1XPVA

Solution structure of northeast structural genomics target protein xcr50 from x. campestris
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELDWPFDAPRLRAWLDAAPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein XCC2852
publication title Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris
rcsb
source organism Xanthomonas campestris
molecule tags Structural genomics, unknown function
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xpvA00
2B5XA 1O6JA 4IN0A 4KW6A 1GP1A 2GLRA 2OACA 1MTCA 2IMFA 1BEDA 2B3SA 1DUGA 3TDGA 4L8EA 1SL0B 1XWGA 4HQZA 1Z9HA 2FWHA 5KN3A 18GSA 4HZ2A 5B7CA 4PUFC 2LNTA 1O81A 1TRSA 4K7OA 5IOXA 1THOA 1U3AA 3FYGA 4IKHA 2AAWA 2VAFA 3TOTA 3IBHA 4I5QA 5IMFA 1WRYA 1SYXA 2B1KA 1S3AA 2GDRA 3WGDA 1JZDA 2YPMA 4DSSB 3FRCA 3GUSA 1VF3A 2FY6A 4EE0A 1XCCA 1F2EA 2VUPA 19GSA 3LGCA 4FH8A 1V9WA 3O3TA 2JU5A 4F0BA 4IELA 3E9JB 3HJOA 1XXUA 3FR3A 1PRXA 2H19A 2PVQA 5E59A 5EY6A 2GT5A 5GZZB 1T3BA 3KMOA 1B9XC 1A8LA 5ID2B 4E8EA 1FO5A 2OADA 5FT3A 3RBTA 5DALA 1K3LA 1F3BA 5AISA 1TRUA 5F07A 1AIUA 3FHKA 5IMAA 2PU9C 3EU4A 2GZPA 3C1RA 1QFNA 2VIMA 1ON4A 1M99A 5IO2A 3M9KA 1J08A 2NPBA 4MPGA 1SL2B 2DJ2A 2E0QA 3L9VA 3F8UA 1TJDA 1J0FA 3DEXA 2HRFA 5KEJA 3AY8A 3F3RA 1ZCPA 1X5DA 1TDIA 4MA9A 2VCVA 3K8NA 5JCUA 1U3IA 4OO4A 2TIRA 5J4UA 4ZB8A 4DVCA 3ERFA 1HNAA 4G9HA 1RW1A 3ZVJD 4PQIA 2YANA 2QGVA 2LQOA 3TJKA 4GXZA 4N10A 2YWOA 5IMVA 5DJLA 1PL1A 2VO4A 5IMZA 1EOHA 2IFQA 4K0NA 2YZUA 2ON7A 4G19A 4EF0A 4GF0A 4FYCA 4IHUA 1HNCA 3C1SA 2OE1A 2ZNMA 5DVBA 4PURA 3GFKA 5D96A 5G31A 2I9HA 5LCZA 4OO5A 3MNGA 1LJRA 3VI7A 3LJRA 5ECLB 3D6IA 2IFQB 3H1NA 1V58A 4IP6A 3VWWA 1V2AA 1BX9A 1GSUA 1XW9A 4ZL7A 2MMAA 4AF2A 2LJRA 3L9UA 4GSNA 4BA7A 5CRHA 1XW6A 3FKFA 4RQRA 2R37A 3GMFA 4I2TA 3VWVA 2YNXA 3PGTA 2FD3A 5ELGA 4HS1A 1USBA 1K0CA 3DGQA 2HSHA 2CA8A 1V98A 3G7JA 2IMKA 3ZMKA 3BJ5A 2C4JA 2I4AA 2KUCA 3HD5A 1T1VA 2YZHA 3GNJA 5FWGA 4BWQA 1M9BA 2VCQA 2GZZA 5LD0A 1VGLA 3WGXA 3RAZA 1O85A 2FCHA 3TOUA 3APQA 3IA1A 1URMA 4HJ2A 2Z9SA 3FZ4A 1K3OA 1M7TA 4NXIA 3ZITA 4GWRA 3A2VA 3DVXA 2H1BA 4ZXGA 3CRUA 2B7KA 2M46A 1PSQA 3BCKA 5CAXA 4GSTA 1JFUA 2GSSA 3HKRA 2IMEA 2IPAA 3UJ1A 2NBSA 2J9HA 1XWKA 4PX1A 1TI1A 3D0ZA 3F4SA 5C04A 5IIZA 1EGOA 3IXRA 4G10A 2AYTA 1ABAA 3GX0A 3OR5A 2V32A 1SU9A 4IQ1A 3QAWA 2XBQA 4WXTA 4EVMA 1ZYQB 1J9BA 4JR4A 4K6XA 4POLA 1SKRB 14GSA 4MJAA 4MLYA 2GVPA 1K0MA 3TCOA 4O7HA 2IMDA 3MDKA 4F03A 3Q6OA 8GSSA 2E2GA 4MJBA 3ZVJA 3CYNA 1XOAA 1FG4A 5IQYA 1AAZA 3KD0A 2FUG2 2L6DA 2D2ZA 5B8BA 5J41A 3UARA 1OE7A 2GQKA 1K0BA 4QQ7A 1GULA 2HZEB 1KEBA 1RQMA 4HQSA 2KLXA 1PKWA 2OE0A 2JL4A 5ECKB 4J2FA 5KN2A 4L0UA 1E2YA 4V2LA 4I2UA 3P90A 2GSRA 4JU5A 3FEUA 2K18A 1YZXA 3LSZA 3D4MA 4POBA 4EUYA 4ZBAA 3MWHA 2M80A 2H71A 4BVYA 3HJMA 1FHEA 3VWUA 4FIWA 1X9WB 1OC8A 2DMLA 2IJYA 3GIXA 3I69A 1ZMAA 2YWNA 3F6DA 1XIYA 1KNGA 1X9SB 3UAPA 1TTZA 1SKWB 1A24A 5IPHA 3APOA 2LRNA 3VPTA 3P8WA 3GSSA 3IC4A 9GSSA 1QQ2A 3QDNA 3WGEA 4JBBA 4EDYA 1M2BA 3IDVA 3HVXA 13GSA 2MMOA 3VPQA 1AW9A 4YAPA 5G2ZA 1F3AA 4ACSA 3ZIVA 2KP2A 1BAYA 3IOSA 6GSSA 1UA5A 2C1YA 2QKEA 3QAGA 2KOKA 6GSYA 1Z5YE 3APSA 4O5RA 1ZOFA 3GRXA 3FW2A 1SK1A 3HCZA 1GWCA 5J3RA 2YJHA 1GSQA 1CQGA 1F9MA 1GLQA 3BD2A 4KAEA 5GAPD 4KSMA 1SD8A 2A2SA 3U6VA 3KTBA 4WBRD 5L71A 2MBTA 5HR2A 1A8YA 4V2MA 2PVOC 2C3TA 4E8HA 1X5CA 2VD0A 1NSWA 4XCSA 3RDWA 4ECCA 1PD21 4ML1A 2VLVA 3F9UA 1N8JA 4IJ3A 3LG6A 2FA4A 1QUWA 3GKXA 2DBCA 2PGTA 4QL7A 1VF2A 5B8AA 3ZLPA 4YH2A 5INYA 5EPFA 5ECSA 4XTSA 3D5JA 3F63A 4ZIJA 2CZ3A 4LL4B 4MP4A 4OD7A 4X0XA 1B48A 3ZFLA 2CV4A 1FW1A 4HOJA 2XPEA 3H4KA 5G5FA 2IL3A 2H66A 1ZYEA 1Z3EA 4DSQA 1GNEA 3RPNA 1FB6A 2LQQA 1THXA 3A3TA 5G1LA 2C0GA 4OFMA 4EC0A 3JCML 2IWTA 1DE1A 1SK0A 4POMA 4CW9A 2BMXA 3BBYA 4GQFA 2OA7A 1M2DA 4K1FA 4N11A 5GSSA 3O76A 2JZSA 4NHZA 1MDKA 3QOUA 4K8MA 5D9XA 3ERWA 3VURA 3IV4A 4XS4B 2WFCA 2BJXA 4TKYA 3ZFBA 4EL1A 2LSTA 4DSSA 3MAKA 3EE2A 3UVTA 1WJKA 4ISDA 3IRAA 3GYKA 5EL8A 1I5GA 1KTEA 3EMXA 1ST9A 4HUAA 3DIEA 4KDXA 3IHQA 3TKSC 4YQVA 5JWOB 1F37A 2F8AA 3HVSA 1Z6MA 4XHMA 1GSFA 1SK2A 1X5EA 1R26A 5H5SA 6GSWA 5DBQA 2A2RA 5DAKB 1TXXA 5F06A 4PUAA 4TXOB 3UVHA 5ID2A 5CNWA 10GSA 4PNFA 2BTOT 2VCZA 4KDUA 2DC5A 2LRCA 2HLSA 4ECBA 1UC7A 1U87A 3TJFA 5B6NA 3ZIJA 1A2JA 2GGTA 11GSA 1O8XA 3TUEA 2R6KA 4IVFA 1T4ZA 3EU3A 1V40A 1XWAA 4KCAA 4XRAA 3KGKA 1GTUA 5CRGA 2LS5A 3D22A 1A2LA 2C3QA 2DIZA 1XWCA 2H74A 3GX8A 2DMMA 1BG5A 3GURA 3L0HA 1XW5A 1Y25A 2WJUA 2H73A 5IOWA 1G7EA 3GA4A 3IPZA 1XOBA 2VL2C 1TK5B 2RM6A 3I43A 3KMNA 4HU7A 1RK4A 2DJ1A 1MEKA 1R4WA 2RIIA 3UBLA 2WRTA 5ECMB 4KA0A 1ERTA 2HXKA 2H6ZA 2ZCTA 1WE0A 3KZQA 3PINA 1YQ1A 5CO3A 1ZGNA 1XBSA 2REMA 4ZB6A 5KN0A 2I1UA 4BWSA 4F2IA 5AIVA 5F0GA 4OMVA 2JACA 3M1GA 5HR1A 4JE1A 1ERUA 2L4CA 4WF4A 1QXHA 2TRCP 1DE2A 1XWBA 1GSSA 2VL9A 3F4TA 2DJ0A 1ACVA 5ENUA 5AN1A 2R2JA 3HA9A 4CDOA 3DRNA 3Q19A 5HFGA 1O8WA 2IIYA 2E7PA 1GSYA 3GKNA 5IM9A 4ECIA 3H93A 1Y6EA 1GUHA 2M72A 1EZKA 2FWEA 3KIJA 1SL1B 1R5PA 1K0DA 1TP9A 3J7Yk 2CZ2A 2RLIA 3L78A 4LL1B 1G0TA 4EXJA 4V1Ap 4FO5A 3KTLA 1HYUA 20GSA 4MJCA 2AUVA 3SWLA 4F0CA 2IMIA 3HYPA 5D9WA 2JADA 5LNKe 3TKQA 2HNLA 4WR5A 2H6XA 1ILOA 1PGTA 3FZ9A 2P5RA 3A2XA 1A0RP 1UN2A 4ULXA 4DSRA 1EEJA 1SD9A 3A5WA 2PUKC 3UOMA 2OJLA 2EIRA 2YV9A 4MH3A 5HR3A 5HQPA 1GTIA 1K0AA 4IS0A 2YJ7A 1E6BA 3DKSA 1WIKA 1GTAA 1BQ7A 3LORA 1AQWA 3CTFA 1TRWA 2WDUA 5D93A 1G7OA 3LQ7A 2VCXA 2DJ3A 2HFDA 4IGJA 2PN8A 2X8GA 1OVNA 2QSIA 3GH9A 1TOFA 5E4WA 1GUKA 2P31A 3R2QA 3EWLA 2ON5A 1FVKA 1HNBA 1TU7A 1FOVA 3PH9A 1WMJA 4TOPA 2G2QA 2OKAA 2NTOA 3CRTA 1QMVA 4K0GA 1R7HA 1VF4A 4GTUA 3C71A 2HZEA 4XS1A 2GQLA 1SJIA 4EO3A 3LYKA 2C8UA 1QK8A 4JEDA 1MDIA 1H4OA 4F9ZA 3KM6A 1GUMA 4MZWA 2H70A 2GQMA 3G7IA 4PQHA 5JWRB 2GT6A 3QAVA 4X1UA 4GSSA 4YQMA 5ECOB 3HDCA 3G9BA 4HZ4A 4K2DA 1NHOA 1PMTA 3RHBA 4TR4A 1W89A 2LJAA 4LLRA 3VWXA 3VI5A 2V6KA 3CMIA 4TW5A 3GSTA 2LJKA 2R3XA 2ZUPA 3TKPA 5KN1A 1YEPA 3GKKA 1OAZA 2LNSA 2OBKA 4MZBA 7GSSA 2F3MA 2R4VA 3HZ8A 1A23A 2JZTA 3EVIA 3LXZA 1U88A 4NV5A 3ERGA 1PQNA 1GNWA 6GSUA 3ME7A 2F8FA 5D73A 5A4VA 2I81A 6GSVA 5D9VA 1M0UA 4RUVA 3QFAC 4PQ1A 5DQYA 2RUEA 1A0FA 2C0DA 1JHBA 4ID0A 2AHEA 2O8VB 5DCHA 12GSA 3DYRA 5J9CA 1B4QA 2YWMA 1B4PA 1K0OA 2VL3A 3KH9A 1PX7A 2K9FA 3FR9A 3QPMA 1XVQA 1GLPA 3I9V2 1PX6A 1YKAA 3P7XA 1M2AA 2HRNA 2MMZA 4WKWA 4MJEA 2N5FA 1K3YA 3HXSA 3KEBA 3A2WA 1AC1A 3UBKA 3TKRA 1JZRA 2G0FA 3UIWA 1Q98A 5ECIB 3ZRDA 4IBPA 3LEFA 3KH7A 1OKTA 4HI7A 1YF1A 2O89A 3DWVA 4L0WA 3U5RE 4DEJA 2MBSA 2GSTA 1SJZA 1HQOA 5F8BA 5IPGA 3ZL5A 5F05A 2H72A 2OBIA 4KGIA 2E2MA 5D8IA 1G6YA 2B5YA 3IAS2 2KHPA 2FGXA 3F0IA 3FR6A 3D21A 2LEGA 3DMLA 4NHWA 2XC2A 1O7UA 5DDLA 1A2MA 1QGVA 2O85A 4HEA2 2CVKA 1Z7PA 4YQUA 2HE3A 3CSJA 3C8EA 2VLTA 1N2AA 3LFLA 5CP1A 2MYGA 4MABA 3C73A 4ZL9A 2CAIA 3IR4A 1NW2A 1OYJA 2DIYA 3EMPA 2JSZA 3HVVA 1PN9A 3TGZA 3GL5A 1EEMA 4XS4A 3QD9A 2VM2A 1EV4A 4PNGA 2GZYA 2LUSA 2FA8A 3TKSA 1YKCA 2LKUA 3WT1A 5J9BA 3F4RA 1I9DA 4WR4A 5DJMA 2X8CA 3I6AA 3HZ4A 4IW9A 2O7KA 2FNOA 3KCMA 2AJQB 2PPTA 3M3MA 4MDCA 4TR1B 3US3A 5CRDA 2L4QA 4KB3A 4ZBDA 1U6TA 4BL7A 3DD3A 4LMVA 3MSZA 1BJXA 3HY2A 2MMNA 1JLVA 4PGTA 2WCIA 1G6WA 4H86A 3H79A 2HYXA 2H76A 5IMDA 3QFBC 2QC7A 2X99A 3GKMA 4KCEA 4MPFA 5DAKA 1T4YA 4KX4A 3C7MA 4TXOA 2WS2A 4Q5NA 4GRFA 1MD4A 2EIQA 2HSYA 3CSHA 1AQXA 17GSA 3ZYWA 1EP7A 4WEYA 4L5OA 2P0GA 4KSOA 4TRXA 2VL2A 4HDEA 2CQ9A 5G5EA 1ZL9A 2GTUA 2WGRA 5ABRA 2R5GA 5GAND 1OE8A 4XIHA 2P5QA 5J5NA 4AJ8A 6GSXA 4NWYA 4RQXA 1NHYA 3LWAA 1YDKA 3IE3A 1MD3A 4OFTA 1YJ6A 1Z6NA 2FWGA 4K7NA 4ZBBA 2O87A 3W8SA 4TR3A 4WBJA 1ERWA 5HR0A 4HJMA 2H1AA 3W6GA 4OCEA 4K9ZA 2H1GA 1FVJA 1F6MC 3HHVA 1WOUA 4GLTA 3CXGA 1SJ6A 2FHEA 3IK9A 1GSEA 3SBCA 4IP1A 1T7PB 1H75A 5GSTA 1LBKA 1EP8A 4MK3A 2YCDA 1SKSB 5ELAA 1NM3A 2YV7A 2C3NA 5DALB 4V2NA 2AV4A 2L57A 2I3YA 4P3YB 1XVWA 4J57E 2K8VA 2V1MA 1HD2A 2PBJA 3TRQA 2V2GA 1VF1A 1V57A 1JLWA 1TK8B 2ES7A 1M9AA 1XFLA 3TRXA 5JCWA 4RI7A 4AGSA 1IYIA 2HT9A 1TU8A 3F6FA 3TRPA 1ERVA 1FB0A 1IYHA 4HU9A 5ECPB 1K0NA 2HI7A 3N9JA 3V1WA 3EYTA 2YWIA 1FAAA 3LYPA 3FY7A 4MCUA 4ML6A 3N5OA 4BPYA 3M9JA 4X43A 2EC4A 1X0RA 4EKZA 1S3DA 4MZCA 2JZRA 2K6VA 3UL3A 3RPPA 5G1KA 1EWXA 4N30A 4MMMA 2EIOA 3IAM2 1CQHA 3L4NA 4RI6A 1XPVA 4XRDA 4GCIA 3TJBA 3FK8A 2N5BA 3G7YA 4IJIA 1MDJA 3VFIA 3VK9A 3DVWA 4I6XA 5CREA 2H0GA 1Q4JA 4AJ7A 2B1LA 3IK7A 1TI3A 4O92A 4NPBA 4OWYA 3P2AA 3EURA 2K8SA 2LTKA 4JRRA 3TJJA 4TN8A 2YP6A 3UMAA 3O6TA 3E0UA 2AB6A 3CBUA 3KXOA 3Q74A 1S3CA 1TW9A 3KJYA 3ED3A 4WETA 5AIXA 1TRVA 1B8XA 3GV1A 3ZZXA 2H0HA 4KH7A 3GL3A 1VRSD 2GS3A 1EGRA 5CRWA 2V6OA 2HZFA 2LRTA 4QL9A 5A4WA 1WWJA 4Q5FA 3EINA 1R5AA 1BYEA 1O73A 3VLNA 1OC9A 4PXOA 2JSYA 3QR6A 2H75A 3NIVA 2H01A 2DLXA 4NMUA 3WYWA 2H30A 3CTGA 4Q5QA 2V41A 16GSA 2PERA 2FWFA 2NDOA 3ZMLA 1TK0B 2VCWA 1YY7A 3GTUA 3FZ5A 1SYRA 1OC9B 1ML6A 4GQCA 4AJ6A 5H5QA 2DJKA 22GSA 5HFKA 2WB9A 3BCIA 5B6MA 5H5RA 3M0FA 5A4UA 3GHAA 3S9FA 1GTBA 2F9SA 3L9SA 4TVEA 1SENA 4MF6A 3GTUB 4I97A 5DCGA 4Q5RA 2MZCA 2ALBA 2A4VA 2FLSA 3ME8A 2N5AA 2L5OA 2WZ9A 3ZREA 4KDYA 3J7Yb 5DQSA 4NV2A 5D9TA 4WF5A 3EC3A 2LV3A 2WULA 1TKDB 1AUCA 4ECJA 2VLUA 3DXBA 2YOIA 2IN3A 3HJPA 3NOFA 2XPDA 2F51A 2PMTA 2YN1A 4NAXA 3LXTA 1T00A 1W4VA 5C00A 5HFIA 2VD1A 2H0IA 2CX4A 2B7JA 2VCTA 2DJJA 4BVXA 3TB2A 4XS6A 3WT2A 3CSIA 3KP9A 4OFNA 4MH2A 1GL8A 4MF5A 3TJGA 1ZZYA 1KBNA 4EDZA 1UVZA 1JZOA 4L5LA 5CYYA 3PR8A 2L6CA 4KUNA 2CAQA 4I8BA 3W8JA 3D4TA 2C0EA 4FYUA 4ZL8A 2NVLA 3BOAA 2H8LA 4POKA 4MF7A 4JZQA 3F3QA 3H8QA 2OE3A 5FHIA 1EOGA 2RM5A 6GSTA 1PA3A 4V1Ag 2J23A 3Q18A 3FZAA 1C72A 2CVBA 4YAVA 1OC3A 1GSDA 5ECHB 4LMWA 5JWQB 1T8EB 2C80A 1DBYA 4JR6A 1YF0A 4KNDA 4ILFA 2VOCA 1OKDA 2DSAA 3QMXA 5EVOA 2H6YA 4ZB9A 4LA1A 3GN3A 5IMCA 1AXDA 1DSBA 3QCPA 4G2EA 5IO0A 5A5KA 3E3EA 2RUFA 3TKSE 3ISOA 1GH2A 3KP8A 2CVDA 2XHFA 4J56E 4TR0A 4Z7XA 2PWJA 4K7IA 4CHSA 2VM1A 1PKZA 3RHCA 5JCGA 3UEMA 4FYBA 2CT6A 4N0VA 2B5EA 5AGYA 3WD6A 4IQAA 1GRXA 4TXVA 1EV9A 1XZOA 1LU4A 2X8HA 3GH6A 4N0ZA 1YEXA 2B6MA 1AQVA 2KP1A 5ECRB 3M8NA 3ZTLA 1Z7RA 2C0FA 4D73A 2GSQA 3NZNA 4ZILA 2X64A 2L59A 1JZWA 1B9YC 4F82A 5ECQB 2CX3A 4O32A 4KE3A 4TR1A 1WPIA 5G30A 1PL2A 2L5LA 4D73B 1X9MB 2TRXA 5COHA 2H1DA 4OCFA 5ECNB 2XBIA 1WP0A
