2JSYA

Solution structure of tpx in the oxidized state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVCDAQTRRFNEEAAKLGDVNVYTISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIEAAKALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable thiol peroxidase
publication title Reversible conformational switch revealed by the redox structures of Bacillus subtilis thiol peroxidase
pubmed doi rcsb
source organism Bacillus subtilis
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jsyA00
4Q5FA 1YQ1A 1CQGA 2B1LA 5J9BA 1Z7PA 5JWQB 13GSA 4V2LA 3HVXA 2FHEA 1GP1A 2TRCP 1PKWA 1H4OA 4MPGA 5JCUA 4K7OA 3GKMA 1XW9A 4PQ1A 2H74A 3HJMA 4TXOA 2KP1A 1AW9A 4CHSA 4BL7A 18GSA 1LJRA 3ZYWA 2IIYA 3WGXA 3TJGA 2M80A 4D73B 4EDYA 17GSA 2VO4A 2O89A 5B7CA 1M9BA 3RHCA 4L5OA 1Q98A 3EU3A 3F4SA 3GL3A 4N30A 4F03A 5INYA 4JU5A 5F05A 4PUAA 1A8LA 2DJ0A 2XBIA 4NV5A 2YNXA 3W6GA 2LRTA 3ZL5A 5D8IA 2F8AA 1U88A 1YF0A 2YZUA 4E8EA 2PERA 5GAPD 2FWEA 2VM2A 4MJCA 3QAVA 1XZOA 2DLXA 1OC3A 4YQVA 4LL4B 3LG6A 3KD0A 3O76A 1WMJA 1XWBA 2FCHA 4HEA2 4KA0A 1GTBA 2V1MA 3GURA 3C73A 1FAAA 3EU4A 1SENA 1EP8A 4K0GA 1ZMAA 3M0FA 1GUHA 6GSVA 5FWGA 2LS5A 4AJ6A 4ZBBA 2OADA 1AQXA 1MTCA 3TB2A 4IP6A 1WJKA 4X1UA 1B8XA 4ML6A 4ZB9A 1GSDA 2GSSA 2CV4A 3FKFA 2LTKA 2JZTA 3GV1A 3BCIA 2WS2A 5G2ZA 2H71A 4G10A 1TRWA 1MDJA 1FG4A 2VCVA 1SD8A 1RQMA 5ECMB 1PN9A 2WCIA 3JCML 4OO4A 5CRHA 2BMXA 2V41A 2FA8A 1I9DA 4ID0A 2DIZA 4MF5A 4ML1A 4TW5A 3VFIA 5GSTA 4Q5NA 1U87A 4Q5QA 1ILOA 4NAXA 2B7KA 5IPHA 3RAZA 3WGDA 5IO0A 3F3QA 3CMIA 2E2GA 1XOBA 3TKRA 3TOUA 4G2EA 4J56E 3PR8A 4FH8A 3KZQA 1V9WA 2HSHA 1M7TA 3KCMA 3HZ4A 3A5WA 5ECPB 1HNAA 4JBBA 2IN3A 2I3YA 2EC4A 2VOCA 4XIHA 3HJOA 3L0HA 1TI3A 3FZ5A 5LNKe 2HSYA 2GT6A 5IQYA 2LV3A 3DEXA 1AC1A 2JZSA 6GSYA 3ZFLA 4GCIA 1EWXA 1PQNA 1HYUA 3QAGA 4OD7A 2YJ7A 2K8VA 1UC7A 1NHOA 2WZ9A 3CTGA 4DSRA 5J41A 3HY2A 4ECCA 2XPEA 3KP8A 2PGTA 1TU7A 2RUFA 2F3MA 2GZYA 2L6CA 1O6JA 3LORA 2R5GA 3L4NA 2P5QA 2H6XA 5CREA 3TDGA 1MEKA 2LRNA 3BCKA 1PX7A 5ELGA 1MDIA 6GSXA 4ILFA 2YV7A 1UN2A 3C1SA 1DE2A 1G0TA 4KAEA 5D9WA 1ZL9A 4WF4A 1J0FA 3CTFA 3DXBA 2RM6A 6GSWA 4YAVA 1ZGNA 3APQA 3LXTA 3W8JA 2JSYA 2MMAA 1UA5A 1Y6EA 1G7OA 2RUEA 1T4ZA 4WF5A 2FWFA 3LQ7A 1TRSA 3KH7A 2CAQA 2B5YA 1V57A 2LQOA 1WOUA 3IAM2 1TRVA 1UVZA 2G0FA 3PGTA 4F0BA 3LEFA 1M99A 4IS0A 4QQ7A 5ABRA 2HFDA 1BQ7A 4AF2A 2HNLA 3DYRA 1JLWA 1S3AA 2DSAA 4IELA 3P7XA 4ZL7A 1LBKA 1KEBA 5C04A 5ECIB 5JCWA 1THXA 4I6XA 5IMVA 2R3XA 3A3TA 5HFKA 4K6XA 3ZMLA 3G7JA 2K9FA 2H19A 3C71A 2NVLA 1TOFA 1T1VA 2MBSA 2GSTA 3DMLA 6GSTA 1PX6A 22GSA 2IMDA 2J9HA 3F4RA 4K1FA 4IBPA 3DIEA 5J9CA 3UBKA 4HQZA 4ECJA 1OVNA 2F51A 2LKUA 3CBUA 1TDIA 3ZITA 3M3MA 3VWWA 1WPIA 2IMKA 1M9AA 5CNWA 19GSA 3GX8A 1ACVA 3FEUA 2ZUPA 2C4JA 3UBLA 2ON5A 4OCEA 2CVBA 1BJXA 3HHVA 1YZXA 2HRFA 5HR2A 3WYWA 2PN8A 4HJ2A 4TR3A 2G2QA 3KIJA 4MJEA 4KGIA 1BEDA 1X5CA 3QOUA 4HZ2A 1NSWA 2ZCTA 3A2XA 3DGQA 2C3NA 2D2ZA 2WB9A 4YAPA 4HU7A 3HXSA 3F9UA 1DSBA 3SWLA 3UL3A 4BVYA 2N5BA 5F8BA 2GQMA 2CVKA 5HQPA 4XS1A 4WKWA 1OE7A 1QUWA 4KNDA 3VK9A 1HQOA 4WETA 4AJ8A 4G9HA 4F2IA 3CYNA 1NW2A 3LYPA 2X8CA 2VD1A 2MZCA 2H1DA 4XS4B 1EGOA 14GSA 2E2MA 1XXUA 3GH9A 3A2VA 4PNFA 4O5RA 5ECRB 2QSIA 5IOWA 2FWHA 3HKRA 3Q18A 4PUFC 4HS1A 5HFIA 5A4WA 2DJ1A 4BPYA 3D21A 3V1WA 3WT1A 3LJRA 1HNBA 2HZEA 5JCGA 4TRXA 5B8AA 5DVBA 3IDVA 5CRWA 2YV9A 3F0IA 2N5AA 1GUKA 5G5FA 2AUVA 3RBTA 5DAKB 3I69A 5ECSA 5KN2A 3EWLA 3TOTA 4GXZA 1OC9B 5G1LA 4V1Ap 4FYCA 4N0VA 1ZYQB 5CP1A 2VAFA 3ZIJA 3DKSA 2XC2A 5D9XA 1GTUA 2DMMA 2L6DA 3D0ZA 3IAS2 1EZKA 4XRAA 3ME7A 2VCWA 1AQWA 3QMXA 4ULXA 3G7IA 3KP9A 2A2RA 1SK0A 5F07A 2GGTA 4TR1B 1E2YA 5DJLA 4XTSA 1S3DA 4CW9A 2GZZA 4N11A 1BAYA 2VL9A 1M2DA 4IHUA 3WGEA 1F3AA 1U6TA 3ZRDA 2MMZA 2AB6A 3F6DA 2H01A 1MDKA 3PH9A 2GT5A 4IP1A 2J23A 1W89A 1WWJA 4GSNA 1SD9A 3H93A 1VF3A 2FGXA 3P8WA 4F0CA 5DALA 4GRFA 3QDNA 3TKSE 3I6AA 1GSQA 1GH2A 1B4PA 2LSTA 2LQQA 3Q74A 1FHEA 3KMNA 3TKQA 4WR5A 1X5EA 1WE0A 5IMCA 4MA9A 1FVJA 1VF2A 3RPNA 4GSSA 4WXTA 1ML6A 4EVMA 2KHPA 2C0EA 2B1KA 2VUPA 2VLUA 3LFLA 5KN3A 1XWKA 1ZCPA 3D6IA 2OBKA 2GQLA 4KSMA 3VWVA 5CO3A 3UVTA 3VPQA 3CXGA 4XRDA 1X5DA 1QXHA 1XBSA 1XVWA 1Q4JA 5CAXA 3EMXA 4PX1A 2K6VA 4MP4A 1THOA 1ON4A 4MJAA 1GRXA 1OC9A 1H75A 2IMFA 4KCEA 4ZB6A 1WRYA 5ECLB 2H1BA 4GF0A 3GTUA 3GFKA 1X9SB 3CRTA 3U5RE 5AN1A 2M72A 1SL2B 4MDCA 1EOHA 2PMTA 2ALBA 3TRQA 3UIWA 3CSJA 2H30A 1U3IA 2B5XA 2NBSA 1A23A 2PVQA 4HQSA 1FB6A 5D93A 4IQAA 3LXZA 4P3YB 4POLA 3K8NA 1PGTA 4MK3A 1URMA 4V1Ag 1YY7A 3VI7A 2H0HA 1R4WA 1USBA 2P31A 4ZL9A 2H75A 1O8WA 4HZ4A 4L5LA 3SBCA 4J2FA 4RUVA 1B9YC 3QPMA 5IM9A 5G30A 4PURA 1BG5A 2GTUA 1EP7A 1GSEA 2ON7A 2VCTA 1OC8A 2GQKA 5ID2B 2A4VA 3GNJA 2C1YA 1BYEA 2FD3A 1Z6MA 1XVQA 3F4TA 1N8JA 1TXXA 4G19A 1LU4A 3VLNA 2JACA 1J08A 3GSSA 1XWCA 2NTOA 2WRTA 2AV4A 4PGTA 2HZFA 1QFNA 4GSTA 2H6YA 4D73A 4GQCA 3KGKA 3GKKA 1PL1A 4F9ZA 2REMA 2KP2A 1WIKA 3KJYA 2CVDA 4TXVA 4MPFA 4HI7A 2DIYA 1R5AA 2B3SA 4X0XA 1X0RA 2H66A 5ECOB 2VL3A 4L0UA 4N10A 3J7Yb 4I97A 3BBYA 2H1AA 3DWVA 3KH9A 5IPGA 5IOXA 1SKWB 1K3OA 4EDZA 3TJJA 4BWQA 4OWYA 2KUCA 4K0NA 3IRAA 1V2AA 3UVHA 2IWTA 4OO5A 4F82A 3QCPA 3Q6OA 1QQ2A 4IJ3A 1GLQA 1GTAA 4QL7A 1AAZA 3IPZA 2PU9C 4IJIA 3D5JA 2V2GA 2FA4A 4ZL8A 1SJZA 2PUKC 1XOAA 4DSSB 2YWOA 2L57A 2YN1A 1MD3A 5KN1A 1TJDA 3A2WA 2LEGA 4IKHA 3H79A 3ED3A 4TKYA 4BVXA 2C3QA 4WBJA 3KXOA 4I2UA 4MZCA 4MZBA 3GSTA 1GTIA 2VL2A 5G5EA 1I5GA 1GL8A 1JHBA 1K3YA 5H5RA 1SJ6A 5ECKB 4ACSA 4LLRA 3FR3A 5FT3A 3D4TA 3ME8A 1F3BA 4ZILA 3GHAA 1GUMA 4LMWA 1OYJA 4DEJA 1R26A 4MF6A 1A24A 3H8QA 2PBJA 4KX4A 3APSA 1SL0B 3FR9A 3FY7A 1AQVA 2VLVA 2CX3A 3BOAA 4I8BA 2XPDA 1PMTA 3CSHA 4MABA 1OAZA 1KTEA 3IOSA 2GZPA 2R37A 5IMDA 1A8YA 1R5PA 5DCGA 4K2DA 4PNGA 4HDEA 4GLTA 3TJBA 2F8FA 1SK2A 3BD2A 4GTUA 1PSQA 2CZ2A 4NXIA 4ECBA 4WBRD 3GH6A 1K0BA 4OFMA 1PL2A 2QKEA 3U6VA 1X9WB 2C3TA 4ECIA 3IK7A 5GZZB 2LNTA 3N9JA 1TK5B 1GULA 3R2QA 3FZ4A 2L4CA 2IFQB 4TR0A 3TRXA 5HR0A 5A5KA 3VI5A 2ES7A 3D4MA 1MD4A 3UOMA 4RQXA 2FLSA 4DSSA 5D9VA 4KDXA 1U3AA 20GSA 2FY6A 2GLRA 3LGCA 4L8EA 1SL1B 1XFLA 1EEMA 2GVPA 2I1UA 5GSSA 3H1NA 1Z9HA 1DE1A 3UAPA 3L9SA 1JZRA 2O87A 4XCSA 5EY6A 4K7NA 1IYIA 1EOGA 3ZLPA 1OKDA 2CAIA 4MZWA 1S3CA 4CDOA 5DDLA 3NIVA 2IL3A 2O85A 1OKTA 4O92A 4PXOA 5JWRB 4JR4A 5ENUA 3HD5A 4MF7A 3J7Yk 3FHKA 1SKRB 4EC0A 1F6MC 5H5QA 2V6KA 2TRXA 2RM5A 4TXOB 2AYTA 2YWMA 3KM6A 1PRXA 2DJKA 5G31A 1AXDA 4NV2A 4MH2A 3GKNA 4HOJA 1ZYEA 3VURA 2MBTA 6GSSA 1HD2A 2V6OA 1K0CA 3GRXA 4MCUA 1O8XA 3F63A 4RI6A 1TRUA 4IW9A 4QL9A 4OMVA 3GMFA 4KB3A 1GSSA 1DBYA 1K0DA 2MYGA 1CQHA 1KNGA 1EEJA 3PINA 2DC5A 5F06A 1R7HA 3IHQA 1A2LA 1A2JA 4NPBA 5EL8A 2WGRA 2YWNA 2X99A 1TTZA 2L59A 3TCOA 2X8HA 2HRNA 1SJIA 1ERTA 4Q5RA 2X64A 2A2SA 2MMOA 4AJ7A 1KBNA 4RI7A 2C8UA 5HR1A 1GSUA 1G6YA 9GSSA 3IE3A 2XHFA 4K7IA 3LSZA 3AY8A 2KOKA 3I9V2 2LJKA 3VWXA 3GL5A 1K3LA 5CYYA 2YCDA 1AIUA 11GSA 2DBCA 2VD0A 4POBA 3KTBA 2WJUA 3IK9A 3MSZA 2OE3A 2VIMA 2VL2C 4ISDA 4J57E 5F0GA 1M2AA 1EV4A 1ZOFA 2LUSA 3HCZA 3P90A 2WULA 4JZQA 3W8SA 1OE8A 1ERWA 2CQ9A 2FUG2 2FWGA 1SYXA 4I5QA 2WDUA 4IQ1A 3HYPA 2BTOT 4LMVA 2E7PA 3MDKA 2EIRA 1XIYA 4RQRA 5AGYA 1FOVA 4EUYA 4I2TA 1V58A 2I81A 3VWUA 4OCFA 2HLSA 1B4QA 4AGSA 4XS4A 1BX9A 4BA7A 1FVKA 2KLXA 4FYUA 4PQIA 2I4AA 4NMUA 1Z5YE 3M8NA 4YH2A 2GS3A 1V40A 4N0ZA 2GSQA 2AHEA 2OE0A 4FO5A 1FW1A 2OACA 5IMFA 2YOIA 2P5RA 1TK0B 3Q19A 1SK1A 3US3A 4OFTA 12GSA 5DAKA 7GSSA 2BJXA 1Z7RA 2H72A 5DQYA 3RPPA 2CZ3A 3UARA 1G6WA 2VM1A 3TKSA 2GSRA 1F37A 1K0NA 1Z3EA 3F8UA 5CRDA 1JZWA 2RLIA 2VCQA 2JADA 3MAKA 3ZVJA 1YEXA 2H76A 2OKAA 2EIOA 1F9MA 1RK4A 4POKA 1JLVA 5DBQA 3EINA 4JR6A 3G7YA 1QK8A 2R4VA 4K9ZA 4TR1A 5EPFA 1ERUA 4MMMA 4O7HA 2ZNMA 1SKSB 3GUSA 5D9TA 2K8SA 4TN8A 1PA3A 4DSQA 3NOFA 2O8VB 2K18A 4MJBA 4ZBDA 3EMPA 4NHWA 1YKCA 2H6ZA 5E4WA 4GWRA 1GNEA 5L71A 3DVXA 2LRCA 3LYKA 5J3RA 2TIRA 1NM3A 2VCXA 3ZTLA 4E8HA 4O32A 3TRPA 4L0WA 1J9BA 1O81A 3ERGA 5E59A 2F9SA 2X8GA 2OA7A 2DJJA 4POMA 3MNGA 3LWAA 3N5OA 3DD3A 4EXJA 3HJPA 3BJ5A 3HZ8A 5GAND 2QC7A 3E9JB 1XCCA 5B6MA 3HVSA 2PWJA 3TJKA 3I43A 3L78A 5ECNB 1GSYA 3GYKA 5COHA 4WEYA 3ZREA 2JSZA 2EIQA 2XBQA 3ERWA 3EYTA 5FHIA 3TJFA 2CT6A 5J4UA 1VGLA 1K0OA 1JZOA 2AJQB 3FRCA 4NWYA 5DCHA 1ERVA 4ZXGA 3F3RA 1JZDA 4EE0A 2PVOC 10GSA 4NHZA 2YP6A 5G1KA 4KDUA 5ECQB 2JL4A 3QAWA 2YZHA 2OBIA 2I9HA 2E0QA 1ABAA 4ZBAA 1TK8B 1SU9A 4V2NA 1HNCA 1F2EA 5H5SA 3QD9A 4KDYA 2FNOA 3TUEA 2YPMA 2Z9SA 3DVWA 1G7EA 3ZVJD 3IV4A 4EF0A 4KUNA 1VRSD 4FYBA 2YJHA 3F6FA 2HYXA 3S9FA 4HU9A 5D96A 5KN0A 1Z6NA 1AUCA 2MMNA 5LD0A 3ISOA 3ZMKA 1B48A 1JFUA 3IXRA 3KTLA 1M0UA 5KEJA 2B6MA 4IN0A 2IPAA 1ST9A 4DVCA 4X43A 2DJ2A 1A0RP 3APOA 4GQFA 4TOPA 5IIZA 5J5NA 1X9MB 3FK8A 1DUGA 1Y25A 1W4VA 1YJ6A 3GN3A 3FR6A 1YF1A 3GIXA 2WFCA 4FIWA 2O7KA 1YEPA 4MLYA 3GA4A 3GX0A 2DMLA 4ZB8A 2NDOA 1GLPA 1GWCA 2CA8A 2PPTA 4XS6A 3UEMA 3CRUA 2H0GA 2L5OA 3DRNA 3M9KA 5ID2A 1TI1A 4LL1B 3FZAA 3RDWA 4IGJA 3EVIA 3EURA 3WD6A 2H70A 3E0UA 3HVVA 3GKXA 2DJ3A 4IVFA 4EKZA 2HT9A 2GDRA 1FO5A 3ZFBA 1T8EB 2JZRA 1K0AA 2IJYA 2LNSA 3HA9A 1GNWA 3TKSC 3IBHA 1YDKA 1VF4A 2HZEB 1TKDB 3KMOA 1XW6A 1A2MA 4V2MA 1FB0A 4XHMA 3KEBA 1VF1A 6GSUA 1SYRA 3M1GA 2B5EA 3EC3A 3O6TA 2M46A 4HUAA 5A4UA 1T4YA 5LCZA 3NZNA 2IMIA 4JE1A 4WR4A 1XWGA 3WT2A 4K8MA 3G9BA 4KW6A 3C7MA 2HXKA 5HFGA 5C00A 3CSIA 1M2BA 1ZZYA 1E6BA 2AAWA 3TGZA 1NHYA 3IC4A 2RIIA 1IYHA 5ECHB 4JRRA 4MH3A 3IA1A 4LA1A 4HJMA 2C0GA 4TVEA 2OJLA 3FZ9A 2IMEA 5JWOB 5DQSA 3ZZXA 1T00A 5AISA 2NPBA 1XWAA 1C72A 1RW1A 2JU5A 4YQMA 1EV9A 2R6KA 2L5LA 3P2AA 3M9JA 1YKAA 1PD21 3O3TA 3OR5A 5A4VA 5DALB 4H86A 3EE2A 1EGRA 3UJ1A 2C80A 4YQUA 2QGVA 2HE3A 5AIXA 1GSFA 1O73A 4ZIJA 2HI7A 4JEDA 4OFNA 5AIVA 3HDCA 2H8LA 4KCAA 3FW2A 4PQHA 4TR4A 2OE1A 2C0FA 1B9XC 5DJMA 5D73A 3E3EA 2VCZA 5B6NA 1N2AA 3C8EA 1O7UA 3ZIVA 8GSSA 4Z7XA 3D22A 5IO2A 3RHBA 3QFBC 3QFAC 5HR3A 3IR4A 4KSOA 1T7PB 3QR6A 1TW9A 4EO3A 1O85A 2VLTA 1PKZA 2C0DA 3VPTA 4EL1A 2H73A 2IFQA 1T3BA 4BWSA 3L9VA 1K0MA 16GSA 2CX4A 3GTUB 1A0FA 5IMZA 5B8BA 2B7JA 1WP0A 3ERFA 3TKPA 1QMVA 2N5FA 3C1RA 1QGVA 2H1GA 5EVOA 1V98A 3UMAA 2LJRA 2L4QA 2V32A 2R2JA 3L9UA 2P0GA 3MWHA 3FYGA 1TP9A 1XW5A 3H4KA 5IMAA 2H0IA 1TU8A 5ELAA 5CRGA 1XPVA 2YWIA 4KE3A 4KH7A 2LJAA 2YANA
