXA 3UIWA 4JBBA 2WRTA 3LYPA 3D21A 4HI7A 4H86A 2GS3A 5IMVA 4POKA 5F06A 2XHFA 1GTUA 3HD5A 1WPIA 3TKSE 1W4VA 1H4OA 2IFQB 2H71A 2LEGA 1O85A 1JZOA 3QAWA 1Q98A 3WGXA 2WZ9A 4XS4A 6GSUA 4MF6A 2I81A 4ZB6A 3ERWA 1H75A 1OE7A 2F8AA 1R4WA 4IS0A 4J56E 1WWJA 4DSSB 4N0ZA 2GGTA 2VAFA 3DGQA 3IA1A 4HZ4A 5KN2A 3ZRDA 4IJ3A 1XVQA 4ECJA 1X0RA 5D9WA 3BCIA 5DCHA 5ECLB 4K8MA 3FZ4A 2H6YA 5H5RA 2LRNA 5KEJA 4GQCA 1NM3A 1YJ6A 2IIYA 3O76A 1SL0B 4TR3A 2DSAA 4AJ8A 5CREA 2DJ1A 1M9AA 1U6TA 1SYXA 1VF1A 5JCUA 3KGKA 1EV9A 1Z7RA 4TRXA 3E3EA 1A0RP 3IR4A 1NHOA 1TOFA 1ERWA 1HNBA 2X8CA 2KP2A 1TRUA 3VFIA 4N0VA 2YWOA 5AIXA 2EIRA 4PQ1A 3ISOA 4MPGA 3MNGA 2H30A 3UOMA 2B1LA 1VGLA 4MJCA 1GULA 1TI1A 3ZVJA 5DALB 3US3A 4POLA 3TKRA 3GNJA 2WFCA 3NZNA 2KHPA 1PMTA 1TDIA 3F4RA 1F6MC 3EMXA 2PVOC 4KW6A 2V41A 4Q5FA 5CRDA 3GX0A 4L8EA 4KAEA 5IMFA 1XWCA 3GH9A 1PL2A 1OC3A 5IIZA 3GV1A 2FD3A 5HR1A 1M9BA 3GL3A 4ZILA 2C3TA 1EOHA 4WEYA 2HNLA 5IQYA 1U87A 2VD1A 1CQGA 2OE1A 1K0AA 3HVSA 5GAND 2XBIA 2O85A 1QK8A 1ST9A 3J7Yb 1FAAA 1FVKA 3BOAA 1G6YA 3KD0A 1LBKA 1X5CA 5ECIB 1DSBA 2C4JA 3KP9A 1T3BA 2R6KA 1GTBA 3GA4A 2MMAA 1EGRA 3VPTA 3PH9A 2J23A 4WR5A 3EURA 2WULA 1RW1A 5F07A 1VRSD 5HR3A 2AUVA 4K0GA 2GT6A 2O87A 1T00A 3QFAC 2WJUA 3IV4A 4JRRA 4MH3A 5D9VA 5AIVA 5B8BA 4GLTA 5FHIA 1N2AA 4EVMA 4KCAA 2VCVA 4GXZA 1QXHA 2JADA 1XWKA 1MD3A 4GWRA 1WMJA 4K7IA 3FYGA 4XS1A 4YQVA 2IMKA 4LLRA 3ZREA 2V32A 3ERFA 2CQ9A 2FHEA 2HZFA 4WR4A 1TK8B 1BX9A 4V1Ap 2BJXA 1YKCA 4IP1A 3HZ4A 3TJJA 3DIEA 3GYKA 2H0IA 4POMA 3ERGA 1ML6A 4I8BA 1THOA 5KN0A 5ABRA 1YDKA 2GZYA 4TR1B 2R5GA 3UEMA 1XWGA 5ELGA 1WOUA 1ZZYA 6GSTA 1BQ7A 4F03A 4MA9A 1ZCPA 2VCTA 2HXKA 1OC9A 2IMEA 5IOXA 3ED3A 2GQKA 3TKPA 1JLVA 4BA7A 2O7KA 1XPVA 5J3RA 4MPFA 5HFIA 2F9SA 1Q4JA 4EXJA 1A8YA 4I97A 3GSSA 4BVYA 3HHVA 3V1WA 4XRAA 1ZL9A 2PGTA 3D0ZA 2X99A 2VO4A 3FZ5A 4IN0A 3QOUA 1E2YA 2PERA 1IYHA 4JR4A 3IE3A 4V2MA 5KN3A 1I9DA 4NPBA 2IMDA 4G10A 2C0EA 5CAXA 1G6WA 2DJJA 3I9V2 4P3YB 4PQHA 5DAKA 4N11A 4Q5RA 5J4UA 3LSZA 3EVIA 1QFNA 2MZCA 1O8WA 1F9MA 4MK3A 1A2MA 5CRHA 1OKTA 2HT9A 3P8WA 1R5AA 2HZEA 5DDLA 2LV3A 4HQSA 4JEDA 4ZBAA 5G2ZA 2H0HA 3GHAA 4NMUA 3IBHA 3KIJA 1YF1A 5GSSA 1S3AA 1X5EA 2QSIA 1ERUA 1DE2A 1OC8A 1QQ2A 3L9UA 2NBSA 2YNXA 2K8SA 3BD2A 3HCZA 1B9YC 3VURA 1AXDA 2MYGA 2VL2C 4HU7A 4FYBA 2OJLA 1I5GA 20GSA 3APOA 1TI3A 5HR0A 1O6JA 1V58A 4WETA 2NTOA 5A4VA 3QMXA 1ILOA 5H5QA 4QL7A 3DRNA 4CDOA 5DQYA 2O89A 3M3MA 1T4ZA 4I2TA 1AIUA 3DWVA 3H79A 1MDJA 2V6OA 1GSUA 4HUAA 4LA1A 5IOWA 3ZMLA 4XS4B 1X9SB 2F8FA 4KX4A 3FW2A 2XBQA 4RI6A 3M9KA 1J08A 4G9HA 4ULXA 1PGTA 3D4TA 5B6NA 2FWFA 1B4PA 1G0TA 1TP9A 2G0FA 4TR1A 3CBUA 1GP1A 1GWCA 5J9BA 4IHUA 5DJMA 3TOTA 1K3OA 2JSZA 1USBA 1GUMA 1EP7A 3M8NA 4ZB9A 1KNGA 3VI7A 5IPGA 8GSSA 4HU9A 3HY2A 4K9ZA 3RAZA 3LORA 4DSQA 3FZ9A 4TW5A 2H01A 1GSDA 3LG6A 4OO5A 1GUHA 2B6MA 1GSQA 1TRSA 2CVBA 2WS2A 4KNDA 5D9TA 3HXSA 1BEDA 4OMVA 4FYUA 2VCWA 4PUFC 2NPBA 1GLQA 2N5BA 4J57E 2DLXA 2F3MA 5G1LA 2RM6A 4I6XA 4TN8A 5IMDA 2E7PA 4HOJA 1B4QA 1YY7A 2YJHA 3QAVA 2WB9A 5ECMB 3D6IA 1UC7A 4RQRA 2GZPA 2B5XA 4XIHA 1GRXA 5COHA 3BJ5A 4IP6A 3P2AA 4GCIA 3W6GA 4V2LA 2L4QA 4DVCA 4PUAA 1AC1A 4AGSA 2DBCA 2NDOA 4YH2A 2F51A 2K18A 5FWGA 5JWRB 2L6DA 2LTKA 3GL5A 5JWOB 3CXGA 3KXOA 5ECKB 5D93A 3LFLA 2OE0A 1YZXA 2CVDA 3EC3A 3F0IA 6GSYA 2E2GA 5ECNB 14GSA 6GSVA 3DKSA 2H8LA 2R3XA 2YV9A 3F9UA 3UVHA 2M46A 2YZUA 3AY8A 4OCEA 4ZIJA 4JR6A 3TKQA 12GSA 3PGTA 3KH7A 4WF5A 4IW9A 3HYPA 2LQOA 4MZWA 2L57A 1XOAA 1LJRA 13GSA 5C00A 3F6DA 2NVLA 4E8HA 4LMWA 1DBYA 3HVVA 3IRAA 1WP0A 3WT2A 2QKEA 3D4MA 5CNWA 1GSFA 3UARA 4GRFA 1XW9A 2QGVA 4D73B 3TRQA 4ZBDA 4TXOA 3LWAA 5E4WA 2I9HA 3GSTA 22GSA 1SD9A 5IM9A 3APSA 2VM1A 3L9SA 4IGJA 3DXBA 3C73A 17GSA 4NV5A 1MTCA 5J5NA 3WGEA 3RDWA 4FIWA 3PINA 5ECQB 3VWVA 1THXA 4PURA 3DYRA 5ECHB 3TKSC 1K0NA 18GSA 1JZRA 3VI5A 2Z9SA 2GSTA 3N9JA 3F63A 2PUKC 1O8XA 3EWLA 2MMOA 2AJQB 3KJYA 3JCML 5G30A 1OC9B 5F8BA 3E0UA 4RI7A 1ZYQB 5DCGA 1MEKA 3A5WA 3FR6A 2I1UA 2VCZA 4K2DA 2WDUA 3UJ1A 3IHQA 3ZIJA 4HQZA 4ZB8A 3H4KA 1MDKA 5F0GA 2YZHA 2H76A 4PGTA 3KCMA 2XC2A 3GTUA 4YQMA 2REMA 2V2GA 4XS6A 3TUEA 2CT6A 4LL1B 3IDVA 2WCIA 9GSSA 4L5OA 1OE8A 2HRNA 4O92A 4Q5NA 4IJIA 2R2JA 1SJ6A 3GKXA 4G2EA 6GSXA 1CQHA 4L0WA 2DC5A 1V40A 5DAKB 2G2QA 1YKAA 2C0FA 1A0FA 3HDCA 5A4WA 1Z9HA 2AAWA 2A2RA 5DBQA 1LU4A 1FG4A 4MF5A 3UBLA 2HZEB 1HQOA 1M2DA 2V6KA 5DVBA 4HS1A 3TCOA 2VIMA 4BWQA 3C71A 2IPAA 2IN3A 5ENUA 1EOGA 1N8JA 2RIIA 1VF3A 4OFMA 4HJ2A 2GTUA 1UN2A 2FCHA 2A4VA 2CA8A 2H74A 2EIQA 2JL4A 4EDZA 2ZNMA 4AJ6A 4X43A 5ECOB 2YPMA 5CYYA 2EIOA 2B7JA 1FB6A 3CSIA 3IPZA 1EGOA 1X9WB 3IC4A 2HSHA 4D73A 1JLWA 3RHBA 1GSEA 1GTAA 3C8EA 2GSSA 1T8EB 3GFKA 5G5EA 1ZGNA 1V57A 4GSTA 2FWEA 1SKRB 3F4TA 2HLSA 1KTEA 3UBKA 4DEJA 2KLXA 5H5SA 1EP8A 1TU8A 4HZ2A 5KN1A 1K0OA 2ZCTA 3C1RA 6GSSA 4IQ1A 1NSWA 1AUCA 1K3YA 1S3CA 2ON7A 3F6FA 2ON5A 1FO5A 4N10A 5HQPA 2QC7A 4I5QA 3L0HA 2DJ0A 2CVKA 1NHYA 4OWYA 2GZZA 1SL2B 1YEPA 2OACA 4MH2A 1U3IA 5D96A 3LXZA 1TRWA 3SWLA 4K7NA 4I2UA 3GX8A 3CRUA 5ECRB 1TU7A 2CX4A 3HZ8A 4ECBA 4EDYA 1XCCA 2VCXA 2K8VA 3EMPA 3DD3A 3S9FA 3ZFLA 2YANA 1PX7A 3LYKA 2VUPA 3UL3A 3H93A 4ISDA 5FT3A 2CV4A 2H75A 1BG5A 2OE3A 1NW2A 5CRWA 3G7YA 2M72A 4AJ7A 1O7UA 4X0XA 2I4AA 3WYWA 1W89A 3A3TA 2JSYA 3R2QA 4HJMA 4ILFA 3C1SA 3Q18A 1HNCA 4FO5A 1S3DA 1AW9A 3VPQA 1M0UA 2P0GA 4MP4A 3UMAA 4PXOA 4OFNA 3QD9A 1V2AA 1EEMA 2KOKA 2B3SA 2FY6A 2FLSA 4ML1A 4LL4B 1B48A 1V9WA 2HSYA 3F3RA 4ECCA 4QL9A 2WGRA 5CRGA 1OAZA 3O3TA 1TK5B 4ZL9A 2YCDA 2LNSA 5D8IA 1YF0A 3NOFA 2L6CA 4EL1A 3G7IA 2AHEA 5DQSA 3FRCA 4GSNA 5JCGA 3KTLA 16GSA 4WF4A 3KZQA 3U5RE 1WJKA 3TJBA 3A2VA 1TJDA 3ZYWA 3EYTA 5LD0A 4WXTA 2L4CA 4NHWA 1GTIA 3L9VA 2CAIA 3TGZA 3RHCA 1PX6A 1QGVA 1M7TA 4CW9A 3GRXA 3J7Yk 1TK0B 3QR6A 4GTUA 4MLYA 3Q74A 2X8GA 4IKHA 3GH6A 1T4YA 1FOVA 2JZRA 4JU5A 3KEBA 3Q19A 4TXOB 2C0DA 1OVNA 1Z6NA 4XTSA 3WGDA 1PKZA 4ZBBA 4IQAA 2GDRA 4X1UA 4JE1A 3P90A 1AQXA 5HR2A 5EPFA 2IL3A 1XVWA 2H19A 5IMCA 1R7HA 1G7EA 1WRYA 5G5FA 2N5AA 4ZXGA 1XW6A 1XWAA 2RUFA 5INYA 1SYRA 2C3NA 4DSRA 2DIYA 4MJBA 2L59A 1FHEA 2C0GA 2H1BA 2N5FA 2AB6A 4BVXA 2LJKA 4F9ZA 4ACSA 3KM6A 2EC4A 2VL9A 1SKSB 4MJEA 2BTOT 4NXIA 4TR0A 4OCFA 2PPTA 4Q5QA 2RLIA 3A2XA 3QDNA 2H1GA 2HI7A 1R26A 5J41A 2LRCA 3GTUB 4YAPA 1ERVA 3KMOA 3M9JA 2K9FA 1ERTA 4NV2A 4K7OA 4ZL7A 3TJGA 2GLRA 2XPDA 1QUWA 3FY7A 2L5LA 4LMVA 3A2WA 1ABAA 3CSJA 4KCEA 4WBJA 2B5YA 4IVFA 3MAKA 1K0CA 1SK0A 2LNTA 3GKKA 3DEXA 3LEFA 1Y6EA 2DIZA 2LKUA 3FK8A 5IPHA 3KMNA 3FKFA 4Z7XA 3RBTA 3TB2A 2VLUA 3ZIVA 5ID2A 3UVTA 2LS5A 1JZDA 1Z3EA 2H6ZA 4PNFA 5EL8A 1GLPA 1GUKA 1F37A 2VL2A 1PSQA 2FGXA 2FNOA 1DE1A 5EVOA 3O6TA 3TJFA 2FA8A 1ZYEA 2LJRA 3GMFA 4TOPA 2LJAA 2DMMA 1A24A 2VL3A 3D5JA 3VWUA 3MWHA 3ZMKA 1Z6MA 2E2MA 1KBNA 4ECIA 5CP1A 3ZZXA 4EUYA 2JZSA 3K8NA 3IXRA 2GSRA 1F2EA 2H1DA 4MMMA 4OD7A 3EINA 2XPEA 2FWGA 4AF2A 2PMTA 2YN1A 1SENA 2OADA 1EEJA 2YOIA 5L71A 2RM5A 1J0FA 3ME7A 2B5EA 3LGCA 3G7JA 3CTGA 2PWJA 5GSTA 2HE3A 3VWXA 7GSSA 3APQA 2E0QA 2VLTA 11GSA 2FA4A 5J9CA 5DJLA 1PKWA 1XOBA 4BL7A 2DJ2A 1JZWA 2ALBA 4ZL8A 4HEA2 3VLNA 1F3BA 1V98A 1Z5YE 4GF0A 3GUSA 1OKDA 3EU4A 1IYIA 3M0FA 4O5RA 5B6MA 5D9XA 1T1VA 3ZLPA 2JU5A 1PD21 1F3AA 3EE2A 3L4NA 1ZOFA 1GSSA 4PX1A 2R4VA 2MMZA 3D22A 1QMVA 4BPYA 1UVZA 3I69A 3CMIA 2L5OA 4G19A 5LNKe 5IMAA 3CSHA 1JHBA 4V1Ag 2P31A 1FW1A 4KB3A 4KSOA 1U88A 2YWMA 2K6VA 3C7MA 1PA3A 4L5LA 4YQUA 3KP8A 3CRTA 2IJYA 2HFDA 2CZ3A 10GSA 2LRTA 3ZL5A 2KP1A 2H73A 4F0BA 1A2JA 4GQFA 4CHSA 5LCZA 1TW9A 4OO4A 5EY6A 3F8UA 1TTZA 3IAM2 3I6AA 1SL1B 2IMIA 1PN9A 4PNGA 2X8HA 4E8EA 3IK7A 5B7CA 3GIXA 5JCWA 3F4SA 4KDUA 2I3YA 2MBTA 1SK2A 1VF4A 3RPNA 3GN3A 2H0GA 2GQMA 2IWTA 2H70A 4MJAA 4MZCA 4KUNA 2MMNA 2PBJA 3DVWA 5AISA 2LSTA 2IFQA 1KEBA 1PQNA 4YAVA 4OFTA 3HJMA 4PQIA 1SJIA 1XXUA 3HKRA 1M2BA 3FR3A 4TXVA 4MABA 2LUSA 4XCSA 3WD6A 1XW5A 3DVXA 5G31A 4MF7A 4POBA 3LJRA 4JZQA 4DSSA 2YWNA 1OYJA 2C8UA 3QFBC 2YWIA 2R37A 1VF2A 2LQQA 1XFLA 2VM2A 4IELA 4F82A 1XBSA 2B7KA 5HFKA 1RQMA 2M80A 5GAPD 2VOCA 5F05A 3RPPA 2PN8A 2GQLA 1MD4A
chains in the Genus database with same CATH superfamily
