2JSYA

Solution structure of tpx in the oxidized state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
b'MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVCDAQTRRFNEEAAKLGDVNVYTISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIEAAKALVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thiol peroxidase
publication title Reversible conformational switch revealed by the redox structures of Bacillus subtilis thiol peroxidase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jsyA00
2H19A 2H6ZA 3FY7A 1X9WB 5G5EA 5H5SA 2K8VA 2I4AA 2AYTA 2C3TA 2VLUA 5A4WA 1NM3A 2AV4A 1N2AA 5DALA 5IMFA 5JWRB 4OCFA 1OC8A 4I6XA 4IKHA 1EEMA 2B3SA 2JACA 4TR1B 1T00A 2K18A 3IXRA 1PX7A 4MJEA 1V9WA 3TB2A 3C8EA 3IA1A 2WFCA 3DYRA 3Q19A 3VPQA 5J3RA 3BBYA 1KNGA 4LMWA 2V6OA 3ZIJA 1W4VA 4I5QA 3EYTA 3WGXA 4Z7XA 3IRAA 3C7MA 3PH9A 5KN2A 2CAQA 4X1UA 4JE1A 4XS4B 2IFQA 3C1RA 2VL2C 3KJYA 13GSA 4DVCA 5CO3A 1S3DA 1M0UA 1GNWA 4F0BA 1VF1A 2LKUA 1O6JA 4IELA 2C0FA 4MLYA 2VCTA 1O85A 4MF7A 2FWEA 1YKAA 5JCWA 3FZAA 4AJ8A 2C8UA 5B8AA 1EEJA 3CRUA 3GURA 2QSIA 2YWIA 3C73A 2OKAA 2YANA 5G1KA 3CSIA 3MAKA 1MTCA 3CTFA 4ZILA 3KTLA 3ZFLA 3ZVJA 5KN3A 2B5EA 3C1SA 5CRGA 2PMTA 2DLXA 1T8EB 3EC3A 3D4TA 2VD0A 3WYWA 2B7KA 4K0NA 2XHFA 4MA9A 1NSWA 2LQOA 5IO2A 2O7KA 1GP1A 1OKDA 4BPYA 1HD2A 3F9UA 1SL0B 1O8WA 2JSZA 2HZEB 4ZBDA 2QC7A 3GIXA 2C1YA 4N30A 1TXXA 3LEFA 4YH2A 3S9FA 5B6NA 4JBBA 3FK8A 3M0FA 5D93A 3IE3A 4ML1A 4ZL9A 4HZ4A 4LLRA 1XW9A 4GWRA 2HSHA 5IQYA 5LNKe 4HJ2A 2WZ9A 4MH3A 1F3AA 5ECOB 14GSA 5ID2A 1ERVA 1ERTA 4PQIA 1OE7A 3KP8A 1KTEA 2OE1A 1PD21 2GT6A 3EU4A 2J9HA 4EDYA 2I1UA 5DALB 2V41A 4IBPA 4D73A 1K3YA 3FW2A 1GWCA 3G7JA 1SK1A 3QD9A 1F2EA 3GKXA 3HJOA 2YPMA 1EV4A 4HS1A 1Z9HA 5ELAA 3ERGA 3WD6A 3GKNA 4KH7A 4QL7A 1JHBA 3UBKA 1ZL9A 5AN1A 1SKWB 1OYJA 3IPZA 4DSSA 4KA0A 2ON7A 2QGVA 1TOFA 1GRXA 4TXOA 1R5PA 1FO5A 1ACVA 1DE1A 3C71A 2FGXA 5FWGA 3TKRA 4EKZA 2N5AA 1TKDB 4K0GA 1BG5A 1YF1A 1JLWA 3G7YA 1T4ZA 3KH9A 2DJJA 4BVYA 1PRXA 3LG6A 1K0MA 3FRCA 3E9JB 4RI6A 3QAWA 2PVQA 2H1BA 4AJ7A 2C80A 5CP1A 2PWJA 2VCQA 3HZ4A 5LD0A 3TKQA 1V57A 4WR5A 2B7JA 3GTUA 4V2MA 2JZRA 3L4NA 4MK3A 2HLSA 2NDOA 3EMPA 3FZ9A 4GSTA 2JL4A 1GSQA 3BCIA 3IV4A 1WE0A 4L0WA 3APQA 3UJ1A 1ZZYA 1U6TA 4AJ6A 2DSAA 3ZIVA 1PSQA 2VO4A 3ED3A 3LXTA 4ZB9A 2N5FA 5ABRA 4TR4A 2PN8A 1RW1A 3ZMLA 4OFMA 4NHWA 4KAEA 3RPNA 3VI7A 5JWQB 2D2ZA 2ES7A 1BAYA 3DVXA 4KW6A 2CZ3A 1GTBA 5AIVA 4O7HA 2HZFA 5J5NA 3HY2A 3MNGA 3APOA 5HFKA 1FW1A 3ERWA 4EC0A 2L6DA 2VOCA 2P5RA 5ECHB 3E0UA 1QXHA 3GX8A 1GSYA 4MCUA 1GSDA 1WOUA 4HU7A 2LJAA 2H71A 3P7XA 2I3YA 1WIKA 4CW9A 1ZMAA 1XWBA 4K9ZA 3OR5A 4ZBAA 5LCZA 3P90A 4MJAA 1OKTA 4HUAA 2B1KA 2O8VB 1V58A 1M2BA 2EIQA 2RM5A 5CYYA 5A5KA 4POBA 3D6IA 1QFNA 2H73A 3TGZA 5D9XA 3MWHA 3KXOA 4DSSB 2PVOC 1WPIA 1X0RA 2OACA 4MMMA 1HQOA 1Z7RA 3VWXA 4ZB8A 3LORA 5DDLA 1SD8A 1AQXA 1XIYA 3KMNA 3VWWA 3DGQA 1G7OA 3M8NA 3DMLA 3FYGA 12GSA 1F3BA 3TKPA 2WB9A 1NW2A 2OBKA 1R5AA 5HR1A 1B9YC 3CMIA 2FNOA 1TU7A 3HJPA 2TRCP 1AXDA 4OMVA 1HNAA 2WDUA 1XVQA 2LTKA 4WBRD 3HD5A 1EGOA 4RQXA 2ZCTA 3EURA 4EDZA 2ALBA 3CXGA 2F9SA 1TTZA 2XPEA 4EE0A 2GDRA 1HNCA 5EVOA 3HVXA 2PBJA 4YQVA 1ON4A 4IN0A 1TRVA 3UEMA 1XWKA 2FWGA 3I6AA 3TRQA 1AAZA 1DUGA 1DSBA 1WMJA 2DMLA 4WXTA 3DD3A 3MDKA 2K9FA 3O6TA 1JZRA 3ZRDA 2HRNA 2MMNA 2REMA 1FAAA 1T4YA 2DC5A 5F8BA 1U87A 1JFUA 2QKEA 3KZQA 2H0GA 5HR3A 1FB0A 1ILOA 3FZ5A 1K3LA 5HFGA 4TKYA 1XWAA 3GYKA 2WGRA 4IHUA 19GSA 1EP8A 1QK8A 2YN1A 1GTAA 2YV7A 2WS2A 1Z5YE 1SD9A 2FWFA 2YWNA 3F4TA 2B5YA 1MEKA 2CX3A 3GUSA 3GMFA 3ME8A 1AC1A 4X43A 2DJKA 6GSUA 2HYXA 2B6MA 1F9MA 3L78A 2HFDA 4JEDA 3UAPA 3HHVA 2MYGA 2WCIA 3GL3A 2VAFA 4TOPA 2G0FA 2MMOA 3Q6OA 3F3RA 5B6MA 1YDKA 4ECCA 1RQMA 2V2GA 4FYBA 2F51A 1GNEA 5DCHA 1U3IA 3UOMA 3HCZA 3D5JA 5L71A 1FVKA 3GH9A 1BJXA 2GZPA 1LJRA 5DQYA 1XWCA 1C72A 2H0HA 1MDJA 3UMAA 2EC4A 2WRTA 1X9MB 5H5QA 1QGVA 3FEUA 4BA7A 5GAPD 1G7EA 4QQ7A 8GSSA 2OE3A 3WT1A 2GT5A 1Z3EA 2CV4A 1GUHA 4FYUA 18GSA 1GTIA 3KIJA 2GSRA 5G2ZA 4PURA 1PA3A 2GSSA 4YAVA 5GZZB 1Z7PA 4ZB6A 3ZFBA 1B9XC 3L0HA 1IYHA 4KGIA 4IW9A 2J23A 6GSYA 3F4SA 4ZL7A 2KOKA 5IMCA 4Q5NA 1N8JA 4OO5A 3QDNA 1U88A 2PPTA 1J08A 4IP1A 3RHCA 3BOAA 1MD3A 2X99A 3BD2A 4I8BA 5CRWA 4XHMA 5CREA 3GKKA 4AGSA 4ACSA 4I2TA 1ZGNA 2JSYA 5AIXA 3CSHA 3APSA 2YZHA 5CNWA 1WWJA 1TRWA 2DJ2A 1A23A 2O87A 3IC4A 2FY6A 3HJMA 2GLRA 3MSZA 1X5CA 4YQMA 4LL4B 1QQ2A 3IOSA 3GRXA 3GSSA 1XXUA 1KBNA 5IO0A 3D21A 1FHEA 5DVBA 2CA8A 4V1Ag 1DBYA 17GSA 2H6XA 1R26A 3UIWA 2VCZA 1T3BA 4GXZA 1K0BA 1VF2A 1EGRA 16GSA 3QCPA 3R2QA 4JRRA 4JU5A 3QFAC 2MMZA 4NHZA 3QAVA 4OD7A 3GHAA 3LYKA 4RQRA 5D73A 5EL8A 1QUWA 1Z6MA 1SK0A 3QFBC 4MDCA 1TDIA 3VWVA 4ECIA 5ECQB 5J4UA 3D0ZA 3L9UA 4G19A 3CBUA 3KP9A 1PL1A 4ISDA 4GRFA 4EO3A 4GCIA 2G2QA 3KH7A 5G5FA 4L5OA 3KGKA 2IMDA 4WR4A 4EL1A 1X5EA 2HXKA 3GA4A 3WGDA 5INYA 1M9AA 3F8UA 1M2AA 1ST9A 4K6XA 3DWVA 3GL5A 3TJFA 2LV3A 1V98A 2CX4A 22GSA 2F8AA 5IIZA 1YJ6A 2LJKA 2P5QA 3RHBA 3TJJA 1M7TA 3A2VA 1SU9A 3IK9A 1EOGA 2CVBA 5FT3A 4OFNA 4PQ1A 1AIUA 1M9BA 2IFQB 4XTSA 3HDCA 1SJZA 2GGTA 3N9JA 2WJUA 2R3XA 2VCVA 3EMXA 5AISA 1VRSD 4PNFA 4KUNA 3AY8A 3A2XA 3IK7A 3ME7A 4ZL8A 2K8SA 1PGTA 4XRDA 1FB6A 4O92A 2LSTA 4JZQA 1UVZA 3TUEA 1TK5B 5F07A 3FKFA 4DSQA 3H8QA 4NWYA 1V40A 4H86A 4IJ3A 2MBSA 1VF4A 2DIZA 5ECLB 3F0IA 1K0OA 2IWTA 5D9VA 5D9TA 2MMAA 3PGTA 2PERA 2VLTA 5CRHA 2BMXA 5IPHA 1ZOFA 2H1AA 3SWLA 2DIYA 4WBJA 4POLA 3NZNA 4KDUA 2C0EA 4YAPA 2VCWA 4BWSA 1SYRA 5ECPB 4XCSA 2VM2A 2VL3A 2DMMA 3EVIA 1K0AA 2H75A 4KDYA 3TOTA 3FZ4A 5A4UA 3ZL5A 3ZVJD 1J0FA 2OADA 2FUG2 1YF0A 5ECRB 2VIMA 3D22A 1PQNA 1SJIA 2CZ2A 3HA9A 2AB6A 2GQKA 3F4RA 1XOAA 1O73A 6GSSA 3LGCA 1MD4A 4MZWA 1V2AA 1YQ1A 2H1DA 1XW6A 2LEGA 5ID2B 1WJKA 4V2LA 3TDGA 2IPAA 2AUVA 3GNJA 4K7IA 3RPPA 4EF0A 4JR6A 2OJLA 1B4PA 2ON5A 4E8EA 2PUKC 5DJMA 4D73B 3ZLPA 3HKRA 4ZXGA 4FH8A 2H66A 4ZBBA 1XW5A 5ECKB 4KDXA 1QMVA 4CHSA 2H76A 20GSA 1S3AA 4NMUA 2E2GA 4KNDA 4KSOA 6GSVA 1MDKA 2YCDA 4ILFA 4TXOB 1Y25A 2KLXA 5DJLA 1FOVA 4G9HA 2FD3A 5IM9A 3UARA 2IMEA 1AQWA 3I9V2 2YWMA 2GQLA 1XOBA 4TR1A 1TU8A 1A0RP 2RIIA 3W6GA 1GSUA 2X8HA 5IPGA 3CYNA 2P0GA 1GTUA 4IVFA 2IJYA 4Q5QA 4QL9A 5ECSA 3ZITA 3P8WA 2NTOA 1SL1B 1X5DA 4K7NA 1VGLA 3A2WA 4N11A 1TI3A 3TRPA 4IQAA 1S3CA 4HDEA 2FWHA 2V1MA 4XS4A 3GTUB 1JZOA 3UBLA 4ULXA 2NBSA 2H30A 2L5LA 4MP4A 1BEDA 2L6CA 3ERFA 2OBIA 1AW9A 3GKMA 4PXOA 1MDIA 4HU9A 1GSEA 3UVHA 1K0NA 2HSYA 4ID0A 2FCHA 3ZREA 3HVVA 5DCGA 6GSWA 5ENUA 1XZOA 1UA5A 4KSMA 4ML6A 5GSSA 2HNLA 2VD1A 3SBCA 5GAND 1BX9A 