chains in the Genus database with same CATH superfamily
4Q5FA 1YQ1A 1CQGA 2B1LA 5J9BA 1Z7PA 5JWQB 13GSA 4V2LA 3HVXA 2FHEA 1GP1A 2TRCP 1PKWA 1H4OA 4MPGA 5JCUA 4K7OA 3GKMA 1XW9A 4PQ1A 2H74A 3HJMA 4TXOA 2KP1A 1AW9A 3CQFA 4CHSA 4BL7A 18GSA 1LJRA 3ZYWA 2IIYA 3WGXA 3TJGA 2A4HA 2M80A 4D73B 4EDYA 17GSA 2VO4A 2O89A 5B7CA 1M9BA 3RHCA 4L5OA 1Q98A 3EU3A 3F4SA 3GL3A 4N30A 4F03A 5INYA 4JU5A 5F05A 4PUAA 1A8LA 2DJ0A 2XBIA 4NV5A 2YNXA 3W6GA 2LRTA 3ZL5A 5D8IA 2F8AA 1U88A 1YF0A 2YZUA 4E8EA 2PERA 5GAPD 2FWEA 2VM2A 4MJCA 3QAVA 1XZOA 2DLXA 1OC3A 4YQVA 4LL4B 3LG6A 3KD0A 4BIKA 3O76A 1WMJA 1XWBA 2FCHA 4HEA2 4KA0A 1GTBA 4O5UA 2V1MA 3GURA 3C73A 1FAAA 3EU4A 1SENA 1EP8A 4K0GA 1ZMAA 4ICYA 3M0FA 1GUHA 6GSVA 5FWGA 2LS5A 4AJ6A 4ZBBA 2OADA 1AQXA 1MTCA 3TB2A 4IP6A 1WJKA 4X1UA 1B8XA 1PFOA 4ML6A 4ZB9A 1GSDA 4BVXB 2GSSA 2CV4A 3FKFA 2LTKA 2JZTA 3GV1A 3BCIA 2WS2A 5G2ZA 2H71A 4G10A 1TRWA 1MDJA 1FG4A 2VCVA 1SD8A 1RQMA 5ECMB 1PN9A 2WCIA 3JCML 4OO4A 3PPUA 5CRHA 2BMXA 2V41A 2FA8A 1I9DA 4ID0A 2DIZA 4MF5A 4ML1A 4TW5A 3VFIA 5GSTA 4Q5NA 1U87A 4Q5QA 1ILOA 4NAXA 2B7KA 5IPHA 3RAZA 3WGDA 2HRKA 5IO0A 3F3QA 3CMIA 2E2GA 1XOBA 3TKRA 3TOUA 4G2EA 4J56E 3PR8A 4FH8A 3KZQA 1V9WA 2HSHA 1M7TA 3KCMA 3HZ4A 3A5WA 5ECPB 1HNAA 4JBBA 2IN3A 2I3YA 2EC4A 2VOCA 4XIHA 4Z2TA 3HJOA 3L0HA 1TI3A 3FZ5A 5LNKe 2HSYA 2GT6A 5IQYA 2A2PA 2LV3A 3DEXA 1AC1A 2JZSA 6GSYA 3ZFLA 4GCIA 1EWXA 1PQNA 1HYUA 3QAGA 4OD7A 2YJ7A 2K8VA 1UC7A 1NHOA 2WZ9A 3CTGA 4DSRA 5J41A 3HY2A 4ECCA 2XPEA 3KP8A 2PGTA 1TU7A 2RUFA 3IHGA 2QA2A 2F3MA 2GZYA 2L6CA 1O6JA 3LORA 2R5GA 3L4NA 2P5QA 2H6XA 5CREA 3TDGA 1MEKA 2LRNA 3BCKA 1PX7A 5ELGA 1MDIA 6GSXA 4ILFA 2YV7A 1UN2A 3C1SA 1DE2A 1G0TA 4KAEA 5D9WA 1ZL9A 4WF4A 1J0FA 3CTFA 3DXBA 2RM6A 6GSWA 4YAVA 1ZGNA 3APQA 3LXTA 3W8JA 2JSYA 2MMAA 1UA5A 1Y6EA 1G7OA 2RUEA 1T4ZA 4WF5A 2FWFA 3LQ7A 1TRSA 3KH7A 2CAQA 2B5YA 1V57A 2LQOA 1WOUA 3IAM2 1TRVA 1UVZA 2G0FA 3PGTA 4F0BA 3LEFA 1M99A 4IS0A 4QQ7A 5ABRA 2HFDA 1BQ7A 4AF2A 2HNLA 3DYRA 1JLWA 4YKFA 1S3AA 2DSAA 4IELA 3P7XA 4ZL7A 1LBKA 1KEBA 5C04A 5ECIB 5JCWA 1THXA 4I6XA 5IMVA 2R3XA 3A3TA 5HFKA 4K6XA 3ZMLA 3G7JA 2K9FA 2H19A 3C71A 4Z2RA 2NVLA 1TOFA 3R3EA 1T1VA 2MBSA 2GSTA 3DMLA 6GSTA 1PX6A 22GSA 2IMDA 2J9HA 3F4RA 4K1FA 4IBPA 3DIEA 5J9CA 3UBKA 4HQZA 4HSCX 4ECJA 1OVNA 2F51A 2LKUA 3CBUA 1TDIA 3ZITA 3M3MA 3VWWA 1WPIA 2IMKA 1M9AA 4MNNA 5CNWA 19GSA 3GX8A 1ACVA 3FEUA 2ZUPA 2C4JA 3UBLA 2ON5A 4OCEA 2CVBA 1BJXA 3HHVA 1YZXA 2HRFA 5HR2A 3WYWA 2PN8A 4HJ2A 4TR3A 2G2QA 3KIJA 4MJEA 4KGIA 1BEDA 1X5CA 3QOUA 4HZ2A 1NSWA 2ZCTA 3A2XA 3DGQA 2C3NA 2D2ZA 2WB9A 4YAPA 4HU7A 3HXSA 3F9UA 1DSBA 3SWLA 3UL3A 4BVYA 2N5BA 5F8BA 2GQMA 2CVKA 5HQPA 4XS1A 4WKWA 1OE7A 1QUWA 4KNDA 3VK9A 1HQOA 4WETA 4AJ8A 4G9HA 4F2IA 3CYNA 1NW2A 3LYPA 2X8CA 2VD1A 2MZCA 2H1DA 4XS4B 1EGOA 14GSA 2E2MA 1XXUA 3GH9A 3A2VA 4PNFA 4O5RA 5ECRB 2QSIA 5IOWA 2FWHA 3HKRA 3Q18A 4PUFC 4HS1A 5HFIA 5A4WA 2DJ1A 4BPYA 3D21A 3V1WA 3WT1A 3LJRA 1HNBA 2HZEA 5JCGA 4TRXA 5B8AA 5DVBA 3IDVA 5CRWA 2YV9A 3F0IA 2N5AA 1GUKA 5G5FA 2AUVA 3RBTA 5DAKB 3I69A 5ECSA 5KN2A 3EWLA 3TOTA 4GXZA 1OC9B 5G1LA 4V1Ap 4FYCA 4N0VA 1ZYQB 5CP1A 2VAFA 3ZIJA 3DKSA 2XC2A 5D9XA 1GTUA 2DMMA 2L6DA 3D0ZA 3IAS2 1EZKA 4XRAA 3ME7A 2VCWA 1AQWA 3QMXA 4ULXA 3G7IA 4G0IA 3KP9A 2A2RA 1SK0A 5F07A 2GGTA 4TR1B 1E2YA 5DJLA 4XTSA 1S3DA 4CW9A 2GZZA 4N11A 1BAYA 2VL9A 1M2DA 4IHUA 3WGEA 1F3AA 1U6TA 3ZRDA 2MMZA 2AB6A 3F6DA 2H01A 1MDKA 3PH9A 2GT5A 4IP1A 2J23A 1W89A 1WWJA 4GSNA 1SD9A 3H93A 1VF3A 2FGXA 3P8WA 4F0CA 5DALA 4GRFA 3MIXA 3QDNA 3TKSE 2R0GA 3I6AA 1GSQA 1GH2A 1B4PA 2LSTA 2LQQA 3Q74A 1FHEA 3KMNA 3TKQA 4WR5A 1X5EA 1WE0A 5IMCA 4MA9A 1FVJA 1VF2A 3RPNA 4GSSA 4WXTA 1ML6A 4EVMA 2KHPA 2C0EA 2B1KA 2VUPA 5BRTA 2VLUA 3LFLA 5KN3A 1XWKA 1ZCPA 3D6IA 2OBKA 2GQLA 4KSMA 3VWVA 5CO3A 3UVTA 3VPQA 3CXGA 4XRDA 1X5DA 1QXHA 1XBSA 1XVWA 1Q4JA 5CAXA 3EMXA 4PX1A 2K6VA 3EPTA 4MP4A 1THOA 1ON4A 4MJAA 1GRXA 1OC9A 1H75A 2IMFA 4KCEA 4ZB6A 1WRYA 5ECLB 2H1BA 4GF0A 3GTUA 3GFKA 1X9SB 3CRTA 3U5RE 5AN1A 5KOWA 2M72A 1SL2B 4MDCA 2HSMA 1EOHA 1ZYNA 2PMTA 2ALBA 3TRQA 3UIWA 3CSJA 2H30A 1U3IA 2B5XA 2NBSA 1A23A 2PVQA 4HQSA 1FB6A 5D93A 4IQAA 3LXZA 4P3YB 4POLA 3K8NA 1PGTA 4MK3A 1URMA 4V1Ag 1YY7A 3VI7A 1ZYPA 2H0HA 1R4WA 1USBA 2P31A 4ZL9A 2H75A 1O8WA 4HZ4A 4L5LA 3SBCA 4J2FA 4RUVA 1B9YC 3QPMA 5IM9A 5G30A 4PURA 1BG5A 2GTUA 1EP7A 1GSEA 2ON7A 2VCTA 1OC8A 2GQKA 5ID2B 2A4VA 3GNJA 2C1YA 1BYEA 2FD3A 1Z6MA 1XVQA 3F4TA 1N8JA 1TXXA 4G19A 1LU4A 3VLNA 2JACA 1J08A 3GSSA 1XWCA 2NTOA 2WRTA 2AV4A 4PGTA 2HZFA 1QFNA 4GSTA 2H6YA 4USSA 4D73A 4GQCA 4PTSA 3KGKA 3GKKA 1PL1A 4F9ZA 2REMA 2KP2A 1WIKA 4YKGA 2DKIA 3KJYA 2CVDA 4TXVA 4MPFA 4HI7A 2DIYA 1R5AA 2B3SA 4X0XA 4EIPA 1X0RA 2H66A 5ECOB 2VL3A 4L0UA 4N10A 3J7Yb 4I97A 3BBYA 2H1AA 3DWVA 3KH9A 5IPGA 5IOXA 1SKWB 1K3OA 4EDZA 3TJJA 4BWQA 4OWYA 2KUCA 4K0NA 3IRAA 1V2AA 3UVHA 2IWTA 4OO5A 4F82A 3QCPA 3Q6OA 1QQ2A 4IJ3A 1GLQA 1GTAA 4QL7A 4CY8A 1AAZA 3IPZA 2PU9C 4IJIA 3D5JA 2V2GA 2FA4A 4ZL8A 1SJZA 2PUKC 1XOAA 4DSSB 2YWOA 2L57A 2YN1A 1MD3A 5KN1A 1TJDA 4K2XA 3A2WA 2LEGA 4IKHA 3H79A 3ED3A 4EIQA 4TKYA 4BVXA 2C3QA 4WBJA 3KXOA 4I2UA 4MZCA 4MZBA 3GSTA 1GTIA 4G0KA 2VL2A 5G5EA 1I5GA 1GL8A 1JHBA 1K3YA 5H5RA 1SJ6A 5ECKB 4ACSA 4LLRA 3FR3A 5FT3A 3D4TA 3ME8A 1F3BA 4ZILA 3GHAA 1GUMA 4LMWA 1OYJA 4DEJA 1R26A 4MF6A 1A24A 3H8QA 2PBJA 4KX4A 3APSA 1SL0B 3FR9A 3FY7A 1AQVA 2VLVA 2CX3A 3BOAA 4I8BA 2XPDA 1PMTA 3CSHA 4MABA 1OAZA 1KTEA 3IOSA 3FMWA 2GZPA 2R37A 5IMDA 1A8YA 1R5PA 5DCGA 4K2DA 4PNGA 4HDEA 4GLTA 2UZ8A 3TJBA 2F8FA 1SK2A 3BD2A 4GTUA 1PSQA 2CZ2A 4NXIA 4ECBA 4WBRD 3GH6A 1K0BA 4OFMA 1PL2A 2QKEA 3U6VA 1X9WB 2C3TA 4ECIA 3IC8A 3IK7A 5GZZB 2LNTA 3N9JA 1TK5B 1GULA 3R2QA 3FZ4A 2L4CA 2IFQB 4TR0A 3TRXA 5HR0A 5A5KA 3VI5A 2ES7A 3D4MA 2X4AA 1MD4A 3UOMA 4RQXA 2FLSA 4DSSA 5D9VA 4KDXA 1U3AA 20GSA 2FY6A 2GLRA 3LGCA 4L8EA 1SL1B 1XFLA 1EEMA 2GVPA 2I1UA 4Z2UA 5GSSA 3H1NA 1Z9HA 1DE1A 3UAPA 3L9SA 1JZRA 2O87A 4XCSA 5EY6A 4K7NA 1IYIA 1EOGA 3ZLPA 1OKDA 2CAIA 4MZWA 1S3CA 3HVNA 4CDOA 5DDLA 3NIVA 2IL3A 2O85A 1OKTA 4O92A 4PXOA 5JWRB 4JR4A 5ENUA 3HD5A 4MF7A 3J7Yk 3FHKA 1SKRB 4EC0A 1F6MC 5H5QA 2V6KA 2TRXA 2RM5A 4TXOB 2AYTA 2YWMA 3KM6A 1PRXA 2DJKA 5G31A 4BL7B 1AXDA 4NV2A 4MH2A 3GKNA 4HOJA 1ZYEA 3VURA 2MBTA 6GSSA 1HD2A 2V6OA 1K0CA 3GRXA 4MCUA 1O8XA 3F63A 4RI6A 1TRUA 4IW9A 4QL9A 4OMVA 3GMFA 4KB3A 1GSSA 1DBYA 1K0DA 2MYGA 1CQHA 1KNGA 1EEJA 3PINA 4K5SA 2DC5A 5F06A 1R7HA 3IHQA 1A2LA 1A2JA 4NPBA 5EL8A 2WGRA 2YWNA 2X99A 1TTZA 2L59A 3TCOA 2X8HA 2HRNA 1SJIA 1ERTA 4Q5RA 2X64A 2A2SA 2MMOA 4AJ7A 1KBNA 4RI7A 2C8UA 5HR1A 1GSUA 1G6YA 9GSSA 3IE3A 2XHFA 4K7IA 3LSZA 3AY8A 2KOKA 3I9V2 2LJKA 3VWXA 3GL5A 1K3LA 5CYYA 2YCDA 1AIUA 11GSA 2DBCA 2VD0A 4POBA 3KTBA 2WJUA 3IK9A 3MSZA 2OE3A 2VIMA 2VL2C 4ISDA 4J57E 5F0GA 1M2AA 1EV4A 1ZOFA 2LUSA 3HCZA 3P90A 2WULA 4JZQA 3W8SA 1OE8A 1ERWA 2CQ9A 2FUG2 2FWGA 1SYXA 4I5QA 2WDUA 4IQ1A 4O5QA 3HYPA 2BTOT 4LMVA 2E7PA 3MDKA 2EIRA 1XIYA 4RQRA 5AGYA 1FOVA 4EUYA 4I2TA 1V58A 2I81A 3VWUA 4OCFA 2HLSA 1B4QA 4AGSA 4XS4A 1BX9A 4BA7A 1FVKA 2KLXA 4FYUA 4PQIA 2I4AA 2HRAA 4NMUA 1Z5YE 4CY6A 3M8NA 4YH2A 2GS3A 1V40A 4N0ZA 4G0LA 2GSQA 2AHEA 2OE0A 4FO5A 1FW1A 2OACA 5IMFA 4FQUA 2YOIA 2P5RA 1TK0B 3Q19A 4KF9A 3A5IA 1SK1A 3US3A 4OFTA 12GSA 5DAKA 7GSSA 2BJXA 1Z7RA 2H72A 5DQYA 3RPPA 2CZ3A 3UARA 1G6WA 2VM1A 3TKSA 2GSRA 1F37A 1K0NA 1Z3EA 3F8UA 5CRDA 1JZWA 2RLIA 2VCQA 2JADA 3MAKA 3ZVJA 1YEXA 2H76A 2OKAA 2EIOA 1F9MA 1RK4A 4POKA 1JLVA 5DBQA 3EINA 4JR6A 3G7YA 1QK8A 2R4VA 4K9ZA 4TR1A 5EPFA 1ERUA 4MMMA 4O7HA 2ZNMA 1SKSB 3GUSA 5D9TA 2K8SA 4TN8A 1PA3A 4DSQA 3NOFA 2O8VB 2K18A 4MJBA 4ZBDA 3EMPA 4NHWA 1YKCA 2H6ZA 1M3JA 5E4WA 4GWRA 1GNEA 5L71A 3DVXA 2LRCA 4X4JA 3LYKA 5J3RA 2TIRA 1NM3A 2VCXA 3ZTLA 4E8HA 4O32A 3TRPA 4L0WA 1J9BA 1O81A 3ERGA 5E59A 2F9SA 2X8GA 2OA7A 2DJJA 4POMA 5BMUA 1XG8A 3MNGA 3LWAA 3N5OA 3DD3A 3MYDA 3HJPA 4EXJA 3BJ5A 3HZ8A 5GAND 2QC7A 3E9JB 1XCCA 5B6MA 3HVSA 2PWJA 3TJKA 3I43A 3L78A 5ECNB 1GSYA 3GYKA 5COHA 4WEYA 3ZREA 2JSZA 2EIQA 2XBQA 3ERWA 3EYTA 5FHIA 3TJFA 2CT6A 4A5PA 5J4UA 1VGLA 1K0OA 2QA1A 1JZOA 2AJQB 3FRCA 4NWYA 5DCHA 1ERVA 4ZXGA 3F3RA 1JZDA 4EE0A 2PVOC 10GSA 4NHZA 2YP6A 5G1KA 4KDUA 5ECQB 2JL4A 3QAWA 2YZHA 2OBIA 2I9HA 2E0QA 1ABAA 4ZBAA 1TK8B 1SU9A 4V2NA 1HNCA 1F2EA 5H5SA 3QD9A 4KDYA 2FNOA 3TUEA 2YPMA 2Z9SA 3DVWA 1G7EA 3ZVJD 3IV4A 4EF0A 4KUNA 1VRSD 4FYBA 2YJHA 3F6FA 2HYXA 3S9FA 4HU9A 5D96A 5KN0A 1Z6NA 1AUCA 2MMNA 5LD0A 3ISOA 3ZMKA 1B48A 1JFUA 3IXRA 3KTLA 1M0UA 5KEJA 2B6MA 4IN0A 2IPAA 1ST9A 4DVCA 4X43A 2DJ2A 1A0RP 3APOA 4GQFA 4TOPA 5IIZA 5J5NA 1X9MB 3FK8A 1DUGA 1Y25A 1W4VA 1YJ6A 3GN3A 3FR6A 1YF1A 3GIXA 2WFCA 4FIWA 2O7KA 1YEPA 4MLYA 3GA4A 