1XPVA

Solution structure of northeast structural genomics target protein xcr50 from x. campestris
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELDWPFDAPRLRAWLDAAPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein XCC2852
publication title Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris
rcsb
source organism Xanthomonas campestris
molecule tags Structural genomics, unknown function
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xpvA00
3TKSC 3GN3A 4POLA 2KOKA 3KIJA 3KTBA 3FYGA 22GSA 1F3BA 2NPBA 4IW9A 3Q18A 3TUEA 1YF1A 4TR4A 3D22A 1AW9A 5FHIA 3BCKA 3QD9A 3F4RA 2KP1A 4N0ZA 3APSA 2DSAA 3TCOA 4KSMA 4MK3A 3QAWA 2C0EA 5ABRA 1USBA 3FHKA 1PQNA 3LORA 1AXDA 3L9SA 3ED3A 2CX4A 2PN8A 1T3BA 3P2AA 3IK9A 3LQ7A 1DBYA 2FA8A 1XW5A 2H0HA 3VI7A 4HI7A 2FWEA 4PQHA 4LL4B 2OBIA 6GSVA 5HFKA 2I81A 2H30A 5CRHA 2H70A 1SK0A 5DDLA 1SENA 3HVSA 3J7Yb 2FWGA 1Q4JA 1XFLA 3ZTLA 4TVEA 1A2LA 1S3CA 1OYJA 4NV5A 4RQXA 2AB6A 4K7OA 4KDYA 3LSZA 5ECOB 1A8LA 3L78A 5CAXA 3QAVA 3CRTA 4ML6A 5B7CA 3TJGA 1GH2A 1ACVA 1NSWA 3ZLPA 2L6CA 4YQVA 5C00A 6GSXA 5C04A 2DIZA 1EV9A 1R4WA 3FZ5A 3GA4A 1OKDA 2B3SA 3LGCA 3ZIJA 1YZXA 4WF5A 1YKCA 3KMNA 2HSHA 1BAYA 1VGLA 4KGIA 3BOAA 4Q5QA 1T8EB 4TR0A 3U6VA 2GQLA 1OC9B 4JEDA 4G2EA 1XWCA 1YEXA 4N30A 4I6XA 5DCGA 4K9ZA 4MPFA 1SL0B 2H0IA 1ERUA 1MEKA 5IMZA 1WMJA 4J57E 1O6JA 1H75A 5A5KA 2B1KA 3IAS2 2OKAA 2NDOA 4YH2A 5ID2A 3IHQA 4XHMA 4GWRA 2GZYA 5DQSA 2FD3A 5IMDA 1GNWA 1YDKA 4MP4A 1TI1A 3HHVA 1EV4A 1V2AA 1VF3A 1GSYA 4OFTA 1EGOA 5CRWA 1URMA 4ID0A 2GT6A 3DYRA 3US3A 1YQ1A 3ME7A 3ZL5A 3KD0A 3HZ8A 4TR1A 2JADA 5ENUA 4OFNA 2VM2A 3GURA 1EWXA 1ERWA 4MJAA 4POMA 4KB3A 2I3YA 4QQ7A 4MJBA 4FYBA 4OO5A 5HR1A 2VCWA 2X99A 3ZREA 2H76A 2GS3A 3TJKA 4RUVA 2WULA 4I5QA 4I2TA 4N0VA 4MA9A 2V6OA 1JFUA 3GRXA 1PA3A 2LEGA 1X5CA 2GTUA 2C0GA 5DQYA 1A23A 4DSQA 1THOA 5IMVA 2HNLA 4V2NA 3W8SA 3QDNA 2DC5A 5HR0A 5GAPD 4OD7A 1FVJA 4GXZA 2R6KA 5LCZA 3F3QA 2MMZA 3Q19A 4EL1A 5ECKB 3F4TA 2ES7A 3LXZA 2WGRA 3O6TA 4LL1B 3IRAA 2YWNA 2CQ9A 1GWCA 1WIKA 4HQZA 3ZYWA 4V1Ap 9GSSA 1CQGA 1G6YA 5LD0A 3KH9A 5ECLB 1KNGA 2IMEA 3PINA 3M8NA 2F3MA 3TOTA 2C0FA 2B5EA 1TU7A 1XBSA 2KP2A 4BVXA 3CXGA 1BJXA 1R7HA 5D73A 5J9BA 5ECIB 3VWWA 2FY6A 1TRVA 1M0UA 2K18A 4AJ8A 3WGXA 1FOVA 5E4WA 2E0QA 1AQVA 3O76A 1BQ7A 4EVMA 1FHEA 2IFQB 3DWVA 3HDCA 3G9BA 4HJMA 4OMVA 3FZAA 1T7PB 3M1GA 3KJYA 4GQFA 1O73A 2AHEA 3A3TA 2HZEB 2OADA 3IC4A 4EO3A 1WJKA 2WRTA 4N10A 5D8IA 2H71A 4V1Ag 5JWRB 2JZRA 4WBRD 2J23A 1XVWA 3ZMKA 1ZOFA 4I8BA 4EDYA 1TXXA 4LMWA 3D4MA 2CVDA 5D9WA 4MF5A 2IJYA 2R5GA 5G2ZA 2V6KA 4AGSA 2OJLA 2FWFA 3F6FA 1UA5A 1ABAA 2PGTA 3D6IA 2X8GA 2I9HA 2PBJA 1TI3A 3EURA 1OC8A 4ULXA 2OE1A 2I4AA 1IYHA 1JLWA 1YJ6A 4EC0A 4IJIA 1JLVA 2D2ZA 4L0UA 1AUCA 4FH8A 5GAND 3CYNA 2QKEA 2V1MA 2M72A 2NVLA 1GUKA 2REMA 2PVQA 5ECRB 5F0GA 1K0MA 2CAIA 5IPGA 5DVBA 2YV7A 2LNSA 1F6MC 2RM6A 2VAFA 4QL9A 5ECSA 1TDIA 5LNKe 2VL2A 3IBHA 1GSQA 1VRSD 2KLXA 2L59A 4WR4A 1OKTA 1XZOA 5G30A 2VIMA 5F05A 2L6DA 2JU5A 4IJ3A 4WXTA 1XWBA 2K6VA 2YJ7A 5HQPA 3FR9A 1U87A 5DCHA 4BVYA 2JSYA 4MZWA 2OE3A 2C3TA 2H75A 2L4QA 4I2UA 2P5QA 3IDVA 2YJHA 3P90A 3VLNA 3L9VA 2EIRA 2GZZA 3O3TA 2XC2A 1BYEA 2LTKA 3L4NA 4E8HA 2H6ZA 5ECPB 5H5RA 1XOAA 2X8CA 1EEMA 1T4YA 2EIQA 3CRUA 4D73B 5AIXA 3FR3A 2LQQA 3ZVJD 3F6DA 3UVTA 3GX8A 3C1SA 2EIOA 1O8WA 4RQRA 3GTUB 2PVOC 4XRDA 3H8QA 1FAAA 1SYXA 4XS4B 1XXUA 3F9UA 1G7OA 5J3RA 3F3RA 5D93A 1K0DA 1TOFA 1NHYA 2L5LA 4EXJA 3GMFA 2G2QA 5CO3A 1YEPA 5IOWA 1A8YA 2R37A 2X8HA 3UOMA 3V1WA 1KEBA 4H86A 4NMUA 1U3IA 4JU5A 3GUSA 1T00A 2GLRA 3MAKA 5ECHB 6GSUA 4HU7A 1GTBA 4OO4A 2CVBA 3FZ9A 1PL2A 3LYPA 4PQIA 4XTSA 5EY6A 1B4PA 5H5QA 5D9TA 4KX4A 5F8BA 2G0FA 6GSWA 4ZBDA 3UMAA 3DRNA 5D96A 2DJJA 2LRNA 7GSSA 1TRSA 2C1YA 2FUG2 3TKPA 4K0NA 1N8JA 1GTIA 1SJZA 2LJKA 3J7Yk 4LA1A 3UBLA 3UBKA 5B6MA 2JSZA 3K8NA 4MF6A 2YPMA 2O8VB 4F9ZA 1MTCA 3IPZA 2F51A 1MDIA 1WP0A 4IBPA 3HVVA 4X0XA 2RM5A 3ERFA 3C1RA 1OE8A 4KE3A 1TW9A 2E7PA 2ON5A 1MDKA 1Z6MA 3QFAC 4ZBBA 3IE3A 3ZZXA 3A2XA 4BWSA 1ZYEA 3EC3A 3FEUA 5EVOA 1O8XA 5IOXA 2CX3A 3GL3A 4N11A 1R5AA 1VF2A 4BA7A 4GLTA 1ON4A 5D9VA 1AC1A 2PUKC 2VO4A 2C8UA 1PKZA 3MNGA 1ML6A 3HXSA 2L57A 1NHOA 1IYIA 3GHAA 2OA7A 3RHCA 1A0FA 4L8EA 3S9FA 2DMLA 3NIVA 4TXOA 2YOIA 1O85A 4X1UA 2AAWA 5CREA 2IMKA 3D5JA 1XW9A 2H74A 4EDZA 3VI5A 1XWAA 3F4SA 1KTEA 1VF4A 3EWLA 1THXA 4IQAA 1U6TA 4K1FA 2H1BA 3DMLA 4FYCA 2A2SA 4IP1A 1FO5A 1OVNA 5G5EA 3KP9A 3EVIA 1XOBA 3M3MA 2C0DA 4XRAA 4G9HA 2MYGA 3TJBA 5FWGA 4IHUA 1WPIA 2GVPA 1ZL9A 4EE0A 1V98A 5DAKA 4GCIA 2C4JA 2LUSA 1K0OA 2FGXA 1DSBA 4V2LA 3RBTA 2RIIA 2DJ0A 1AAZA 3EYTA 1W89A 5COHA 2MBTA 5HR3A 4ECJA 2JACA 2BMXA 3FR6A 5B6NA 4DSSA 2F9SA 4BL7A 2B5XA 1R26A 1ZZYA 1TRUA 4AF2A 1GSFA 1SYRA 3KZQA 1B8XA 4OCFA 1J08A 1YKAA 4PUAA 5DJMA 2TIRA 5JWQB 2NTOA 4K0GA 4OCEA 2AJQB 1SK1A 2XBQA 1CQHA 2R4VA 2RLIA 3FKFA 1VF1A 2OE0A 1A24A 3TDGA 4LMVA 1WWJA 2YWOA 1SU9A 5KN1A 3GX0A 2O7KA 3FK8A 4ACSA 1PSQA 3DVXA 3BCIA 1EGRA 2YCDA 3CSHA 2IMDA 1DUGA 1BG5A 1H4OA 4GF0A 3DD3A 1PD21 3TB2A 5ECMB 1TK5B 5GSTA 3LFLA 2K9FA 2LSTA 3VURA 5H5SA 3LWAA 2FWHA 3DIEA 5J41A 2VCZA 1QXHA 4JBBA 4HEA2 4ZL8A 1B4QA 2DBCA 4TKYA 4AJ7A 1U88A 2H8LA 4POKA 1T4ZA 1XWGA 3C8EA 5DAKB 1B9XC 3N9JA 1Y6EA 3I6AA 3MWHA 1V58A 2DIYA 4PNGA 16GSA 2VLVA 2CVKA 1FB0A 4KDXA 1ERTA 2H0GA 1JHBA 1SJ6A 4L5OA 1X9MB 4GQCA 3BBYA 4DSSB 5L71A 2LJAA 5ID2B 4KAEA 1MD3A 1C72A 4AJ6A 4NHWA 4GSTA 5AISA 2HI7A 4L5LA 1Z5YE 1ST9A 4WEYA 1NM3A 3D4TA 1M2DA 4MH2A 4MJCA 3M9JA 1Z6NA 5KN0A 1UC7A 4F82A 4TR1B 3GSTA 1ILOA 5G1LA 2H1AA 3QAGA 2VCVA 4MMMA 4IGJA 1F3AA 1PGTA 2YP6A 5EL8A 5IMCA 4ZIJA 1X5EA 4TW5A 1PX6A 2H66A 5E59A 1YF0A 4K2DA 3ERWA 3GIXA 4IP6A 4ZB8A 5IIZA 5J5NA 1QQ2A 2WB9A 2WZ9A 4TXVA 4ML1A 1HNCA 3NOFA 5IO2A 4PQ1A 1XPVA 1TJDA 3TGZA 8GSSA 2P31A 3A2WA 1GSSA 2LRTA 5IMFA 3TKSA 4XS1A 3VWUA 2C3NA 2VL3A 1PKWA 2HRFA 2HSYA 3Q74A 3HYPA 1K0NA 4ECCA 3GKKA 1GULA 1PRXA 4LLRA 1U3AA 3HCZA 2IL3A 2HRNA 2I1UA 4MF7A 4TRXA 2H1DA 4Q5RA 5IQYA 2F8AA 2O85A 1ZYQB 1GTUA 3EMXA 3H4KA 4K8MA 2QGVA 2BTOT 4KDUA 1G0TA 2H01A 2WS2A 3EE2A 6GSTA 1SJIA 1K0AA 3UL3A 1SKSB 1YY7A 3HJPA 4IKHA 3AY8A 4IS0A 1GNEA 4DEJA 3HZ4A 1QFNA 1B9YC 2AYTA 4IN0A 1ZMAA 3R2QA 2IMFA 3ZMLA 1AQXA 4PGTA 2HZFA 2WJUA 3ISOA 2HFDA 3UJ1A 2MMNA 1XVQA 3TRQA 4MH3A 2VCXA 2FCHA 4EF0A 1E2YA 1JZWA 1FG4A 3DEXA 5F07A 5A4UA 3ZITA 2HE3A 1TP9A 3ZFLA 5G31A 3RPNA 3DKSA 1OAZA 5IPHA 1GUHA 1X0RA 4MLYA 2XPDA 5IMAA 3KEBA 2H1GA 5KN3A 4V2MA 3KTLA 3KXOA 2GT5A 3TJFA 2GSTA 3WGDA 3U5RE 2MZCA 5B8AA 1I9DA 2VCTA 4TN8A 4K7NA 4QL7A 1V9WA 3E3EA 1MD4A 6GSYA 1WRYA 1SL1B 3MSZA 3QPMA 4HDEA 2LRCA 3PR8A 2ZNMA 1BEDA 3HKRA 19GSA 1RW1A 2B7KA 3VK9A 4HZ4A 3QMXA 2CAQA 5CP1A 4FO5A 3IAM2 2P5RA 1DE2A 3C73A 1TU8A 1SL2B 1XIYA 2V41A 5INYA 1PN9A 4XCSA 5G1KA 1UVZA 2WCIA 2IWTA 3RAZA 1TK0B 1A0RP 3HA9A 1HD2A 4BPYA 4GSSA 5AN1A 1V40A 2PERA 2QSIA 2JZTA 3DGQA 4MZCA 20GSA 3TOUA 3ZFBA 4JE1A 3TRXA 3EMPA 2B5YA 5HFIA 5JWOB 1SKRB 1M9AA 2E2MA 4MCUA 2PU9C 4ISDA 3CTGA 1HYUA 1SK2A 3GL5A 3GKMA 3KM6A 1E6BA 3I69A 2A2RA 1JZRA 4O92A 1R5PA 2L4CA 2LNTA 2CV4A 2M46A 2VM1A 2PMTA 1XW6A 4YQMA 4KW6A 1M7TA 2M80A 2GZPA 3VPTA 2YN1A 4HUAA 2XBIA 4ZBAA 2XHFA 3VWXA 4ZL7A 4HU9A 1B48A 3LEFA 2WDUA 4EKZA 2TRXA 1SKWB 1HNBA 2FHEA 4CDOA 2C3QA 2VD1A 4XS6A 4FYUA 11GSA 4MZBA 3IXRA 4KUNA 1OC9A 2N5BA 1TRWA 1X5DA 2AV4A 3WT2A 3HD5A 4WETA 2WFCA 2LKUA 3GKNA 4NPBA 12GSA 5B8BA 2VUPA 4XIHA 2YWIA 1PX7A 1G6WA 1ZCPA 2MMOA 2VD0A 2VL2C 3IOSA 1F37A 5J9CA 4E8EA 4ZXGA 2CT6A 4IVFA 3E0UA 3VWVA 4NV2A 2PPTA 1A2JA 1HNAA 2H19A 3CSJA 1K3YA 1WE0A 3H93A 4JZQA 3W8JA 5AGYA 1F2EA 2HLSA 3MDKA 2B6MA 3KGKA 1XCCA 1Z7PA 2IPAA 1F9MA 1GUMA 3KH7A 1GL8A 5G5FA 1JZDA 3UARA 3CTFA 2DJ2A 18GSA 2GDRA 3VPQA 4BWQA 3VFIA 3LXTA 4JR4A 2P0GA 2YNXA 4NAXA 1TKDB 1LBKA 1M9BA 5HFGA 1DE1A 2AUVA 2XPEA 3UVHA 2N5AA 4KH7A 2DJ1A 4Z7XA 4YAVA 5JCGA 4YQUA 3GFKA 1S3AA 3F0IA 4F2IA 3Q6OA 5JCUA 4O32A 1QMVA 2H6XA 2L5OA 4ECIA 4MABA 5CRDA 3C7MA 3UAPA 1MDJA 5D9XA 5IM9A 5J4UA 4OWYA 4P3YB 3GH6A 2DJKA 4POBA 2YWMA 4X43A 3ZRDA 2A4VA 1GP1A 4TXOB 2OACA 5F06A 5ECNB 4KNDA 3WGEA 3KMOA 1M2AA 4GTUA 4WBJA 1V57A 2QC7A 3D21A 3HVXA 4JR6A 5A4VA 2ZCTA 4GSNA 1A2MA 1QK8A 5DJLA 2LV3A 2ZUPA 4O7HA 1M99A 4ZILA 1GLQA 1FW1A 4L0WA 3TKQA 5EPFA 4F03A 3BJ5A 2DLXA 2VLUA 2V2GA 2HT9A 3QR6A 2O87A 4JRRA 1K3LA 2H72A 1OC3A 1GSDA 6GSSA 1O7UA 4KCEA 2N5FA 3LG6A 4J2FA 1NW2A 2FLSA 2RUFA 3WD6A 3JCML 2MMAA 3APOA 3L0HA 1M2BA 3CMIA 2IFQA 3EU4A 3KCMA 2PWJA 3WT1A 3PH9A 4G10A 1FB6A 2IMIA 2DJ3A 2HZEA 3IV4A 5HR2A 4NWYA 2K8SA 1GTAA 3UEMA 1GRXA 1WOUA 3M0FA 3H1NA 2CA8A 1AQWA 3F63A 1SD9A 3QFBC 1XWKA 2NBSA 4ZB9A 3FY7A 2X64A 5AIVA 2YV9A 2Z9SA 3DXBA 3WYWA 4RI7A 5ELAA 2GSQA 5FT3A 4IQ1A 3GSSA 4OFMA 1GSUA 4KSOA 2RUEA 1SD8A 2C80A 3ME8A 5KEJA 4ILFA 5ELGA 3RDWA 2H6YA 3FRCA 3W6GA 1O81A 1Z7RA 2HXKA 2R2JA 2GSRA 2LS5A 2H73A 4EUYA 2R3XA 3FZ4A 3C71A 3SWLA 5CYYA 14GSA 3G7IA 2MBSA 3G7YA 1N2AA 3KP8A 1J9BA 1RK4A 2CZ3A 4IELA 4HJ2A 4WF4A 4O5RA 3P8WA 1K0BA 2E2GA 1ZGNA 4PURA 1J0FA 4RI6A 2JL4A 4Q5NA 2VLTA 1Q98A 4MPGA 3IK7A 4WR5A 1PL1A 1EP8A 2B1LA 3HJOA 5IO0A 2YANA 3EU3A 4K7IA 3ERGA 3GNJA 2IN3A 3TJJA 1Z9HA 4F0CA 1EEJA 3HY2A 3EINA 3QOUA 3I9V2 4Q5FA 1HQOA 4DSRA 4GRFA 3TKRA 3L9UA 1W4VA 2KUCA 2BJXA 1GSEA 1EOHA 3NZNA 3GV1A 5CNWA 3APQA 1X9WB 1G7EA 2YZUA 4ECBA 2B7JA 1I5GA 2VL9A 1K0CA 4D73A 4MJEA 1S3DA 5GZZB 3GYKA 3TRPA 1Z3EA 2KHPA 1TTZA 1X9SB 3GTUA 4TOPA 3GKXA 4XS4A 1EZKA 4PUFC 4J56E 2EC4A 1QGVA 3IR4A 3N5OA 1K3OA 1UN2A 2ON7A 1TK8B 2TRCP 4PX1A 3IA1A 2OBKA 17GSA 3RPPA 5DALA 4K6XA 4I97A 4PXOA 2O89A 3M9KA 2GGTA 4ZB6A 4HS1A 1JZOA 4YAPA 5DBQA 3A2VA 1FVKA 4F0BA 3LJRA 13GSA 3ZVJA 3LYKA 2IIYA 4HQSA 4ZL9A 4MDCA 5A4WA 2FA4A 2VCQA 3GH9A 4CHSA 2J9HA 1Y25A 5ECQB 2CZ2A 4PNFA 1GLPA 3H79A 4WKWA 2ALBA 5JCWA 1PMTA 2YZHA 3OR5A 2GQKA 4HZ2A 5KN2A 3QCPA 3DVWA 1RQMA 1T1VA 2DMMA 2F8FA 2LQOA 4HOJA 3G7JA 2K8VA 2GQMA 2JZSA 4FIWA 1KBNA 10GSA 1ERVA 1LJRA 2GSSA 1BX9A 3CSIA 3SBCA 1OE7A 2LJRA 1EP7A 4NHZA 4NXIA 3ZIVA 2VOCA 5GSSA 3CBUA 3FW2A 2FNOA 3I43A 4DVCA 4KA0A 3A5WA 4G19A 3PGTA 2HYXA 3P7XA 3UIWA 1QUWA 2V32A 5DALB 4KCAA 4CW9A 3HJMA 3RHBA 3BD2A 4TR3A 1LU4A 5CRGA 3D0ZA 3E9JB 3TKSE 1EOGA 3F8UA 1AIUA