chains in the Genus database with same CATH superfamily
2B5XA 1O6JA 4IN0A 4KW6A 1GP1A 2GLRA 2OACA 1MTCA 2IMFA 1BEDA 2B3SA 1DUGA 3TDGA 4L8EA 1SL0B 1XWGA 3EPTA 4HQZA 1Z9HA 2FWHA 5KN3A 18GSA 4HZ2A 5B7CA 4PUFC 2LNTA 1O81A 1TRSA 4K7OA 5IOXA 1THOA 1U3AA 3FYGA 4IKHA 2AAWA 2VAFA 3TOTA 3IBHA 4I5QA 5IMFA 1WRYA 1SYXA 2B1KA 1S3AA 2GDRA 3WGDA 1JZDA 2YPMA 4DSSB 3FRCA 3GUSA 1VF3A 2FY6A 4EE0A 1XCCA 1F2EA 2VUPA 19GSA 3LGCA 4FH8A 1V9WA 3O3TA 2JU5A 4F0BA 4IELA 3E9JB 3HJOA 1XXUA 3FR3A 1PRXA 2H19A 2PVQA 5E59A 5EY6A 2GT5A 5GZZB 1T3BA 1M3IA 3KMOA 1B9XC 1A8LA 5ID2B 4E8EA 4K5SA 1FO5A 2OADA 5FT3A 3RBTA 5DALA 1K3LA 1F3BA 5AISA 1TRUA 5F07A 1AIUA 3FHKA 5IMAA 2PU9C 3EU4A 2GZPA 3C1RA 1QFNA 2VIMA 1ON4A 1M99A 5IO2A 3M9KA 5BMUA 1J08A 2NPBA 4MPGA 1SL2B 2DJ2A 2E0QA 3L9VA 3F8UA 1TJDA 1J0FA 3DEXA 2HRFA 5KEJA 3AY8A 3F3RA 1ZCPA 1X5DA 1TDIA 4MA9A 2VCVA 3K8NA 5JCUA 1U3IA 4OO4A 2TIRA 5J4UA 4ZB8A 4DVCA 3ERFA 1HNAA 4G9HA 1RW1A 3ZVJD 4PQIA 2YANA 2QGVA 2LQOA 3TJKA 4GXZA 4N10A 2YWOA 5IMVA 5DJLA 1PL1A 2R0GA 2VO4A 5IMZA 1EOHA 2IFQA 4K0NA 2YZUA 2ON7A 4G19A 4EF0A 4GF0A 4FYCA 4IHUA 1HNCA 3C1SA 2OE1A 2ZNMA 5DVBA 4PURA 3GFKA 5D96A 5G31A 2I9HA 5LCZA 4OO5A 3MNGA 1LJRA 3VI7A 3LJRA 5ECLB 3D6IA 2IFQB 3H1NA 1V58A 4IP6A 3VWWA 1V2AA 1BX9A 1GSUA 1XW9A 4ZL7A 2MMAA 4AF2A 2LJRA 3L9UA 4GSNA 4BA7A 5CRHA 1XW6A 3FKFA 4RQRA 2R37A 3GMFA 4I2TA 3VWVA 2YNXA 3PGTA 2FD3A 5ELGA 4HS1A 1USBA 1K0CA 3DGQA 2HSHA 2CA8A 1V98A 3G7JA 2IMKA 3ZMKA 3BJ5A 2C4JA 2I4AA 2KUCA 1S3RA 3HD5A 1T1VA 2YZHA 3GNJA 5FWGA 4BWQA 2UZ8A 1M9BA 2VCQA 2GZZA 5LD0A 1VGLA 3WGXA 4USSA 3RAZA 1O85A 2FCHA 3TOUA 3APQA 3IA1A 1URMA 4HJ2A 2Z9SA 3FZ4A 1K3OA 1M7TA 4NXIA 4X4JA 3ZITA 4GWRA 3A2VA 3DVXA 2H1BA 4ZXGA 3CRUA 2B7KA 2M46A 1PSQA 3BCKA 5CAXA 4GSTA 1JFUA 2GSSA 3HKRA 2IMEA 2IPAA 3UJ1A 2NBSA 2J9HA 1XWKA 4PX1A 1TI1A 3D0ZA 3F4SA 5C04A 5IIZA 1EGOA 3IXRA 4CY8A 4G10A 2AYTA 1ABAA 3GX0A 3OR5A 2V32A 1SU9A 4IQ1A 3QAWA 2XBQA 4WXTA 4EVMA 1ZYQB 1J9BA 4JR4A 4K6XA 4POLA 1SKRB 14GSA 4MJAA 4MLYA 2GVPA 1K0MA 3TCOA 4O7HA 2IMDA 3MDKA 4F03A 3Q6OA 8GSSA 2E2GA 4MJBA 4K2XA 4HSCX 3ZVJA 3CYNA 1XOAA 1FG4A 5IQYA 1AAZA 3FMWA 3KD0A 2FUG2 2L6DA 2D2ZA 5B8BA 5J41A 3UARA 1OE7A 2GQKA 1K0BA 5ECNB 3IC8A 4QQ7A 1GULA 2HZEB 1KEBA 1RQMA 4HQSA 2KLXA 1PKWA 2OE0A 2JL4A 5ECKB 4J2FA 5KN2A 4L0UA 1E2YA 4V2LA 4I2UA 3P90A 2GSRA 4JU5A 3FEUA 2K18A 1YZXA 3LSZA 3D4MA 4POBA 4EUYA 4ZBAA 3MWHA 2M80A 2H71A 4BVYA 3HJMA 4O5UA 1FHEA 3VWUA 4FIWA 1X9WB 1OC8A 2DMLA 2IJYA 3GIXA 3I69A 1ZMAA 2YWNA 3F6DA 1XIYA 1KNGA 1X9SB 3UAPA 1TTZA 1SKWB 1A24A 5IPHA 3APOA 2LRNA 3VPTA 3P8WA 3GSSA 3IC4A 9GSSA 1QQ2A 3QDNA 3WGEA 4JBBA 4EDYA 1M2BA 3IDVA 3HVXA 13GSA 2MMOA 3VPQA 1AW9A 4YAPA 5G2ZA 1F3AA 4ACSA 3ZIVA 2KP2A 1BAYA 3IOSA 6GSSA 1UA5A 2C1YA 2QKEA 3QAGA 2KOKA 6GSYA 1Z5YE 3APSA 4O5RA 1ZOFA 3GRXA 3FW2A 1SK1A 3HCZA 1GWCA 5J3RA 2YJHA 1GSQA 1CQGA 1F9MA 1GLQA 3BD2A 4KAEA 5GAPD 4KSMA 1SD8A 2A2SA 3U6VA 3KTBA 4WBRD 5L71A 2MBTA 5HR2A 1A8YA 4V2MA 2PVOC 2C3TA 4E8HA 1X5CA 2VD0A 1NSWA 5KOXA 4XCSA 3RDWA 4ECCA 1PD21 4ML1A 2VLVA 3F9UA 1N8JA 4IJ3A 3LG6A 2FA4A 1QUWA 3GKXA 2DBCA 2PGTA 4QL7A 1VF2A 5B8AA 3ZLPA 4YH2A 5INYA 4Z2RA 5EPFA 5ECSA 4XTSA 3D5JA 3F63A 4ZIJA 2CZ3A 4LL4B 4MP4A 4OD7A 4X0XA 1B48A 3ZFLA 2CV4A 1FW1A 3LW9A 4HOJA 2XPEA 3H4KA 5G5FA 2IL3A 2H66A 1ZYEA 1Z3EA 4DSQA 1GNEA 3RPNA 1FB6A 2LQQA 1THXA 3A3TA 5G1LA 2C0GA 4OFMA 4EC0A 3JCML 2IWTA 1DE1A 1SK0A 4POMA 4CW9A 2BMXA 3BBYA 4GQFA 2OA7A 1M2DA 4K1FA 4N11A 5GSSA 3O76A 2JZSA 4NHZA 1MDKA 3QOUA 4K8MA 5D9XA 3ERWA 1ZYNA 3VURA 3IV4A 4XS4B 2WFCA 2BJXA 4TKYA 3ZFBA 4EL1A 2LSTA 4DSSA 3MAKA 3MIXA 3EE2A 5BRTA 3UVTA 1WJKA 4ISDA 3IRAA 3GYKA 5EL8A 1I5GA 4G0IA 1KTEA 3EMXA 1ST9A 4HUAA 3DIEA 4KDXA 4BL7B 3IHQA 3TKSC 4YQVA 5JWOB 1F37A 2F8AA 3HVSA 1Z6MA 4XHMA 1GSFA 1SK2A 1X5EA 1R26A 5H5SA 6GSWA 5DBQA 2A2RA 5DAKB 1TXXA 5F06A 4PUAA 4TXOB 3UVHA 5ID2A 5CNWA 10GSA 4PNFA 2BTOT 2VCZA 4KDUA 2DC5A 2LRCA 2HLSA 4ECBA 1UC7A 1U87A 3TJFA 5B6NA 3ZIJA 4YKGA 1A2JA 2GGTA 11GSA 1O8XA 3TUEA 2R6KA 4IVFA 1T4ZA 3EU3A 1V40A 1XWAA 3PPUA 4KCAA 4XRAA 3KGKA 1GTUA 5CRGA 2LS5A 3D22A 1A2LA 2C3QA 2DIZA 1XWCA 2H74A 3GX8A 2DMMA 1BG5A 3GURA 3L0HA 1XW5A 1Y25A 2WJUA 2H73A 5IOWA 1G7EA 3GA4A 3IPZA 1XOBA 2VL2C 1TK5B 2RM6A 3I43A 3KMNA 4HU7A 1RK4A 2DJ1A 1MEKA 1R4WA 2RIIA 3UBLA 2WRTA 5ECMB 4KA0A 1ERTA 2HXKA 2H6ZA 2ZCTA 1WE0A 3KZQA 3PINA 1YQ1A 5CO3A 1ZGNA 1XBSA 2REMA 4ZB6A 5KN0A 2I1UA 4BWSA 4F2IA 5AIVA 5F0GA 4OMVA 2JACA 3M1GA 5HR1A 1FOHA 4JE1A 1ERUA 2L4CA 4WF4A 1QXHA 2TRCP 1DE2A 1XWBA 2QA1A 1GSSA 2VL9A 3F4TA 2DJ0A 1ACVA 5ENUA 5AN1A 2R2JA 3HA9A 4CDOA 2A2PA 3DRNA 3Q19A 5HFGA 1O8WA 2IIYA 2E7PA 2R0PA 1GSYA 3GKNA 5IM9A 4ECIA 3H93A 1ZYPA 1Y6EA 1GUHA 2M72A 1EZKA 2FWEA 3KIJA 1SL1B 1R5PA 1K0DA 1TP9A 3J7Yk 2CZ2A 2RLIA 3L78A 4LL1B 4ICYA 1G0TA 4EXJA 4V1Ap 4FO5A 3KTLA 1HYUA 20GSA 4MJCA 2AUVA 3SWLA 4F0CA 2IMIA 3HYPA 5D9WA 2JADA 5LNKe 4K5RA 2QA2A 3TKQA 2HNLA 4WR5A 2H6XA 1ILOA 1PGTA 3FZ9A 2P5RA 3A2XA 1A0RP 1UN2A 4ULXA 4DSRA 1EEJA 1SD9A 3A5WA 2PUKC 3UOMA 2OJLA 2EIRA 2YV9A 4MH3A 5HR3A 5HQPA 1GTIA 1K0AA 4IS0A 2YJ7A 1E6BA 3DKSA 1WIKA 1GTAA 1BQ7A 3LORA 1AQWA 3CTFA 1TRWA 2WDUA 5D93A 1G7OA 3LQ7A 2VCXA 2DJ3A 2HFDA 4IGJA 2PN8A 2X8GA 1OVNA 2QSIA 3GH9A 1TOFA 5E4WA 1GUKA 2P31A 3R2QA 3EWLA 2ON5A 1FVKA 1HNBA 1TU7A 1FOVA 3PH9A 1WMJA 4TOPA 2G2QA 2OKAA 1XG8A 2NTOA 2DKIA 3CRTA 1QMVA 4K0GA 1R7HA 1VF4A 4GTUA 3C71A 2HZEA 4XS1A 2GQLA 1SJIA 4EO3A 3LYKA 2C8UA 1QK8A 4JEDA 1MDIA 1H4OA 4F9ZA 3KM6A 1GUMA 4MZWA 2H70A 2GQMA 3G7IA 4PQHA 5JWRB 2GT6A 3QAVA 4X1UA 4GSSA 4YQMA 5ECOB 3HDCA 3G9BA 4HZ4A 4K2DA 1NHOA 1PMTA 3RHBA 4TR4A 1W89A 2LJAA 4LLRA 3VWXA 3VI5A 2V6KA 3CMIA 4TW5A 3GSTA 2LJKA 2R3XA 2ZUPA 3TKPA 5KN1A 1YEPA 3GKKA 1OAZA 2LNSA 2OBKA 4O5QA 4MZBA 7GSSA 2F3MA 2R4VA 3HZ8A 1A23A 2JZTA 3EVIA 3LXZA 1U88A 4NV5A 3ERGA 1PQNA 1GNWA 4PTSA 6GSUA 3ME7A 2F8FA 5D73A 5A4VA 2I81A 6GSVA 5D9VA 1M0UA 4BVXB 4RUVA 3QFAC 4PQ1A 5DQYA 2RUEA 1A0FA 2C0DA 1JHBA 4ID0A 2AHEA 2O8VB 12GSA 3DYRA 5DCHA 5J9CA 1B4QA 2YWMA 1B4PA 1K0OA 2VL3A 3KH9A 1PX7A 2K9FA 3FR9A 3QPMA 1XVQA 1GLPA 3I9V2 1PX6A 1YKAA 3P7XA 1M2AA 2HRNA 2MMZA 4WKWA 4MJEA 2N5FA 1K3YA 3HXSA 3KEBA 3A2WA 1AC1A 3UBKA 3TKRA 1JZRA 2G0FA 3UIWA 1Q98A 5ECIB 3ZRDA 2R0CA 4IBPA 3LEFA 3KH7A 1OKTA 4HI7A 1YF1A 2O89A 3CQFA 3DWVA 4L0WA 3U5RE 2MBSA 2GSTA 4DEJA 1SJZA 1HQOA 5F8BA 5IPGA 3ZL5A 5F05A 2H72A 2OBIA 4KGIA 3MYDA 2E2MA 5D8IA 1G6YA 2B5YA 3IAS2 2KHPA 2FGXA 3F0IA 2HSMA 3FR6A 3D21A 2LEGA 3DMLA 4NHWA 2XC2A 1O7UA 5DDLA 1A2MA 1QGVA 2O85A 4HEA2 2CVKA 1Z7PA 4YQUA 2HE3A 3CSJA 3C8EA 2VLTA 1N2AA 3LFLA 5CP1A 2MYGA 4MABA 3C73A 4ZL9A 2CAIA 3IR4A 1NW2A 1OYJA 2DIYA 3EMPA 2JSZA 3HVVA 1PN9A 3TGZA 3GL5A 1EEMA 4XS4A 3QD9A 2VM2A 2HRKA 1EV4A 4PNGA 2GZYA 2LUSA 2FA8A 3TKSA 1YKCA 2LKUA 3WT1A 5J9BA 3F4RA 1I9DA 4WR4A 5DJMA 2X8CA 3I6AA 3HZ4A 4IW9A 2O7KA 2FNOA 3KCMA 2AJQB 2PPTA 3M3MA 4MDCA 4TR1B 3US3A 2X4AA 2L4QA 5CRDA 4KB3A 4ZBDA 1U6TA 4BL7A 3DD3A 4LMVA 3MSZA 1BJXA 3HY2A 2MMNA 4PGTA 2WCIA 1G6WA 4H86A 3H79A 3A5IA 2HYXA 2H76A 5IMDA 3QFBC 2QC7A 2X99A 3GKMA 4KCEA 4MPFA 5DAKA 1T4YA 4KX4A 1PN0A 3C7MA 4TXOA 2WS2A 4Q5NA 4GRFA 4Z2UA 1MD4A 2EIQA 2HSYA 3CSHA 1AQXA 17GSA 3ZYWA 1EP7A 4WEYA 4L5OA 2P0GA 4G0LA 4KSOA 4TRXA 2VL2A 4HDEA 2CQ9A 5G5EA 1ZL9A 2GTUA 2WGRA 5ABRA 2R5GA 5GAND 1OE8A 4XIHA 2P5QA 5J5NA 4AJ8A 6GSXA 4NWYA 3HVNA 4RQXA 1NHYA 3LWAA 1YDKA 3IE3A 1MD3A 4BIKA 4OFTA 1YJ6A 1Z6NA 2FWGA 4K7NA 4ZBBA 2O87A 3W8SA 4TR3A 4G0KA 4WBJA 1ERWA 5HR0A 4HJMA 2H1AA 3W6GA 4OCEA 2X49A 4K9ZA 2H1GA 1FVJA 1F6MC 3HHVA 1WOUA 4GLTA 3CXGA 1SJ6A 2FHEA 3IK9A 1GSEA 3SBCA 4IP1A 1T7PB 1H75A 5GSTA 4YKFA 1LBKA 1EP8A 4MK3A 2YCDA 1SKSB 5ELAA 1NM3A 2YV7A 2C3NA 5DALB 4V2NA 2AV4A 2L57A 2I3YA 4P3YB 4A5PA 1XVWA 4J57E 2K8VA 2V1MA 1HD2A 2PBJA 3TRQA 2V2GA 1VF1A 1V57A 1JLWA 1TK8B 2ES7A 1M9AA 1XFLA 3TRXA 5JCWA 4RI7A 4AGSA 1IYIA 2HT9A 1TU8A 3F6FA 3TRPA 1ERVA 1FB0A 1IYHA 2A4HA 4HU9A 5ECPB 1K0NA 2HI7A 3N9JA 3V1WA 3EYTA 2YWIA 1FAAA 3LYPA 3FY7A 4MCUA 4ML6A 3N5OA 4BPYA 2HRAA 3M9JA 4X43A 2EC4A 1X0RA 4EKZA 1S3DA 4MZCA 2JZRA 2K6VA 3UL3A 3RPPA 5G1KA 1EWXA 4N30A 4MMMA 2EIOA 3IAM2 1CQHA 3L4NA 4RI6A 1XPVA 4XRDA 4GCIA 3TJBA 3FK8A 2N5BA 3G7YA 4MNNA 4IJIA 1MDJA 3VFIA 3VK9A 3DVWA 4I6XA 5CREA 2H0GA 1Q4JA 4AJ7A 2B1LA 3IK7A 1TI3A 4O92A 4NPBA 4OWYA 3P2AA 3EURA 2K8SA 2LTKA 4JRRA 3TJJA 4TN8A 2YP6A 3UMAA 3O6TA 3E0UA 2AB6A 3CBUA 3KXOA 3Q74A 1S3CA 1TW9A 3KJYA 3ED3A 4WETA 5AIXA 1TRVA 4EIQA 1B8XA 3GV1A 3ZZXA 2H0HA 4KH7A 3GL3A 1VRSD 2GS3A 1EGRA 5CRWA 2V6OA 2HZFA 2LRTA 4QL9A 5A4WA 1WWJA 4Q5FA 3EINA 1R5AA 1BYEA 1O73A 3VLNA 1OC9A 4PXOA 2JSYA 3IHGA 3QR6A 2H75A 3NIVA 2H01A 2DLXA 4NMUA 3WYWA 2H30A 3CTGA 4Q5QA 2V41A 16GSA 2PERA 2FWFA 2NDOA 3ZMLA 1TK0B 2VCWA 