2X8CA 5ECIB 4K8MA 2BTOT 1A24A 4XS6A 4FO5A 1EV9A 1Q4JA 4RUVA 2FLSA 2X8GA 5IOXA 1PL2A 1TK0B 3V1WA 2KP2A 3IHQA 2C3QA 5KN1A 2YV9A 3CRTA 3EINA 2HE3A 3G7IA 1GLQA 1B48A 4LA1A 5AGYA 1NHYA 2YNXA 5J41A 1CQGA 1E6BA 5COHA 3UVTA 3O3TA 2DJ0A 3M9JA 2R2JA 3TOUA 2HZEA 1BQ7A 4HJMA 3EWLA 4N10A 3F6FA 1HYUA 2YWOA 3TJKA 2KP1A 3TKSC 6GSTA 5HR2A 1Q98A 2E7PA 4KX4A 1USBA 1W89A 2R6KA 1UN2A 4RI7A 2MBTA 9GSSA 2M46A 4NV5A 2H0IA 4WF5A 1EP7A 3GFKA 4KCEA 4L0UA 5HR0A 5EPFA 1SJ6A 2JADA 5IMDA 5D9WA 2LRNA 3PINA 3HYPA 2L4QA 3LWAA 2HT9A 3Q18A 4ECBA 3ISOA 3KTBA 3QOUA 4NV2A 1GULA 4CDOA 5FHIA 5EY6A 2VM1A 4PX1A 3DXBA 4N0ZA 4XS1A 3F3QA 3TKSA 4TR3A 1G0TA 4LMVA 3VI5A 2CVKA 1G6WA 2IL3A 1O7UA 1A2MA 5ECMB 2YOIA 1K3OA 3US3A 1F6MC 1SYXA 3A5WA 1TK8B 2XC2A 3DKSA 5D8IA 2BJXA 2EIRA 3J7Yk 4WKWA 2CT6A 4TXVA 4HOJA 2H6YA 2VUPA 2H8LA 1BYEA 4MABA 4V1Ap 4X0XA 3LJRA 2R5GA 1GSFA 5IMAA 4GLTA 3VK9A 3IR4A 5F06A 2OE0A 4PQHA 1ABAA 2WULA 2PU9C 3LFLA 4Q5FA 4IQ1A 1GL8A 1B4QA 2I9HA 4IGJA 2H74A 3FHKA 4MZBA 4HEA2 1NHOA 2IMIA 2VLVA 4J57E 2LNSA 1H75A 2MZCA 4LL1B 4HI7A 3FR6A 4F0CA 2VL2A 1SL2B 4EVMA 4MPFA 3I43A 3VWUA 1U3AA 3KD0A 4L8EA 3HXSA 1I9DA 4GTUA 2R37A 1OC9A 3FR9A 1SENA 1ZCPA 3RDWA 3ZYWA 4BVXA 3FR3A 7GSSA 1AUCA 4OCEA 3IAM2 4DSRA 2YP6A 1AQVA 3LXZA 3F63A 2GQMA 1HNBA 2GSTA 4O32A 1ZYQB 4POMA 11GSA 1LU4A 2CAIA 2PGTA 4PUAA 2H01A 1TI1A 4ZIJA 4WETA 1EOHA 1ZYEA 5IMVA 2ZNMA 1PX6A 4AF2A 1A2LA 1GH2A 3P2AA 1PKZA 1OE8A 1PMTA 2XBIA 4V2NA 2O85A 2JZTA 2A2RA 1THOA 3H93A 4MF5A 2CQ9A 5CAXA 1PN9A 4K1FA 1URMA 5ELGA 3TKSE 1YEPA 3BJ5A 5HQPA 2YJ7A 5C04A 1TRSA 4WEYA 2AAWA 5JCUA 4TVEA 4TN8A 1O81A 2K6VA 5ECNB 1A0FA 1YY7A 3ZZXA 3CTGA 3JCML 2VL9A 1XWGA 5E4WA 5JCGA 1SKRB 3EE2A 3U6VA 2IMFA 1JZDA 3DIEA 4JR4A 2LJRA 2LRTA 2F3MA 1TJDA 4OFTA 3DRNA 1UC7A 3VFIA 4WF4A 3GN3A 2LQQA 3WT2A 1GSSA 5KN0A 1XPVA 2RM6A 2IIYA 1OAZA 2NPBA 1IYIA 4FIWA 4F82A 3M3MA 2N5BA 5G31A 4BL7A 3M1GA 2M72A 1K0CA 1B8XA 3VLNA 3GV1A 4TR0A 2EIOA 4KB3A 2GZZA 4GQFA 2A2SA 3L9SA 4GQCA 5D96A 3Q74A 4EUYA 1TW9A 5H5RA 5DBQA 2M80A 2H72A 5IOWA 1ML6A 2GTUA 1JZWA 1VF3A 3IBHA 2IMKA 3QMXA 3H1NA 3CSJA 1XBSA 1JLVA 3QPMA 2JZSA 1K0DA 3GSTA 3W8SA 2Z9SA 2IN3A 3DEXA 1Z6NA 1E2YA 2KHPA 1XFLA 2L5OA 4TRXA 3LQ7A 1OC9B 1F37A 2NVLA 2X64A 1LBKA 3QAGA 2YZUA 5DAKA 4OWYA 2YJHA 4HZ2A 4HQSA 6GSXA 2FHEA 1OC3A 5GSTA 3D4MA 2F8FA 3U5RE 3J7Yb 4PUFC 2V6KA 1T7PB 1GUMA 4POKA 3TCOA 2ZUPA 3LSZA 3IDVA 2AHEA 2H1GA 5CRDA 1WRYA 2A4VA 2FA8A 4EXJA 4G2EA 2C4JA 2CVDA 1A8LA 4PNGA 2HRFA 3KM6A 4GSNA 3E3EA 4K2DA 2R4VA 4IJIA 4MJCA 1YEXA 3IAS2 1A8YA 1T1VA 4DEJA 4G10A 4Q5RA 1O8XA 2AJQB 3NOFA 3GX0A 1CQHA 4KCAA 3PR8A 4I2UA 5B8BA 4F9ZA 4E8HA 4NXIA 3H4KA 5IMZA 1R7HA 2XPDA 1OVNA 3O76A 1Y6EA 2RUFA 3RBTA 4IP6A 5A4VA 3W8JA 1EWXA 1GUKA 2O89A 2TIRA 1ERWA 2GZYA 3GH6A 2VCXA 3L9VA 2C0GA 3I69A 2V32A 5J9BA 2L59A 1I5GA 1GLPA 4XRAA 3QR6A 4MPGA 1XCCA 3LYPA 3M9KA 5DQSA 2DJ3A 5HFIA 4TW5A 3N5OA 4PGTA 4MF6A 2DBCA 4FYCA 3VURA 5F0GA 3KEBA 2RUEA 1TRUA 2LRCA 2LUSA 4J56E 1SK2A 4NPBA 1THXA 2JU5A 3KCMA 3F6DA 1M2DA 5KEJA 3BCKA 3H79A 3EU3A 1J9BA 3ZTLA 5G30A 4F2IA 4XIHA 3K8NA 1FG4A 1X9SB 2RLIA 2E0QA 2E2MA 3WGEA 4I97A 3UL3A 3TJBA 1PKWA 2C3NA 1M99A 5F05A 5JWOB 2H70A 4O5RA 2P31A 4L5LA 1YZXA 5G1LA 2B1LA 2GVPA 4MJBA 3HVSA 4J2FA 3HZ8A 3RAZA 3TRXA 2TRXA 2I81A 1A2JA 2GS3A 3ZMKA 1RK4A 1ERUA 5DAKB 3G9BA 1WP0A 2LS5A 2OA7A 1DE2A 2XBQA 2DJ1A 1SKSB 1XVWA 4YQUA 4NAXA 2LNTA 5C00A 1KEBA 2FA4A 2L57A 2KUCA 2HI7A 1R4WA 4OO4A 4BWQA 2L4CA 1FVJA 3DVWA 4KE3A 4F03A 4GF0A 4MZCA 2B5XA 2C0DA 4HQZA 5B7CA 4N0VA 4MH2A 3TJGA 3VPTA 1YKCA 4K7OA 4ECJA 5J9CA 5E59A 4P3YB 2GSQA 1G6YA 1EZKA 1TP9A 3A3TA 1H4OA 3KMOA 10GSA 4GSSA 4IS0A 3NIVA
chains in the Genus database with same CATH superfamily
2H19A 2H6ZA 3FY7A 1X9WB 5G5EA 5H5SA 2K8VA 2I4AA 2AYTA 2C3TA 2VLUA 5A4WA 1NM3A 2AV4A 1N2AA 5DALA 5IMFA 5JWRB 4OCFA 1OC8A 4I6XA 1FOHA 4IKHA 1EEMA 2B3SA 2JACA 4TR1B 1T00A 2K18A 3IXRA 1PX7A 4MJEA 1V9WA 3TB2A 3C8EA 3IA1A 2WFCA 3DYRA 3Q19A 3VPQA 5J3RA 3BBYA 1KNGA 4LMWA 2V6OA 3ZIJA 1W4VA 4I5QA 3EYTA 3WGXA 4X4JA 4Z7XA 3IRAA 3C7MA 1PFOA 3PH9A 5KN2A 2CAQA 4X1UA 4JE1A 4XS4B 2IFQA 3C1RA 2VL2C 3KJYA 13GSA 4DVCA 5CO3A 1S3DA 1M0UA 1GNWA 2A2PA 3CQFA 4F0BA 1VF1A 2LKUA 1O6JA 4IELA 2C0FA 4MLYA 2VCTA 1O85A 4MF7A 2FWEA 4G0LA 1YKAA 5JCWA 3FZAA 4YKGA 4AJ8A 2C8UA 5B8AA 1EEJA 3CRUA 3GURA 2QSIA 2YWIA 3C73A 2OKAA 2YANA 5G1KA 3CSIA 3MAKA 4BIKA 1MTCA 3CTFA 4ZILA 3KTLA 3ZFLA 3ZVJA 5KN3A 2B5EA 3C1SA 5CRGA 2PMTA 2DLXA 1T8EB 3EC3A 3D4TA 2VD0A 3WYWA 2B7KA 4K0NA 2XHFA 4MA9A 1NSWA 2LQOA 5IO2A 3IC8A 2O7KA 1GP1A 1OKDA 4BPYA 1HD2A 3F9UA 1SL0B 1O8WA 2JSZA 2HZEB 4ZBDA 2QC7A 3GIXA 2C1YA 4N30A 1TXXA 1PN0A 3LEFA 4YH2A 3S9FA 5B6NA 4JBBA 3FK8A 3M0FA 5D93A 3IE3A 4ML1A 4ZL9A 4HZ4A 4LLRA 1XW9A 4GWRA 2HSHA 5IQYA 5LNKe 4HJ2A 2WZ9A 4MH3A 1F3AA 5ECOB 14GSA 5ID2A 1ERVA 1ERTA 4PQIA 1OE7A 3PPUA 3KP8A 1KTEA 2OE1A 1PD21 4Z2UA 2GT6A 3EU4A 2J9HA 4EDYA 2I1UA 5DALB 3A5IA 2V41A 4IBPA 4D73A 1K3YA 3FW2A 1GWCA 3G7JA 1SK1A 3QD9A 1F2EA 3GKXA 3HJOA 2YPMA 1EV4A 4HS1A 1Z9HA 5ELAA 3ERGA 3WD6A 3GKNA 4KH7A 4QL7A 1JHBA 3UBKA 1ZL9A 5AN1A 1SKWB 1OYJA 3IPZA 4DSSA 4KA0A 2ON7A 2QGVA 1TOFA 1GRXA 4TXOA 1R5PA 1FO5A 1ACVA 1DE1A 3C71A 2FGXA 5FWGA 3TKRA 4EKZA 2N5AA 1TKDB 4K0GA 1BG5A 1YF1A 1JLWA 3G7YA 1T4ZA 3KH9A 2DJJA 4O5QA 4BVYA 1PRXA 3LG6A 1K0MA 3FRCA 3E9JB 4RI6A 3QAWA 2PVQA 2H1BA 4AJ7A 2C80A 5CP1A 2PWJA 2VCQA 3HZ4A 5LD0A 3TKQA 1V57A 4WR5A 2B7JA 3GTUA 4V2MA 2JZRA 3L4NA 4MK3A 2HLSA 2NDOA 3EMPA 3FZ9A 4GSTA 2JL4A 1GSQA 3BCIA 3IV4A 2X49A 1WE0A 4L0WA 3APQA 3UJ1A 1ZZYA 1U6TA 4AJ6A 2DSAA 3ZIVA 1PSQA 2VO4A 3ED3A 3LXTA 4ZB9A 2N5FA 2UZ8A 5ABRA 4TR4A 2PN8A 1RW1A 3ZMLA 4OFMA 4NHWA 4KAEA 3RPNA 3VI7A 5JWQB 2D2ZA 2ES7A 1BAYA 3DVXA 4KW6A 2CZ3A 1GTBA 5AIVA 4O7HA 2HZFA 5J5NA 3HY2A 3MNGA 3APOA 5HFKA 1FW1A 3ERWA 4EC0A 2L6DA 2VOCA 2P5RA 5ECHB 3E0UA 1QXHA 3GX8A 1GSYA 4MCUA 1GSDA 1WOUA 4HU7A 4G0KA 2LJAA 2H71A 3P7XA 2I3YA 1WIKA 4CW9A 1ZMAA 1XWBA 4K9ZA 3OR5A 4ZBAA 5LCZA 3P90A 4MJAA 1OKTA 4HUAA 2B1KA 2O8VB 1V58A 1M2BA 2EIQA 2RM5A 5CYYA 5A5KA 4POBA 3D6IA 1QFNA 2H73A 3TGZA 5D9XA 3MWHA 3KXOA 4DSSB 4MNNA 2PVOC 1WPIA 1X0RA 2OACA 4MMMA 1HQOA 1Z7RA 3VWXA 4ZB8A 3LORA 5DDLA 1SD8A 1AQXA 1XIYA 1M3JA 3KMNA 3VWWA 3DGQA 1G7OA 3M8NA 3DMLA 3FYGA 12GSA 1F3BA 3TKPA 2WB9A 1NW2A 4BVYB 2OBKA 1R5AA 5HR1A 1B9YC 3CMIA 2FNOA 4BL7B 1TU7A 3HJPA 2TRCP 1AXDA 4OMVA 1HNAA 2WDUA 1XVQA 2LTKA 4WBRD 3HD5A 1EGOA 4RQXA 2ZCTA 3EURA 4EDZA 2ALBA 2R0GA 3CXGA 2F9SA 1TTZA 2XPEA 4EE0A 2GDRA 1HNCA 5EVOA 3HVXA 2PBJA 4YQVA 1ON4A 4IN0A 