3QCPA 1TRVA 3TJKA 4F2IA 4GSSA 4KSMA 3HJOA 3DMLA 4KGIA 3TRPA 3QPMA 4NWYA 1ON4A 2C3QA 4KA0A 3VWWA 3L78A 5HFGA 1YQ1A 3W8JA 1GNWA 3MSZA 3MDKA 4NHZA 1EV4A 1MDIA 3SBCA 2VLVA 5IMZA 2C1YA 3TKSA 1O81A 3FHKA 1GNEA 4HDEA 4IBPA 5DALA 4FYCA 1SKWB 2B1KA 1M99A 2C80A 2GT5A 2UZ8A 3Q6OA 3BBYA 5B8AA 2HRFA 4BVXB 4F0CA 3WT1A 3N5OA 4O7HA 2V1MA 4XHMA 1R5PA 3G9BA 2PU9C 3CTFA 5A5KA 2X64A 2GVPA 5IO0A 4TVEA 3LXTA 4ID0A 3GURA 2PVQA 2AYTA 1FB0A 1SK1A 4BWSA 1JFUA 2DJ3A 2BMXA 3HVNA 1G7OA 4WKWA 5AN1A 3FZAA 4J2FA 2DMLA 1DUGA 1UA5A 2CX3A 3IOSA 1K0DA 4FQUA 1ZMAA 2TIRA 4K0NA 3CYNA 4EF0A 4KE3A 2IMFA 2A2SA 4USSA 1C72A 1AQWA 5IO2A 3ZITA 3HJPA 2CZ2A 1YEXA 3GKNA 4O32A 1PRXA 2GSQA 2OA7A 1A2LA 4EE0A 2AV4A 1SD8A 1GH2A 1GSYA 4EC0A 4QQ7A 4Z2TA 5AGYA 2CAQA 3M1GA 2OBKA 4WBRD 1WIKA 3E9JB 3KTBA 3FEUA 2ZUPA 5ID2B 19GSA 4KDYA 2YV7A 5C04A 2VCQA 3P7XA 3ZTLA 2DJKA 4RUVA 2TRCP 1URMA 2J9HA 1SU9A 2P5QA 1XIYA 3VK9A 1XZOA 5GZZB 1Y25A 1K0MA 2DKIA 1J9BA 3ZVJD 1HNAA 1FVJA 4G0KA 2OKAA 5G1KA 1K3LA 1WE0A 3HA9A 1X5DA 2H1AA 1GL8A 5ECPB 1U3AA 2MBSA 6GSWA 1K0BA 1T7PB 3F3QA 2JACA 3TDGA 1A8LA 3H1NA 2YP6A 2ES7A 2P5RA 3EU3A 2RUEA 3TRXA 4L0UA 4MCUA 3QAGA 3ME8A 4MZBA 5JWQB 2KUCA 4XRDA 4K1FA 3LW9A 3H8QA 4KF9A 1XWBA 5D73A 1M2AA 4EKZA 5ELAA 1X9MB 2H66A 4EO3A 3ZFBA 1SJZA 1HD2A 3UAPA 4FH8A 4RQXA 4ML6A 4N30A 4BL7B 5ECSA 3PR8A 1EZKA 1B8XA 1TXXA 2D2ZA 2YJ7A 2TRXA 2X49A 3KH9A 3LQ7A 1B9XC 1BAYA 3OR5A 1HYUA 4TKYA 1RK4A 3IK9A 2VD0A 2HYXA 3HVXA 1O73A 3IAS2 2OBIA 1EWXA 5CO3A 3I43A 3U6VA 1BYEA 5A4UA 4EIQA 3GKMA 4KH7A 3W8SA 4YKGA 2FUG2 2FWHA 4KDXA 3TOUA 4MDCA 2JZTA 1A23A 4V2NA 3FR9A 4HSCX 1TKDB 2H72A 1AQVA 3BCKA 1PL1A 1AAZA 4K6XA 5E59A 1ACVA 4NAXA 1Z7PA 3NIVA 2O8VB 2H6XA 4TR4A 1E6BA 1BJXA 3UIWA 4JBBA 2WRTA 3LYPA 3D21A 4HI7A 4H86A 2GS3A 4K5RA 5IMVA 4POKA 5F06A 2XHFA 1GTUA 3HD5A 1WPIA 3TKSE 1W4VA 1H4OA 2IFQB 2H71A 2LEGA 1O85A 1JZOA 3QAWA 1Q98A 3WGXA 2WZ9A 2X4AA 4XS4A 6GSUA 4MF6A 2I81A 4ZB6A 3ERWA 1H75A 1OE7A 2F8AA 1R4WA 4IS0A 4J56E 1WWJA 4DSSB 4N0ZA 2GGTA 2VAFA 3DGQA 3IA1A 4HZ4A 5KN2A 3ZRDA 4IJ3A 3FMWA 1XVQA 4ECJA 1X0RA 5D9WA 3BCIA 5DCHA 5ECLB 4K8MA 3FZ4A 2H6YA 5H5RA 2LRNA 5KEJA 4GQCA 1NM3A 1YJ6A 2IIYA 3O76A 1SL0B 4TR3A 2DSAA 4AJ8A 5CREA 2DJ1A 1M9AA 1U6TA 1SYXA 1VF1A 5JCUA 3KGKA 1EV9A 1Z7RA 4TRXA 2HRAA 3E3EA 1A0RP 3IR4A 1NHOA 1TOFA 1ERWA 1HNBA 2X8CA 2KP2A 1TRUA 3VFIA 4N0VA 2YWOA 5AIXA 2EIRA 4PQ1A 3ISOA 4MPGA 3MNGA 1M3JA 2H30A 3UOMA 4MNNA 2B1LA 1VGLA 4MJCA 1GULA 1TI1A 3ZVJA 5DALB 3US3A 4POLA 3TKRA 3GNJA 2WFCA 3NZNA 2KHPA 1PMTA 1TDIA 3R3EA 3F4RA 1F6MC 3EMXA 2PVOC 4KW6A 3EPTA 2V41A 4Q5FA 5CRDA 3GX0A 4L8EA 4KAEA 5IMFA 1XWCA 3GH9A 1PL2A 1OC3A 5IIZA 3GV1A 2FD3A 5HR1A 1M9BA 3GL3A 4ZILA 2C3TA 1EOHA 4WEYA 2HNLA 5IQYA 1U87A 2VD1A 1CQGA 2OE1A 2HSMA 1K0AA 3HVSA 5GAND 2XBIA 2O85A 1QK8A 1ST9A 3J7Yb 4CY8A 1FAAA 1FVKA 3BOAA 1G6YA 3KD0A 1LBKA 1X5CA 5ECIB 5KOWA 1DSBA 2C4JA 3KP9A 1T3BA 2R6KA 1GTBA 3GA4A 2MMAA 1EGRA 3VPTA 4A5PA 3PH9A 2J23A 4WR5A 3EURA 2WULA 1RW1A 5F07A 1VRSD 5HR3A 2AUVA 4K0GA 2GT6A 2O87A 1T00A 3QFAC 2WJUA 3IV4A 4JRRA 4MH3A 5D9VA 5AIVA 5B8BA 4GLTA 5FHIA 1N2AA 4EVMA 4KCAA 2VCVA 4GXZA 1QXHA 2JADA 1XWKA 1MD3A 4GWRA 1WMJA 4K7IA 3FYGA 4XS1A 4YQVA 2IMKA 4LLRA 3ZREA 2V32A 3ERFA 2CQ9A 2FHEA 2HZFA 4WR4A 1TK8B 1BX9A 4V1Ap 2BJXA 1YKCA 4IP1A 3HZ4A 3TJJA 3DIEA 3GYKA 2H0IA 4POMA 3ERGA 1ML6A 4I8BA 1M3IA 1THOA 5KN0A 5ABRA 1YDKA 4ICYA 2GZYA 4TR1B 2R5GA 3UEMA 1XWGA 5ELGA 1WOUA 1ZZYA 6GSTA 1BQ7A 4F03A 4MA9A 1ZCPA 2VCTA 2HXKA 1OC9A 2IMEA 5IOXA 3ED3A 2GQKA 3TKPA 1JLVA 4BA7A 2O7KA 1XPVA 5J3RA 4MPFA 5HFIA 2F9SA 1Q4JA 4EXJA 1A8YA 4I97A 3GSSA 4BVYA 3HHVA 3V1WA 4XRAA 1ZL9A 2PGTA 3D0ZA 2X99A 2VO4A 3FZ5A 2QA2A 4IN0A 3QOUA 1E2YA 2PERA 1IYHA 4JR4A 3IE3A 4V2MA 5KN3A 1I9DA 4NPBA 2QA1A 2DKHA 2IMDA 4G10A 2C0EA 5CAXA 1G6WA 2DJJA 3I9V2 4P3YB 4PQHA 5DAKA 4N11A 4Q5RA 5J4UA 3LSZA 3EVIA 1QFNA 2MZCA 1O8WA 1F9MA 4MK3A 1A2MA 5CRHA 1OKTA 2HT9A 3P8WA 1R5AA 2HZEA 5DDLA 2LV3A 4HQSA 4JEDA 4ZBAA 5G2ZA 2H0HA 4NMUA 3GHAA 3IBHA 3KIJA 1YF1A 5GSSA 1S3AA 1X5EA 2QSIA 1ERUA 1DE2A 1OC8A 1QQ2A 4G0LA 3L9UA 2NBSA 2YNXA 2K8SA 3BD2A 3HCZA 1B9YC 3VURA 1AXDA 2MYGA 2VL2C 4HU7A 4FYBA 2OJLA 1I5GA 20GSA 3APOA 4YKFA 1TI3A 5HR0A 1O6JA 1V58A 4WETA 2NTOA 5A4VA 3QMXA 1ILOA 5H5QA 4QL7A 3DRNA 4CDOA 5DQYA 2O89A 1FOHA 3M3MA 1T4ZA 4I2TA 1AIUA 3DWVA 3H79A 1MDJA 2V6OA 1GSUA 4HUAA 4LA1A 5IOWA 3ZMLA 4XS4B 1X9SB 2F8FA 4KX4A 3FW2A 2XBQA 4RI6A 3M9KA 1J08A 4G9HA 4ULXA 1PGTA 3D4TA 5B6NA 2FWFA 1B4PA 1G0TA 1TP9A 2G0FA 4TR1A 3CBUA 1GP1A 1GWCA 5J9BA 4IHUA 5DJMA 3TOTA 1K3OA 2JSZA 1USBA 1GUMA 1EP7A 3M8NA 4ZB9A 1KNGA 3VI7A 5IPGA 8GSSA 4HU9A 3HY2A 4K9ZA 3RAZA 3LORA 4DSQA 3FZ9A 4TW5A 2H01A 1GSDA 3LG6A 4OO5A 1GUHA 2B6MA 1GSQA 1TRSA 2CVBA 2WS2A 4KNDA 5D9TA 3HXSA 1BEDA 4OMVA 4FYUA 4O5QA 2VCWA 4PUFC 2NPBA 1GLQA 2N5BA 4J57E 2DLXA 2F3MA 5G1LA 2RM6A 4I6XA 4TN8A 5IMDA 2E7PA 4HOJA 1B4QA 1YY7A 2YJHA 3QAVA 2WB9A 5ECMB 3D6IA 1UC7A 4RQRA 2GZPA 2B5XA 3CQFA 4XIHA 1GRXA 5COHA 3BJ5A 4IP6A 3P2AA 4GCIA 3W6GA 4V2LA 2L4QA 4DVCA 4PUAA 1AC1A 4AGSA 2DBCA 2NDOA 4YH2A 2F51A 2K18A 5FWGA 5JWRB 2L6DA 2LTKA 3GL5A 5JWOB 3CXGA 3KXOA 5ECKB 5D93A 3LFLA 2OE0A 1YZXA 2CVDA 3EC3A 3F0IA 6GSYA 2E2GA 5ECNB 14GSA 6GSVA 3DKSA 2H8LA 2R3XA 2YV9A 3F9UA 3UVHA 2M46A 2YZUA 3AY8A 4OCEA 4ZIJA 4JR6A 3TKQA 12GSA 3PGTA 4BIKA 3KH7A 4WF5A 4IW9A 3HYPA 2LQOA 4MZWA 2L57A 1XOAA 1LJRA 13GSA 5C00A 3F6DA 2NVLA 4E8HA 4LMWA 1DBYA 3HVVA 3IRAA 1WP0A 3WT2A 2QKEA 3D4MA 5CNWA 1GSFA 3UARA 4GRFA 1XW9A 2QGVA 4D73B 3TRQA 4ZBDA 4TXOA 3LWAA 5E4WA 2I9HA 3GSTA 22GSA 1SD9A 5IM9A 3APSA 2VM1A 3L9SA 4IGJA 3DXBA 3C73A 17GSA 4NV5A 1MTCA 5J5NA 3WGEA 3RDWA 4FIWA 3PINA 5ECQB 3VWVA 4CY6A 1THXA 4PURA 3DYRA 5ECHB 3TKSC 1K0NA 18GSA 1JZRA 3VI5A 2Z9SA 2GSTA 3N9JA 3F63A 2PUKC 1O8XA 3EWLA 2MMOA 2AJQB 3KJYA 3JCML 5G30A 1OC9B 5F8BA 3E0UA 4RI7A 1ZYQB 5DCGA 1MEKA 3A5WA 3FR6A 2I1UA 2VCZA 4K2DA 2WDUA 3UJ1A 3IHQA 3ZIJA 4HQZA 4ZB8A 2R0GA 3PPUA 3H4KA 1MDKA 5F0GA 4BVYB 2YZHA 2H76A 4PGTA 3KCMA 2XC2A 3GTUA 4YQMA 2REMA 2V2GA 4XS6A 3TUEA 2CT6A 4LL1B 3IDVA 2WCIA 9GSSA 4L5OA 1OE8A 2HRNA 4O92A 4Q5NA 4IJIA 2R2JA 1SJ6A 3GKXA 4G2EA 6GSXA 1CQHA 4L0WA 2DC5A 1V40A 5DAKB 2G2QA 1YKAA 2C0FA 1A0FA 3HDCA 5A4WA 1Z9HA 2AAWA 2A2RA 5DBQA 1LU4A 1FG4A 4MF5A 3UBLA 2HZEB 1HQOA 1M2DA 2V6KA 5DVBA 4HS1A 3TCOA 2VIMA 4BWQA 3IC8A 3C71A 2IPAA 2IN3A 5ENUA 1EOGA 1N8JA 2RIIA 1VF3A 4OFMA 4HJ2A 2GTUA 1UN2A 2FCHA 2A4VA 2CA8A 2H74A 2EIQA 2JL4A 4EDZA 2ZNMA 4AJ6A 4X43A 5ECOB 2YPMA 5CYYA 2EIOA 2B7JA 1FB6A 3CSIA 3IPZA 1EGOA 2R0PA 1X9WB 3IC4A 2HSHA 4D73A 1JLWA 3RHBA 1GSEA 1GTAA 3C8EA 2GSSA 2HRKA 1T8EB 3GFKA 5G5EA 1ZGNA 1V57A 4GSTA 2FWEA 1SKRB 3F4TA 1ZYNA 2HLSA 1KTEA 3UBKA 4DEJA 2KLXA 5H5SA 1EP8A 1TU8A 4HZ2A 5KN1A 1K0OA 2ZCTA 3C1RA 2A2PA 6GSSA 4IQ1A 1NSWA 1AUCA 1K3YA 1S3CA 2ON7A 3F6FA 2ON5A 1FO5A 4N10A 5HQPA 2QC7A 4I5QA 3L0HA 2DJ0A 2CVKA 1NHYA 4OWYA 2GZZA 4Z2UA 1SL2B 1YEPA 2OACA 4MH2A 1U3IA 5D96A 3LXZA 1TRWA 3SWLA 4K7NA 4I2UA 3GX8A 3CRUA 5ECRB 1TU7A 2CX4A 3HZ8A 4ECBA 4EDYA 1XCCA 2VCXA 2K8VA 3EMPA 3DD3A 3S9FA 3ZFLA 2YANA 1PX7A 3LYKA 2VUPA 3UL3A 3H93A 4ISDA 5FT3A 2CV4A 2H75A 1BG5A 2OE3A 1NW2A 5CRWA 3G7YA 2M72A 4AJ7A 1O7UA 4X0XA 2I4AA 3WYWA 1W89A 3A3TA 4O5UA 2JSYA 3R2QA 4HJMA 4ILFA 3C1SA 3Q18A 1HNCA 4FO5A 1S3DA 1AW9A 3VPQA 1M0UA 2P0GA 4MP4A 3UMAA 4PXOA 4OFNA 3QD9A 1V2AA 1EEMA 2KOKA 3MYDA 2B3SA 2FY6A 2FLSA 4ML1A 4LL4B 1B48A 1V9WA 2HSYA 2R0CA 3F3RA 4ECCA 4QL9A 2A4HA 2WGRA 5CRGA 1OAZA 3O3TA 1TK5B 4ZL9A 2YCDA 2LNSA 5D8IA 4K5SA 1YF0A 3NOFA 2L6CA 4EL1A 3G7IA 2AHEA 5DQSA 3FRCA 4GSNA 5JCGA 3KTLA 4EIPA 16GSA 4WF4A 3KZQA 3U5RE 1WJKA 3TJBA 3A2VA 1TJDA 3ZYWA 3EYTA 5LD0A 4WXTA 2L4CA 3MIXA 4NHWA 1GTIA 3L9VA 2CAIA 3TGZA 3RHCA 1PX6A 1QGVA 1M7TA 4CW9A 3GRXA 3J7Yk 1TK0B 3QR6A 4GTUA 4MLYA 3Q74A 2X8GA 4IKHA 3GH6A 1T4YA 1FOVA 2JZRA 4JU5A 3KEBA 3Q19A 4TXOB 4PTSA 2C0DA 1OVNA 1Z6NA 4XTSA 3WGDA 1PKZA 4ZBBA 4IQAA 2GDRA 4K2XA 4X1UA 4JE1A 3P90A 1AQXA 5HR2A 5EPFA 2IL3A 1XVWA 2H19A 5IMCA 1R7HA 1G7EA 1WRYA 5G5FA 2N5AA 4ZXGA 1XW6A 1PFOA 1XWAA 2RUFA 5INYA 1SYRA 2C3NA 4DSRA 2DIYA 4MJBA 2L59A 1FHEA 2C0GA 2H1BA 2N5FA 2AB6A 4BVXA 2LJKA 4F9ZA 4ACSA 3KM6A 2EC4A 2VL9A 1SKSB 4MJEA 2BTOT 4NXIA 4TR0A 4OCFA 2PPTA 4Q5QA 2RLIA 3A2XA 3QDNA 2H1GA 2HI7A 1R26A 5J41A 2LRCA 3GTUB 4YAPA 1ERVA 3KMOA 5KOXA 3M9JA 2K9FA 1ERTA 4NV2A 4K7OA 4ZL7A 3TJGA 2GLRA 2XPDA 1QUWA 3FY7A 2L5LA 4LMVA 3A2WA 1ABAA 3CSJA 3A5IA 4KCEA 4WBJA 2B5YA 4IVFA 3MAKA 1K0CA 1SK0A 2LNTA 3GKKA 3DEXA 3LEFA 1Y6EA 2DIZA 2LKUA 3FK8A 5IPHA 3KMNA 3FKFA 4X4JA 4Z7XA 3RBTA 3TB2A 2VLUA 3ZIVA 5ID2A 3UVTA 4G0IA 2LS5A 1JZDA 1Z3EA 2H6ZA 4PNFA 5EL8A 1GLPA 1GUKA 1F37A 2VL2A 1PSQA 2FGXA 2FNOA 1DE1A 5EVOA 3O6TA 3TJFA 2FA8A 1ZYEA 2LJRA 3GMFA 4TOPA 2LJAA 2DMMA 1A24A 2VL3A 3D5JA 3VWUA 3MWHA 3ZMKA 1Z6MA 2E2MA 1KBNA 4ECIA 5CP1A 3ZZXA 4EUYA 2JZSA 3K8NA 3IXRA 2GSRA 1F2EA 2H1DA 4MMMA 4OD7A 3EINA 2XPEA 2FWGA 4AF2A 2PMTA 2YN1A 1SENA 2OADA 1EEJA 2YOIA 5L71A 2RM5A 1J0FA 3ME7A 2B5EA 3LGCA 3G7JA 3CTGA 2PWJA 5GSTA 2HE3A 3VWXA 5BRTA 7GSSA 3APQA 2E0QA 2VLTA 11GSA 2FA4A 5J9CA 5DJLA 1PKWA 1XOBA 4BL7A 2DJ2A 1JZWA 2ALBA 4ZL8A 4HEA2 3VLNA 1F3BA 1S3RA 1V98A 1Z5YE 4GF0A 3GUSA 1OKDA 3EU4A 1IYIA 3M0FA 4O5RA 5B6MA 5D9XA 1T1VA 3ZLPA 2JU5A 1PD21 1F3AA 3EE2A 3L4NA 1ZOFA 1GSSA 4PX1A 2R4VA 2MMZA 3D22A 1QMVA 4BPYA 1UVZA 3I69A 3CMIA 2L5OA 4G19A 5LNKe 5IMAA 1XG8A 3CSHA 1JHBA 4V1Ag 2P31A 1FW1A 4KB3A 4KSOA 1PN0A 1U88A 2YWMA 2K6VA 3C7MA 1PA3A 4L5LA 4YQUA 3KP8A 3CRTA 2IJYA 2HFDA 2CZ3A 10GSA 2LRTA 3ZL5A 2KP1A 2H73A 4F0BA 1A2JA 4Z2RA 4GQFA 4CHSA 5LCZA 1TW9A 4OO4A 5EY6A 3F8UA 1TTZA 3IAM2 3I6AA 1SL1B 5BMUA 2IMIA 1PN9A 4PNGA 2X8HA 4E8EA 3IK7A 5B7CA 3GIXA 5JCWA 3F4SA 4KDUA 2I3YA 2MBTA 1SK2A 1VF4A 3RPNA 3GN3A 2H0GA 2GQMA 2IWTA 2H70A 4MJAA 4MZCA 4KUNA 2MMNA 2PBJA 3DVWA 5AISA 2LSTA 2IFQA 1KEBA 1PQNA 4YAVA 4OFTA 3HJMA 4PQIA 1SJIA 1XXUA 3HKRA 1M2BA 3FR3A 4TXVA 4MABA 2LUSA 4XCSA 3WD6A 1XW5A 3DVXA 5G31A 4MF7A 4POBA 3LJRA 4JZQA 4DSSA 2YWNA 1OYJA 2C8UA 3QFBC 2YWIA 2R37A 1VF2A 2LQQA 1XFLA 2VM2A 4IELA 4F82A 1XBSA 3IHGA 2B7KA 5HFKA 1RQMA 2M80A 5GAPD 2VOCA 1ZYPA 5F05A 3RPPA 2PN8A 2GQLA 1MD4A
chains in the Genus database with same CATH topology