1YY7A 3GTUA 3FZ5A 1SYRA 1OC9B 1ML6A 4GQCA 4AJ6A 5H5QA 2DJKA 22GSA 5HFKA 2WB9A 3BCIA 5B6MA 5H5RA 3M0FA 5A4UA 3GHAA 3S9FA 1GTBA 2F9SA 3L9SA 4TVEA 1SENA 4MF6A 3GTUB 4I97A 5DCGA 4Q5RA 2MZCA 2ALBA 2A4VA 2FLSA 3ME8A 2N5AA 2L5OA 2WZ9A 3ZREA 4KDYA 3J7Yb 5DQSA 4NV2A 5D9TA 4WF5A 3EC3A 2LV3A 2WULA 1TKDB 1AUCA 4ECJA 2VLUA 3DXBA 2YOIA 2IN3A 3HJPA 3NOFA 2XPDA 2F51A 2PMTA 2YN1A 4NAXA 3LXTA 1T00A 1W4VA 5C00A 5HFIA 2VD1A 2H0IA 2CX4A 4CY6A 2B7JA 2VCTA 2DJJA 4BVXA 3TB2A 4XS6A 3WT2A 3CSIA 3KP9A 4OFNA 4MH2A 1GL8A 4MF5A 3TJGA 1ZZYA 1KBNA 4EDZA 1UVZA 1JZOA 4L5LA 5CYYA 3PR8A 2L6CA 4KUNA 2CAQA 4I8BA 3W8JA 3D4TA 2C0EA 4FYUA 4ZL8A 4EIPA 2NVLA 3BOAA 2H8LA 4POKA 4KF9A 4BVYB 4MF7A 1PFOA 4JZQA 3F3QA 3H8QA 2OE3A 5FHIA 1EOGA 2RM5A 6GSTA 1PA3A 4V1Ag 2J23A 3Q18A 3FZAA 1C72A 4FQUA 2CVBA 4YAVA 1OC3A 1GSDA 5ECHB 3R3EA 4LMWA 5JWQB 1T8EB 2C80A 1DBYA 4JR6A 1YF0A 4KNDA 5KOWA 4ILFA 2VOCA 1OKDA 2DSAA 3QMXA 5EVOA 2H6YA 4ZB9A 4LA1A 3GN3A 5IMCA 1AXDA 1DSBA 3QCPA 4G2EA 5IO0A 5A5KA 3E3EA 2RUFA 3TKSE 3ISOA 1GH2A 3KP8A 2CVDA 2XHFA 4J56E 4TR0A 4Z7XA 2PWJA 4K7IA 4CHSA 2VM1A 1PKZA 3RHCA 5JCGA 3UEMA 4FYBA 2CT6A 4N0VA 2B5EA 5AGYA 3WD6A 4IQAA 1GRXA 4TXVA 1EV9A 1XZOA 1LU4A 2X8HA 2DKHA 3GH6A 4N0ZA 1YEXA 2B6MA 1AQVA 1M3JA 2KP1A 5ECRB 3M8NA 3ZTLA 1Z7RA 2C0FA 4D73A 2GSQA 3NZNA 4ZILA 2X64A 2L59A 1JZWA 1B9YC 4F82A 5ECQB 2CX3A 4O32A 4KE3A 4TR1A 4Z2TA 1WPIA 5G30A 1PL2A 2L5LA 4D73B 1X9MB 2TRXA 5COHA 2H1DA 4OCFA 1JLVA 2XBIA 1WP0A
chains in the Genus database with same CATH topology
2B5XA 1O6JA 4IN0A 4KW6A 1GP1A 2GLRA 2OACA 1MTCA 2IMFA 1BEDA 2B3SA 1DUGA 3TDGA 4L8EA 1SL0B 1XWGA 3EPTA 4HQZA 1Z9HA 2FWHA 5KN3A 18GSA 4HZ2A 5B7CA 4PUFC 2LNTA 1O81A 1TRSA 4K7OA 5IOXA 1THOA 1U3AA 3FYGA 4IKHA 2AAWA 2VAFA 3TOTA 3IBHA 4I5QA 5IMFA 1WRYA 1SYXA 2B1KA 1S3AA 2GDRA 3WGDA 1JZDA 2YPMA 4DSSB 3FRCA 3GUSA 1VF3A 2FY6A 4EE0A 1XCCA 1F2EA 2VUPA 19GSA 3LGCA 4FH8A 1V9WA 3O3TA 2JU5A 4F0BA 4IELA 3E9JB 3HJOA 1XXUA 3FR3A 1PRXA 2H19A 2PVQA 5E59A 5EY6A 2GT5A 5GZZB 1T3BA 3KMOA 1B9XC 1A8LA 5ID2B 4E8EA 4K5SA 1FO5A 2OADA 5FT3A 3RBTA 5DALA 1K3LA 1F3BA 5AISA 1TRUA 5F07A 1AIUA 3FHKA 5IMAA 2PU9C 3EU4A 2GZPA 3C1RA 1QFNA 2VIMA 1ON4A 1M99A 5IO2A 3M9KA 5BMUA 1J08A 2NPBA 4MPGA 1SL2B 2DJ2A 2E0QA 3L9VA 3F8UA 1TJDA 1J0FA 3DEXA 2HRFA 5KEJA 3AY8A 3F3RA 1ZCPA 1X5DA 1TDIA 4MA9A 2VCVA 3K8NA 5JCUA 1U3IA 4OO4A 2TIRA 5J4UA 4ZB8A 4DVCA 3ERFA 1HNAA 4G9HA 1RW1A 3ZVJD 4PQIA 2YANA 2QGVA 2LQOA 3TJKA 4GXZA 4N10A 2YWOA 5IMVA 5DJLA 1PL1A 2R0GA 2VO4A 5IMZA 1EOHA 2IFQA 4K0NA 2YZUA 2ON7A 4G19A 4EF0A 4GF0A 4FYCA 4IHUA 1HNCA 3C1SA 2OE1A 2ZNMA 5DVBA 4PURA 3GFKA 5D96A 5G31A 2I9HA 5LCZA 4OO5A 3MNGA 1LJRA 3VI7A 3LJRA 5ECLB 3D6IA 2IFQB 3H1NA 1V58A 4IP6A 3VWWA 1V2AA 1BX9A 1GSUA 1XW9A 4ZL7A 2MMAA 4AF2A 2LJRA 3L9UA 4GSNA 4BA7A 5CRHA 1XW6A 3FKFA 4RQRA 2R37A 3GMFA 4I2TA 3VWVA 2YNXA 3PGTA 2FD3A 5ELGA 4HS1A 1USBA 1K0CA 3DGQA 2HSHA 2CA8A 1V98A 3G7JA 2IMKA 3ZMKA 3BJ5A 2C4JA 2I4AA 2KUCA 3HD5A 1T1VA 2YZHA 3GNJA 5FWGA 4BWQA 2UZ8A 1M9BA 2VCQA 2GZZA 5LD0A 1VGLA 3WGXA 4USSA 3RAZA 1O85A 2FCHA 3TOUA 3APQA 3IA1A 1URMA 4HJ2A 2Z9SA 3FZ4A 1K3OA 1M7TA 4NXIA 4X4JA 3ZITA 4GWRA 3A2VA 3DVXA 2H1BA 4ZXGA 3CRUA 2B7KA 2M46A 1PSQA 3BCKA 5CAXA 4GSTA 1JFUA 2GSSA 3HKRA 2IMEA 2IPAA 3UJ1A 2NBSA 2J9HA 1XWKA 4PX1A 1TI1A 3D0ZA 3F4SA 5C04A 5IIZA 1EGOA 3IXRA 4CY8A 4G10A 2AYTA 1ABAA 3GX0A 3OR5A 2V32A 1SU9A 4IQ1A 3QAWA 2XBQA 4WXTA 4EVMA 1ZYQB 1J9BA 4JR4A 4K6XA 4POLA 1SKRB 14GSA 4MJAA 4MLYA 2GVPA 1K0MA 3TCOA 4O7HA 2IMDA 3MDKA 4F03A 3Q6OA 8GSSA 2E2GA 4MJBA 4K2XA 3ZVJA 3CYNA 1XOAA 1FG4A 5IQYA 1AAZA 3FMWA 3KD0A 2FUG2 2L6DA 2D2ZA 5B8BA 5J41A 3UARA 1OE7A 2GQKA 1K0BA 5ECNB 3IC8A 4QQ7A 1GULA 2HZEB 1KEBA 1RQMA 4HQSA 2KLXA 1PKWA 2OE0A 2JL4A 5ECKB 4J2FA 5KN2A 4L0UA 1E2YA 4V2LA 4I2UA 3P90A 2GSRA 4JU5A 3FEUA 2K18A 1YZXA 3LSZA 3D4MA 4POBA 4EUYA 4ZBAA 3MWHA 2M80A 2H71A 4BVYA 3HJMA 4O5UA 1FHEA 3VWUA 4FIWA 1X9WB 1OC8A 2DMLA 2IJYA 3GIXA 3I69A 1ZMAA 2YWNA 3F6DA 1XIYA 1KNGA 1X9SB 3UAPA 1TTZA 1SKWB 1A24A 5IPHA 3APOA 2LRNA 3VPTA 3P8WA 3GSSA 3IC4A 9GSSA 1QQ2A 3QDNA 3WGEA 4JBBA 4EDYA 1M2BA 3IDVA 3HVXA 13GSA 2MMOA 3VPQA 1AW9A 4YAPA 5G2ZA 1F3AA 4ACSA 3ZIVA 2KP2A 1BAYA 3IOSA 6GSSA 1UA5A 2C1YA 2QKEA 3QAGA 2KOKA 6GSYA 1Z5YE 3APSA 4O5RA 1ZOFA 3GRXA 3FW2A 1SK1A 3HCZA 1GWCA 5J3RA 2YJHA 1GSQA 1CQGA 1F9MA 1GLQA 3BD2A 4KAEA 5GAPD 4KSMA 1SD8A 2A2SA 3U6VA 3KTBA 4WBRD 5L71A 2MBTA 5HR2A 1A8YA 4V2MA 2PVOC 2C3TA 4E8HA 1X5CA 2VD0A 1NSWA 5KOXA 4XCSA 3RDWA 4ECCA 1PD21 4ML1A 2VLVA 3F9UA 1N8JA 4IJ3A 3LG6A 2FA4A 1QUWA 3GKXA 2DBCA 2PGTA 4QL7A 1VF2A 5B8AA 3ZLPA 4YH2A 5INYA 4Z2RA 5EPFA 5ECSA 4XTSA 3D5JA 3F63A 4ZIJA 2CZ3A 4LL4B 4MP4A 4OD7A 4X0XA 1B48A 3ZFLA 2CV4A 1FW1A 3LW9A 4HOJA 2XPEA 3H4KA 5G5FA 2IL3A 2H66A 1ZYEA 1Z3EA 4DSQA 1GNEA 3RPNA 1FB6A 2LQQA 1THXA 3A3TA 5G1LA 2C0GA 4OFMA 4EC0A 3JCML 2IWTA 1DE1A 1SK0A 4POMA 4CW9A 2BMXA 3BBYA 4GQFA 2OA7A 1M2DA 4K1FA 4N11A 5GSSA 3O76A 2JZSA 4NHZA 1MDKA 3QOUA 4K8MA 5D9XA 3ERWA 1ZYNA 3VURA 3IV4A 4XS4B 2WFCA 2BJXA 4TKYA 3ZFBA 4EL1A 2LSTA 4DSSA 3MAKA 3MIXA 3EE2A 5BRTA 3UVTA 1WJKA 4ISDA 3IRAA 3GYKA 5EL8A 1I5GA 4G0IA 1KTEA 3EMXA 1ST9A 4HUAA 3DIEA 4KDXA 4BL7B 3IHQA 3TKSC 4YQVA 5JWOB 1F37A 2F8AA 3HVSA 1Z6MA 4XHMA 1GSFA 1SK2A 1X5EA 1R26A 5H5SA 6GSWA 5DBQA 2A2RA 5DAKB 1TXXA 5F06A 4PUAA 4TXOB 3UVHA 5ID2A 5CNWA 10GSA 4PNFA 2BTOT 2VCZA 4KDUA 2DC5A 2LRCA 2HLSA 4ECBA 1UC7A 1U87A 3TJFA 5B6NA 3ZIJA 4YKGA 1A2JA 2GGTA 11GSA 1O8XA 3TUEA 2R6KA 4IVFA 1T4ZA 3EU3A 1V40A 1XWAA 3PPUA 4KCAA 4XRAA 3KGKA 1GTUA 5CRGA 2LS5A 3D22A 1A2LA 2C3QA 2DIZA 1XWCA 2H74A 3GX8A 2DMMA 1BG5A 3GURA 3L0HA 1XW5A 1Y25A 2WJUA 2H73A 5IOWA 1G7EA 3GA4A 3IPZA 1XOBA 2VL2C 1TK5B 2RM6A 3I43A 3KMNA 4HU7A 1RK4A 2DJ1A 1MEKA 1R4WA 2RIIA 3UBLA 2WRTA 5ECMB 4KA0A 1ERTA 2HXKA 2H6ZA 2ZCTA 1WE0A 3KZQA 3PINA 1YQ1A 5CO3A 1ZGNA 1XBSA 2REMA 4ZB6A 5KN0A 2I1UA 4BWSA 4F2IA 5AIVA 5F0GA 4OMVA 2JACA 3M1GA 5HR1A 1FOHA 4JE1A 1ERUA 2L4CA 4WF4A 1QXHA 2TRCP 1DE2A 1XWBA 2QA1A 1GSSA 2VL9A 3F4TA 2DJ0A 1ACVA 5ENUA 5AN1A 2R2JA 3HA9A 4CDOA 2A2PA 3DRNA 3Q19A 5HFGA 1O8WA 2IIYA 2E7PA 2R0PA 1GSYA 3GKNA 5IM9A 4ECIA 3H93A 1ZYPA 1Y6EA 1GUHA 2M72A 1EZKA 2FWEA 3KIJA 1SL1B 1R5PA 1K0DA 1TP9A 3J7Yk 2CZ2A 2RLIA 3L78A 4LL1B 4ICYA 1G0TA 4EXJA 4V1Ap 4FO5A 3KTLA 1HYUA 20GSA 4MJCA 2AUVA 3SWLA 4F0CA 2IMIA 3HYPA 5D9WA 2JADA 5LNKe 4K5RA 2QA2A 3TKQA 2HNLA 4WR5A 2H6XA 1ILOA 1PGTA 3FZ9A 2P5RA 3A2XA 1A0RP 1UN2A 4ULXA 4DSRA 1EEJA 1SD9A 3A5WA 2PUKC 3UOMA 2OJLA 2EIRA 2YV9A 4MH3A 5HR3A 5HQPA 1GTIA 1K0AA 4IS0A 2YJ7A 1E6BA 3DKSA 1WIKA 1GTAA 1BQ7A 3LORA 1AQWA 3CTFA 1TRWA 2WDUA 5D93A 1G7OA 3LQ7A 2VCXA 2DJ3A 2HFDA 4IGJA 2PN8A 2X8GA 1OVNA 2QSIA 3GH9A 1TOFA 5E4WA 1GUKA 2P31A 3R2QA 3EWLA 2ON5A 1FVKA 1HNBA 1TU7A 1FOVA 3PH9A 1WMJA 4TOPA 2G2QA 2OKAA 2NTOA 2DKIA 3CRTA 1QMVA 4K0GA 1R7HA 1VF4A 4GTUA 3C71A 2HZEA 4XS1A 2GQLA 1SJIA 4EO3A 3LYKA 2C8UA 1QK8A 4JEDA 1MDIA 1H4OA 4F9ZA 3KM6A 1GUMA 4MZWA 2H70A 2GQMA 3G7IA 4PQHA 5JWRB 2GT6A 3QAVA 4X1UA 4GSSA 4YQMA 5ECOB 3HDCA 3G9BA 4HZ4A 4K2DA 1NHOA 1PMTA 3RHBA 4TR4A 1W89A 2LJAA 4LLRA 3VWXA 3VI5A 2V6KA 3CMIA 4TW5A 3GSTA 2LJKA 2R3XA 2ZUPA 3TKPA 5KN1A 1YEPA 3GKKA 1OAZA 2LNSA 2OBKA 4O5QA 4MZBA 7GSSA 2F3MA 2R4VA 3HZ8A 1A23A 2JZTA 3EVIA 3LXZA 1U88A 4NV5A 3ERGA 1PQNA 1GNWA 4PTSA 6GSUA 3ME7A 2F8FA 5D73A 5A4VA 2I81A 6GSVA 5D9VA 1M0UA 4BVXB 4RUVA 3QFAC 4PQ1A 5DQYA 2RUEA 1A0FA 2C0DA 1JHBA 4ID0A 2AHEA 2O8VB 12GSA 3DYRA 5DCHA 5J9CA 1B4QA 2YWMA 1B4PA 1K0OA 2VL3A 3KH9A 1PX7A 2K9FA 3FR9A 3QPMA 1XVQA 1GLPA 3I9V2 1PX6A 1YKAA 3P7XA 1M2AA 2HRNA 2MMZA 4WKWA 4MJEA 2N5FA 1K3YA 3HXSA 3KEBA 3A2WA 1AC1A 3UBKA 3TKRA 1JZRA 2G0FA 3UIWA 1Q98A 5ECIB 3ZRDA 2R0CA 4IBPA 3LEFA 3KH7A 1OKTA 4HI7A 1YF1A 2O89A 3DWVA 4L0WA 3U5RE 4DEJA 2MBSA 2GSTA 1SJZA 1HQOA 5F8BA 5IPGA 3ZL5A 5F05A 2H72A 2OBIA 4KGIA 3MYDA 2E2MA 5D8IA 1G6YA 2B5YA 3IAS2 2KHPA 2FGXA 3F0IA 2HSMA 3FR6A 3D21A 2LEGA 3DMLA 4NHWA 2XC2A 1O7UA 5DDLA 1A2MA 1QGVA 2O85A 4HEA2 2CVKA 1Z7PA 4YQUA 2HE3A 3CSJA 3C8EA 2VLTA 1N2AA 3LFLA 5CP1A 2MYGA 4MABA 3C73A 4ZL9A 2CAIA 3IR4A 1NW2A 1OYJA 2DIYA 3EMPA 2JSZA 3HVVA 1PN9A 3TGZA 3GL5A 1EEMA 4XS4A 3QD9A 2VM2A 2HRKA 1EV4A 4PNGA 2GZYA 2LUSA 2FA8A 3TKSA 1YKCA 2LKUA 3WT1A 5J9BA 3F4RA 1I9DA 4WR4A 5DJMA 2X8CA 3I6AA 3HZ4A 4IW9A 2O7KA 2FNOA 3KCMA 2AJQB 2PPTA 3M3MA 4MDCA 4TR1B 3US3A 2X4AA 2L4QA 5CRDA 4KB3A 4ZBDA 1U6TA 4BL7A 3DD3A 4LMVA 3MSZA 1BJXA 3HY2A 2MMNA 4PGTA 2WCIA 1G6WA 4H86A 3H79A 3A5IA 2HYXA 2H76A 5IMDA 3QFBC 2QC7A 2X99A 3GKMA 4KCEA 4MPFA 5DAKA 1T4YA 4KX4A 1PN0A 3C7MA 4TXOA 2WS2A 4Q5NA 4GRFA 4Z2UA 1MD4A 2EIQA 2HSYA 3CSHA 1AQXA 17GSA 3ZYWA 1EP7A 4WEYA 4L5OA 2P0GA 4G0LA 4KSOA 4TRXA 2VL2A 4HDEA 2CQ9A 5G5EA 1ZL9A 2GTUA 2WGRA 5ABRA 2R5GA 5GAND 1OE8A 4XIHA 2P5QA 5J5NA 4AJ8A 6GSXA 4NWYA 4RQXA 1NHYA 3LWAA 1YDKA 3IE3A 1MD3A 4OFTA 1YJ6A 1Z6NA 2FWGA 4K7NA 4ZBBA 2O87A 3W8SA 4TR3A 4G0KA 4WBJA 1ERWA 5HR0A 4HJMA 2H1AA 3W6GA 4OCEA 2X49A 4K9ZA 2H1GA 1FVJA 1F6MC 3HHVA 1WOUA 4GLTA 3CXGA 1SJ6A 2FHEA 3IK9A 1GSEA 3SBCA 4IP1A 1T7PB 1H75A 5GSTA 4YKFA 1LBKA 1EP8A 4MK3A 2YCDA 1SKSB 5ELAA 1NM3A 2YV7A 2C3NA 5DALB 4V2NA 2AV4A 2L57A 2I3YA 4P3YB 4A5PA 1XVWA 4J57E 2K8VA 2V1MA 1HD2A 2PBJA 3TRQA 2V2GA 1VF1A 1V57A 1JLWA 1TK8B 2ES7A 1M9AA 1XFLA 3TRXA 5JCWA 4RI7A 4AGSA 1IYIA 2HT9A 1TU8A 3F6FA 3TRPA 1ERVA 1FB0A 1IYHA 2A4HA 4HU9A 5ECPB 1K0NA 2HI7A 3N9JA 3V1WA 3EYTA 2YWIA 1FAAA 3LYPA 3FY7A 4MCUA 4ML6A 3N5OA 4BPYA 2HRAA 3M9JA 4X43A 