3GX0A 5KOXA 2DMLA 4ZB8A 2NDOA 1GLPA 1GWCA 2CA8A 2PPTA 4XS6A 3UEMA 3CRUA 2H0GA 2L5OA 3DRNA 3M9KA 5ID2A 1TI1A 4BVYB 4LL1B 3FZAA 3RDWA 4IGJA 3EVIA 3EURA 3WD6A 2H70A 3E0UA 3HVVA 3GKXA 2DJ3A 4IVFA 4EKZA 2R0CA 2HT9A 2GDRA 1FO5A 3ZFBA 1T8EB 2JZRA 1K0AA 2IJYA 2LNSA 3HA9A 1GNWA 3TKSC 3IBHA 1YDKA 1VF4A 2HZEB 1TKDB 3KMOA 1XW6A 1A2MA 4V2MA 1FB0A 4XHMA 3KEBA 1VF1A 6GSUA 1SYRA 3M1GA 2B5EA 3EC3A 3O6TA 2M46A 4HUAA 5A4UA 1T4YA 5LCZA 3NZNA 2IMIA 4JE1A 4WR4A 1XWGA 3WT2A 4K8MA 3G9BA 4KW6A 3C7MA 2HXKA 5HFGA 5C00A 3CSIA 1M2BA 1ZZYA 1E6BA 2AAWA 3TGZA 1NHYA 3IC4A 2RIIA 1IYHA 5ECHB 2X49A 4JRRA 4MH3A 3IA1A 4LA1A 4HJMA 2C0GA 4TVEA 2OJLA 3FZ9A 2IMEA 5JWOB 5DQSA 3ZZXA 1T00A 4K5RA 5AISA 2NPBA 1XWAA 1C72A 1RW1A 2JU5A 4YQMA 1EV9A 2R6KA 2L5LA 1S3RA 3P2AA 3M9JA 1YKAA 1PD21 3O3TA 3OR5A 5A4VA 5DALB 4H86A 3EE2A 1EGRA 3UJ1A 2C80A 4YQUA 2QGVA 2HE3A 5AIXA 1GSFA 1O73A 4ZIJA 2HI7A 4JEDA 4OFNA 5AIVA 3HDCA 2H8LA 4KCAA 3FW2A 4PQHA 4TR4A 2OE1A 2C0FA 1PN0A 1B9XC 5DJMA 5D73A 3E3EA 2VCZA 5B6NA 1N2AA 3C8EA 1O7UA 3ZIVA 8GSSA 4Z7XA 3D22A 5IO2A 1M3IA 3RHBA 3QFBC 3QFAC 5HR3A 3IR4A 4KSOA 1T7PB 2R0PA 3QR6A 1TW9A 4EO3A 1O85A 2VLTA 1PKZA 2DKHA 2C0DA 3VPTA 4EL1A 1FOHA 2H73A 2IFQA 1T3BA 4BWSA 3L9VA 1K0MA 3LW9A 16GSA 2CX4A 3GTUB 1A0FA 5IMZA 5B8BA 2B7JA 1WP0A 3ERFA 3TKPA 1QMVA 2N5FA 3C1RA 1QGVA 2H1GA 5EVOA 1V98A 3UMAA 2LJRA 2L4QA 2V32A 2R2JA 3L9UA 2P0GA 3MWHA 3FYGA 1TP9A 1XW5A 3H4KA 5IMAA 2H0IA 1TU8A 5ELAA 5CRGA 1XPVA 2YWIA 4KE3A 4KH7A 2LJAA 2YANA
chains in the Genus database with same CATH topology
4Q5FA 1YQ1A 1CQGA 2B1LA 5J9BA 1Z7PA 5JWQB 13GSA 4V2LA 3HVXA 2FHEA 1GP1A 2TRCP 1PKWA 1H4OA 4MPGA 5JCUA 4K7OA 3GKMA 1XW9A 4PQ1A 2H74A 3HJMA 4TXOA 2KP1A 1AW9A 4CHSA 4BL7A 18GSA 1LJRA 3ZYWA 2IIYA 3WGXA 3TJGA 2A4HA 2M80A 4D73B 4EDYA 17GSA 2VO4A 2O89A 5B7CA 1M9BA 3RHCA 4L5OA 1Q98A 3EU3A 3F4SA 3GL3A 4N30A 4F03A 5INYA 4JU5A 5F05A 4PUAA 1A8LA 2DJ0A 2XBIA 4NV5A 2YNXA 3W6GA 2LRTA 3ZL5A 5D8IA 2F8AA 1U88A 1YF0A 2YZUA 4E8EA 2PERA 5GAPD 2FWEA 2VM2A 4MJCA 3QAVA 1XZOA 2DLXA 1OC3A 4YQVA 4LL4B 3LG6A 3KD0A 3O76A 1WMJA 1XWBA 2FCHA 4HEA2 4KA0A 1GTBA 4O5UA 2V1MA 3GURA 3C73A 1FAAA 3EU4A 1SENA 1EP8A 4K0GA 1ZMAA 4ICYA 3M0FA 1GUHA 6GSVA 5FWGA 2LS5A 4AJ6A 4ZBBA 2OADA 1AQXA 1MTCA 3TB2A 4IP6A 1WJKA 4X1UA 1B8XA 4ML6A 4ZB9A 1GSDA 4BVXB 2GSSA 2CV4A 3FKFA 2LTKA 2JZTA 3GV1A 3BCIA 2WS2A 5G2ZA 2H71A 4G10A 1TRWA 1MDJA 1FG4A 2VCVA 1SD8A 1RQMA 5ECMB 1PN9A 2WCIA 3JCML 4OO4A 3PPUA 5CRHA 2BMXA 2V41A 2FA8A 1I9DA 4ID0A 2DIZA 4MF5A 4ML1A 4TW5A 3VFIA 5GSTA 4Q5NA 1U87A 4Q5QA 1ILOA 4NAXA 2B7KA 5IPHA 3RAZA 3WGDA 2HRKA 5IO0A 3F3QA 3CMIA 2E2GA 1XOBA 3TKRA 3TOUA 4G2EA 4J56E 3PR8A 4FH8A 3KZQA 1V9WA 2HSHA 1M7TA 3KCMA 3HZ4A 3A5WA 5ECPB 1HNAA 4JBBA 2IN3A 2I3YA 2EC4A 2VOCA 4XIHA 4Z2TA 3HJOA 3L0HA 1TI3A 3FZ5A 5LNKe 2HSYA 2GT6A 5IQYA 2A2PA 2LV3A 3DEXA 1AC1A 2JZSA 6GSYA 3ZFLA 4GCIA 1EWXA 1PQNA 1HYUA 3QAGA 4OD7A 2YJ7A 2K8VA 1UC7A 1NHOA 2WZ9A 3CTGA 4DSRA 5J41A 3HY2A 4ECCA 2XPEA 3KP8A 2PGTA 1TU7A 2RUFA 3IHGA 2QA2A 2F3MA 2GZYA 2L6CA 1O6JA 3LORA 2R5GA 3L4NA 2P5QA 2H6XA 5CREA 3TDGA 1MEKA 2LRNA 3BCKA 1PX7A 5ELGA 1MDIA 6GSXA 4ILFA 2YV7A 1UN2A 3C1SA 1DE2A 1G0TA 4KAEA 5D9WA 1ZL9A 4WF4A 1J0FA 3CTFA 3DXBA 2RM6A 6GSWA 4YAVA 1ZGNA 3APQA 3LXTA 3W8JA 2JSYA 2MMAA 1UA5A 1Y6EA 1G7OA 2RUEA 1T4ZA 4WF5A 2FWFA 3LQ7A 1TRSA 3KH7A 2CAQA 2B5YA 1V57A 2LQOA 1WOUA 3IAM2 1TRVA 1UVZA 2G0FA 3PGTA 4F0BA 3LEFA 1M99A 4IS0A 4QQ7A 5ABRA 2HFDA 1BQ7A 4AF2A 2HNLA 3DYRA 1JLWA 4YKFA 1S3AA 2DSAA 4IELA 3P7XA 4ZL7A 1LBKA 1KEBA 5C04A 5ECIB 5JCWA 1THXA 4I6XA 5IMVA 2R3XA 3A3TA 5HFKA 4K6XA 3ZMLA 3G7JA 2K9FA 2H19A 3C71A 4Z2RA 2NVLA 1TOFA 3R3EA 1T1VA 2MBSA 2GSTA 3DMLA 6GSTA 1PX6A 22GSA 2IMDA 2J9HA 3F4RA 4K1FA 4IBPA 3DIEA 5J9CA 3UBKA 4HQZA 4ECJA 1OVNA 2F51A 2LKUA 3CBUA 1TDIA 3ZITA 3M3MA 3VWWA 1WPIA 2IMKA 1M9AA 4MNNA 5CNWA 19GSA 3GX8A 1ACVA 3FEUA 2ZUPA 2C4JA 3UBLA 2ON5A 4OCEA 2CVBA 1BJXA 3HHVA 1YZXA 2HRFA 5HR2A 3WYWA 2PN8A 4HJ2A 4TR3A 2G2QA 3KIJA 4MJEA 4KGIA 1BEDA 1X5CA 3QOUA 4HZ2A 1NSWA 2ZCTA 3A2XA 3DGQA 2C3NA 2D2ZA 2WB9A 4YAPA 4HU7A 3HXSA 3F9UA 1DSBA 3SWLA 3UL3A 4BVYA 2N5BA 5F8BA 2GQMA 2CVKA 5HQPA 4XS1A 4WKWA 1OE7A 1QUWA 4KNDA 3VK9A 1HQOA 4WETA 4AJ8A 4G9HA 4F2IA 3CYNA 1NW2A 3LYPA 2X8CA 2VD1A 2MZCA 2H1DA 4XS4B 1EGOA 14GSA 2E2MA 1XXUA 3GH9A 3A2VA 4PNFA 4O5RA 5ECRB 2QSIA 5IOWA 2FWHA 3HKRA 3Q18A 4PUFC 4HS1A 5HFIA 5A4WA 2DJ1A 4BPYA 3D21A 3V1WA 3WT1A 3LJRA 1HNBA 2HZEA 5JCGA 4TRXA 5B8AA 5DVBA 3IDVA 5CRWA 2YV9A 3F0IA 2N5AA 1GUKA 5G5FA 2AUVA 3RBTA 5DAKB 3I69A 5ECSA 5KN2A 3EWLA 3TOTA 4GXZA 1OC9B 5G1LA 4V1Ap 4FYCA 4N0VA 1ZYQB 5CP1A 2VAFA 3ZIJA 3DKSA 2XC2A 5D9XA 1GTUA 2DMMA 2L6DA 3D0ZA 3IAS2 1EZKA 4XRAA 3ME7A 2VCWA 1AQWA 3QMXA 4ULXA 3G7IA 4G0IA 3KP9A 2A2RA 1SK0A 5F07A 2GGTA 4TR1B 1E2YA 5DJLA 4XTSA 1S3DA 4CW9A 2GZZA 4N11A 1BAYA 2VL9A 1M2DA 4IHUA 3WGEA 1F3AA 1U6TA 3ZRDA 2MMZA 2AB6A 3F6DA 2H01A 1MDKA 3PH9A 2GT5A 4IP1A 2J23A 1W89A 1WWJA 4GSNA 1SD9A 3H93A 1VF3A 2FGXA 3P8WA 4F0CA 5DALA 4GRFA 3MIXA 3QDNA 3TKSE 2R0GA 3I6AA 1GSQA 1GH2A 1B4PA 2LSTA 2LQQA 3Q74A 1FHEA 3KMNA 3TKQA 4WR5A 1X5EA 1WE0A 5IMCA 4MA9A 1FVJA 1VF2A 3RPNA 4GSSA 4WXTA 1ML6A 4EVMA 2KHPA 2C0EA 2B1KA 2VUPA 5BRTA 2VLUA 3LFLA 5KN3A 1XWKA 1ZCPA 3D6IA 2OBKA 2GQLA 4KSMA 3VWVA 5CO3A 3UVTA 3VPQA 3CXGA 4XRDA 1X5DA 1QXHA 1XBSA 1XVWA 1Q4JA 5CAXA 3EMXA 4PX1A 2K6VA 3EPTA 4MP4A 1THOA 1ON4A 4MJAA 1GRXA 1OC9A 1H75A 2IMFA 4KCEA 4ZB6A 1WRYA 5ECLB 2H1BA 4GF0A 3GTUA 3GFKA 1X9SB 3CRTA 3U5RE 5AN1A 5KOWA 2M72A 1SL2B 4MDCA 2HSMA 1EOHA 1ZYNA 2PMTA 2ALBA 3TRQA 3UIWA 3CSJA 2H30A 1U3IA 2B5XA 2NBSA 1A23A 2PVQA 4HQSA 1FB6A 5D93A 4IQAA 3LXZA 4P3YB 4POLA 3K8NA 1PGTA 4MK3A 1URMA 4V1Ag 1YY7A 3VI7A 1ZYPA 2H0HA 1R4WA 1USBA 2P31A 4ZL9A 2H75A 1O8WA 4HZ4A 4L5LA 3SBCA 4J2FA 4RUVA 1B9YC 3QPMA 5IM9A 5G30A 4PURA 1BG5A 2GTUA 1EP7A 1GSEA 2ON7A 2VCTA 1OC8A 2GQKA 5ID2B 2A4VA 3GNJA 2C1YA 1BYEA 2FD3A 1Z6MA 1XVQA 3F4TA 1N8JA 1TXXA 4G19A 1LU4A 3VLNA 2JACA 1J08A 3GSSA 1XWCA 2NTOA 2WRTA 2AV4A 4PGTA 2HZFA 1QFNA 4GSTA 2H6YA 4USSA 4D73A 4GQCA 4PTSA 3KGKA 3GKKA 1PL1A 4F9ZA 2REMA 2KP2A 1WIKA 4YKGA 2DKIA 3KJYA 2CVDA 4TXVA 4MPFA 4HI7A 2DIYA 1R5AA 2B3SA 4X0XA 4EIPA 1X0RA 2H66A 5ECOB 2VL3A 4L0UA 4N10A 3J7Yb 4I97A 3BBYA 2H1AA 3DWVA 3KH9A 5IPGA 5IOXA 1SKWB 1K3OA 4EDZA 3TJJA 4BWQA 4OWYA 2KUCA 4K0NA 3IRAA 1V2AA 3UVHA 2IWTA 4OO5A 4F82A 3QCPA 3Q6OA 1QQ2A 4IJ3A 1GLQA 1GTAA 4QL7A 4CY8A 1AAZA 3IPZA 2PU9C 4IJIA 3D5JA 2V2GA 2FA4A 4ZL8A 1SJZA 2PUKC 1XOAA 4DSSB 2YWOA 2L57A 2YN1A 1MD3A 5KN1A 1TJDA 4K2XA 3A2WA 2LEGA 4IKHA 3H79A 3ED3A 4EIQA 4TKYA 4BVXA 2C3QA 4WBJA 3KXOA 4I2UA 4MZCA 4MZBA 3GSTA 1GTIA 4G0KA 2VL2A 5G5EA 1I5GA 1GL8A 1JHBA 1K3YA 5H5RA 1SJ6A 5ECKB 4ACSA 4LLRA 3FR3A 5FT3A 3D4TA 3ME8A 1F3BA 4ZILA 3GHAA 1GUMA 4LMWA 1OYJA 4DEJA 1R26A 4MF6A 1A24A 3H8QA 2PBJA 4KX4A 3APSA 1SL0B 3FR9A 3FY7A 1AQVA 2VLVA 2CX3A 3BOAA 4I8BA 2XPDA 1PMTA 3CSHA 4MABA 1OAZA 1KTEA 3IOSA 3FMWA 2GZPA 2R37A 5IMDA 1A8YA 1R5PA 5DCGA 4K2DA 4PNGA 4HDEA 4GLTA 2UZ8A 3TJBA 2F8FA 1SK2A 3BD2A 4GTUA 1PSQA 2CZ2A 4NXIA 4ECBA 4WBRD 3GH6A 1K0BA 4OFMA 1PL2A 2QKEA 3U6VA 1X9WB 2C3TA 4ECIA 3IC8A 3IK7A 5GZZB 2LNTA 3N9JA 1TK5B 1GULA 3R2QA 3FZ4A 2L4CA 2IFQB 4TR0A 3TRXA 5HR0A 5A5KA 3VI5A 2ES7A 3D4MA 2X4AA 1MD4A 3UOMA 4RQXA 2FLSA 4DSSA 5D9VA 4KDXA 1U3AA 20GSA 2FY6A 2GLRA 3LGCA 4L8EA 1SL1B 1XFLA 1EEMA 2GVPA 2I1UA 4Z2UA 5GSSA 3H1NA 1Z9HA 1DE1A 3UAPA 3L9SA 1JZRA 2O87A 4XCSA 5EY6A 4K7NA 1IYIA 1EOGA 3ZLPA 1OKDA 2CAIA 4MZWA 1S3CA 4CDOA 5DDLA 3NIVA 2IL3A 2O85A 1OKTA 4O92A 4PXOA 5JWRB 4JR4A 5ENUA 3HD5A 4MF7A 3J7Yk 3FHKA 1SKRB 4EC0A 1F6MC 5H5QA 2V6KA 2TRXA 2RM5A 4TXOB 2AYTA 2YWMA 3KM6A 1PRXA 2DJKA 5G31A 4BL7B 1AXDA 4NV2A 4MH2A 3GKNA 4HOJA 1ZYEA 3VURA 2MBTA 6GSSA 1HD2A 2V6OA 1K0CA 3GRXA 4MCUA 1O8XA 3F63A 4RI6A 1TRUA 4IW9A 4QL9A 4OMVA 3GMFA 4KB3A 1GSSA 1DBYA 1K0DA 2MYGA 1CQHA 1KNGA 1EEJA 3PINA 4K5SA 2DC5A 5F06A 1R7HA 3IHQA 1A2LA 1A2JA 4NPBA 5EL8A 2WGRA 2YWNA 2X99A 1TTZA 2L59A 3TCOA 2X8HA 2HRNA 1SJIA 1ERTA 4Q5RA 2X64A 2A2SA 2MMOA 4AJ7A 1KBNA 4RI7A 2C8UA 5HR1A 1GSUA 1G6YA 9GSSA 3IE3A 2XHFA 4K7IA 3LSZA 3AY8A 2KOKA 3I9V2 2LJKA 3VWXA 3GL5A 1K3LA 5CYYA 2YCDA 1AIUA 11GSA 2DBCA 2VD0A 4POBA 3KTBA 2WJUA 3IK9A 3MSZA 2OE3A 2VIMA 2VL2C 4ISDA 4J57E 5F0GA 1M2AA 1EV4A 1ZOFA 2LUSA 3HCZA 3P90A 2WULA 4JZQA 3W8SA 1OE8A 1ERWA 2CQ9A 2FUG2 2FWGA 1SYXA 4I5QA 2WDUA 4IQ1A 4O5QA 3HYPA 2BTOT 4LMVA 2E7PA 3MDKA 2EIRA 1XIYA 4RQRA 5AGYA 1FOVA 4EUYA 4I2TA 1V58A 2I81A 3VWUA 4OCFA 2HLSA 1B4QA 4AGSA 4XS4A 1BX9A 4BA7A 1FVKA 2KLXA 4FYUA 4PQIA 2I4AA 2HRAA 4NMUA 1Z5YE 4CY6A 3M8NA 4YH2A 2GS3A 1V40A 4N0ZA 4G0LA 2GSQA 2AHEA 2OE0A 4FO5A 1FW1A 2OACA 5IMFA 4FQUA 2YOIA 2P5RA 1TK0B 3Q19A 4KF9A 3A5IA 1SK1A 3US3A 4OFTA 12GSA 5DAKA 7GSSA 2BJXA 1Z7RA 2H72A 5DQYA 3RPPA 2CZ3A 3UARA 1G6WA 2VM1A 3TKSA 2GSRA 1F37A 1K0NA 1Z3EA 3F8UA 5CRDA 1JZWA 2RLIA 2VCQA 2JADA 3MAKA 3ZVJA 1YEXA 2H76A 2OKAA 2EIOA 1F9MA 1RK4A 4POKA 1JLVA 5DBQA 3EINA 4JR6A 3G7YA 1QK8A 2R4VA 4K9ZA 4TR1A 5EPFA 1ERUA 4MMMA 4O7HA 2ZNMA 1SKSB 3GUSA 5D9TA 2K8SA 4TN8A 1PA3A 4DSQA 3NOFA 2O8VB 2K18A 4MJBA 4ZBDA 3EMPA 4NHWA 1YKCA 2H6ZA 5E4WA 4GWRA 1GNEA 5L71A 3DVXA 2LRCA 4X4JA 3LYKA 5J3RA 2TIRA 1NM3A 2VCXA 3ZTLA 4E8HA 4O32A 3TRPA 4L0WA 1J9BA 1O81A 3ERGA 5E59A 2F9SA 2X8GA 2OA7A 2DJJA 4POMA 5BMUA 3MNGA 3LWAA 3N5OA 3DD3A 3MYDA 3HJPA 4EXJA 3BJ5A 3HZ8A 5GAND 2QC7A 3E9JB 1XCCA 5B6MA 3HVSA 2PWJA 3TJKA 3I43A 3L78A 5ECNB 1GSYA 3GYKA 5COHA 