3QCPA 1TRVA 3TJKA 4F2IA 4GSSA 4KSMA 3HJOA 3DMLA 4KGIA 3TRPA 3QPMA 4NWYA 1ON4A 2C3QA 4KA0A 3VWWA 3L78A 5HFGA 1YQ1A 3W8JA 1GNWA 3MSZA 3MDKA 4NHZA 1EV4A 1MDIA 3SBCA 2VLVA 5IMZA 2C1YA 3TKSA 1O81A 3FHKA 1GNEA 4HDEA 4IBPA 5DALA 4FYCA 1SKWB 2B1KA 1M99A 2C80A 2GT5A 2UZ8A 3Q6OA 3BBYA 5B8AA 2HRFA 4BVXB 4F0CA 3WT1A 3N5OA 4O7HA 2V1MA 4XHMA 1R5PA 3G9BA 2PU9C 3CTFA 5A5KA 2X64A 2GVPA 5IO0A 4TVEA 3LXTA 4ID0A 3GURA 2PVQA 2AYTA 1FB0A 1SK1A 4BWSA 1JFUA 2DJ3A 2BMXA 1G7OA 4WKWA 5AN1A 3FZAA 4J2FA 2DMLA 1DUGA 1UA5A 2CX3A 3IOSA 1K0DA 4FQUA 1ZMAA 2TIRA 4K0NA 3CYNA 4EF0A 4KE3A 2IMFA 2A2SA 4USSA 1C72A 1AQWA 5IO2A 3ZITA 3HJPA 2CZ2A 1YEXA 3GKNA 4O32A 1PRXA 2GSQA 2OA7A 1A2LA 4EE0A 2AV4A 1SD8A 1GH2A 1GSYA 4EC0A 4QQ7A 4Z2TA 5AGYA 2CAQA 3M1GA 2OBKA 4WBRD 1WIKA 3E9JB 3KTBA 3FEUA 2ZUPA 5ID2B 19GSA 4KDYA 2YV7A 5C04A 2VCQA 3P7XA 3ZTLA 2DJKA 4RUVA 2TRCP 1URMA 2J9HA 1SU9A 2P5QA 1XIYA 3VK9A 1XZOA 5GZZB 1Y25A 1K0MA 2DKIA 1J9BA 3ZVJD 1HNAA 1FVJA 4G0KA 2OKAA 5G1KA 1K3LA 1WE0A 3HA9A 1X5DA 2H1AA 1GL8A 5ECPB 1U3AA 2MBSA 6GSWA 1K0BA 1T7PB 3F3QA 2JACA 3TDGA 1A8LA 3H1NA 2YP6A 2ES7A 2P5RA 3EU3A 2RUEA 3TRXA 4L0UA 4MCUA 3QAGA 3ME8A 4MZBA 5JWQB 2KUCA 4XRDA 4K1FA 3LW9A 3H8QA 4KF9A 1XWBA 5D73A 1M2AA 4EKZA 5ELAA 1X9MB 2H66A 4EO3A 3ZFBA 1SJZA 1HD2A 3UAPA 4FH8A 4RQXA 4ML6A 4N30A 4BL7B 5ECSA 3PR8A 1EZKA 1B8XA 1TXXA 2D2ZA 2YJ7A 2TRXA 2X49A 3KH9A 3LQ7A 1B9XC 1BAYA 3OR5A 1HYUA 4TKYA 1RK4A 3IK9A 2VD0A 2HYXA 3HVXA 1O73A 3IAS2 2OBIA 1EWXA 5CO3A 3I43A 3U6VA 1BYEA 5A4UA 4EIQA 3GKMA 4KH7A 3W8SA 4YKGA 2FUG2 2FWHA 4KDXA 3TOUA 4MDCA 2JZTA 1A23A 4V2NA 3FR9A 1TKDB 2H72A 1AQVA 3BCKA 1PL1A 1AAZA 4K6XA 5E59A 1ACVA 4NAXA 1Z7PA 3NIVA 2O8VB 2H6XA 4TR4A 1E6BA 1BJXA 3UIWA 4JBBA 2WRTA 3LYPA 3D21A 4HI7A 4H86A 2GS3A 4K5RA 5IMVA 4POKA 5F06A 2XHFA 1GTUA 3HD5A 1WPIA 3TKSE 1W4VA 1H4OA 2IFQB 2H71A 2LEGA 1O85A 1JZOA 3QAWA 1Q98A 3WGXA 2WZ9A 2X4AA 4XS4A 6GSUA 4MF6A 2I81A 4ZB6A 3ERWA 1H75A 1OE7A 2F8AA 1R4WA 4IS0A 4J56E 1WWJA 4DSSB 4N0ZA 2GGTA 2VAFA 3DGQA 3IA1A 4HZ4A 5KN2A 3ZRDA 4IJ3A 3FMWA 1XVQA 4ECJA 1X0RA 5D9WA 3BCIA 5DCHA 5ECLB 4K8MA 3FZ4A 2H6YA 5H5RA 2LRNA 5KEJA 4GQCA 1NM3A 1YJ6A 2IIYA 3O76A 1SL0B 4TR3A 2DSAA 4AJ8A 5CREA 2DJ1A 1M9AA 1U6TA 1SYXA 1VF1A 5JCUA 3KGKA 1EV9A 1Z7RA 4TRXA 2HRAA 3E3EA 1A0RP 3IR4A 1NHOA 1TOFA 1ERWA 1HNBA 2X8CA 2KP2A 1TRUA 3VFIA 4N0VA 2YWOA 5AIXA 2EIRA 4PQ1A 3ISOA 4MPGA 3MNGA 2H30A 3UOMA 4MNNA 2B1LA 1VGLA 4MJCA 1GULA 1TI1A 3ZVJA 5DALB 3US3A 4POLA 3TKRA 3GNJA 2WFCA 3NZNA 2KHPA 1PMTA 1TDIA 3R3EA 3F4RA 1F6MC 3EMXA 2PVOC 4KW6A 3EPTA 2V41A 4Q5FA 5CRDA 3GX0A 4L8EA 4KAEA 5IMFA 1XWCA 3GH9A 1PL2A 1OC3A 5IIZA 3GV1A 2FD3A 5HR1A 1M9BA 3GL3A 4ZILA 2C3TA 1EOHA 4WEYA 2HNLA 5IQYA 1U87A 2VD1A 1CQGA 2OE1A 2HSMA 1K0AA 3HVSA 5GAND 2XBIA 2O85A 1QK8A 1ST9A 3J7Yb 4CY8A 1FAAA 1FVKA 3BOAA 1G6YA 3KD0A 1LBKA 1X5CA 5ECIB 5KOWA 1DSBA 2C4JA 3KP9A 1T3BA 2R6KA 1GTBA 3GA4A 2MMAA 1EGRA 3VPTA 4A5PA 3PH9A 2J23A 4WR5A 3EURA 2WULA 1RW1A 5F07A 1VRSD 5HR3A 2AUVA 4K0GA 2GT6A 2O87A 1T00A 3QFAC 2WJUA 3IV4A 4JRRA 4MH3A 5D9VA 5AIVA 5B8BA 4GLTA 5FHIA 1N2AA 4EVMA 4KCAA 2VCVA 4GXZA 1QXHA 2JADA 1XWKA 1MD3A 4GWRA 1WMJA 4K7IA 3FYGA 4XS1A 4YQVA 2IMKA 4LLRA 3ZREA 2V32A 3ERFA 2CQ9A 2FHEA 2HZFA 4WR4A 1TK8B 1BX9A 4V1Ap 2BJXA 1YKCA 4IP1A 3HZ4A 3TJJA 3DIEA 3GYKA 2H0IA 4POMA 3ERGA 1ML6A 4I8BA 1THOA 5KN0A 5ABRA 1YDKA 4ICYA 2GZYA 4TR1B 2R5GA 3UEMA 1XWGA 5ELGA 1WOUA 1ZZYA 6GSTA 1BQ7A 4F03A 4MA9A 1ZCPA 2VCTA 2HXKA 1OC9A 2IMEA 5IOXA 3ED3A 2GQKA 3TKPA 1JLVA 4BA7A 2O7KA 1XPVA 5J3RA 4MPFA 5HFIA 2F9SA 1Q4JA 4EXJA 1A8YA 4I97A 3GSSA 4BVYA 3HHVA 3V1WA 4XRAA 1ZL9A 2PGTA 3D0ZA 2X99A 2VO4A 3FZ5A 2QA2A 4IN0A 3QOUA 1E2YA 2PERA 1IYHA 4JR4A 3IE3A 4V2MA 5KN3A 1I9DA 4NPBA 2QA1A 2DKHA 2IMDA 4G10A 2C0EA 5CAXA 1G6WA 2DJJA 3I9V2 4P3YB 4PQHA 5DAKA 4N11A 4Q5RA 5J4UA 3LSZA 3EVIA 1QFNA 2MZCA 1O8WA 1F9MA 4MK3A 1A2MA 5CRHA 1OKTA 2HT9A 3P8WA 1R5AA 2HZEA 5DDLA 2LV3A 4HQSA 4JEDA 4ZBAA 5G2ZA 2H0HA 4NMUA 3GHAA 3IBHA 3KIJA 1YF1A 5GSSA 1S3AA 1X5EA 2QSIA 1ERUA 1DE2A 1OC8A 1QQ2A 4G0LA 3L9UA 2NBSA 2YNXA 2K8SA 3BD2A 3HCZA 1B9YC 3VURA 1AXDA 2MYGA 2VL2C 4HU7A 4FYBA 2OJLA 1I5GA 20GSA 3APOA 4YKFA 1TI3A 5HR0A 1O6JA 1V58A 4WETA 2NTOA 5A4VA 3QMXA 1ILOA 5H5QA 4QL7A 3DRNA 4CDOA 5DQYA 2O89A 1FOHA 3M3MA 1T4ZA 4I2TA 1AIUA 3DWVA 3H79A 1MDJA 2V6OA 1GSUA 4HUAA 4LA1A 5IOWA 3ZMLA 4XS4B 1X9SB 2F8FA 4KX4A 3FW2A 2XBQA 4RI6A 3M9KA 1J08A 4G9HA 4ULXA 1PGTA 3D4TA 5B6NA 2FWFA 1B4PA 1G0TA 1TP9A 2G0FA 4TR1A 3CBUA 1GP1A 1GWCA 5J9BA 4IHUA 5DJMA 3TOTA 1K3OA 2JSZA 1USBA 1GUMA 1EP7A 3M8NA 4ZB9A 1KNGA 3VI7A 5IPGA 8GSSA 4HU9A 3HY2A 4K9ZA 3RAZA 3LORA 4DSQA 3FZ9A 4TW5A 2H01A 1GSDA 3LG6A 4OO5A 1GUHA 2B6MA 1GSQA 1TRSA 2CVBA 2WS2A 4KNDA 5D9TA 3HXSA 1BEDA 4OMVA 4FYUA 4O5QA 2VCWA 4PUFC 2NPBA 1GLQA 2N5BA 4J57E 2DLXA 2F3MA 5G1LA 2RM6A 4I6XA 4TN8A 5IMDA 2E7PA 4HOJA 1B4QA 1YY7A 2YJHA 3QAVA 2WB9A 5ECMB 3D6IA 1UC7A 4RQRA 2GZPA 2B5XA 4XIHA 1GRXA 5COHA 3BJ5A 4IP6A 3P2AA 4GCIA 3W6GA 4V2LA 2L4QA 4DVCA 4PUAA 1AC1A 4AGSA 2DBCA 2NDOA 4YH2A 2F51A 2K18A 5FWGA 5JWRB 2L6DA 2LTKA 3GL5A 5JWOB 3CXGA 3KXOA 5ECKB 5D93A 3LFLA 2OE0A 1YZXA 2CVDA 3EC3A 3F0IA 6GSYA 2E2GA 5ECNB 14GSA 6GSVA 3DKSA 2H8LA 2R3XA 2YV9A 3F9UA 3UVHA 2M46A 2YZUA 3AY8A 4OCEA 4ZIJA 4JR6A 3TKQA 12GSA 3PGTA 3KH7A 4WF5A 4IW9A 3HYPA 2LQOA 4MZWA 2L57A 1XOAA 1LJRA 13GSA 5C00A 3F6DA 2NVLA 4E8HA 4LMWA 1DBYA 3HVVA 3IRAA 1WP0A 3WT2A 2QKEA 3D4MA 5CNWA 1GSFA 3UARA 4GRFA 1XW9A 2QGVA 4D73B 3TRQA 4ZBDA 4TXOA 3LWAA 5E4WA 2I9HA 3GSTA 22GSA 1SD9A 5IM9A 3APSA 2VM1A 3L9SA 4IGJA 3DXBA 3C73A 17GSA 4NV5A 1MTCA 5J5NA 3WGEA 3RDWA 4FIWA 3PINA 5ECQB 3VWVA 4CY6A 1THXA 4PURA 3DYRA 5ECHB 3TKSC 1K0NA 18GSA 1JZRA 3VI5A 2Z9SA 2GSTA 3N9JA 3F63A 2PUKC 1O8XA 3EWLA 2MMOA 2AJQB 3KJYA 3JCML 5G30A 1OC9B 5F8BA 3E0UA 4RI7A 1ZYQB 5DCGA 1MEKA 3A5WA 3FR6A 2I1UA 2VCZA 4K2DA 2WDUA 3UJ1A 3IHQA 3ZIJA 4HQZA 4ZB8A 2R0GA 3PPUA 3H4KA 1MDKA 5F0GA 4BVYB 2YZHA 2H76A 4PGTA 3KCMA 2XC2A 3GTUA 4YQMA 2REMA 2V2GA 4XS6A 3TUEA 2CT6A 4LL1B 3IDVA 2WCIA 9GSSA 4L5OA 1OE8A 2HRNA 4O92A 4Q5NA 4IJIA 2R2JA 1SJ6A 3GKXA 4G2EA 6GSXA 1CQHA 4L0WA 2DC5A 1V40A 5DAKB 2G2QA 1YKAA 2C0FA 1A0FA 3HDCA 5A4WA 1Z9HA 2AAWA 2A2RA 5DBQA 1LU4A 1FG4A 4MF5A 3UBLA 2HZEB 1HQOA 1M2DA 2V6KA 5DVBA 4HS1A 3TCOA 2VIMA 4BWQA 3IC8A 3C71A 2IPAA 2IN3A 5ENUA 1EOGA 1N8JA 2RIIA 1VF3A 4OFMA 4HJ2A 2GTUA 1UN2A 2FCHA 2A4VA 2CA8A 2H74A 2EIQA 2JL4A 4EDZA 2ZNMA 4AJ6A 4X43A 5ECOB 2YPMA 5CYYA 2EIOA 2B7JA 1FB6A 3CSIA 3IPZA 1EGOA 2R0PA 1X9WB 3IC4A 2HSHA 4D73A 1JLWA 3RHBA 1GSEA 1GTAA 3C8EA 2GSSA 2HRKA 1T8EB 3GFKA 5G5EA 1ZGNA 1V57A 4GSTA 2FWEA 1SKRB 3F4TA 1ZYNA 2HLSA 1KTEA 3UBKA 4DEJA 2KLXA 5H5SA 1EP8A 1TU8A 4HZ2A 5KN1A 1K0OA 2ZCTA 3C1RA 2A2PA 6GSSA 4IQ1A 1NSWA 1AUCA 1K3YA 1S3CA 2ON7A 3F6FA 2ON5A 1FO5A 4N10A 5HQPA 2QC7A 4I5QA 3L0HA 2DJ0A 2CVKA 1NHYA 4OWYA 2GZZA 4Z2UA 1SL2B 1YEPA 2OACA 4MH2A 1U3IA 5D96A 3LXZA 1TRWA 3SWLA 4K7NA 4I2UA 3GX8A 3CRUA 5ECRB 1TU7A 2CX4A 3HZ8A 4ECBA 4EDYA 1XCCA 2VCXA 2K8VA 3EMPA 3DD3A 3S9FA 3ZFLA 2YANA 1PX7A 3LYKA 2VUPA 3UL3A 3H93A 4ISDA 5FT3A 2CV4A 2H75A 1BG5A 2OE3A 1NW2A 5CRWA 3G7YA 2M72A 4AJ7A 1O7UA 4X0XA 2I4AA 3WYWA 1W89A 3A3TA 4O5UA 2JSYA 3R2QA 4HJMA 4ILFA 3C1SA 3Q18A 1HNCA 4FO5A 1S3DA 1AW9A 3VPQA 1M0UA 2P0GA 4MP4A 3UMAA 4PXOA 4OFNA 3QD9A 1V2AA 1EEMA 2KOKA 3MYDA 2B3SA 2FY6A 2FLSA 4ML1A 4LL4B 1B48A 1V9WA 2HSYA 2R0CA 3F3RA 4ECCA 4QL9A 2A4HA 2WGRA 5CRGA 1OAZA 3O3TA 1TK5B 4ZL9A 2YCDA 2LNSA 5D8IA 4K5SA 1YF0A 3NOFA 2L6CA 4EL1A 3G7IA 2AHEA 5DQSA 3FRCA 4GSNA 5JCGA 3KTLA 4EIPA 16GSA 4WF4A 3KZQA 3U5RE 1WJKA 3TJBA 3A2VA 1TJDA 3ZYWA 3EYTA 5LD0A 4WXTA 2L4CA 3MIXA 4NHWA 1GTIA 3L9VA 2CAIA 3TGZA 3RHCA 1PX6A 1QGVA 1M7TA 4CW9A 3GRXA 3J7Yk 1TK0B 3QR6A 4GTUA 4MLYA 3Q74A 2X8GA 4IKHA 3GH6A 1T4YA 1FOVA 2JZRA 4JU5A 3KEBA 3Q19A 4TXOB 4PTSA 2C0DA 1OVNA 1Z6NA 4XTSA 3WGDA 1PKZA 4ZBBA 4IQAA 2GDRA 4K2XA 4X1UA 4JE1A 3P90A 1AQXA 5HR2A 5EPFA 2IL3A 1XVWA 2H19A 5IMCA 1R7HA 1G7EA 1WRYA 5G5FA 2N5AA 4ZXGA 1XW6A 1XWAA 2RUFA 5INYA 1SYRA 2C3NA 4DSRA 2DIYA 4MJBA 2L59A 1FHEA 2C0GA 2H1BA 2N5FA 2AB6A 4BVXA 2LJKA 4F9ZA 4ACSA 3KM6A 2EC4A 2VL9A 1SKSB 4MJEA 2BTOT 4NXIA 4TR0A 4OCFA 2PPTA 4Q5QA 2RLIA 3A2XA 3QDNA 2H1GA 2HI7A 1R26A 5J41A 2LRCA 3GTUB 4YAPA 1ERVA 3KMOA 5KOXA 3M9JA 2K9FA 1ERTA 4NV2A 4K7OA 4ZL7A 3TJGA 2GLRA 2XPDA 1QUWA 3FY7A 2L5LA 4LMVA 3A2WA 1ABAA 3CSJA 3A5IA 4KCEA 4WBJA 2B5YA 4IVFA 3MAKA 1K0CA 1SK0A 2LNTA 3GKKA 3DEXA 3LEFA 1Y6EA 2DIZA 2LKUA 3FK8A 5IPHA 3KMNA 3FKFA 4X4JA 4Z7XA 3RBTA 3TB2A 2VLUA 3ZIVA 5ID2A 3UVTA 4G0IA 2LS5A 1JZDA 1Z3EA 2H6ZA 4PNFA 5EL8A 1GLPA 1GUKA 1F37A 2VL2A 1PSQA 2FGXA 2FNOA 1DE1A 5EVOA 3O6TA 3TJFA 2FA8A 1ZYEA 2LJRA 3GMFA 4TOPA 2LJAA 2DMMA 1A24A 2VL3A 3D5JA 3VWUA 3MWHA 3ZMKA 1Z6MA 2E2MA 1KBNA 4ECIA 5CP1A 3ZZXA 4EUYA 2JZSA 3K8NA 3IXRA 2GSRA 1F2EA 2H1DA 4MMMA 4OD7A 3EINA 2XPEA 2FWGA 4AF2A 2PMTA 2YN1A 1SENA 2OADA 1EEJA 2YOIA 5L71A 2RM5A 1J0FA 3ME7A 2B5EA 3LGCA 3G7JA 3CTGA 2PWJA 5GSTA 2HE3A 3VWXA 5BRTA 7GSSA 3APQA 2E0QA 2VLTA 11GSA 2FA4A 5J9CA 5DJLA 1PKWA 1XOBA 4BL7A 2DJ2A 1JZWA 2ALBA 4ZL8A 4HEA2 3VLNA 1F3BA 1V98A 1Z5YE 4GF0A 3GUSA 1OKDA 3EU4A 1IYIA 3M0FA 4O5RA 5B6MA 5D9XA 1T1VA 3ZLPA 2JU5A 1PD21 1F3AA 3EE2A 3L4NA 1ZOFA 1GSSA 4PX1A 2R4VA 2MMZA 