1TRVA 3UEMA 1XWKA 2FWGA 3I6AA 4HSCX 3TRQA 1AAZA 1DUGA 1DSBA 1WMJA 2DMLA 4WXTA 3DD3A 3MDKA 2K9FA 3O6TA 1JZRA 3ZRDA 2HRNA 2MMNA 2REMA 1FAAA 4KF9A 1T4YA 2DC5A 5F8BA 1U87A 1JFUA 2QKEA 3KZQA 2H0GA 5HR3A 1FB0A 1ILOA 3FZ5A 4K2XA 1K3LA 5HFGA 4TKYA 1XWAA 3GYKA 2WGRA 4IHUA 19GSA 1EP8A 1QK8A 2YN1A 1GTAA 2YV7A 2WS2A 1Z5YE 1SD9A 2FWFA 2YWNA 3F4TA 1ZYPA 2B5YA 1MEKA 2CX3A 3GUSA 3GMFA 3ME8A 1AC1A 4X43A 2DJKA 6GSUA 2HYXA 2B6MA 1F9MA 3L78A 2HFDA 4JEDA 3UAPA 3HHVA 2MYGA 2WCIA 3GL3A 2VAFA 4TOPA 2G0FA 2MMOA 3Q6OA 3F3RA 5B6MA 1YDKA 4ECCA 1RQMA 2V2GA 4FYBA 2F51A 1GNEA 5KOWA 5DCHA 1U3IA 3UOMA 3HCZA 3D5JA 5L71A 1FVKA 3GH9A 1BJXA 2GZPA 1LJRA 5DQYA 1XWCA 1C72A 2H0HA 1MDJA 3UMAA 2EC4A 2WRTA 1X9MB 5H5QA 1QGVA 3FEUA 4BA7A 5GAPD 1G7EA 4QQ7A 8GSSA 2OE3A 3WT1A 2GT5A 1Z3EA 2CV4A 1GUHA 4FYUA 18GSA 1GTIA 3KIJA 2GSRA 5G2ZA 4PURA 1PA3A 2GSSA 4YAVA 5GZZB 1Z7PA 4ZB6A 3ZFBA 1B9XC 3L0HA 1IYHA 4KGIA 4IW9A 2J23A 6GSYA 3F4SA 4ZL7A 2KOKA 5IMCA 4USSA 4Q5NA 1N8JA 4OO5A 3QDNA 1U88A 2PPTA 1J08A 4IP1A 3RHCA 3BOAA 1MD3A 2X99A 3BD2A 4I8BA 5CRWA 4XHMA 5CREA 3GKKA 4AGSA 4ACSA 4I2TA 1ZGNA 2JSYA 5AIXA 3CSHA 3APSA 2YZHA 2DKIA 5CNWA 1WWJA 1TRWA 2DJ2A 1A23A 2O87A 3IC4A 2FY6A 3HJMA 2GLRA 4CY6A 3MSZA 1X5CA 4YQMA 4LL4B 1QQ2A 3IOSA 3GRXA 3GSSA 1XXUA 1KBNA 5IO0A 3D21A 1FHEA 5DVBA 2CA8A 4V1Ag 1DBYA 17GSA 2H6XA 1R26A 3UIWA 2VCZA 1T3BA 4GXZA 1K0BA 1VF2A 1EGRA 16GSA 3QCPA 3R2QA 4JRRA 4JU5A 3QFAC 2MMZA 4NHZA 3QAVA 4OD7A 3GHAA 3LYKA 4RQRA 5D73A 5EL8A 1QUWA 1Z6MA 1SK0A 3QFBC 4MDCA 1TDIA 3VWVA 4ECIA 5ECQB 5J4UA 3D0ZA 3L9UA 4G19A 3CBUA 3KP9A 1PL1A 4ISDA 4GRFA 4EO3A 4GCIA 2G2QA 3KH7A 5G5FA 4L5OA 4CY8A 2A4HA 3KGKA 2IMDA 4WR4A 4EL1A 1X5EA 2HXKA 3GA4A 3WGDA 5INYA 1M9AA 3F8UA 1M2AA 1ST9A 4K6XA 3DWVA 4EIPA 3GL5A 3TJFA 2LV3A 1V98A 2CX4A 22GSA 2F8AA 5IIZA 1YJ6A 2LJKA 2P5QA 3RHBA 3TJJA 1M7TA 3A2VA 1SU9A 3IK9A 1EOGA 2CVBA 5FT3A 4OFNA 4PQ1A 4ICYA 1AIUA 1M9BA 2IFQB 4XTSA 3HDCA 1SJZA 2GGTA 3N9JA 2WJUA 2R3XA 2VCVA 3EMXA 5AISA 1VRSD 4PNFA 4KUNA 3AY8A 3A2XA 3IK7A 3ME7A 4ZL8A 2K8SA 1PGTA 4XRDA 1FB6A 3MIXA 4O92A 4Z2TA 2LSTA 4JZQA 1UVZA 3TUEA 1TK5B 5F07A 3FKFA 4DSQA 3H8QA 4NWYA 1V40A 4H86A 4IJ3A 2MBSA 1VF4A 2DIZA 5ECLB 3F0IA 1K0OA 2IWTA 5D9VA 3LW9A 5D9TA 2MMAA 3PGTA 2PERA 2VLTA 5CRHA 2BMXA 5IPHA 1ZOFA 2H1AA 3SWLA 2DIYA 4WBJA 4POLA 3NZNA 4KDUA 2C0EA 4YAPA 2VCWA 4BWSA 1SYRA 5ECPB 4XCSA 2VM2A 2QA2A 2VL3A 2DMMA 3IHGA 3EVIA 1K0AA 2H75A 4KDYA 3TOTA 3FZ4A 5A4UA 3ZL5A 3ZVJD 1J0FA 2OADA 2FUG2 1YF0A 5ECRB 2VIMA 3D22A 1PQNA 1SJIA 2CZ2A 3HA9A 2AB6A 2GQKA 3F4RA 1XOAA 1O73A 6GSSA 3LGCA 1MD4A 4MZWA 1V2AA 1YQ1A 2H1DA 1XW6A 2LEGA 5ID2B 1WJKA 4V2LA 3TDGA 2IPAA 2AUVA 3GNJA 4K7IA 3RPPA 4EF0A 4JR6A 2OJLA 5BMUA 1B4PA 2ON5A 4E8EA 2PUKC 5DJMA 4D73B 3ZLPA 3HKRA 4ZXGA 4FH8A 2H66A 4ZBBA 1XW5A 5ECKB 4KDXA 1QMVA 4CHSA 2H76A 20GSA 1S3AA 4NMUA 2E2GA 4KNDA 4KSOA 6GSVA 1MDKA 2YCDA 4ILFA 4TXOB 1Y25A 2KLXA 5DJLA 1FOVA 4G9HA 4YKFA 2FD3A 5IM9A 3UARA 2IMEA 1AQWA 3R3EA 3I9V2 2YWMA 2GQLA 1XOBA 4TR1A 1TU8A 1A0RP 2RIIA 3W6GA 1GSUA 2X8HA 5IPGA 3CYNA 2P0GA 1GTUA 4IVFA 2IJYA 4Q5QA 4QL9A 5ECSA 3ZITA 3P8WA 2NTOA 1SL1B 1X5DA 4K7NA 1VGLA 3A2WA 4N11A 1TI3A 3TRPA 4IQAA 1S3CA 4HDEA 2FWHA 2V1MA 4XS4A 3GTUB 1JZOA 3UBLA 4ULXA 2NBSA 2H30A 2L5LA 4MP4A 1BEDA 2L6CA 3ERFA 2OBIA 1AW9A 3GKMA 4PXOA 1MDIA 4HU9A 1GSEA 3UVHA 1K0NA 2HSYA 4ID0A 2FCHA 3ZREA 3HVVA 5DCGA 6GSWA 5ENUA 1XZOA 1UA5A 4KSMA 4ML6A 5GSSA 2HNLA 2VD1A 3SBCA 5GAND 1BX9A 2X8CA 5ECIB 4K8MA 2BTOT 1A24A 4XS6A 4FO5A 1EV9A 1Q4JA 4RUVA 2FLSA 5BRTA 2X8GA 5IOXA 1PL2A 1TK0B 3V1WA 2KP2A 3IHQA 2C3QA 5KN1A 2YV9A 3CRTA 3EINA 2HE3A 3G7IA 1GLQA 1B48A 4LA1A 5AGYA 1NHYA 2YNXA 5J41A 1CQGA 1E6BA 5COHA 2X4AA 3UVTA 3O3TA 2DJ0A 3M9JA 2R2JA 3TOUA 2HZEA 1BQ7A 4HJMA 3EWLA 4N10A 3F6FA 1HYUA 2YWOA 3TJKA 2KP1A 3TKSC 6GSTA 4FQUA 5HR2A 1Q98A 2E7PA 4KX4A 1USBA 1W89A 2R6KA 1UN2A 4RI7A 2MBTA 9GSSA 2M46A 4NV5A 2H0IA 4WF5A 1EP7A 3GFKA 4KCEA 1ZYNA 4L0UA 5HR0A 5EPFA 1SJ6A 2JADA 5IMDA 5D9WA 2LRNA 3PINA 3HYPA 2L4QA 3LWAA 2HT9A 3Q18A 4ECBA 3ISOA 3KTBA 3QOUA 4NV2A 1GULA 4CDOA 5FHIA 5EY6A 1S3RA 2VM1A 4PX1A 3DXBA 4N0ZA 4XS1A 3F3QA 3TKSA 4TR3A 1G0TA 4LMVA 3VI5A 2CVKA 1G6WA 2IL3A 1O7UA 1A2MA 5ECMB 2YOIA 4PTSA 1K3OA 3US3A 1F6MC 1SYXA 3A5WA 1TK8B 2XC2A 3DKSA 5D8IA 2BJXA 2EIRA 3J7Yk 4WKWA 2CT6A 4TXVA 4HOJA 2H6YA 2VUPA 2H8LA 1BYEA 4MABA 4V1Ap 4X0XA 3LJRA 2R5GA 1GSFA 5IMAA 4GLTA 3VK9A 3IR4A 5F06A 2OE0A 4PQHA 1ABAA 2WULA 2PU9C 3LFLA 4Q5FA 4IQ1A 1GL8A 1B4QA 2I9HA 4IGJA 2H74A 3FHKA 4MZBA 4HEA2 1NHOA 2IMIA 2VLVA 4J57E 2LNSA 1H75A 2MZCA 4LL1B 4HI7A 3FR6A 4F0CA 2VL2A 1SL2B 4EVMA 4MPFA 3I43A 4Z2RA 3VWUA 1U3AA 3KD0A 4L8EA 3HXSA 1I9DA 4GTUA 2R37A 1OC9A 3FR9A 1SENA 1ZCPA 3RDWA 3ZYWA 4BVXA 3FR3A 7GSSA 1AUCA 4OCEA 3IAM2 4DSRA 2YP6A 1AQVA 3LXZA 3F63A 2GQMA 1HNBA 2GSTA 4O32A 2R0PA 1ZYQB 4POMA 11GSA 1LU4A 2CAIA 2PGTA 4PUAA 2H01A 1TI1A 4ZIJA 4WETA 1EOHA 1ZYEA 5IMVA 2ZNMA 1PX6A 4AF2A 1A2LA 1GH2A 3P2AA 1PKZA 1OE8A 1PMTA 2XBIA 4V2NA 2O85A 2JZTA 2A2RA 1THOA 3H93A 4MF5A 2CQ9A 5CAXA 1PN9A 4K1FA 1URMA 5ELGA 3TKSE 1YEPA 3BJ5A 5HQPA 2YJ7A 5C04A 1TRSA 4WEYA 2AAWA 5JCUA 4TVEA 3MYDA 4TN8A 1O81A 2K6VA 5ECNB 1A0FA 1YY7A 3ZZXA 3CTGA 3JCML 2VL9A 1XWGA 5E4WA 5JCGA 1SKRB 3EE2A 3U6VA 2IMFA 1JZDA 3DIEA 4JR4A 2LJRA 2LRTA 2F3MA 1TJDA 4OFTA 3DRNA 1UC7A 3VFIA 4WF4A 3GN3A 2LQQA 3WT2A 1GSSA 5KN0A 1XPVA 2RM6A 2IIYA 1OAZA 2NPBA 1IYIA 4FIWA 4F82A 3M3MA 2N5BA 5G31A 4BL7A 3M1GA 2M72A 1K0CA 1B8XA 3VLNA 3GV1A 4TR0A 2EIOA 1XG8A 4KB3A 2GZZA 4GQFA 2A2SA 3L9SA 4GQCA 5D96A 3Q74A 4EUYA 1TW9A 5H5RA 5DBQA 2M80A 2H72A 3EPTA 5IOWA 1ML6A 2GTUA 1JZWA 1VF3A 3IBHA 2IMKA 2HRKA 3QMXA 5KOXA 3H1NA 1M3IA 3CSJA 1XBSA 1JLVA 3QPMA 2JZSA 1K0DA 3GSTA 3W8SA 2Z9SA 2IN3A 3DEXA 4K5SA 1Z6NA 1E2YA 2KHPA 1XFLA 2L5OA 4TRXA 3LQ7A 1OC9B 1F37A 2NVLA 2X64A 1LBKA 3QAGA 2YZUA 4BVXB 5DAKA 4OWYA 2YJHA 4HZ2A 4HQSA 6GSXA 2FHEA 1OC3A 5GSTA 3D4MA 2F8FA 3U5RE 3J7Yb 4PUFC 2V6KA 1T7PB 4K5RA 1GUMA 4POKA 3TCOA 2ZUPA 3LSZA 3IDVA 4G0IA 2AHEA 2H1GA 5CRDA 1WRYA 2A4VA 2FA8A 4EXJA 4G2EA 2C4JA 2CVDA 1A8LA 4PNGA 2HRFA 3KM6A 4GSNA 3E3EA 4K2DA 2R4VA 4IJIA 4MJCA 1YEXA 3IAS2 1A8YA 1T1VA 4DEJA 4G10A 4Q5RA 1O8XA 2AJQB 2R0CA 3NOFA 3GX0A 1CQHA 4KCAA 3PR8A 4I2UA 5B8BA 4F9ZA 4E8HA 4NXIA 3H4KA 5IMZA 1R7HA 2XPDA 1OVNA 3O76A 1Y6EA 2RUFA 3RBTA 2DKHA 4IP6A 5A4VA 3W8JA 1EWXA 1GUKA 2O89A 2TIRA 1ERWA 2GZYA 3GH6A 4O5UA 2VCXA 3L9VA 2C0GA 3I69A 2V32A 5J9BA 2L59A 1I5GA 1GLPA 4XRAA 3QR6A 4MPGA 4A5PA 1XCCA 2HRAA 3LYPA 3M9KA 5DQSA 2DJ3A 5HFIA 4TW5A 2QA1A 3N5OA 4PGTA 4MF6A 2DBCA 4FYCA 3VURA 5F0GA 3KEBA 2RUEA 1TRUA 2LRCA 2LUSA 4J56E 1SK2A 4NPBA 1THXA 2JU5A 3KCMA 3F6DA 1M2DA 5KEJA 3BCKA 3H79A 3EU3A 1J9BA 3ZTLA 5G30A 4F2IA 4XIHA 3K8NA 1FG4A 3HVNA 1X9SB 2RLIA 2E0QA 2E2MA 3WGEA 4I97A 3UL3A 3TJBA 1PKWA 2C3NA 1M99A 5F05A 5JWOB 2H70A 4O5RA 2P31A 4L5LA 1YZXA 5G1LA 2B1LA 2GVPA 4EIQA 3FMWA 4MJBA 3HVSA 4J2FA 3HZ8A 3RAZA 3TRXA 2TRXA 2I81A 1A2JA 2GS3A 3ZMKA 1RK4A 1ERUA 5DAKB 3G9BA 1WP0A 2LS5A 2OA7A 1DE2A 2XBQA 2DJ1A 1SKSB 1XVWA 4YQUA 4NAXA 2LNTA 5C00A 1KEBA 2FA4A 2L57A 2KUCA 2HSMA 2HI7A 1R4WA 4OO4A 4BWQA 2L4CA 1FVJA 3DVWA 4KE3A 4F03A 4GF0A 4MZCA 2B5XA 2C0DA 4HQZA 5B7CA 4N0VA 4MH2A 3TJGA 3VPTA 1YKCA 4K7OA 4ECJA 5J9CA 5E59A 4P3YB 2GSQA 1G6YA 1EZKA 1TP9A 3A3TA 1H4OA 3KMOA 10GSA 4GSSA 4IS0A 3NIVA