chains in the Genus database with same CATH superfamily
3TKSC 3GN3A 4POLA 2KOKA 3KIJA 2QA2A 3KTBA 3FYGA 22GSA 1F3BA 2NPBA 4IW9A 3Q18A 3TUEA 1YF1A 4TR4A 3D22A 1AW9A 5FHIA 3BCKA 3QD9A 3F4RA 2KP1A 4N0ZA 3APSA 2DSAA 3TCOA 4KSMA 4MK3A 5BRTA 3QAWA 2C0EA 5ABRA 1USBA 3FHKA 1PQNA 3LORA 1AXDA 3L9SA 3ED3A 2CX4A 2PN8A 1T3BA 3P2AA 1ZYNA 3IK9A 3LQ7A 1DBYA 2FA8A 1XW5A 2H0HA 3VI7A 4HI7A 2FWEA 4PQHA 4LL4B 2OBIA 6GSVA 5HFKA 2I81A 2H30A 5CRHA 2H70A 1SK0A 5DDLA 1SENA 3HVSA 3J7Yb 2FWGA 1Q4JA 1XFLA 3ZTLA 4TVEA 1A2LA 1S3CA 1OYJA 4NV5A 4RQXA 4K5SA 2AB6A 4K7OA 4KDYA 3LSZA 5ECOB 1A8LA 3L78A 5CAXA 3QAVA 3CRTA 4ML6A 5B7CA 1M3JA 3TJGA 1GH2A 1ACVA 5KOXA 1NSWA 3ZLPA 2L6CA 4YQVA 5C00A 6GSXA 5C04A 2DIZA 1EV9A 1R4WA 4EIQA 3FZ5A 3GA4A 1OKDA 2B3SA 3LGCA 3ZIJA 1YZXA 4WF5A 1YKCA 3KMNA 2HSHA 1BAYA 1VGLA 4FQUA 4KGIA 3BOAA 4Q5QA 1T8EB 4TR0A 3U6VA 2GQLA 1OC9B 4JEDA 4G2EA 1XWCA 1YEXA 4N30A 4I6XA 5DCGA 4K9ZA 4MPFA 1SL0B 2H0IA 1ERUA 1MEKA 5IMZA 1WMJA 4J57E 1O6JA 1H75A 5A5KA 2B1KA 3IAS2 2OKAA 2NDOA 4YH2A 5ID2A 3IHQA 4XHMA 4GWRA 4Z2UA 2GZYA 5DQSA 2FD3A 5IMDA 1GNWA 1YDKA 4MP4A 1TI1A 3HHVA 1EV4A 1V2AA 1VF3A 1GSYA 4OFTA 1EGOA 5CRWA 1URMA 4ID0A 2GT6A 3DYRA 3US3A 1YQ1A 3ME7A 3ZL5A 3KD0A 3HZ8A 4TR1A 2JADA 5ENUA 4OFNA 2VM2A 3GURA 1EWXA 1ERWA 4MJAA 4POMA 4KB3A 2I3YA 4QQ7A 4MJBA 4FYBA 4OO5A 5HR1A 2VCWA 2X99A 3ZREA 2H76A 2GS3A 3TJKA 4RUVA 2WULA 4I5QA 4I2TA 4N0VA 4MA9A 2V6OA 1JFUA 3GRXA 1PA3A 2LEGA 1X5CA 2GTUA 2C0GA 5DQYA 1A23A 4G0LA 4DSQA 4BIKA 1THOA 5IMVA 2HNLA 4V2NA 3W8SA 3QDNA 2DC5A 5HR0A 5GAPD 4OD7A 1FVJA 4GXZA 2R6KA 5LCZA 3F3QA 2MMZA 3Q19A 4EL1A 5ECKB 3F4TA 2ES7A 3LXZA 2WGRA 3O6TA 4LL1B 3IRAA 2YWNA 2CQ9A 1GWCA 1WIKA 4HQZA 3ZYWA 4V1Ap 9GSSA 1CQGA 1G6YA 5LD0A 3KH9A 5ECLB 1KNGA 2IMEA 3PINA 3M8NA 2HSMA 2F3MA 3TOTA 2C0FA 2B5EA 1TU7A 1XBSA 2KP2A 4BVXA 3MIXA 2A2PA 3CXGA 1BJXA 1R7HA 5D73A 5J9BA 5ECIB 3VWWA 2DKIA 2FY6A 1TRVA 1M0UA 2K18A 4AJ8A 3WGXA 1FOVA 5E4WA 2E0QA 1AQVA 3O76A 1BQ7A 4EVMA 1FHEA 2IFQB 3DWVA 4ICYA 3HDCA 3G9BA 4HJMA 4OMVA 3FZAA 1T7PB 3M1GA 3FMWA 3KJYA 4GQFA 1O73A 2AHEA 1S3RA 3A3TA 2HZEB 2OADA 3IC4A 4EO3A 2R0CA 1WJKA 2WRTA 4N10A 5D8IA 2H71A 4V1Ag 5JWRB 2JZRA 4WBRD 2J23A 1XVWA 3ZMKA 1ZOFA 4I8BA 4EDYA 1TXXA 4LMWA 3D4MA 2CVDA 4MF5A 5D9WA 2IJYA 2R5GA 5G2ZA 2V6KA 4AGSA 2OJLA 2FWFA 3F6FA 1UA5A 1ABAA 2PGTA 3D6IA 2X8GA 2I9HA 2PBJA 1TI3A 3EURA 1OC8A 4ULXA 2OE1A 2I4AA 1IYHA 1JLWA 1YJ6A 4EC0A 4IJIA 1JLVA 2D2ZA 4L0UA 1AUCA 4FH8A 5GAND 3CYNA 2QKEA 2V1MA 2M72A 1PFOA 2NVLA 1GUKA 2REMA 2PVQA 5ECRB 5F0GA 1K0MA 2CAIA 5IPGA 5DVBA 2YV7A 2LNSA 1F6MC 2RM6A 2VAFA 4QL9A 5ECSA 1TDIA 5LNKe 2VL2A 3IBHA 1GSQA 1VRSD 2KLXA 2L59A 4WR4A 1OKTA 1XZOA 5G30A 2VIMA 5F05A 2L6DA 2JU5A 4IJ3A 4WXTA 1XWBA 2K6VA 2YJ7A 5HQPA 3FR9A 1U87A 5DCHA 4BVYA 2JSYA 2R0GA 4MZWA 2OE3A 2C3TA 2H75A 2L4QA 4I2UA 2P5QA 3IDVA 2YJHA 3P90A 3VLNA 3L9VA 2EIRA 2GZZA 3O3TA 2XC2A 1BYEA 2LTKA 3L4NA 4E8HA 2H6ZA 5ECPB 5H5RA 1XOAA 2X8CA 1EEMA 1T4YA 2EIQA 3CRUA 4D73B 5AIXA 3FR3A 2LQQA 3ZVJD 3F6DA 3UVTA 3GX8A 3C1SA 2EIOA 1O8WA 4RQRA 3GTUB 2PVOC 4XRDA 3H8QA 1FAAA 1SYXA 4XS4B 1XXUA 3F9UA 1G7OA 5J3RA 3F3RA 5D93A 1K0DA 1TOFA 1NHYA 2L5LA 4EXJA 3GMFA 2G2QA 5CO3A 1YEPA 5IOWA 1A8YA 2R37A 2X8HA 3UOMA 3V1WA 1KEBA 4H86A 4NMUA 1U3IA 4JU5A 3GUSA 1T00A 2GLRA 3MAKA 5ECHB 6GSUA 4HU7A 1GTBA 4OO4A 2CVBA 3FZ9A 1PL2A 3LYPA 4PQIA 4XTSA 5EY6A 1B4PA 5H5QA 5D9TA 4KX4A 5F8BA 2G0FA 6GSWA 4ZBDA 3UMAA 3DRNA 5D96A 2DJJA 2LRNA 7GSSA 1TRSA 2C1YA 2FUG2 3TKPA 4K0NA 1N8JA 1GTIA 1SJZA 2LJKA 3J7Yk 4LA1A 3UBLA 3UBKA 5B6MA 2JSZA 3K8NA 4MF6A 2YPMA 2O8VB 4F9ZA 1MTCA 3IPZA 2F51A 1MDIA 1WP0A 4Z2TA 4IBPA 3HVVA 4X0XA 2RM5A 3ERFA 3C1RA 1OE8A 4KE3A 1TW9A 2E7PA 2ON5A 5KOWA 1MDKA 1Z6MA 3QFAC 4ZBBA 3IE3A 3ZZXA 4A5PA 2UZ8A 3A2XA 4BWSA 1ZYEA 3EC3A 3FEUA 5EVOA 1O8XA 5IOXA 2CX3A 3GL3A 4N11A 1R5AA 1VF2A 4BA7A 4GLTA 1ON4A 5D9VA 1AC1A 2PUKC 2VO4A 2C8UA 1PKZA 3MNGA 1ML6A 3HXSA 2L57A 1NHOA 1IYIA 3GHAA 2OA7A 3RHCA 1A0FA 4L8EA 3S9FA 2DMLA 3NIVA 4TXOA 2YOIA 1O85A 4X1UA 2AAWA 5CREA 2IMKA 3D5JA 1XW9A 2H74A 4EDZA 3VI5A 1XWAA 3F4SA 1KTEA 1VF4A 3EWLA 1THXA 4IQAA 1U6TA 4K1FA 2H1BA 3DMLA 4FYCA 2A2SA 4IP1A 1FO5A 1OVNA 5G5EA 3KP9A 3EVIA 1XOBA 3M3MA 2C0DA 4XRAA 4G9HA 2MYGA 3TJBA 5FWGA 4IHUA 1WPIA 2GVPA 1ZL9A 4EE0A 1V98A 5DAKA 4GCIA 2C4JA 2LUSA 1K0OA 2FGXA 4K2XA 1DSBA 4V2LA 3RBTA 2RIIA 2DJ0A 1AAZA 3EYTA 1W89A 5COHA 2MBTA 5HR3A 4ECJA 2JACA 2BMXA 3FR6A 5B6NA 4DSSA 2F9SA 4BL7A 2B5XA 1R26A 1ZZYA 1TRUA 4AF2A 4K5RA 1GSFA 1SYRA 3KZQA 1B8XA 4OCFA 1J08A 1YKAA 4PUAA 5DJMA 2TIRA 5JWQB 2NTOA 4K0GA 4OCEA 2AJQB 1SK1A 4KF9A 2XBQA 1CQHA 2R4VA 3CQFA 2RLIA 3FKFA 1VF1A 2OE0A 1A24A 3TDGA 4LMVA 1WWJA 2YWOA 1SU9A 5KN1A 3GX0A 2O7KA 3FK8A 4ACSA 1PSQA 3DVXA 3BCIA 1EGRA 2YCDA 3CSHA 2IMDA 1DUGA 1BG5A 1H4OA 4GF0A 3DD3A 1PD21 3TB2A 5ECMB 1TK5B 5GSTA 3LFLA 2K9FA 2LSTA 2QA1A 3VURA 5H5SA 3LWAA 2FWHA 3DIEA 5J41A 2VCZA 1QXHA 4JBBA 4HEA2 3IC8A 4ZL8A 1B4QA 2DBCA 4TKYA 4AJ7A 1U88A 2H8LA 4POKA 1T4ZA 1XWGA 3C8EA 5DAKB 1B9XC 3N9JA 1Y6EA 3I6AA 3MWHA 1V58A 2DIYA 4PNGA 16GSA 2VLVA 2CVKA 1FB0A 4KDXA 3A5IA 1ERTA 2H0GA 1JHBA 1SJ6A 4L5OA 1X9MB 4GQCA 4EIPA 3BBYA 4DSSB 5L71A 2LJAA 5ID2B 4KAEA 1MD3A 1C72A 4AJ6A 4NHWA 4GSTA 5AISA 2HI7A 4L5LA 1Z5YE 1ST9A 4WEYA 1NM3A 3D4TA 1M2DA 4MH2A 4MJCA 3M9JA 1Z6NA 5KN0A 1UC7A 4F82A 4TR1B 3GSTA 1ILOA 5G1LA 2H1AA 3QAGA 2VCVA 4MMMA 4IGJA 1F3AA 1PGTA 2YP6A 5EL8A 5IMCA 4ZIJA 1X5EA 4TW5A 1PX6A 2H66A 5E59A 1YF0A 4K2DA 3ERWA 3GIXA 4IP6A 4ZB8A 5IIZA 5J5NA 1XG8A 1QQ2A 2WB9A 2WZ9A 4TXVA 4ML1A 1HNCA 3NOFA 5IO2A 4PQ1A 1XPVA 1TJDA 3TGZA 8GSSA 2P31A 3A2WA 1GSSA 4YKFA 2LRTA 5IMFA 3TKSA 4XS1A 3VWUA 2C3NA 2VL3A 1PKWA 2HRFA 2HSYA 3Q74A 3HYPA 1K0NA 4ECCA 3GKKA 1GULA 1PRXA 4LLRA 1U3AA 3HCZA 2IL3A 2HRNA 2I1UA 4MF7A 4TRXA 2H1DA 4Q5RA 5IQYA 2F8AA 2O85A 1ZYQB 1GTUA 3EMXA 3H4KA 4K8MA 2QGVA 2BTOT 2X4AA 4KDUA 1G0TA 2H01A 2WS2A 3EE2A 6GSTA 1SJIA 1K0AA 3UL3A 1SKSB 1YY7A 3HJPA 4IKHA 3AY8A 4IS0A 1GNEA 4DEJA 2A4HA 3HZ4A 1QFNA 1B9YC 3R3EA 2AYTA 4IN0A 1ZMAA 3R2QA 2IMFA 4BVXB 3ZMLA 1AQXA 4PGTA 2HZFA 2WJUA 3ISOA 2HFDA 3UJ1A 2MMNA 1XVQA 3TRQA 4MH3A 2VCXA 2HRKA 2FCHA 4EF0A 1E2YA 1JZWA 1FG4A 3DEXA 5F07A 5A4UA 3ZITA 2HE3A 1TP9A 3ZFLA 5G31A 3RPNA 3DKSA 1OAZA 5IPHA 1GUHA 1X0RA 4MLYA 2XPDA 5IMAA 3KEBA 2H1GA 5KN3A 4V2MA 3KTLA 3KXOA 2GT5A 3TJFA 2GSTA 3WGDA 3U5RE 2MZCA 5B8AA 1I9DA 2VCTA 4TN8A 4K7NA 4QL7A 1V9WA 3E3EA 1MD4A 6GSYA 1WRYA 1SL1B 3MSZA 3QPMA 4HDEA 2LRCA 3PR8A 2ZNMA 1BEDA 3HKRA 19GSA 1RW1A 2B7KA 3VK9A 4HZ4A 3QMXA 2CAQA 5CP1A 4FO5A 3IAM2 4G0KA 2P5RA 1DE2A 3C73A 1TU8A 1SL2B 1XIYA 1M3IA 2V41A 5INYA 1PN9A 4XCSA 5G1KA 1UVZA 2WCIA 2IWTA 3RAZA 1TK0B 1A0RP 3HA9A 1HD2A 4BPYA 4GSSA 5AN1A 1V40A 2PERA 2QSIA 2JZTA 3DGQA 4MZCA 20GSA 3TOUA 3ZFBA 4JE1A 3TRXA 3EMPA 2B5YA 5HFIA 5JWOB 1SKRB 1M9AA 2E2MA 4MCUA 2PU9C 4ISDA 3CTGA 1HYUA 1SK2A 3GL5A 3GKMA 3KM6A 1E6BA 3I69A 2A2RA 4HSCX 4BVYB 1JZRA 4O92A 1R5PA 2L4CA 2LNTA 2CV4A 2M46A 2VM1A 2PMTA 1XW6A 4YQMA 5BMUA 4KW6A 1M7TA 2M80A 3PPUA 2GZPA 3VPTA 2YN1A 4HUAA 2XBIA 4ZBAA 2XHFA 3VWXA 4ZL7A 4HU9A 1B48A 3LEFA 2WDUA 4EKZA 2TRXA 1SKWB 1HNBA 2FHEA 4CDOA 2C3QA 2VD1A 4XS6A 4FYUA 11GSA 4MZBA 3IXRA 4KUNA 1OC9A 2N5BA 1TRWA 1X5DA 2AV4A 3WT2A 3HD5A 4WETA 2WFCA 2LKUA 3GKNA 4NPBA 4YKGA 12GSA 5B8BA 2VUPA 1ZYPA 4XIHA 2YWIA 1PX7A 1G6WA 1ZCPA 2MMOA 2VD0A 2VL2C 3IOSA 1F37A 5J9CA 4E8EA 4ZXGA 2CT6A 4IVFA 3E0UA 3VWVA 4NV2A 2PPTA 1A2JA 1HNAA 2H19A 3CSJA 1K3YA 1WE0A 3H93A 4JZQA 3W8JA 5AGYA 1F2EA 2HLSA 3MDKA 2B6MA 3KGKA 1XCCA 1Z7PA 2IPAA 1F9MA 1GUMA 3KH7A 1GL8A 5G5FA 1JZDA 3UARA 3CTFA 2DJ2A 18GSA 2GDRA 3VPQA 4BWQA 3VFIA 3LXTA 4JR4A 2P0GA 2R0PA 4O5QA 2YNXA 4NAXA 1TKDB 1LBKA 1M9BA 3LW9A 5HFGA 1DE1A 2AUVA 2XPEA 3UVHA 2N5AA 4MNNA 4KH7A 2DJ1A 4Z7XA 4YAVA 5JCGA 4YQUA 3GFKA 1S3AA 3F0IA 4F2IA 3Q6OA 5JCUA 4O32A 1QMVA 2H6XA 2L5OA 4ECIA 4MABA 5CRDA 3C7MA 3UAPA 1MDJA 5D9XA 5IM9A 5J4UA 4OWYA 4P3YB 3GH6A 2DJKA 4CY8A 4POBA 2YWMA 4X43A 3ZRDA 2A4VA 1GP1A 4TXOB 2OACA 5F06A 5ECNB 4KNDA 3WGEA 3KMOA 1M2AA 4GTUA 4WBJA 1V57A 2QC7A 3D21A 3HVXA 2HRAA 4JR6A 5A4VA 1FOHA 2ZCTA 4GSNA 1A2MA 1QK8A 5DJLA 2LV3A 2ZUPA 4O7HA 1M99A 4ZILA 1GLQA 1FW1A 4L0WA 3TKQA 5EPFA 4F03A 3EPTA 3BJ5A 2DLXA 2VLUA 2V2GA 2HT9A 3QR6A 2O87A 4JRRA 1K3LA 2H72A 1OC3A 1GSDA 6GSSA 1O7UA 4KCEA 2N5FA 3LG6A 4J2FA 1NW2A 2FLSA 2RUFA 3WD6A 3JCML 2MMAA 4G0IA 3APOA 3L0HA 1M2BA 3CMIA 2IFQA 3EU4A 3KCMA 4CY6A 2PWJA 3WT1A 3PH9A 4G10A 1FB6A 2IMIA 2DJ3A 2HZEA 3IV4A 5HR2A 4NWYA 2K8SA 1GTAA 3UEMA 1GRXA 1WOUA 4BL7B 3MYDA 3M0FA 3H1NA 2CA8A 1AQWA 3F63A 1SD9A 3QFBC 1XWKA 2NBSA 4ZB9A 3FY7A 2X64A 5AIVA 2YV9A 2Z9SA 3DXBA 3WYWA 4RI7A 5ELAA 2GSQA 5FT3A 4IQ1A 3GSSA 4OFMA 1GSUA 4KSOA 2RUEA 1SD8A 2C80A 3ME8A 5KEJA 