2EC4A 1X0RA 4EKZA 1S3DA 4MZCA 2JZRA 2K6VA 3UL3A 3RPPA 5G1KA 1EWXA 4N30A 4MMMA 2EIOA 3IAM2 1CQHA 3L4NA 4RI6A 1XPVA 4XRDA 4GCIA 3TJBA 3FK8A 2N5BA 3G7YA 4MNNA 4IJIA 1MDJA 3VFIA 3VK9A 3DVWA 4I6XA 5CREA 2H0GA 1Q4JA 4AJ7A 2B1LA 3IK7A 1TI3A 4O92A 4NPBA 4OWYA 3P2AA 3EURA 2K8SA 2LTKA 4JRRA 3TJJA 4TN8A 2YP6A 3UMAA 3O6TA 3E0UA 2AB6A 3CBUA 3KXOA 3Q74A 1S3CA 1TW9A 3KJYA 3ED3A 4WETA 5AIXA 1TRVA 4EIQA 1B8XA 3GV1A 3ZZXA 2H0HA 4KH7A 3GL3A 1VRSD 2GS3A 1EGRA 5CRWA 2V6OA 2HZFA 2LRTA 4QL9A 5A4WA 1WWJA 4Q5FA 3EINA 1R5AA 1BYEA 1O73A 3VLNA 1OC9A 4PXOA 2JSYA 3IHGA 3QR6A 2H75A 3NIVA 2H01A 2DLXA 4NMUA 3WYWA 2H30A 3CTGA 4Q5QA 2V41A 16GSA 2PERA 2FWFA 2NDOA 3ZMLA 1TK0B 2VCWA 1YY7A 3GTUA 3FZ5A 1SYRA 1OC9B 1ML6A 4GQCA 4AJ6A 5H5QA 2DJKA 22GSA 5HFKA 2WB9A 3BCIA 5B6MA 5H5RA 3M0FA 5A4UA 3GHAA 3S9FA 1GTBA 2F9SA 3L9SA 4TVEA 1SENA 4MF6A 3GTUB 4I97A 5DCGA 4Q5RA 2MZCA 2ALBA 2A4VA 2FLSA 3ME8A 2N5AA 2L5OA 2WZ9A 3ZREA 4KDYA 3J7Yb 5DQSA 4NV2A 5D9TA 4WF5A 3EC3A 2LV3A 2WULA 1TKDB 1AUCA 4ECJA 2VLUA 3DXBA 2YOIA 2IN3A 3HJPA 3NOFA 2XPDA 2F51A 2PMTA 2YN1A 4NAXA 3LXTA 1T00A 1W4VA 5C00A 5HFIA 2VD1A 2H0IA 2CX4A 4CY6A 2B7JA 2VCTA 2DJJA 4BVXA 3TB2A 4XS6A 3WT2A 3CSIA 3KP9A 4OFNA 4MH2A 1GL8A 4MF5A 3TJGA 1ZZYA 1KBNA 4EDZA 1UVZA 1JZOA 4L5LA 5CYYA 3PR8A 2L6CA 4KUNA 2CAQA 4I8BA 3W8JA 3D4TA 2C0EA 4FYUA 4ZL8A 4EIPA 2NVLA 3BOAA 2H8LA 4POKA 4KF9A 4BVYB 4MF7A 4JZQA 3F3QA 3H8QA 2OE3A 5FHIA 1EOGA 2RM5A 6GSTA 1PA3A 4V1Ag 2J23A 3Q18A 3FZAA 1C72A 4FQUA 2CVBA 4YAVA 1OC3A 1GSDA 5ECHB 3R3EA 4LMWA 5JWQB 1T8EB 2C80A 1DBYA 4JR6A 1YF0A 4KNDA 5KOWA 4ILFA 2VOCA 1OKDA 2DSAA 3QMXA 5EVOA 2H6YA 4ZB9A 4LA1A 3GN3A 5IMCA 1AXDA 1DSBA 3QCPA 4G2EA 5IO0A 5A5KA 3E3EA 2RUFA 3TKSE 3ISOA 1GH2A 3KP8A 2CVDA 2XHFA 4J56E 4TR0A 4Z7XA 2PWJA 4K7IA 4CHSA 2VM1A 1PKZA 3RHCA 5JCGA 3UEMA 4FYBA 2CT6A 4N0VA 2B5EA 5AGYA 3WD6A 4IQAA 1GRXA 4TXVA 1EV9A 1XZOA 1LU4A 2X8HA 2DKHA 3GH6A 4N0ZA 1YEXA 2B6MA 1AQVA 2KP1A 5ECRB 3M8NA 3ZTLA 1Z7RA 2C0FA 4D73A 2GSQA 3NZNA 4ZILA 2X64A 2L59A 1JZWA 1B9YC 4F82A 5ECQB 2CX3A 4O32A 4KE3A 4TR1A 4Z2TA 1WPIA 5G30A 1PL2A 2L5LA 4D73B 1X9MB 2TRXA 5COHA 2H1DA 4OCFA 1JLVA 2XBIA 1WP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5X A;  1O6J A;  4IN0 A;  4KW6 A;  1GP1 A;  2GLR A;  2OAC A;  1MTC A;  2IMF A;  1BED A;  2B3S A;  1DUG A;  3TDG A;  4L8E A;  1SL0 B;  1XWG A;  4HQZ A;  1Z9H A;  2FWH A;  5KN3 A;  18GS A;  4HZ2 A;  5B7C A;  4PUF C;  2LNT A;  1O81 A;  1TRS A;  4K7O A;  5IOX A;  1THO A;  1U3A A;  3FYG A;  4IKH A;  2AAW A;  2VAF A;  3TOT A;  3IBH A;  4I5Q A;  5IMF A;  1WRY A;  1SYX A;  2B1K A;  1S3A A;  2GDR A;  3WGD A;  1JZD A;  2YPM A;  4DSS B;  3FRC A;  3GUS A;  1VF3 A;  2FY6 A;  4EE0 A;  1XCC A;  1F2E A;  2VUP A;  19GS A;  3LGC A;  4FH8 A;  1V9W A;  3O3T A;  2JU5 A;  4F0B A;  4IEL A;  3E9J B;  3HJO A;  1XXU A;  3FR3 A;  1PRX A;  2H19 A;  2PVQ A;  5E59 A;  5EY6 A;  2GT5 A;  5GZZ B;  1T3B A;  3KMO A;  1B9X C;  1A8L A;  5ID2 B;  4E8E A;  1FO5 A;  2OAD A;  5FT3 A;  3RBT A;  5DAL A;  1K3L A;  1F3B A;  5AIS A;  1TRU A;  5F07 A;  1AIU A;  3FHK A;  5IMA A;  2PU9 C;  3EU4 A;  2GZP A;  3C1R A;  1QFN A;  2VIM A;  1ON4 A;  1M99 A;  5IO2 A;  3M9K A;  1J08 A;  2NPB A;  4MPG A;  1SL2 B;  2DJ2 A;  2E0Q A;  3L9V A;  3F8U A;  1TJD A;  1J0F A;  3DEX A;  2HRF A;  5KEJ A;  3AY8 A;  3F3R A;  1ZCP A;  1X5D A;  1TDI A;  4MA9 A;  2VCV A;  3K8N A;  5JCU A;  1U3I A;  4OO4 A;  2TIR A;  5J4U A;  4ZB8 A;  4DVC A;  3ERF A;  1HNA A;  4G9H A;  1RW1 A;  3ZVJ D;  4PQI A;  2YAN A;  2QGV A;  2LQO A;  3TJK A;  4GXZ A;  4N10 A;  2YWO A;  5IMV A;  5DJL A;  1PL1 A;  2VO4 A;  5IMZ A;  1EOH A;  2IFQ A;  4K0N A;  2YZU A;  2ON7 A;  4G19 A;  4EF0 A;  4GF0 A;  4FYC A;  4IHU A;  1HNC A;  3C1S A;  2OE1 A;  2ZNM A;  5DVB A;  4PUR A;  3GFK A;  5D96 A;  5G31 A;  2I9H A;  5LCZ A;  4OO5 A;  3MNG A;  1LJR A;  3VI7 A;  3LJR A;  5ECL B;  3D6I A;  2IFQ B;  3H1N A;  1V58 A;  4IP6 A;  3VWW A;  1V2A A;  1BX9 A;  1GSU A;  1XW9 A;  4ZL7 A;  2MMA A;  4AF2 A;  2LJR A;  3L9U A;  4GSN A;  4BA7 A;  5CRH A;  1XW6 A;  3FKF A;  4RQR A;  2R37 A;  3GMF A;  4I2T A;  3VWV A;  2YNX A;  3PGT A;  2FD3 A;  5ELG A;  4HS1 A;  1USB A;  1K0C A;  3DGQ A;  2HSH A;  2CA8 A;  1V98 A;  3G7J A;  2IMK A;  3ZMK A;  3BJ5 A;  2C4J A;  2I4A A;  2KUC A;  3HD5 A;  1T1V A;  2YZH A;  3GNJ A;  5FWG A;  4BWQ A;  1M9B A;  2VCQ A;  2GZZ A;  5LD0 A;  1VGL A;  3WGX A;  3RAZ A;  1O85 A;  2FCH A;  3TOU A;  3APQ A;  3IA1 A;  1URM A;  4HJ2 A;  2Z9S A;  3FZ4 A;  1K3O A;  1M7T A;  4NXI A;  3ZIT A;  4GWR A;  3A2V A;  3DVX A;  2H1B A;  4ZXG A;  3CRU A;  2B7K A;  2M46 A;  1PSQ A;  3BCK A;  5CAX A;  4GST A;  1JFU A;  2GSS A;  3HKR A;  2IME A;  2IPA A;  3UJ1 A;  2NBS A;  2J9H A;  1XWK A;  4PX1 A;  1TI1 A;  3D0Z A;  3F4S A;  5C04 A;  5IIZ A;  1EGO A;  3IXR A;  4G10 A;  2AYT A;  1ABA A;  3GX0 A;  3OR5 A;  2V32 A;  1SU9 A;  4IQ1 A;  3QAW A;  2XBQ A;  4WXT A;  4EVM A;  1ZYQ B;  1J9B A;  4JR4 A;  4K6X A;  4POL A;  1SKR B;  14GS A;  4MJA A;  4MLY A;  2GVP A;  1K0M A;  3TCO A;  4O7H A;  2IMD A;  3MDK A;  4F03 A;  3Q6O A;  8GSS A;  2E2G A;  4MJB A;  3ZVJ A;  3CYN A;  1XOA A;  1FG4 A;  5IQY A;  1AAZ A;  3KD0 A;  2FUG 2;  2L6D A;  2D2Z A;  5B8B A;  5J41 A;  3UAR A;  1OE7 A;  2GQK A;  1K0B A;  4QQ7 A;  1GUL A;  2HZE B;  1KEB A;  1RQM A;  4HQS A;  2KLX A;  1PKW A;  2OE0 A;  2JL4 A;  5ECK B;  4J2F A;  5KN2 A;  4L0U A;  1E2Y A;  4V2L A;  4I2U A;  3P90 A;  2GSR A;  4JU5 A;  3FEU A;  2K18 A;  1YZX A;  3LSZ A;  3D4M A;  4POB A;  4EUY A;  4ZBA A;  3MWH A;  2M80 A;  2H71 A;  4BVY A;  3HJM A;  1FHE A;  3VWU A;  4FIW A;  1X9W B;  1OC8 A;  2DML A;  2IJY A;  3GIX A;  3I69 A;  1ZMA A;  2YWN A;  3F6D A;  1XIY A;  1KNG A;  1X9S B;  3UAP A;  1TTZ A;  1SKW B;  1A24 A;  5IPH A;  3APO A;  2LRN A;  3VPT A;  3P8W A;  3GSS A;  3IC4 A;  9GSS A;  1QQ2 A;  3QDN A;  3WGE A;  4JBB A;  4EDY A;  1M2B A;  3IDV A;  3HVX A;  13GS A;  2MMO A;  3VPQ A;  1AW9 A;  4YAP A;  5G2Z A;  1F3A A;  4ACS A;  3ZIV A;  2KP2 A;  1BAY A;  3IOS A;  6GSS A;  1UA5 A;  2C1Y A;  2QKE A;  3QAG A;  2KOK A;  6GSY A;  1Z5Y E;  3APS A;  4O5R A;  1ZOF A;  3GRX A;  3FW2 A;  1SK1 A;  3HCZ A;  1GWC A;  5J3R A;  2YJH A;  1GSQ A;  1CQG A;  1F9M A;  1GLQ A;  3BD2 A;  4KAE A;  5GAP D;  4KSM A;  1SD8 A;  2A2S A;  3U6V A;  3KTB A;  4WBR D;  5L71 A;  2MBT A;  5HR2 A;  1A8Y A;  4V2M A;  2PVO C;  2C3T A;  4E8H A;  1X5C A;  2VD0 A;  1NSW A;  4XCS A;  3RDW A;  4ECC A;  1PD2 1;  4ML1 A;  2VLV A;  3F9U A;  1N8J A;  4IJ3 A;  3LG6 A;  2FA4 A;  1QUW A;  3GKX A;  2DBC A;  2PGT A;  4QL7 A;  1VF2 A;  5B8A A;  3ZLP A;  4YH2 A;  5INY A;  5EPF A;  5ECS A;  4XTS A;  3D5J A;  3F63 A;  4ZIJ A;  2CZ3 A;  4LL4 B;  4MP4 A;  4OD7 A;  4X0X A;  1B48 A;  3ZFL A;  2CV4 A;  1FW1 A;  4HOJ A;  2XPE A;  3H4K A;  5G5F A;  2IL3 A;  2H66 A;  1ZYE A;  1Z3E A;  4DSQ A;  1GNE A;  3RPN A;  1FB6 A;  2LQQ A;  1THX A;  3A3T A;  5G1L A;  2C0G A;  4OFM A;  4EC0 A;  3JCM L;  2IWT A;  1DE1 A;  1SK0 A;  4POM A;  4CW9 A;  2BMX A;  3BBY A;  4GQF A;  2OA7 A;  1M2D A;  4K1F A;  4N11 A;  5GSS A;  3O76 A;  2JZS A;  4NHZ A;  1MDK A;  3QOU A;  4K8M A;  5D9X A;  3ERW A;  3VUR A;  3IV4 A;  4XS4 B;  2WFC A;  2BJX A;  4TKY A;  3ZFB A;  4EL1 A;  2LST A;  4DSS A;  3MAK A;  3EE2 A;  3UVT A;  1WJK A;  4ISD A;  3IRA A;  3GYK A;  5EL8 A;  1I5G A;  1KTE A;  3EMX A;  1ST9 A;  4HUA A;  3DIE A;  4KDX A;  3IHQ A;  3TKS C;  4YQV A;  5JWO B;  1F37 A;  2F8A A;  3HVS A;  1Z6M A;  4XHM A;  1GSF A;  1SK2 A;  1X5E A;  1R26 A;  5H5S A;  6GSW A;  5DBQ A;  2A2R A;  5DAK B;  1TXX A;  5F06 A;  4PUA A;  4TXO B;  3UVH A;  5ID2 A;  5CNW A;  10GS A;  4PNF A;  2BTO T;  2VCZ A;  4KDU A;  2DC5 A;  2LRC A;  2HLS A;  4ECB A;  1UC7 A;  1U87 A;  3TJF A;  5B6N A;  3ZIJ A;  1A2J A;  2GGT A;  11GS A;  1O8X A;  3TUE A;  2R6K A;  4IVF A;  1T4Z A;  3EU3 A;  1V40 A;  1XWA A;  4KCA A;  4XRA A;  3KGK A;  1GTU A;  5CRG A;  2LS5 A;  3D22 A;  1A2L A;  2C3Q A;  2DIZ A;  1XWC A;  2H74 A;  3GX8 A;  2DMM A;  1BG5 A;  3GUR A;  3L0H A;  1XW5 A;  1Y25 A;  2WJU A;  2H73 A;  5IOW A;  1G7E A;  3GA4 A;  3IPZ A;  1XOB A;  2VL2 C;  1TK5 B;  2RM6 A;  3I43 A;  3KMN A;  4HU7 A;  1RK4 A;  2DJ1 A;  1MEK A;  1R4W A;  2RII A;  3UBL A;  2WRT A;  5ECM B;  4KA0 A;  1ERT A;  2HXK A;  2H6Z A;  2ZCT A;  1WE0 A;  3KZQ A;  3PIN A;  1YQ1 A;  5CO3 A;  1ZGN A;  1XBS A;  2REM A;  4ZB6 A;  5KN0 A;  2I1U A;  4BWS A;  4F2I A;  5AIV A;  5F0G A;  4OMV A;  2JAC A;  3M1G A;  5HR1 A;  4JE1 A;  1ERU A;  2L4C A;  4WF4 A;  1QXH A;  2TRC P;  1DE2 A;  1XWB A;  1GSS A;  2VL9 A;  3F4T A;  2DJ0 A;  1ACV A;  5ENU A;  5AN1 A;  2R2J A;  3HA9 A;  4CDO A;  3DRN A;  3Q19 A;  5HFG A;  1O8W A;  2IIY A;  2E7P A;  1GSY A;  3GKN A;  5IM9 A;  4ECI A;  3H93 A;  1Y6E A;  1GUH A;  2M72 A;  1EZK A;  2FWE A;  3KIJ A;  1SL1 B;  1R5P A;  1K0D A;  1TP9 A;  3J7Y k;  2CZ2 A;  2RLI A;  3L78 A;  4LL1 B;  1G0T A;  4EXJ A;  4V1A p;  4FO5 A;  3KTL A;  1HYU A;  20GS A;  4MJC A;  2AUV A;  3SWL A;  4F0C A;  2IMI A;  3HYP A;  5D9W A;  2JAD A;  5LNK e;  3TKQ A;  2HNL A;  4WR5 A;  2H6X A;  1ILO A;  1PGT A;  3FZ9 A;  2P5R A;  3A2X A;  1A0R P;  1UN2 A;  4ULX A;  4DSR A;  1EEJ A;  1SD9 A;  3A5W A;  2PUK C;  3UOM A;  2OJL A;  2EIR A;  2YV9 A;  4MH3 A;  5HR3 A;  5HQP A;  1GTI A;  1K0A A;  4IS0 A;  2YJ7 A;  1E6B A;  