chains in the Genus database with same CATH topology
2H19A 2H6ZA 3FY7A 1X9WB 5G5EA 5H5SA 2K8VA 2I4AA 2AYTA 2C3TA 2VLUA 5A4WA 1NM3A 2AV4A 1N2AA 5DALA 5IMFA 5JWRB 4OCFA 1OC8A 4I6XA 1FOHA 4IKHA 1EEMA 2B3SA 2JACA 4TR1B 1T00A 2K18A 3IXRA 1PX7A 4MJEA 1V9WA 3TB2A 3C8EA 3IA1A 2WFCA 3DYRA 3Q19A 3VPQA 5J3RA 3BBYA 1KNGA 4LMWA 2V6OA 3ZIJA 1W4VA 4I5QA 3EYTA 3WGXA 4X4JA 4Z7XA 3IRAA 3C7MA 3PH9A 5KN2A 2CAQA 4X1UA 4JE1A 4XS4B 2IFQA 3C1RA 2VL2C 3KJYA 13GSA 4DVCA 5CO3A 1S3DA 1M0UA 1GNWA 2A2PA 4F0BA 1VF1A 2LKUA 1O6JA 4IELA 2C0FA 4MLYA 2VCTA 1O85A 4MF7A 2FWEA 4G0LA 1YKAA 5JCWA 3FZAA 4YKGA 4AJ8A 2C8UA 5B8AA 1EEJA 3CRUA 3GURA 2QSIA 2YWIA 3C73A 2OKAA 2YANA 5G1KA 3CSIA 3MAKA 1MTCA 3CTFA 4ZILA 3KTLA 3ZFLA 3ZVJA 5KN3A 2B5EA 3C1SA 5CRGA 2PMTA 2DLXA 1T8EB 3EC3A 3D4TA 2VD0A 3WYWA 2B7KA 4K0NA 2XHFA 4MA9A 1NSWA 2LQOA 5IO2A 3IC8A 2O7KA 1GP1A 1OKDA 4BPYA 1HD2A 3F9UA 1SL0B 1O8WA 2JSZA 2HZEB 4ZBDA 2QC7A 3GIXA 2C1YA 4N30A 1TXXA 1PN0A 3LEFA 4YH2A 3S9FA 5B6NA 4JBBA 3FK8A 3M0FA 5D93A 3IE3A 4ML1A 4ZL9A 4HZ4A 4LLRA 1XW9A 4GWRA 2HSHA 5IQYA 5LNKe 4HJ2A 2WZ9A 4MH3A 1F3AA 5ECOB 14GSA 5ID2A 1ERVA 1ERTA 4PQIA 1OE7A 3PPUA 3KP8A 1KTEA 2OE1A 1PD21 4Z2UA 2GT6A 3EU4A 2J9HA 4EDYA 2I1UA 5DALB 3A5IA 2V41A 4IBPA 4D73A 1K3YA 3FW2A 1GWCA 3G7JA 1SK1A 3QD9A 1F2EA 3GKXA 3HJOA 2YPMA 1EV4A 4HS1A 1Z9HA 5ELAA 3ERGA 3WD6A 3GKNA 4KH7A 4QL7A 1JHBA 3UBKA 1ZL9A 5AN1A 1SKWB 1OYJA 3IPZA 4DSSA 4KA0A 2ON7A 2QGVA 1TOFA 1GRXA 4TXOA 1R5PA 1FO5A 1ACVA 1DE1A 3C71A 2FGXA 5FWGA 3TKRA 4EKZA 2N5AA 1TKDB 4K0GA 1BG5A 1YF1A 1JLWA 3G7YA 1T4ZA 3KH9A 2DJJA 4O5QA 4BVYA 1PRXA 3LG6A 1K0MA 3FRCA 3E9JB 4RI6A 3QAWA 2PVQA 2H1BA 4AJ7A 2C80A 5CP1A 2PWJA 2VCQA 3HZ4A 5LD0A 3TKQA 1V57A 4WR5A 2B7JA 3GTUA 4V2MA 2JZRA 3L4NA 4MK3A 2HLSA 2NDOA 3EMPA 3FZ9A 4GSTA 2JL4A 1GSQA 3BCIA 3IV4A 2X49A 1WE0A 4L0WA 3APQA 3UJ1A 1ZZYA 1U6TA 4AJ6A 2DSAA 3ZIVA 1PSQA 2VO4A 3ED3A 3LXTA 4ZB9A 2N5FA 2UZ8A 5ABRA 4TR4A 2PN8A 1RW1A 3ZMLA 4OFMA 4NHWA 4KAEA 3RPNA 3VI7A 5JWQB 2D2ZA 2ES7A 1BAYA 3DVXA 4KW6A 2CZ3A 1GTBA 5AIVA 4O7HA 2HZFA 5J5NA 3HY2A 3MNGA 3APOA 5HFKA 1FW1A 3ERWA 4EC0A 2L6DA 2VOCA 2P5RA 5ECHB 3E0UA 1QXHA 3GX8A 1GSYA 4MCUA 1GSDA 1WOUA 4HU7A 4G0KA 2LJAA 2H71A 3P7XA 2I3YA 1WIKA 4CW9A 1ZMAA 1XWBA 4K9ZA 3OR5A 4ZBAA 5LCZA 3P90A 4MJAA 1OKTA 4HUAA 2B1KA 2O8VB 1V58A 1M2BA 2EIQA 2RM5A 5CYYA 5A5KA 4POBA 3D6IA 1QFNA 2H73A 3TGZA 5D9XA 3MWHA 3KXOA 4DSSB 4MNNA 2PVOC 1WPIA 1X0RA 2OACA 4MMMA 1HQOA 1Z7RA 3VWXA 4ZB8A 3LORA 5DDLA 1SD8A 1AQXA 1XIYA 3KMNA 3VWWA 3DGQA 1G7OA 3M8NA 3DMLA 3FYGA 12GSA 1F3BA 3TKPA 2WB9A 1NW2A 4BVYB 2OBKA 1R5AA 5HR1A 1B9YC 3CMIA 2FNOA 4BL7B 1TU7A 3HJPA 2TRCP 1AXDA 4OMVA 1HNAA 2WDUA 1XVQA 2LTKA 4WBRD 3HD5A 1EGOA 4RQXA 2ZCTA 3EURA 4EDZA 2ALBA 2R0GA 3CXGA 2F9SA 1TTZA 2XPEA 4EE0A 2GDRA 1HNCA 5EVOA 3HVXA 2PBJA 4YQVA 1ON4A 4IN0A 1TRVA 3UEMA 1XWKA 2FWGA 3I6AA 3TRQA 1AAZA 1DUGA 1DSBA 1WMJA 2DMLA 4WXTA 3DD3A 3MDKA 2K9FA 3O6TA 1JZRA 3ZRDA 2HRNA 2MMNA 2REMA 1FAAA 4KF9A 1T4YA 2DC5A 5F8BA 1U87A 1JFUA 2QKEA 3KZQA 2H0GA 5HR3A 1FB0A 1ILOA 3FZ5A 4K2XA 1K3LA 5HFGA 4TKYA 1XWAA 3GYKA 2WGRA 4IHUA 19GSA 1EP8A 1QK8A 2YN1A 1GTAA 2YV7A 2WS2A 1Z5YE 1SD9A 2FWFA 2YWNA 3F4TA 1ZYPA 2B5YA 1MEKA 2CX3A 3GUSA 3GMFA 3ME8A 1AC1A 4X43A 2DJKA 6GSUA 2HYXA 2B6MA 1F9MA 3L78A 2HFDA 4JEDA 3UAPA 3HHVA 2MYGA 2WCIA 3GL3A 2VAFA 4TOPA 2G0FA 2MMOA 3Q6OA 3F3RA 5B6MA 1YDKA 4ECCA 1RQMA 2V2GA 4FYBA 2F51A 1GNEA 5KOWA 5DCHA 1U3IA 3UOMA 3HCZA 3D5JA 5L71A 1FVKA 3GH9A 1BJXA 2GZPA 1LJRA 5DQYA 1XWCA 1C72A 2H0HA 1MDJA 3UMAA 2EC4A 2WRTA 1X9MB 5H5QA 1QGVA 3FEUA 4BA7A 5GAPD 1G7EA 4QQ7A 8GSSA 2OE3A 3WT1A 2GT5A 1Z3EA 2CV4A 1GUHA 4FYUA 18GSA 1GTIA 3KIJA 2GSRA 5G2ZA 4PURA 1PA3A 2GSSA 4YAVA 5GZZB 1Z7PA 4ZB6A 3ZFBA 1B9XC 3L0HA 1IYHA 4KGIA 4IW9A 2J23A 6GSYA 3F4SA 4ZL7A 2KOKA 5IMCA 4USSA 4Q5NA 1N8JA 4OO5A 3QDNA 1U88A 2PPTA 1J08A 4IP1A 3RHCA 3BOAA 1MD3A 2X99A 3BD2A 4I8BA 5CRWA 4XHMA 5CREA 3GKKA 4AGSA 4ACSA 4I2TA 1ZGNA 2JSYA 5AIXA 3CSHA 3APSA 2YZHA 2DKIA 5CNWA 1WWJA 1TRWA 2DJ2A 1A23A 2O87A 3IC4A 2FY6A 3HJMA 2GLRA 4CY6A 3MSZA 1X5CA 4YQMA 4LL4B 1QQ2A 3IOSA 3GRXA 3GSSA 1XXUA 1KBNA 5IO0A 3D21A 1FHEA 5DVBA 2CA8A 4V1Ag 1DBYA 17GSA 2H6XA 1R26A 3UIWA 2VCZA 1T3BA 4GXZA 1K0BA 1VF2A 1EGRA 16GSA 3QCPA 3R2QA 4JRRA 4JU5A 3QFAC 2MMZA 4NHZA 3QAVA 4OD7A 3GHAA 3LYKA 4RQRA 5D73A 5EL8A 1QUWA 1Z6MA 1SK0A 3QFBC 4MDCA 1TDIA 3VWVA 4ECIA 5ECQB 5J4UA 3D0ZA 3L9UA 4G19A 3CBUA 3KP9A 1PL1A 4ISDA 4GRFA 4EO3A 4GCIA 2G2QA 3KH7A 5G5FA 4L5OA 4CY8A 2A4HA 3KGKA 2IMDA 4WR4A 4EL1A 1X5EA 2HXKA 3GA4A 3WGDA 5INYA 1M9AA 3F8UA 1M2AA 1ST9A 4K6XA 3DWVA 4EIPA 3GL5A 3TJFA 2LV3A 1V98A 2CX4A 22GSA 2F8AA 5IIZA 1YJ6A 2LJKA 2P5QA 3RHBA 3TJJA 1M7TA 3A2VA 1SU9A 3IK9A 1EOGA 2CVBA 5FT3A 4OFNA 4PQ1A 4ICYA 1AIUA 1M9BA 2IFQB 4XTSA 3HDCA 1SJZA 2GGTA 3N9JA 2WJUA 2R3XA 2VCVA 3EMXA 5AISA 1VRSD 4PNFA 4KUNA 3AY8A 3A2XA 3IK7A 3ME7A 4ZL8A 2K8SA 1PGTA 4XRDA 1FB6A 3MIXA 4O92A 4Z2TA 2LSTA 4JZQA 1UVZA 3TUEA 1TK5B 5F07A 3FKFA 4DSQA 3H8QA 4NWYA 1V40A 4H86A 4IJ3A 2MBSA 1VF4A 2DIZA 5ECLB 3F0IA 1K0OA 2IWTA 5D9VA 3LW9A 5D9TA 2MMAA 3PGTA 2PERA 2VLTA 5CRHA 2BMXA 5IPHA 1ZOFA 2H1AA 3SWLA 2DIYA 4WBJA 4POLA 3NZNA 4KDUA 2C0EA 4YAPA 2VCWA 4BWSA 1SYRA 5ECPB 4XCSA 2VM2A 2QA2A 2VL3A 2DMMA 3IHGA 3EVIA 1K0AA 2H75A 4KDYA 3TOTA 3FZ4A 5A4UA 3ZL5A 3ZVJD 1J0FA 2OADA 2FUG2 1YF0A 5ECRB 2VIMA 3D22A 1PQNA 1SJIA 2CZ2A 3HA9A 2AB6A 2GQKA 3F4RA 1XOAA 1O73A 6GSSA 3LGCA 1MD4A 4MZWA 1V2AA 1YQ1A 2H1DA 1XW6A 2LEGA 5ID2B 1WJKA 4V2LA 3TDGA 2IPAA 2AUVA 3GNJA 4K7IA 3RPPA 4EF0A 4JR6A 2OJLA 5BMUA 1B4PA 2ON5A 4E8EA 2PUKC 5DJMA 4D73B 3ZLPA 3HKRA 4ZXGA 4FH8A 2H66A 4ZBBA 1XW5A 5ECKB 4KDXA 1QMVA 4CHSA 2H76A 20GSA 1S3AA 4NMUA 2E2GA 4KNDA 4KSOA 6GSVA 1MDKA 2YCDA 4ILFA 4TXOB 1Y25A 2KLXA 5DJLA 1FOVA 