3D22A 1QMVA 4BPYA 1UVZA 3I69A 3CMIA 2L5OA 4G19A 5LNKe 5IMAA 3CSHA 1JHBA 4V1Ag 2P31A 1FW1A 4KB3A 4KSOA 1PN0A 1U88A 2YWMA 2K6VA 3C7MA 1PA3A 4L5LA 4YQUA 3KP8A 3CRTA 2IJYA 2HFDA 2CZ3A 10GSA 2LRTA 3ZL5A 2KP1A 2H73A 4F0BA 1A2JA 4Z2RA 4GQFA 4CHSA 5LCZA 1TW9A 4OO4A 5EY6A 3F8UA 1TTZA 3IAM2 3I6AA 1SL1B 5BMUA 2IMIA 1PN9A 4PNGA 2X8HA 4E8EA 3IK7A 5B7CA 3GIXA 5JCWA 3F4SA 4KDUA 2I3YA 2MBTA 1SK2A 1VF4A 3RPNA 3GN3A 2H0GA 2GQMA 2IWTA 2H70A 4MJAA 4MZCA 4KUNA 2MMNA 2PBJA 3DVWA 5AISA 2LSTA 2IFQA 4YAVA 1KEBA 1PQNA 4OFTA 3HJMA 4PQIA 1SJIA 1XXUA 3HKRA 1M2BA 3FR3A 4TXVA 4MABA 2LUSA 4XCSA 3WD6A 1XW5A 3DVXA 5G31A 4MF7A 4POBA 3LJRA 4JZQA 4DSSA 2YWNA 1OYJA 2C8UA 3QFBC 2YWIA 2R37A 1VF2A 2LQQA 1XFLA 2VM2A 4IELA 4F82A 1XBSA 3IHGA 2B7KA 5HFKA 1RQMA 2M80A 5GAPD 2VOCA 1ZYPA 5F05A 3RPPA 2PN8A 2GQLA 1MD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QCP A;  1TRV A;  3TJK A;  4F2I A;  4GSS A;  4KSM A;  3HJO A;  3DML A;  4KGI A;  3TRP A;  3QPM A;  4NWY A;  1ON4 A;  2C3Q A;  4KA0 A;  3VWW A;  3L78 A;  5HFG A;  1YQ1 A;  3W8J A;  1GNW A;  3MSZ A;  3MDK A;  4NHZ A;  1EV4 A;  1MDI A;  3SBC A;  2VLV A;  5IMZ A;  2C1Y A;  3TKS A;  1O81 A;  3FHK A;  1GNE A;  4HDE A;  4IBP A;  5DAL A;  4FYC A;  1SKW B;  2B1K A;  1M99 A;  2C80 A;  2GT5 A;  3Q6O A;  3BBY A;  5B8A A;  2HRF A;  4F0C A;  3WT1 A;  3N5O A;  4O7H A;  2V1M A;  4XHM A;  1R5P A;  3G9B A;  2PU9 C;  3CTF A;  5A5K A;  2X64 A;  2GVP A;  5IO0 A;  4TVE A;  3LXT A;  4ID0 A;  3GUR A;  2PVQ A;  2AYT A;  1FB0 A;  1SK1 A;  4BWS A;  1JFU A;  2DJ3 A;  2BMX A;  1G7O A;  4WKW A;  5AN1 A;  3FZA A;  4J2F A;  2DML A;  1DUG A;  1UA5 A;  2CX3 A;  3IOS A;  1K0D A;  1ZMA A;  2TIR A;  4K0N A;  3CYN A;  4EF0 A;  4KE3 A;  2IMF A;  2A2S A;  1C72 A;  1AQW A;  5IO2 A;  3ZIT A;  3HJP A;  2CZ2 A;  1YEX A;  3GKN A;  4O32 A;  1PRX A;  2GSQ A;  2OA7 A;  1A2L A;  4EE0 A;  2AV4 A;  1SD8 A;  1GH2 A;  1GSY A;  4EC0 A;  4QQ7 A;  5AGY A;  2CAQ A;  3M1G A;  2OBK A;  4WBR D;  1WIK A;  3E9J B;  3KTB A;  3FEU A;  2ZUP A;  5ID2 B;  19GS A;  4KDY A;  2YV7 A;  5C04 A;  2VCQ A;  3P7X A;  3ZTL A;  2DJK A;  4RUV A;  2TRC P;  1URM A;  2J9H A;  1SU9 A;  2P5Q A;  1XIY A;  3VK9 A;  1XZO A;  5GZZ B;  1Y25 A;  1K0M A;  1J9B A;  3ZVJ D;  1HNA A;  1FVJ A;  5G1K A;  2OKA A;  1K3L A;  1WE0 A;  3HA9 A;  1X5D A;  2H1A A;  1GL8 A;  5ECP B;  1U3A A;  2MBS A;  6GSW A;  1K0B A;  1T7P B;  3F3Q A;  2JAC A;  3TDG A;  1A8L A;  3H1N A;  2YP6 A;  2ES7 A;  2P5R A;  3EU3 A;  2RUE A;  3TRX A;  4L0U A;  4MCU A;  3QAG A;  3ME8 A;  4MZB A;  5JWQ B;  2KUC A;  4XRD A;  4K1F A;  3H8Q A;  1XWB A;  5D73 A;  1M2A A;  4EKZ A;  5ELA A;  1X9M B;  2H66 A;  4EO3 A;  3ZFB A;  1SJZ A;  1HD2 A;  3UAP A;  4FH8 A;  4RQX A;  4ML6 A;  4N30 A;  5ECS A;  3PR8 A;  1EZK A;  1B8X A;  1TXX A;  2D2Z A;  2YJ7 A;  2TRX A;  3KH9 A;  3LQ7 A;  1B9X C;  1BAY A;  3OR5 A;  1HYU A;  4TKY A;  1RK4 A;  3IK9 A;  2VD0 A;  2HYX A;  3HVX A;  1O73 A;  3IAS 2;  2OBI A;  1EWX A;  5CO3 A;  3I43 A;  3U6V A;  1BYE A;  5A4U A;  3GKM A;  4KH7 A;  3W8S A;  2FUG 2;  2FWH A;  4KDX A;  3TOU A;  4MDC A;  2JZT A;  1A23 A;  4V2N A;  3FR9 A;  1TKD B;  2H72 A;  1AQV A;  3BCK A;  1PL1 A;  1AAZ A;  4K6X A;  5E59 A;  1ACV A;  4NAX A;  1Z7P A;  3NIV A;  2O8V B;  2H6X A;  4TR4 A;  1E6B A;  1BJX A;  3UIW A;  4JBB A;  2WRT A;  3LYP A;  3D21 A;  4HI7 A;  4H86 A;  2GS3 A;  5IMV A;  4POK A;  5F06 A;  2XHF A;  1GTU A;  3HD5 A;  1WPI A;  3TKS E;  1W4V A;  1H4O A;  2IFQ B;  2H71 A;  2LEG A;  1O85 A;  1JZO A;  3QAW A;  1Q98 A;  3WGX A;  2WZ9 A;  4XS4 A;  6GSU A;  4MF6 A;  2I81 A;  4ZB6 A;  3ERW A;  1H75 A;  1OE7 A;  2F8A A;  1R4W A;  4IS0 A;  4J56 E;  1WWJ A;  4DSS B;  4N0Z A;  2GGT A;  2VAF A;  3DGQ A;  3IA1 A;  4HZ4 A;  5KN2 A;  3ZRD A;  4IJ3 A;  1XVQ A;  4ECJ A;  1X0R A;  5D9W A;  3BCI A;  5DCH A;  5ECL B;  4K8M A;  3FZ4 A;  2H6Y A;  5H5R A;  2LRN A;  5KEJ A;  4GQC A;  1NM3 A;  1YJ6 A;  2IIY A;  3O76 A;  1SL0 B;  4TR3 A;  2DSA A;  4AJ8 A;  5CRE A;  2DJ1 A;  1M9A A;  1U6T A;  1SYX A;  1VF1 A;  5JCU A;  3KGK A;  1EV9 A;  1Z7R A;  4TRX A;  3E3E A;  1A0R P;  3IR4 A;  1NHO A;  1TOF A;  1ERW A;  1HNB A;  2X8C A;  2KP2 A;  1TRU A;  3VFI A;  4N0V A;  2YWO A;  5AIX A;  2EIR A;  4PQ1 A;  3ISO A;  4MPG A;  3MNG A;  2H30 A;  3UOM A;  2B1L A;  1VGL A;  4MJC A;  1GUL A;  1TI1 A;  3ZVJ A;  5DAL B;  3US3 A;  4POL A;  3TKR A;  3GNJ A;  2WFC A;  3NZN A;  2KHP A;  1PMT A;  1TDI A;  3F4R A;  1F6M C;  3EMX A;  2PVO C;  4KW6 A;  2V41 A;  4Q5F A;  5CRD A;  3GX0 A;  4L8E A;  4KAE A;  5IMF A;  1XWC A;  3GH9 A;  1PL2 A;  1OC3 A;  5IIZ A;  3GV1 A;  2FD3 A;  5HR1 A;  1M9B A;  3GL3 A;  4ZIL A;  2C3T A;  1EOH A;  4WEY A;  2HNL A;  5IQY A;  1U87 A;  2VD1 A;  1CQG A;  2OE1 A;  1K0A A;  3HVS A;  5GAN D;  2XBI A;  2O85 A;  1QK8 A;  1ST9 A;  3J7Y b;  1FAA A;  1FVK A;  3BOA A;  1G6Y A;  3KD0 A;  1LBK A;  1X5C A;  5ECI B;  1DSB A;  2C4J A;  3KP9 A;  1T3B A;  2R6K A;  1GTB A;  3GA4 A;  2MMA A;  1EGR A;  3VPT A;  3PH9 A;  2J23 A;  4WR5 A;  3EUR A;  2WUL A;  1RW1 A;  5F07 A;  1VRS D;  5HR3 A;  2AUV A;  4K0G A;  2GT6 A;  2O87 A;  1T00 A;  3QFA C;  2WJU A;  3IV4 A;  4JRR A;  4MH3 A;  5D9V A;  5AIV A;  5B8B A;  4GLT A;  5FHI A;  1N2A A;  4EVM A;  4KCA A;  2VCV A;  4GXZ A;  1QXH A;  2JAD A;  1XWK A;  1MD3 A;  4GWR A;  1WMJ A;  4K7I A;  3FYG A;  4XS1 A;  4YQV A;  2IMK A;  4LLR A;  3ZRE A;  2V32 A;  3ERF A;  2CQ9 A;  2FHE A;  2HZF A;  4WR4 A;  1TK8 B;  1BX9 A;  4V1A p;  2BJX A;  1YKC A;  4IP1 A;  3HZ4 A;  3TJJ A;  3DIE A;  3GYK A;  2H0I A;  4POM A;  3ERG A;  1ML6 A;  4I8B A;  1THO A;  5KN0 A;  5ABR A;  1YDK A;  2GZY A;  4TR1 B;  2R5G A;  3UEM A;  1XWG A;  5ELG A;  1WOU A;  1ZZY A;  6GST A;  1BQ7 A;  4F03 A;  4MA9 A;  1ZCP A;  2VCT A;  2HXK A;  1OC9 A;  2IME A;  5IOX A;  3ED3 A;  2GQK A;  3TKP A;  1JLV A;  4BA7 A;  2O7K A;  1XPV A;  5J3R A;  4MPF A;  5HFI A;  2F9S A;  1Q4J A;  4EXJ A;  1A8Y A;  4I97 A;  3GSS A;  4BVY A;  3HHV A;  3V1W A;  4XRA A;  1ZL9 A;  2PGT A;  3D0Z A;  2X99 A;  2VO4 A;  3FZ5 A;  4IN0 A;  3QOU A;  1E2Y A;  2PER A;  1IYH A;  4JR4 A;  3IE3 A;  4V2M A;  5KN3 A;  1I9D A;  4NPB A;  2IMD A;  4G10 A;  2C0E A;  5CAX A;  1G6W A;  2DJJ A;  3I9V 2;  4P3Y B;  4PQH A;  5DAK A;  4N11 A;  4Q5R A;  5J4U A;  3LSZ A;  3EVI A;  1QFN A;  2MZC A;  1O8W A;  1F9M A;  4MK3 A;  1A2M A;  5CRH A;  1OKT A;  2HT9 A;  3P8W A;  1R5A A;  2HZE A;  5DDL A;  2LV3 A;  4HQS A;  4JED A;  4ZBA A;  5G2Z A;  2H0H A;  3GHA A;  4NMU A;  3IBH A;  3KIJ A;  1YF1 A;  5GSS A;  1S3A A;  1X5E A;  2QSI A;  1ERU A;  1DE2 A;  1OC8 A;  1QQ2 A;  3L9U A;  2NBS A;  2YNX A;  2K8S A;  3BD2 A;  3HCZ A;  1B9Y C;  3VUR A;  1AXD A;  2MYG A;  2VL2 C;  4HU7 A;  4FYB A;  2OJL A;  1I5G A;  20GS A;  3APO A;  1TI3 A;  5HR0 A;  1O6J A;  1V58 A;  4WET A;  2NTO A;  5A4V A;  3QMX A;  1ILO A;  5H5Q A;  4QL7 A;  3DRN A;  4CDO A;  5DQY A;  2O89 A;  3M3M A;  1T4Z A;  4I2T A;  1AIU A;  3DWV A;  3H79 A;  1MDJ A;  2V6O A;  1GSU A;  4HUA A;  4LA1 A;  5IOW A;  3ZML A;  4XS4 B;  1X9S B;  2F8F A;  4KX4 A;  3FW2 A;  2XBQ A;  4RI6 A;  3M9K A;  1J08 A;  4G9H A;  4ULX A;  1PGT A;  3D4T A;  5B6N A;  2FWF A;  1B4P A;  1G0T A;  1TP9 A;  2G0F A;  4TR1 A;  3CBU A;  1GP1 A;  1GWC A;  5J9B A;  4IHU A;  5DJM A;  3TOT A;  1K3O A;  2JSZ A;  1USB A;  1GUM A;  1EP7 A;  3M8N A;  4ZB9 A;  1KNG A;  3VI7 A;  5IPG A;  8GSS A;  4HU9 A;  3HY2 A;  4K9Z A;  3RAZ A;  3LOR A;  4DSQ A;  3FZ9 A;  4TW5 A;  2H01 A;  1GSD A;  3LG6 A;  4OO5 A;  1GUH A;  2B6M A;  1GSQ A;  1TRS A;  2CVB A;  2WS2 A;  4KND A;  5D9T A;  3HXS A;  1BED A;  4OMV A;  4FYU A;  2VCW A;  4PUF C;  2NPB A;  1GLQ A;  2N5B A;  4J57 E;  2DLX A;  2F3M A;  5G1L A;  2RM6 A;  4I6X A;  4TN8 A;  5IMD A;  2E7P A;  4HOJ A;  1B4Q A;  1YY7 A;  2YJH A;  3QAV A;  2WB9 A;  5ECM B;  3D6I A;  1UC7 A;  4RQR A;  2GZP A;  2B5X A;  4XIH A;  1GRX A;  5COH A;  3BJ5 A;  4IP6 A;  3P2A A;  4GCI A;  3W6G A;  4V2L A;  2L4Q A;  4DVC A;  4PUA A;  1AC1 A;  4AGS A;  2DBC A;  2NDO A;  4YH2 A;  2F51 A;  2K18 A;  5FWG A;  5JWR B;  2L6D A;  2LTK A;  3GL5 A;  5JWO B;  3CXG A;  3KXO A;  5ECK B;  5D93 A;  3LFL A;  2OE0 A;  1YZX A;  2CVD A;  3EC3 A;  3F0I A;  6GSY A;  2E2G A;  5ECN B;  14GS A;  6GSV A;  3DKS A;  2H8L A;  2R3X A;  2YV9 A;  3F9U A;  3UVH A;  2M46 A;  2YZU A;  3AY8 A;  4OCE A;  4ZIJ A;  4JR6 A;  3TKQ A;  12GS A;  3PGT A;  3KH7 A;  4WF5 A;  4IW9 A;  3HYP A;  2LQO A;  4MZW A;  2L57 A;  1XOA A;  1LJR A;  13GS A;  5C00 A;  3F6D A;  2NVL A;  4E8H A;  4LMW A;  1DBY A;  3HVV A;  3IRA A;  1WP0 A;  3WT2 A;  2QKE A;  3D4M A;  5CNW A;  1GSF A;  3UAR A;  4GRF A;  1XW9 A;  2QGV A;  4D73 B;  3TRQ A;  4ZBD A;  4TXO A;  3LWA A;  5E4W A;  2I9H A;  3GST A;  22GS A;  1SD9 A;  5IM9 A;  3APS A;  2VM1 A;  3L9S A;  4IGJ A;  3DXB A;  3C73 A;  17GS A;  4NV5 A;  1MTC A;  5J5N A;  3WGE A;  3RDW A;  4FIW A;  3PIN A;  5ECQ B;  3VWV A;  1THX A;  4PUR A;  3DYR A;  5ECH B;  3TKS C;  1K0N A;  18GS A;  1JZR A;  3VI5 A;  2Z9S A;  2GST A;  3N9J A;  3F63 A;  2PUK C;  1O8X A;  