3DKS A;  1WIK A;  1GTA A;  1BQ7 A;  3LOR A;  1AQW A;  3CTF A;  1TRW A;  2WDU A;  5D93 A;  1G7O A;  3LQ7 A;  2VCX A;  2DJ3 A;  2HFD A;  4IGJ A;  2PN8 A;  2X8G A;  1OVN A;  2QSI A;  3GH9 A;  1TOF A;  5E4W A;  1GUK A;  2P31 A;  3R2Q A;  3EWL A;  2ON5 A;  1FVK A;  1HNB A;  1TU7 A;  1FOV A;  3PH9 A;  1WMJ A;  4TOP A;  2G2Q A;  2OKA A;  2NTO A;  3CRT A;  1QMV A;  4K0G A;  1R7H A;  1VF4 A;  4GTU A;  3C71 A;  2HZE A;  4XS1 A;  2GQL A;  1SJI A;  4EO3 A;  3LYK A;  2C8U A;  1QK8 A;  4JED A;  1MDI A;  1H4O A;  4F9Z A;  3KM6 A;  1GUM A;  4MZW A;  2H70 A;  2GQM A;  3G7I A;  4PQH A;  5JWR B;  2GT6 A;  3QAV A;  4X1U A;  4GSS A;  4YQM A;  5ECO B;  3HDC A;  3G9B A;  4HZ4 A;  4K2D A;  1NHO A;  1PMT A;  3RHB A;  4TR4 A;  1W89 A;  2LJA A;  4LLR A;  3VWX A;  3VI5 A;  2V6K A;  3CMI A;  4TW5 A;  3GST A;  2LJK A;  2R3X A;  2ZUP A;  3TKP A;  5KN1 A;  1YEP A;  3GKK A;  1OAZ A;  2LNS A;  2OBK A;  4MZB A;  7GSS A;  2F3M A;  2R4V A;  3HZ8 A;  1A23 A;  2JZT A;  3EVI A;  3LXZ A;  1U88 A;  4NV5 A;  3ERG A;  1PQN A;  1GNW A;  6GSU A;  3ME7 A;  2F8F A;  5D73 A;  5A4V A;  2I81 A;  6GSV A;  5D9V A;  1M0U A;  4RUV A;  3QFA C;  4PQ1 A;  5DQY A;  2RUE A;  1A0F A;  2C0D A;  1JHB A;  4ID0 A;  2AHE A;  2O8V B;  5DCH A;  12GS A;  3DYR A;  5J9C A;  1B4Q A;  2YWM A;  1B4P A;  1K0O A;  2VL3 A;  3KH9 A;  1PX7 A;  2K9F A;  3FR9 A;  3QPM A;  1XVQ A;  1GLP A;  3I9V 2;  1PX6 A;  1YKA A;  3P7X A;  1M2A A;  2HRN A;  2MMZ A;  4WKW A;  4MJE A;  2N5F A;  1K3Y A;  3HXS A;  3KEB A;  3A2W A;  1AC1 A;  3UBK A;  3TKR A;  1JZR A;  2G0F A;  3UIW A;  1Q98 A;  5ECI B;  3ZRD A;  4IBP A;  3LEF A;  3KH7 A;  1OKT A;  4HI7 A;  1YF1 A;  2O89 A;  3DWV A;  4L0W A;  3U5R E;  4DEJ A;  2MBS A;  2GST A;  1SJZ A;  1HQO A;  5F8B A;  5IPG A;  3ZL5 A;  5F05 A;  2H72 A;  2OBI A;  4KGI A;  2E2M A;  5D8I A;  1G6Y A;  2B5Y A;  3IAS 2;  2KHP A;  2FGX A;  3F0I A;  3FR6 A;  3D21 A;  2LEG A;  3DML A;  4NHW A;  2XC2 A;  1O7U A;  5DDL A;  1A2M A;  1QGV A;  2O85 A;  4HEA 2;  2CVK A;  1Z7P A;  4YQU A;  2HE3 A;  3CSJ A;  3C8E A;  2VLT A;  1N2A A;  3LFL A;  5CP1 A;  2MYG A;  4MAB A;  3C73 A;  4ZL9 A;  2CAI A;  3IR4 A;  1NW2 A;  1OYJ A;  2DIY A;  3EMP A;  2JSZ A;  3HVV A;  1PN9 A;  3TGZ A;  3GL5 A;  1EEM A;  4XS4 A;  3QD9 A;  2VM2 A;  1EV4 A;  4PNG A;  2GZY A;  2LUS A;  2FA8 A;  3TKS A;  1YKC A;  2LKU A;  3WT1 A;  5J9B A;  3F4R A;  1I9D A;  4WR4 A;  5DJM A;  2X8C A;  3I6A A;  3HZ4 A;  4IW9 A;  2O7K A;  2FNO A;  3KCM A;  2AJQ B;  2PPT A;  3M3M A;  4MDC A;  4TR1 B;  3US3 A;  5CRD A;  2L4Q A;  4KB3 A;  4ZBD A;  1U6T A;  4BL7 A;  3DD3 A;  4LMV A;  3MSZ A;  1BJX A;  3HY2 A;  2MMN A;  1JLV A;  4PGT A;  2WCI A;  1G6W A;  4H86 A;  3H79 A;  2HYX A;  2H76 A;  5IMD A;  3QFB C;  2QC7 A;  2X99 A;  3GKM A;  4KCE A;  4MPF A;  5DAK A;  1T4Y A;  4KX4 A;  3C7M A;  4TXO A;  2WS2 A;  4Q5N A;  4GRF A;  1MD4 A;  2EIQ A;  2HSY A;  3CSH A;  1AQX A;  17GS A;  3ZYW A;  1EP7 A;  4WEY A;  4L5O A;  2P0G A;  4KSO A;  4TRX A;  2VL2 A;  4HDE A;  2CQ9 A;  5G5E A;  1ZL9 A;  2GTU A;  2WGR A;  5ABR A;  2R5G A;  5GAN D;  1OE8 A;  4XIH A;  2P5Q A;  5J5N A;  4AJ8 A;  6GSX A;  4NWY A;  4RQX A;  1NHY A;  3LWA A;  1YDK A;  3IE3 A;  1MD3 A;  4OFT A;  1YJ6 A;  1Z6N A;  2FWG A;  4K7N A;  4ZBB A;  2O87 A;  3W8S A;  4TR3 A;  4WBJ A;  1ERW A;  5HR0 A;  4HJM A;  2H1A A;  3W6G A;  4OCE A;  4K9Z A;  2H1G A;  1FVJ A;  1F6M C;  3HHV A;  1WOU A;  4GLT A;  3CXG A;  1SJ6 A;  2FHE A;  3IK9 A;  1GSE A;  3SBC A;  4IP1 A;  1T7P B;  1H75 A;  5GST A;  1LBK A;  1EP8 A;  4MK3 A;  2YCD A;  1SKS B;  5ELA A;  1NM3 A;  2YV7 A;  2C3N A;  5DAL B;  4V2N A;  2AV4 A;  2L57 A;  2I3Y A;  4P3Y B;  1XVW A;  4J57 E;  2K8V A;  2V1M A;  1HD2 A;  2PBJ A;  3TRQ A;  2V2G A;  1VF1 A;  1V57 A;  1JLW A;  1TK8 B;  2ES7 A;  1M9A A;  1XFL A;  3TRX A;  5JCW A;  4RI7 A;  4AGS A;  1IYI A;  2HT9 A;  1TU8 A;  3F6F A;  3TRP A;  1ERV A;  1FB0 A;  1IYH A;  4HU9 A;  5ECP B;  1K0N A;  2HI7 A;  3N9J A;  3V1W A;  3EYT A;  2YWI A;  1FAA A;  3LYP A;  3FY7 A;  4MCU A;  4ML6 A;  3N5O A;  4BPY A;  3M9J A;  4X43 A;  2EC4 A;  1X0R A;  4EKZ A;  1S3D A;  4MZC A;  2JZR A;  2K6V A;  3UL3 A;  3RPP A;  5G1K A;  1EWX A;  4N30 A;  4MMM A;  2EIO A;  3IAM 2;  1CQH A;  3L4N A;  4RI6 A;  1XPV A;  4XRD A;  4GCI A;  3TJB A;  3FK8 A;  2N5B A;  3G7Y A;  4IJI A;  1MDJ A;  3VFI A;  3VK9 A;  3DVW A;  4I6X A;  5CRE A;  2H0G A;  1Q4J A;  4AJ7 A;  2B1L A;  3IK7 A;  1TI3 A;  4O92 A;  4NPB A;  4OWY A;  3P2A A;  3EUR A;  2K8S A;  2LTK A;  4JRR A;  3TJJ A;  4TN8 A;  2YP6 A;  3UMA A;  3O6T A;  3E0U A;  2AB6 A;  3CBU A;  3KXO A;  3Q74 A;  1S3C A;  1TW9 A;  3KJY A;  3ED3 A;  4WET A;  5AIX A;  1TRV A;  1B8X A;  3GV1 A;  3ZZX A;  2H0H A;  4KH7 A;  3GL3 A;  1VRS D;  2GS3 A;  1EGR A;  5CRW A;  2V6O A;  2HZF A;  2LRT A;  4QL9 A;  5A4W A;  1WWJ A;  4Q5F A;  3EIN A;  1R5A A;  1BYE A;  1O73 A;  3VLN A;  1OC9 A;  4PXO A;  2JSY A;  3QR6 A;  2H75 A;  3NIV A;  2H01 A;  2DLX A;  4NMU A;  3WYW A;  2H30 A;  3CTG A;  4Q5Q A;  2V41 A;  16GS A;  2PER A;  2FWF A;  2NDO A;  3ZML A;  1TK0 B;  2VCW A;  1YY7 A;  3GTU A;  3FZ5 A;  1SYR A;  1OC9 B;  1ML6 A;  4GQC A;  4AJ6 A;  5H5Q A;  2DJK A;  22GS A;  5HFK A;  2WB9 A;  3BCI A;  5B6M A;  5H5R A;  3M0F A;  5A4U A;  3GHA A;  3S9F A;  1GTB A;  2F9S A;  3L9S A;  4TVE A;  1SEN A;  4MF6 A;  3GTU B;  4I97 A;  5DCG A;  4Q5R A;  2MZC A;  2ALB A;  2A4V A;  2FLS A;  3ME8 A;  2N5A A;  2L5O A;  2WZ9 A;  3ZRE A;  4KDY A;  3J7Y b;  5DQS A;  4NV2 A;  5D9T A;  4WF5 A;  3EC3 A;  2LV3 A;  2WUL A;  1TKD B;  1AUC A;  4ECJ A;  2VLU A;  3DXB A;  2YOI A;  2IN3 A;  3HJP A;  3NOF A;  2XPD A;  2F51 A;  2PMT A;  2YN1 A;  4NAX A;  3LXT A;  1T00 A;  1W4V A;  5C00 A;  5HFI A;  2VD1 A;  2H0I A;  2CX4 A;  2B7J A;  2VCT A;  2DJJ A;  4BVX A;  3TB2 A;  4XS6 A;  3WT2 A;  3CSI A;  3KP9 A;  4OFN A;  4MH2 A;  1GL8 A;  4MF5 A;  3TJG A;  1ZZY A;  1KBN A;  4EDZ A;  1UVZ A;  1JZO A;  4L5L A;  5CYY A;  3PR8 A;  2L6C A;  4KUN A;  2CAQ A;  4I8B A;  3W8J A;  3D4T A;  2C0E A;  4FYU A;  4ZL8 A;  2NVL A;  3BOA A;  2H8L A;  4POK A;  4MF7 A;  4JZQ A;  3F3Q A;  3H8Q A;  2OE3 A;  5FHI A;  1EOG A;  2RM5 A;  6GST A;  1PA3 A;  4V1A g;  2J23 A;  3Q18 A;  3FZA A;  1C72 A;  2CVB A;  4YAV A;  1OC3 A;  1GSD A;  5ECH B;  4LMW A;  5JWQ B;  1T8E B;  2C80 A;  1DBY A;  4JR6 A;  1YF0 A;  4KND A;  4ILF A;  2VOC A;  1OKD A;  2DSA A;  3QMX A;  5EVO A;  2H6Y A;  4ZB9 A;  4LA1 A;  3GN3 A;  5IMC A;  1AXD A;  1DSB A;  3QCP A;  4G2E A;  5IO0 A;  5A5K A;  3E3E A;  2RUF A;  3TKS E;  3ISO A;  1GH2 A;  3KP8 A;  2CVD A;  2XHF A;  4J56 E;  4TR0 A;  4Z7X A;  2PWJ A;  4K7I A;  4CHS A;  2VM1 A;  1PKZ A;  3RHC A;  5JCG A;  3UEM A;  4FYB A;  2CT6 A;  4N0V A;  2B5E A;  5AGY A;  3WD6 A;  4IQA A;  1GRX A;  4TXV A;  1EV9 A;  1XZO A;  1LU4 A;  2X8H A;  3GH6 A;  4N0Z A;  1YEX A;  2B6M A;  1AQV A;  2KP1 A;  5ECR B;  3M8N A;  3ZTL A;  1Z7R A;  2C0F A;  4D73 A;  2GSQ A;  3NZN A;  4ZIL A;  2X64 A;  2L59 A;  1JZW A;  1B9Y C;  4F82 A;  5ECQ B;  2CX3 A;  4O32 A;  4KE3 A;  4TR1 A;  1WPI A;  5G30 A;  1PL2 A;  2L5L A;  4D73 B;  1X9M B;  2TRX A;  5COH A;  2H1D A;  4OCF A;  5ECN B;  2XBI A;  1WP0 A; 
#chains in the Genus database with same CATH topology
 2B5X A;  1O6J A;  4IN0 A;  4KW6 A;  1GP1 A;  2GLR A;  2OAC A;  1MTC A;  2IMF A;  1BED A;  2B3S A;  1DUG A;  3TDG A;  4L8E A;  1SL0 B;  1XWG A;  3EPT A;  4HQZ A;  1Z9H A;  2FWH A;  5KN3 A;  18GS A;  4HZ2 A;  5B7C A;  4PUF C;  2LNT A;  1O81 A;  1TRS A;  4K7O A;  5IOX A;  1THO A;  1U3A A;  3FYG A;  4IKH A;  2AAW A;  2VAF A;  3TOT A;  3IBH A;  4I5Q A;  5IMF A;  1WRY A;  1SYX A;  2B1K A;  1S3A A;  2GDR A;  3WGD A;  1JZD A;  2YPM A;  4DSS B;  3FRC A;  3GUS A;  1VF3 A;  2FY6 A;  4EE0 A;  1XCC A;  1F2E A;  2VUP A;  19GS A;  3LGC A;  4FH8 A;  1V9W A;  3O3T A;  2JU5 A;  4F0B A;  4IEL A;  3E9J B;  3HJO A;  1XXU A;  3FR3 A;  1PRX A;  2H19 A;  2PVQ A;  5E59 A;  5EY6 A;  2GT5 A;  5GZZ B;  1T3B A;  1M3I A;  3KMO A;  1B9X C;  1A8L A;  5ID2 B;  4E8E A;  4K5S A;  1FO5 A;  2OAD A;  5FT3 A;  3RBT A;  5DAL A;  1K3L A;  1F3B A;  5AIS A;  1TRU A;  5F07 A;  1AIU A;  3FHK A;  5IMA A;  2PU9 C;  3EU4 A;  2GZP A;  3C1R A;  1QFN A;  2VIM A;  1ON4 A;  1M99 A;  5IO2 A;  3M9K A;  5BMU A;  1J08 A;  2NPB A;  4MPG A;  1SL2 B;  2DJ2 A;  2E0Q A;  3L9V A;  3F8U A;  1TJD A;  1J0F A;  3DEX A;  2HRF A;  5KEJ A;  3AY8 A;  3F3R A;  1ZCP A;  1X5D A;  1TDI A;  4MA9 A;  2VCV A;  3K8N A;  5JCU A;  1U3I A;  4OO4 A;  2TIR A;  5J4U A;  4ZB8 A;  4DVC A;  3ERF A;  1HNA A;  4G9H A;  1RW1 A;  3ZVJ D;  4PQI A;  2YAN A;  2QGV A;  2LQO A;  3TJK A;  4GXZ A;  4N10 A;  2YWO A;  5IMV A;  5DJL A;  1PL1 A;  2R0G A;  2VO4 A;  5IMZ A;  1EOH A;  2IFQ A;  4K0N A;  2YZU A;  2ON7 A;  4G19 A;  4EF0 A;  4GF0 A;  4FYC A;  4IHU A;  1HNC A;  3C1S A;  2OE1 A;  2ZNM A;  5DVB A;  4PUR A;  3GFK A;  5D96 A;  5G31 A;  2I9H A;  5LCZ A;  4OO5 A;  3MNG A;  1LJR A;  3VI7 A;  3LJR A;  5ECL B;  3D6I A;  2IFQ B;  3H1N A;  1V58 A;  4IP6 A;  3VWW A;  1V2A A;  1BX9 A;  1GSU A;  1XW9 A;  4ZL7 A;  2MMA A;  4AF2 A;  2LJR A;  3L9U A;  4GSN A;  4BA7 A;  5CRH A;  1XW6 A;  3FKF A;  4RQR A;  2R37 A;  3GMF A;  4I2T A;  3VWV A;  2YNX A;  3PGT A;  2FD3 A;  5ELG A;  4HS1 A;  1USB A;  1K0C A;  3DGQ A;  2HSH A;  2CA8 