4G9HA 4YKFA 2FD3A 5IM9A 3UARA 2IMEA 1AQWA 3R3EA 3I9V2 2YWMA 2GQLA 1XOBA 4TR1A 1TU8A 1A0RP 2RIIA 3W6GA 1GSUA 2X8HA 5IPGA 3CYNA 2P0GA 1GTUA 4IVFA 2IJYA 4Q5QA 4QL9A 5ECSA 3ZITA 3P8WA 2NTOA 1SL1B 1X5DA 4K7NA 1VGLA 3A2WA 4N11A 1TI3A 3TRPA 4IQAA 1S3CA 4HDEA 2FWHA 2V1MA 4XS4A 3GTUB 1JZOA 3UBLA 4ULXA 2NBSA 2H30A 2L5LA 4MP4A 1BEDA 2L6CA 3ERFA 2OBIA 1AW9A 3GKMA 4PXOA 1MDIA 4HU9A 1GSEA 3UVHA 1K0NA 2HSYA 4ID0A 2FCHA 3ZREA 3HVVA 5DCGA 6GSWA 5ENUA 1XZOA 1UA5A 4KSMA 4ML6A 5GSSA 2HNLA 2VD1A 3SBCA 5GAND 1BX9A 2X8CA 5ECIB 4K8MA 2BTOT 1A24A 4XS6A 4FO5A 1EV9A 1Q4JA 4RUVA 2FLSA 5BRTA 2X8GA 5IOXA 1PL2A 1TK0B 3V1WA 2KP2A 3IHQA 2C3QA 5KN1A 2YV9A 3CRTA 3EINA 2HE3A 3G7IA 1GLQA 1B48A 4LA1A 5AGYA 1NHYA 2YNXA 5J41A 1CQGA 1E6BA 5COHA 2X4AA 3UVTA 3O3TA 2DJ0A 3M9JA 2R2JA 3TOUA 2HZEA 1BQ7A 4HJMA 3EWLA 4N10A 3F6FA 1HYUA 2YWOA 3TJKA 2KP1A 3TKSC 6GSTA 4FQUA 5HR2A 1Q98A 2E7PA 4KX4A 1USBA 1W89A 2R6KA 1UN2A 4RI7A 2MBTA 9GSSA 2M46A 4NV5A 2H0IA 4WF5A 1EP7A 3GFKA 4KCEA 1ZYNA 4L0UA 5HR0A 5EPFA 1SJ6A 2JADA 5IMDA 5D9WA 2LRNA 3PINA 3HYPA 2L4QA 3LWAA 2HT9A 3Q18A 4ECBA 3ISOA 3KTBA 3QOUA 4NV2A 1GULA 4CDOA 5FHIA 5EY6A 2VM1A 4PX1A 3DXBA 4N0ZA 4XS1A 3F3QA 3TKSA 4TR3A 1G0TA 4LMVA 3VI5A 2CVKA 1G6WA 2IL3A 1O7UA 1A2MA 5ECMB 2YOIA 4PTSA 1K3OA 3US3A 1F6MC 1SYXA 3A5WA 1TK8B 2XC2A 3DKSA 5D8IA 2BJXA 2EIRA 3J7Yk 4WKWA 2CT6A 4TXVA 4HOJA 2H6YA 2VUPA 2H8LA 1BYEA 4MABA 4V1Ap 4X0XA 3LJRA 2R5GA 1GSFA 5IMAA 4GLTA 3VK9A 3IR4A 5F06A 2OE0A 4PQHA 1ABAA 2WULA 2PU9C 3LFLA 4Q5FA 4IQ1A 1GL8A 1B4QA 2I9HA 4IGJA 2H74A 3FHKA 4MZBA 4HEA2 1NHOA 2IMIA 2VLVA 4J57E 2LNSA 1H75A 2MZCA 4LL1B 4HI7A 3FR6A 4F0CA 2VL2A 1SL2B 4EVMA 4MPFA 3I43A 4Z2RA 3VWUA 1U3AA 3KD0A 4L8EA 3HXSA 1I9DA 4GTUA 2R37A 1OC9A 3FR9A 1SENA 1ZCPA 3RDWA 3ZYWA 4BVXA 3FR3A 7GSSA 1AUCA 4OCEA 3IAM2 4DSRA 2YP6A 1AQVA 3LXZA 3F63A 2GQMA 1HNBA 2GSTA 4O32A 2R0PA 1ZYQB 4POMA 11GSA 1LU4A 2CAIA 2PGTA 4PUAA 2H01A 1TI1A 4ZIJA 4WETA 1EOHA 1ZYEA 5IMVA 2ZNMA 1PX6A 4AF2A 1A2LA 1GH2A 3P2AA 1PKZA 1OE8A 1PMTA 2XBIA 4V2NA 2O85A 2JZTA 2A2RA 1THOA 3H93A 4MF5A 2CQ9A 5CAXA 1PN9A 4K1FA 1URMA 5ELGA 3TKSE 1YEPA 3BJ5A 5HQPA 2YJ7A 5C04A 1TRSA 4WEYA 2AAWA 5JCUA 4TVEA 3MYDA 4TN8A 1O81A 2K6VA 5ECNB 1A0FA 1YY7A 3ZZXA 3CTGA 3JCML 2VL9A 1XWGA 5E4WA 5JCGA 1SKRB 3EE2A 3U6VA 2IMFA 1JZDA 3DIEA 4JR4A 2LJRA 2LRTA 2F3MA 1TJDA 4OFTA 3DRNA 1UC7A 3VFIA 4WF4A 3GN3A 2LQQA 3WT2A 1GSSA 5KN0A 1XPVA 2RM6A 2IIYA 1OAZA 2NPBA 1IYIA 4FIWA 4F82A 3M3MA 2N5BA 5G31A 4BL7A 3M1GA 2M72A 1K0CA 1B8XA 3VLNA 3GV1A 4TR0A 2EIOA 4KB3A 2GZZA 4GQFA 2A2SA 3L9SA 4GQCA 5D96A 3Q74A 4EUYA 1TW9A 5H5RA 5DBQA 2M80A 2H72A 3EPTA 5IOWA 1ML6A 2GTUA 1JZWA 1VF3A 3IBHA 2IMKA 2HRKA 3QMXA 5KOXA 3H1NA 3CSJA 1XBSA 1JLVA 3QPMA 2JZSA 1K0DA 3GSTA 3W8SA 2Z9SA 2IN3A 3DEXA 4K5SA 1Z6NA 1E2YA 2KHPA 1XFLA 2L5OA 4TRXA 3LQ7A 1OC9B 1F37A 2NVLA 2X64A 1LBKA 3QAGA 2YZUA 4BVXB 5DAKA 4OWYA 2YJHA 4HZ2A 4HQSA 6GSXA 2FHEA 1OC3A 5GSTA 3D4MA 2F8FA 3U5RE 3J7Yb 4PUFC 2V6KA 1T7PB 4K5RA 1GUMA 4POKA 3TCOA 2ZUPA 3LSZA 3IDVA 4G0IA 2AHEA 2H1GA 5CRDA 1WRYA 2A4VA 2FA8A 4EXJA 4G2EA 2C4JA 2CVDA 1A8LA 4PNGA 2HRFA 3KM6A 4GSNA 3E3EA 4K2DA 2R4VA 4IJIA 4MJCA 1YEXA 3IAS2 1A8YA 1T1VA 4DEJA 4G10A 4Q5RA 1O8XA 2AJQB 2R0CA 3NOFA 3GX0A 1CQHA 4KCAA 3PR8A 4I2UA 5B8BA 4F9ZA 4E8HA 4NXIA 3H4KA 5IMZA 1R7HA 2XPDA 1OVNA 3O76A 1Y6EA 2RUFA 3RBTA 2DKHA 4IP6A 5A4VA 3W8JA 1EWXA 1GUKA 2O89A 2TIRA 1ERWA 2GZYA 3GH6A 4O5UA 2VCXA 3L9VA 2C0GA 3I69A 2V32A 5J9BA 2L59A 1I5GA 1GLPA 4XRAA 3QR6A 4MPGA 4A5PA 1XCCA 2HRAA 3LYPA 3M9KA 5DQSA 2DJ3A 5HFIA 4TW5A 2QA1A 3N5OA 4PGTA 4MF6A 2DBCA 4FYCA 3VURA 5F0GA 3KEBA 2RUEA 1TRUA 2LRCA 2LUSA 4J56E 1SK2A 4NPBA 1THXA 2JU5A 3KCMA 3F6DA 1M2DA 5KEJA 3BCKA 3H79A 3EU3A 1J9BA 3ZTLA 5G30A 4F2IA 4XIHA 3K8NA 1FG4A 1X9SB 2RLIA 2E0QA 2E2MA 3WGEA 4I97A 3UL3A 3TJBA 1PKWA 2C3NA 1M99A 5F05A 5JWOB 2H70A 4O5RA 2P31A 4L5LA 1YZXA 5G1LA 2B1LA 2GVPA 4EIQA 3FMWA 4MJBA 3HVSA 4J2FA 3HZ8A 3RAZA 3TRXA 2TRXA 2I81A 1A2JA 2GS3A 3ZMKA 1RK4A 1ERUA 5DAKB 3G9BA 1WP0A 2LS5A 2OA7A 1DE2A 2XBQA 2DJ1A 1SKSB 1XVWA 4YQUA 4NAXA 2LNTA 5C00A 1KEBA 2FA4A 2L57A 2KUCA 2HSMA 2HI7A 1R4WA 4OO4A 4BWQA 2L4CA 1FVJA 3DVWA 4KE3A 4F03A 4GF0A 4MZCA 2B5XA 2C0DA 4HQZA 5B7CA 4N0VA 4MH2A 3TJGA 3VPTA 1YKCA 4K7OA 4ECJA 5J9CA 5E59A 4P3YB 2GSQA 1G6YA 1EZKA 1TP9A 3A3TA 1H4OA 3KMOA 10GSA 4GSSA 4IS0A 3NIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H19 A;  2H6Z A;  3FY7 A;  1X9W B;  5G5E A;  5H5S A;  2K8V A;  2I4A A;  2AYT A;  2C3T A;  2VLU A;  5A4W A;  1NM3 A;  2AV4 A;  1N2A A;  5DAL A;  5IMF A;  5JWR B;  4OCF A;  1OC8 A;  4I6X A;  4IKH A;  1EEM A;  2B3S A;  2JAC A;  4TR1 B;  1T00 A;  2K18 A;  3IXR A;  1PX7 A;  4MJE A;  1V9W A;  3TB2 A;  3C8E A;  3IA1 A;  2WFC A;  3DYR A;  3Q19 A;  3VPQ A;  5J3R A;  3BBY A;  1KNG A;  4LMW A;  2V6O A;  3ZIJ A;  1W4V A;  4I5Q A;  3EYT A;  3WGX A;  4Z7X A;  3IRA A;  3C7M A;  3PH9 A;  5KN2 A;  2CAQ A;  4X1U A;  4JE1 A;  4XS4 B;  2IFQ A;  3C1R A;  2VL2 C;  3KJY A;  13GS A;  4DVC A;  5CO3 A;  1S3D A;  1M0U A;  1GNW A;  4F0B A;  1VF1 A;  2LKU A;  1O6J A;  4IEL A;  2C0F A;  4MLY A;  2VCT A;  1O85 A;  4MF7 A;  2FWE A;  1YKA A;  5JCW A;  3FZA A;  4AJ8 A;  2C8U A;  5B8A A;  1EEJ A;  3CRU A;  3GUR A;  2QSI A;  2YWI A;  3C73 A;  2OKA A;  2YAN A;  5G1K A;  3CSI A;  3MAK A;  1MTC A;  3CTF A;  4ZIL A;  3KTL A;  3ZFL A;  3ZVJ A;  5KN3 A;  2B5E A;  3C1S A;  5CRG A;  2PMT A;  2DLX A;  1T8E B;  3EC3 A;  3D4T A;  2VD0 A;  3WYW A;  2B7K A;  4K0N A;  2XHF A;  4MA9 A;  1NSW A;  2LQO A;  5IO2 A;  2O7K A;  1GP1 A;  1OKD A;  4BPY A;  1HD2 A;  3F9U A;  1SL0 B;  1O8W A;  2JSZ A;  2HZE B;  4ZBD A;  2QC7 A;  3GIX A;  2C1Y A;  4N30 A;  1TXX A;  3LEF A;  4YH2 A;  3S9F A;  5B6N A;  4JBB A;  3FK8 A;  3M0F A;  5D93 A;  3IE3 A;  4ML1 A;  4ZL9 A;  4HZ4 A;  4LLR A;  1XW9 A;  4GWR A;  2HSH A;  5IQY A;  5LNK e;  4HJ2 A;  2WZ9 A;  4MH3 A;  1F3A A;  5ECO B;  14GS A;  5ID2 A;  1ERV A;  1ERT A;  4PQI A;  1OE7 A;  3KP8 A;  1KTE A;  2OE1 A;  1PD2 1;  2GT6 A;  3EU4 A;  2J9H A;  4EDY A;  2I1U A;  5DAL B;  2V41 A;  4IBP A;  4D73 A;  1K3Y A;  3FW2 A;  1GWC A;  3G7J A;  1SK1 A;  3QD9 A;  1F2E A;  3GKX A;  3HJO A;  2YPM A;  1EV4 A;  4HS1 A;  1Z9H A;  5ELA A;  3ERG A;  3WD6 A;  3GKN A;  4KH7 A;  4QL7 A;  1JHB A;  3UBK A;  1ZL9 A;  5AN1 A;  1SKW B;  1OYJ A;  3IPZ A;  4DSS A;  4KA0 A;  2ON7 A;  2QGV A;  1TOF A;  1GRX A;  4TXO A;  1R5P A;  1FO5 A;  1ACV A;  1DE1 A;  3C71 A;  2FGX A;  5FWG A;  3TKR A;  4EKZ A;  2N5A A;  1TKD