3EWL A;  2MMO A;  2AJQ B;  3KJY A;  3JCM L;  5G30 A;  1OC9 B;  5F8B A;  3E0U A;  4RI7 A;  1ZYQ B;  5DCG A;  1MEK A;  3A5W A;  3FR6 A;  2I1U A;  2VCZ A;  4K2D A;  2WDU A;  3UJ1 A;  3IHQ A;  3ZIJ A;  4HQZ A;  4ZB8 A;  3H4K A;  1MDK A;  5F0G A;  2YZH A;  2H76 A;  4PGT A;  3KCM A;  2XC2 A;  3GTU A;  4YQM A;  2REM A;  2V2G A;  4XS6 A;  3TUE A;  2CT6 A;  4LL1 B;  3IDV A;  2WCI A;  9GSS A;  4L5O A;  1OE8 A;  2HRN A;  4O92 A;  4Q5N A;  4IJI A;  2R2J A;  1SJ6 A;  3GKX A;  4G2E A;  6GSX A;  1CQH A;  4L0W A;  2DC5 A;  1V40 A;  5DAK B;  2G2Q A;  1YKA A;  2C0F A;  1A0F A;  3HDC A;  5A4W A;  1Z9H A;  2AAW A;  2A2R A;  5DBQ A;  1LU4 A;  1FG4 A;  4MF5 A;  3UBL A;  2HZE B;  1HQO A;  1M2D A;  2V6K A;  5DVB A;  4HS1 A;  3TCO A;  2VIM A;  4BWQ A;  3C71 A;  2IPA A;  2IN3 A;  5ENU A;  1EOG A;  1N8J A;  2RII A;  1VF3 A;  4OFM A;  4HJ2 A;  2GTU A;  1UN2 A;  2FCH A;  2A4V A;  2CA8 A;  2H74 A;  2EIQ A;  2JL4 A;  4EDZ A;  2ZNM A;  4AJ6 A;  4X43 A;  5ECO B;  2YPM A;  5CYY A;  2EIO A;  2B7J A;  1FB6 A;  3CSI A;  3IPZ A;  1EGO A;  1X9W B;  3IC4 A;  2HSH A;  4D73 A;  1JLW A;  3RHB A;  1GSE A;  1GTA A;  3C8E A;  2GSS A;  1T8E B;  3GFK A;  5G5E A;  1ZGN A;  1V57 A;  4GST A;  2FWE A;  1SKR B;  3F4T A;  2HLS A;  1KTE A;  3UBK A;  4DEJ A;  2KLX A;  5H5S A;  1EP8 A;  1TU8 A;  4HZ2 A;  5KN1 A;  1K0O A;  2ZCT A;  3C1R A;  6GSS A;  4IQ1 A;  1NSW A;  1AUC A;  1K3Y A;  1S3C A;  2ON7 A;  3F6F A;  2ON5 A;  1FO5 A;  4N10 A;  5HQP A;  2QC7 A;  4I5Q A;  3L0H A;  2DJ0 A;  2CVK A;  1NHY A;  4OWY A;  2GZZ A;  1SL2 B;  1YEP A;  2OAC A;  4MH2 A;  1U3I A;  5D96 A;  3LXZ A;  1TRW A;  3SWL A;  4K7N A;  4I2U A;  3GX8 A;  3CRU A;  5ECR B;  1TU7 A;  2CX4 A;  3HZ8 A;  4ECB A;  4EDY A;  1XCC A;  2VCX A;  2K8V A;  3EMP A;  3DD3 A;  3S9F A;  3ZFL A;  2YAN A;  1PX7 A;  3LYK A;  2VUP A;  3UL3 A;  3H93 A;  4ISD A;  5FT3 A;  2CV4 A;  2H75 A;  1BG5 A;  2OE3 A;  1NW2 A;  5CRW A;  3G7Y A;  2M72 A;  4AJ7 A;  1O7U A;  4X0X A;  2I4A A;  3WYW A;  1W89 A;  3A3T A;  2JSY A;  3R2Q A;  4HJM A;  4ILF A;  3C1S A;  3Q18 A;  1HNC A;  4FO5 A;  1S3D A;  1AW9 A;  3VPQ A;  1M0U A;  2P0G A;  4MP4 A;  3UMA A;  4PXO A;  4OFN A;  3QD9 A;  1V2A A;  1EEM A;  2KOK A;  2B3S A;  2FY6 A;  2FLS A;  4ML1 A;  4LL4 B;  1B48 A;  1V9W A;  2HSY A;  3F3R A;  4ECC A;  4QL9 A;  2WGR A;  5CRG A;  1OAZ A;  3O3T A;  1TK5 B;  4ZL9 A;  2YCD A;  2LNS A;  5D8I A;  1YF0 A;  3NOF A;  2L6C A;  4EL1 A;  3G7I A;  2AHE A;  5DQS A;  3FRC A;  4GSN A;  5JCG A;  3KTL A;  16GS A;  4WF4 A;  3KZQ A;  3U5R E;  1WJK A;  3TJB A;  3A2V A;  1TJD A;  3ZYW A;  3EYT A;  5LD0 A;  4WXT A;  2L4C A;  4NHW A;  1GTI A;  3L9V A;  2CAI A;  3TGZ A;  3RHC A;  1PX6 A;  1QGV A;  1M7T A;  4CW9 A;  3GRX A;  3J7Y k;  1TK0 B;  3QR6 A;  4GTU A;  4MLY A;  3Q74 A;  2X8G A;  4IKH A;  3GH6 A;  1T4Y A;  1FOV A;  2JZR A;  4JU5 A;  3KEB A;  3Q19 A;  4TXO B;  2C0D A;  1OVN A;  1Z6N A;  4XTS A;  3WGD A;  1PKZ A;  4ZBB A;  4IQA A;  2GDR A;  4X1U A;  4JE1 A;  3P90 A;  1AQX A;  5HR2 A;  5EPF A;  2IL3 A;  1XVW A;  2H19 A;  5IMC A;  1R7H A;  1G7E A;  1WRY A;  5G5F A;  2N5A A;  4ZXG A;  1XW6 A;  1XWA A;  2RUF A;  5INY A;  1SYR A;  2C3N A;  4DSR A;  2DIY A;  4MJB A;  2L59 A;  1FHE A;  2C0G A;  2H1B A;  2N5F A;  2AB6 A;  4BVX A;  2LJK A;  4F9Z A;  4ACS A;  3KM6 A;  2EC4 A;  2VL9 A;  1SKS B;  4MJE A;  2BTO T;  4NXI A;  4TR0 A;  4OCF A;  2PPT A;  4Q5Q A;  2RLI A;  3A2X A;  3QDN A;  2H1G A;  2HI7 A;  1R26 A;  5J41 A;  2LRC A;  3GTU B;  4YAP A;  1ERV A;  3KMO A;  3M9J A;  2K9F A;  1ERT A;  4NV2 A;  4K7O A;  4ZL7 A;  3TJG A;  2GLR A;  2XPD A;  1QUW A;  3FY7 A;  2L5L A;  4LMV A;  3A2W A;  1ABA A;  3CSJ A;  4KCE A;  4WBJ A;  2B5Y A;  4IVF A;  3MAK A;  1K0C A;  1SK0 A;  2LNT A;  3GKK A;  3DEX A;  3LEF A;  1Y6E A;  2DIZ A;  2LKU A;  3FK8 A;  5IPH A;  3KMN A;  3FKF A;  4Z7X A;  3RBT A;  3TB2 A;  2VLU A;  3ZIV A;  5ID2 A;  3UVT A;  2LS5 A;  1JZD A;  1Z3E A;  2H6Z A;  4PNF A;  5EL8 A;  1GLP A;  1GUK A;  1F37 A;  2VL2 A;  1PSQ A;  2FGX A;  2FNO A;  1DE1 A;  5EVO A;  3O6T A;  3TJF A;  2FA8 A;  1ZYE A;  2LJR A;  3GMF A;  4TOP A;  2LJA A;  2DMM A;  1A24 A;  2VL3 A;  3D5J A;  3VWU A;  3MWH A;  3ZMK A;  1Z6M A;  2E2M A;  1KBN A;  4ECI A;  5CP1 A;  3ZZX A;  4EUY A;  2JZS A;  3K8N A;  3IXR A;  2GSR A;  1F2E A;  2H1D A;  4MMM A;  4OD7 A;  3EIN A;  2XPE A;  2FWG A;  4AF2 A;  2PMT A;  2YN1 A;  1SEN A;  2OAD A;  1EEJ A;  2YOI A;  5L71 A;  2RM5 A;  1J0F A;  3ME7 A;  2B5E A;  3LGC A;  3G7J A;  3CTG A;  2PWJ A;  5GST A;  2HE3 A;  3VWX A;  7GSS A;  3APQ A;  2E0Q A;  2VLT A;  11GS A;  2FA4 A;  5J9C A;  5DJL A;  1PKW A;  1XOB A;  4BL7 A;  2DJ2 A;  1JZW A;  2ALB A;  4ZL8 A;  4HEA 2;  3VLN A;  1F3B A;  1V98 A;  1Z5Y E;  4GF0 A;  3GUS A;  1OKD A;  3EU4 A;  1IYI A;  3M0F A;  4O5R A;  5B6M A;  5D9X A;  1T1V A;  3ZLP A;  2JU5 A;  1PD2 1;  1F3A A;  3EE2 A;  3L4N A;  1ZOF A;  1GSS A;  4PX1 A;  2R4V A;  2MMZ A;  3D22 A;  1QMV A;  4BPY A;  1UVZ A;  3I69 A;  3CMI A;  2L5O A;  4G19 A;  5LNK e;  5IMA A;  3CSH A;  1JHB A;  4V1A g;  2P31 A;  1FW1 A;  4KB3 A;  4KSO A;  1U88 A;  2YWM A;  2K6V A;  3C7M A;  1PA3 A;  4L5L A;  4YQU A;  3KP8 A;  3CRT A;  2IJY A;  2HFD A;  2CZ3 A;  10GS A;  2LRT A;  3ZL5 A;  2KP1 A;  2H73 A;  4F0B A;  1A2J A;  4GQF A;  4CHS A;  5LCZ A;  1TW9 A;  4OO4 A;  5EY6 A;  3F8U A;  1TTZ A;  3IAM 2;  3I6A A;  1SL1 B;  2IMI A;  1PN9 A;  4PNG A;  2X8H A;  4E8E A;  3IK7 A;  5B7C A;  3GIX A;  5JCW A;  3F4S A;  4KDU A;  2I3Y A;  2MBT A;  1SK2 A;  1VF4 A;  3RPN A;  3GN3 A;  2H0G A;  2GQM A;  2IWT A;  2H70 A;  4MJA A;  4MZC A;  4KUN A;  2MMN A;  2PBJ A;  3DVW A;  5AIS A;  2LST A;  2IFQ A;  1KEB A;  1PQN A;  4YAV A;  4OFT A;  3HJM A;  4PQI A;  1SJI A;  1XXU A;  3HKR A;  1M2B A;  3FR3 A;  4TXV A;  4MAB A;  2LUS A;  4XCS A;  3WD6 A;  1XW5 A;  3DVX A;  5G31 A;  4MF7 A;  4POB A;  3LJR A;  4JZQ A;  4DSS A;  2YWN A;  1OYJ A;  2C8U A;  3QFB C;  2YWI A;  2R37 A;  1VF2 A;  2LQQ A;  1XFL A;  2VM2 A;  4IEL A;  4F82 A;  1XBS A;  2B7K A;  5HFK A;  1RQM A;  2M80 A;  5GAP D;  2VOC A;  5F05 A;  3RPP A;  2PN8 A;  2GQL A;  1MD4 A; 
#chains in the Genus database with same CATH topology
 3QCP A;  1TRV A;  3TJK A;  4F2I A;  4GSS A;  4KSM A;  3HJO A;  3DML A;  4KGI A;  3TRP A;  3QPM A;  4NWY A;  1ON4 A;  2C3Q A;  4KA0 A;  3VWW A;  3L78 A;  5HFG A;  1YQ1 A;  3W8J A;  1GNW A;  3MSZ A;  3MDK A;  4NHZ A;  1EV4 A;  1MDI A;  3SBC A;  2VLV A;  5IMZ A;  2C1Y A;  3TKS A;  1O81 A;  3FHK A;  1GNE A;  4HDE A;  4IBP A;  5DAL A;  4FYC A;  1SKW B;  2B1K A;  1M99 A;  2C80 A;  2GT5 A;  2UZ8 A;  3Q6O A;  3BBY A;  5B8A A;  2HRF A;  4BVX B;  4F0C A;  3WT1 A;  3N5O A;  4O7H A;  2V1M A;  4XHM A;  1R5P A;  3G9B A;  2PU9 C;  3CTF A;  5A5K A;  2X64 A;  2GVP A;  5IO0 A;  4TVE A;  3LXT A;  4ID0 A;  3GUR A;  2PVQ A;  2AYT A;  1FB0 A;  1SK1 A;  4BWS A;  1JFU A;  2DJ3 A;  2BMX A;  3HVN A;  1G7O A;  4WKW A;  5AN1 A;  3FZA A;  4J2F A;  2DML A;  1DUG A;  1UA5 A;  2CX3 A;  3IOS A;  1K0D A;  4FQU A;  1ZMA A;  2TIR A;  4K0N A;  3CYN A;  4EF0 A;  4KE3 A;  2IMF A;  2A2S A;  4USS A;  1C72 A;  1AQW A;  5IO2 A;  3ZIT A;  3HJP A;  2CZ2 A;  1YEX A;  3GKN A;  4O32 A;  1PRX A;  2GSQ A;  2OA7 A;  1A2L A;  4EE0 A;  2AV4 A;  1SD8 A;  1GH2 A;  1GSY A;  4EC0 A;  4QQ7 A;  4Z2T A;  5AGY A;  2CAQ A;  3M1G A;  2OBK A;  4WBR D;  1WIK A;  3E9J B;  3KTB A;  3FEU A;  2ZUP A;  5ID2 B;  19GS A;  4KDY A;  2YV7 A;  5C04 A;  2VCQ A;  3P7X A;  3ZTL A;  2DJK A;  4RUV A;  2TRC P;  1URM A;  2J9H A;  1SU9 A;  2P5Q A;  1XIY A;  3VK9 A;  1XZO A;  5GZZ B;  1Y25 A;  1K0M A;  2DKI A;  1J9B A;  3ZVJ D;  1HNA A;  1FVJ A;  4G0K A;  2OKA A;  5G1K A;  1K3L A;  1WE0 A;  3HA9 A;  1X5D A;  2H1A A;  1GL8 A;  5ECP B;  1U3A A;  2MBS A;  6GSW A;  1K0B A;  1T7P B;  3F3Q A;  2JAC A;  3TDG A;  1A8L A;  3H1N A;  2YP6 A;  2ES7 A;  2P5R A;  3EU3 A;  2RUE A;  3TRX A;  4L0U A;  4MCU A;  3QAG A;  3ME8 A;  4MZB A;  5JWQ B;  2KUC A;  4XRD A;  4K1F A;  3LW9 A;  3H8Q A;  4KF9 A;  1XWB A;  5D73 A;  1M2A A;  4EKZ A;  5ELA A;  1X9M B;  2H66 A;  4EO3 A;  3ZFB A;  1SJZ A;  1HD2 A;  3UAP A;  4FH8 A;  4RQX A;  4ML6 A;  4N30 A;  4BL7 B;  5ECS A;  3PR8 A;  1EZK A;  1B8X A;  1TXX A;  2D2Z A;  2YJ7 A;  2TRX A;  2X49 A;  3KH9 A;  3LQ7 A;  1B9X C;  1BAY A;  3OR5 A;  1HYU A;  4TKY A;  1RK4 A;  3IK9 A;  2VD0 A;  2HYX A;  3HVX A;  1O73 A;  3IAS 2;  2OBI A;  1EWX A;  5CO3 A;  3I43 A;  3U6V A;  1BYE A;  5A4U A;  4EIQ A;  3GKM A;  4KH7 A;  3W8S A;  4YKG A;  2FUG 2;  2FWH A;  4KDX A;  3TOU A;  4MDC A;  2JZT A;  1A23 A;  4V2N A;  3FR9 A;  4HSC X;  1TKD B;  2H72 A;  1AQV A;  3BCK A;  1PL1 A;  1AAZ A;  4K6X A;  5E59 A;  1ACV A;  4NAX A;  1Z7P A;  3NIV A;  2O8V B;  2H6X A;  4TR4 A;  1E6B A;  1BJX A;  3UIW A;  4JBB A;  2WRT A;  3LYP A;  3D21 A;  4HI7 A;  4H86 A;  2GS3 A;  4K5R A;  5IMV A;  4POK A;  5F06 A;  2XHF A;  1GTU A;  3HD5 A;  1WPI A;  3TKS E;  1W4V A;  1H4O A;  2IFQ B;  2H71 A;  2LEG A;  1O85 A;  1JZO A;  3QAW A;  1Q98 A;  3WGX A;  2WZ9 A;  2X4A A;  