4ILFA 5ELGA 3RDWA 2H6YA 3FRCA 3W6GA 1O81A 1Z7RA 2HXKA 2R2JA 2GSRA 4PTSA 2LS5A 2H73A 4EUYA 2R3XA 3FZ4A 3C71A 3SWLA 5CYYA 14GSA 3G7IA 2MBSA 3G7YA 1N2AA 3KP8A 1J9BA 1RK4A 2CZ3A 4IELA 2DKHA 4HJ2A 4WF4A 4O5RA 3P8WA 1K0BA 2E2GA 1ZGNA 4PURA 1J0FA 4RI6A 2JL4A 4Q5NA 2VLTA 1Q98A 4MPGA 3IHGA 3IK7A 4WR5A 1PL1A 1EP8A 2B1LA 3HJOA 5IO0A 2YANA 3EU3A 4K7IA 3ERGA 3GNJA 2IN3A 3TJJA 1Z9HA 4F0CA 1EEJA 3HY2A 3EINA 3QOUA 3I9V2 4Q5FA 1HQOA 4DSRA 4GRFA 3TKRA 3L9UA 1W4VA 2KUCA 2BJXA 1GSEA 1EOHA 3NZNA 3GV1A 5CNWA 3APQA 1X9WB 1G7EA 2YZUA 4ECBA 2B7JA 1I5GA 2VL9A 1K0CA 4D73A 4MJEA 1S3DA 5GZZB 3GYKA 3TRPA 1Z3EA 2KHPA 1TTZA 1X9SB 3GTUA 4TOPA 3GKXA 4XS4A 1EZKA 4PUFC 4J56E 2EC4A 1QGVA 3IR4A 2X49A 1K3OA 3N5OA 1UN2A 2ON7A 1TK8B 2TRCP 4PX1A 3IA1A 2OBKA 17GSA 3RPPA 5DALA 4K6XA 4I97A 4PXOA 2O89A 3M9KA 2GGTA 4ZB6A 4HS1A 1JZOA 3HVNA 4USSA 4YAPA 5DBQA 3A2VA 1FVKA 4F0BA 3LJRA 13GSA 3ZVJA 3LYKA 2IIYA 4HQSA 4ZL9A 4MDCA 5A4WA 2FA4A 4O5UA 2VCQA 3GH9A 4CHSA 2J9HA 1Y25A 5ECQB 2CZ2A 4PNFA 1GLPA 3H79A 4WKWA 2ALBA 5JCWA 1PMTA 2YZHA 3OR5A 2GQKA 4HZ2A 5KN2A 3QCPA 3DVWA 1RQMA 1T1VA 2DMMA 2F8FA 2LQOA 4HOJA 3G7JA 2K8VA 2GQMA 2JZSA 4FIWA 1KBNA 10GSA 1ERVA 4Z2RA 1LJRA 2GSSA 1BX9A 3CSIA 3SBCA 1OE7A 2LJRA 1EP7A 4NHZA 4NXIA 3ZIVA 2VOCA 5GSSA 3CBUA 3FW2A 2FNOA 3I43A 4DVCA 4KA0A 3A5WA 4G19A 4X4JA 3PGTA 2HYXA 3P7XA 3UIWA 1QUWA 2V32A 5DALB 4KCAA 4CW9A 3HJMA 3RHBA 3BD2A 4TR3A 1LU4A 5CRGA 3D0ZA 1PN0A 3E9JB 3TKSE 1EOGA 3F8UA 1AIUA
chains in the Genus database with same CATH topology
3TKSC 3GN3A 4POLA 2KOKA 3KIJA 2QA2A 3KTBA 3FYGA 22GSA 1F3BA 2NPBA 4IW9A 3Q18A 3TUEA 1YF1A 4TR4A 3D22A 1AW9A 5FHIA 3BCKA 3QD9A 3F4RA 2KP1A 4N0ZA 3APSA 2DSAA 3TCOA 4KSMA 4MK3A 5BRTA 3QAWA 2C0EA 5ABRA 1USBA 3FHKA 1PQNA 3LORA 1AXDA 3L9SA 3ED3A 2CX4A 2PN8A 1T3BA 3P2AA 1ZYNA 3IK9A 3LQ7A 1DBYA 2FA8A 1XW5A 2H0HA 3VI7A 4HI7A 2FWEA 4PQHA 4LL4B 2OBIA 6GSVA 5HFKA 2I81A 2H30A 5CRHA 2H70A 1SK0A 5DDLA 1SENA 3HVSA 3J7Yb 2FWGA 1Q4JA 1XFLA 3ZTLA 4TVEA 1A2LA 1S3CA 1OYJA 4NV5A 4RQXA 4K5SA 2AB6A 4K7OA 4KDYA 3LSZA 5ECOB 1A8LA 3L78A 5CAXA 3QAVA 3CRTA 4ML6A 5B7CA 3TJGA 1GH2A 1ACVA 5KOXA 1NSWA 3ZLPA 2L6CA 4YQVA 5C00A 6GSXA 5C04A 2DIZA 1EV9A 1R4WA 4EIQA 3FZ5A 3GA4A 1OKDA 2B3SA 3LGCA 3ZIJA 1YZXA 4WF5A 1YKCA 3KMNA 2HSHA 1BAYA 1VGLA 4FQUA 4KGIA 3BOAA 4Q5QA 1T8EB 4TR0A 3U6VA 2GQLA 1OC9B 4JEDA 4G2EA 1XWCA 1YEXA 4N30A 4I6XA 5DCGA 4K9ZA 4MPFA 1SL0B 2H0IA 1ERUA 1MEKA 5IMZA 1WMJA 4J57E 1O6JA 1H75A 5A5KA 2B1KA 3IAS2 2OKAA 2NDOA 4YH2A 5ID2A 3IHQA 4XHMA 4GWRA 4Z2UA 2GZYA 5DQSA 2FD3A 5IMDA 1GNWA 1YDKA 4MP4A 1TI1A 3HHVA 1EV4A 1V2AA 1VF3A 1GSYA 4OFTA 1EGOA 5CRWA 1URMA 4ID0A 2GT6A 3DYRA 3US3A 1YQ1A 3ME7A 3ZL5A 3KD0A 3HZ8A 4TR1A 2JADA 5ENUA 4OFNA 2VM2A 3GURA 1EWXA 1ERWA 4MJAA 4POMA 4KB3A 2I3YA 4QQ7A 4MJBA 4FYBA 4OO5A 5HR1A 2VCWA 2X99A 3ZREA 2H76A 2GS3A 3TJKA 4RUVA 2WULA 4I5QA 4I2TA 4N0VA 4MA9A 2V6OA 1JFUA 3GRXA 1PA3A 2LEGA 1X5CA 2GTUA 2C0GA 5DQYA 1A23A 4G0LA 4DSQA 1THOA 5IMVA 2HNLA 4V2NA 3W8SA 3QDNA 2DC5A 5HR0A 5GAPD 4OD7A 1FVJA 4GXZA 2R6KA 5LCZA 3F3QA 2MMZA 3Q19A 4EL1A 5ECKB 3F4TA 2ES7A 3LXZA 2WGRA 3O6TA 4LL1B 3IRAA 2YWNA 2CQ9A 1GWCA 1WIKA 4HQZA 3ZYWA 4V1Ap 9GSSA 1CQGA 1G6YA 5LD0A 3KH9A 5ECLB 1KNGA 2IMEA 3PINA 3M8NA 2HSMA 2F3MA 3TOTA 2C0FA 2B5EA 1TU7A 1XBSA 2KP2A 4BVXA 3MIXA 2A2PA 3CXGA 1BJXA 1R7HA 5D73A 5J9BA 5ECIB 3VWWA 2DKIA 2FY6A 1TRVA 1M0UA 2K18A 4AJ8A 3WGXA 1FOVA 5E4WA 2E0QA 1AQVA 3O76A 1BQ7A 4EVMA 1FHEA 2IFQB 3DWVA 4ICYA 3HDCA 3G9BA 4HJMA 4OMVA 3FZAA 1T7PB 3M1GA 3FMWA 3KJYA 4GQFA 1O73A 2AHEA 3A3TA 2HZEB 2OADA 3IC4A 4EO3A 2R0CA 1WJKA 2WRTA 4N10A 5D8IA 2H71A 4V1Ag 5JWRB 2JZRA 4WBRD 2J23A 1XVWA 3ZMKA 1ZOFA 4I8BA 4EDYA 1TXXA 4LMWA 3D4MA 2CVDA 4MF5A 5D9WA 2IJYA 2R5GA 5G2ZA 2V6KA 4AGSA 2OJLA 2FWFA 3F6FA 1UA5A 1ABAA 2PGTA 3D6IA 2X8GA 2I9HA 2PBJA 1TI3A 3EURA 1OC8A 4ULXA 2OE1A 2I4AA 1IYHA 1JLWA 1YJ6A 4EC0A 4IJIA 1JLVA 2D2ZA 4L0UA 1AUCA 4FH8A 5GAND 3CYNA 2QKEA 2V1MA 2M72A 2NVLA 1GUKA 2REMA 2PVQA 5ECRB 5F0GA 1K0MA 2CAIA 5IPGA 5DVBA 2YV7A 2LNSA 1F6MC 2RM6A 2VAFA 4QL9A 5ECSA 1TDIA 5LNKe 2VL2A 3IBHA 1GSQA 1VRSD 2KLXA 2L59A 4WR4A 1OKTA 1XZOA 5G30A 2VIMA 5F05A 2L6DA 2JU5A 4IJ3A 4WXTA 1XWBA 2K6VA 2YJ7A 5HQPA 3FR9A 1U87A 5DCHA 4BVYA 2JSYA 2R0GA 4MZWA 2OE3A 2C3TA 2H75A 2L4QA 4I2UA 2P5QA 3IDVA 2YJHA 3P90A 3VLNA 3L9VA 2EIRA 2GZZA 3O3TA 2XC2A 1BYEA 2LTKA 3L4NA 4E8HA 2H6ZA 5ECPB 5H5RA 1XOAA 2X8CA 1EEMA 1T4YA 2EIQA 3CRUA 4D73B 5AIXA 3FR3A 2LQQA 3ZVJD 3F6DA 3UVTA 3GX8A 3C1SA 2EIOA 1O8WA 4RQRA 3GTUB 2PVOC 4XRDA 3H8QA 1FAAA 1SYXA 4XS4B 1XXUA 3F9UA 1G7OA 5J3RA 3F3RA 5D93A 1K0DA 1TOFA 1NHYA 2L5LA 4EXJA 3GMFA 2G2QA 5CO3A 1YEPA 5IOWA 1A8YA 2R37A 2X8HA 3UOMA 3V1WA 1KEBA 4H86A 4NMUA 1U3IA 4JU5A 3GUSA 1T00A 2GLRA 3MAKA 5ECHB 6GSUA 4HU7A 1GTBA 4OO4A 2CVBA 3FZ9A 1PL2A 3LYPA 4PQIA 4XTSA 5EY6A 1B4PA 5H5QA 5D9TA 4KX4A 5F8BA 2G0FA 6GSWA 4ZBDA 3UMAA 3DRNA 5D96A 2DJJA 2LRNA 7GSSA 1TRSA 2C1YA 2FUG2 3TKPA 4K0NA 1N8JA 1GTIA 1SJZA 2LJKA 3J7Yk 4LA1A 3UBLA 3UBKA 5B6MA 2JSZA 3K8NA 4MF6A 2YPMA 2O8VB 4F9ZA 1MTCA 3IPZA 2F51A 1MDIA 1WP0A 4Z2TA 4IBPA 3HVVA 4X0XA 2RM5A 3ERFA 3C1RA 1OE8A 4KE3A 1TW9A 2E7PA 2ON5A 5KOWA 1MDKA 1Z6MA 3QFAC 4ZBBA 3IE3A 3ZZXA 4A5PA 2UZ8A 3A2XA 4BWSA 1ZYEA 3EC3A 3FEUA 5EVOA 1O8XA 5IOXA 2CX3A 3GL3A 4N11A 1R5AA 1VF2A 4BA7A 4GLTA 1ON4A 5D9VA 1AC1A 2PUKC 2VO4A 2C8UA 1PKZA 3MNGA 1ML6A 3HXSA 2L57A 1NHOA 1IYIA 3GHAA 2OA7A 3RHCA 1A0FA 4L8EA 3S9FA 2DMLA 3NIVA 4TXOA 2YOIA 1O85A 4X1UA 2AAWA 5CREA 2IMKA 3D5JA 1XW9A 2H74A 4EDZA 3VI5A 1XWAA 3F4SA 1KTEA 1VF4A 3EWLA 1THXA 4IQAA 1U6TA 4K1FA 2H1BA 3DMLA 4FYCA 2A2SA 4IP1A 1FO5A 1OVNA 5G5EA 3KP9A 3EVIA 1XOBA 3M3MA 2C0DA 4XRAA 4G9HA 2MYGA 3TJBA 5FWGA 4IHUA 1WPIA 2GVPA 1ZL9A 4EE0A 1V98A 5DAKA 4GCIA 2C4JA 2LUSA 1K0OA 2FGXA 4K2XA 1DSBA 4V2LA 3RBTA 2RIIA 2DJ0A 1AAZA 3EYTA 1W89A 5COHA 2MBTA 5HR3A 4ECJA 2JACA 2BMXA 3FR6A 5B6NA 4DSSA 2F9SA 4BL7A 2B5XA 1R26A 1ZZYA 1TRUA 4AF2A 4K5RA 1GSFA 1SYRA 3KZQA 1B8XA 4OCFA 1J08A 1YKAA 4PUAA 5DJMA 2TIRA 5JWQB 2NTOA 4K0GA 4OCEA 2AJQB 1SK1A 4KF9A 2XBQA 1CQHA 2R4VA 2RLIA 3FKFA 1VF1A 2OE0A 1A24A 3TDGA 4LMVA 1WWJA 2YWOA 1SU9A 5KN1A 3GX0A 2O7KA 3FK8A 4ACSA 1PSQA 3DVXA 3BCIA 1EGRA 2YCDA 3CSHA 2IMDA 1DUGA 1BG5A 1H4OA 4GF0A 3DD3A 1PD21 3TB2A 5ECMB 1TK5B 5GSTA 3LFLA 2K9FA 2LSTA 2QA1A 3VURA 5H5SA 3LWAA 2FWHA 3DIEA 5J41A 2VCZA 1QXHA 4JBBA 4HEA2 3IC8A 4ZL8A 1B4QA 2DBCA 4TKYA 4AJ7A 1U88A 2H8LA 4POKA 1T4ZA 1XWGA 3C8EA 5DAKB 1B9XC 3N9JA 1Y6EA 3I6AA 3MWHA 1V58A 2DIYA 4PNGA 16GSA 2VLVA 2CVKA 1FB0A 4KDXA 3A5IA 1ERTA 2H0GA 1JHBA 1SJ6A 4L5OA 1X9MB 4GQCA 4EIPA 3BBYA 4DSSB 5L71A 2LJAA 5ID2B 4KAEA 1MD3A 1C72A 4AJ6A 4NHWA 4GSTA 5AISA 2HI7A 4L5LA 1Z5YE 1ST9A 4WEYA 1NM3A 3D4TA 1M2DA 4MH2A 4MJCA 3M9JA 1Z6NA 5KN0A 1UC7A 4F82A 4TR1B 3GSTA 1ILOA 5G1LA 2H1AA 3QAGA 2VCVA 4MMMA 4IGJA 1F3AA 1PGTA 2YP6A 5EL8A 5IMCA 4ZIJA 1X5EA 4TW5A 1PX6A 2H66A 5E59A 1YF0A 4K2DA 3ERWA 3GIXA 4IP6A 4ZB8A 5IIZA 5J5NA 1QQ2A 2WB9A 2WZ9A 4TXVA 4ML1A 1HNCA 3NOFA 5IO2A 4PQ1A 1XPVA 1TJDA 3TGZA 8GSSA 2P31A 3A2WA 1GSSA 4YKFA 2LRTA 5IMFA 3TKSA 4XS1A 3VWUA 2C3NA 2VL3A 1PKWA 2HRFA 2HSYA 3Q74A 3HYPA 1K0NA 4ECCA 3GKKA 1GULA 1PRXA 4LLRA 1U3AA 3HCZA 2IL3A 2HRNA 2I1UA 4MF7A 4TRXA 2H1DA 4Q5RA 5IQYA 2F8AA 2O85A 1ZYQB 1GTUA 3EMXA 3H4KA 4K8MA 2QGVA 2BTOT 2X4AA 4KDUA 1G0TA 2H01A 2WS2A 3EE2A 6GSTA 1SJIA 1K0AA 3UL3A 1SKSB 1YY7A 3HJPA 4IKHA 3AY8A 4IS0A 1GNEA 4DEJA 2A4HA 3HZ4A 1QFNA 1B9YC 3R3EA 2AYTA 4IN0A 1ZMAA 3R2QA 2IMFA 4BVXB 3ZMLA 1AQXA 4PGTA 2HZFA 2WJUA 3ISOA 2HFDA 3UJ1A 2MMNA 1XVQA 3TRQA 4MH3A 2VCXA 2HRKA 2FCHA 4EF0A 1E2YA 1JZWA 1FG4A 3DEXA 5F07A 5A4UA 3ZITA 2HE3A 1TP9A 3ZFLA 5G31A 3RPNA 3DKSA 1OAZA 5IPHA 1GUHA 1X0RA 4MLYA 2XPDA 5IMAA 3KEBA 2H1GA 5KN3A 4V2MA 3KTLA 3KXOA 2GT5A 3TJFA 2GSTA 3WGDA 3U5RE 2MZCA 5B8AA 1I9DA 2VCTA 4TN8A 4K7NA 4QL7A 1V9WA 3E3EA 1MD4A 6GSYA 1WRYA 1SL1B 3MSZA 3QPMA 4HDEA 2LRCA 3PR8A 2ZNMA 1BEDA 3HKRA 19GSA 1RW1A 2B7KA 3VK9A 4HZ4A 3QMXA 2CAQA 5CP1A 4FO5A 3IAM2 4G0KA 2P5RA 1DE2A 3C73A 1TU8A 1SL2B 1XIYA 2V41A 5INYA 1PN9A 4XCSA 5G1KA 1UVZA 2WCIA 2IWTA 3RAZA 1TK0B 1A0RP 3HA9A 1HD2A 4BPYA 4GSSA 5AN1A 1V40A 2PERA 2QSIA 2JZTA 3DGQA 4MZCA 20GSA 3TOUA 3ZFBA 4JE1A 3TRXA 3EMPA 2B5YA 5HFIA 5JWOB 1SKRB 1M9AA 2E2MA 4MCUA 2PU9C 4ISDA 3CTGA 1HYUA 1SK2A 3GL5A 3GKMA 3KM6A 1E6BA 3I69A 2A2RA 4BVYB 1JZRA 4O92A 1R5PA 2L4CA 2LNTA 2CV4A 2M46A 2VM1A 2PMTA 1XW6A 4YQMA 5BMUA 4KW6A 1M7TA 2M80A 3PPUA 2GZPA 3VPTA 2YN1A 4HUAA 2XBIA 4ZBAA 2XHFA 3VWXA 4ZL7A 4HU9A 1B48A 3LEFA 2WDUA 4EKZA 2TRXA 1SKWB 1HNBA 2FHEA 4CDOA 2C3QA 2VD1A 4XS6A 4FYUA 11GSA 4MZBA 3IXRA 4KUNA 1OC9A 2N5BA 1TRWA 1X5DA 2AV4A 3WT2A 3HD5A 4WETA 2WFCA 2LKUA 3GKNA 4NPBA 4YKGA 12GSA 5B8BA 2VUPA 1ZYPA 4XIHA 2YWIA 1PX7A 1G6WA 1ZCPA 2MMOA 2VD0A 2VL2C 3IOSA 1F37A 5J9CA 4E8EA 4ZXGA 2CT6A 4IVFA 3E0UA 3VWVA 4NV2A 2PPTA 1A2JA 1HNAA 2H19A 3CSJA 1K3YA 1WE0A 3H93A 4JZQA 3W8JA 5AGYA 1F2EA 2HLSA 3MDKA 2B6MA 3KGKA 1XCCA 1Z7PA 2IPAA 1F9MA 1GUMA 3KH7A 1GL8A 5G5FA 1JZDA 3UARA 3CTFA 2DJ2A 18GSA 2GDRA 3VPQA 4BWQA 3VFIA 3LXTA 4JR4A 2P0GA 2R0PA 4O5QA 2YNXA 4NAXA 1TKDB 1LBKA 1M9BA 3LW9A 5HFGA 1DE1A 2AUVA 2XPEA 3UVHA 2N5AA 4MNNA 4KH7A 2DJ1A 4Z7XA 4YAVA 5JCGA 4YQUA 3GFKA 1S3AA 3F0IA 4F2IA 3Q6OA 5JCUA 4O32A 1QMVA 2H6XA 2L5OA 4ECIA 4MABA 5CRDA 3C7MA 3UAPA 1MDJA 5D9XA 5IM9A 5J4UA 4OWYA 4P3YB 3GH6A 2DJKA 4CY8A 4POBA 2YWMA 4X43A 3ZRDA 2A4VA 1GP1A 4TXOB 2OACA 5F06A 5ECNB 4KNDA 3WGEA 3KMOA 1M2AA 4GTUA 