4WEYA 3ZREA 2JSZA 2EIQA 2XBQA 3ERWA 3EYTA 5FHIA 3TJFA 2CT6A 4A5PA 5J4UA 1VGLA 1K0OA 2QA1A 1JZOA 2AJQB 3FRCA 4NWYA 5DCHA 1ERVA 4ZXGA 3F3RA 1JZDA 4EE0A 2PVOC 10GSA 4NHZA 2YP6A 5G1KA 4KDUA 5ECQB 2JL4A 3QAWA 2YZHA 2OBIA 2I9HA 2E0QA 1ABAA 4ZBAA 1TK8B 1SU9A 4V2NA 1HNCA 1F2EA 5H5SA 3QD9A 4KDYA 2FNOA 3TUEA 2YPMA 2Z9SA 3DVWA 1G7EA 3ZVJD 3IV4A 4EF0A 4KUNA 1VRSD 4FYBA 2YJHA 3F6FA 2HYXA 3S9FA 4HU9A 5D96A 5KN0A 1Z6NA 1AUCA 2MMNA 5LD0A 3ISOA 3ZMKA 1B48A 1JFUA 3IXRA 3KTLA 1M0UA 5KEJA 2B6MA 4IN0A 2IPAA 1ST9A 4DVCA 4X43A 2DJ2A 1A0RP 3APOA 4GQFA 4TOPA 5IIZA 5J5NA 1X9MB 3FK8A 1DUGA 1Y25A 1W4VA 1YJ6A 3GN3A 3FR6A 1YF1A 3GIXA 2WFCA 4FIWA 2O7KA 1YEPA 4MLYA 3GA4A 3GX0A 5KOXA 2DMLA 4ZB8A 2NDOA 1GLPA 1GWCA 2CA8A 2PPTA 4XS6A 3UEMA 3CRUA 2H0GA 2L5OA 3DRNA 3M9KA 5ID2A 1TI1A 4BVYB 4LL1B 3FZAA 3RDWA 4IGJA 3EVIA 3EURA 3WD6A 2H70A 3E0UA 3HVVA 3GKXA 2DJ3A 4IVFA 4EKZA 2R0CA 2HT9A 2GDRA 1FO5A 3ZFBA 1T8EB 2JZRA 1K0AA 2IJYA 2LNSA 3HA9A 1GNWA 3TKSC 3IBHA 1YDKA 1VF4A 2HZEB 1TKDB 3KMOA 1XW6A 1A2MA 4V2MA 1FB0A 4XHMA 3KEBA 1VF1A 6GSUA 1SYRA 3M1GA 2B5EA 3EC3A 3O6TA 2M46A 4HUAA 5A4UA 1T4YA 5LCZA 3NZNA 2IMIA 4JE1A 4WR4A 1XWGA 3WT2A 4K8MA 3G9BA 4KW6A 3C7MA 2HXKA 5HFGA 5C00A 3CSIA 1M2BA 1ZZYA 1E6BA 2AAWA 3TGZA 1NHYA 3IC4A 2RIIA 1IYHA 5ECHB 2X49A 4JRRA 4MH3A 3IA1A 4LA1A 4HJMA 2C0GA 4TVEA 2OJLA 3FZ9A 2IMEA 5JWOB 5DQSA 3ZZXA 1T00A 4K5RA 5AISA 2NPBA 1XWAA 1C72A 1RW1A 2JU5A 4YQMA 1EV9A 2R6KA 2L5LA 3P2AA 3M9JA 1YKAA 1PD21 3O3TA 3OR5A 5A4VA 5DALB 4H86A 3EE2A 1EGRA 3UJ1A 2C80A 4YQUA 2QGVA 2HE3A 5AIXA 1GSFA 1O73A 4ZIJA 2HI7A 4JEDA 4OFNA 5AIVA 3HDCA 2H8LA 4KCAA 3FW2A 4PQHA 4TR4A 2OE1A 2C0FA 1PN0A 1B9XC 5DJMA 5D73A 3E3EA 2VCZA 5B6NA 1N2AA 3C8EA 1O7UA 3ZIVA 8GSSA 4Z7XA 3D22A 5IO2A 3RHBA 3QFBC 3QFAC 5HR3A 3IR4A 4KSOA 1T7PB 2R0PA 3QR6A 1TW9A 4EO3A 1O85A 2VLTA 1PKZA 2DKHA 2C0DA 3VPTA 4EL1A 1FOHA 2H73A 2IFQA 1T3BA 4BWSA 3L9VA 1K0MA 3LW9A 16GSA 2CX4A 3GTUB 1A0FA 5IMZA 5B8BA 2B7JA 1WP0A 3ERFA 3TKPA 1QMVA 2N5FA 3C1RA 1QGVA 2H1GA 5EVOA 1V98A 3UMAA 2LJRA 2L4QA 2V32A 2R2JA 3L9UA 2P0GA 3MWHA 3FYGA 1TP9A 1XW5A 3H4KA 5IMAA 2H0IA 1TU8A 5ELAA 5CRGA 1XPVA 2YWIA 4KE3A 4KH7A 2LJAA 2YANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5F A;  1YQ1 A;  1CQG A;  2B1L A;  5J9B A;  1Z7P A;  5JWQ B;  13GS A;  4V2L A;  3HVX A;  2FHE A;  1GP1 A;  2TRC P;  1PKW A;  1H4O A;  4MPG A;  5JCU A;  4K7O A;  3GKM A;  1XW9 A;  4PQ1 A;  2H74 A;  3HJM A;  4TXO A;  2KP1 A;  1AW9 A;  4CHS A;  4BL7 A;  18GS A;  1LJR A;  3ZYW A;  2IIY A;  3WGX A;  3TJG A;  2M80 A;  4D73 B;  4EDY A;  17GS A;  2VO4 A;  2O89 A;  5B7C A;  1M9B A;  3RHC A;  4L5O A;  1Q98 A;  3EU3 A;  3F4S A;  3GL3 A;  4N30 A;  4F03 A;  5INY A;  4JU5 A;  5F05 A;  4PUA A;  1A8L A;  2DJ0 A;  2XBI A;  4NV5 A;  2YNX A;  3W6G A;  2LRT A;  3ZL5 A;  5D8I A;  2F8A A;  1U88 A;  1YF0 A;  2YZU A;  4E8E A;  2PER A;  5GAP D;  2FWE A;  2VM2 A;  4MJC A;  3QAV A;  1XZO A;  2DLX A;  1OC3 A;  4YQV A;  4LL4 B;  3LG6 A;  3KD0 A;  3O76 A;  1WMJ A;  1XWB A;  2FCH A;  4HEA 2;  4KA0 A;  1GTB A;  2V1M A;  3GUR A;  3C73 A;  1FAA A;  3EU4 A;  1SEN A;  1EP8 A;  4K0G A;  1ZMA A;  3M0F A;  1GUH A;  6GSV A;  5FWG A;  2LS5 A;  4AJ6 A;  4ZBB A;  2OAD A;  1AQX A;  1MTC A;  3TB2 A;  4IP6 A;  1WJK A;  4X1U A;  1B8X A;  4ML6 A;  4ZB9 A;  1GSD A;  2GSS A;  2CV4 A;  3FKF A;  2LTK A;  2JZT A;  3GV1 A;  3BCI A;  2WS2 A;  5G2Z A;  2H71 A;  4G10 A;  1TRW A;  1MDJ A;  1FG4 A;  2VCV A;  1SD8 A;  1RQM A;  5ECM B;  1PN9 A;  2WCI A;  3JCM L;  4OO4 A;  5CRH A;  2BMX A;  2V41 A;  2FA8 A;  1I9D A;  4ID0 A;  2DIZ A;  4MF5 A;  4ML1 A;  4TW5 A;  3VFI A;  5GST A;  4Q5N A;  1U87 A;  4Q5Q A;  1ILO A;  4NAX A;  2B7K A;  5IPH A;  3RAZ A;  3WGD A;  5IO0 A;  3F3Q A;  3CMI A;  2E2G A;  1XOB A;  3TKR A;  3TOU A;  4G2E A;  4J56 E;  3PR8 A;  4FH8 A;  3KZQ A;  1V9W A;  2HSH A;  1M7T A;  3KCM A;  3HZ4 A;  3A5W A;  5ECP B;  1HNA A;  4JBB A;  2IN3 A;  2I3Y A;  2EC4 A;  2VOC A;  4XIH A;  3HJO A;  3L0H A;  1TI3 A;  3FZ5 A;  5LNK e;  2HSY A;  2GT6 A;  5IQY A;  2LV3 A;  3DEX A;  1AC1 A;  2JZS A;  6GSY A;  3ZFL A;  4GCI A;  1EWX A;  1PQN A;  1HYU A;  3QAG A;  4OD7 A;  2YJ7 A;  2K8V A;  1UC7 A;  1NHO A;  2WZ9 A;  3CTG A;  4DSR A;  5J41 A;  3HY2 A;  4ECC A;  2XPE A;  3KP8 A;  2PGT A;  1TU7 A;  2RUF A;  2F3M A;  2GZY A;  2L6C A;  1O6J A;  3LOR A;  2R5G A;  3L4N A;  2P5Q A;  2H6X A;  5CRE A;  3TDG A;  1MEK A;  2LRN A;  3BCK A;  1PX7 A;  5ELG A;  1MDI A;  6GSX A;  4ILF A;  2YV7 A;  1UN2 A;  3C1S A;  1DE2 A;  1G0T A;  4KAE A;  5D9W A;  1ZL9 A;  4WF4 A;  1J0F A;  3CTF A;  3DXB A;  2RM6 A;  6GSW A;  4YAV A;  1ZGN A;  3APQ A;  3LXT A;  3W8J A;  2JSY A;  2MMA A;  1UA5 A;  1Y6E A;  1G7O A;  2RUE A;  1T4Z A;  4WF5 A;  2FWF A;  3LQ7 A;  1TRS A;  3KH7 A;  2CAQ A;  2B5Y A;  1V57 A;  2LQO A;  1WOU A;  3IAM 2;  1TRV A;  1UVZ A;  2G0F A;  3PGT A;  4F0B A;  3LEF A;  1M99 A;  4IS0 A;  4QQ7 A;  5ABR A;  2HFD A;  1BQ7 A;  4AF2 A;  2HNL A;  3DYR A;  1JLW A;  1S3A A;  2DSA A;  4IEL A;  3P7X A;  4ZL7 A;  1LBK A;  1KEB A;  5C04 A;  5ECI B;  5JCW A;  1THX A;  4I6X A;  5IMV A;  2R3X A;  3A3T A;  5HFK A;  4K6X A;  3ZML A;  3G7J A;  2K9F A;  2H19 A;  3C71 A;  2NVL A;  1TOF A;  1T1V A;  2MBS A;  2GST A;  3DML A;  6GST A;  1PX6 A;  22GS A;  2IMD A;  2J9H A;  3F4R A;  4K1F A;  4IBP A;  3DIE A;  5J9C A;  3UBK A;  4HQZ A;  4ECJ A;  1OVN A;  2F51 A;  2LKU A;  3CBU A;  1TDI A;  3ZIT A;  3M3M A;  3VWW A;  1WPI A;  2IMK A;  1M9A A;  5CNW A;  19GS A;  3GX8 A;  1ACV A;  3FEU A;  2ZUP A;  2C4J A;  3UBL A;  2ON5 A;  4OCE A;  2CVB A;  1BJX A;  3HHV A;  1YZX A;  2HRF A;  5HR2 A;  3WYW A;  2PN8 A;  4HJ2 A;  4TR3 A;  2G2Q A;  3KIJ A;  4MJE A;  4KGI A;  1BED A;  1X5C A;  3QOU A;  4HZ2 A;  1NSW A;  2ZCT A;  3A2X A;  3DGQ A;  2C3N A;  2D2Z A;  2WB9 A;  4YAP A;  4HU7 A;  3HXS A;  3F9U A;  1DSB A;  3SWL A;  3UL3 A;  4BVY A;  2N5B A;  5F8B A;  2GQM A;  2CVK A;  5HQP A;  4XS1 A;  4WKW A;  1OE7 A;  1QUW A;  4KND A;  3VK9 A;  1HQO A;  4WET A;  4AJ8 A;  4G9H A;  4F2I A;  3CYN A;  1NW2 A;  3LYP A;  2X8C A;  2VD1 A;  2MZC A;  2H1D A;  4XS4 B;  1EGO A;  14GS A;  2E2M A;  1XXU A;  3GH9 A;  3A2V A;  4PNF A;  4O5R A;  5ECR B;  2QSI A;  5IOW A;  2FWH A;  3HKR A;  3Q18 A;  4PUF C;  4HS1 A;  5HFI A;  5A4W A;  2DJ1 A;  4BPY A;  3D21 A;  3V1W A;  3WT1 A;  3LJR A;  1HNB A;  2HZE A;  5JCG A;  4TRX A;  5B8A A;  5DVB A;  3IDV A;  5CRW A;  2YV9 A;  3F0I A;  2N5A A;  1GUK A;  5G5F A;  2AUV A;  3RBT A;  5DAK B;  3I69 A;  5ECS A;  5KN2 A;  3EWL A;  3TOT A;  4GXZ A;  1OC9 B;  5G1L A;  4V1A p;  4FYC A;  4N0V A;  1ZYQ B;  5CP1 A;  2VAF A;  3ZIJ A;  3DKS A;  2XC2 A;  5D9X A;  1GTU A;  2DMM A;  2L6D A;  3D0Z A;  3IAS 2;  1EZK A;  4XRA A;  3ME7 A;  2VCW A;  1AQW A;  3QMX A;  4ULX A;  3G7I A;  3KP9 A;  2A2R A;  1SK0 A;  5F07 A;  2GGT A;  4TR1 B;  1E2Y A;  5DJL A;  4XTS A;  1S3D A;  4CW9 A;  2GZZ A;  4N11 A;  1BAY A;  2VL9 A;  1M2D A;  4IHU A;  3WGE A;  1F3A A;  1U6T A;  3ZRD A;  2MMZ A;  2AB6 A;  3F6D A;  2H01 A;  1MDK A;  3PH9 A;  2GT5 A;  4IP1 A;  2J23 A;  1W89 A;  1WWJ A;  4GSN A;  1SD9 A;  3H93 A;  1VF3 A;  2FGX A;  3P8W A;  4F0C A;  5DAL A;  4GRF A;  3QDN A;  3TKS E;  3I6A A;  1GSQ A;  1GH2 A;  1B4P A;  2LST A;  2LQQ A;  3Q74 A;  1FHE A;  3KMN A;  3TKQ A;  4WR5 A;  1X5E A;  1WE0 A;  5IMC A;  4MA9 A;  1FVJ A;  1VF2 A;  3RPN A;  4GSS A;  4WXT A;  1ML6 A;  4EVM A;  2KHP A;  2C0E A;  2B1K A;  2VUP A;  2VLU A;  3LFL A;  5KN3 A;  1XWK A;  1ZCP A;  3D6I A;  2OBK A;  2GQL A;  4KSM A;  3VWV A;  5CO3 A;  3UVT A;  3VPQ A;  3CXG A;  4XRD A;  1X5D A;  1QXH A;  1XBS A;  1XVW A;  1Q4J A;  5CAX A;  3EMX A;  4PX1 A;  2K6V A;  4MP4 A;  1THO A;  1ON4 A;  4MJA A;  1GRX A;  1OC9 A;  1H75 A;  2IMF A;  4KCE A;  4ZB6 A;  1WRY A;  5ECL B;  2H1B A;  4GF0 A;  3GTU A;  3GFK A;  1X9S B;  3CRT A;  3U5R E;  5AN1 A;  2M72 A;  1SL2 B;  4MDC A;  1EOH A;  2PMT A;  2ALB A;  3TRQ A;  3UIW A;  3CSJ A;  2H30 A;  1U3I A;  2B5X A;  2NBS A;  1A23 A;  2PVQ A;  4HQS A;  1FB6 A;  5D93 A;  4IQA A;  3LXZ A;  4P3Y B;  4POL A;  3K8N A;  1PGT A;  4MK3 A;  1URM A;  4V1A g;  1YY7 A;  3VI7 A;  2H0H A;  1R4W A;  1USB A;  2P31 A;  4ZL9 A;  2H75 A;  1O8W A;  4HZ4 A;  4L5L A;  3SBC A;  4J2F A;  4RUV A;  1B9Y C;  3QPM A;  5IM9 A;  5G30 A;  4PUR A;  1BG5 A;  2GTU A;  1EP7 A;  1GSE A;  2ON7 A;  2VCT A;  1OC8 A;  2GQK A;  5ID2 B;  2A4V A;  3GNJ A;  2C1Y A;  1BYE A;  2FD3 A;  1Z6M A;  1XVQ A;  3F4T A;  1N8J A;  1TXX A;  4G19 A;  1LU4 A;  3VLN A;  2JAC A;  1J08 A;  3GSS A;  1XWC A;  2NTO A;  2WRT A;  2AV4 A;  4PGT A;  2HZF A;  1QFN A;  4GST A;  2H6Y A;  4D73 A;  4GQC A;  3KGK A;  3GKK A;  1PL1 A;  4F9Z A;  2REM A;  2KP2 A;  1WIK A;  3KJY A;  2CVD A;  4TXV A;  4MPF A;  4HI7 A;  2DIY A;  1R5A A;  2B3S A;  4X0X A;  1X0R A;  2H66 A;  5ECO B;  2VL3 A;  4L0U A;  4N10 A;  3J7Y b;  4I97 A;  3BBY A;  2H1A A;  3DWV A;  3KH9 A;  5IPG A;  5IOX A;  1SKW B;  1K3O A;  4EDZ A;  3TJJ A;  4BWQ A;  4OWY A;  2KUC A;  4K0N A;  3IRA A;  1V2A A;  3UVH A;  2IWT A;  4OO5 A;  4F82 A;  3QCP A;  3Q6O A;  1QQ2 A;  4IJ3 A;  1GLQ A;  1GTA A;  4QL7 A;  1AAZ A;  3IPZ A;  2PU9 C;  4IJI A;  3D5J A;  2V2G A;  2FA4 A;  4ZL8 A;  1SJZ A;  2PUK C;  1XOA A;  4DSS B;  2YWO A;  2L57 A;  2YN1 A;  1MD3 A;  5KN1 A;  1TJD A;  3A2W A;  2LEG A;  4IKH A;  