4XS4 A;  6GSU A;  4MF6 A;  2I81 A;  4ZB6 A;  3ERW A;  1H75 A;  1OE7 A;  2F8A A;  1R4W A;  4IS0 A;  4J56 E;  1WWJ A;  4DSS B;  4N0Z A;  2GGT A;  2VAF A;  3DGQ A;  3IA1 A;  4HZ4 A;  5KN2 A;  3ZRD A;  4IJ3 A;  3FMW A;  1XVQ A;  4ECJ A;  1X0R A;  5D9W A;  3BCI A;  5DCH A;  5ECL B;  4K8M A;  3FZ4 A;  2H6Y A;  5H5R A;  2LRN A;  5KEJ A;  4GQC A;  1NM3 A;  1YJ6 A;  2IIY A;  3O76 A;  1SL0 B;  4TR3 A;  2DSA A;  4AJ8 A;  5CRE A;  2DJ1 A;  1M9A A;  1U6T A;  1SYX A;  1VF1 A;  5JCU A;  3KGK A;  1EV9 A;  1Z7R A;  4TRX A;  2HRA A;  3E3E A;  1A0R P;  3IR4 A;  1NHO A;  1TOF A;  1ERW A;  1HNB A;  2X8C A;  2KP2 A;  1TRU A;  3VFI A;  4N0V A;  2YWO A;  5AIX A;  2EIR A;  4PQ1 A;  3ISO A;  4MPG A;  3MNG A;  1M3J A;  2H30 A;  3UOM A;  4MNN A;  2B1L A;  1VGL A;  4MJC A;  1GUL A;  1TI1 A;  3ZVJ A;  5DAL B;  3US3 A;  4POL A;  3TKR A;  3GNJ A;  2WFC A;  3NZN A;  2KHP A;  1PMT A;  1TDI A;  3R3E A;  3F4R A;  1F6M C;  3EMX A;  2PVO C;  4KW6 A;  3EPT A;  2V41 A;  4Q5F A;  5CRD A;  3GX0 A;  4L8E A;  4KAE A;  5IMF A;  1XWC A;  3GH9 A;  1PL2 A;  1OC3 A;  5IIZ A;  3GV1 A;  2FD3 A;  5HR1 A;  1M9B A;  3GL3 A;  4ZIL A;  2C3T A;  1EOH A;  4WEY A;  2HNL A;  5IQY A;  1U87 A;  2VD1 A;  1CQG A;  2OE1 A;  2HSM A;  1K0A A;  3HVS A;  5GAN D;  2XBI A;  2O85 A;  1QK8 A;  1ST9 A;  3J7Y b;  4CY8 A;  1FAA A;  1FVK A;  3BOA A;  1G6Y A;  3KD0 A;  1LBK A;  1X5C A;  5ECI B;  5KOW A;  1DSB A;  2C4J A;  3KP9 A;  1T3B A;  2R6K A;  1GTB A;  3GA4 A;  2MMA A;  1EGR A;  3VPT A;  4A5P A;  3PH9 A;  2J23 A;  4WR5 A;  3EUR A;  2WUL A;  1RW1 A;  5F07 A;  1VRS D;  5HR3 A;  2AUV A;  4K0G A;  2GT6 A;  2O87 A;  1T00 A;  3QFA C;  2WJU A;  3IV4 A;  4JRR A;  4MH3 A;  5D9V A;  5AIV A;  5B8B A;  4GLT A;  5FHI A;  1N2A A;  4EVM A;  4KCA A;  2VCV A;  4GXZ A;  1QXH A;  2JAD A;  1XWK A;  1MD3 A;  4GWR A;  1WMJ A;  4K7I A;  3FYG A;  4XS1 A;  4YQV A;  2IMK A;  4LLR A;  3ZRE A;  2V32 A;  3ERF A;  2CQ9 A;  2FHE A;  2HZF A;  4WR4 A;  1TK8 B;  1BX9 A;  4V1A p;  2BJX A;  1YKC A;  4IP1 A;  3HZ4 A;  3TJJ A;  3DIE A;  3GYK A;  2H0I A;  4POM A;  3ERG A;  1ML6 A;  4I8B A;  1M3I A;  1THO A;  5KN0 A;  5ABR A;  1YDK A;  4ICY A;  2GZY A;  4TR1 B;  2R5G A;  3UEM A;  1XWG A;  5ELG A;  1WOU A;  1ZZY A;  6GST A;  1BQ7 A;  4F03 A;  4MA9 A;  1ZCP A;  2VCT A;  2HXK A;  1OC9 A;  2IME A;  5IOX A;  3ED3 A;  2GQK A;  3TKP A;  1JLV A;  4BA7 A;  2O7K A;  1XPV A;  5J3R A;  4MPF A;  5HFI A;  2F9S A;  1Q4J A;  4EXJ A;  1A8Y A;  4I97 A;  3GSS A;  4BVY A;  3HHV A;  3V1W A;  4XRA A;  1ZL9 A;  2PGT A;  3D0Z A;  2X99 A;  2VO4 A;  3FZ5 A;  2QA2 A;  4IN0 A;  3QOU A;  1E2Y A;  2PER A;  1IYH A;  4JR4 A;  3IE3 A;  4V2M A;  5KN3 A;  1I9D A;  4NPB A;  2QA1 A;  2DKH A;  2IMD A;  4G10 A;  2C0E A;  5CAX A;  1G6W A;  2DJJ A;  3I9V 2;  4P3Y B;  4PQH A;  5DAK A;  4N11 A;  4Q5R A;  5J4U A;  3LSZ A;  3EVI A;  1QFN A;  2MZC A;  1O8W A;  1F9M A;  4MK3 A;  1A2M A;  5CRH A;  1OKT A;  2HT9 A;  3P8W A;  1R5A A;  2HZE A;  5DDL A;  2LV3 A;  4HQS A;  4JED A;  4ZBA A;  5G2Z A;  2H0H A;  4NMU A;  3GHA A;  3IBH A;  3KIJ A;  1YF1 A;  5GSS A;  1S3A A;  1X5E A;  2QSI A;  1ERU A;  1DE2 A;  1OC8 A;  1QQ2 A;  4G0L A;  3L9U A;  2NBS A;  2YNX A;  2K8S A;  3BD2 A;  3HCZ A;  1B9Y C;  3VUR A;  1AXD A;  2MYG A;  2VL2 C;  4HU7 A;  4FYB A;  2OJL A;  1I5G A;  20GS A;  3APO A;  4YKF A;  1TI3 A;  5HR0 A;  1O6J A;  1V58 A;  4WET A;  2NTO A;  5A4V A;  3QMX A;  1ILO A;  5H5Q A;  4QL7 A;  3DRN A;  4CDO A;  5DQY A;  2O89 A;  1FOH A;  3M3M A;  1T4Z A;  4I2T A;  1AIU A;  3DWV A;  3H79 A;  1MDJ A;  2V6O A;  1GSU A;  4HUA A;  4LA1 A;  5IOW A;  3ZML A;  4XS4 B;  1X9S B;  2F8F A;  4KX4 A;  3FW2 A;  2XBQ A;  4RI6 A;  3M9K A;  1J08 A;  4G9H A;  4ULX A;  1PGT A;  3D4T A;  5B6N A;  2FWF A;  1B4P A;  1G0T A;  1TP9 A;  2G0F A;  4TR1 A;  3CBU A;  1GP1 A;  1GWC A;  5J9B A;  4IHU A;  5DJM A;  3TOT A;  1K3O A;  2JSZ A;  1USB A;  1GUM A;  1EP7 A;  3M8N A;  4ZB9 A;  1KNG A;  3VI7 A;  5IPG A;  8GSS A;  4HU9 A;  3HY2 A;  4K9Z A;  3RAZ A;  3LOR A;  4DSQ A;  3FZ9 A;  4TW5 A;  2H01 A;  1GSD A;  3LG6 A;  4OO5 A;  1GUH A;  2B6M A;  1GSQ A;  1TRS A;  2CVB A;  2WS2 A;  4KND A;  5D9T A;  3HXS A;  1BED A;  4OMV A;  4FYU A;  4O5Q A;  2VCW A;  4PUF C;  2NPB A;  1GLQ A;  2N5B A;  4J57 E;  2DLX A;  2F3M A;  5G1L A;  2RM6 A;  4I6X A;  4TN8 A;  5IMD A;  2E7P A;  4HOJ A;  1B4Q A;  1YY7 A;  2YJH A;  3QAV A;  2WB9 A;  5ECM B;  3D6I A;  1UC7 A;  4RQR A;  2GZP A;  2B5X A;  3CQF A;  4XIH A;  1GRX A;  5COH A;  3BJ5 A;  4IP6 A;  3P2A A;  4GCI A;  3W6G A;  4V2L A;  2L4Q A;  4DVC A;  4PUA A;  1AC1 A;  4AGS A;  2DBC A;  2NDO A;  4YH2 A;  2F51 A;  2K18 A;  5FWG A;  5JWR B;  2L6D A;  2LTK A;  3GL5 A;  5JWO B;  3CXG A;  3KXO A;  5ECK B;  5D93 A;  3LFL A;  2OE0 A;  1YZX A;  2CVD A;  3EC3 A;  3F0I A;  6GSY A;  2E2G A;  5ECN B;  14GS A;  6GSV A;  3DKS A;  2H8L A;  2R3X A;  2YV9 A;  3F9U A;  3UVH A;  2M46 A;  2YZU A;  3AY8 A;  4OCE A;  4ZIJ A;  4JR6 A;  3TKQ A;  12GS A;  3PGT A;  4BIK A;  3KH7 A;  4WF5 A;  4IW9 A;  3HYP A;  2LQO A;  4MZW A;  2L57 A;  1XOA A;  1LJR A;  13GS A;  5C00 A;  3F6D A;  2NVL A;  4E8H A;  4LMW A;  1DBY A;  3HVV A;  3IRA A;  1WP0 A;  3WT2 A;  2QKE A;  3D4M A;  5CNW A;  1GSF A;  3UAR A;  4GRF A;  1XW9 A;  2QGV A;  4D73 B;  3TRQ A;  4ZBD A;  4TXO A;  3LWA A;  5E4W A;  2I9H A;  3GST A;  22GS A;  1SD9 A;  5IM9 A;  3APS A;  2VM1 A;  3L9S A;  4IGJ A;  3DXB A;  3C73 A;  17GS A;  4NV5 A;  1MTC A;  5J5N A;  3WGE A;  3RDW A;  4FIW A;  3PIN A;  5ECQ B;  3VWV A;  4CY6 A;  1THX A;  4PUR A;  3DYR A;  5ECH B;  3TKS C;  1K0N A;  18GS A;  1JZR A;  3VI5 A;  2Z9S A;  2GST A;  3N9J A;  3F63 A;  2PUK C;  1O8X A;  3EWL A;  2MMO A;  2AJQ B;  3KJY A;  3JCM L;  5G30 A;  1OC9 B;  5F8B A;  3E0U A;  4RI7 A;  1ZYQ B;  5DCG A;  1MEK A;  3A5W A;  3FR6 A;  2I1U A;  2VCZ A;  4K2D A;  2WDU A;  3UJ1 A;  3IHQ A;  3ZIJ A;  4HQZ A;  4ZB8 A;  2R0G A;  3PPU A;  3H4K A;  1MDK A;  5F0G A;  4BVY B;  2YZH A;  2H76 A;  4PGT A;  3KCM A;  2XC2 A;  3GTU A;  4YQM A;  2REM A;  2V2G A;  4XS6 A;  3TUE A;  2CT6 A;  4LL1 B;  3IDV A;  2WCI A;  9GSS A;  4L5O A;  1OE8 A;  2HRN A;  4O92 A;  4Q5N A;  4IJI A;  2R2J A;  1SJ6 A;  3GKX A;  4G2E A;  6GSX A;  1CQH A;  4L0W A;  2DC5 A;  1V40 A;  5DAK B;  2G2Q A;  1YKA A;  2C0F A;  1A0F A;  3HDC A;  5A4W A;  1Z9H A;  2AAW A;  2A2R A;  5DBQ A;  1LU4 A;  1FG4 A;  4MF5 A;  3UBL A;  2HZE B;  1HQO A;  1M2D A;  2V6K A;  5DVB A;  4HS1 A;  3TCO A;  2VIM A;  4BWQ A;  3IC8 A;  3C71 A;  2IPA A;  2IN3 A;  5ENU A;  1EOG A;  1N8J A;  2RII A;  1VF3 A;  4OFM A;  4HJ2 A;  2GTU A;  1UN2 A;  2FCH A;  2A4V A;  2CA8 A;  2H74 A;  2EIQ A;  2JL4 A;  4EDZ A;  2ZNM A;  4AJ6 A;  4X43 A;  5ECO B;  2YPM A;  5CYY A;  2EIO A;  2B7J A;  1FB6 A;  3CSI A;  3IPZ A;  1EGO A;  2R0P A;  1X9W B;  3IC4 A;  2HSH A;  4D73 A;  1JLW A;  3RHB A;  1GSE A;  1GTA A;  3C8E A;  2GSS A;  2HRK A;  1T8E B;  3GFK A;  5G5E A;  1ZGN A;  1V57 A;  4GST A;  2FWE A;  1SKR B;  3F4T A;  1ZYN A;  2HLS A;  1KTE A;  3UBK A;  4DEJ A;  2KLX A;  5H5S A;  1EP8 A;  1TU8 A;  4HZ2 A;  5KN1 A;  1K0O A;  2ZCT A;  3C1R A;  2A2P A;  6GSS A;  4IQ1 A;  1NSW A;  1AUC A;  1K3Y A;  1S3C A;  2ON7 A;  3F6F A;  2ON5 A;  1FO5 A;  4N10 A;  5HQP A;  2QC7 A;  4I5Q A;  3L0H A;  2DJ0 A;  2CVK A;  1NHY A;  4OWY A;  2GZZ A;  4Z2U A;  1SL2 B;  1YEP A;  2OAC A;  4MH2 A;  1U3I A;  5D96 A;  3LXZ A;  1TRW A;  3SWL A;  4K7N A;  4I2U A;  3GX8 A;  3CRU A;  5ECR B;  1TU7 A;  2CX4 A;  3HZ8 A;  4ECB A;  4EDY A;  1XCC A;  2VCX A;  2K8V A;  3EMP A;  3DD3 A;  3S9F A;  3ZFL A;  2YAN A;  1PX7 A;  3LYK A;  2VUP A;  3UL3 A;  3H93 A;  4ISD A;  5FT3 A;  2CV4 A;  2H75 A;  1BG5 A;  2OE3 A;  1NW2 A;  5CRW A;  3G7Y A;  2M72 A;  4AJ7 A;  1O7U A;  4X0X A;  2I4A A;  3WYW A;  1W89 A;  3A3T A;  4O5U A;  2JSY A;  3R2Q A;  4HJM A;  4ILF A;  3C1S A;  3Q18 A;  1HNC A;  4FO5 A;  1S3D A;  1AW9 A;  3VPQ A;  1M0U A;  2P0G A;  4MP4 A;  3UMA A;  4PXO A;  4OFN A;  3QD9 A;  1V2A A;  1EEM A;  2KOK A;  3MYD A;  2B3S A;  2FY6 A;  2FLS A;  4ML1 A;  4LL4 B;  1B48 A;  1V9W A;  2HSY A;  2R0C A;  3F3R A;  4ECC A;  4QL9 A;  2A4H A;  2WGR A;  5CRG A;  1OAZ A;  3O3T A;  1TK5 B;  4ZL9 A;  2YCD A;  2LNS A;  5D8I A;  4K5S A;  1YF0 A;  3NOF A;  2L6C A;  4EL1 A;  3G7I A;  2AHE A;  5DQS A;  3FRC A;  4GSN A;  5JCG A;  3KTL A;  4EIP A;  16GS A;  4WF4 A;  3KZQ A;  3U5R E;  1WJK A;  3TJB A;  3A2V A;  1TJD A;  3ZYW A;  3EYT A;  5LD0 A;  4WXT A;  2L4C A;  3MIX A;  4NHW A;  1GTI A;  3L9V A;  2CAI A;  3TGZ A;  3RHC A;  1PX6 A;  1QGV A;  1M7T A;  4CW9 A;  3GRX A;  3J7Y k;  1TK0 B;  3QR6 A;  4GTU A;  4MLY A;  3Q74 A;  2X8G A;  4IKH A;  3GH6 A;  1T4Y A;  1FOV A;  2JZR A;  4JU5 A;  3KEB A;  3Q19 A;  4TXO B;  4PTS A;  2C0D A;  1OVN A;  1Z6N A;  4XTS A;  3WGD A;  1PKZ A;  4ZBB A;  4IQA A;  2GDR A;  4K2X A;  4X1U A;  4JE1 A;  3P90 A;  1AQX A;  5HR2 A;  5EPF A;  2IL3 A;  1XVW A;  2H19 A;  5IMC A;  1R7H A;  1G7E A;  1WRY A;  5G5F A;  2N5A A;  4ZXG A;  1XW6 A;  1PFO A;  1XWA A;  2RUF A;  