A;  1V98 A;  3G7J A;  2IMK A;  3ZMK A;  3BJ5 A;  2C4J A;  2I4A A;  2KUC A;  1S3R A;  3HD5 A;  1T1V A;  2YZH A;  3GNJ A;  5FWG A;  4BWQ A;  2UZ8 A;  1M9B A;  2VCQ A;  2GZZ A;  5LD0 A;  1VGL A;  3WGX A;  4USS A;  3RAZ A;  1O85 A;  2FCH A;  3TOU A;  3APQ A;  3IA1 A;  1URM A;  4HJ2 A;  2Z9S A;  3FZ4 A;  1K3O A;  1M7T A;  4NXI A;  4X4J A;  3ZIT A;  4GWR A;  3A2V A;  3DVX A;  2H1B A;  4ZXG A;  3CRU A;  2B7K A;  2M46 A;  1PSQ A;  3BCK A;  5CAX A;  4GST A;  1JFU A;  2GSS A;  3HKR A;  2IME A;  2IPA A;  3UJ1 A;  2NBS A;  2J9H A;  1XWK A;  4PX1 A;  1TI1 A;  3D0Z A;  3F4S A;  5C04 A;  5IIZ A;  1EGO A;  3IXR A;  4CY8 A;  4G10 A;  2AYT A;  1ABA A;  3GX0 A;  3OR5 A;  2V32 A;  1SU9 A;  4IQ1 A;  3QAW A;  2XBQ A;  4WXT A;  4EVM A;  1ZYQ B;  1J9B A;  4JR4 A;  4K6X A;  4POL A;  1SKR B;  14GS A;  4MJA A;  4MLY A;  2GVP A;  1K0M A;  3TCO A;  4O7H A;  2IMD A;  3MDK A;  4F03 A;  3Q6O A;  8GSS A;  2E2G A;  4MJB A;  4K2X A;  4HSC X;  3ZVJ A;  3CYN A;  1XOA A;  1FG4 A;  5IQY A;  1AAZ A;  3FMW A;  3KD0 A;  2FUG 2;  2L6D A;  2D2Z A;  5B8B A;  5J41 A;  3UAR A;  1OE7 A;  2GQK A;  1K0B A;  5ECN B;  3IC8 A;  4QQ7 A;  1GUL A;  2HZE B;  1KEB A;  1RQM A;  4HQS A;  2KLX A;  1PKW A;  2OE0 A;  2JL4 A;  5ECK B;  4J2F A;  5KN2 A;  4L0U A;  1E2Y A;  4V2L A;  4I2U A;  3P90 A;  2GSR A;  4JU5 A;  3FEU A;  2K18 A;  1YZX A;  3LSZ A;  3D4M A;  4POB A;  4EUY A;  4ZBA A;  3MWH A;  2M80 A;  2H71 A;  4BVY A;  3HJM A;  4O5U A;  1FHE A;  3VWU A;  4FIW A;  1X9W B;  1OC8 A;  2DML A;  2IJY A;  3GIX A;  3I69 A;  1ZMA A;  2YWN A;  3F6D A;  1XIY A;  1KNG A;  1X9S B;  3UAP A;  1TTZ A;  1SKW B;  1A24 A;  5IPH A;  3APO A;  2LRN A;  3VPT A;  3P8W A;  3GSS A;  3IC4 A;  9GSS A;  1QQ2 A;  3QDN A;  3WGE A;  4JBB A;  4EDY A;  1M2B A;  3IDV A;  3HVX A;  13GS A;  2MMO A;  3VPQ A;  1AW9 A;  4YAP A;  5G2Z A;  1F3A A;  4ACS A;  3ZIV A;  2KP2 A;  1BAY A;  3IOS A;  6GSS A;  1UA5 A;  2C1Y A;  2QKE A;  3QAG A;  2KOK A;  6GSY A;  1Z5Y E;  3APS A;  4O5R A;  1ZOF A;  3GRX A;  3FW2 A;  1SK1 A;  3HCZ A;  1GWC A;  5J3R A;  2YJH A;  1GSQ A;  1CQG A;  1F9M A;  1GLQ A;  3BD2 A;  4KAE A;  5GAP D;  4KSM A;  1SD8 A;  2A2S A;  3U6V A;  3KTB A;  4WBR D;  5L71 A;  2MBT A;  5HR2 A;  1A8Y A;  4V2M A;  2PVO C;  2C3T A;  4E8H A;  1X5C A;  2VD0 A;  1NSW A;  5KOX A;  4XCS A;  3RDW A;  4ECC A;  1PD2 1;  4ML1 A;  2VLV A;  3F9U A;  1N8J A;  4IJ3 A;  3LG6 A;  2FA4 A;  1QUW A;  3GKX A;  2DBC A;  2PGT A;  4QL7 A;  1VF2 A;  5B8A A;  3ZLP A;  4YH2 A;  5INY A;  4Z2R A;  5EPF A;  5ECS A;  4XTS A;  3D5J A;  3F63 A;  4ZIJ A;  2CZ3 A;  4LL4 B;  4MP4 A;  4OD7 A;  4X0X A;  1B48 A;  3ZFL A;  2CV4 A;  1FW1 A;  3LW9 A;  4HOJ A;  2XPE A;  3H4K A;  5G5F A;  2IL3 A;  2H66 A;  1ZYE A;  1Z3E A;  4DSQ A;  1GNE A;  3RPN A;  1FB6 A;  2LQQ A;  1THX A;  3A3T A;  5G1L A;  2C0G A;  4OFM A;  4EC0 A;  3JCM L;  2IWT A;  1DE1 A;  1SK0 A;  4POM A;  4CW9 A;  2BMX A;  3BBY A;  4GQF A;  2OA7 A;  1M2D A;  4K1F A;  4N11 A;  5GSS A;  3O76 A;  2JZS A;  4NHZ A;  1MDK A;  3QOU A;  4K8M A;  5D9X A;  3ERW A;  1ZYN A;  3VUR A;  3IV4 A;  4XS4 B;  2WFC A;  2BJX A;  4TKY A;  3ZFB A;  4EL1 A;  2LST A;  4DSS A;  3MAK A;  3MIX A;  3EE2 A;  5BRT A;  3UVT A;  1WJK A;  4ISD A;  3IRA A;  3GYK A;  5EL8 A;  1I5G A;  4G0I A;  1KTE A;  3EMX A;  1ST9 A;  4HUA A;  3DIE A;  4KDX A;  4BL7 B;  3IHQ A;  3TKS C;  4YQV A;  5JWO B;  1F37 A;  2F8A A;  3HVS A;  1Z6M A;  4XHM A;  1GSF A;  1SK2 A;  1X5E A;  1R26 A;  5H5S A;  6GSW A;  5DBQ A;  2A2R A;  5DAK B;  1TXX A;  5F06 A;  4PUA A;  4TXO B;  3UVH A;  5ID2 A;  5CNW A;  10GS A;  4PNF A;  2BTO T;  2VCZ A;  4KDU A;  2DC5 A;  2LRC A;  2HLS A;  4ECB A;  1UC7 A;  1U87 A;  3TJF A;  5B6N A;  3ZIJ A;  4YKG A;  1A2J A;  2GGT A;  11GS A;  1O8X A;  3TUE A;  2R6K A;  4IVF A;  1T4Z A;  3EU3 A;  1V40 A;  1XWA A;  3PPU A;  4KCA A;  4XRA A;  3KGK A;  1GTU A;  5CRG A;  2LS5 A;  3D22 A;  1A2L A;  2C3Q A;  2DIZ A;  1XWC A;  2H74 A;  3GX8 A;  2DMM A;  1BG5 A;  3GUR A;  3L0H A;  1XW5 A;  1Y25 A;  2WJU A;  2H73 A;  5IOW A;  1G7E A;  3GA4 A;  3IPZ A;  1XOB A;  2VL2 C;  1TK5 B;  2RM6 A;  3I43 A;  3KMN A;  4HU7 A;  1RK4 A;  2DJ1 A;  1MEK A;  1R4W A;  2RII A;  3UBL A;  2WRT A;  5ECM B;  4KA0 A;  1ERT A;  2HXK A;  2H6Z A;  2ZCT A;  1WE0 A;  3KZQ A;  3PIN A;  1YQ1 A;  5CO3 A;  1ZGN A;  1XBS A;  2REM A;  4ZB6 A;  5KN0 A;  2I1U A;  4BWS A;  4F2I A;  5AIV A;  5F0G A;  4OMV A;  2JAC A;  3M1G A;  5HR1 A;  1FOH A;  4JE1 A;  1ERU A;  2L4C A;  4WF4 A;  1QXH A;  2TRC P;  1DE2 A;  1XWB A;  2QA1 A;  1GSS A;  2VL9 A;  3F4T A;  2DJ0 A;  1ACV A;  5ENU A;  5AN1 A;  2R2J A;  3HA9 A;  4CDO A;  2A2P A;  3DRN A;  3Q19 A;  5HFG A;  1O8W A;  2IIY A;  2E7P A;  2R0P A;  1GSY A;  3GKN A;  5IM9 A;  4ECI A;  3H93 A;  1ZYP A;  1Y6E A;  1GUH A;  2M72 A;  1EZK A;  2FWE A;  3KIJ A;  1SL1 B;  1R5P A;  1K0D A;  1TP9 A;  3J7Y k;  2CZ2 A;  2RLI A;  3L78 A;  4LL1 B;  4ICY A;  1G0T A;  4EXJ A;  4V1A p;  4FO5 A;  3KTL A;  1HYU A;  20GS A;  4MJC A;  2AUV A;  3SWL A;  4F0C A;  2IMI A;  3HYP A;  5D9W A;  2JAD A;  5LNK e;  4K5R A;  2QA2 A;  3TKQ A;  2HNL A;  4WR5 A;  2H6X A;  1ILO A;  1PGT A;  3FZ9 A;  2P5R A;  3A2X A;  1A0R P;  1UN2 A;  4ULX A;  4DSR A;  1EEJ A;  1SD9 A;  3A5W A;  2PUK C;  3UOM A;  2OJL A;  2EIR A;  2YV9 A;  4MH3 A;  5HR3 A;  5HQP A;  1GTI A;  1K0A A;  4IS0 A;  2YJ7 A;  1E6B A;  3DKS A;  1WIK A;  1GTA A;  1BQ7 A;  3LOR A;  1AQW A;  3CTF A;  1TRW A;  2WDU A;  5D93 A;  1G7O A;  3LQ7 A;  2VCX A;  2DJ3 A;  2HFD A;  4IGJ A;  2PN8 A;  2X8G A;  1OVN A;  2QSI A;  3GH9 A;  1TOF A;  5E4W A;  1GUK A;  2P31 A;  3R2Q A;  3EWL A;  2ON5 A;  1FVK A;  1HNB A;  1TU7 A;  1FOV A;  3PH9 A;  1WMJ A;  4TOP A;  2G2Q A;  2OKA A;  1XG8 A;  2NTO A;  2DKI A;  3CRT A;  1QMV A;  4K0G A;  1R7H A;  1VF4 A;  4GTU A;  3C71 A;  2HZE A;  4XS1 A;  2GQL A;  1SJI A;  4EO3 A;  3LYK A;  2C8U A;  1QK8 A;  4JED A;  1MDI A;  1H4O A;  4F9Z A;  3KM6 A;  1GUM A;  4MZW A;  2H70 A;  2GQM A;  3G7I A;  4PQH A;  5JWR B;  2GT6 A;  3QAV A;  4X1U A;  4GSS A;  4YQM A;  5ECO B;  3HDC A;  3G9B A;  4HZ4 A;  4K2D A;  1NHO A;  1PMT A;  3RHB A;  4TR4 A;  1W89 A;  2LJA A;  4LLR A;  3VWX A;  3VI5 A;  2V6K A;  3CMI A;  4TW5 A;  3GST A;  2LJK A;  2R3X A;  2ZUP A;  3TKP A;  5KN1 A;  1YEP A;  3GKK A;  1OAZ A;  2LNS A;  2OBK A;  4O5Q A;  4MZB A;  7GSS A;  2F3M A;  2R4V A;  3HZ8 A;  1A23 A;  2JZT A;  3EVI A;  3LXZ A;  1U88 A;  4NV5 A;  3ERG A;  1PQN A;  1GNW A;  4PTS A;  6GSU A;  3ME7 A;  2F8F A;  5D73 A;  5A4V A;  2I81 A;  6GSV A;  5D9V A;  1M0U A;  4BVX B;  4RUV A;  3QFA C;  4PQ1 A;  5DQY A;  2RUE A;  1A0F A;  2C0D A;  1JHB A;  4ID0 A;  2AHE A;  2O8V B;  12GS A;  3DYR A;  5DCH A;  5J9C A;  1B4Q A;  2YWM A;  1B4P A;  1K0O A;  2VL3 A;  3KH9 A;  1PX7 A;  2K9F A;  3FR9 A;  3QPM A;  1XVQ A;  1GLP A;  3I9V 2;  1PX6 A;  1YKA A;  3P7X A;  1M2A A;  2HRN A;  2MMZ A;  4WKW A;  4MJE A;  2N5F A;  1K3Y A;  3HXS A;  3KEB A;  3A2W A;  1AC1 A;  3UBK A;  3TKR A;  1JZR A;  2G0F A;  3UIW A;  1Q98 A;  5ECI B;  3ZRD A;  2R0C A;  4IBP A;  3LEF A;  3KH7 A;  1OKT A;  4HI7 A;  1YF1 A;  2O89 A;  3CQF A;  3DWV A;  4L0W A;  3U5R E;  2MBS A;  2GST A;  4DEJ A;  1SJZ A;  1HQO A;  5F8B A;  5IPG A;  3ZL5 A;  5F05 A;  2H72 A;  2OBI A;  4KGI A;  3MYD A;  2E2M A;  5D8I A;  1G6Y A;  2B5Y A;  3IAS 2;  2KHP A;  2FGX A;  3F0I A;  2HSM A;  3FR6 A;  3D21 A;  2LEG A;  3DML A;  4NHW A;  2XC2 A;  1O7U A;  5DDL A;  1A2M A;  1QGV A;  2O85 A;  4HEA 2;  2CVK A;  1Z7P A;  4YQU A;  2HE3 A;  3CSJ A;  3C8E A;  2VLT A;  1N2A A;  3LFL A;  5CP1 A;  2MYG A;  4MAB A;  3C73 A;  4ZL9 A;  2CAI A;  3IR4 A;  1NW2 A;  1OYJ A;  2DIY A;  3EMP A;  2JSZ A;  3HVV A;  1PN9 A;  3TGZ A;  3GL5 A;  1EEM A;  4XS4 A;  3QD9 A;  2VM2 A;  2HRK A;  1EV4 A;  4PNG A;  2GZY A;  2LUS A;  2FA8 A;  3TKS A;  1YKC A;  2LKU A;  3WT1 A;  5J9B A;  3F4R A;  1I9D A;  4WR4 A;  5DJM A;  2X8C A;  3I6A A;  3HZ4 A;  4IW9 A;  2O7K A;  2FNO A;  3KCM A;  2AJQ B;  2PPT A;  3M3M A;  4MDC A;  4TR1 B;  3US3 A;  2X4A A;  2L4Q A;  5CRD A;  4KB3 A;  4ZBD A;  1U6T A;  4BL7 A;  3DD3 A;  4LMV A;  3MSZ A;  1BJX A;  3HY2 A;  2MMN A;  4PGT A;  2WCI A;  1G6W A;  4H86 A;  3H79 A;  3A5I A;  2HYX A;  2H76 A;  5IMD A;  3QFB C;  2QC7 A;  2X99 A;  3GKM A;  4KCE A;  4MPF A;  5DAK A;  1T4Y A;  4KX4 A;  1PN0 A;  3C7M A;  4TXO A;  2WS2 A;  4Q5N A;  4GRF A;  4Z2U A;  1MD4 A;  2EIQ A;  2HSY A;  3CSH A;  1AQX A;  17GS A;  3ZYW A;  1EP7 A;  4WEY A;  4L5O A;  2P0G A;  4G0L A;  4KSO A;  4TRX A;  2VL2 A;  4HDE A;  2CQ9 A;  5G5E A;  1ZL9 A;  2GTU A;  2WGR A;  5ABR A;  2R5G A;  5GAN D;  1OE8 A;  4XIH A;  2P5Q A;  5J5N A;  4AJ8 A;  6GSX A;  4NWY A;  3HVN A;  4RQX A;  1NHY A;  3LWA A;  1YDK A;  3IE3 A;  1MD3 A;  4BIK A;  4OFT A;  1YJ6 A;  1Z6N A;  2FWG A;  4K7N A;  4ZBB A;  2O87 A;  3W8S A;  4TR3 A;  4G0K A;  4WBJ A;  1ERW A;  5HR0 A;  4HJM A;  2H1A A;  3W6G A;  4OCE A;  2X49 A;  4K9Z A;  2H1G A;  1FVJ A;  1F6M C;  3HHV A;  1WOU A;  4GLT A;  3CXG A;  1SJ6 A;  2FHE A;  3IK9 A;  1GSE A;  3SBC A;  4IP1 A;  1T7P B;  1H75 A;  5GST A;  4YKF A;  1LBK A;  1EP8 A;  4MK3 A;  2YCD A;  1SKS B;  5ELA A;  1NM3 A;  2YV7 A;  2C3N A;  5DAL B;  4V2N A;  2AV4 A;  2L57 A;  2I3Y A;  4P3Y B;  4A5P A;  1XVW A;  4J57 E;  2K8V A;  2V1M A;  1HD2 A;  2PBJ A;  3TRQ A;  2V2G A;  1VF1 A;  1V57 A;  1JLW A;  1TK8 B;  2ES7 A;  1M9A A;  1XFL A;  3TRX A;  5JCW A;  4RI7 A;  4AGS A;  1IYI A;  2HT9 A;  1TU8 A;  3F6F A;  3TRP A;  1ERV A;  1FB0 A;  1IYH A;  2A4H A;  4HU9 A;  5ECP B;  1K0N A;  2HI7 A;  3N9J A;  3V1W A;  3EYT A;  2YWI A;  1FAA A;  3LYP A;  3FY7 A;  4MCU A;  4ML6 A;  3N5O A;  4BPY A;  2HRA A;  3M9J A;  4X43 A;  2EC4 A;  1X0R A;  4EKZ A;  1S3D A;  4MZC A;  2JZR A;  2K6V A;  3UL3 A;  3RPP A;  5G1K A;  1EWX A;  4N30 A;  4MMM A;  2EIO A;  3IAM 2;  1CQH A;  3L4N A;  4RI6 A;  1XPV A;  4XRD A;  4GCI A;  3TJB A;  3FK8 A;  2N5B A;  3G7Y A;  4MNN A;  4IJI A;  1MDJ A;  3VFI A;  3VK9 A;  3DVW A;  4I6X A;  5CRE A;  2H0G A;  1Q4J A;  4AJ7 A;  2B1L A;  3IK7 A;  1TI3 A;  4O92 A;  4NPB A;  4OWY A;  3P2A A;  3EUR A;  2K8S A;  2LTK A;  4JRR A;  3TJJ A;  4TN8 A;  2YP6 A;  3UMA A;  3O6T A;  3E0U A;  2AB6 A;  3CBU A;  3KXO A;  3Q74 A;  1S3C A;  1TW9 A;  3KJY A;  3ED3 A;  4WET A;  5AIX A;  1TRV A;  4EIQ A;  1B8X A;  3GV1 A;  3ZZX A;  2H0H A;  4KH7 A;  3GL3 A;  1VRS D;  2GS3 A;  1EGR A;  5CRW A;  2V6O A;  2HZF A;  2LRT A;  4QL9 A;  5A4W A;  1WWJ A;  4Q5F A;  3EIN A;  1R5A A;  1BYE A;  1O73 A;  3VLN A;  1OC9 A;  4PXO A;  2JSY A;  3IHG A;  3QR6 A;  2H75 A;  3NIV A;  2H01 A;  2DLX A;  4NMU A;  3WYW A;  2H30 A;  3CTG A;  4Q5Q A;  2V41 A;  16GS A;  2PER A;  2FWF A;  2NDO A;  3ZML A;  1TK0 B;  2VCW A;  1YY7 A;  3GTU A;  3FZ5 A;  1SYR A;  1OC9 B;  1ML6 A;  4GQC A;  4AJ6 A;  5H5Q A;  2DJK A;  22GS A;  5HFK A;  2WB9 A;  3BCI A;  5B6M A;  5H5R A;  3M0F A;  5A4U A;  3GHA A;  3S9F A;  1GTB A;  2F9S A;  3L9S A;  4TVE A;  1SEN A;  4MF6 A;  3GTU B;  4I97 A;  5DCG A;  4Q5R A;  2MZC A;  2ALB A;  2A4V A;  2FLS A;  3ME8 A;  2N5A A;  2L5O A;  2WZ9 A;  3ZRE A;  4KDY A;  3J7Y b;  5DQS A;  4NV2 A;  5D9T A;  4WF5 A;  3EC3 A;  2LV3 A;  2WUL A;  1TKD B;  1AUC A;  4ECJ A;  2VLU A;  3DXB A;  2YOI A;  2IN3 A;  3HJP A;  3NOF A;  2XPD A;  2F51 A;  2PMT A;  2YN1 A;  4NAX A;  3LXT A;  1T00 A;  1W4V A;  5C00 A;  5HFI A;  2VD1 A;  2H0I A;  2CX4 A;  4CY6 A;  2B7J A;  2VCT A;  2DJJ A;  4BVX A;  3TB2 A;  4XS6 A;  3WT2 A;  3CSI A;  3KP9 A;  4OFN A;  4MH2 A;  1GL8 A;  4MF5 A;  3TJG A;  1ZZY A;  1KBN A;  4EDZ A;  1UVZ A;  1JZO A;  4L5L A;  5CYY A;  3PR8 A;  2L6C A;  4KUN A;  2CAQ A;  4I8B A;  3W8J A;  3D4T A;  2C0E A;  4FYU A;  4ZL8 A;  4EIP A;  2NVL A;  3BOA A;  2H8L A;  4POK A;  4KF9 A;  4BVY B;  4MF7 A;  1PFO A;  4JZQ A;  3F3Q A;  3H8Q A;  2OE3 A;  5FHI A;  1EOG A;  2RM5 A;  6GST A;  1PA3 A;  4V1A g;  2J23 A;  3Q18 A;  3FZA A;  1C72 A;  4FQU A;  2CVB A;  4YAV A;  1OC3 A;  1GSD A;  5ECH B;  3R3E A;  4LMW A;  5JWQ B;  1T8E B;  2C80 A;  1DBY A;  4JR6 A;  1YF0 A;  4KND A;  5KOW A;  4ILF A;  2VOC A;  1OKD A;  2DSA A;  3QMX A;  5EVO A;  2H6Y A;  4ZB9 A;  4LA1 A;  3GN3 A;  5IMC A;  1AXD A;  1DSB A;  3QCP A;  4G2E A;  5IO0 A;  5A5K A;  3E3E A;  2RUF A;  3TKS E;  3ISO A;  1GH2 A;  3KP8 A;  2CVD A;  2XHF A;  4J56 E;  4TR0 A;  4Z7X A;  2PWJ A;  4K7I A;  4CHS A;  2VM1 A;  1PKZ A;  3RHC A;  5JCG A;  3UEM A;  4FYB A;  2CT6 A;  4N0V A;  2B5E A;  5AGY A;  3WD6 A;  4IQA A;  1GRX A;  4TXV A;  1EV9 A;  1XZO A;  1LU4 A;  2X8H A;  2DKH A;  3GH6 A;  4N0Z A;  1YEX A;  2B6M A;  1AQV A;  1M3J A;  2KP1 A;  5ECR B;  3M8N A;  3ZTL A;  1Z7R A;  2C0F A;  4D73 A;  2GSQ A;  3NZN A;  4ZIL A;  2X64 A;  2L59 A;  1JZW A;  1B9Y C;  4F82 A;  5ECQ B;  2CX3 A;  4O32 A;  4KE3 A;  4TR1 A;  4Z2T A;  1WPI A;  5G30 A;  1PL2 A;  2L5L A;  4D73 B;  1X9M B;  2TRX A;  5COH A;  2H1D A;  4OCF A;  1JLV A;  2XBI A;  1WP0 A; 
#chains in the Genus database with same CATH homology
 2B5X A;  1O6J A;  4IN0 A;  4KW6 A;  1GP1 A;  2GLR A;  2OAC A;  1MTC A;  2IMF A;  1BED A;  2B3S A;  1DUG A;  3TDG A;  4L8E A;  1SL0 B;  1XWG A;  3EPT A;  4HQZ A;  1Z9H A;  2FWH A;  5KN3 A;  18GS A;  4HZ2 A;  5B7C A;  4PUF C;  2LNT A;  1O81 A;  1TRS A;  4K7O A;  5IOX A;  1THO A;  1U3A A;  3FYG A;  4IKH A;  2AAW A;  2VAF A;  3TOT A;  3IBH A;  4I5Q A;  5IMF A;  1WRY A;  1SYX A;  2B1K A;  1S3A A;  2GDR A;  3WGD A;  1JZD A;  2YPM A;  4DSS B;  3FRC A;  3GUS A;  1VF3 A;  2FY6 A;  4EE0 A;  1XCC A;  1F2E A;  2VUP A;  19GS A;  3LGC A;  4FH8 A;  1V9W A;  3O3T A;  2JU5 A;  4F0B A;  4IEL A;  3E9J B;  3HJO A;  1XXU A;  3FR3 A;  1PRX A;  2H19 A;  2PVQ A;  5E59 A;  5EY6 A;  2GT5 A;  5GZZ B;  1T3B A;  3KMO A;  1B9X C;  1A8L A;  5ID2 B;  4E8E A;  4K5S A;  1FO5 A;  2OAD A;  5FT3 A;  3RBT A;  5DAL A;  1K3L A;  1F3B A;  5AIS A;  1TRU A;  5F07 A;  1AIU A;  3FHK A;  5IMA A;  2PU9 C;  3EU4 A;  2GZP A;  3C1R A;  1QFN A;  2VIM A;  1ON4 A;  1M99 A;  5IO2 A;  3M9K A;  5BMU A;  1J08 A;  2NPB A;  4MPG A;  1SL2 B;  2DJ2 A;  2E0Q A;  3L9V A;  3F8U A;  1TJD A;  1J0F A;  3DEX A;  2HRF A;  5KEJ A;  3AY8 A;  3F3R A;  1ZCP A;  1X5D A;  1TDI A;  4MA9 A;  2VCV A;  3K8N A;  5JCU A;  1U3I A;  4OO4 A;  2TIR A;  5J4U A;  4ZB8 A;  4DVC A;  3ERF A;  1HNA A;  4G9H A;  1RW1 A;  3ZVJ D;  4PQI A;  2YAN A;  2QGV A;  2LQO A;  3TJK A;  4GXZ A;  4N10 A;  2YWO A;  5IMV A;  5DJL A;  1PL1 A;  2R0G A;  2VO4 A;  5IMZ A;  1EOH A;  2IFQ A;  4K0N A;  2YZU A;  2ON7 A;  4G19 A;  4EF0 A;  4GF0 A;  4FYC A;  4IHU A;  1HNC A;  3C1S A;  2OE1 A;  2ZNM A;  5DVB A;  4PUR A;  3GFK A;  5D96 A;  5G31 A;  2I9H A;  5LCZ A;  4OO5 A;  3MNG A;  1LJR A;  3VI7 A;  3LJR A;  5ECL B;  3D6I A;  2IFQ B;  3H1N A;  1V58 A;  4IP6 A;  3VWW A;  1V2A A;  1BX9 A;  1GSU A;  1XW9 A;  4ZL7 A;  2MMA A;  4AF2 A;  2LJR A;  3L9U A;  4GSN A;  4BA7 A;  5CRH A;  1XW6 A;  3FKF A;  4RQR A;  2R37 A;  3GMF A;  4I2T A;  3VWV A;  2YNX A;  3PGT A;  2FD3 A;  5ELG A;  4HS1 A;  1USB A;  1K0C A;  3DGQ A;  2HSH A;  2CA8 A;  1V98 A;  3G7J A;  2IMK A;  3ZMK A;  3BJ5 A;  2C4J A;  2I4A A;  2KUC A;  3HD5 A;  1T1V A;  2YZH A;  3GNJ A;  5FWG A;  4BWQ A;  2UZ8 A;  1M9B A;  2VCQ A;  2GZZ A;  5LD0 A;  1VGL A;  3WGX A;  4USS A;  3RAZ A;  1O85 A;  2FCH A;  3TOU A;  3APQ A;  3IA1 A;  1URM A;  4HJ2 A;  2Z9S A;  3FZ4 A;  1K3O A;  1M7T A;  4NXI A;  4X4J A;  3ZIT A;  4GWR A;  3A2V A;  3DVX A;  2H1B A;  4ZXG A;  3CRU A;  2B7K A;  2M46 A;  1PSQ A;  3BCK A;  5CAX A;  4GST A;  1JFU A;  2GSS A;  3HKR A;  2IME A;  2IPA A;  3UJ1 A;  2NBS A;  2J9H A;  1XWK A;  4PX1 A;  1TI1 A;  3D0Z A;  3F4S A;  5C04 A;  5IIZ A;  1EGO A;  3IXR A;  4CY8 A;  4G10 A;  2AYT A;  1ABA A;  3GX0 A;  3OR5 A;  2V32 A;  1SU9 A;  4IQ1 A;  3QAW A;  2XBQ A;  4WXT A;  4EVM A;  1ZYQ B;  1J9B A;  4JR4 A;  4K6X A;  4POL A;  1SKR B;  14GS A;  4MJA A;  4MLY A;  2GVP A;  1K0M A;  3TCO A;  4O7H A;  2IMD A;  3MDK A;  4F03 A;  3Q6O A;  8GSS A;  2E2G A;  4MJB A;  4K2X A;  3ZVJ A;  3CYN A;  1XOA A;  1FG4 A;  5IQY A;  1AAZ A;  3FMW A;  3KD0 A;  2FUG 2;  2L6D A;  2D2Z A;  5B8B A;  5J41 A;  3UAR A;  1OE7 A;  2GQK A;  1K0B A;  5ECN B;  3IC8 A;  4QQ7 A;  1GUL A;  2HZE B;  1KEB A;  1RQM A;  4HQS A;  2KLX A;  1PKW A;  2OE0 A;  2JL4 A;  5ECK B;  4J2F A;  5KN2 A;  4L0U A;  1E2Y A;  4V2L A;  4I2U A;  3P90 A;  2GSR A;  4JU5 A;  3FEU A;  2K18 A;  1YZX A;  3LSZ A;  3D4M A;  4POB A;  4EUY A;  4ZBA A;  3MWH A;  2M80 A;  2H71 A;  4BVY A;  3HJM A;  4O5U A;  1FHE A;  3VWU A;  4FIW A;  1X9W B;  1OC8 A;  2DML A;  2IJY A;  3GIX A;  3I69 A;  1ZMA A;  2YWN A;  3F6D A;  1XIY A;  1KNG A;  1X9S B;  3UAP A;  1TTZ A;  1SKW B;  1A24 A;  5IPH A;  3APO A;  2LRN A;  3VPT A;  3P8W A;  3GSS A;  3IC4 A;  9GSS A;  1QQ2 A;  3QDN A;  3WGE A;  4JBB A;  4EDY A;  1M2B A;  3IDV A;  3HVX A;  13GS A;  2MMO A;  3VPQ A;  1AW9 A;  4YAP A;  5G2Z A;  1F3A A;  4ACS A;  3ZIV A;  2KP2 A;  1BAY A;  3IOS A;  6GSS A;  1UA5 A;  2C1Y A;  2QKE A;  3QAG A;  2KOK A;  6GSY A;  1Z5Y E;  3APS A;  4O5R A;  1ZOF A;  3GRX A;  3FW2 A;  1SK1 A;  3HCZ A;  1GWC A;  5J3R A;  2YJH A;  1GSQ A;  1CQG A;  1F9M A;  1GLQ A;  3BD2 A;  4KAE A;  5GAP D;  4KSM A;  1SD8 A;  2A2S A;  3U6V A;  3KTB A;  4WBR D;  5L71 A;  2MBT A;  5HR2 A;  1A8Y A;  4V2M A;  2PVO C;  2C3T A;  4E8H A;  1X5C A;  2VD0 A;  1NSW A;  5KOX A;  4XCS A;  3RDW A;  4ECC A;  1PD2 1;  4ML1 A;  2VLV A;  3F9U A;  1N8J A;  4IJ3 A;  3LG6 A;  2FA4 A;  1QUW A;  3GKX A;  2DBC A;  2PGT A;  4QL7 A;  1VF2 A;  5B8A A;  3ZLP A;  4YH2 A;  5INY A;  4Z2R A;  5EPF A;  5ECS A;  4XTS A;  3D5J A;  3F63 A;  4ZIJ A;  2CZ3 A;  4LL4 B;  4MP4 A;  4OD7 A;  4X0X A;  1B48 A;  3ZFL A;  2CV4 A;  1FW1 A;  3LW9 A;  4HOJ A;  2XPE A;  3H4K A;  5G5F A;  2IL3 A;  2H66 A;  1ZYE A;  1Z3E A;  4DSQ A;  1GNE A;  3RPN A;  1FB6 A;  2LQQ A;  1THX A;  3A3T A;  5G1L A;  2C0G A;  4OFM A;  4EC0 A;  3JCM L;  2IWT A;  1DE1 A;  1SK0 A;  4POM A;  4CW9 A;  2BMX A;  3BBY A;  4GQF A;  2OA7 A;  1M2D A;  4K1F A;  4N11 A;  5GSS A;  3O76 A;  2JZS A;  4NHZ A;  1MDK A;  3QOU A;  4K8M A;  5D9X A;  3ERW A;  1ZYN A;  3VUR A;  3IV4 A;  4XS4 B;  2WFC A;  2BJX A;  4TKY A;  3ZFB A;  4EL1 A;  2LST A;  4DSS A;  3MAK A;  3MIX A;  3EE2 A;  5BRT A;  3UVT A;  1WJK A;  4ISD A;  3IRA A;  3GYK A;  5EL8 A;  1I5G A;  4G0I A;  1KTE A;  3EMX A;  1ST9 A;  4HUA A;  3DIE A;  4KDX A;  4BL7 B;  3IHQ A;  3TKS C;  4YQV A;  5JWO B;  1F37 A;  2F8A A;  3HVS A;  1Z6M A;  4XHM A;  1GSF A;  1SK2 A;  1X5E A;  1R26 A;  5H5S A;  6GSW A;  5DBQ A;  2A2R A;  5DAK B;  1TXX A;  5F06 A;  4PUA A;  4TXO B;  3UVH A;  5ID2 A;  5CNW A;  10GS A;  