3H79 A;  3ED3 A;  4TKY A;  4BVX A;  2C3Q A;  4WBJ A;  3KXO A;  4I2U A;  4MZC A;  4MZB A;  3GST A;  1GTI A;  2VL2 A;  5G5E A;  1I5G A;  1GL8 A;  1JHB A;  1K3Y A;  5H5R A;  1SJ6 A;  5ECK B;  4ACS A;  4LLR A;  3FR3 A;  5FT3 A;  3D4T A;  3ME8 A;  1F3B A;  4ZIL A;  3GHA A;  1GUM A;  4LMW A;  1OYJ A;  4DEJ A;  1R26 A;  4MF6 A;  1A24 A;  3H8Q A;  2PBJ A;  4KX4 A;  3APS A;  1SL0 B;  3FR9 A;  3FY7 A;  1AQV A;  2VLV A;  2CX3 A;  3BOA A;  4I8B A;  2XPD A;  1PMT A;  3CSH A;  4MAB A;  1OAZ A;  1KTE A;  3IOS A;  2GZP A;  2R37 A;  5IMD A;  1A8Y A;  1R5P A;  5DCG A;  4K2D A;  4PNG A;  4HDE A;  4GLT A;  3TJB A;  2F8F A;  1SK2 A;  3BD2 A;  4GTU A;  1PSQ A;  2CZ2 A;  4NXI A;  4ECB A;  4WBR D;  3GH6 A;  1K0B A;  4OFM A;  1PL2 A;  2QKE A;  3U6V A;  1X9W B;  2C3T A;  4ECI A;  3IK7 A;  5GZZ B;  2LNT A;  3N9J A;  1TK5 B;  1GUL A;  3R2Q A;  3FZ4 A;  2L4C A;  2IFQ B;  4TR0 A;  3TRX A;  5HR0 A;  5A5K A;  3VI5 A;  2ES7 A;  3D4M A;  1MD4 A;  3UOM A;  4RQX A;  2FLS A;  4DSS A;  5D9V A;  4KDX A;  1U3A A;  20GS A;  2FY6 A;  2GLR A;  3LGC A;  4L8E A;  1SL1 B;  1XFL A;  1EEM A;  2GVP A;  2I1U A;  5GSS A;  3H1N A;  1Z9H A;  1DE1 A;  3UAP A;  3L9S A;  1JZR A;  2O87 A;  4XCS A;  5EY6 A;  4K7N A;  1IYI A;  1EOG A;  3ZLP A;  1OKD A;  2CAI A;  4MZW A;  1S3C A;  4CDO A;  5DDL A;  3NIV A;  2IL3 A;  2O85 A;  1OKT A;  4O92 A;  4PXO A;  5JWR B;  4JR4 A;  5ENU A;  3HD5 A;  4MF7 A;  3J7Y k;  3FHK A;  1SKR B;  4EC0 A;  1F6M C;  5H5Q A;  2V6K A;  2TRX A;  2RM5 A;  4TXO B;  2AYT A;  2YWM A;  3KM6 A;  1PRX A;  2DJK A;  5G31 A;  1AXD A;  4NV2 A;  4MH2 A;  3GKN A;  4HOJ A;  1ZYE A;  3VUR A;  2MBT A;  6GSS A;  1HD2 A;  2V6O A;  1K0C A;  3GRX A;  4MCU A;  1O8X A;  3F63 A;  4RI6 A;  1TRU A;  4IW9 A;  4QL9 A;  4OMV A;  3GMF A;  4KB3 A;  1GSS A;  1DBY A;  1K0D A;  2MYG A;  1CQH A;  1KNG A;  1EEJ A;  3PIN A;  2DC5 A;  5F06 A;  1R7H A;  3IHQ A;  1A2L A;  1A2J A;  4NPB A;  5EL8 A;  2WGR A;  2YWN A;  2X99 A;  1TTZ A;  2L59 A;  3TCO A;  2X8H A;  2HRN A;  1SJI A;  1ERT A;  4Q5R A;  2X64 A;  2A2S A;  2MMO A;  4AJ7 A;  1KBN A;  4RI7 A;  2C8U A;  5HR1 A;  1GSU A;  1G6Y A;  9GSS A;  3IE3 A;  2XHF A;  4K7I A;  3LSZ A;  3AY8 A;  2KOK A;  3I9V 2;  2LJK A;  3VWX A;  3GL5 A;  1K3L A;  5CYY A;  2YCD A;  1AIU A;  11GS A;  2DBC A;  2VD0 A;  4POB A;  3KTB A;  2WJU A;  3IK9 A;  3MSZ A;  2OE3 A;  2VIM A;  2VL2 C;  4ISD A;  4J57 E;  5F0G A;  1M2A A;  1EV4 A;  1ZOF A;  2LUS A;  3HCZ A;  3P90 A;  2WUL A;  4JZQ A;  3W8S A;  1OE8 A;  1ERW A;  2CQ9 A;  2FUG 2;  2FWG A;  1SYX A;  4I5Q A;  2WDU A;  4IQ1 A;  3HYP A;  2BTO T;  4LMV A;  2E7P A;  3MDK A;  2EIR A;  1XIY A;  4RQR A;  5AGY A;  1FOV A;  4EUY A;  4I2T A;  1V58 A;  2I81 A;  3VWU A;  4OCF A;  2HLS A;  1B4Q A;  4AGS A;  4XS4 A;  1BX9 A;  4BA7 A;  1FVK A;  2KLX A;  4FYU A;  4PQI A;  2I4A A;  4NMU A;  1Z5Y E;  3M8N A;  4YH2 A;  2GS3 A;  1V40 A;  4N0Z A;  2GSQ A;  2AHE A;  2OE0 A;  4FO5 A;  1FW1 A;  2OAC A;  5IMF A;  2YOI A;  2P5R A;  1TK0 B;  3Q19 A;  1SK1 A;  3US3 A;  4OFT A;  12GS A;  5DAK A;  7GSS A;  2BJX A;  1Z7R A;  2H72 A;  5DQY A;  3RPP A;  2CZ3 A;  3UAR A;  1G6W A;  2VM1 A;  3TKS A;  2GSR A;  1F37 A;  1K0N A;  1Z3E A;  3F8U A;  5CRD A;  1JZW A;  2RLI A;  2VCQ A;  2JAD A;  3MAK A;  3ZVJ A;  1YEX A;  2H76 A;  2OKA A;  2EIO A;  1F9M A;  1RK4 A;  4POK A;  1JLV A;  5DBQ A;  3EIN A;  4JR6 A;  3G7Y A;  1QK8 A;  2R4V A;  4K9Z A;  4TR1 A;  5EPF A;  1ERU A;  4MMM A;  4O7H A;  2ZNM A;  1SKS B;  3GUS A;  5D9T A;  2K8S A;  4TN8 A;  1PA3 A;  4DSQ A;  3NOF A;  2O8V B;  2K18 A;  4MJB A;  4ZBD A;  3EMP A;  4NHW A;  1YKC A;  2H6Z A;  5E4W A;  4GWR A;  1GNE A;  5L71 A;  3DVX A;  2LRC A;  3LYK A;  5J3R A;  2TIR A;  1NM3 A;  2VCX A;  3ZTL A;  4E8H A;  4O32 A;  3TRP A;  4L0W A;  1J9B A;  1O81 A;  3ERG A;  5E59 A;  2F9S A;  2X8G A;  2OA7 A;  2DJJ A;  4POM A;  3MNG A;  3LWA A;  3N5O A;  3DD3 A;  4EXJ A;  3HJP A;  3BJ5 A;  3HZ8 A;  5GAN D;  2QC7 A;  3E9J B;  1XCC A;  5B6M A;  3HVS A;  2PWJ A;  3TJK A;  3I43 A;  3L78 A;  5ECN B;  1GSY A;  3GYK A;  5COH A;  4WEY A;  3ZRE A;  2JSZ A;  2EIQ A;  2XBQ A;  3ERW A;  3EYT A;  5FHI A;  3TJF A;  2CT6 A;  5J4U A;  1VGL A;  1K0O A;  1JZO A;  2AJQ B;  3FRC A;  4NWY A;  5DCH A;  1ERV A;  4ZXG A;  3F3R A;  1JZD A;  4EE0 A;  2PVO C;  10GS A;  4NHZ A;  2YP6 A;  5G1K A;  4KDU A;  5ECQ B;  2JL4 A;  3QAW A;  2YZH A;  2OBI A;  2I9H A;  2E0Q A;  1ABA A;  4ZBA A;  1TK8 B;  1SU9 A;  4V2N A;  1HNC A;  1F2E A;  5H5S A;  3QD9 A;  4KDY A;  2FNO A;  3TUE A;  2YPM A;  2Z9S A;  3DVW A;  1G7E A;  3ZVJ D;  3IV4 A;  4EF0 A;  4KUN A;  1VRS D;  4FYB A;  2YJH A;  3F6F A;  2HYX A;  3S9F A;  4HU9 A;  5D96 A;  5KN0 A;  1Z6N A;  1AUC A;  2MMN A;  5LD0 A;  3ISO A;  3ZMK A;  1B48 A;  1JFU A;  3IXR A;  3KTL A;  1M0U A;  5KEJ A;  2B6M A;  4IN0 A;  2IPA A;  1ST9 A;  4DVC A;  4X43 A;  2DJ2 A;  1A0R P;  3APO A;  4GQF A;  4TOP A;  5IIZ A;  5J5N A;  1X9M B;  3FK8 A;  1DUG A;  1Y25 A;  1W4V A;  1YJ6 A;  3GN3 A;  3FR6 A;  1YF1 A;  3GIX A;  2WFC A;  4FIW A;  2O7K A;  1YEP A;  4MLY A;  3GA4 A;  3GX0 A;  2DML A;  4ZB8 A;  2NDO A;  1GLP A;  1GWC A;  2CA8 A;  2PPT A;  4XS6 A;  3UEM A;  3CRU A;  2H0G A;  2L5O A;  3DRN A;  3M9K A;  5ID2 A;  1TI1 A;  4LL1 B;  3FZA A;  3RDW A;  4IGJ A;  3EVI A;  3EUR A;  3WD6 A;  2H70 A;  3E0U A;  3HVV A;  3GKX A;  2DJ3 A;  4IVF A;  4EKZ A;  2HT9 A;  2GDR A;  1FO5 A;  3ZFB A;  1T8E B;  2JZR A;  1K0A A;  2IJY A;  2LNS A;  3HA9 A;  1GNW A;  3TKS C;  3IBH A;  1YDK A;  1VF4 A;  2HZE B;  1TKD B;  3KMO A;  1XW6 A;  1A2M A;  4V2M A;  1FB0 A;  4XHM A;  3KEB A;  1VF1 A;  6GSU A;  1SYR A;  3M1G A;  2B5E A;  3EC3 A;  3O6T A;  2M46 A;  4HUA A;  5A4U A;  1T4Y A;  5LCZ A;  3NZN A;  2IMI A;  4JE1 A;  4WR4 A;  1XWG A;  3WT2 A;  4K8M A;  3G9B A;  4KW6 A;  3C7M A;  2HXK A;  5HFG A;  5C00 A;  3CSI A;  1M2B A;  1ZZY A;  1E6B A;  2AAW A;  3TGZ A;  1NHY A;  3IC4 A;  2RII A;  1IYH A;  5ECH B;  4JRR A;  4MH3 A;  3IA1 A;  4LA1 A;  4HJM A;  2C0G A;  4TVE A;  2OJL A;  3FZ9 A;  2IME A;  5JWO B;  5DQS A;  3ZZX A;  1T00 A;  5AIS A;  2NPB A;  1XWA A;  1C72 A;  1RW1 A;  2JU5 A;  4YQM A;  1EV9 A;  2R6K A;  2L5L A;  3P2A A;  3M9J A;  1YKA A;  1PD2 1;  3O3T A;  3OR5 A;  5A4V A;  5DAL B;  4H86 A;  3EE2 A;  1EGR A;  3UJ1 A;  2C80 A;  4YQU A;  2QGV A;  2HE3 A;  5AIX A;  1GSF A;  1O73 A;  4ZIJ A;  2HI7 A;  4JED A;  4OFN A;  5AIV A;  3HDC A;  2H8L A;  4KCA A;  3FW2 A;  4PQH A;  4TR4 A;  2OE1 A;  2C0F A;  1B9X C;  5DJM A;  5D73 A;  3E3E A;  2VCZ A;  5B6N A;  1N2A A;  3C8E A;  1O7U A;  3ZIV A;  8GSS A;  4Z7X A;  3D22 A;  5IO2 A;  3RHB A;  3QFB C;  3QFA C;  5HR3 A;  3IR4 A;  4KSO A;  1T7P B;  3QR6 A;  1TW9 A;  4EO3 A;  1O85 A;  2VLT A;  1PKZ A;  2C0D A;  3VPT A;  4EL1 A;  2H73 A;  2IFQ A;  1T3B A;  4BWS A;  3L9V A;  1K0M A;  16GS A;  2CX4 A;  3GTU B;  1A0F A;  5IMZ A;  5B8B A;  2B7J A;  1WP0 A;  3ERF A;  3TKP A;  1QMV A;  2N5F A;  3C1R A;  1QGV A;  2H1G A;  5EVO A;  1V98 A;  3UMA A;  2LJR A;  2L4Q A;  2V32 A;  2R2J A;  3L9U A;  2P0G A;  3MWH A;  3FYG A;  1TP9 A;  1XW5 A;  3H4K A;  5IMA A;  2H0I A;  1TU8 A;  5ELA A;  5CRG A;  1XPV A;  2YWI A;  4KE3 A;  4KH7 A;  2LJA A;  2YAN A; 
#chains in the Genus database with same CATH topology
 4Q5F A;  1YQ1 A;  1CQG A;  2B1L A;  5J9B A;  1Z7P A;  5JWQ B;  13GS A;  4V2L A;  3HVX A;  2FHE A;  1GP1 A;  2TRC P;  1PKW A;  1H4O A;  4MPG A;  5JCU A;  4K7O A;  3GKM A;  1XW9 A;  4PQ1 A;  2H74 A;  3HJM A;  4TXO A;  2KP1 A;  1AW9 A;  3CQF A;  4CHS A;  4BL7 A;  18GS A;  1LJR A;  3ZYW A;  2IIY A;  3WGX A;  3TJG A;  2A4H A;  2M80 A;  4D73 B;  4EDY A;  17GS A;  2VO4 A;  2O89 A;  5B7C A;  1M9B A;  3RHC A;  4L5O A;  1Q98 A;  3EU3 A;  3F4S A;  3GL3 A;  4N30 A;  4F03 A;  5INY A;  4JU5 A;  5F05 A;  4PUA A;  1A8L A;  2DJ0 A;  2XBI A;  4NV5 A;  2YNX A;  3W6G A;  2LRT A;  3ZL5 A;  5D8I A;  2F8A A;  1U88 A;  1YF0 A;  2YZU A;  4E8E A;  2PER A;  5GAP D;  2FWE A;  2VM2 A;  4MJC A;  3QAV A;  1XZO A;  2DLX A;  1OC3 A;  4YQV A;  4LL4 B;  3LG6 A;  3KD0 A;  4BIK A;  3O76 A;  1WMJ A;  1XWB A;  2FCH A;  4HEA 2;  4KA0 A;  1GTB A;  4O5U A;  2V1M A;  3GUR A;  3C73 A;  1FAA A;  3EU4 A;  1SEN A;  1EP8 A;  4K0G A;  1ZMA A;  4ICY A;  3M0F A;  1GUH A;  6GSV A;  5FWG A;  2LS5 A;  4AJ6 A;  4ZBB A;  2OAD A;  1AQX A;  1MTC A;  3TB2 A;  4IP6 A;  1WJK A;  4X1U A;  1B8X A;  1PFO A;  4ML6 A;  4ZB9 A;  1GSD A;  4BVX B;  2GSS A;  2CV4 A;  3FKF A;  2LTK A;  2JZT A;  3GV1 A;  3BCI A;  2WS2 A;  5G2Z A;  2H71 A;  4G10 A;  1TRW A;  1MDJ A;  1FG4 A;  2VCV A;  1SD8 A;  1RQM A;  5ECM B;  1PN9 A;  2WCI A;  3JCM L;  4OO4 A;  3PPU A;  5CRH A;  2BMX A;  2V41 A;  2FA8 A;  1I9D A;  4ID0 A;  2DIZ A;  4MF5 A;  4ML1 A;  4TW5 A;  3VFI A;  5GST A;  4Q5N A;  1U87 A;  4Q5Q A;  1ILO A;  4NAX A;  2B7K A;  5IPH A;  3RAZ A;  3WGD A;  2HRK A;  5IO0 A;  3F3Q A;  3CMI A;  2E2G A;  1XOB A;  3TKR A;  3TOU A;  4G2E A;  4J56 E;  3PR8 A;  4FH8 A;  3KZQ A;  1V9W A;  2HSH A;  1M7T A;  3KCM A;  3HZ4 A;  3A5W A;  5ECP B;  1HNA A;  4JBB A;  2IN3 A;  2I3Y A;  2EC4 A;  2VOC A;  4XIH A;  4Z2T A;  3HJO A;  3L0H A;  1TI3 A;  3FZ5 A;  5LNK e;  2HSY A;  2GT6 A;  5IQY A;  2A2P A;  2LV3 A;  3DEX A;  1AC1 A;  2JZS A;  6GSY A;  3ZFL A;  4GCI A;  1EWX A;  1PQN A;  1HYU A;  3QAG A;  4OD7 A;  