5INY A;  1SYR A;  2C3N A;  4DSR A;  2DIY A;  4MJB A;  2L59 A;  1FHE A;  2C0G A;  2H1B A;  2N5F A;  2AB6 A;  4BVX A;  2LJK A;  4F9Z A;  4ACS A;  3KM6 A;  2EC4 A;  2VL9 A;  1SKS B;  4MJE A;  2BTO T;  4NXI A;  4TR0 A;  4OCF A;  2PPT A;  4Q5Q A;  2RLI A;  3A2X A;  3QDN A;  2H1G A;  2HI7 A;  1R26 A;  5J41 A;  2LRC A;  3GTU B;  4YAP A;  1ERV A;  3KMO A;  5KOX A;  3M9J A;  2K9F A;  1ERT A;  4NV2 A;  4K7O A;  4ZL7 A;  3TJG A;  2GLR A;  2XPD A;  1QUW A;  3FY7 A;  2L5L A;  4LMV A;  3A2W A;  1ABA A;  3CSJ A;  3A5I A;  4KCE A;  4WBJ A;  2B5Y A;  4IVF A;  3MAK A;  1K0C A;  1SK0 A;  2LNT A;  3GKK A;  3DEX A;  3LEF A;  1Y6E A;  2DIZ A;  2LKU A;  3FK8 A;  5IPH A;  3KMN A;  3FKF A;  4X4J A;  4Z7X A;  3RBT A;  3TB2 A;  2VLU A;  3ZIV A;  5ID2 A;  3UVT A;  4G0I A;  2LS5 A;  1JZD A;  1Z3E A;  2H6Z A;  4PNF A;  5EL8 A;  1GLP A;  1GUK A;  1F37 A;  2VL2 A;  1PSQ A;  2FGX A;  2FNO A;  1DE1 A;  5EVO A;  3O6T A;  3TJF A;  2FA8 A;  1ZYE A;  2LJR A;  3GMF A;  4TOP A;  2LJA A;  2DMM A;  1A24 A;  2VL3 A;  3D5J A;  3VWU A;  3MWH A;  3ZMK A;  1Z6M A;  2E2M A;  1KBN A;  4ECI A;  5CP1 A;  3ZZX A;  4EUY A;  2JZS A;  3K8N A;  3IXR A;  2GSR A;  1F2E A;  2H1D A;  4MMM A;  4OD7 A;  3EIN A;  2XPE A;  2FWG A;  4AF2 A;  2PMT A;  2YN1 A;  1SEN A;  2OAD A;  1EEJ A;  2YOI A;  5L71 A;  2RM5 A;  1J0F A;  3ME7 A;  2B5E A;  3LGC A;  3G7J A;  3CTG A;  2PWJ A;  5GST A;  2HE3 A;  3VWX A;  5BRT A;  7GSS A;  3APQ A;  2E0Q A;  2VLT A;  11GS A;  2FA4 A;  5J9C A;  5DJL A;  1PKW A;  1XOB A;  4BL7 A;  2DJ2 A;  1JZW A;  2ALB A;  4ZL8 A;  4HEA 2;  3VLN A;  1F3B A;  1S3R A;  1V98 A;  1Z5Y E;  4GF0 A;  3GUS A;  1OKD A;  3EU4 A;  1IYI A;  3M0F A;  4O5R A;  5B6M A;  5D9X A;  1T1V A;  3ZLP A;  2JU5 A;  1PD2 1;  1F3A A;  3EE2 A;  3L4N A;  1ZOF A;  1GSS A;  4PX1 A;  2R4V A;  2MMZ A;  3D22 A;  1QMV A;  4BPY A;  1UVZ A;  3I69 A;  3CMI A;  2L5O A;  4G19 A;  5LNK e;  5IMA A;  1XG8 A;  3CSH A;  1JHB A;  4V1A g;  2P31 A;  1FW1 A;  4KB3 A;  4KSO A;  1PN0 A;  1U88 A;  2YWM A;  2K6V A;  3C7M A;  1PA3 A;  4L5L A;  4YQU A;  3KP8 A;  3CRT A;  2IJY A;  2HFD A;  2CZ3 A;  10GS A;  2LRT A;  3ZL5 A;  2KP1 A;  2H73 A;  4F0B A;  1A2J A;  4Z2R A;  4GQF A;  4CHS A;  5LCZ A;  1TW9 A;  4OO4 A;  5EY6 A;  3F8U A;  1TTZ A;  3IAM 2;  3I6A A;  1SL1 B;  5BMU A;  2IMI A;  1PN9 A;  4PNG A;  2X8H A;  4E8E A;  3IK7 A;  5B7C A;  3GIX A;  5JCW A;  3F4S A;  4KDU A;  2I3Y A;  2MBT A;  1SK2 A;  1VF4 A;  3RPN A;  3GN3 A;  2H0G A;  2GQM A;  2IWT A;  2H70 A;  4MJA A;  4MZC A;  4KUN A;  2MMN A;  2PBJ A;  3DVW A;  5AIS A;  2LST A;  2IFQ A;  1KEB A;  1PQN A;  4YAV A;  4OFT A;  3HJM A;  4PQI A;  1SJI A;  1XXU A;  3HKR A;  1M2B A;  3FR3 A;  4TXV A;  4MAB A;  2LUS A;  4XCS A;  3WD6 A;  1XW5 A;  3DVX A;  5G31 A;  4MF7 A;  4POB A;  3LJR A;  4JZQ A;  4DSS A;  2YWN A;  1OYJ A;  2C8U A;  3QFB C;  2YWI A;  2R37 A;  1VF2 A;  2LQQ A;  1XFL A;  2VM2 A;  4IEL A;  4F82 A;  1XBS A;  3IHG A;  2B7K A;  5HFK A;  1RQM A;  2M80 A;  5GAP D;  2VOC A;  1ZYP A;  5F05 A;  3RPP A;  2PN8 A;  2GQL A;  1MD4 A; 
#chains in the Genus database with same CATH homology
 3QCP A;  1TRV A;  3TJK A;  4F2I A;  4GSS A;  4KSM A;  3HJO A;  3DML A;  4KGI A;  3TRP A;  3QPM A;  4NWY A;  1ON4 A;  2C3Q A;  4KA0 A;  3VWW A;  3L78 A;  5HFG A;  1YQ1 A;  3W8J A;  1GNW A;  3MSZ A;  3MDK A;  4NHZ A;  1EV4 A;  1MDI A;  3SBC A;  2VLV A;  5IMZ A;  2C1Y A;  3TKS A;  1O81 A;  3FHK A;  1GNE A;  4HDE A;  4IBP A;  5DAL A;  4FYC A;  1SKW B;  2B1K A;  1M99 A;  2C80 A;  2GT5 A;  2UZ8 A;  3Q6O A;  3BBY A;  5B8A A;  2HRF A;  4BVX B;  4F0C A;  3WT1 A;  3N5O A;  4O7H A;  2V1M A;  4XHM A;  1R5P A;  3G9B A;  2PU9 C;  3CTF A;  5A5K A;  2X64 A;  2GVP A;  5IO0 A;  4TVE A;  3LXT A;  4ID0 A;  3GUR A;  2PVQ A;  2AYT A;  1FB0 A;  1SK1 A;  4BWS A;  1JFU A;  2DJ3 A;  2BMX A;  1G7O A;  4WKW A;  5AN1 A;  3FZA A;  4J2F A;  2DML A;  1DUG A;  1UA5 A;  2CX3 A;  3IOS A;  1K0D A;  4FQU A;  1ZMA A;  2TIR A;  4K0N A;  3CYN A;  4EF0 A;  4KE3 A;  2IMF A;  2A2S A;  4USS A;  1C72 A;  1AQW A;  5IO2 A;  3ZIT A;  3HJP A;  2CZ2 A;  1YEX A;  3GKN A;  4O32 A;  1PRX A;  2GSQ A;  2OA7 A;  1A2L A;  4EE0 A;  2AV4 A;  1SD8 A;  1GH2 A;  1GSY A;  4EC0 A;  4QQ7 A;  4Z2T A;  5AGY A;  2CAQ A;  3M1G A;  2OBK A;  4WBR D;  1WIK A;  3E9J B;  3KTB A;  3FEU A;  2ZUP A;  5ID2 B;  19GS A;  4KDY A;  2YV7 A;  5C04 A;  2VCQ A;  3P7X A;  3ZTL A;  2DJK A;  4RUV A;  2TRC P;  1URM A;  2J9H A;  1SU9 A;  2P5Q A;  1XIY A;  3VK9 A;  1XZO A;  5GZZ B;  1Y25 A;  1K0M A;  2DKI A;  1J9B A;  3ZVJ D;  1HNA A;  1FVJ A;  4G0K A;  2OKA A;  5G1K A;  1K3L A;  1WE0 A;  3HA9 A;  1X5D A;  2H1A A;  1GL8 A;  5ECP B;  1U3A A;  2MBS A;  6GSW A;  1K0B A;  1T7P B;  3F3Q A;  2JAC A;  3TDG A;  1A8L A;  3H1N A;  2YP6 A;  2ES7 A;  2P5R A;  3EU3 A;  2RUE A;  3TRX A;  4L0U A;  4MCU A;  3QAG A;  3ME8 A;  4MZB A;  5JWQ B;  2KUC A;  4XRD A;  4K1F A;  3LW9 A;  3H8Q A;  4KF9 A;  1XWB A;  5D73 A;  1M2A A;  4EKZ A;  5ELA A;  1X9M B;  2H66 A;  4EO3 A;  3ZFB A;  1SJZ A;  1HD2 A;  3UAP A;  4FH8 A;  4RQX A;  4ML6 A;  4N30 A;  4BL7 B;  5ECS A;  3PR8 A;  1EZK A;  1B8X A;  1TXX A;  2D2Z A;  2YJ7 A;  2TRX A;  2X49 A;  3KH9 A;  3LQ7 A;  1B9X C;  1BAY A;  3OR5 A;  1HYU A;  4TKY A;  1RK4 A;  3IK9 A;  2VD0 A;  2HYX A;  3HVX A;  1O73 A;  3IAS 2;  2OBI A;  1EWX A;  5CO3 A;  3I43 A;  3U6V A;  1BYE A;  5A4U A;  4EIQ A;  3GKM A;  4KH7 A;  3W8S A;  4YKG A;  2FUG 2;  2FWH A;  4KDX A;  3TOU A;  4MDC A;  2JZT A;  1A23 A;  4V2N A;  3FR9 A;  1TKD B;  2H72 A;  1AQV A;  3BCK A;  1PL1 A;  1AAZ A;  4K6X A;  5E59 A;  1ACV A;  4NAX A;  1Z7P A;  3NIV A;  2O8V B;  2H6X A;  4TR4 A;  1E6B A;  1BJX A;  3UIW A;  4JBB A;  2WRT A;  3LYP A;  3D21 A;  4HI7 A;  4H86 A;  2GS3 A;  4K5R A;  5IMV A;  4POK A;  5F06 A;  2XHF A;  1GTU A;  3HD5 A;  1WPI A;  3TKS E;  1W4V A;  1H4O A;  2IFQ B;  2H71 A;  2LEG A;  1O85 A;  1JZO A;  3QAW A;  1Q98 A;  3WGX A;  2WZ9 A;  2X4A A;  4XS4 A;  6GSU A;  4MF6 A;  2I81 A;  4ZB6 A;  3ERW A;  1H75 A;  1OE7 A;  2F8A A;  1R4W A;  4IS0 A;  4J56 E;  1WWJ A;  4DSS B;  4N0Z A;  2GGT A;  2VAF A;  3DGQ A;  3IA1 A;  4HZ4 A;  5KN2 A;  3ZRD A;  4IJ3 A;  3FMW A;  1XVQ A;  4ECJ A;  1X0R A;  5D9W A;  3BCI A;  5DCH A;  5ECL B;  4K8M A;  3FZ4 A;  2H6Y A;  5H5R A;  2LRN A;  5KEJ A;  4GQC A;  1NM3 A;  1YJ6 A;  2IIY A;  3O76 A;  1SL0 B;  4TR3 A;  2DSA A;  4AJ8 A;  5CRE A;  2DJ1 A;  1M9A A;  1U6T A;  1SYX A;  1VF1 A;  5JCU A;  3KGK A;  1EV9 A;  1Z7R A;  4TRX A;  2HRA A;  3E3E A;  1A0R P;  3IR4 A;  1NHO A;  1TOF A;  1ERW A;  1HNB A;  2X8C A;  2KP2 A;  1TRU A;  3VFI A;  4N0V A;  2YWO A;  5AIX A;  2EIR A;  4PQ1 A;  3ISO A;  4MPG A;  3MNG A;  2H30 A;  3UOM A;  4MNN A;  2B1L A;  1VGL A;  4MJC A;  1GUL A;  1TI1 A;  3ZVJ A;  5DAL B;  3US3 A;  4POL A;  3TKR A;  3GNJ A;  2WFC A;  3NZN A;  2KHP A;  1PMT A;  1TDI A;  3R3E A;  3F4R A;  1F6M C;  3EMX A;  2PVO C;  4KW6 A;  3EPT A;  2V41 A;  4Q5F A;  5CRD A;  3GX0 A;  4L8E A;  4KAE A;  5IMF A;  1XWC A;  3GH9 A;  1PL2 A;  1OC3 A;  5IIZ A;  3GV1 A;  2FD3 A;  5HR1 A;  1M9B A;  3GL3 A;  4ZIL A;  2C3T A;  1EOH A;  4WEY A;  2HNL A;  5IQY A;  1U87 A;  2VD1 A;  1CQG A;  2OE1 A;  2HSM A;  1K0A A;  3HVS A;  5GAN D;  2XBI A;  2O85 A;  1QK8 A;  1ST9 A;  3J7Y b;  4CY8 A;  1FAA A;  1FVK A;  3BOA A;  1G6Y A;  3KD0 A;  1LBK A;  1X5C A;  5ECI B;  5KOW A;  1DSB A;  2C4J A;  3KP9 A;  1T3B A;  2R6K A;  1GTB A;  3GA4 A;  2MMA A;  1EGR A;  3VPT A;  4A5P A;  3PH9 A;  2J23 A;  4WR5 A;  3EUR A;  2WUL A;  1RW1 A;  5F07 A;  1VRS D;  5HR3 A;  2AUV A;  4K0G A;  2GT6 A;  2O87 A;  1T00 A;  3QFA C;  2WJU A;  3IV4 A;  4JRR A;  4MH3 A;  5D9V A;  5AIV A;  5B8B A;  4GLT A;  5FHI A;  1N2A A;  4EVM A;  4KCA A;  2VCV A;  4GXZ A;  1QXH A;  2JAD A;  1XWK A;  1MD3 A;  4GWR A;  1WMJ A;  4K7I A;  3FYG A;  4XS1 A;  4YQV A;  2IMK A;  4LLR A;  3ZRE A;  2V32 A;  3ERF A;  2CQ9 A;  2FHE A;  2HZF A;  4WR4 A;  1TK8 B;  1BX9 A;  4V1A p;  2BJX A;  1YKC A;  4IP1 A;  3HZ4 A;  3TJJ A;  3DIE A;  3GYK A;  2H0I A;  4POM A;  3ERG A;  1ML6 A;  4I8B A;  1THO A;  5KN0 A;  5ABR A;  1YDK A;  4ICY A;  2GZY A;  4TR1 B;  2R5G A;  3UEM A;  1XWG A;  5ELG A;  1WOU A;  1ZZY A;  6GST A;  1BQ7 A;  4F03 A;  4MA9 A;  1ZCP A;  2VCT A;  2HXK A;  1OC9 A;  2IME A;  5IOX A;  3ED3 A;  2GQK A;  3TKP A;  1JLV A;  4BA7 A;  2O7K A;  1XPV A;  5J3R A;  4MPF A;  5HFI A;  2F9S A;  1Q4J A;  4EXJ A;  1A8Y A;  4I97 A;  3GSS A;  4BVY A;  3HHV A;  3V1W A;  4XRA A;  1ZL9 A;  2PGT A;  3D0Z A;  2X99 A;  2VO4 A;  3FZ5 A;  2QA2 A;  4IN0 A;  3QOU A;  1E2Y A;  2PER A;  1IYH A;  4JR4 A;  3IE3 A;  4V2M A;  5KN3 A;  1I9D A;  4NPB A;  2QA1 A;  2DKH A;  2IMD A;  4G10 A;  2C0E A;  5CAX A;  1G6W A;  2DJJ A;  3I9V 2;  4P3Y B;  4PQH A;  5DAK A;  4N11 A;  4Q5R A;  5J4U A;  3LSZ A;  3EVI A;  1QFN A;  2MZC A;  1O8W A;  1F9M A;  4MK3 A;  1A2M A;  5CRH A;  1OKT A;  2HT9 A;  3P8W A;  1R5A A;  2HZE A;  5DDL A;  2LV3 A;  4HQS A;  4JED A;  4ZBA A;  5G2Z A;  2H0H A;  4NMU A;  3GHA A;  3IBH A;  3KIJ A;  1YF1 A;  5GSS A;  1S3A A;  1X5E A;  2QSI A;  1ERU A;  1DE2 A;  1OC8 A;  1QQ2 A;  4G0L A;  3L9U A;  2NBS A;  2YNX A;  2K8S A;  3BD2 A;  3HCZ A;  1B9Y C;  3VUR A;  1AXD A;  2MYG A;  2VL2 C;  4HU7 A;  4FYB A;  2OJL A;  1I5G A;  20GS A;  3APO A;  4YKF A;  1TI3 A;  5HR0 A;  1O6J A;  1V58 A;  4WET A;  2NTO A;  5A4V A;  3QMX A;  1ILO A;  5H5Q A;  4QL7 A;  3DRN A;  4CDO A;  5DQY A;  2O89 A;  1FOH A;  3M3M A;  1T4Z A;  4I2T A;  1AIU A;  3DWV A;  3H79 A;  1MDJ A;  2V6O A;  1GSU A;  4HUA A;  4LA1 A;  5IOW A;  3ZML A;  4XS4 B;  1X9S B;  2F8F A;  4KX4 A;  3FW2 A;  2XBQ A;  4RI6 A;  3M9K A;  1J08 A;  4G9H A;  4ULX A;  1PGT A;  3D4T A;  5B6N A;  2FWF A;  1B4P A;  1G0T A;  1TP9 A;  2G0F A;  4TR1 A;  3CBU A;  1GP1 A;  1GWC A;  5J9B A;  4IHU A;  5DJM A;  3TOT A;  1K3O A;  2JSZ A;  1USB A;  1GUM A;  1EP7 A;  3M8N A;  4ZB9 A;  1KNG A;  3VI7 A;  5IPG A;  8GSS A;  4HU9 A;  3HY2 A;  4K9Z A;  3RAZ A;  3LOR A;  4DSQ A;  3FZ9 A;  4TW5 A;  2H01 A;  1GSD A;  3LG6 A;  4OO5 A;  1GUH A;  2B6M A;  1GSQ A;  1TRS A;  2CVB A;  2WS2 A;  4KND A;  5D9T A;  3HXS A;  1BED A;  4OMV A;  4FYU A;  4O5Q A;  2VCW A;  4PUF C;  2NPB A;  1GLQ A;  2N5B A;  4J57 E;  2DLX A;  2F3M A;  5G1L A;  2RM6 A;  4I6X A;  4TN8 A;  5IMD A;  2E7P A;  4HOJ A;  1B4Q A;  1YY7 A;  2YJH A;  3QAV A;  2WB9 A;  5ECM B;  3D6I A;  1UC7 A;  4RQR A;  2GZP A;  2B5X A;  4XIH A;  1GRX A;  5COH A;  3BJ5 A;  4IP6 A;  3P2A A;  4GCI A;  3W6G A;  4V2L A;  2L4Q A;  4DVC A;  4PUA A;  1AC1 A;  4AGS A;  2DBC A;  2NDO A;  4YH2 A;  2F51 A;  2K18 A;  5FWG A;  5JWR B;  2L6D A;  2LTK A;  3GL5 A;  5JWO B;  3CXG A;  3KXO A;  5ECK B;  5D93 A;  3LFL A;  2OE0 A;  1YZX A;  2CVD A;  3EC3 A;  3F0I A;  6GSY A;  2E2G A;  5ECN B;  14GS A;  6GSV A;  3DKS A;  2H8L A;  2R3X A;  2YV9 A;  3F9U A;  3UVH A;  2M46 A;  2YZU A;  3AY8 A;  4OCE A;  4ZIJ A;  4JR6 A;  3TKQ A;  12GS A;  3PGT A;  3KH7 A;  4WF5 A;  4IW9 A;  3HYP A;  2LQO A;  4MZW A;  2L57 A;  1XOA A;  1LJR A;  13GS A;  5C00 A;  3F6D A;  2NVL A;  4E8H A;  4LMW A;  1DBY A;  3HVV A;  3IRA A;  1WP0 A;  3WT2 A;  2QKE A;  3D4M A;  5CNW A;  1GSF A;  3UAR A;  4GRF A;  1XW9 A;  2QGV A;  4D73 B;  3TRQ A;  4ZBD A;  4TXO A;  3LWA A;  5E4W A;  2I9H A;  3GST A;  22GS A;  1SD9 A;  5IM9 A;  3APS A;  2VM1 A;  3L9S A;  4IGJ A;  3DXB A;  3C73 A;  17GS A;  4NV5 A;  1MTC A;  5J5N A;  3WGE A;  3RDW A;  4FIW A;  3PIN A;  5ECQ B;  3VWV A;  4CY6 A;  1THX A;  4PUR A;  3DYR A;  5ECH B;  3TKS C;  1K0N A;  18GS A;  1JZR A;  3VI5 A;  2Z9S A;  2GST A;  3N9J A;  3F63 A;  2PUK C;  1O8X A;  3EWL A;  2MMO A;  2AJQ B;  3KJY A;  3JCM L;  5G30 A;  1OC9 B;  5F8B A;  3E0U A;  4RI7 A;  1ZYQ B;  5DCG A;  1MEK A;  3A5W A;  3FR6 A;  2I1U A;  2VCZ A;  4K2D A;  2WDU A;  3UJ1 A;  3IHQ A;  3ZIJ A;  4HQZ A;  4ZB8 A;  2R0G A;  3PPU A;  3H4K A;  1MDK A;  5F0G A;  4BVY B;  2YZH A;  2H76 A;  4PGT A;  3KCM A;  2XC2 A;  3GTU A;  4YQM A;  2REM A;  2V2G A;  4XS6 A;  3TUE A;  2CT6 A;  4LL1 B;  3IDV A;  2WCI A;  9GSS A;  4L5O A;  1OE8 A;  2HRN A;  4O92 A;  4Q5N A;  4IJI A;  2R2J A;  1SJ6 A;  3GKX A;  4G2E A;  6GSX A;  1CQH A;  4L0W A;  2DC5 A;  1V40 A;  5DAK B;  2G2Q A;  1YKA A;  2C0F A;  1A0F A;  3HDC A;  5A4W A;  1Z9H A;  2AAW A;  2A2R A;  5DBQ A;  1LU4 A;  1FG4 A;  4MF5 A;  3UBL A;  2HZE B;  1HQO A;  1M2D A;  2V6K A;  5DVB A;  4HS1 A;  3TCO A;  2VIM A;  4BWQ A;  3IC8 A;  3C71 A;  2IPA A;  2IN3 A;  5ENU A;  1EOG A;  1N8J A;  2RII A;  1VF3 A;  4OFM A;  4HJ2 A;  2GTU A;  1UN2 A;  2FCH A;  2A4V A;  2CA8 A;  2H74 A;  2EIQ A;  2JL4 A;  4EDZ A;  2ZNM A;  4AJ6 A;  4X43 A;  5ECO B;  2YPM A;  5CYY A;  2EIO A;  2B7J A;  1FB6 A;  3CSI A;  3IPZ A;  1EGO A;  2R0P A;  1X9W B;  3IC4 A;  2HSH A;  4D73 A;  1JLW A;  3RHB A;  1GSE A;  1GTA A;  3C8E A;  2GSS A;  2HRK A;  1T8E B;  3GFK A;  5G5E A;  1ZGN A;  1V57 A;  4GST A;  2FWE A;  1SKR B;  3F4T A;  1ZYN A;  2HLS A;  1KTE A;  3UBK A;  4DEJ A;  2KLX A;  5H5S A;  1EP8 A;  1TU8 A;  4HZ2 A;  5KN1 A;  1K0O A;  2ZCT A;  3C1R A;  2A2P A;  6GSS A;  4IQ1 A;  1NSW A;  1AUC A;  1K3Y A;  1S3C A;  2ON7 A;  3F6F A;  2ON5 A;  1FO5 A;  4N10 A;  5HQP A;  2QC7 A;  4I5Q A;  3L0H A;  2DJ0 A;  2CVK A;  1NHY A;  4OWY A;  2GZZ A;  4Z2U A;  1SL2 B;  1YEP A;  2OAC A;  4MH2 A;  1U3I A;  5D96 A;  3LXZ A;  1TRW A;  3SWL A;  4K7N A;  4I2U A;  3GX8 A;  3CRU A;  5ECR B;  1TU7 A;  2CX4 A;  3HZ8 A;  4ECB A;  4EDY A;  1XCC A;  2VCX A;  2K8V A;  3EMP A;  3DD3 A;  3S9F A;  3ZFL A;  2YAN A;  1PX7 A;  3LYK A;  2VUP A;  3UL3 A;  3H93 A;  4ISD A;  5FT3 A;  2CV4 A;  2H75 A;  1BG5 A;  2OE3 A;  1NW2 A;  5CRW A;  3G7Y A;  2M72 A;  4AJ7 A;  1O7U A;  4X0X A;  2I4A A;  3WYW A;  1W89 A;  3A3T A;  4O5U A;  2JSY A;  3R2Q A;  4HJM A;  4ILF A;  3C1S A;  3Q18 A;  1HNC A;  4FO5 A;  1S3D A;  1AW9 A;  3VPQ A;  1M0U A;  2P0G A;  4MP4 A;  3UMA A;  4PXO A;  4OFN A;  3QD9 A;  1V2A A;  1EEM A;  2KOK A;  3MYD A;  2B3S A;  2FY6 A;  2FLS A;  4ML1 A;  4LL4 B;  1B48 A;  1V9W A;  2HSY A;  2R0C A;  3F3R A;  4ECC A;  4QL9 A;  2A4H A;  2WGR A;  5CRG A;  1OAZ A;  3O3T A;  1TK5 B;  4ZL9 A;  2YCD A;  2LNS A;  5D8I A;  4K5S A;  1YF0 A;  3NOF A;  2L6C A;  4EL1 A;  3G7I A;  2AHE A;  5DQS A;  3FRC A;  4GSN A;  5JCG A;  3KTL A;  4EIP A;  16GS A;  4WF4 A;  3KZQ A;  3U5R E;  1WJK A;  3TJB A;  3A2V A;  1TJD A;  3ZYW A;  3EYT A;  5LD0 A;  4WXT A;  2L4C A;  3MIX A;  4NHW A;  1GTI A;  3L9V A;  2CAI A;  3TGZ A;  3RHC A;  1PX6 A;  1QGV A;  1M7T A;  4CW9 A;  3GRX A;  3J7Y k;  1TK0 B;  3QR6 A;  4GTU A;  4MLY A;  3Q74 A;  2X8G A;  4IKH A;  3GH6 A;  1T4Y A;  1FOV A;  2JZR A;  4JU5 A;  3KEB A;  3Q19 A;  4TXO B;  4PTS A;  2C0D A;  1OVN A;  1Z6N A;  4XTS A;  3WGD A;  1PKZ A;  4ZBB A;  4IQA A;  2GDR A;  4K2X A;  4X1U A;  4JE1 A;  3P90 A;  1AQX A;  5HR2 A;  5EPF A;  2IL3 A;  1XVW A;  2H19 A;  5IMC A;  1R7H A;  1G7E A;  1WRY A;  5G5F A;  2N5A A;  4ZXG A;  1XW6 A;  1XWA A;  2RUF A;  5INY A;  1SYR A;  2C3N A;  4DSR A;  2DIY A;  4MJB A;  2L59 A;  1FHE A;  2C0G A;  2H1B A;  2N5F A;  2AB6 A;  4BVX A;  2LJK A;  4F9Z A;  4ACS A;  3KM6 A;  2EC4 A;  2VL9 A;  1SKS B;  4MJE A;  2BTO T;  4NXI A;  4TR0 A;  4OCF A;  2PPT A;  4Q5Q A;  2RLI A;  3A2X A;  3QDN A;  2H1G A;  2HI7 A;  1R26 A;  5J41 A;  2LRC A;  3GTU B;  4YAP A;  1ERV A;  3KMO A;  5KOX A;  3M9J A;  2K9F A;  1ERT A;  4NV2 A;  4K7O A;  4ZL7 A;  3TJG A;  2GLR A;  2XPD A;  1QUW A;  3FY7 A;  2L5L A;  4LMV A;  3A2W A;  1ABA A;  3CSJ A;  3A5I A;  4KCE A;  4WBJ A;  2B5Y A;  4IVF A;  3MAK A;  1K0C A;  1SK0 A;  2LNT A;  3GKK A;  3DEX A;  3LEF A;  1Y6E A;  2DIZ A;  2LKU A;  3FK8 A;  5IPH A;  3KMN A;  3FKF A;  4X4J A;  4Z7X A;  3RBT A;  3TB2 A;  2VLU A;  3ZIV A;  5ID2 A;  3UVT A;  4G0I A;  2LS5 A;  1JZD A;  1Z3E A;  2H6Z A;  4PNF A;  5EL8 A;  1GLP A;  1GUK A;  1F37 A;  2VL2 A;  1PSQ A;  2FGX A;  2FNO A;  1DE1 A;  5EVO A;  3O6T A;  3TJF A;  2FA8 A;  1ZYE A;  2LJR A;  3GMF A;  4TOP A;  2LJA A;  2DMM A;  1A24 A;  2VL3 A;  3D5J A;  3VWU A;  3MWH A;  3ZMK A;  1Z6M A;  2E2M A;  1KBN A;  4ECI A;  5CP1 A;  3ZZX A;  4EUY A;  2JZS A;  3K8N A;  3IXR A;  2GSR A;  1F2E A;  2H1D A;  4MMM A;  4OD7 A;  3EIN A;  2XPE A;  2FWG A;  4AF2 A;  2PMT A;  2YN1 A;  1SEN A;  2OAD A;  1EEJ A;  2YOI A;  5L71 A;  2RM5 A;  1J0F A;  3ME7 A;  2B5E A;  3LGC A;  3G7J A;  3CTG A;  2PWJ A;  5GST A;  2HE3 A;  3VWX A;  5BRT A;  7GSS A;  3APQ A;  2E0Q A;  2VLT A;  11GS A;  2FA4 A;  5J9C A;  5DJL A;  1PKW A;  1XOB A;  4BL7 A;  2DJ2 A;  1JZW A;  2ALB A;  4ZL8 A;  4HEA 2;  3VLN A;  1F3B A;  1V98 A;  1Z5Y E;  4GF0 A;  3GUS A;  1OKD A;  3EU4 A;  1IYI A;  3M0F A;  4O5R A;  5B6M A;  5D9X A;  1T1V A;  3ZLP A;  2JU5 A;  1PD2 1;  1F3A A;  3EE2 A;  3L4N A;  1ZOF A;  1GSS A;  4PX1 A;  2R4V A;  2MMZ A;  3D22 A;  1QMV A;  4BPY A;  1UVZ A;  3I69 A;  3CMI A;  2L5O A;  4G19 A;  5LNK e;  5IMA A;  3CSH A;  1JHB A;  4V1A g;  2P31 A;  1FW1 A;  4KB3 A;  4KSO A;  1PN0 A;  1U88 A;  2YWM A;  2K6V A;  3C7M A;  1PA3 A;  4L5L A;  4YQU A;  3KP8 A;  3CRT A;  2IJY A;  2HFD A;  2CZ3 A;  10GS A;  2LRT A;  3ZL5 A;  2KP1 A;  2H73 A;  4F0B A;  1A2J A;  4Z2R A;  4GQF A;  4CHS A;  5LCZ A;  1TW9 A;  4OO4 A;  5EY6 A;  3F8U A;  1TTZ A;  3IAM 2;  3I6A A;  1SL1 B;  5BMU A;  2IMI A;  1PN9 A;  4PNG A;  2X8H A;  4E8E A;  3IK7 A;  5B7C A;  3GIX A;  5JCW A;  3F4S A;  4KDU A;  2I3Y A;  2MBT A;  1SK2 A;  1VF4 A;  3RPN A;  3GN3 A;  2H0G A;  2GQM A;  2IWT A;  2H70 A;  4MJA A;  4MZC A;  4KUN A;  2MMN A;  2PBJ A;  3DVW A;  5AIS A;  2LST A;  2IFQ A;  4YAV A;  1KEB A;  1PQN A;  4OFT A;  3HJM A;  4PQI A;  1SJI A;  1XXU A;  3HKR A;  1M2B A;  3FR3 A;  4TXV A;  4MAB A;  2LUS A;  4XCS A;  3WD6 A;  1XW5 A;  3DVX A;  5G31 A;  4MF7 A;  4POB A;  3LJR A;  4JZQ A;  4DSS A;  2YWN A;  1OYJ A;  2C8U A;  3QFB C;  2YWI A;  2R37 A;  1VF2 A;  2LQQ A;  1XFL A;  2VM2 A;  4IEL A;  4F82 A;  1XBS A;  3IHG A;  2B7K A;  5HFK A;  1RQM A;  2M80 A;  5GAP D;  2VOC A;  1ZYP A;  5F05 A;  3RPP A;  2PN8 A;  2GQL A;  1MD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...