B;  4K0G A;  1BG5 A;  1YF1 A;  1JLW A;  3G7Y A;  1T4Z A;  3KH9 A;  2DJJ A;  4BVY A;  1PRX A;  3LG6 A;  1K0M A;  3FRC A;  3E9J B;  4RI6 A;  3QAW A;  2PVQ A;  2H1B A;  4AJ7 A;  2C80 A;  5CP1 A;  2PWJ A;  2VCQ A;  3HZ4 A;  5LD0 A;  3TKQ A;  1V57 A;  4WR5 A;  2B7J A;  3GTU A;  4V2M A;  2JZR A;  3L4N A;  4MK3 A;  2HLS A;  2NDO A;  3EMP A;  3FZ9 A;  4GST A;  2JL4 A;  1GSQ A;  3BCI A;  3IV4 A;  1WE0 A;  4L0W A;  3APQ A;  3UJ1 A;  1ZZY A;  1U6T A;  4AJ6 A;  2DSA A;  3ZIV A;  1PSQ A;  2VO4 A;  3ED3 A;  3LXT A;  4ZB9 A;  2N5F A;  5ABR A;  4TR4 A;  2PN8 A;  1RW1 A;  3ZML A;  4OFM A;  4NHW A;  4KAE A;  3RPN A;  3VI7 A;  5JWQ B;  2D2Z A;  2ES7 A;  1BAY A;  3DVX A;  4KW6 A;  2CZ3 A;  1GTB A;  5AIV A;  4O7H A;  2HZF A;  5J5N A;  3HY2 A;  3MNG A;  3APO A;  5HFK A;  1FW1 A;  3ERW A;  4EC0 A;  2L6D A;  2VOC A;  2P5R A;  5ECH B;  3E0U A;  1QXH A;  3GX8 A;  1GSY A;  4MCU A;  1GSD A;  1WOU A;  4HU7 A;  2LJA A;  2H71 A;  3P7X A;  2I3Y A;  1WIK A;  4CW9 A;  1ZMA A;  1XWB A;  4K9Z A;  3OR5 A;  4ZBA A;  5LCZ A;  3P90 A;  4MJA A;  1OKT A;  4HUA A;  2B1K A;  2O8V B;  1V58 A;  1M2B A;  2EIQ A;  2RM5 A;  5CYY A;  5A5K A;  4POB A;  3D6I A;  1QFN A;  2H73 A;  3TGZ A;  5D9X A;  3MWH A;  3KXO A;  4DSS B;  2PVO C;  1WPI A;  1X0R A;  2OAC A;  4MMM A;  1HQO A;  1Z7R A;  3VWX A;  4ZB8 A;  3LOR A;  5DDL A;  1SD8 A;  1AQX A;  1XIY A;  3KMN A;  3VWW A;  3DGQ A;  1G7O A;  3M8N A;  3DML A;  3FYG A;  12GS A;  1F3B A;  3TKP A;  2WB9 A;  1NW2 A;  2OBK A;  1R5A A;  5HR1 A;  1B9Y C;  3CMI A;  2FNO A;  1TU7 A;  3HJP A;  2TRC P;  1AXD A;  4OMV A;  1HNA A;  2WDU A;  1XVQ A;  2LTK A;  4WBR D;  3HD5 A;  1EGO A;  4RQX A;  2ZCT A;  3EUR A;  4EDZ A;  2ALB A;  3CXG A;  2F9S A;  1TTZ A;  2XPE A;  4EE0 A;  2GDR A;  1HNC A;  5EVO A;  3HVX A;  2PBJ A;  4YQV A;  1ON4 A;  4IN0 A;  1TRV A;  3UEM A;  1XWK A;  2FWG A;  3I6A A;  3TRQ A;  1AAZ A;  1DUG A;  1DSB A;  1WMJ A;  2DML A;  4WXT A;  3DD3 A;  3MDK A;  2K9F A;  3O6T A;  1JZR A;  3ZRD A;  2HRN A;  2MMN A;  2REM A;  1FAA A;  1T4Y A;  2DC5 A;  5F8B A;  1U87 A;  1JFU A;  2QKE A;  3KZQ A;  2H0G A;  5HR3 A;  1FB0 A;  1ILO A;  3FZ5 A;  1K3L A;  5HFG A;  4TKY A;  1XWA A;  3GYK A;  2WGR A;  4IHU A;  19GS A;  1EP8 A;  1QK8 A;  2YN1 A;  1GTA A;  2YV7 A;  2WS2 A;  1Z5Y E;  1SD9 A;  2FWF A;  2YWN A;  3F4T A;  2B5Y A;  1MEK A;  2CX3 A;  3GUS A;  3GMF A;  3ME8 A;  1AC1 A;  4X43 A;  2DJK A;  6GSU A;  2HYX A;  2B6M A;  1F9M A;  3L78 A;  2HFD A;  4JED A;  3UAP A;  3HHV A;  2MYG A;  2WCI A;  3GL3 A;  2VAF A;  4TOP A;  2G0F A;  2MMO A;  3Q6O A;  3F3R A;  5B6M A;  1YDK A;  4ECC A;  1RQM A;  2V2G A;  4FYB A;  2F51 A;  1GNE A;  5DCH A;  1U3I A;  3UOM A;  3HCZ A;  3D5J A;  5L71 A;  1FVK A;  3GH9 A;  1BJX A;  2GZP A;  1LJR A;  5DQY A;  1XWC A;  1C72 A;  2H0H A;  1MDJ A;  3UMA A;  2EC4 A;  2WRT A;  1X9M B;  5H5Q A;  1QGV A;  3FEU A;  4BA7 A;  5GAP D;  1G7E A;  4QQ7 A;  8GSS A;  2OE3 A;  3WT1 A;  2GT5 A;  1Z3E A;  2CV4 A;  1GUH A;  4FYU A;  18GS A;  1GTI A;  3KIJ A;  2GSR A;  5G2Z A;  4PUR A;  1PA3 A;  2GSS A;  4YAV A;  5GZZ B;  1Z7P A;  4ZB6 A;  3ZFB A;  1B9X C;  3L0H A;  1IYH A;  4KGI A;  4IW9 A;  2J23 A;  6GSY A;  3F4S A;  4ZL7 A;  2KOK A;  5IMC A;  4Q5N A;  1N8J A;  4OO5 A;  3QDN A;  1U88 A;  2PPT A;  1J08 A;  4IP1 A;  3RHC A;  3BOA A;  1MD3 A;  2X99 A;  3BD2 A;  4I8B A;  5CRW A;  4XHM A;  5CRE A;  3GKK A;  4AGS A;  4ACS A;  4I2T A;  1ZGN A;  2JSY A;  5AIX A;  3CSH A;  3APS A;  2YZH A;  5CNW A;  1WWJ A;  1TRW A;  2DJ2 A;  1A23 A;  2O87 A;  3IC4 A;  2FY6 A;  3HJM A;  2GLR A;  3MSZ A;  1X5C A;  4YQM A;  4LL4 B;  1QQ2 A;  3IOS A;  3GRX A;  3GSS A;  1XXU A;  1KBN A;  5IO0 A;  3D21 A;  1FHE A;  5DVB A;  2CA8 A;  4V1A g;  1DBY A;  17GS A;  2H6X A;  1R26 A;  3UIW A;  2VCZ A;  1T3B A;  4GXZ A;  1K0B A;  1VF2 A;  1EGR A;  16GS A;  3QCP A;  3R2Q A;  4JRR A;  4JU5 A;  3QFA C;  2MMZ A;  4NHZ A;  3QAV A;  4OD7 A;  3GHA A;  3LYK A;  4RQR A;  5D73 A;  5EL8 A;  1QUW A;  1Z6M A;  1SK0 A;  3QFB C;  4MDC A;  1TDI A;  3VWV A;  4ECI A;  5ECQ B;  5J4U A;  3D0Z A;  3L9U A;  4G19 A;  3CBU A;  3KP9 A;  1PL1 A;  4ISD A;  4GRF A;  4EO3 A;  4GCI A;  2G2Q A;  3KH7 A;  5G5F A;  4L5O A;  3KGK A;  2IMD A;  4WR4 A;  4EL1 A;  1X5E A;  2HXK A;  3GA4 A;  3WGD A;  5INY A;  1M9A A;  3F8U A;  1M2A A;  1ST9 A;  4K6X A;  3DWV A;  3GL5 A;  3TJF A;  2LV3 A;  1V98 A;  2CX4 A;  22GS A;  2F8A A;  5IIZ A;  1YJ6 A;  2LJK A;  2P5Q A;  3RHB A;  3TJJ A;  1M7T A;  3A2V A;  1SU9 A;  3IK9 A;  1EOG A;  2CVB A;  5FT3 A;  4OFN A;  4PQ1 A;  1AIU A;  1M9B A;  2IFQ B;  4XTS A;  3HDC A;  1SJZ A;  2GGT A;  3N9J A;  2WJU A;  2R3X A;  2VCV A;  3EMX A;  5AIS A;  1VRS D;  4PNF A;  4KUN A;  3AY8 A;  3A2X A;  3IK7 A;  3ME7 A;  4ZL8 A;  2K8S A;  1PGT A;  4XRD A;  1FB6 A;  4O92 A;  2LST A;  4JZQ A;  1UVZ A;  3TUE A;  1TK5 B;  5F07 A;  3FKF A;  4DSQ A;  3H8Q A;  4NWY A;  1V40 A;  4H86 A;  4IJ3 A;  2MBS A;  1VF4 A;  2DIZ A;  5ECL B;  3F0I A;  1K0O A;  2IWT A;  5D9V A;  5D9T A;  2MMA A;  3PGT A;  2PER A;  2VLT A;  5CRH A;  2BMX A;  5IPH A;  1ZOF A;  2H1A A;  3SWL A;  2DIY A;  4WBJ A;  4POL A;  3NZN A;  4KDU A;  2C0E A;  4YAP A;  2VCW A;  4BWS A;  1SYR A;  5ECP B;  4XCS A;  2VM2 A;  2VL3 A;  2DMM A;  3EVI A;  1K0A A;  2H75 A;  4KDY A;  3TOT A;  3FZ4 A;  5A4U A;  3ZL5 A;  3ZVJ D;  1J0F A;  2OAD A;  2FUG 2;  1YF0 A;  5ECR B;  2VIM A;  3D22 A;  1PQN A;  1SJI A;  2CZ2 A;  3HA9 A;  2AB6 A;  2GQK A;  3F4R A;  1XOA A;  1O73 A;  6GSS A;  3LGC A;  1MD4 A;  4MZW A;  1V2A A;  1YQ1 A;  2H1D A;  1XW6 A;  2LEG A;  5ID2 B;  1WJK A;  4V2L A;  3TDG A;  2IPA A;  2AUV A;  3GNJ A;  4K7I A;  3RPP A;  4EF0 A;  4JR6 A;  2OJL A;  1B4P A;  2ON5 A;  4E8E A;  2PUK C;  5DJM A;  4D73 B;  3ZLP A;  3HKR A;  4ZXG A;  4FH8 A;  2H66 A;  4ZBB A;  1XW5 A;  5ECK B;  4KDX A;  1QMV A;  4CHS A;  2H76 A;  20GS A;  1S3A A;  4NMU A;  2E2G A;  4KND A;  4KSO A;  6GSV A;  1MDK A;  2YCD A;  4ILF A;  4TXO B;  1Y25 A;  2KLX A;  5DJL A;  1FOV A;  4G9H A;  2FD3 A;  5IM9 A;  3UAR A;  2IME A;  1AQW A;  3I9V 2;  2YWM A;  2GQL A;  1XOB A;  4TR1 A;  1TU8 A;  1A0R P;  2RII A;  3W6G A;  1GSU A;  2X8H A;  5IPG A;  3CYN A;  2P0G A;  1GTU A;  4IVF A;  2IJY A;  4Q5Q A;  4QL9 A;  5ECS A;  3ZIT A;  3P8W A;  2NTO A;  1SL1 B;  1X5D A;  4K7N A;  1VGL A;  3A2W A;  4N11 A;  1TI3 A;  3TRP A;  4IQA A;  1S3C A;  4HDE A;  2FWH A;  2V1M A;  4XS4 A;  3GTU B;  1JZO A;  3UBL A;  