4WBJA 1V57A 2QC7A 3D21A 3HVXA 2HRAA 4JR6A 5A4VA 1FOHA 2ZCTA 4GSNA 1A2MA 1QK8A 5DJLA 2LV3A 2ZUPA 4O7HA 1M99A 4ZILA 1GLQA 1FW1A 4L0WA 3TKQA 5EPFA 4F03A 3EPTA 3BJ5A 2DLXA 2VLUA 2V2GA 2HT9A 3QR6A 2O87A 4JRRA 1K3LA 2H72A 1OC3A 1GSDA 6GSSA 1O7UA 4KCEA 2N5FA 3LG6A 4J2FA 1NW2A 2FLSA 2RUFA 3WD6A 3JCML 2MMAA 4G0IA 3APOA 3L0HA 1M2BA 3CMIA 2IFQA 3EU4A 3KCMA 4CY6A 2PWJA 3WT1A 3PH9A 4G10A 1FB6A 2IMIA 2DJ3A 2HZEA 3IV4A 5HR2A 4NWYA 2K8SA 1GTAA 3UEMA 1GRXA 1WOUA 4BL7B 3MYDA 3M0FA 3H1NA 2CA8A 1AQWA 3F63A 1SD9A 3QFBC 1XWKA 2NBSA 4ZB9A 3FY7A 2X64A 5AIVA 2YV9A 2Z9SA 3DXBA 3WYWA 4RI7A 5ELAA 2GSQA 5FT3A 4IQ1A 3GSSA 4OFMA 1GSUA 4KSOA 2RUEA 1SD8A 2C80A 3ME8A 5KEJA 4ILFA 5ELGA 3RDWA 2H6YA 3FRCA 3W6GA 1O81A 1Z7RA 2HXKA 2R2JA 2GSRA 4PTSA 2LS5A 2H73A 4EUYA 2R3XA 3FZ4A 3C71A 3SWLA 5CYYA 14GSA 3G7IA 2MBSA 3G7YA 1N2AA 3KP8A 1J9BA 1RK4A 2CZ3A 4IELA 2DKHA 4HJ2A 4WF4A 4O5RA 3P8WA 1K0BA 2E2GA 1ZGNA 4PURA 1J0FA 4RI6A 2JL4A 4Q5NA 2VLTA 1Q98A 4MPGA 3IHGA 3IK7A 4WR5A 1PL1A 1EP8A 2B1LA 3HJOA 5IO0A 2YANA 3EU3A 4K7IA 3ERGA 3GNJA 2IN3A 3TJJA 1Z9HA 4F0CA 1EEJA 3HY2A 3EINA 3QOUA 3I9V2 4Q5FA 1HQOA 4DSRA 4GRFA 3TKRA 3L9UA 1W4VA 2KUCA 2BJXA 1GSEA 1EOHA 3NZNA 3GV1A 5CNWA 3APQA 1X9WB 1G7EA 2YZUA 4ECBA 2B7JA 1I5GA 2VL9A 1K0CA 4D73A 4MJEA 1S3DA 5GZZB 3GYKA 3TRPA 1Z3EA 2KHPA 1TTZA 1X9SB 3GTUA 4TOPA 3GKXA 4XS4A 1EZKA 4PUFC 4J56E 2EC4A 1QGVA 3IR4A 2X49A 1K3OA 3N5OA 1UN2A 2ON7A 1TK8B 2TRCP 4PX1A 3IA1A 2OBKA 17GSA 3RPPA 5DALA 4K6XA 4I97A 4PXOA 2O89A 3M9KA 2GGTA 4ZB6A 4HS1A 1JZOA 4USSA 4YAPA 5DBQA 3A2VA 1FVKA 4F0BA 3LJRA 13GSA 3ZVJA 3LYKA 2IIYA 4HQSA 4ZL9A 4MDCA 5A4WA 2FA4A 4O5UA 2VCQA 3GH9A 4CHSA 2J9HA 1Y25A 5ECQB 2CZ2A 4PNFA 1GLPA 3H79A 4WKWA 2ALBA 5JCWA 1PMTA 2YZHA 3OR5A 2GQKA 4HZ2A 5KN2A 3QCPA 3DVWA 1RQMA 1T1VA 2DMMA 2F8FA 2LQOA 4HOJA 3G7JA 2K8VA 2GQMA 2JZSA 4FIWA 1KBNA 10GSA 1ERVA 4Z2RA 1LJRA 2GSSA 1BX9A 3CSIA 3SBCA 1OE7A 2LJRA 1EP7A 4NHZA 4NXIA 3ZIVA 2VOCA 5GSSA 3CBUA 3FW2A 2FNOA 3I43A 4DVCA 4KA0A 3A5WA 4G19A 4X4JA 3PGTA 2HYXA 3P7XA 3UIWA 1QUWA 2V32A 5DALB 4KCAA 4CW9A 3HJMA 3RHBA 3BD2A 4TR3A 1LU4A 5CRGA 3D0ZA 1PN0A 3E9JB 3TKSE 1EOGA 3F8UA 1AIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKS C;  3GN3 A;  4POL A;  2KOK A;  3KIJ A;  3KTB A;  3FYG A;  22GS A;  1F3B A;  2NPB A;  4IW9 A;  3Q18 A;  3TUE A;  1YF1 A;  4TR4 A;  3D22 A;  1AW9 A;  5FHI A;  3BCK A;  3QD9 A;  3F4R A;  2KP1 A;  4N0Z A;  3APS A;  2DSA A;  3TCO A;  4KSM A;  4MK3 A;  3QAW A;  2C0E A;  5ABR A;  1USB A;  3FHK A;  1PQN A;  3LOR A;  1AXD A;  3L9S A;  3ED3 A;  2CX4 A;  2PN8 A;  1T3B A;  3P2A A;  3IK9 A;  3LQ7 A;  1DBY A;  2FA8 A;  1XW5 A;  2H0H A;  3VI7 A;  4HI7 A;  2FWE A;  4PQH A;  4LL4 B;  2OBI A;  6GSV A;  5HFK A;  2I81 A;  2H30 A;  5CRH A;  2H70 A;  1SK0 A;  5DDL A;  1SEN A;  3HVS A;  3J7Y b;  2FWG A;  1Q4J A;  1XFL A;  3ZTL A;  4TVE A;  1A2L A;  1S3C A;  1OYJ A;  4NV5 A;  4RQX A;  2AB6 A;  4K7O A;  4KDY A;  3LSZ A;  5ECO B;  1A8L A;  3L78 A;  5CAX A;  3QAV A;  3CRT A;  4ML6 A;  5B7C A;  3TJG A;  1GH2 A;  1ACV A;  1NSW A;  3ZLP A;  2L6C A;  4YQV A;  5C00 A;  6GSX A;  5C04 A;  2DIZ A;  1EV9 A;  1R4W A;  3FZ5 A;  3GA4 A;  1OKD A;  2B3S A;  3LGC A;  3ZIJ A;  1YZX A;  4WF5 A;  1YKC A;  3KMN A;  2HSH A;  1BAY A;  1VGL A;  4KGI A;  3BOA A;  4Q5Q A;  1T8E B;  4TR0 A;  3U6V A;  2GQL A;  1OC9 B;  4JED A;  4G2E A;  1XWC A;  1YEX A;  4N30 A;  4I6X A;  5DCG A;  4K9Z A;  4MPF A;  1SL0 B;  2H0I A;  1ERU A;  1MEK A;  5IMZ A;  1WMJ A;  4J57 E;  1O6J A;  1H75 A;  5A5K A;  2B1K A;  3IAS 2;  2OKA A;  2NDO A;  4YH2 A;  5ID2 A;  3IHQ A;  4XHM A;  4GWR A;  2GZY A;  5DQS A;  2FD3 A;  5IMD A;  1GNW A;  1YDK A;  4MP4 A;  1TI1 A;  3HHV A;  1EV4 A;  1V2A A;  1VF3 A;  1GSY A;  4OFT A;  1EGO A;  5CRW A;  1URM A;  4ID0 A;  2GT6 A;  3DYR A;  3US3 A;  1YQ1 A;  3ME7 A;  3ZL5 A;  3KD0 A;  3HZ8 A;  4TR1 A;  2JAD A;  5ENU A;  4OFN A;  2VM2 A;  3GUR A;  1EWX A;  1ERW A;  4MJA A;  4POM A;  4KB3 A;  2I3Y A;  4QQ7 A;  4MJB A;  4FYB A;  4OO5 A;  5HR1 A;  2VCW A;  2X99 A;  3ZRE A;  2H76 A;  2GS3 A;  3TJK A;  4RUV A;  2WUL A;  4I5Q A;  4I2T A;  4N0V A;  4MA9 A;  2V6O A;  1JFU A;  3GRX A;  1PA3 A;  2LEG A;  1X5C A;  2GTU A;  2C0G A;  5DQY A;  1A23 A;  4DSQ A;  1THO A;  5IMV A;  2HNL A;  4V2N A;  3W8S A;  3QDN A;  2DC5 A;  5HR0 A;  5GAP D;  4OD7 A;  1FVJ A;  4GXZ A;  2R6K A;  5LCZ A;  3F3Q A;  2MMZ A;  3Q19 A;  4EL1 A;  5ECK B;  3F4T A;  2ES7 A;  3LXZ A;  2WGR A;  3O6T A;  4LL1 B;  3IRA A;  2YWN A;  2CQ9 A;  1GWC A;  1WIK A;  4HQZ A;  3ZYW A;  4V1A p;  9GSS A;  1CQG A;  1G6Y A;  5LD0 A;  3KH9 A;  5ECL B;  1KNG A;  2IME A;  3PIN A;  3M8N A;  2F3M A;  3TOT A;  2C0F A;  2B5E A;  1TU7 A;  1XBS A;  2KP2 A;  4BVX A;  3CXG A;  1BJX A;  1R7H A;  5D73 A;  5J9B A;  5ECI B;  3VWW A;  2FY6 A;  1TRV A;  1M0U A;  2K18 A;  4AJ8 A;  3WGX A;  1FOV A;  5E4W A;  2E0Q A;  1AQV A;  3O76 A;  1BQ7 A;  4EVM A;  1FHE A;  2IFQ B;  3DWV A;  3HDC A;  3G9B A;  4HJM A;  4OMV A;  3FZA A;  1T7P B;  3M1G A;  3KJY A;  4GQF A;  1O73 A;  2AHE A;  3A3T A;  2HZE B;  2OAD A;  3IC4 A;  4EO3 A;  1WJK A;  2WRT A;  4N10 A;  5D8I A;  2H71 A;  4V1A g;  5JWR B;  2JZR A;  4WBR D;  2J23 A;  1XVW A;  3ZMK A;  1ZOF A;  4I8B A;  4EDY A;  1TXX A;  4LMW A;  3D4M A;  2CVD A;  5D9W A;  4MF5 A;  2IJY A;  2R5G A;  5G2Z A;  2V6K A;  4AGS A;  2OJL A;  2FWF A;  3F6F A;  1UA5 A;  1ABA A;  2PGT A;  3D6I A;  2X8G A;  2I9H A;  2PBJ A;  1TI3 A;  3EUR A;  1OC8 A;  4ULX A;  2OE1 A;  2I4A A;  1IYH A;  1JLW A;  1YJ6 A;  4EC0 A;  4IJI A;  1JLV A;  2D2Z A;  4L0U A;  1AUC A;  4FH8 A;  5GAN D;  3CYN A;  2QKE A;  2V1M A;  2M72 A;  2NVL A;  1GUK A;  2REM A;  2PVQ A;  5ECR B;  5F0G A;  1K0M A;  2CAI A;  5IPG A;  5DVB A;  2YV7 A;  2LNS A;  1F6M C;  2RM6 A;  2VAF A;  4QL9 A;  5ECS A;  1TDI A;  5LNK e;  2VL2 A;  3IBH A;  1GSQ A;  1VRS D;  2KLX A;  2L59 A;  4WR4 A;  1OKT A;  1XZO A;  5G30 A;  2VIM A;  5F05 A;  2L6D A;  2JU5 A;  4IJ3 A;  4WXT A;  1XWB A;  2K6V A;  2YJ7 A;  5HQP A;  3FR9 A;  1U87 A;  5DCH A;  4BVY A;  2JSY A;  4MZW A;  2OE3 A;  2C3T A;  2H75 A;  2L4Q A;  4I2U A;  2P5Q A;  3IDV A;  2YJH A;  3P90 A;  3VLN A;  3L9V A;  2EIR A;  2GZZ A;  3O3T A;  2XC2 A;  1BYE A;  2LTK A;  3L4N A;  4E8H A;  2H6Z A;  5ECP B;  5H5R A;  1XOA A;  2X8C A;  1EEM A;  1T4Y A;  2EIQ A;  3CRU A;  4D73 B;  5AIX A;  3FR3 A;  2LQQ A;  3ZVJ D;  3F6D A;  3UVT A;  3GX8 A;  3C1S A;  2EIO A;  1O8W A;  4RQR A;  3GTU B;  2PVO C;  4XRD A;  3H8Q A;  1FAA A;  1SYX A;  4XS4 B;  1XXU A;  3F9U A;  1G7O A;  5J3R A;  3F3R A;  5D93 A;  1K0D A;  1TOF A;  1NHY A;  2L5L A;  4EXJ A;  3GMF A;  2G2Q A;  5CO3 A;  1YEP A;  5IOW A;  1A8Y A;  2R37 A;  2X8H A;  3UOM A;  3V1W A;  1KEB A;  4H86 A;  4NMU A;  1U3I A;  4JU5 A;  3GUS A;  1T00 A;  2GLR A;  3MAK A;  5ECH B;  6GSU A;  4HU7 A;  1GTB A;  4OO4 A;  2CVB A;  3FZ9 A;  1PL2 A;  3LYP A;  4PQI A;  4XTS A;  5EY6 A;  1B4P A;  5H5Q A;  5D9T A;  4KX4 A;  5F8B A;  2G0F A;  6GSW A;  4ZBD A;  3UMA A;  3DRN A;  5D96 A;  2DJJ A;  2LRN A;  7GSS A;  1TRS A;  2C1Y A;  2FUG 2;  3TKP A;  4K0N A;  1N8J A;  1GTI A;  1SJZ A;  2LJK A;  3J7Y k;  4LA1 A;  3UBL A;  3UBK A;  5B6M A;  2JSZ A;  3K8N A;  4MF6 A;  2YPM A;  2O8V B;  4F9Z A;  1MTC A;  3IPZ A;  2F51 A;  1MDI A;  1WP0 A;  4IBP A;  3HVV A;  4X0X A;  2RM5 A;  3ERF A;  3C1R A;  1OE8 A;  4KE3 A;  1TW9 A;  2E7P A;  2ON5 A;  1MDK A;  1Z6M A;  3QFA C;  4ZBB A;  3IE3 A;  3ZZX A;  3A2X A;  4BWS A;  1ZYE A;  3EC3 A;  3FEU A;  5EVO A;  1O8X A;  5IOX A;  2CX3 A;  3GL3 A;  4N11 A;  1R5A A;  1VF2 A;  4BA7 A;  4GLT A;  1ON4 A;  5D9V A;  1AC1 A;  2PUK C;  2VO4 A;  2C8U A;  1PKZ A;  3MNG A;  1ML6 A;  3HXS A;  2L57 A;  1NHO A;  1IYI A;  3GHA A;  2OA7 A;  3RHC A;  1A0F A;  4L8E A;  3S9F A;  2DML A;  3NIV A;  4TXO A;  2YOI A;  1O85 A;  4X1U A;  2AAW A;  5CRE A;  2IMK A;  3D5J A;  1XW9 A;  2H74 A;  4EDZ A;  3VI5 A;  1XWA A;  3F4S A;  1KTE A;  1VF4 A;  3EWL A;  1THX A;  4IQA A;  1U6T A;  4K1F A;  2H1B A;  3DML A;  4FYC A;  2A2S A;  4IP1 A;  1FO5 A;  1OVN A;  5G5E A;  3KP9 A;  3EVI A;  1XOB A;  3M3M A;  2C0D A;  4XRA A;  4G9H A;  2MYG A;  3TJB A;  5FWG A;  4IHU A;  1WPI A;  2GVP A;  1ZL9 A;  4EE0 A;  1V98 A;  5DAK A;  4GCI A;  2C4J A;  2LUS A;  1K0O A;  2FGX A;  1DSB A;  4V2L A;  3RBT A;  2RII A;  2DJ0 A;  1AAZ A;  3EYT A;  1W89 A;  5COH A;  2MBT A;  5HR3 A;  4ECJ A;  2JAC A;  2BMX A;  3FR6 A;  5B6N A;  4DSS A;  2F9S A;  4BL7 A;  2B5X A;  1R26 A;  1ZZY A;  1TRU A;  4AF2 A;  1GSF A;  1SYR A;  3KZQ A;  1B8X A;  4OCF A;  1J08 A;  1YKA A;  4PUA A;  5DJM A;  2TIR A;  5JWQ B;  2NTO A;  4K0G A;  4OCE A;  2AJQ B;  1SK1 A;  2XBQ A;  1CQH A;  2R4V A;  2RLI A;  3FKF A;  1VF1 A;  2OE0 A;  1A24 A;  3TDG A;  4LMV A;  1WWJ A;  2YWO A;  1SU9 A;  5KN1 A;  3GX0 A;  2O7K A;  3FK8 A;  4ACS A;  1PSQ A;  3DVX A;  3BCI A;  1EGR A;  2YCD A;  3CSH A;  2IMD A;  1DUG A;  1BG5 A;  1H4O A;  4GF0 A;  3DD3 A;  1PD2 1;  3TB2 A;  5ECM B;  1TK5 B;  5GST A;  3LFL A;  2K9F A;  2LST A;  3VUR A;  5H5S A;  3LWA A;  2FWH A;  3DIE A;  5J41 A;  2VCZ A;  1QXH A;  4JBB A;  4HEA 2;  4ZL8 A;  1B4Q A;  2DBC A;  4TKY A;  4AJ7 A;  1U88 A;  2H8L A;  4POK A;  1T4Z A;  1XWG A;  3C8E A;  5DAK B;  1B9X C;  3N9J A;  1Y6E A;  3I6A A;  3MWH A;  1V58 A;  2DIY A;  4PNG A;  16GS A;  2VLV A;  2CVK A;  