2YJ7 A;  2K8V A;  1UC7 A;  1NHO A;  2WZ9 A;  3CTG A;  4DSR A;  5J41 A;  3HY2 A;  4ECC A;  2XPE A;  3KP8 A;  2PGT A;  1TU7 A;  2RUF A;  3IHG A;  2QA2 A;  2F3M A;  2GZY A;  2L6C A;  1O6J A;  3LOR A;  2R5G A;  3L4N A;  2P5Q A;  2H6X A;  5CRE A;  3TDG A;  1MEK A;  2LRN A;  3BCK A;  1PX7 A;  5ELG A;  1MDI A;  6GSX A;  4ILF A;  2YV7 A;  1UN2 A;  3C1S A;  1DE2 A;  1G0T A;  4KAE A;  5D9W A;  1ZL9 A;  4WF4 A;  1J0F A;  3CTF A;  3DXB A;  2RM6 A;  6GSW A;  4YAV A;  1ZGN A;  3APQ A;  3LXT A;  3W8J A;  2JSY A;  2MMA A;  1UA5 A;  1Y6E A;  1G7O A;  2RUE A;  1T4Z A;  4WF5 A;  2FWF A;  3LQ7 A;  1TRS A;  3KH7 A;  2CAQ A;  2B5Y A;  1V57 A;  2LQO A;  1WOU A;  3IAM 2;  1TRV A;  1UVZ A;  2G0F A;  3PGT A;  4F0B A;  3LEF A;  1M99 A;  4IS0 A;  4QQ7 A;  5ABR A;  2HFD A;  1BQ7 A;  4AF2 A;  2HNL A;  3DYR A;  1JLW A;  4YKF A;  1S3A A;  2DSA A;  4IEL A;  3P7X A;  4ZL7 A;  1LBK A;  1KEB A;  5C04 A;  5ECI B;  5JCW A;  1THX A;  4I6X A;  5IMV A;  2R3X A;  3A3T A;  5HFK A;  4K6X A;  3ZML A;  3G7J A;  2K9F A;  2H19 A;  3C71 A;  4Z2R A;  2NVL A;  1TOF A;  3R3E A;  1T1V A;  2MBS A;  2GST A;  3DML A;  6GST A;  1PX6 A;  22GS A;  2IMD A;  2J9H A;  3F4R A;  4K1F A;  4IBP A;  3DIE A;  5J9C A;  3UBK A;  4HQZ A;  4HSC X;  4ECJ A;  1OVN A;  2F51 A;  2LKU A;  3CBU A;  1TDI A;  3ZIT A;  3M3M A;  3VWW A;  1WPI A;  2IMK A;  1M9A A;  4MNN A;  5CNW A;  19GS A;  3GX8 A;  1ACV A;  3FEU A;  2ZUP A;  2C4J A;  3UBL A;  2ON5 A;  4OCE A;  2CVB A;  1BJX A;  3HHV A;  1YZX A;  2HRF A;  5HR2 A;  3WYW A;  2PN8 A;  4HJ2 A;  4TR3 A;  2G2Q A;  3KIJ A;  4MJE A;  4KGI A;  1BED A;  1X5C A;  3QOU A;  4HZ2 A;  1NSW A;  2ZCT A;  3A2X A;  3DGQ A;  2C3N A;  2D2Z A;  2WB9 A;  4YAP A;  4HU7 A;  3HXS A;  3F9U A;  1DSB A;  3SWL A;  3UL3 A;  4BVY A;  2N5B A;  5F8B A;  2GQM A;  2CVK A;  5HQP A;  4XS1 A;  4WKW A;  1OE7 A;  1QUW A;  4KND A;  3VK9 A;  1HQO A;  4WET A;  4AJ8 A;  4G9H A;  4F2I A;  3CYN A;  1NW2 A;  3LYP A;  2X8C A;  2VD1 A;  2MZC A;  2H1D A;  4XS4 B;  1EGO A;  14GS A;  2E2M A;  1XXU A;  3GH9 A;  3A2V A;  4PNF A;  4O5R A;  5ECR B;  2QSI A;  5IOW A;  2FWH A;  3HKR A;  3Q18 A;  4PUF C;  4HS1 A;  5HFI A;  5A4W A;  2DJ1 A;  4BPY A;  3D21 A;  3V1W A;  3WT1 A;  3LJR A;  1HNB A;  2HZE A;  5JCG A;  4TRX A;  5B8A A;  5DVB A;  3IDV A;  5CRW A;  2YV9 A;  3F0I A;  2N5A A;  1GUK A;  5G5F A;  2AUV A;  3RBT A;  5DAK B;  3I69 A;  5ECS A;  5KN2 A;  3EWL A;  3TOT A;  4GXZ A;  1OC9 B;  5G1L A;  4V1A p;  4FYC A;  4N0V A;  1ZYQ B;  5CP1 A;  2VAF A;  3ZIJ A;  3DKS A;  2XC2 A;  5D9X A;  1GTU A;  2DMM A;  2L6D A;  3D0Z A;  3IAS 2;  1EZK A;  4XRA A;  3ME7 A;  2VCW A;  1AQW A;  3QMX A;  4ULX A;  3G7I A;  4G0I A;  3KP9 A;  2A2R A;  1SK0 A;  5F07 A;  2GGT A;  4TR1 B;  1E2Y A;  5DJL A;  4XTS A;  1S3D A;  4CW9 A;  2GZZ A;  4N11 A;  1BAY A;  2VL9 A;  1M2D A;  4IHU A;  3WGE A;  1F3A A;  1U6T A;  3ZRD A;  2MMZ A;  2AB6 A;  3F6D A;  2H01 A;  1MDK A;  3PH9 A;  2GT5 A;  4IP1 A;  2J23 A;  1W89 A;  1WWJ A;  4GSN A;  1SD9 A;  3H93 A;  1VF3 A;  2FGX A;  3P8W A;  4F0C A;  5DAL A;  4GRF A;  3MIX A;  3QDN A;  3TKS E;  2R0G A;  3I6A A;  1GSQ A;  1GH2 A;  1B4P A;  2LST A;  2LQQ A;  3Q74 A;  1FHE A;  3KMN A;  3TKQ A;  4WR5 A;  1X5E A;  1WE0 A;  5IMC A;  4MA9 A;  1FVJ A;  1VF2 A;  3RPN A;  4GSS A;  4WXT A;  1ML6 A;  4EVM A;  2KHP A;  2C0E A;  2B1K A;  2VUP A;  5BRT A;  2VLU A;  3LFL A;  5KN3 A;  1XWK A;  1ZCP A;  3D6I A;  2OBK A;  2GQL A;  4KSM A;  3VWV A;  5CO3 A;  3UVT A;  3VPQ A;  3CXG A;  4XRD A;  1X5D A;  1QXH A;  1XBS A;  1XVW A;  1Q4J A;  5CAX A;  3EMX A;  4PX1 A;  2K6V A;  3EPT A;  4MP4 A;  1THO A;  1ON4 A;  4MJA A;  1GRX A;  1OC9 A;  1H75 A;  2IMF A;  4KCE A;  4ZB6 A;  1WRY A;  5ECL B;  2H1B A;  4GF0 A;  3GTU A;  3GFK A;  1X9S B;  3CRT A;  3U5R E;  5AN1 A;  5KOW A;  2M72 A;  1SL2 B;  4MDC A;  2HSM A;  1EOH A;  1ZYN A;  2PMT A;  2ALB A;  3TRQ A;  3UIW A;  3CSJ A;  2H30 A;  1U3I A;  2B5X A;  2NBS A;  1A23 A;  2PVQ A;  4HQS A;  1FB6 A;  5D93 A;  4IQA A;  3LXZ A;  4P3Y B;  4POL A;  3K8N A;  1PGT A;  4MK3 A;  1URM A;  4V1A g;  1YY7 A;  3VI7 A;  1ZYP A;  2H0H A;  1R4W A;  1USB A;  2P31 A;  4ZL9 A;  2H75 A;  1O8W A;  4HZ4 A;  4L5L A;  3SBC A;  4J2F A;  4RUV A;  1B9Y C;  3QPM A;  5IM9 A;  5G30 A;  4PUR A;  1BG5 A;  2GTU A;  1EP7 A;  1GSE A;  2ON7 A;  2VCT A;  1OC8 A;  2GQK A;  5ID2 B;  2A4V A;  3GNJ A;  2C1Y A;  1BYE A;  2FD3 A;  1Z6M A;  1XVQ A;  3F4T A;  1N8J A;  1TXX A;  4G19 A;  1LU4 A;  3VLN A;  2JAC A;  1J08 A;  3GSS A;  1XWC A;  2NTO A;  2WRT A;  2AV4 A;  4PGT A;  2HZF A;  1QFN A;  4GST A;  2H6Y A;  4USS A;  4D73 A;  4GQC A;  4PTS A;  3KGK A;  3GKK A;  1PL1 A;  4F9Z A;  2REM A;  2KP2 A;  1WIK A;  4YKG A;  2DKI A;  3KJY A;  2CVD A;  4TXV A;  4MPF A;  4HI7 A;  2DIY A;  1R5A A;  2B3S A;  4X0X A;  4EIP A;  1X0R A;  2H66 A;  5ECO B;  2VL3 A;  4L0U A;  4N10 A;  3J7Y b;  4I97 A;  3BBY A;  2H1A A;  3DWV A;  3KH9 A;  5IPG A;  5IOX A;  1SKW B;  1K3O A;  4EDZ A;  3TJJ A;  4BWQ A;  4OWY A;  2KUC A;  4K0N A;  3IRA A;  1V2A A;  3UVH A;  2IWT A;  4OO5 A;  4F82 A;  3QCP A;  3Q6O A;  1QQ2 A;  4IJ3 A;  1GLQ A;  1GTA A;  4QL7 A;  4CY8 A;  1AAZ A;  3IPZ A;  2PU9 C;  4IJI A;  3D5J A;  2V2G A;  2FA4 A;  4ZL8 A;  1SJZ A;  2PUK C;  1XOA A;  4DSS B;  2YWO A;  2L57 A;  2YN1 A;  1MD3 A;  5KN1 A;  1TJD A;  4K2X A;  3A2W A;  2LEG A;  4IKH A;  3H79 A;  3ED3 A;  4EIQ A;  4TKY A;  4BVX A;  2C3Q A;  4WBJ A;  3KXO A;  4I2U A;  4MZC A;  4MZB A;  3GST A;  1GTI A;  4G0K A;  2VL2 A;  5G5E A;  1I5G A;  1GL8 A;  1JHB A;  1K3Y A;  5H5R A;  1SJ6 A;  5ECK B;  4ACS A;  4LLR A;  3FR3 A;  5FT3 A;  3D4T A;  3ME8 A;  1F3B A;  4ZIL A;  3GHA A;  1GUM A;  4LMW A;  1OYJ A;  4DEJ A;  1R26 A;  4MF6 A;  1A24 A;  3H8Q A;  2PBJ A;  4KX4 A;  3APS A;  1SL0 B;  3FR9 A;  3FY7 A;  1AQV A;  2VLV A;  2CX3 A;  3BOA A;  4I8B A;  2XPD A;  1PMT A;  3CSH A;  4MAB A;  1OAZ A;  1KTE A;  3IOS A;  3FMW A;  2GZP A;  2R37 A;  5IMD A;  1A8Y A;  1R5P A;  5DCG A;  4K2D A;  4PNG A;  4HDE A;  4GLT A;  2UZ8 A;  3TJB A;  2F8F A;  1SK2 A;  3BD2 A;  4GTU A;  1PSQ A;  2CZ2 A;  4NXI A;  4ECB A;  4WBR D;  3GH6 A;  1K0B A;  4OFM A;  1PL2 A;  2QKE A;  3U6V A;  1X9W B;  2C3T A;  4ECI A;  3IC8 A;  3IK7 A;  5GZZ B;  2LNT A;  3N9J A;  1TK5 B;  1GUL A;  3R2Q A;  3FZ4 A;  2L4C A;  2IFQ B;  4TR0 A;  3TRX A;  5HR0 A;  5A5K A;  3VI5 A;  2ES7 A;  3D4M A;  2X4A A;  1MD4 A;  3UOM A;  4RQX A;  2FLS A;  4DSS A;  5D9V A;  4KDX A;  1U3A A;  20GS A;  2FY6 A;  2GLR A;  3LGC A;  4L8E A;  1SL1 B;  1XFL A;  1EEM A;  2GVP A;  2I1U A;  4Z2U A;  5GSS A;  3H1N A;  1Z9H A;  1DE1 A;  3UAP A;  3L9S A;  1JZR A;  2O87 A;  4XCS A;  5EY6 A;  4K7N A;  1IYI A;  1EOG A;  3ZLP A;  1OKD A;  2CAI A;  4MZW A;  1S3C A;  3HVN A;  4CDO A;  5DDL A;  3NIV A;  2IL3 A;  2O85 A;  1OKT A;  4O92 A;  4PXO A;  5JWR B;  4JR4 A;  5ENU A;  3HD5 A;  4MF7 A;  3J7Y k;  3FHK A;  1SKR B;  4EC0 A;  1F6M C;  5H5Q A;  2V6K A;  2TRX A;  2RM5 A;  4TXO B;  2AYT A;  2YWM A;  3KM6 A;  1PRX A;  2DJK A;  5G31 A;  4BL7 B;  1AXD A;  4NV2 A;  4MH2 A;  3GKN A;  4HOJ A;  1ZYE A;  3VUR A;  2MBT A;  6GSS A;  1HD2 A;  2V6O A;  1K0C A;  3GRX A;  4MCU A;  1O8X A;  3F63 A;  4RI6 A;  1TRU A;  4IW9 A;  4QL9 A;  4OMV A;  3GMF A;  4KB3 A;  1GSS A;  1DBY A;  1K0D A;  2MYG A;  1CQH A;  1KNG A;  1EEJ A;  3PIN A;  4K5S A;  2DC5 A;  5F06 A;  1R7H A;  3IHQ A;  1A2L A;  1A2J A;  4NPB A;  5EL8 A;  2WGR A;  2YWN A;  2X99 A;  1TTZ A;  2L59 A;  3TCO A;  2X8H A;  2HRN A;  1SJI A;  1ERT A;  4Q5R A;  2X64 A;  2A2S A;  2MMO A;  4AJ7 A;  1KBN A;  4RI7 A;  2C8U A;  5HR1 A;  1GSU A;  1G6Y A;  9GSS A;  3IE3 A;  2XHF A;  4K7I A;  3LSZ A;  3AY8 A;  2KOK A;  3I9V 2;  2LJK A;  3VWX A;  3GL5 A;  1K3L A;  5CYY A;  2YCD A;  1AIU A;  11GS A;  2DBC A;  2VD0 A;  4POB A;  3KTB A;  2WJU A;  3IK9 A;  3MSZ A;  2OE3 A;  2VIM A;  2VL2 C;  4ISD A;  4J57 E;  5F0G A;  1M2A A;  1EV4 A;  1ZOF A;  2LUS A;  3HCZ A;  3P90 A;  2WUL A;  4JZQ A;  3W8S A;  1OE8 A;  1ERW A;  2CQ9 A;  2FUG 2;  2FWG A;  1SYX A;  4I5Q A;  2WDU A;  4IQ1 A;  4O5Q A;  3HYP A;  2BTO T;  4LMV A;  2E7P A;  3MDK A;  2EIR A;  1XIY A;  4RQR A;  5AGY A;  1FOV A;  4EUY A;  4I2T A;  1V58 A;  2I81 A;  3VWU A;  4OCF A;  2HLS A;  1B4Q A;  4AGS A;  4XS4 A;  1BX9 A;  4BA7 A;  1FVK A;  2KLX A;  4FYU A;  4PQI A;  2I4A A;  2HRA A;  4NMU A;  1Z5Y E;  4CY6 A;  3M8N A;  4YH2 A;  2GS3 A;  1V40 A;  4N0Z A;  4G0L A;  2GSQ A;  2AHE A;  2OE0 A;  4FO5 A;  1FW1 A;  2OAC A;  5IMF A;  4FQU A;  2YOI A;  2P5R A;  1TK0 B;  3Q19 A;  4KF9 A;  3A5I A;  1SK1 A;  3US3 A;  4OFT A;  12GS A;  5DAK A;  7GSS A;  2BJX A;  1Z7R A;  2H72 A;  5DQY A;  3RPP A;  2CZ3 A;  3UAR A;  1G6W A;  2VM1 A;  3TKS A;  2GSR A;  1F37 A;  1K0N A;  1Z3E A;  3F8U A;  5CRD A;  1JZW A;  2RLI A;  2VCQ A;  2JAD A;  3MAK A;  3ZVJ A;  1YEX A;  2H76 A;  2OKA A;  2EIO A;  1F9M A;  1RK4 A;  4POK A;  1JLV A;  5DBQ A;  3EIN A;  4JR6 A;  3G7Y A;  1QK8 A;  2R4V A;  4K9Z A;  4TR1 A;  5EPF A;  1ERU A;  4MMM A;  4O7H A;  2ZNM A;  1SKS B;  3GUS A;  5D9T A;  2K8S A;  4TN8 A;  1PA3 A;  4DSQ A;  3NOF A;  2O8V B;  2K18 A;  4MJB A;  4ZBD A;  3EMP A;  4NHW A;  1YKC A;  2H6Z A;  1M3J A;  5E4W A;  4GWR A;  1GNE A;  5L71 A;  3DVX A;  2LRC A;  4X4J A;  3LYK A;  5J3R A;  2TIR A;  1NM3 A;  2VCX A;  3ZTL A;  4E8H A;  4O32 A;  3TRP A;  4L0W A;  1J9B A;  1O81 A;  3ERG A;  5E59 A;  2F9S A;  2X8G A;  2OA7 A;  2DJJ A;  4POM A;  5BMU A;  1XG8 A;  3MNG A;  3LWA A;  3N5O A;  3DD3 A;  3MYD A;  3HJP A;  4EXJ A;  3BJ5 A;  3HZ8 A;  5GAN D;  2QC7 A;  3E9J B;  1XCC A;  5B6M A;  3HVS A;  2PWJ A;  3TJK A;  3I43 A;  3L78 A;  5ECN B;  1GSY A;  3GYK A;  5COH A;  4WEY A;  3ZRE A;  2JSZ A;  2EIQ A;  2XBQ A;  3ERW A;  3EYT A;  5FHI A;  3TJF A;  2CT6 A;  4A5P A;  5J4U A;  1VGL A;  1K0O A;  2QA1 A;  1JZO A;  2AJQ B;  3FRC A;  4NWY A;  5DCH A;  1ERV A;  4ZXG A;  3F3R A;  1JZD A;  4EE0 A;  2PVO C;  10GS A;  4NHZ A;  2YP6 A;  5G1K A;  4KDU A;  5ECQ B;  2JL4 A;  3QAW A;  2YZH A;  2OBI A;  2I9H A;  2E0Q A;  1ABA A;  4ZBA A;  1TK8 B;  1SU9 A;  4V2N A;  1HNC A;  1F2E A;  5H5S A;  3QD9 A;  4KDY A;  2FNO A;  3TUE A;  2YPM A;  2Z9S A;  3DVW A;  1G7E A;  3ZVJ D;  3IV4 A;  4EF0 A;  4KUN A;  1VRS D;  4FYB A;  2YJH A;  3F6F A;  2HYX A;  3S9F A;  4HU9 A;  5D96 A;  5KN0 A;  1Z6N A;  1AUC A;  2MMN A;  5LD0 A;  3ISO A;  3ZMK A;  1B48 A;  1JFU A;  3IXR A;  3KTL A;  1M0U A;  5KEJ A;  2B6M A;  4IN0 A;  2IPA A;  1ST9 A;  4DVC A;  4X43 A;  2DJ2 A;  1A0R P;  3APO A;  4GQF A;  4TOP A;  5IIZ A;  5J5N A;  1X9M B;  3FK8 A;  1DUG A;  1Y25 A;  1W4V A;  1YJ6 A;  3GN3 A;  3FR6 A;  1YF1 A;  3GIX A;  2WFC A;  4FIW A;  2O7K A;  1YEP A;  4MLY A;  3GA4 A;  3GX0 A;  5KOX A;  2DML A;  4ZB8 A;  2NDO A;  1GLP A;  1GWC A;  2CA8 A;  2PPT A;  4XS6 A;  3UEM A;  3CRU A;  2H0G A;  2L5O A;  3DRN A;  3M9K A;  5ID2 A;  1TI1 A;  4BVY B;  4LL1 B;  3FZA A;  3RDW A;  4IGJ A;  3EVI A;  3EUR A;  3WD6 A;  2H70 A;  3E0U A;  3HVV A;  3GKX A;  2DJ3 A;  4IVF A;  4EKZ A;  2R0C A;  2HT9 A;  2GDR A;  1FO5 A;  3ZFB A;  1T8E B;  2JZR A;  1K0A A;  2IJY A;  2LNS A;  3HA9 A;  1GNW A;  3TKS C;  3IBH A;  1YDK A;  1VF4 A;  2HZE B;  1TKD B;  3KMO A;  1XW6 A;  1A2M A;  4V2M A;  1FB0 A;  4XHM A;  3KEB A;  1VF1 A;  6GSU A;  1SYR A;  3M1G A;  2B5E A;  3EC3 A;  3O6T A;  2M46 A;  4HUA A;  5A4U A;  1T4Y A;  5LCZ A;  3NZN A;  2IMI A;  4JE1 A;  4WR4 A;  1XWG A;  3WT2 A;  4K8M A;  3G9B A;  4KW6 A;  3C7M A;  2HXK A;  5HFG A;  5C00 A;  3CSI A;  1M2B A;  1ZZY A;  1E6B A;  2AAW A;  3TGZ A;  1NHY A;  3IC4 A;  2RII A;  1IYH A;  5ECH B;  2X49 A;  4JRR A;  4MH3 A;  3IA1 A;  4LA1 A;  4HJM A;  2C0G A;  4TVE A;  2OJL A;  3FZ9 A;  2IME A;  5JWO B;  5DQS A;  3ZZX A;  1T00 A;  4K5R A;  5AIS A;  2NPB A;  1XWA A;  1C72 A;  1RW1 A;  2JU5 A;  4YQM A;  1EV9 A;  2R6K A;  2L5L A;  1S3R A;  3P2A A;  3M9J A;  1YKA A;  1PD2 1;  3O3T A;  3OR5 A;  5A4V A;  5DAL B;  4H86 A;  3EE2 A;  1EGR A;  3UJ1 A;  2C80 A;  4YQU A;  2QGV A;  2HE3 A;  5AIX A;  1GSF A;  1O73 A;  4ZIJ A;  2HI7 A;  4JED A;  4OFN A;  5AIV A;  3HDC A;  2H8L A;  4KCA A;  3FW2 A;  4PQH A;  4TR4 A;  2OE1 A;  2C0F A;  1PN0 A;  1B9X C;  5DJM A;  5D73 A;  3E3E A;  2VCZ A;  5B6N A;  1N2A A;  3C8E A;  1O7U A;  3ZIV A;  8GSS A;  4Z7X A;  3D22 A;  5IO2 A;  1M3I A;  3RHB A;  3QFB C;  3QFA C;  5HR3 A;  3IR4 A;  4KSO A;  1T7P B;  2R0P A;  3QR6 A;  1TW9 A;  4EO3 A;  1O85 A;  2VLT A;  1PKZ A;  2DKH A;  2C0D A;  3VPT A;  4EL1 A;  1FOH A;  2H73 A;  2IFQ A;  1T3B A;  4BWS A;  3L9V A;  1K0M A;  3LW9 A;  16GS A;  2CX4 A;  3GTU B;  1A0F A;  5IMZ A;  5B8B A;  2B7J A;  1WP0 A;  3ERF A;  3TKP A;  1QMV A;  2N5F A;  3C1R A;  1QGV A;  2H1G A;  5EVO A;  1V98 A;  3UMA A;  2LJR A;  2L4Q A;  2V32 A;  2R2J A;  3L9U A;  2P0G A;  3MWH A;  3FYG A;  1TP9 A;  1XW5 A;  3H4K A;  5IMA A;  2H0I A;  1TU8 A;  5ELA A;  5CRG A;  1XPV A;  2YWI A;  4KE3 A;  4KH7 A;  2LJA A;  2YAN A; 
#chains in the Genus database with same CATH homology
 4Q5F A;  1YQ1 A;  1CQG A;  2B1L A;  5J9B A;  1Z7P A;  5JWQ B;  13GS A;  4V2L A;  3HVX A;  2FHE A;  1GP1 A;  2TRC P;  1PKW A;  1H4O A;  4MPG A;  5JCU A;  4K7O A;  3GKM A;  1XW9 A;  4PQ1 A;  2H74 A;  3HJM A;  4TXO A;  2KP1 A;  1AW9 A;  4CHS A;  4BL7 A;  18GS A;  1LJR A;  3ZYW A;  2IIY A;  3WGX A;  3TJG A;  2A4H A;  2M80 A;  4D73 B;  4EDY A;  17GS A;  2VO4 A;  2O89 A;  5B7C A;  1M9B A;  3RHC A;  4L5O A;  1Q98 A;  3EU3 A;  3F4S A;  3GL3 A;  4N30 A;  4F03 A;  5INY A;  4JU5 A;  5F05 A;  4PUA A;  1A8L A;  2DJ0 A;  2XBI A;  4NV5 A;  2YNX A;  3W6G A;  2LRT A;  3ZL5 A;  5D8I A;  2F8A A;  1U88 A;  1YF0 A;  2YZU A;  4E8E A;  2PER A;  5GAP D;  2FWE A;  2VM2 A;  4MJC A;  3QAV A;  1XZO A;  2DLX A;  1OC3 A;  4YQV A;  4LL4 B;  3LG6 A;  3KD0 A;  3O76 A;  1WMJ A;  1XWB A;  2FCH A;  4HEA 2;  4KA0 A;  1GTB A;  4O5U A;  2V1M A;  3GUR A;  3C73 A;  1FAA A;  3EU4 A;  1SEN A;  1EP8 A;  4K0G A;  1ZMA A;  4ICY A;  3M0F A;  1GUH A;  6GSV A;  5FWG A;  2LS5 A;  4AJ6 A;  4ZBB A;  2OAD A;  1AQX A;  1MTC A;  3TB2 A;  4IP6 A;  1WJK A;  4X1U A;  1B8X A;  4ML6 A;  4ZB9 A;  1GSD A;  4BVX B;  2GSS A;  2CV4 A;  3FKF A;  2LTK A;  2JZT A;  3GV1 A;  3BCI A;  2WS2 A;  5G2Z A;  2H71 A;  4G10 A;  1TRW A;  1MDJ A;  1FG4 A;  2VCV A;  1SD8 A;  1RQM A;  5ECM B;  1PN9 A;  2WCI A;  3JCM L;  4OO4 A;  3PPU A;  5CRH A;  2BMX A;  2V41 A;  2FA8 A;  1I9D A;  4ID0 A;  2DIZ A;  4MF5 A;  4ML1 A;  4TW5 A;  3VFI A;  5GST A;  4Q5N A;  1U87 A;  4Q5Q A;  1ILO A;  4NAX A;  2B7K A;  5IPH A;  3RAZ A;  3WGD A;  2HRK A;  5IO0 A;  3F3Q A;  3CMI A;  2E2G A;  1XOB A;  3TKR A;  3TOU A;  4G2E A;  4J56 E;  3PR8 A;  4FH8 A;  3KZQ A;  1V9W A;  2HSH A;  1M7T A;  3KCM A;  3HZ4 A;  3A5W A;  5ECP B;  1HNA A;  4JBB A;  2IN3 A;  2I3Y A;  2EC4 A;  2VOC A;  4XIH A;  4Z2T A;  3HJO A;  3L0H A;  1TI3 A;  3FZ5 A;  5LNK e;  2HSY A;  2GT6 A;  5IQY A;  2A2P A;  2LV3 A;  3DEX A;  1AC1 A;  2JZS A;  6GSY A;  3ZFL A;  4GCI A;  1EWX A;  1PQN A;  1HYU A;  3QAG A;  4OD7 A;  2YJ7 A;  2K8V A;  1UC7 A;  1NHO A;  2WZ9 A;  3CTG A;  4DSR A;  5J41 A;  3HY2 A;  4ECC A;  2XPE A;  3KP8 A;  2PGT A;  1TU7 A;  2RUF A;  3IHG A;  2QA2 A;  2F3M A;  2GZY A;  2L6C A;  1O6J A;  3LOR A;  2R5G A;  3L4N A;  2P5Q A;  2H6X A;  5CRE A;  3TDG A;  1MEK A;  2LRN A;  3BCK A;  1PX7 A;  5ELG A;  1MDI A;  6GSX A;  4ILF A;  2YV7 A;  1UN2 A;  3C1S A;  1DE2 A;  1G0T A;  4KAE A;  5D9W A;  1ZL9 A;  4WF4 A;  1J0F A;  3CTF A;  3DXB A;  2RM6 A;  6GSW A;  4YAV A;  1ZGN A;  3APQ A;  3LXT A;  3W8J A;  2JSY A;  2MMA A;  1UA5 A;  1Y6E A;  1G7O A;  2RUE A;  1T4Z A;  4WF5 A;  2FWF A;  3LQ7 A;  1TRS A;  3KH7 A;  2CAQ A;  2B5Y A;  1V57 A;  2LQO A;  1WOU A;  3IAM 2;  1TRV A;  1UVZ A;  2G0F A;  3PGT A;  4F0B A;  3LEF A;  1M99 A;  4IS0 A;  4QQ7 A;  5ABR A;  2HFD A;  1BQ7 A;  4AF2 A;  2HNL A;  3DYR A;  1JLW A;  4YKF A;  1S3A A;  2DSA A;  4IEL A;  3P7X A;  4ZL7 A;  1LBK A;  1KEB A;  5C04 A;  5ECI B;  5JCW A;  1THX A;  4I6X A;  5IMV A;  2R3X A;  3A3T A;  5HFK A;  4K6X A;  3ZML A;  3G7J A;  2K9F A;  2H19 A;  3C71 A;  4Z2R A;  2NVL A;  1TOF A;  3R3E A;  1T1V A;  2MBS A;  2GST A;  3DML A;  6GST A;  1PX6 A;  22GS A;  2IMD A;  2J9H A;  3F4R A;  4K1F A;  4IBP A;  3DIE A;  5J9C A;  3UBK A;  4HQZ A;  4ECJ A;  1OVN A;  2F51 A;  2LKU A;  3CBU A;  1TDI A;  3ZIT A;  3M3M A;  3VWW A;  1WPI A;  2IMK A;  1M9A A;  4MNN A;  5CNW A;  19GS A;  3GX8 A;  1ACV A;  3FEU A;  2ZUP A;  2C4J A;  3UBL A;  2ON5 A;  4OCE A;  2CVB A;  1BJX A;  3HHV A;  1YZX A;  2HRF A;  5HR2 A;  3WYW A;  2PN8 A;  4HJ2 A;  4TR3 A;  2G2Q A;  3KIJ A;  4MJE A;  4KGI A;  1BED A;  1X5C A;  3QOU A;  4HZ2 A;  1NSW A;  2ZCT A;  3A2X A;  3DGQ A;  2C3N A;  2D2Z A;  2WB9 A;  4YAP A;  4HU7 A;  3HXS A;  3F9U A;  1DSB A;  3SWL A;  3UL3 A;  4BVY A;  2N5B A;  5F8B A;  2GQM A;  2CVK A;  5HQP A;  4XS1 A;  4WKW A;  1OE7 A;  1QUW A;  4KND A;  3VK9 A;  1HQO A;  4WET A;  4AJ8 A;  4G9H A;  4F2I A;  3CYN A;  1NW2 A;  3LYP A;  2X8C A;  2VD1 A;  2MZC A;  2H1D A;  4XS4 B;  1EGO A;  14GS A;  2E2M A;  1XXU A;  3GH9 A;  3A2V A;  4PNF A;  4O5R A;  5ECR B;  2QSI A;  5IOW A;  2FWH A;  3HKR A;  3Q18 A;  4PUF C;  4HS1 A;  5HFI A;  5A4W A;  2DJ1 A;  4BPY A;  3D21 A;  3V1W A;  3WT1 A;  3LJR A;  1HNB A;  2HZE A;  5JCG A;  4TRX A;  5B8A A;  5DVB A;  3IDV A;  5CRW A;  2YV9 A;  3F0I A;  2N5A A;  1GUK A;  5G5F A;  2AUV A;  3RBT A;  5DAK B;  3I69 A;  5ECS A;  5KN2 A;  3EWL A;  3TOT A;  4GXZ A;  1OC9 B;  5G1L A;  4V1A p;  4FYC A;  4N0V A;  1ZYQ B;  5CP1 A;  2VAF A;  3ZIJ A;  3DKS A;  2XC2 A;  5D9X A;  1GTU A;  2DMM A;  2L6D A;  3D0Z A;  3IAS 2;  1EZK A;  4XRA A;  3ME7 A;  2VCW A;  1AQW A;  3QMX A;  4ULX A;  3G7I A;  4G0I A;  3KP9 A;  2A2R A;  1SK0 A;  5F07 A;  2GGT A;  4TR1 B;  1E2Y A;  5DJL A;  4XTS A;  1S3D A;  4CW9 A;  2GZZ A;  4N11 A;  1BAY A;  2VL9 A;  1M2D A;  4IHU A;  3WGE A;  1F3A A;  1U6T A;  3ZRD A;  2MMZ A;  2AB6 A;  3F6D A;  2H01 A;  1MDK A;  3PH9 A;  2GT5 A;  4IP1 A;  2J23 A;  1W89 A;  1WWJ A;  4GSN A;  1SD9 A;  3H93 A;  1VF3 A;  2FGX A;  3P8W A;  4F0C A;  5DAL A;  4GRF A;  3MIX A;  3QDN A;  3TKS E;  2R0G A;  3I6A A;  1GSQ A;  1GH2 A;  1B4P A;  2LST A;  2LQQ A;  3Q74 A;  1FHE A;  3KMN A;  3TKQ A;  4WR5 A;  1X5E A;  1WE0 A;  5IMC A;  4MA9 A;  1FVJ A;  1VF2 A;  3RPN A;  4GSS A;  4WXT A;  1ML6 A;  4EVM A;  2KHP A;  2C0E A;  2B1K A;  2VUP A;  5BRT A;  2VLU A;  3LFL A;  5KN3 A;  1XWK A;  1ZCP A;  3D6I A;  2OBK A;  2GQL A;  4KSM A;  3VWV A;  5CO3 A;  3UVT A;  3VPQ A;  3CXG A;  4XRD A;  1X5D A;  1QXH A;  1XBS A;  1XVW A;  1Q4J A;  5CAX A;  3EMX A;  4PX1 A;  2K6V A;  3EPT A;  4MP4 