4ULX A;  2NBS A;  2H30 A;  2L5L A;  4MP4 A;  1BED A;  2L6C A;  3ERF A;  2OBI A;  1AW9 A;  3GKM A;  4PXO A;  1MDI A;  4HU9 A;  1GSE A;  3UVH A;  1K0N A;  2HSY A;  4ID0 A;  2FCH A;  3ZRE A;  3HVV A;  5DCG A;  6GSW A;  5ENU A;  1XZO A;  1UA5 A;  4KSM A;  4ML6 A;  5GSS A;  2HNL A;  2VD1 A;  3SBC A;  5GAN D;  1BX9 A;  2X8C A;  5ECI B;  4K8M A;  2BTO T;  1A24 A;  4XS6 A;  4FO5 A;  1EV9 A;  1Q4J A;  4RUV A;  2FLS A;  2X8G A;  5IOX A;  1PL2 A;  1TK0 B;  3V1W A;  2KP2 A;  3IHQ A;  2C3Q A;  5KN1 A;  2YV9 A;  3CRT A;  3EIN A;  2HE3 A;  3G7I A;  1GLQ A;  1B48 A;  4LA1 A;  5AGY A;  1NHY A;  2YNX A;  5J41 A;  1CQG A;  1E6B A;  5COH A;  3UVT A;  3O3T A;  2DJ0 A;  3M9J A;  2R2J A;  3TOU A;  2HZE A;  1BQ7 A;  4HJM A;  3EWL A;  4N10 A;  3F6F A;  1HYU A;  2YWO A;  3TJK A;  2KP1 A;  3TKS C;  6GST A;  5HR2 A;  1Q98 A;  2E7P A;  4KX4 A;  1USB A;  1W89 A;  2R6K A;  1UN2 A;  4RI7 A;  2MBT A;  9GSS A;  2M46 A;  4NV5 A;  2H0I A;  4WF5 A;  1EP7 A;  3GFK A;  4KCE A;  4L0U A;  5HR0 A;  5EPF A;  1SJ6 A;  2JAD A;  5IMD A;  5D9W A;  2LRN A;  3PIN A;  3HYP A;  2L4Q A;  3LWA A;  2HT9 A;  3Q18 A;  4ECB A;  3ISO A;  3KTB A;  3QOU A;  4NV2 A;  1GUL A;  4CDO A;  5FHI A;  5EY6 A;  2VM1 A;  4PX1 A;  3DXB A;  4N0Z A;  4XS1 A;  3F3Q A;  3TKS A;  4TR3 A;  1G0T A;  4LMV A;  3VI5 A;  2CVK A;  1G6W A;  2IL3 A;  1O7U A;  1A2M A;  5ECM B;  2YOI A;  1K3O A;  3US3 A;  1F6M C;  1SYX A;  3A5W A;  1TK8 B;  2XC2 A;  3DKS A;  5D8I A;  2BJX A;  2EIR A;  3J7Y k;  4WKW A;  2CT6 A;  4TXV A;  4HOJ A;  2H6Y A;  2VUP A;  2H8L A;  1BYE A;  4MAB A;  4V1A p;  4X0X A;  3LJR A;  2R5G A;  1GSF A;  5IMA A;  4GLT A;  3VK9 A;  3IR4 A;  5F06 A;  2OE0 A;  4PQH A;  1ABA A;  2WUL A;  2PU9 C;  3LFL A;  4Q5F A;  4IQ1 A;  1GL8 A;  1B4Q A;  2I9H A;  4IGJ A;  2H74 A;  3FHK A;  4MZB A;  4HEA 2;  1NHO A;  2IMI A;  2VLV A;  4J57 E;  2LNS A;  1H75 A;  2MZC A;  4LL1 B;  4HI7 A;  3FR6 A;  4F0C A;  2VL2 A;  1SL2 B;  4EVM A;  4MPF A;  3I43 A;  3VWU A;  1U3A A;  3KD0 A;  4L8E A;  3HXS A;  1I9D A;  4GTU A;  2R37 A;  1OC9 A;  3FR9 A;  1SEN A;  1ZCP A;  3RDW A;  3ZYW A;  4BVX A;  3FR3 A;  7GSS A;  1AUC A;  4OCE A;  3IAM 2;  4DSR A;  2YP6 A;  1AQV A;  3LXZ A;  3F63 A;  2GQM A;  1HNB A;  2GST A;  4O32 A;  1ZYQ B;  4POM A;  11GS A;  1LU4 A;  2CAI A;  2PGT A;  4PUA A;  2H01 A;  1TI1 A;  4ZIJ A;  4WET A;  1EOH A;  1ZYE A;  5IMV A;  2ZNM A;  1PX6 A;  4AF2 A;  1A2L A;  1GH2 A;  3P2A A;  1PKZ A;  1OE8 A;  1PMT A;  2XBI A;  4V2N A;  2O85 A;  2JZT A;  2A2R A;  1THO A;  3H93 A;  4MF5 A;  2CQ9 A;  5CAX A;  1PN9 A;  4K1F A;  1URM A;  5ELG A;  3TKS E;  1YEP A;  3BJ5 A;  5HQP A;  2YJ7 A;  5C04 A;  1TRS A;  4WEY A;  2AAW A;  5JCU A;  4TVE A;  4TN8 A;  1O81 A;  2K6V A;  5ECN B;  1A0F A;  1YY7 A;  3ZZX A;  3CTG A;  3JCM L;  2VL9 A;  1XWG A;  5E4W A;  5JCG A;  1SKR B;  3EE2 A;  3U6V A;  2IMF A;  1JZD A;  3DIE A;  4JR4 A;  2LJR A;  2LRT A;  2F3M A;  1TJD A;  4OFT A;  3DRN A;  1UC7 A;  3VFI A;  4WF4 A;  3GN3 A;  2LQQ A;  3WT2 A;  1GSS A;  5KN0 A;  1XPV A;  2RM6 A;  2IIY A;  1OAZ A;  2NPB A;  1IYI A;  4FIW A;  4F82 A;  3M3M A;  2N5B A;  5G31 A;  4BL7 A;  3M1G A;  2M72 A;  1K0C A;  1B8X A;  3VLN A;  3GV1 A;  4TR0 A;  2EIO A;  4KB3 A;  2GZZ A;  4GQF A;  2A2S A;  3L9S A;  4GQC A;  5D96 A;  3Q74 A;  4EUY A;  1TW9 A;  5H5R A;  5DBQ A;  2M80 A;  2H72 A;  5IOW A;  1ML6 A;  2GTU A;  1JZW A;  1VF3 A;  3IBH A;  2IMK A;  3QMX A;  3H1N A;  3CSJ A;  1XBS A;  1JLV A;  3QPM A;  2JZS A;  1K0D A;  3GST A;  3W8S A;  2Z9S A;  2IN3 A;  3DEX A;  1Z6N A;  1E2Y A;  2KHP A;  1XFL A;  2L5O A;  4TRX A;  3LQ7 A;  1OC9 B;  1F37 A;  2NVL A;  2X64 A;  1LBK A;  3QAG A;  2YZU A;  5DAK A;  4OWY A;  2YJH A;  4HZ2 A;  4HQS A;  6GSX A;  2FHE A;  1OC3 A;  5GST A;  3D4M A;  2F8F A;  3U5R E;  3J7Y b;  4PUF C;  2V6K A;  1T7P B;  1GUM A;  4POK A;  3TCO A;  2ZUP A;  3LSZ A;  3IDV A;  2AHE A;  2H1G A;  5CRD A;  1WRY A;  2A4V A;  2FA8 A;  4EXJ A;  4G2E A;  2C4J A;  2CVD A;  1A8L A;  4PNG A;  2HRF A;  3KM6 A;  4GSN A;  3E3E A;  4K2D A;  2R4V A;  4IJI A;  4MJC A;  1YEX A;  3IAS 2;  1A8Y A;  1T1V A;  4DEJ A;  4G10 A;  4Q5R A;  1O8X A;  2AJQ B;  3NOF A;  3GX0 A;  1CQH A;  4KCA A;  3PR8 A;  4I2U A;  5B8B A;  4F9Z A;  4E8H A;  4NXI A;  3H4K A;  5IMZ A;  1R7H A;  2XPD A;  1OVN A;  3O76 A;  1Y6E A;  2RUF A;  3RBT A;  4IP6 A;  5A4V A;  3W8J A;  1EWX A;  1GUK A;  2O89 A;  2TIR A;  1ERW A;  2GZY A;  3GH6 A;  2VCX A;  3L9V A;  2C0G A;  3I69 A;  2V32 A;  5J9B A;  2L59 A;  1I5G A;  1GLP A;  4XRA A;  3QR6 A;  4MPG A;  1XCC A;  3LYP A;  3M9K A;  5DQS A;  2DJ3 A;  5HFI A;  4TW5 A;  3N5O A;  4PGT A;  4MF6 A;  2DBC A;  4FYC A;  3VUR A;  5F0G A;  3KEB A;  2RUE A;  1TRU A;  2LRC A;  2LUS A;  4J56 E;  1SK2 A;  4NPB A;  1THX A;  2JU5 A;  3KCM A;  3F6D A;  1M2D A;  5KEJ A;  3BCK A;  3H79 A;  3EU3 A;  1J9B A;  3ZTL A;  5G30 A;  4F2I A;  4XIH A;  3K8N A;  1FG4 A;  1X9S B;  2RLI A;  2E0Q A;  2E2M A;  3WGE A;  4I97 A;  3UL3 A;  3TJB A;  1PKW A;  2C3N A;  1M99 A;  5F05 A;  5JWO B;  2H70 A;  4O5R A;  2P31 A;  4L5L A;  1YZX A;  5G1L A;  2B1L A;  2GVP A;  4MJB A;  3HVS A;  4J2F A;  3HZ8 A;  3RAZ A;  3TRX A;  2TRX A;  2I81 A;  1A2J A;  2GS3 A;  3ZMK A;  1RK4 A;  1ERU A;  5DAK B;  3G9B A;  1WP0 A;  2LS5 A;  2OA7 A;  1DE2 A;  2XBQ A;  2DJ1 A;  1SKS B;  1XVW A;  4YQU A;  4NAX A;  2LNT A;  5C00 A;  1KEB A;  2FA4 A;  2L57 A;  2KUC A;  2HI7 A;  1R4W A;  4OO4 A;  4BWQ A;  2L4C A;  1FVJ A;  3DVW A;  4KE3 A;  4F03 A;  4GF0 A;  4MZC A;  2B5X A;  2C0D A;  4HQZ A;  5B7C A;  4N0V A;  4MH2 A;  3TJG A;  3VPT A;  1YKC A;  4K7O A;  4ECJ A;  5J9C A;  5E59 A;  4P3Y B;  2GSQ A;  1G6Y A;  1EZK A;  1TP9 A;  3A3T A;  1H4O A;  3KMO A;  10GS A;  4GSS A;  4IS0 A;  3NIV A; 
#chains in the Genus database with same CATH topology