1FB0 A;  4KDX A;  1ERT A;  2H0G A;  1JHB A;  1SJ6 A;  4L5O A;  1X9M B;  4GQC A;  3BBY A;  4DSS B;  5L71 A;  2LJA A;  5ID2 B;  4KAE A;  1MD3 A;  1C72 A;  4AJ6 A;  4NHW A;  4GST A;  5AIS A;  2HI7 A;  4L5L A;  1Z5Y E;  1ST9 A;  4WEY A;  1NM3 A;  3D4T A;  1M2D A;  4MH2 A;  4MJC A;  3M9J A;  1Z6N A;  5KN0 A;  1UC7 A;  4F82 A;  4TR1 B;  3GST A;  1ILO A;  5G1L A;  2H1A A;  3QAG A;  2VCV A;  4MMM A;  4IGJ A;  1F3A A;  1PGT A;  2YP6 A;  5EL8 A;  5IMC A;  4ZIJ A;  1X5E A;  4TW5 A;  1PX6 A;  2H66 A;  5E59 A;  1YF0 A;  4K2D A;  3ERW A;  3GIX A;  4IP6 A;  4ZB8 A;  5IIZ A;  5J5N A;  1QQ2 A;  2WB9 A;  2WZ9 A;  4TXV A;  4ML1 A;  1HNC A;  3NOF A;  5IO2 A;  4PQ1 A;  1XPV A;  1TJD A;  3TGZ A;  8GSS A;  2P31 A;  3A2W A;  1GSS A;  2LRT A;  5IMF A;  3TKS A;  4XS1 A;  3VWU A;  2C3N A;  2VL3 A;  1PKW A;  2HRF A;  2HSY A;  3Q74 A;  3HYP A;  1K0N A;  4ECC A;  3GKK A;  1GUL A;  1PRX A;  4LLR A;  1U3A A;  3HCZ A;  2IL3 A;  2HRN A;  2I1U A;  4MF7 A;  4TRX A;  2H1D A;  4Q5R A;  5IQY A;  2F8A A;  2O85 A;  1ZYQ B;  1GTU A;  3EMX A;  3H4K A;  4K8M A;  2QGV A;  2BTO T;  4KDU A;  1G0T A;  2H01 A;  2WS2 A;  3EE2 A;  6GST A;  1SJI A;  1K0A A;  3UL3 A;  1SKS B;  1YY7 A;  3HJP A;  4IKH A;  3AY8 A;  4IS0 A;  1GNE A;  4DEJ A;  3HZ4 A;  1QFN A;  1B9Y C;  2AYT A;  4IN0 A;  1ZMA A;  3R2Q A;  2IMF A;  3ZML A;  1AQX A;  4PGT A;  2HZF A;  2WJU A;  3ISO A;  2HFD A;  3UJ1 A;  2MMN A;  1XVQ A;  3TRQ A;  4MH3 A;  2VCX A;  2FCH A;  4EF0 A;  1E2Y A;  1JZW A;  1FG4 A;  3DEX A;  5F07 A;  5A4U A;  3ZIT A;  2HE3 A;  1TP9 A;  3ZFL A;  5G31 A;  3RPN A;  3DKS A;  1OAZ A;  5IPH A;  1GUH A;  1X0R A;  4MLY A;  2XPD A;  5IMA A;  3KEB A;  2H1G A;  5KN3 A;  4V2M A;  3KTL A;  3KXO A;  2GT5 A;  3TJF A;  2GST A;  3WGD A;  3U5R E;  2MZC A;  5B8A A;  1I9D A;  2VCT A;  4TN8 A;  4K7N A;  4QL7 A;  1V9W A;  3E3E A;  1MD4 A;  6GSY A;  1WRY A;  1SL1 B;  3MSZ A;  3QPM A;  4HDE A;  2LRC A;  3PR8 A;  2ZNM A;  1BED A;  3HKR A;  19GS A;  1RW1 A;  2B7K A;  3VK9 A;  4HZ4 A;  3QMX A;  2CAQ A;  5CP1 A;  4FO5 A;  3IAM 2;  2P5R A;  1DE2 A;  3C73 A;  1TU8 A;  1SL2 B;  1XIY A;  2V41 A;  5INY A;  1PN9 A;  4XCS A;  5G1K A;  1UVZ A;  2WCI A;  2IWT A;  3RAZ A;  1TK0 B;  1A0R P;  3HA9 A;  1HD2 A;  4BPY A;  4GSS A;  5AN1 A;  1V40 A;  2PER A;  2QSI A;  2JZT A;  3DGQ A;  4MZC A;  20GS A;  3TOU A;  3ZFB A;  4JE1 A;  3TRX A;  3EMP A;  2B5Y A;  5HFI A;  5JWO B;  1SKR B;  1M9A A;  2E2M A;  4MCU A;  2PU9 C;  4ISD A;  3CTG A;  1HYU A;  1SK2 A;  3GL5 A;  3GKM A;  3KM6 A;  1E6B A;  3I69 A;  2A2R A;  1JZR A;  4O92 A;  1R5P A;  2L4C A;  2LNT A;  2CV4 A;  2M46 A;  2VM1 A;  2PMT A;  1XW6 A;  4YQM A;  4KW6 A;  1M7T A;  2M80 A;  2GZP A;  3VPT A;  2YN1 A;  4HUA A;  2XBI A;  4ZBA A;  2XHF A;  3VWX A;  4ZL7 A;  4HU9 A;  1B48 A;  3LEF A;  2WDU A;  4EKZ A;  2TRX A;  1SKW B;  1HNB A;  2FHE A;  4CDO A;  2C3Q A;  2VD1 A;  4XS6 A;  4FYU A;  11GS A;  4MZB A;  3IXR A;  4KUN A;  1OC9 A;  2N5B A;  1TRW A;  1X5D A;  2AV4 A;  3WT2 A;  3HD5 A;  4WET A;  2WFC A;  2LKU A;  3GKN A;  4NPB A;  12GS A;  5B8B A;  2VUP A;  4XIH A;  2YWI A;  1PX7 A;  1G6W A;  1ZCP A;  2MMO A;  2VD0 A;  2VL2 C;  3IOS A;  1F37 A;  5J9C A;  4E8E A;  4ZXG A;  2CT6 A;  4IVF A;  3E0U A;  3VWV A;  4NV2 A;  2PPT A;  1A2J A;  1HNA A;  2H19 A;  3CSJ A;  1K3Y A;  1WE0 A;  3H93 A;  4JZQ A;  3W8J A;  5AGY A;  1F2E A;  2HLS A;  3MDK A;  2B6M A;  3KGK A;  1XCC A;  1Z7P A;  2IPA A;  1F9M A;  1GUM A;  3KH7 A;  1GL8 A;  5G5F A;  1JZD A;  3UAR A;  3CTF A;  2DJ2 A;  18GS A;  2GDR A;  3VPQ A;  4BWQ A;  3VFI A;  3LXT A;  4JR4 A;  2P0G A;  2YNX A;  4NAX A;  1TKD B;  1LBK A;  1M9B A;  5HFG A;  1DE1 A;  2AUV A;  2XPE A;  3UVH A;  2N5A A;  4KH7 A;  2DJ1 A;  4Z7X A;  4YAV A;  5JCG A;  4YQU A;  3GFK A;  1S3A A;  3F0I A;  4F2I A;  3Q6O A;  5JCU A;  4O32 A;  1QMV A;  2H6X A;  2L5O A;  4ECI A;  4MAB A;  5CRD A;  3C7M A;  3UAP A;  1MDJ A;  5D9X A;  5IM9 A;  5J4U A;  4OWY A;  4P3Y B;  3GH6 A;  2DJK A;  4POB A;  2YWM A;  4X43 A;  3ZRD A;  2A4V A;  1GP1 A;  4TXO B;  2OAC A;  5F06 A;  5ECN B;  4KND A;  3WGE A;  3KMO A;  1M2A A;  4GTU A;  4WBJ A;  1V57 A;  2QC7 A;  3D21 A;  3HVX A;  4JR6 A;  5A4V A;  2ZCT A;  4GSN A;  1A2M A;  1QK8 A;  5DJL A;  2LV3 A;  2ZUP A;  4O7H A;  1M99 A;  4ZIL A;  1GLQ A;  1FW1 A;  4L0W A;  3TKQ A;  5EPF A;  4F03 A;  3BJ5 A;  2DLX A;  2VLU A;  2V2G A;  2HT9 A;  3QR6 A;  2O87 A;  4JRR A;  1K3L A;  2H72 A;  1OC3 A;  1GSD A;  6GSS A;  1O7U A;  4KCE A;  2N5F A;  3LG6 A;  4J2F A;  1NW2 A;  2FLS A;  2RUF A;  3WD6 A;  3JCM L;  2MMA A;  3APO A;  3L0H A;  1M2B A;  3CMI A;  2IFQ A;  3EU4 A;  3KCM A;  2PWJ A;  3WT1 A;  3PH9 A;  4G10 A;  1FB6 A;  2IMI A;  2DJ3 A;  2HZE A;  3IV4 A;  5HR2 A;  4NWY A;  2K8S A;  1GTA A;  3UEM A;  1GRX A;  1WOU A;  3M0F A;  3H1N A;  2CA8 A;  1AQW A;  3F63 A;  1SD9 A;  3QFB C;  1XWK A;  2NBS A;  4ZB9 A;  3FY7 A;  2X64 A;  5AIV A;  2YV9 A;  2Z9S A;  3DXB A;  3WYW A;  4RI7 A;  5ELA A;  2GSQ A;  5FT3 A;  4IQ1 A;  3GSS A;  4OFM A;  1GSU A;  4KSO A;  2RUE A;  1SD8 A;  2C80 A;  3ME8 A;  5KEJ A;  4ILF A;  5ELG A;  3RDW A;  2H6Y A;  3FRC A;  3W6G A;  1O81 A;  1Z7R A;  2HXK A;  2R2J A;  2GSR A;  2LS5 A;  2H73 A;  4EUY A;  2R3X A;  3FZ4 A;  3C71 A;  3SWL A;  5CYY A;  14GS A;  3G7I A;  2MBS A;  3G7Y A;  1N2A A;  3KP8 A;  1J9B A;  1RK4 A;  2CZ3 A;  4IEL A;  4HJ2 A;  4WF4 A;  4O5R A;  3P8W A;  1K0B A;  2E2G A;  1ZGN A;  4PUR A;  1J0F A;  4RI6 A;  2JL4 A;  4Q5N A;  2VLT A;  1Q98 A;  4MPG A;  3IK7 A;  4WR5 A;  1PL1 A;  1EP8 A;  2B1L A;  3HJO A;  5IO0 A;  2YAN A;  3EU3 A;  4K7I A;  3ERG A;  3GNJ A;  2IN3 A;  3TJJ A;  1Z9H A;  4F0C A;  1EEJ A;  3HY2 A;  3EIN A;  3QOU A;  3I9V 2;  4Q5F A;  1HQO A;  4DSR A;  4GRF A;  3TKR A;  3L9U A;  1W4V A;  2KUC A;  2BJX A;  1GSE A;  1EOH A;  3NZN A;  3GV1 A;  5CNW A;  3APQ A;  1X9W B;  1G7E A;  2YZU A;  4ECB A;  2B7J A;  1I5G A;  2VL9 A;  1K0C A;  4D73 A;  4MJE A;  1S3D A;  5GZZ B;  3GYK A;  3TRP A;  1Z3E A;  2KHP A;  1TTZ A;  1X9S B;  3GTU A;  4TOP A;  3GKX A;  4XS4 A;  1EZK A;  4PUF C;  4J56 E;  2EC4 A;  1QGV A;  3IR4 A;  3N5O A;  1K3O A;  1UN2 A;  2ON7 A;  1TK8 B;  2TRC P;  4PX1 A;  3IA1 A;  2OBK A;  17GS A;  3RPP A;  5DAL A;  4K6X A;  4I97 A;  4PXO A;  2O89 A;  3M9K A;  2GGT A;  4ZB6 A;  4HS1 A;  1JZO A;  4YAP A;  5DBQ A;  3A2V A;  1FVK A;  4F0B A;  3LJR A;  13GS A;  3ZVJ A;  3LYK A;  2IIY A;  4HQS A;  4ZL9 A;  4MDC A;  5A4W A;  2FA4 A;  2VCQ A;  3GH9 A;  4CHS A;  2J9H A;  1Y25 A;  5ECQ B;  2CZ2 A;  4PNF A;  1GLP A;  3H79 A;  4WKW A;  2ALB A;  5JCW A;  1PMT A;  2YZH A;  3OR5 A;  2GQK A;  4HZ2 A;  5KN2 A;  3QCP A;  3DVW A;  1RQM A;  1T1V A;  2DMM A;  2F8F A;  2LQO A;  4HOJ A;  3G7J A;  2K8V A;  2GQM A;  2JZS A;  4FIW A;  1KBN A;  10GS A;  1ERV A;  1LJR A;  2GSS A;  1BX9 A;  3CSI A;  3SBC A;  1OE7 A;  2LJR A;  1EP7 A;  4NHZ A;  4NXI A;  3ZIV A;  2VOC A;  5GSS A;  3CBU A;  3FW2 A;  2FNO A;  3I43 A;  4DVC A;  4KA0 A;  3A5W A;  4G19 A;  3PGT A;  2HYX A;  3P7X A;  3UIW A;  1QUW A;  2V32 A;  5DAL B;  4KCA A;  4CW9 A;  3HJM A;  3RHB A;  3BD2 A;  4TR3 A;  1LU4 A;  5CRG A;  3D0Z A;  3E9J B;  3TKS E;  1EOG A;  3F8U A;  1AIU A; 
#chains in the Genus database with same CATH topology
 3TKS C;  3GN3 A;  4POL A;  2KOK A;  3KIJ A;  2QA2 A;  3KTB A;  3FYG A;  22GS A;  1F3B A;  2NPB A;  4IW9 A;  3Q18 A;  3TUE A;  1YF1 A;  4TR4 A;  3D22 A;  1AW9 A;  5FHI A;  3BCK A;  3QD9 A;  3F4R A;  2KP1 A;  4N0Z A;  3APS A;  2DSA A;  3TCO A;  4KSM A;  4MK3 A;  5BRT A;  3QAW A;  2C0E A;  5ABR A;  1USB A;  3FHK A;  1PQN A;  3LOR A;  1AXD A;  3L9S A;  3ED3 A;  2CX4 A;  2PN8 A;  1T3B A;  3P2A A;  1ZYN A;  3IK9 A;  3LQ7 A;  1DBY A;  2FA8 A;  1XW5 A;  2H0H A;  3VI7 A;  4HI7 A;  2FWE A;  4PQH A;  4LL4 B;  2OBI A;  6GSV A;  5HFK A;  2I81 A;  2H30 A;  5CRH A;  2H70 A;  1SK0 A;  5DDL A;  1SEN A;  3HVS A;  3J7Y b;  2FWG A;  1Q4J A;  1XFL A;  3ZTL A;  4TVE A;  1A2L A;  1S3C A;  1OYJ A;  4NV5 A;  4RQX A;  4K5S A;  2AB6 A;  4K7O A;  4KDY A;  3LSZ A;  5ECO B;  1A8L A;  3L78 A;  5CAX A;  3QAV A;  3CRT A;  4ML6 A;  5B7C A;  1M3J A;  3TJG A;  1GH2 A;  1ACV A;  5KOX A;  1NSW A;  3ZLP A;  2L6C A;  4YQV A;  5C00 A;  6GSX A;  5C04 A;  2DIZ A;  1EV9 A;  1R4W A;  4EIQ A;  3FZ5 A;  3GA4 A;  1OKD A;  2B3S A;  3LGC A;  3ZIJ A;  1YZX A;  4WF5 A;  1YKC A;  3KMN A;  2HSH A;  1BAY A;  1VGL A;  4FQU A;  4KGI A;  3BOA A;  4Q5Q A;  1T8E B;  4TR0 A;  3U6V A;  2GQL A;  1OC9 B;  4JED A;  4G2E A;  1XWC A;  1YEX A;  4N30 A;  4I6X A;  5DCG A;  4K9Z A;  4MPF A;  1SL0 B;  2H0I A;  1ERU A;  1MEK A;  5IMZ A;  1WMJ A;  4J57 E;  1O6J A;  1H75 A;  5A5K A;  2B1K A;  3IAS 2;  2OKA A;  2NDO A;  4YH2 A;  5ID2 A;  3IHQ A;  4XHM A;  4GWR A;  4Z2U A;  2GZY A;  5DQS A;  2FD3 A;  5IMD A;  1GNW A;  1YDK A;  4MP4 A;  1TI1 A;  3HHV A;  1EV4 A;  1V2A A;  1VF3 A;  1GSY A;  4OFT A;  1EGO A;  5CRW A;  1URM A;  4ID0 A;  2GT6 A;  3DYR A;  3US3 A;  1YQ1 A;  3ME7 A;  3ZL5 A;  3KD0 A;  3HZ8 A;  4TR1 A;  2JAD A;  5ENU A;  4OFN A;  2VM2 A;  3GUR A;  1EWX A;  1ERW A;  4MJA A;  4POM A;  4KB3 A;  2I3Y A;  4QQ7 A;  4MJB A;  4FYB A;  4OO5 A;  5HR1 A;  2VCW A;  2X99 A;  3ZRE A;  2H76 A;  2GS3 A;  3TJK A;  4RUV A;  2WUL A;  4I5Q A;  4I2T A;  4N0V A;  4MA9 A;  2V6O A;  1JFU A;  3GRX A;  1PA3 A;  2LEG A;  1X5C A;  2GTU A;  2C0G A;  5DQY A;  1A23 A;  4G0L A;  4DSQ A;  4BIK A;  1THO A;  5IMV A;  2HNL A;  4V2N A;  3W8S A;  3QDN A;  2DC5 A;  5HR0 A;  5GAP D;  4OD7 A;  1FVJ A;  4GXZ A;  2R6K A;  5LCZ A;  3F3Q A;  2MMZ A;  3Q19 A;  4EL1 A;  5ECK B;  3F4T A;  2ES7 A;  3LXZ A;  2WGR A;  3O6T A;  4LL1 B;  3IRA A;  2YWN A;  2CQ9 A;  1GWC A;  1WIK A;  4HQZ A;  3ZYW A;  4V1A p;  9GSS A;  1CQG A;  1G6Y A;  5LD0 A;  3KH9 A;  5ECL B;  1KNG A;  2IME A;  3PIN A;  3M8N A;  2HSM A;  2F3M A;  3TOT A;  2C0F A;  2B5E A;  1TU7 A;  1XBS A;  2KP2 A;  4BVX A;  3MIX A;  2A2P A;  3CXG A;  1BJX A;  1R7H A;  5D73 A;  5J9B A;  5ECI B;  3VWW A;  2DKI A;  2FY6 A;  1TRV A;  1M0U A;  2K18 A;  4AJ8 A;  3WGX A;  1FOV A;  5E4W A;  2E0Q A;  1AQV A;  3O76 A;  1BQ7 A;  4EVM A;  1FHE A;  2IFQ B;  3DWV A;  4ICY A;  3HDC A;  3G9B A;  4HJM A;  4OMV A;  3FZA A;  1T7P B;  3M1G A;  3FMW A;  3KJY A;  4GQF A;  1O73 A;  2AHE A;  1S3R A;  3A3T A;  2HZE B;  2OAD A;  3IC4 A;  4EO3 A;  2R0C A;  1WJK A;  2WRT A;  4N10 A;  5D8I A;  2H71 A;  4V1A g;  5JWR B;  2JZR A;  4WBR D;  2J23 A;  1XVW A;  3ZMK A;  1ZOF A;  4I8B A;  4EDY A;  1TXX A;  4LMW A;  3D4M A;  2CVD A;  4MF5 A;  5D9W A;  2IJY A;  2R5G A;  5G2Z A;  2V6K A;  4AGS A;  2OJL A;  2FWF A;  3F6F A;  1UA5 A;  1ABA A;  2PGT A;  3D6I A;  2X8G A;  2I9H A;  2PBJ A;  1TI3 A;  3EUR A;  1OC8 A;  4ULX A;  2OE1 A;  2I4A A;  1IYH A;  1JLW A;  1YJ6 A;  4EC0 A;  4IJI A;  1JLV A;  2D2Z A;  4L0U A;  1AUC A;  4FH8 A;  5GAN D;  3CYN A;  2QKE A;  2V1M A;  2M72 A;  1PFO A;  2NVL A;  1GUK A;  2REM A;  2PVQ A;  5ECR B;  5F0G A;  1K0M A;  2CAI A;  5IPG A;  5DVB A;  2YV7 A;  2LNS A;  1F6M C;  2RM6 A;  2VAF A;  4QL9 A;  5ECS A;  1TDI A;  5LNK e;  2VL2 A;  3IBH A;  1GSQ A;  1VRS D;  2KLX A;  2L59 A;  4WR4 A;  1OKT A;  1XZO A;  5G30 A;  2VIM A;  5F05 A;  2L6D A;  2JU5 A;  4IJ3 A;  4WXT A;  1XWB A;  2K6V A;  2YJ7 A;  5HQP A;  3FR9 A;  1U87 A;  5DCH A;  4BVY A;  2JSY A;  2R0G A;  4MZW A;  2OE3 A;  2C3T A;  2H75 A;  2L4Q A;  4I2U A;  2P5Q A;  3IDV A;  2YJH A;  3P90 A;  3VLN A;  3L9V A;  2EIR A;  2GZZ A;  3O3T A;  2XC2 A;  1BYE A;  2LTK A;  3L4N A;  4E8H A;  2H6Z A;  5ECP B;  5H5R A;  1XOA A;  2X8C A;  1EEM A;  1T4Y A;  2EIQ A;  3CRU A;  4D73 B;  5AIX A;  3FR3 A;  2LQQ A;  3ZVJ D;  3F6D A;  3UVT A;  3GX8 A;  3C1S A;  2EIO A;  1O8W A;  4RQR A;  3GTU B;  2PVO C;  4XRD A;  3H8Q A;  1FAA A;  1SYX A;  4XS4 B;  1XXU A;  3F9U A;  1G7O A;  5J3R A;  3F3R A;  5D93 A;  1K0D A;  1TOF A;  1NHY A;  2L5L A;  4EXJ A;  3GMF A;  2G2Q A;  5CO3 A;  1YEP A;  5IOW A;  1A8Y A;  2R37 A;  2X8H A;  3UOM A;  3V1W A;  1KEB A;  4H86 A;  4NMU A;  1U3I A;  4JU5 A;  3GUS A;  1T00 A;  2GLR A;  3MAK A;  5ECH B;  6GSU A;  4HU7 A;  1GTB A;  4OO4 A;  2CVB A;  3FZ9 A;  1PL2 A;  3LYP A;  4PQI A;  4XTS A;  5EY6 A;  1B4P A;  5H5Q A;  5D9T A;  4KX4 A;  5F8B A;  2G0F A;  6GSW A;  4ZBD A;  3UMA A;  3DRN A;  5D96 A;  2DJJ A;  2LRN A;  7GSS A;  1TRS A;  2C1Y A;  2FUG 2;  3TKP A;  4K0N A;  1N8J A;  1GTI A;  1SJZ A;  2LJK A;  3J7Y k;  4LA1 A;  3UBL A;  3UBK A;  5B6M A;  2JSZ A;  3K8N A;  4MF6 A;  2YPM A;  2O8V B;  4F9Z A;  1MTC A;  3IPZ A;  2F51 A;  1MDI A;  1WP0 A;  4Z2T A;  4IBP A;  3HVV A;  4X0X A;  2RM5 A;  3ERF A;  3C1R A;  1OE8 A;  4KE3 A;  1TW9 A;  2E7P A;  2ON5 A;  5KOW A;  1MDK A;  1Z6M A;  3QFA C;  4ZBB A;  3IE3 A;  3ZZX A;  4A5P A;  2UZ8 A;  3A2X A;  4BWS A;  1ZYE A;  3EC3 A;  3FEU A;  5EVO A;  1O8X A;  5IOX A;  2CX3 A;  3GL3 A;  4N11 A;  1R5A A;  1VF2 A;  4BA7 A;  4GLT A;  1ON4 A;  5D9V A;  1AC1 A;  2PUK C;  2VO4 A;  2C8U A;  1PKZ A;  3MNG A;  1ML6 A;  3HXS A;  2L57 A;  1NHO A;  1IYI A;  3GHA A;  2OA7 A;  3RHC A;  1A0F A;  4L8E A;  3S9F A;  2DML A;  3NIV A;  4TXO A;  2YOI A;  1O85 A;  4X1U A;  2AAW A;  5CRE A;  2IMK A;  3D5J A;  1XW9 A;  2H74 A;  4EDZ A;  3VI5 A;  1XWA A;  3F4S A;  1KTE A;  1VF4 A;  3EWL A;  1THX A;  4IQA A;  1U6T A;  4K1F A;  2H1B A;  3DML A;  4FYC A;  2A2S A;  4IP1 A;  1FO5 A;  1OVN A;  5G5E A;  3KP9 A;  3EVI A;  1XOB A;  3M3M A;  2C0D A;  4XRA A;  4G9H A;  2MYG A;  3TJB A;  5FWG A;  4IHU A;  1WPI A;  2GVP A;  1ZL9 A;  4EE0 A;  1V98 A;  5DAK A;  4GCI A;  2C4J A;  2LUS A;  1K0O A;  2FGX A;  4K2X A;  1DSB A;  4V2L A;  3RBT A;  2RII A;  2DJ0 A;  1AAZ A;  3EYT A;  1W89 A;  5COH A;  2MBT A;  5HR3 A;  4ECJ A;  2JAC A;  2BMX A;  3FR6 A;  5B6N A;  4DSS A;  2F9S A;  4BL7 A;  2B5X A;  1R26 A;  1ZZY A;  1TRU A;  4AF2 A;  4K5R A;  1GSF A;  1SYR A;  3KZQ A;  1B8X A;  4OCF A;  1J08 A;  1YKA A;  4PUA A;  5DJM A;  2TIR A;  5JWQ B;  2NTO A;  4K0G A;  4OCE A;  2AJQ B;  1SK1 A;  4KF9 A;  2XBQ A;  1CQH A;  2R4V A;  3CQF A;  2RLI A;  3FKF A;  1VF1 A;  2OE0 A;  1A24 A;  3TDG A;  4LMV A;  1WWJ A;  2YWO A;  1SU9 A;  5KN1 A;  3GX0 A;  2O7K A;  3FK8 A;  4ACS A;  1PSQ A;  3DVX A;  3BCI A;  1EGR A;  2YCD A;  3CSH A;  2IMD A;  1DUG A;  1BG5 A;  1H4O A;  4GF0 A;  3DD3 A;  1PD2 1;  3TB2 A;  5ECM B;  1TK5 B;  5GST A;  3LFL A;  2K9F A;  2LST A;  2QA1 A;  3VUR A;  5H5S A;  3LWA A;  2FWH A;  3DIE A;  5J41 A;  2VCZ A;  1QXH A;  4JBB A;  4HEA 2;  3IC8 A;  4ZL8 A;  1B4Q A;  2DBC A;  4TKY A;  4AJ7 A;  1U88 A;  2H8L A;  4POK A;  1T4Z A;  1XWG A;  3C8E A;  5DAK B;  1B9X C;  3N9J A;  1Y6E A;  3I6A A;  3MWH A;  1V58 A;  2DIY A;  4PNG A;  16GS A;  2VLV A;  2CVK A;  1FB0 A;  4KDX A;  3A5I A;  1ERT A;  2H0G A;  1JHB A;  1SJ6 A;  4L5O A;  1X9M B;  4GQC A;  4EIP A;  3BBY A;  4DSS B;  5L71 A;  2LJA A;  5ID2 B;  4KAE A;  1MD3 A;  1C72 A;  4AJ6 A;  4NHW A;  4GST A;  5AIS A;  2HI7 A;  4L5L A;  1Z5Y E;  1ST9 A;  4WEY A;  1NM3 A;  3D4T A;  1M2D A;  4MH2 A;  4MJC A;  3M9J A;  1Z6N A;  5KN0 A;  1UC7 A;  4F82 A;  4TR1 B;  3GST A;  1ILO A;  5G1L A;  2H1A A;  3QAG A;  2VCV A;  4MMM A;  4IGJ A;  1F3A A;  1PGT A;  2YP6 A;  5EL8 A;  5IMC A;  4ZIJ A;  1X5E A;  4TW5 A;  1PX6 A;  2H66 A;  5E59 A;  1YF0 A;  4K2D A;  3ERW A;  3GIX A;  4IP6 A;  4ZB8 A;  5IIZ A;  5J5N A;  1XG8 A;  1QQ2 A;  2WB9 A;  2WZ9 A;  4TXV A;  4ML1 A;  1HNC A;  3NOF A;  5IO2 A;  4PQ1 A;  1XPV A;  1TJD A;  3TGZ A;  8GSS A;  2P31 A;  3A2W A;  1GSS A;  4YKF A;  2LRT A;  5IMF A;  3TKS A;  4XS1 A;  3VWU A;  2C3N A;  2VL3 A;  1PKW A;  2HRF A;  2HSY A;  3Q74 A;  3HYP A;  1K0N A;  4ECC A;  3GKK A;  1GUL A;  1PRX A;  4LLR A;  1U3A A;  3HCZ A;  2IL3 A;  2HRN A;  2I1U A;  4MF7 A;  4TRX A;  2H1D A;  4Q5R A;  5IQY A;  2F8A A;  2O85 A;  1ZYQ B;  1GTU A;  3EMX A;  3H4K A;  4K8M A;  2QGV A;  2BTO T;  2X4A A;  4KDU A;  1G0T A;  2H01 A;  2WS2 A;  3EE2 A;  6GST A;  1SJI A;  1K0A A;  3UL3 A;  1SKS B;  1YY7 A;  3HJP A;  4IKH A;  3AY8 A;  4IS0 A;  1GNE A;  4DEJ A;  2A4H A;  3HZ4 A;  1QFN A;  1B9Y C;  3R3E A;  2AYT A;  4IN0 A;  1ZMA A;  3R2Q A;  2IMF A;  4BVX B;  3ZML A;  1AQX A;  4PGT A;  2HZF A;  2WJU A;  3ISO A;  2HFD A;  3UJ1 A;  2MMN A;  1XVQ A;  3TRQ A;  4MH3 A;  2VCX A;  2HRK A;  2FCH A;  4EF0 A;  1E2Y A;  1JZW A;  1FG4 A;  3DEX A;  5F07 A;  5A4U A;  3ZIT A;  2HE3 A;  1TP9 A;  3ZFL A;  5G31 A;  3RPN A;  3DKS A;  1OAZ A;  5IPH A;  1GUH A;  1X0R A;  4MLY A;  2XPD A;  5IMA A;  3KEB A;  2H1G A;  5KN3 A;  4V2M A;  3KTL A;  3KXO A;  2GT5 A;  3TJF A;  2GST A;  3WGD A;  3U5R E;  2MZC A;  5B8A A;  1I9D A;  2VCT A;  4TN8 A;  4K7N A;  4QL7 A;  1V9W A;  3E3E A;  1MD4 A;  6GSY A;  1WRY A;  1SL1 B;  3MSZ A;  3QPM A;  4HDE A;  2LRC A;  3PR8 A;  2ZNM A;  1BED A;  3HKR A;  19GS A;  1RW1 A;  2B7K A;  3VK9 A;  4HZ4 A;  3QMX A;  2CAQ A;  5CP1 A;  4FO5 A;  3IAM 2;  4G0K A;  2P5R A;  1DE2 A;  3C73 A;  1TU8 A;  1SL2 B;  1XIY A;  1M3I A;  2V41 A;  5INY A;  1PN9 A;  4XCS A;  5G1K A;  1UVZ A;  2WCI A;  2IWT A;  3RAZ A;  1TK0 B;  1A0R P;  3HA9 A;  1HD2 A;  4BPY A;  4GSS A;  5AN1 A;  1V40 A;  2PER A;  2QSI A;  2JZT A;  3DGQ A;  4MZC A;  20GS A;  3TOU A;  3ZFB A;  4JE1 A;  3TRX A;  3EMP A;  2B5Y A;  5HFI A;  5JWO B;  1SKR B;  1M9A A;  2E2M A;  4MCU A;  2PU9 C;  4ISD A;  3CTG A;  1HYU A;  1SK2 A;  3GL5 A;  3GKM A;  3KM6 A;  1E6B A;  3I69 A;  2A2R A;  4HSC X;  4BVY B;  1JZR A;  4O92 A;  1R5P A;  2L4C A;  2LNT A;  2CV4 A;  2M46 A;  2VM1 A;  2PMT A;  1XW6 A;  4YQM A;  5BMU A;  4KW6 A;  1M7T A;  2M80 A;  3PPU A;  2GZP A;  3VPT A;  2YN1 A;  4HUA A;  2XBI A;  4ZBA A;  2XHF A;  3VWX A;  4ZL7 A;  4HU9 A;  1B48 A;  3LEF A;  2WDU A;  4EKZ A;  2TRX A;  1SKW B;  1HNB A;  2FHE A;  4CDO A;  2C3Q A;  2VD1 A;  4XS6 A;  4FYU A;  11GS A;  4MZB A;  3IXR A;  4KUN A;  1OC9 A;  2N5B A;  1TRW A;  1X5D A;  2AV4 A;  3WT2 A;  3HD5 A;  4WET A;  2WFC A;  2LKU A;  3GKN A;  4NPB A;  4YKG A;  12GS A;  5B8B A;  2VUP A;  1ZYP A;  4XIH A;  2YWI A;  1PX7 A;  1G6W A;  1ZCP A;  2MMO A;  2VD0 A;  2VL2 C;  3IOS A;  1F37 A;  5J9C A;  4E8E A;  4ZXG A;  2CT6 A;  4IVF A;  3E0U A;  3VWV A;  4NV2 A;  2PPT A;  1A2J A;  1HNA A;  2H19 A;  3CSJ A;  1K3Y A;  1WE0 A;  3H93 A;  4JZQ A;  3W8J A;  5AGY A;  1F2E A;  2HLS A;  3MDK A;  2B6M A;  3KGK A;  1XCC A;  1Z7P A;  2IPA A;  1F9M A;  1GUM A;  3KH7 A;  1GL8 A;  5G5F A;  1JZD A;  3UAR A;  3CTF A;  2DJ2 A;  18GS A;  2GDR A;  3VPQ A;  4BWQ A;  3VFI A;  3LXT A;  4JR4 A;  2P0G A;  2R0P A;  4O5Q A;  2YNX A;  4NAX A;  1TKD B;  1LBK A;  1M9B A;  3LW9 A;  5HFG A;  1DE1 A;  2AUV A;  2XPE A;  3UVH A;  2N5A A;  4MNN A;  4KH7 A;  2DJ1 A;  4Z7X A;  4YAV