A;  1THO A;  1ON4 A;  4MJA A;  1GRX A;  1OC9 A;  1H75 A;  2IMF A;  4KCE A;  4ZB6 A;  1WRY A;  5ECL B;  2H1B A;  4GF0 A;  3GTU A;  3GFK A;  1X9S B;  3CRT A;  3U5R E;  5AN1 A;  5KOW A;  2M72 A;  1SL2 B;  4MDC A;  2HSM A;  1EOH A;  1ZYN A;  2PMT A;  2ALB A;  3TRQ A;  3UIW A;  3CSJ A;  2H30 A;  1U3I A;  2B5X A;  2NBS A;  1A23 A;  2PVQ A;  4HQS A;  1FB6 A;  5D93 A;  4IQA A;  3LXZ A;  4P3Y B;  4POL A;  3K8N A;  1PGT A;  4MK3 A;  1URM A;  4V1A g;  1YY7 A;  3VI7 A;  1ZYP A;  2H0H A;  1R4W A;  1USB A;  2P31 A;  4ZL9 A;  2H75 A;  1O8W A;  4HZ4 A;  4L5L A;  3SBC A;  4J2F A;  4RUV A;  1B9Y C;  3QPM A;  5IM9 A;  5G30 A;  4PUR A;  1BG5 A;  2GTU A;  1EP7 A;  1GSE A;  2ON7 A;  2VCT A;  1OC8 A;  2GQK A;  5ID2 B;  2A4V A;  3GNJ A;  2C1Y A;  1BYE A;  2FD3 A;  1Z6M A;  1XVQ A;  3F4T A;  1N8J A;  1TXX A;  4G19 A;  1LU4 A;  3VLN A;  2JAC A;  1J08 A;  3GSS A;  1XWC A;  2NTO A;  2WRT A;  2AV4 A;  4PGT A;  2HZF A;  1QFN A;  4GST A;  2H6Y A;  4USS A;  4D73 A;  4GQC A;  4PTS A;  3KGK A;  3GKK A;  1PL1 A;  4F9Z A;  2REM A;  2KP2 A;  1WIK A;  4YKG A;  2DKI A;  3KJY A;  2CVD A;  4TXV A;  4MPF A;  4HI7 A;  2DIY A;  1R5A A;  2B3S A;  4X0X A;  4EIP A;  1X0R A;  2H66 A;  5ECO B;  2VL3 A;  4L0U A;  4N10 A;  3J7Y b;  4I97 A;  3BBY A;  2H1A A;  3DWV A;  3KH9 A;  5IPG A;  5IOX A;  1SKW B;  1K3O A;  4EDZ A;  3TJJ A;  4BWQ A;  4OWY A;  2KUC A;  4K0N A;  3IRA A;  1V2A A;  3UVH A;  2IWT A;  4OO5 A;  4F82 A;  3QCP A;  3Q6O A;  1QQ2 A;  4IJ3 A;  1GLQ A;  1GTA A;  4QL7 A;  4CY8 A;  1AAZ A;  3IPZ A;  2PU9 C;  4IJI A;  3D5J A;  2V2G A;  2FA4 A;  4ZL8 A;  1SJZ A;  2PUK C;  1XOA A;  4DSS B;  2YWO A;  2L57 A;  2YN1 A;  1MD3 A;  5KN1 A;  1TJD A;  4K2X A;  3A2W A;  2LEG A;  4IKH A;  3H79 A;  3ED3 A;  4EIQ A;  4TKY A;  4BVX A;  2C3Q A;  4WBJ A;  3KXO A;  4I2U A;  4MZC A;  4MZB A;  3GST A;  1GTI A;  4G0K A;  2VL2 A;  5G5E A;  1I5G A;  1GL8 A;  1JHB A;  1K3Y A;  5H5R A;  1SJ6 A;  5ECK B;  4ACS A;  4LLR A;  3FR3 A;  5FT3 A;  3D4T A;  3ME8 A;  1F3B A;  4ZIL A;  3GHA A;  1GUM A;  4LMW A;  1OYJ A;  4DEJ A;  1R26 A;  4MF6 A;  1A24 A;  3H8Q A;  2PBJ A;  4KX4 A;  3APS A;  1SL0 B;  3FR9 A;  3FY7 A;  1AQV A;  2VLV A;  2CX3 A;  3BOA A;  4I8B A;  2XPD A;  1PMT A;  3CSH A;  4MAB A;  1OAZ A;  1KTE A;  3IOS A;  3FMW A;  2GZP A;  2R37 A;  5IMD A;  1A8Y A;  1R5P A;  5DCG A;  4K2D A;  4PNG A;  4HDE A;  4GLT A;  2UZ8 A;  3TJB A;  2F8F A;  1SK2 A;  3BD2 A;  4GTU A;  1PSQ A;  2CZ2 A;  4NXI A;  4ECB A;  4WBR D;  3GH6 A;  1K0B A;  4OFM A;  1PL2 A;  2QKE A;  3U6V A;  1X9W B;  2C3T A;  4ECI A;  3IC8 A;  3IK7 A;  5GZZ B;  2LNT A;  3N9J A;  1TK5 B;  1GUL A;  3R2Q A;  3FZ4 A;  2L4C A;  2IFQ B;  4TR0 A;  3TRX A;  5HR0 A;  5A5K A;  3VI5 A;  2ES7 A;  3D4M A;  2X4A A;  1MD4 A;  3UOM A;  4RQX A;  2FLS A;  4DSS A;  5D9V A;  4KDX A;  1U3A A;  20GS A;  2FY6 A;  2GLR A;  3LGC A;  4L8E A;  1SL1 B;  1XFL A;  1EEM A;  2GVP A;  2I1U A;  4Z2U A;  5GSS A;  3H1N A;  1Z9H A;  1DE1 A;  3UAP A;  3L9S A;  1JZR A;  2O87 A;  4XCS A;  5EY6 A;  4K7N A;  1IYI A;  1EOG A;  3ZLP A;  1OKD A;  2CAI A;  4MZW A;  1S3C A;  4CDO A;  5DDL A;  3NIV A;  2IL3 A;  2O85 A;  1OKT A;  4O92 A;  4PXO A;  5JWR B;  4JR4 A;  5ENU A;  3HD5 A;  4MF7 A;  3J7Y k;  3FHK A;  1SKR B;  4EC0 A;  1F6M C;  5H5Q A;  2V6K A;  2TRX A;  2RM5 A;  4TXO B;  2AYT A;  2YWM A;  3KM6 A;  1PRX A;  2DJK A;  5G31 A;  4BL7 B;  1AXD A;  4NV2 A;  4MH2 A;  3GKN A;  4HOJ A;  1ZYE A;  3VUR A;  2MBT A;  6GSS A;  1HD2 A;  2V6O A;  1K0C A;  3GRX A;  4MCU A;  1O8X A;  3F63 A;  4RI6 A;  1TRU A;  4IW9 A;  4QL9 A;  4OMV A;  3GMF A;  4KB3 A;  1GSS A;  1DBY A;  1K0D A;  2MYG A;  1CQH A;  1KNG A;  1EEJ A;  3PIN A;  4K5S A;  2DC5 A;  5F06 A;  1R7H A;  3IHQ A;  1A2L A;  1A2J A;  4NPB A;  5EL8 A;  2WGR A;  2YWN A;  2X99 A;  1TTZ A;  2L59 A;  3TCO A;  2X8H A;  2HRN A;  1SJI A;  1ERT A;  4Q5R A;  2X64 A;  2A2S A;  2MMO A;  4AJ7 A;  1KBN A;  4RI7 A;  2C8U A;  5HR1 A;  1GSU A;  1G6Y A;  9GSS A;  3IE3 A;  2XHF A;  4K7I A;  3LSZ A;  3AY8 A;  2KOK A;  3I9V 2;  2LJK A;  3VWX A;  3GL5 A;  1K3L A;  5CYY A;  2YCD A;  1AIU A;  11GS A;  2DBC A;  2VD0 A;  4POB A;  3KTB A;  2WJU A;  3IK9 A;  3MSZ A;  2OE3 A;  2VIM A;  2VL2 C;  4ISD A;  4J57 E;  5F0G A;  1M2A A;  1EV4 A;  1ZOF A;  2LUS A;  3HCZ A;  3P90 A;  2WUL A;  4JZQ A;  3W8S A;  1OE8 A;  1ERW A;  2CQ9 A;  2FUG 2;  2FWG A;  1SYX A;  4I5Q A;  2WDU A;  4IQ1 A;  4O5Q A;  3HYP A;  2BTO T;  4LMV A;  2E7P A;  3MDK A;  2EIR A;  1XIY A;  4RQR A;  5AGY A;  1FOV A;  4EUY A;  4I2T A;  1V58 A;  2I81 A;  3VWU A;  4OCF A;  2HLS A;  1B4Q A;  4AGS A;  4XS4 A;  1BX9 A;  4BA7 A;  1FVK A;  2KLX A;  4FYU A;  4PQI A;  2I4A A;  2HRA A;  4NMU A;  1Z5Y E;  4CY6 A;  3M8N A;  4YH2 A;  2GS3 A;  1V40 A;  4N0Z A;  4G0L A;  2GSQ A;  2AHE A;  2OE0 A;  4FO5 A;  1FW1 A;  2OAC A;  5IMF A;  4FQU A;  2YOI A;  2P5R A;  1TK0 B;  3Q19 A;  4KF9 A;  3A5I A;  1SK1 A;  3US3 A;  4OFT A;  12GS A;  5DAK A;  7GSS A;  2BJX A;  1Z7R A;  2H72 A;  5DQY A;  3RPP A;  2CZ3 A;  3UAR A;  1G6W A;  2VM1 A;  3TKS A;  2GSR A;  1F37 A;  1K0N A;  1Z3E A;  3F8U A;  5CRD A;  1JZW A;  2RLI A;  2VCQ A;  2JAD A;  3MAK A;  3ZVJ A;  1YEX A;  2H76 A;  2OKA A;  2EIO A;  1F9M A;  1RK4 A;  4POK A;  1JLV A;  5DBQ A;  3EIN A;  4JR6 A;  3G7Y A;  1QK8 A;  2R4V A;  4K9Z A;  4TR1 A;  5EPF A;  1ERU A;  4MMM A;  4O7H A;  2ZNM A;  1SKS B;  3GUS A;  5D9T A;  2K8S A;  4TN8 A;  1PA3 A;  4DSQ A;  3NOF A;  2O8V B;  2K18 A;  4MJB A;  4ZBD A;  3EMP A;  4NHW A;  1YKC A;  2H6Z A;  5E4W A;  4GWR A;  1GNE A;  5L71 A;  3DVX A;  2LRC A;  4X4J A;  3LYK A;  5J3R A;  2TIR A;  1NM3 A;  2VCX A;  3ZTL A;  4E8H A;  4O32 A;  3TRP A;  4L0W A;  1J9B A;  1O81 A;  3ERG A;  5E59 A;  2F9S A;  2X8G A;  2OA7 A;  2DJJ A;  4POM A;  5BMU A;  3MNG A;  3LWA A;  3N5O A;  3DD3 A;  3MYD A;  3HJP A;  4EXJ A;  3BJ5 A;  3HZ8 A;  5GAN D;  2QC7 A;  3E9J B;  1XCC A;  5B6M A;  3HVS A;  2PWJ A;  3TJK A;  3I43 A;  3L78 A;  5ECN B;  1GSY A;  3GYK A;  5COH A;  4WEY A;  3ZRE A;  2JSZ A;  2EIQ A;  2XBQ A;  3ERW A;  3EYT A;  5FHI A;  3TJF A;  2CT6 A;  4A5P A;  5J4U A;  1VGL A;  1K0O A;  2QA1 A;  1JZO A;  2AJQ B;  3FRC A;  4NWY A;  5DCH A;  1ERV A;  4ZXG A;  3F3R A;  1JZD A;  4EE0 A;  2PVO C;  10GS A;  4NHZ A;  2YP6 A;  5G1K A;  4KDU A;  5ECQ B;  2JL4 A;  3QAW A;  2YZH A;  2OBI A;  2I9H A;  2E0Q A;  1ABA A;  4ZBA A;  1TK8 B;  1SU9 A;  4V2N A;  1HNC A;  1F2E A;  5H5S A;  3QD9 A;  4KDY A;  2FNO A;  3TUE A;  2YPM A;  2Z9S A;  3DVW A;  1G7E A;  3ZVJ D;  3IV4 A;  4EF0 A;  4KUN A;  1VRS D;  4FYB A;  2YJH A;  3F6F A;  2HYX A;  3S9F A;  4HU9 A;  5D96 A;  5KN0 A;  1Z6N A;  1AUC A;  2MMN A;  5LD0 A;  3ISO A;  3ZMK A;  1B48 A;  1JFU A;  3IXR A;  3KTL A;  1M0U A;  5KEJ A;  2B6M A;  4IN0 A;  2IPA A;  1ST9 A;  4DVC A;  4X43 A;  2DJ2 A;  1A0R P;  3APO A;  4GQF A;  4TOP A;  5IIZ A;  5J5N A;  1X9M B;  3FK8 A;  1DUG A;  1Y25 A;  1W4V A;  1YJ6 A;  3GN3 A;  3FR6 A;  1YF1 A;  3GIX A;  2WFC A;  4FIW A;  2O7K A;  1YEP A;  4MLY A;  3GA4 A;  3GX0 A;  5KOX A;  2DML A;  4ZB8 A;  2NDO A;  1GLP A;  1GWC A;  2CA8 A;  2PPT A;  4XS6 A;  3UEM A;  3CRU A;  2H0G A;  2L5O A;  3DRN A;  3M9K A;  5ID2 A;  1TI1 A;  4BVY B;  4LL1 B;  3FZA A;  3RDW A;  4IGJ A;  3EVI A;  3EUR A;  3WD6 A;  2H70 A;  3E0U A;  3HVV A;  3GKX A;  2DJ3 A;  4IVF A;  4EKZ A;  2R0C A;  2HT9 A;  2GDR A;  1FO5 A;  3ZFB A;  1T8E B;  2JZR A;  1K0A A;  2IJY A;  2LNS A;  3HA9 A;  1GNW A;  3TKS C;  3IBH A;  1YDK A;  1VF4 A;  2HZE B;  1TKD B;  3KMO A;  1XW6 A;  1A2M A;  4V2M A;  1FB0 A;  4XHM A;  3KEB A;  1VF1 A;  6GSU A;  1SYR A;  3M1G A;  2B5E A;  3EC3 A;  3O6T A;  2M46 A;  4HUA A;  5A4U A;  1T4Y A;  5LCZ A;  3NZN A;  2IMI A;  4JE1 A;  4WR4 A;  1XWG A;  3WT2 A;  4K8M A;  3G9B A;  4KW6 A;  3C7M A;  2HXK A;  5HFG A;  5C00 A;  3CSI A;  1M2B A;  1ZZY A;  1E6B A;  2AAW A;  3TGZ A;  1NHY A;  3IC4 A;  2RII A;  1IYH A;  5ECH B;  2X49 A;  4JRR A;  4MH3 A;  3IA1 A;  4LA1 A;  4HJM A;  2C0G A;  4TVE A;  2OJL A;  3FZ9 A;  2IME A;  5JWO B;  5DQS A;  3ZZX A;  1T00 A;  4K5R A;  5AIS A;  2NPB A;  1XWA A;  1C72 A;  1RW1 A;  2JU5 A;  4YQM A;  1EV9 A;  2R6K A;  2L5L A;  3P2A A;  3M9J A;  1YKA A;  1PD2 1;  3O3T A;  3OR5 A;  5A4V A;  5DAL B;  4H86 A;  3EE2 A;  1EGR A;  3UJ1 A;  2C80 A;  4YQU A;  2QGV A;  2HE3 A;  5AIX A;  1GSF A;  1O73 A;  4ZIJ A;  2HI7 A;  4JED A;  4OFN A;  5AIV A;  3HDC A;  2H8L A;  4KCA A;  3FW2 A;  4PQH A;  4TR4 A;  2OE1 A;  2C0F A;  1PN0 A;  1B9X C;  5DJM A;  5D73 A;  3E3E A;  2VCZ A;  5B6N A;  1N2A A;  3C8E A;  1O7U A;  3ZIV A;  8GSS A;  4Z7X A;  3D22 A;  5IO2 A;  3RHB A;  3QFB C;  3QFA C;  5HR3 A;  3IR4 A;  4KSO A;  1T7P B;  2R0P A;  3QR6 A;  1TW9 A;  4EO3 A;  1O85 A;  2VLT A;  1PKZ A;  2DKH A;  2C0D A;  3VPT A;  4EL1 A;  1FOH A;  2H73 A;  2IFQ A;  1T3B A;  4BWS A;  3L9V A;  1K0M A;  3LW9 A;  16GS A;  2CX4 A;  3GTU B;  1A0F A;  5IMZ A;  5B8B A;  2B7J A;  1WP0 A;  3ERF A;  3TKP A;  1QMV A;  2N5F A;  3C1R A;  1QGV A;  2H1G A;  5EVO A;  1V98 A;  3UMA A;  2LJR A;  2L4Q A;  2V32 A;  2R2J A;  3L9U A;  2P0G A;  3MWH A;  3FYG A;  1TP9 A;  1XW5 A;  3H4K A;  5IMA A;  2H0I A;  1TU8 A;  5ELA A;  5CRG A;  1XPV A;  2YWI A;  4KE3 A;  4KH7 A;  2LJA A;  2YAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...