4PNF A;  2BTO T;  2VCZ A;  4KDU A;  2DC5 A;  2LRC A;  2HLS A;  4ECB A;  1UC7 A;  1U87 A;  3TJF A;  5B6N A;  3ZIJ A;  4YKG A;  1A2J A;  2GGT A;  11GS A;  1O8X A;  3TUE A;  2R6K A;  4IVF A;  1T4Z A;  3EU3 A;  1V40 A;  1XWA A;  3PPU A;  4KCA A;  4XRA A;  3KGK A;  1GTU A;  5CRG A;  2LS5 A;  3D22 A;  1A2L A;  2C3Q A;  2DIZ A;  1XWC A;  2H74 A;  3GX8 A;  2DMM A;  1BG5 A;  3GUR A;  3L0H A;  1XW5 A;  1Y25 A;  2WJU A;  2H73 A;  5IOW A;  1G7E A;  3GA4 A;  3IPZ A;  1XOB A;  2VL2 C;  1TK5 B;  2RM6 A;  3I43 A;  3KMN A;  4HU7 A;  1RK4 A;  2DJ1 A;  1MEK A;  1R4W A;  2RII A;  3UBL A;  2WRT A;  5ECM B;  4KA0 A;  1ERT A;  2HXK A;  2H6Z A;  2ZCT A;  1WE0 A;  3KZQ A;  3PIN A;  1YQ1 A;  5CO3 A;  1ZGN A;  1XBS A;  2REM A;  4ZB6 A;  5KN0 A;  2I1U A;  4BWS A;  4F2I A;  5AIV A;  5F0G A;  4OMV A;  2JAC A;  3M1G A;  5HR1 A;  1FOH A;  4JE1 A;  1ERU A;  2L4C A;  4WF4 A;  1QXH A;  2TRC P;  1DE2 A;  1XWB A;  2QA1 A;  1GSS A;  2VL9 A;  3F4T A;  2DJ0 A;  1ACV A;  5ENU A;  5AN1 A;  2R2J A;  3HA9 A;  4CDO A;  2A2P A;  3DRN A;  3Q19 A;  5HFG A;  1O8W A;  2IIY A;  2E7P A;  2R0P A;  1GSY A;  3GKN A;  5IM9 A;  4ECI A;  3H93 A;  1ZYP A;  1Y6E A;  1GUH A;  2M72 A;  1EZK A;  2FWE A;  3KIJ A;  1SL1 B;  1R5P A;  1K0D A;  1TP9 A;  3J7Y k;  2CZ2 A;  2RLI A;  3L78 A;  4LL1 B;  4ICY A;  1G0T A;  4EXJ A;  4V1A p;  4FO5 A;  3KTL A;  1HYU A;  20GS A;  4MJC A;  2AUV A;  3SWL A;  4F0C A;  2IMI A;  3HYP A;  5D9W A;  2JAD A;  5LNK e;  4K5R A;  2QA2 A;  3TKQ A;  2HNL A;  4WR5 A;  2H6X A;  1ILO A;  1PGT A;  3FZ9 A;  2P5R A;  3A2X A;  1A0R P;  1UN2 A;  4ULX A;  4DSR A;  1EEJ A;  1SD9 A;  3A5W A;  2PUK C;  3UOM A;  2OJL A;  2EIR A;  2YV9 A;  4MH3 A;  5HR3 A;  5HQP A;  1GTI A;  1K0A A;  4IS0 A;  2YJ7 A;  1E6B A;  3DKS A;  1WIK A;  1GTA A;  1BQ7 A;  3LOR A;  1AQW A;  3CTF A;  1TRW A;  2WDU A;  5D93 A;  1G7O A;  3LQ7 A;  2VCX A;  2DJ3 A;  2HFD A;  4IGJ A;  2PN8 A;  2X8G A;  1OVN A;  2QSI A;  3GH9 A;  1TOF A;  5E4W A;  1GUK A;  2P31 A;  3R2Q A;  3EWL A;  2ON5 A;  1FVK A;  1HNB A;  1TU7 A;  1FOV A;  3PH9 A;  1WMJ A;  4TOP A;  2G2Q A;  2OKA A;  2NTO A;  2DKI A;  3CRT A;  1QMV A;  4K0G A;  1R7H A;  1VF4 A;  4GTU A;  3C71 A;  2HZE A;  4XS1 A;  2GQL A;  1SJI A;  4EO3 A;  3LYK A;  2C8U A;  1QK8 A;  4JED A;  1MDI A;  1H4O A;  4F9Z A;  3KM6 A;  1GUM A;  4MZW A;  2H70 A;  2GQM A;  3G7I A;  4PQH A;  5JWR B;  2GT6 A;  3QAV A;  4X1U A;  4GSS A;  4YQM A;  5ECO B;  3HDC A;  3G9B A;  4HZ4 A;  4K2D A;  1NHO A;  1PMT A;  3RHB A;  4TR4 A;  1W89 A;  2LJA A;  4LLR A;  3VWX A;  3VI5 A;  2V6K A;  3CMI A;  4TW5 A;  3GST A;  2LJK A;  2R3X A;  2ZUP A;  3TKP A;  5KN1 A;  1YEP A;  3GKK A;  1OAZ A;  2LNS A;  2OBK A;  4O5Q A;  4MZB A;  7GSS A;  2F3M A;  2R4V A;  3HZ8 A;  1A23 A;  2JZT A;  3EVI A;  3LXZ A;  1U88 A;  4NV5 A;  3ERG A;  1PQN A;  1GNW A;  4PTS A;  6GSU A;  3ME7 A;  2F8F A;  5D73 A;  5A4V A;  2I81 A;  6GSV A;  5D9V A;  1M0U A;  4BVX B;  4RUV A;  3QFA C;  4PQ1 A;  5DQY A;  2RUE A;  1A0F A;  2C0D A;  1JHB A;  4ID0 A;  2AHE A;  2O8V B;  12GS A;  3DYR A;  5DCH A;  5J9C A;  1B4Q A;  2YWM A;  1B4P A;  1K0O A;  2VL3 A;  3KH9 A;  1PX7 A;  2K9F A;  3FR9 A;  3QPM A;  1XVQ A;  1GLP A;  3I9V 2;  1PX6 A;  1YKA A;  3P7X A;  1M2A A;  2HRN A;  2MMZ A;  4WKW A;  4MJE A;  2N5F A;  1K3Y A;  3HXS A;  3KEB A;  3A2W A;  1AC1 A;  3UBK A;  3TKR A;  1JZR A;  2G0F A;  3UIW A;  1Q98 A;  5ECI B;  3ZRD A;  2R0C A;  4IBP A;  3LEF A;  3KH7 A;  1OKT A;  4HI7 A;  1YF1 A;  2O89 A;  3DWV A;  4L0W A;  3U5R E;  4DEJ A;  2MBS A;  2GST A;  1SJZ A;  1HQO A;  5F8B A;  5IPG A;  3ZL5 A;  5F05 A;  2H72 A;  2OBI A;  4KGI A;  3MYD A;  2E2M A;  5D8I A;  1G6Y A;  2B5Y A;  3IAS 2;  2KHP A;  2FGX A;  3F0I A;  2HSM A;  3FR6 A;  3D21 A;  2LEG A;  3DML A;  4NHW A;  2XC2 A;  1O7U A;  5DDL A;  1A2M A;  1QGV A;  2O85 A;  4HEA 2;  2CVK A;  1Z7P A;  4YQU A;  2HE3 A;  3CSJ A;  3C8E A;  2VLT A;  1N2A A;  3LFL A;  5CP1 A;  2MYG A;  4MAB A;  3C73 A;  4ZL9 A;  2CAI A;  3IR4 A;  1NW2 A;  1OYJ A;  2DIY A;  3EMP A;  2JSZ A;  3HVV A;  1PN9 A;  3TGZ A;  3GL5 A;  1EEM A;  4XS4 A;  3QD9 A;  2VM2 A;  2HRK A;  1EV4 A;  4PNG A;  2GZY A;  2LUS A;  2FA8 A;  3TKS A;  1YKC A;  2LKU A;  3WT1 A;  5J9B A;  3F4R A;  1I9D A;  4WR4 A;  5DJM A;  2X8C A;  3I6A A;  3HZ4 A;  4IW9 A;  2O7K A;  2FNO A;  3KCM A;  2AJQ B;  2PPT A;  3M3M A;  4MDC A;  4TR1 B;  3US3 A;  2X4A A;  2L4Q A;  5CRD A;  4KB3 A;  4ZBD A;  1U6T A;  4BL7 A;  3DD3 A;  4LMV A;  3MSZ A;  1BJX A;  3HY2 A;  2MMN A;  4PGT A;  2WCI A;  1G6W A;  4H86 A;  3H79 A;  3A5I A;  2HYX A;  2H76 A;  5IMD A;  3QFB C;  2QC7 A;  2X99 A;  3GKM A;  4KCE A;  4MPF A;  5DAK A;  1T4Y A;  4KX4 A;  1PN0 A;  3C7M A;  4TXO A;  2WS2 A;  4Q5N A;  4GRF A;  4Z2U A;  1MD4 A;  2EIQ A;  2HSY A;  3CSH A;  1AQX A;  17GS A;  3ZYW A;  1EP7 A;  4WEY A;  4L5O A;  2P0G A;  4G0L A;  4KSO A;  4TRX A;  2VL2 A;  4HDE A;  2CQ9 A;  5G5E A;  1ZL9 A;  2GTU A;  2WGR A;  5ABR A;  2R5G A;  5GAN D;  1OE8 A;  4XIH A;  2P5Q A;  5J5N A;  4AJ8 A;  6GSX A;  4NWY A;  4RQX A;  1NHY A;  3LWA A;  1YDK A;  3IE3 A;  1MD3 A;  4OFT A;  1YJ6 A;  1Z6N A;  2FWG A;  4K7N A;  4ZBB A;  2O87 A;  3W8S A;  4TR3 A;  4G0K A;  4WBJ A;  1ERW A;  5HR0 A;  4HJM A;  2H1A A;  3W6G A;  4OCE A;  2X49 A;  4K9Z A;  2H1G A;  1FVJ A;  1F6M C;  3HHV A;  1WOU A;  4GLT A;  3CXG A;  1SJ6 A;  2FHE A;  3IK9 A;  1GSE A;  3SBC A;  4IP1 A;  1T7P B;  1H75 A;  5GST A;  4YKF A;  1LBK A;  1EP8 A;  4MK3 A;  2YCD A;  1SKS B;  5ELA A;  1NM3 A;  2YV7 A;  2C3N A;  5DAL B;  4V2N A;  2AV4 A;  2L57 A;  2I3Y A;  4P3Y B;  4A5P A;  1XVW A;  4J57 E;  2K8V A;  2V1M A;  1HD2 A;  2PBJ A;  3TRQ A;  2V2G A;  1VF1 A;  1V57 A;  1JLW A;  1TK8 B;  2ES7 A;  1M9A A;  1XFL A;  3TRX A;  5JCW A;  4RI7 A;  4AGS A;  1IYI A;  2HT9 A;  1TU8 A;  3F6F A;  3TRP A;  1ERV A;  1FB0 A;  1IYH A;  2A4H A;  4HU9 A;  5ECP B;  1K0N A;  2HI7 A;  3N9J A;  3V1W A;  3EYT A;  2YWI A;  1FAA A;  3LYP A;  3FY7 A;  4MCU A;  4ML6 A;  3N5O A;  4BPY A;  2HRA A;  3M9J A;  4X43 A;  2EC4 A;  1X0R A;  4EKZ A;  1S3D A;  4MZC A;  2JZR A;  2K6V A;  3UL3 A;  3RPP A;  5G1K A;  1EWX A;  4N30 A;  4MMM A;  2EIO A;  3IAM 2;  1CQH A;  3L4N A;  4RI6 A;  1XPV A;  4XRD A;  4GCI A;  3TJB A;  3FK8 A;  2N5B A;  3G7Y A;  4MNN A;  4IJI A;  1MDJ A;  3VFI A;  3VK9 A;  3DVW A;  4I6X A;  5CRE A;  2H0G A;  1Q4J A;  4AJ7 A;  2B1L A;  3IK7 A;  1TI3 A;  4O92 A;  4NPB A;  4OWY A;  3P2A A;  3EUR A;  2K8S A;  2LTK A;  4JRR A;  3TJJ A;  4TN8 A;  2YP6 A;  3UMA A;  3O6T A;  3E0U A;  2AB6 A;  3CBU A;  3KXO A;  3Q74 A;  1S3C A;  1TW9 A;  3KJY A;  3ED3 A;  4WET A;  5AIX A;  1TRV A;  4EIQ A;  1B8X A;  3GV1 A;  3ZZX A;  2H0H A;  4KH7 A;  3GL3 A;  1VRS D;  2GS3 A;  1EGR A;  5CRW A;  2V6O A;  2HZF A;  2LRT A;  4QL9 A;  5A4W A;  1WWJ A;  4Q5F A;  3EIN A;  1R5A A;  1BYE A;  1O73 A;  3VLN A;  1OC9 A;  4PXO A;  2JSY A;  3IHG A;  3QR6 A;  2H75 A;  3NIV A;  2H01 A;  2DLX A;  4NMU A;  3WYW A;  2H30 A;  3CTG A;  4Q5Q A;  2V41 A;  16GS A;  2PER A;  2FWF A;  2NDO A;  3ZML A;  1TK0 B;  2VCW A;  1YY7 A;  3GTU A;  3FZ5 A;  1SYR A;  1OC9 B;  1ML6 A;  4GQC A;  4AJ6 A;  5H5Q A;  2DJK A;  22GS A;  5HFK A;  2WB9 A;  3BCI A;  5B6M A;  5H5R A;  3M0F A;  5A4U A;  3GHA A;  3S9F A;  1GTB A;  2F9S A;  3L9S A;  4TVE A;  1SEN A;  4MF6 A;  3GTU B;  4I97 A;  5DCG A;  4Q5R A;  2MZC A;  2ALB A;  2A4V A;  2FLS A;  3ME8 A;  2N5A A;  2L5O A;  2WZ9 A;  3ZRE A;  4KDY A;  3J7Y b;  5DQS A;  4NV2 A;  5D9T A;  4WF5 A;  3EC3 A;  2LV3 A;  2WUL A;  1TKD B;  1AUC A;  4ECJ A;  2VLU A;  3DXB A;  2YOI A;  2IN3 A;  3HJP A;  3NOF A;  2XPD A;  2F51 A;  2PMT A;  2YN1 A;  4NAX A;  3LXT A;  1T00 A;  1W4V A;  5C00 A;  5HFI A;  2VD1 A;  2H0I A;  2CX4 A;  4CY6 A;  2B7J A;  2VCT A;  2DJJ A;  4BVX A;  3TB2 A;  4XS6 A;  3WT2 A;  3CSI A;  3KP9 A;  4OFN A;  4MH2 A;  1GL8 A;  4MF5 A;  3TJG A;  1ZZY A;  1KBN A;  4EDZ A;  1UVZ A;  1JZO A;  4L5L A;  5CYY A;  3PR8 A;  2L6C A;  4KUN A;  2CAQ A;  4I8B A;  3W8J A;  3D4T A;  2C0E A;  4FYU A;  4ZL8 A;  4EIP A;  2NVL A;  3BOA A;  2H8L A;  4POK A;  4KF9 A;  4BVY B;  4MF7 A;  4JZQ A;  3F3Q A;  3H8Q A;  2OE3 A;  5FHI A;  1EOG A;  2RM5 A;  6GST A;  1PA3 A;  4V1A g;  2J23 A;  3Q18 A;  3FZA A;  1C72 A;  4FQU A;  2CVB A;  4YAV A;  1OC3 A;  1GSD A;  5ECH B;  3R3E A;  4LMW A;  5JWQ B;  1T8E B;  2C80 A;  1DBY A;  4JR6 A;  1YF0 A;  4KND A;  5KOW A;  4ILF A;  2VOC A;  1OKD A;  2DSA A;  3QMX A;  5EVO A;  2H6Y A;  4ZB9 A;  4LA1 A;  3GN3 A;  5IMC A;  1AXD A;  1DSB A;  3QCP A;  4G2E A;  5IO0 A;  5A5K A;  3E3E A;  2RUF A;  3TKS E;  3ISO A;  1GH2 A;  3KP8 A;  2CVD A;  2XHF A;  4J56 E;  4TR0 A;  4Z7X A;  2PWJ A;  4K7I A;  4CHS A;  2VM1 A;  1PKZ A;  3RHC A;  5JCG A;  3UEM A;  4FYB A;  2CT6 A;  4N0V A;  2B5E A;  5AGY A;  3WD6 A;  4IQA A;  1GRX A;  4TXV A;  1EV9 A;  1XZO A;  1LU4 A;  2X8H A;  2DKH A;  3GH6 A;  4N0Z A;  1YEX A;  2B6M A;  1AQV A;  2KP1 A;  5ECR B;  3M8N A;  3ZTL A;  1Z7R A;  2C0F A;  4D73 A;  2GSQ A;  3NZN A;  4ZIL A;  2X64 A;  2L59 A;  1JZW A;  1B9Y C;  4F82 A;  5ECQ B;  2CX3 A;  4O32 A;  4KE3 A;  4TR1 A;  4Z2T A;  1WPI A;  5G30 A;  1PL2 A;  2L5L A;  4D73 B;  1X9M B;  2TRX A;  5COH A;  2H1D A;  4OCF A;  1JLV A;  2XBI A;  1WP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...