A;  5JCG A;  4YQU A;  3GFK A;  1S3A A;  3F0I A;  4F2I A;  3Q6O A;  5JCU A;  4O32 A;  1QMV A;  2H6X A;  2L5O A;  4ECI A;  4MAB A;  5CRD A;  3C7M A;  3UAP A;  1MDJ A;  5D9X A;  5IM9 A;  5J4U A;  4OWY A;  4P3Y B;  3GH6 A;  2DJK A;  4CY8 A;  4POB A;  2YWM A;  4X43 A;  3ZRD A;  2A4V A;  1GP1 A;  4TXO B;  2OAC A;  5F06 A;  5ECN B;  4KND A;  3WGE A;  3KMO A;  1M2A A;  4GTU A;  4WBJ A;  1V57 A;  2QC7 A;  3D21 A;  3HVX A;  2HRA A;  4JR6 A;  5A4V A;  1FOH A;  2ZCT A;  4GSN A;  1A2M A;  1QK8 A;  5DJL A;  2LV3 A;  2ZUP A;  4O7H A;  1M99 A;  4ZIL A;  1GLQ A;  1FW1 A;  4L0W A;  3TKQ A;  5EPF A;  4F03 A;  3EPT A;  3BJ5 A;  2DLX A;  2VLU A;  2V2G A;  2HT9 A;  3QR6 A;  2O87 A;  4JRR A;  1K3L A;  2H72 A;  1OC3 A;  1GSD A;  6GSS A;  1O7U A;  4KCE A;  2N5F A;  3LG6 A;  4J2F A;  1NW2 A;  2FLS A;  2RUF A;  3WD6 A;  3JCM L;  2MMA A;  4G0I A;  3APO A;  3L0H A;  1M2B A;  3CMI A;  2IFQ A;  3EU4 A;  3KCM A;  4CY6 A;  2PWJ A;  3WT1 A;  3PH9 A;  4G10 A;  1FB6 A;  2IMI A;  2DJ3 A;  2HZE A;  3IV4 A;  5HR2 A;  4NWY A;  2K8S A;  1GTA A;  3UEM A;  1GRX A;  1WOU A;  4BL7 B;  3MYD A;  3M0F A;  3H1N A;  2CA8 A;  1AQW A;  3F63 A;  1SD9 A;  3QFB C;  1XWK A;  2NBS A;  4ZB9 A;  3FY7 A;  2X64 A;  5AIV A;  2YV9 A;  2Z9S A;  3DXB A;  3WYW A;  4RI7 A;  5ELA A;  2GSQ A;  5FT3 A;  4IQ1 A;  3GSS A;  4OFM A;  1GSU A;  4KSO A;  2RUE A;  1SD8 A;  2C80 A;  3ME8 A;  5KEJ A;  4ILF A;  5ELG A;  3RDW A;  2H6Y A;  3FRC A;  3W6G A;  1O81 A;  1Z7R A;  2HXK A;  2R2J A;  2GSR A;  4PTS A;  2LS5 A;  2H73 A;  4EUY A;  2R3X A;  3FZ4 A;  3C71 A;  3SWL A;  5CYY A;  14GS A;  3G7I A;  2MBS A;  3G7Y A;  1N2A A;  3KP8 A;  1J9B A;  1RK4 A;  2CZ3 A;  4IEL A;  2DKH A;  4HJ2 A;  4WF4 A;  4O5R A;  3P8W A;  1K0B A;  2E2G A;  1ZGN A;  4PUR A;  1J0F A;  4RI6 A;  2JL4 A;  4Q5N A;  2VLT A;  1Q98 A;  4MPG A;  3IHG A;  3IK7 A;  4WR5 A;  1PL1 A;  1EP8 A;  2B1L A;  3HJO A;  5IO0 A;  2YAN A;  3EU3 A;  4K7I A;  3ERG A;  3GNJ A;  2IN3 A;  3TJJ A;  1Z9H A;  4F0C A;  1EEJ A;  3HY2 A;  3EIN A;  3QOU A;  3I9V 2;  4Q5F A;  1HQO A;  4DSR A;  4GRF A;  3TKR A;  3L9U A;  1W4V A;  2KUC A;  2BJX A;  1GSE A;  1EOH A;  3NZN A;  3GV1 A;  5CNW A;  3APQ A;  1X9W B;  1G7E A;  2YZU A;  4ECB A;  2B7J A;  1I5G A;  2VL9 A;  1K0C A;  4D73 A;  4MJE A;  1S3D A;  5GZZ B;  3GYK A;  3TRP A;  1Z3E A;  2KHP A;  1TTZ A;  1X9S B;  3GTU A;  4TOP A;  3GKX A;  4XS4 A;  1EZK A;  4PUF C;  4J56 E;  2EC4 A;  1QGV A;  3IR4 A;  2X49 A;  1K3O A;  3N5O A;  1UN2 A;  2ON7 A;  1TK8 B;  2TRC P;  4PX1 A;  3IA1 A;  2OBK A;  17GS A;  3RPP A;  5DAL A;  4K6X A;  4I97 A;  4PXO A;  2O89 A;  3M9K A;  2GGT A;  4ZB6 A;  4HS1 A;  1JZO A;  3HVN A;  4USS A;  4YAP A;  5DBQ A;  3A2V A;  1FVK A;  4F0B A;  3LJR A;  13GS A;  3ZVJ A;  3LYK A;  2IIY A;  4HQS A;  4ZL9 A;  4MDC A;  5A4W A;  2FA4 A;  4O5U A;  2VCQ A;  3GH9 A;  4CHS A;  2J9H A;  1Y25 A;  5ECQ B;  2CZ2 A;  4PNF A;  1GLP A;  3H79 A;  4WKW A;  2ALB A;  5JCW A;  1PMT A;  2YZH A;  3OR5 A;  2GQK A;  4HZ2 A;  5KN2 A;  3QCP A;  3DVW A;  1RQM A;  1T1V A;  2DMM A;  2F8F A;  2LQO A;  4HOJ A;  3G7J A;  2K8V A;  2GQM A;  2JZS A;  4FIW A;  1KBN A;  10GS A;  1ERV A;  4Z2R A;  1LJR A;  2GSS A;  1BX9 A;  3CSI A;  3SBC A;  1OE7 A;  2LJR A;  1EP7 A;  4NHZ A;  4NXI A;  3ZIV A;  2VOC A;  5GSS A;  3CBU A;  3FW2 A;  2FNO A;  3I43 A;  4DVC A;  4KA0 A;  3A5W A;  4G19 A;  4X4J A;  3PGT A;  2HYX A;  3P7X A;  3UIW A;  1QUW A;  2V32 A;  5DAL B;  4KCA A;  4CW9 A;  3HJM A;  3RHB A;  3BD2 A;  4TR3 A;  1LU4 A;  5CRG A;  3D0Z A;  1PN0 A;  3E9J B;  3TKS E;  1EOG A;  3F8U A;  1AIU A; 
#chains in the Genus database with same CATH homology
 3TKS C;  3GN3 A;  4POL A;  2KOK A;  3KIJ A;  2QA2 A;  3KTB A;  3FYG A;  22GS A;  1F3B A;  2NPB A;  4IW9 A;  3Q18 A;  3TUE A;  1YF1 A;  4TR4 A;  3D22 A;  1AW9 A;  5FHI A;  3BCK A;  3QD9 A;  3F4R A;  2KP1 A;  4N0Z A;  3APS A;  2DSA A;  3TCO A;  4KSM A;  4MK3 A;  5BRT A;  3QAW A;  2C0E A;  5ABR A;  1USB A;  3FHK A;  1PQN A;  3LOR A;  1AXD A;  3L9S A;  3ED3 A;  2CX4 A;  2PN8 A;  1T3B A;  3P2A A;  1ZYN A;  3IK9 A;  3LQ7 A;  1DBY A;  2FA8 A;  1XW5 A;  2H0H A;  3VI7 A;  4HI7 A;  2FWE A;  4PQH A;  4LL4 B;  2OBI A;  6GSV A;  5HFK A;  2I81 A;  2H30 A;  5CRH A;  2H70 A;  1SK0 A;  5DDL A;  1SEN A;  3HVS A;  3J7Y b;  2FWG A;  1Q4J A;  1XFL A;  3ZTL A;  4TVE A;  1A2L A;  1S3C A;  1OYJ A;  4NV5 A;  4RQX A;  4K5S A;  2AB6 A;  4K7O A;  4KDY A;  3LSZ A;  5ECO B;  1A8L A;  3L78 A;  5CAX A;  3QAV A;  3CRT A;  4ML6 A;  5B7C A;  3TJG A;  1GH2 A;  1ACV A;  5KOX A;  1NSW A;  3ZLP A;  2L6C A;  4YQV A;  5C00 A;  6GSX A;  5C04 A;  2DIZ A;  1EV9 A;  1R4W A;  4EIQ A;  3FZ5 A;  3GA4 A;  1OKD A;  2B3S A;  3LGC A;  3ZIJ A;  1YZX A;  4WF5 A;  1YKC A;  3KMN A;  2HSH A;  1BAY A;  1VGL A;  4FQU A;  4KGI A;  3BOA A;  4Q5Q A;  1T8E B;  4TR0 A;  3U6V A;  2GQL A;  1OC9 B;  4JED A;  4G2E A;  1XWC A;  1YEX A;  4N30 A;  4I6X A;  5DCG A;  4K9Z A;  4MPF A;  1SL0 B;  2H0I A;  1ERU A;  1MEK A;  5IMZ A;  1WMJ A;  4J57 E;  1O6J A;  1H75 A;  5A5K A;  2B1K A;  3IAS 2;  2OKA A;  2NDO A;  4YH2 A;  5ID2 A;  3IHQ A;  4XHM A;  4GWR A;  4Z2U A;  2GZY A;  5DQS A;  2FD3 A;  5IMD A;  1GNW A;  1YDK A;  4MP4 A;  1TI1 A;  3HHV A;  1EV4 A;  1V2A A;  1VF3 A;  1GSY A;  4OFT A;  1EGO A;  5CRW A;  1URM A;  4ID0 A;  2GT6 A;  3DYR A;  3US3 A;  1YQ1 A;  3ME7 A;  3ZL5 A;  3KD0 A;  3HZ8 A;  4TR1 A;  2JAD A;  5ENU A;  4OFN A;  2VM2 A;  3GUR A;  1EWX A;  1ERW A;  4MJA A;  4POM A;  4KB3 A;  2I3Y A;  4QQ7 A;  4MJB A;  4FYB A;  4OO5 A;  5HR1 A;  2VCW A;  2X99 A;  3ZRE A;  2H76 A;  2GS3 A;  3TJK A;  4RUV A;  2WUL A;  4I5Q A;  4I2T A;  4N0V A;  4MA9 A;  2V6O A;  1JFU A;  3GRX A;  1PA3 A;  2LEG A;  1X5C A;  2GTU A;  2C0G A;  5DQY A;  1A23 A;  4G0L A;  4DSQ A;  1THO A;  5IMV A;  2HNL A;  4V2N A;  3W8S A;  3QDN A;  2DC5 A;  5HR0 A;  5GAP D;  4OD7 A;  1FVJ A;  4GXZ A;  2R6K A;  5LCZ A;  3F3Q A;  2MMZ A;  3Q19 A;  4EL1 A;  5ECK B;  3F4T A;  2ES7 A;  3LXZ A;  2WGR A;  3O6T A;  4LL1 B;  3IRA A;  2YWN A;  2CQ9 A;  1GWC A;  1WIK A;  4HQZ A;  3ZYW A;  4V1A p;  9GSS A;  1CQG A;  1G6Y A;  5LD0 A;  3KH9 A;  5ECL B;  1KNG A;  2IME A;  3PIN A;  3M8N A;  2HSM A;  2F3M A;  3TOT A;  2C0F A;  2B5E A;  1TU7 A;  1XBS A;  2KP2 A;  4BVX A;  3MIX A;  2A2P A;  3CXG A;  1BJX A;  1R7H A;  5D73 A;  5J9B A;  5ECI B;  3VWW A;  2DKI A;  2FY6 A;  1TRV A;  1M0U A;  2K18 A;  4AJ8 A;  3WGX A;  1FOV A;  5E4W A;  2E0Q A;  1AQV A;  3O76 A;  1BQ7 A;  4EVM A;  1FHE A;  2IFQ B;  3DWV A;  4ICY A;  3HDC A;  3G9B A;  4HJM A;  4OMV A;  3FZA A;  1T7P B;  3M1G A;  3FMW A;  3KJY A;  4GQF A;  1O73 A;  2AHE A;  3A3T A;  2HZE B;  2OAD A;  3IC4 A;  4EO3 A;  2R0C A;  1WJK A;  2WRT A;  4N10 A;  5D8I A;  2H71 A;  4V1A g;  5JWR B;  2JZR A;  4WBR D;  2J23 A;  1XVW A;  3ZMK A;  1ZOF A;  4I8B A;  4EDY A;  1TXX A;  4LMW A;  3D4M A;  2CVD A;  4MF5 A;  5D9W A;  2IJY A;  2R5G A;  5G2Z A;  2V6K A;  4AGS A;  2OJL A;  2FWF A;  3F6F A;  1UA5 A;  1ABA A;  2PGT A;  3D6I A;  2X8G A;  2I9H A;  2PBJ A;  1TI3 A;  3EUR A;  1OC8 A;  4ULX A;  2OE1 A;  2I4A A;  1IYH A;  1JLW A;  1YJ6 A;  4EC0 A;  4IJI A;  1JLV A;  2D2Z A;  4L0U A;  1AUC A;  4FH8 A;  5GAN D;  3CYN A;  2QKE A;  2V1M A;  2M72 A;  2NVL A;  1GUK A;  2REM A;  2PVQ A;  5ECR B;  5F0G A;  1K0M A;  2CAI A;  5IPG A;  5DVB A;  2YV7 A;  2LNS A;  1F6M C;  2RM6 A;  2VAF A;  4QL9 A;  5ECS A;  1TDI A;  5LNK e;  2VL2 A;  3IBH A;  1GSQ A;  1VRS D;  2KLX A;  2L59 A;  4WR4 A;  1OKT A;  1XZO A;  5G30 A;  2VIM A;  5F05 A;  2L6D A;  2JU5 A;  4IJ3 A;  4WXT A;  1XWB A;  2K6V A;  2YJ7 A;  5HQP A;  3FR9 A;  1U87 A;  5DCH A;  4BVY A;  2JSY A;  2R0G A;  4MZW A;  2OE3 A;  2C3T A;  2H75 A;  2L4Q A;  4I2U A;  2P5Q A;  3IDV A;  2YJH A;  3P90 A;  3VLN A;  3L9V A;  2EIR A;  2GZZ A;  3O3T A;  2XC2 A;  1BYE A;  2LTK A;  3L4N A;  4E8H A;  2H6Z A;  5ECP B;  5H5R A;  1XOA A;  2X8C A;  1EEM A;  1T4Y A;  2EIQ A;  3CRU A;  4D73 B;  5AIX A;  3FR3 A;  2LQQ A;  3ZVJ D;  3F6D A;  3UVT A;  3GX8 A;  3C1S A;  2EIO A;  1O8W A;  4RQR A;  3GTU B;  2PVO C;  4XRD A;  3H8Q A;  1FAA A;  1SYX A;  4XS4 B;  1XXU A;  3F9U A;  1G7O A;  5J3R A;  3F3R A;  5D93 A;  1K0D A;  1TOF A;  1NHY A;  2L5L A;  4EXJ A;  3GMF A;  2G2Q A;  5CO3 A;  1YEP A;  5IOW A;  1A8Y A;  2R37 A;  2X8H A;  3UOM A;  3V1W A;  1KEB A;  4H86 A;  4NMU A;  1U3I A;  4JU5 A;  3GUS A;  1T00 A;  2GLR A;  3MAK A;  5ECH B;  6GSU A;  4HU7 A;  1GTB A;  4OO4 A;  2CVB A;  3FZ9 A;  1PL2 A;  3LYP A;  4PQI A;  4XTS A;  5EY6 A;  1B4P A;  5H5Q A;  5D9T A;  4KX4 A;  5F8B A;  2G0F A;  6GSW A;  4ZBD A;  3UMA A;  3DRN A;  5D96 A;  2DJJ A;  2LRN A;  7GSS A;  1TRS A;  2C1Y A;  2FUG 2;  3TKP A;  4K0N A;  1N8J A;  1GTI A;  1SJZ A;  2LJK A;  3J7Y k;  4LA1 A;  3UBL A;  3UBK A;  5B6M A;  2JSZ A;  3K8N A;  4MF6 A;  2YPM A;  2O8V B;  4F9Z A;  1MTC A;  3IPZ A;  2F51 A;  1MDI A;  1WP0 A;  4Z2T A;  4IBP A;  3HVV A;  4X0X A;  2RM5 A;  3ERF A;  3C1R A;  1OE8 A;  4KE3 A;  1TW9 A;  2E7P A;  2ON5 A;  5KOW A;  1MDK A;  1Z6M A;  3QFA C;  4ZBB A;  3IE3 A;  3ZZX A;  4A5P A;  2UZ8 A;  3A2X A;  4BWS A;  1ZYE A;  3EC3 A;  3FEU A;  5EVO A;  1O8X A;  5IOX A;  2CX3 A;  3GL3 A;  4N11 A;  1R5A A;  1VF2 A;  4BA7 A;  4GLT A;  1ON4 A;  5D9V A;  1AC1 A;  2PUK C;  2VO4 A;  2C8U A;  1PKZ A;  3MNG A;  1ML6 A;  3HXS A;  2L57 A;  1NHO A;  1IYI A;  3GHA A;  2OA7 A;  3RHC A;  1A0F A;  4L8E A;  3S9F A;  2DML A;  3NIV A;  4TXO A;  2YOI A;  1O85 A;  4X1U A;  2AAW A;  5CRE A;  2IMK A;  3D5J A;  1XW9 A;  2H74 A;  4EDZ A;  3VI5 A;  1XWA A;  3F4S A;  1KTE A;  1VF4 A;  3EWL A;  1THX A;  4IQA A;  1U6T A;  4K1F A;  2H1B A;  3DML A;  4FYC A;  2A2S A;  4IP1 A;  1FO5 A;  1OVN A;  5G5E A;  3KP9 A;  3EVI A;  1XOB A;  3M3M A;  2C0D A;  4XRA A;  4G9H A;  2MYG A;  3TJB A;  5FWG A;  4IHU A;  1WPI A;  2GVP A;  1ZL9 A;  4EE0 A;  1V98 A;  5DAK A;  4GCI A;  2C4J A;  2LUS A;  1K0O A;  2FGX A;  4K2X A;  1DSB A;  4V2L A;  3RBT A;  2RII A;  2DJ0 A;  1AAZ A;  3EYT A;  1W89 A;  5COH A;  2MBT A;  5HR3 A;  4ECJ A;  2JAC A;  2BMX A;  3FR6 A;  5B6N A;  4DSS A;  2F9S A;  4BL7 A;  2B5X A;  1R26 A;  1ZZY A;  1TRU A;  4AF2 A;  4K5R A;  1GSF A;  1SYR A;  3KZQ A;  1B8X A;  4OCF A;  1J08 A;  1YKA A;  4PUA A;  5DJM A;  2TIR A;  5JWQ B;  2NTO A;  4K0G A;  4OCE A;  2AJQ B;  1SK1 A;  4KF9 A;  2XBQ A;  1CQH A;  2R4V A;  2RLI A;  3FKF A;  1VF1 A;  2OE0 A;  1A24 A;  3TDG A;  4LMV A;  1WWJ A;  2YWO A;  1SU9 A;  5KN1 A;  3GX0 A;  2O7K A;  3FK8 A;  4ACS A;  1PSQ A;  3DVX A;  3BCI A;  1EGR A;  2YCD A;  3CSH A;  2IMD A;  1DUG A;  1BG5 A;  1H4O A;  4GF0 A;  3DD3 A;  1PD2 1;  3TB2 A;  5ECM B;  1TK5 B;  5GST A;  3LFL A;  2K9F A;  2LST A;  2QA1 A;  3VUR A;  5H5S A;  3LWA A;  2FWH A;  3DIE A;  5J41 A;  2VCZ A;  1QXH A;  4JBB A;  4HEA 2;  3IC8 A;  4ZL8 A;  1B4Q A;  2DBC A;  4TKY A;  4AJ7 A;  1U88 A;  2H8L A;  4POK A;  1T4Z A;  1XWG A;  3C8E A;  5DAK B;  1B9X C;  3N9J A;  1Y6E A;  3I6A A;  3MWH A;  1V58 A;  2DIY A;  4PNG A;  16GS A;  2VLV A;  2CVK A;  1FB0 A;  4KDX A;  3A5I A;  1ERT A;  2H0G A;  1JHB A;  1SJ6 A;  4L5O A;  1X9M B;  4GQC A;  4EIP A;  3BBY A;  4DSS B;  5L71 A;  2LJA A;  5ID2 B;  4KAE A;  1MD3 A;  1C72 A;  4AJ6 A;  4NHW A;  4GST A;  5AIS A;  2HI7 A;  4L5L A;  1Z5Y E;  1ST9 A;  4WEY A;  1NM3 A;  3D4T A;  1M2D A;  4MH2 A;  4MJC A;  3M9J A;  1Z6N A;  5KN0 A;  1UC7 A;  4F82 A;  4TR1 B;  3GST A;  1ILO A;  5G1L A;  2H1A A;  3QAG A;  2VCV A;  4MMM A;  4IGJ A;  1F3A A;  1PGT A;  2YP6 A;  5EL8 A;  5IMC A;  4ZIJ A;  1X5E A;  4TW5 A;  1PX6 A;  2H66 A;  5E59 A;  1YF0 A;  4K2D A;  3ERW A;  3GIX A;  4IP6 A;  4ZB8 A;  5IIZ A;  5J5N A;  1QQ2 A;  2WB9 A;  2WZ9 A;  4TXV A;  4ML1 A;  1HNC A;  3NOF A;  5IO2 A;  4PQ1 A;  1XPV A;  1TJD A;  3TGZ A;  8GSS A;  2P31 A;  3A2W A;  1GSS A;  4YKF A;  2LRT A;  5IMF A;  3TKS A;  4XS1 A;  3VWU A;  2C3N A;  2VL3 A;  1PKW A;  2HRF A;  2HSY A;  3Q74 A;  3HYP A;  1K0N A;  4ECC A;  3GKK A;  1GUL A;  1PRX A;  4LLR A;  1U3A A;  3HCZ A;  2IL3 A;  2HRN A;  2I1U A;  4MF7 A;  4TRX A;  2H1D A;  4Q5R A;  5IQY A;  2F8A A;  2O85 A;  1ZYQ B;  1GTU A;  3EMX A;  3H4K A;  4K8M A;  2QGV A;  2BTO T;  2X4A A;  4KDU A;  1G0T A;  2H01 A;  2WS2 A;  3EE2 A;  6GST A;  1SJI A;  1K0A A;  3UL3 A;  1SKS B;  1YY7 A;  3HJP A;  4IKH A;  3AY8 A;  4IS0 A;  1GNE A;  4DEJ A;  2A4H A;  3HZ4 A;  1QFN A;  1B9Y C;  3R3E A;  2AYT A;  4IN0 A;  1ZMA A;  3R2Q A;  2IMF A;  4BVX B;  3ZML A;  1AQX A;  4PGT A;  2HZF A;  2WJU A;  3ISO A;  2HFD A;  3UJ1 A;  2MMN A;  1XVQ A;  3TRQ A;  4MH3 A;  2VCX A;  2HRK A;  2FCH A;  4EF0 A;  1E2Y A;  1JZW A;  1FG4 A;  3DEX A;  5F07 A;  5A4U A;  3ZIT A;  2HE3 A;  1TP9 A;  3ZFL A;  5G31 A;  3RPN A;  3DKS A;  1OAZ A;  5IPH A;  1GUH A;  1X0R A;  4MLY A;  2XPD A;  5IMA A;  3KEB A;  2H1G A;  5KN3 A;  4V2M A;  3KTL A;  3KXO A;  2GT5 A;  3TJF A;  2GST A;  3WGD A;  3U5R E;  2MZC A;  5B8A A;  1I9D A;  2VCT A;  4TN8 A;  4K7N A;  4QL7 A;  1V9W A;  3E3E A;  1MD4 A;  6GSY A;  1WRY A;  1SL1 B;  3MSZ A;  3QPM A;  4HDE A;  2LRC A;  3PR8 A;  2ZNM A;  1BED A;  3HKR A;  19GS A;  1RW1 A;  2B7K A;  3VK9 A;  4HZ4 A;  3QMX A;  2CAQ A;  5CP1 A;  4FO5 A;  3IAM 2;  4G0K A;  2P5R A;  1DE2 A;  3C73 A;  1TU8 A;  1SL2 B;  1XIY A;  2V41 A;  5INY A;  1PN9 A;  4XCS A;  5G1K A;  1UVZ A;  2WCI A;  2IWT A;  3RAZ A;  1TK0 B;  1A0R P;  3HA9 A;  1HD2 A;  4BPY A;  4GSS A;  5AN1 A;  1V40 A;  2PER A;  2QSI A;  2JZT A;  3DGQ A;  4MZC A;  20GS A;  3TOU A;  3ZFB A;  4JE1 A;  3TRX A;  3EMP A;  2B5Y A;  5HFI A;  5JWO B;  1SKR B;  1M9A A;  2E2M A;  4MCU A;  2PU9 C;  4ISD A;  3CTG A;  1HYU A;  1SK2 A;  3GL5 A;  3GKM A;  3KM6 A;  1E6B A;  3I69 A;  2A2R A;  4BVY B;  1JZR A;  4O92 A;  1R5P A;  2L4C A;  2LNT A;  2CV4 A;  2M46 A;  2VM1 A;  2PMT A;  1XW6 A;  4YQM A;  5BMU A;  4KW6 A;  1M7T A;  2M80 A;  3PPU A;  2GZP A;  3VPT A;  2YN1 A;  4HUA A;  2XBI A;  4ZBA A;  2XHF A;  3VWX A;  4ZL7 A;  4HU9 A;  1B48 A;  3LEF A;  2WDU A;  4EKZ A;  2TRX A;  1SKW B;  1HNB A;  2FHE A;  4CDO A;  2C3Q A;  2VD1 A;  4XS6 A;  4FYU A;  11GS A;  4MZB A;  3IXR A;  4KUN A;  1OC9 A;  2N5B A;  1TRW A;  1X5D A;  2AV4 A;  3WT2 A;  3HD5 A;  4WET A;  2WFC A;  2LKU A;  3GKN A;  4NPB A;  4YKG A;  12GS A;  5B8B A;  2VUP A;  1ZYP A;  4XIH A;  2YWI A;  1PX7 A;  1G6W A;  1ZCP A;  2MMO A;  2VD0 A;  2VL2 C;  3IOS A;  1F37 A;  5J9C A;  4E8E A;  4ZXG A;  2CT6 A;  4IVF A;  3E0U A;  3VWV A;  4NV2 A;  2PPT A;  1A2J A;  1HNA A;  2H19 A;  3CSJ A;  1K3Y A;  1WE0 A;  3H93 A;  4JZQ A;  3W8J A;  5AGY A;  1F2E A;  2HLS A;  3MDK A;  2B6M A;  3KGK A;  1XCC A;  1Z7P A;  2IPA A;  1F9M A;  1GUM A;  3KH7 A;  1GL8 A;  5G5F A;  1JZD A;  3UAR A;  3CTF A;  2DJ2 A;  18GS A;  2GDR A;  3VPQ A;  4BWQ A;  3VFI A;  3LXT A;  4JR4 A;  2P0G A;  2R0P A;  4O5Q A;  2YNX A;  4NAX A;  1TKD B;  1LBK A;  1M9B A;  3LW9 A;  5HFG A;  1DE1 A;  2AUV A;  2XPE A;  3UVH A;  2N5A A;  4MNN A;  4KH7 A;  2DJ1 A;  4Z7X A;  4YAV A;  5JCG A;  4YQU A;  3GFK A;  1S3A A;  3F0I A;  4F2I A;  3Q6O A;  5JCU A;  4O32 A;  1QMV A;  2H6X A;  2L5O A;  4ECI A;  4MAB A;  5CRD A;  3C7M A;  3UAP A;  1MDJ A;  5D9X A;  5IM9 A;  5J4U A;  4OWY A;  4P3Y B;  3GH6 A;  2DJK A;  4CY8 A;  4POB A;  2YWM A;  4X43 A;  3ZRD A;  2A4V A;  1GP1 A;  4TXO B;  2OAC A;  5F06 A;  5ECN B;  4KND A;  3WGE A;  3KMO A;  1M2A A;  4GTU A;  4WBJ A;  1V57 A;  2QC7 A;  3D21 A;  3HVX A;  2HRA A;  4JR6 A;  5A4V A;  1FOH A;  2ZCT A;  4GSN A;  1A2M A;  1QK8 A;  5DJL A;  2LV3 A;  2ZUP A;  4O7H A;  1M99 A;  4ZIL A;  1GLQ A;  1FW1 A;  4L0W A;  3TKQ A;  5EPF A;  4F03 A;  3EPT A;  3BJ5 A;  2DLX A;  2VLU A;  2V2G A;  2HT9 A;  3QR6 A;  2O87 A;  4JRR A;  1K3L A;  2H72 A;  1OC3 A;  1GSD A;  6GSS A;  1O7U A;  4KCE A;  2N5F A;  3LG6 A;  4J2F A;  1NW2 A;  2FLS A;  2RUF A;  3WD6 A;  3JCM L;  2MMA A;  4G0I A;  3APO A;  3L0H A;  1M2B A;  3CMI A;  2IFQ A;  3EU4 A;  3KCM A;  4CY6 A;  2PWJ A;  3WT1 A;  3PH9 A;  4G10 A;  1FB6 A;  2IMI A;  2DJ3 A;  2HZE A;  3IV4 A;  5HR2 A;  4NWY A;  2K8S A;  1GTA A;  3UEM A;  1GRX A;  1WOU A;  4BL7 B;  3MYD A;  3M0F A;  3H1N A;  2CA8 A;  1AQW A;  3F63 A;  1SD9 A;  3QFB C;  1XWK A;  2NBS A;  4ZB9 A;  3FY7 A;  2X64 A;  5AIV A;  2YV9 A;  2Z9S A;  3DXB A;  3WYW A;  4RI7 A;  5ELA A;  2GSQ A;  5FT3 A;  4IQ1 A;  3GSS A;  4OFM A;  1GSU A;  4KSO A;  2RUE A;  1SD8 A;  2C80 A;  3ME8 A;  5KEJ A;  4ILF A;  5ELG A;  3RDW A;  2H6Y A;  3FRC A;  3W6G A;  1O81 A;  1Z7R A;  2HXK A;  2R2J A;  2GSR A;  4PTS A;  2LS5 A;  2H73 A;  4EUY A;  2R3X A;  3FZ4 A;  3C71 A;  3SWL A;  5CYY A;  14GS A;  3G7I A;  2MBS A;  3G7Y A;  1N2A A;  3KP8 A;  1J9B A;  1RK4 A;  2CZ3 A;  4IEL A;  2DKH A;  4HJ2 A;  4WF4 A;  4O5R A;  3P8W A;  1K0B A;  2E2G A;  1ZGN A;  4PUR A;  1J0F A;  4RI6 A;  2JL4 A;  4Q5N A;  2VLT A;  1Q98 A;  4MPG A;  3IHG A;  3IK7 A;  4WR5 A;  1PL1 A;  1EP8 A;  2B1L A;  3HJO A;  5IO0 A;  2YAN A;  3EU3 A;  4K7I A;  3ERG A;  3GNJ A;  2IN3 A;  3TJJ A;  1Z9H A;  4F0C A;  1EEJ A;  3HY2 A;  3EIN A;  3QOU A;  3I9V 2;  4Q5F A;  1HQO A;  4DSR A;  4GRF A;  3TKR A;  3L9U A;  1W4V A;  2KUC A;  2BJX A;  1GSE A;  1EOH A;  3NZN A;  3GV1 A;  5CNW A;  3APQ A;  1X9W B;  1G7E A;  2YZU A;  4ECB A;  2B7J A;  1I5G A;  2VL9 A;  1K0C A;  4D73 A;  4MJE A;  1S3D A;  5GZZ B;  3GYK A;  3TRP A;  1Z3E A;  2KHP A;  1TTZ A;  1X9S B;  3GTU A;  4TOP A;  3GKX A;  4XS4 A;  1EZK A;  4PUF C;  4J56 E;  2EC4 A;  1QGV A;  3IR4 A;  2X49 A;  1K3O A;  3N5O A;  1UN2 A;  2ON7 A;  1TK8 B;  2TRC P;  4PX1 A;  3IA1 A;  2OBK A;  17GS A;  3RPP A;  5DAL A;  4K6X A;  4I97 A;  4PXO A;  2O89 A;  3M9K A;  2GGT A;  4ZB6 A;  4HS1 A;  1JZO A;  4USS A;  4YAP A;  5DBQ A;  3A2V A;  1FVK A;  4F0B A;  3LJR A;  13GS A;  3ZVJ A;  3LYK A;  2IIY A;  4HQS A;  4ZL9 A;  4MDC A;  5A4W A;  2FA4 A;  4O5U A;  2VCQ A;  3GH9 A;  4CHS A;  2J9H A;  1Y25 A;  5ECQ B;  2CZ2 A;  4PNF A;  1GLP A;  3H79 A;  4WKW A;  2ALB A;  5JCW A;  1PMT A;  2YZH A;  3OR5 A;  2GQK A;  4HZ2 A;  5KN2 A;  3QCP A;  3DVW A;  1RQM A;  1T1V A;  2DMM A;  2F8F A;  2LQO A;  4HOJ A;  3G7J A;  2K8V A;  2GQM A;  2JZS A;  4FIW A;  1KBN A;  10GS A;  1ERV A;  4Z2R A;  1LJR A;  2GSS A;  1BX9 A;  3CSI A;  3SBC A;  1OE7 A;  2LJR A;  1EP7 A;  4NHZ A;  4NXI A;  3ZIV A;  2VOC A;  5GSS A;  3CBU A;  3FW2 A;  2FNO A;  3I43 A;  4DVC A;  4KA0 A;  3A5W A;  4G19 A;  4X4J A;  3PGT A;  2HYX A;  3P7X A;  3UIW A;  1QUW A;  2V32 A;  5DAL B;  4KCA A;  4CW9 A;  3HJM A;  3RHB A;  3BD2 A;  4TR3 A;  1LU4 A;  5CRG A;  3D0Z A;  1PN0 A;  3E9J B;  3TKS E;  1EOG A;  3F8U A;  1AIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...