 2H19 A;  2H6Z A;  3FY7 A;  1X9W B;  5G5E A;  5H5S A;  2K8V A;  2I4A A;  2AYT A;  2C3T A;  2VLU A;  5A4W A;  1NM3 A;  2AV4 A;  1N2A A;  5DAL A;  5IMF A;  5JWR B;  4OCF A;  1OC8 A;  4I6X A;  1FOH A;  4IKH A;  1EEM A;  2B3S A;  2JAC A;  4TR1 B;  1T00 A;  2K18 A;  3IXR A;  1PX7 A;  4MJE A;  1V9W A;  3TB2 A;  3C8E A;  3IA1 A;  2WFC A;  3DYR A;  3Q19 A;  3VPQ A;  5J3R A;  3BBY A;  1KNG A;  4LMW A;  2V6O A;  3ZIJ A;  1W4V A;  4I5Q A;  3EYT A;  3WGX A;  4X4J A;  4Z7X A;  3IRA A;  3C7M A;  1PFO A;  3PH9 A;  5KN2 A;  2CAQ A;  4X1U A;  4JE1 A;  4XS4 B;  2IFQ A;  3C1R A;  2VL2 C;  3KJY A;  13GS A;  4DVC A;  5CO3 A;  1S3D A;  1M0U A;  1GNW A;  2A2P A;  3CQF A;  4F0B A;  1VF1 A;  2LKU A;  1O6J A;  4IEL A;  2C0F A;  4MLY A;  2VCT A;  1O85 A;  4MF7 A;  2FWE A;  4G0L A;  1YKA A;  5JCW A;  3FZA A;  4YKG A;  4AJ8 A;  2C8U A;  5B8A A;  1EEJ A;  3CRU A;  3GUR A;  2QSI A;  2YWI A;  3C73 A;  2OKA A;  2YAN A;  5G1K A;  3CSI A;  3MAK A;  4BIK A;  1MTC A;  3CTF A;  4ZIL A;  3KTL A;  3ZFL A;  3ZVJ A;  5KN3 A;  2B5E A;  3C1S A;  5CRG A;  2PMT A;  2DLX A;  1T8E B;  3EC3 A;  3D4T A;  2VD0 A;  3WYW A;  2B7K A;  4K0N A;  2XHF A;  4MA9 A;  1NSW A;  2LQO A;  5IO2 A;  3IC8 A;  2O7K A;  1GP1 A;  1OKD A;  4BPY A;  1HD2 A;  3F9U A;  1SL0 B;  1O8W A;  2JSZ A;  2HZE B;  4ZBD A;  2QC7 A;  3GIX A;  2C1Y A;  4N30 A;  1TXX A;  1PN0 A;  3LEF A;  4YH2 A;  3S9F A;  5B6N A;  4JBB A;  3FK8 A;  3M0F A;  5D93 A;  3IE3 A;  4ML1 A;  4ZL9 A;  4HZ4 A;  4LLR A;  1XW9 A;  4GWR A;  2HSH A;  5IQY A;  5LNK e;  4HJ2 A;  2WZ9 A;  4MH3 A;  1F3A A;  5ECO B;  14GS A;  5ID2 A;  1ERV A;  1ERT A;  4PQI A;  1OE7 A;  3PPU A;  3KP8 A;  1KTE A;  2OE1 A;  1PD2 1;  4Z2U A;  2GT6 A;  3EU4 A;  2J9H A;  4EDY A;  2I1U A;  5DAL B;  3A5I A;  2V41 A;  4IBP A;  4D73 A;  1K3Y A;  3FW2 A;  1GWC A;  3G7J A;  1SK1 A;  3QD9 A;  1F2E A;  3GKX A;  3HJO A;  2YPM A;  1EV4 A;  4HS1 A;  1Z9H A;  5ELA A;  3ERG A;  3WD6 A;  3GKN A;  4KH7 A;  4QL7 A;  1JHB A;  3UBK A;  1ZL9 A;  5AN1 A;  1SKW B;  1OYJ A;  3IPZ A;  4DSS A;  4KA0 A;  2ON7 A;  2QGV A;  1TOF A;  1GRX A;  4TXO A;  1R5P A;  1FO5 A;  1ACV A;  1DE1 A;  3C71 A;  2FGX A;  5FWG A;  3TKR A;  4EKZ A;  2N5A A;  1TKD B;  4K0G A;  1BG5 A;  1YF1 A;  1JLW A;  3G7Y A;  1T4Z A;  3KH9 A;  2DJJ A;  4O5Q A;  4BVY A;  1PRX A;  3LG6 A;  1K0M A;  3FRC A;  3E9J B;  4RI6 A;  3QAW A;  2PVQ A;  2H1B A;  4AJ7 A;  2C80 A;  5CP1 A;  2PWJ A;  2VCQ A;  3HZ4 A;  5LD0 A;  3TKQ A;  1V57 A;  4WR5 A;  2B7J A;  3GTU A;  4V2M A;  2JZR A;  3L4N A;  4MK3 A;  2HLS A;  2NDO A;  3EMP A;  3FZ9 A;  4GST A;  2JL4 A;  1GSQ A;  3BCI A;  3IV4 A;  2X49 A;  1WE0 A;  4L0W A;  3APQ A;  3UJ1 A;  1ZZY A;  1U6T A;  4AJ6 A;  2DSA A;  3ZIV A;  1PSQ A;  2VO4 A;  3ED3 A;  3LXT A;  4ZB9 A;  2N5F A;  2UZ8 A;  5ABR A;  4TR4 A;  2PN8 A;  1RW1 A;  3ZML A;  4OFM A;  4NHW A;  4KAE A;  3RPN A;  3VI7 A;  5JWQ B;  2D2Z A;  2ES7 A;  1BAY A;  3DVX A;  4KW6 A;  2CZ3 A;  1GTB A;  5AIV A;  4O7H A;  2HZF A;  5J5N A;  3HY2 A;  3MNG A;  3APO A;  5HFK A;  1FW1 A;  3ERW A;  4EC0 A;  2L6D A;  2VOC A;  2P5R A;  5ECH B;  3E0U A;  1QXH A;  3GX8 A;  1GSY A;  4MCU A;  1GSD A;  1WOU A;  4HU7 A;  4G0K A;  2LJA A;  2H71 A;  3P7X A;  2I3Y A;  1WIK A;  4CW9 A;  1ZMA A;  1XWB A;  4K9Z A;  3OR5 A;  4ZBA A;  5LCZ A;  3P90 A;  4MJA A;  1OKT A;  4HUA A;  2B1K A;  2O8V B;  1V58 A;  1M2B A;  2EIQ A;  2RM5 A;  5CYY A;  5A5K A;  4POB A;  3D6I A;  1QFN A;  2H73 A;  3TGZ A;  5D9X A;  3MWH A;  3KXO A;  4DSS B;  4MNN A;  2PVO C;  1WPI A;  1X0R A;  2OAC A;  4MMM A;  1HQO A;  1Z7R A;  3VWX A;  4ZB8 A;  3LOR A;  5DDL A;  1SD8 A;  1AQX A;  1XIY A;  1M3J A;  3KMN A;  3VWW A;  3DGQ A;  1G7O A;  3M8N A;  3DML A;  3FYG A;  12GS A;  1F3B A;  3TKP A;  2WB9 A;  1NW2 A;  4BVY B;  2OBK A;  1R5A A;  5HR1 A;  1B9Y C;  3CMI A;  2FNO A;  4BL7 B;  1TU7 A;  3HJP A;  2TRC P;  1AXD A;  4OMV A;  1HNA A;  2WDU A;  1XVQ A;  2LTK A;  4WBR D;  3HD5 A;  1EGO A;  4RQX A;  2ZCT A;  3EUR A;  4EDZ A;  2ALB A;  2R0G A;  3CXG A;  2F9S A;  1TTZ A;  2XPE A;  4EE0 A;  2GDR A;  1HNC A;  5EVO A;  3HVX A;  2PBJ A;  4YQV A;  1ON4 A;  4IN0 A;  1TRV A;  3UEM A;  1XWK A;  2FWG A;  3I6A A;  4HSC X;  3TRQ A;  1AAZ A;  1DUG A;  1DSB A;  1WMJ A;  2DML A;  4WXT A;  3DD3 A;  3MDK A;  2K9F A;  3O6T A;  1JZR A;  3ZRD A;  2HRN A;  2MMN A;  2REM A;  1FAA A;  4KF9 A;  1T4Y A;  2DC5 A;  5F8B A;  1U87 A;  1JFU A;  2QKE A;  3KZQ A;  2H0G A;  5HR3 A;  1FB0 A;  1ILO A;  3FZ5 A;  4K2X A;  1K3L A;  5HFG A;  4TKY A;  1XWA A;  3GYK A;  2WGR A;  4IHU A;  19GS A;  1EP8 A;  1QK8 A;  2YN1 A;  1GTA A;  2YV7 A;  2WS2 A;  1Z5Y E;  1SD9 A;  2FWF A;  2YWN A;  3F4T A;  1ZYP A;  2B5Y A;  1MEK A;  2CX3 A;  3GUS A;  3GMF A;  3ME8 A;  1AC1 A;  4X43 A;  2DJK A;  6GSU A;  2HYX A;  2B6M A;  1F9M A;  3L78 A;  2HFD A;  4JED A;  3UAP A;  3HHV A;  2MYG A;  2WCI A;  3GL3 A;  2VAF A;  4TOP A;  2G0F A;  2MMO A;  3Q6O A;  3F3R A;  5B6M A;  1YDK A;  4ECC A;  1RQM A;  2V2G A;  4FYB A;  2F51 A;  1GNE A;  5KOW A;  5DCH A;  1U3I A;  3UOM A;  3HCZ A;  3D5J A;  5L71 A;  1FVK A;  3GH9 A;  1BJX A;  2GZP A;  1LJR A;  5DQY A;  1XWC A;  1C72 A;  2H0H A;  1MDJ A;  3UMA A;  2EC4 A;  2WRT A;  1X9M B;  5H5Q A;  1QGV A;  3FEU A;  4BA7 A;  5GAP D;  1G7E A;  4QQ7 A;  8GSS A;  2OE3 A;  3WT1 A;  2GT5 A;  1Z3E A;  2CV4 A;  1GUH A;  4FYU A;  18GS A;  1GTI A;  3KIJ A;  2GSR A;  5G2Z A;  4PUR A;  1PA3 A;  2GSS A;  4YAV A;  5GZZ B;  1Z7P A;  4ZB6 A;  3ZFB A;  1B9X C;  3L0H A;  1IYH A;  4KGI A;  4IW9 A;  2J23 A;  6GSY A;  3F4S A;  4ZL7 A;  2KOK A;  5IMC A;  4USS A;  4Q5N A;  1N8J A;  4OO5 A;  3QDN A;  1U88 A;  2PPT A;  1J08 A;  4IP1 A;  3RHC A;  3BOA A;  1MD3 A;  2X99 A;  3BD2 A;  4I8B A;  5CRW A;  4XHM A;  5CRE A;  3GKK A;  4AGS A;  4ACS A;  4I2T A;  1ZGN A;  2JSY A;  5AIX A;  3CSH A;  3APS A;  2YZH A;  2DKI A;  5CNW A;  1WWJ A;  1TRW A;  2DJ2 A;  1A23 A;  2O87 A;  3IC4 A;  2FY6 A;  3HJM A;  2GLR A;  4CY6 A;  3MSZ A;  1X5C A;  4YQM A;  4LL4 B;  1QQ2 A;  3IOS A;  3GRX A;  3GSS A;  1XXU A;  1KBN A;  5IO0 A;  3D21 A;  1FHE A;  5DVB A;  2CA8 A;  4V1A g;  1DBY A;  17GS A;  2H6X A;  1R26 A;  3UIW A;  2VCZ A;  1T3B A;  4GXZ A;  1K0B A;  1VF2 A;  1EGR A;  16GS A;  3QCP A;  3R2Q A;  4JRR A;  4JU5 A;  3QFA C;  2MMZ A;  4NHZ A;  3QAV A;  4OD7 A;  3GHA A;  3LYK A;  4RQR A;  5D73 A;  5EL8 A;  1QUW A;  1Z6M A;  1SK0 A;  3QFB C;  4MDC A;  1TDI A;  3VWV A;  4ECI A;  5ECQ B;  5J4U A;  3D0Z A;  3L9U A;  4G19 A;  3CBU A;  3KP9 A;  1PL1 A;  4ISD A;  4GRF A;  4EO3 A;  4GCI A;  2G2Q A;  3KH7 A;  5G5F A;  4L5O A;  4CY8 A;  2A4H A;  3KGK A;  2IMD A;  4WR4 A;  4EL1 A;  1X5E A;  2HXK A;  3GA4 A;  3WGD A;  5INY A;  1M9A A;  3F8U A;  1M2A A;  1ST9 A;  4K6X A;  3DWV A;  4EIP A;  3GL5 A;  3TJF A;  2LV3 A;  1V98 A;  2CX4 A;  22GS A;  2F8A A;  5IIZ A;  1YJ6 A;  2LJK A;  2P5Q A;  3RHB A;  3TJJ A;  1M7T A;  3A2V A;  1SU9 A;  3IK9 A;  1EOG A;  2CVB A;  5FT3 A;  4OFN A;  4PQ1 A;  4ICY A;  1AIU A;  1M9B A;  2IFQ B;  4XTS A;  3HDC A;  1SJZ A;  2GGT A;  3N9J A;  2WJU A;  2R3X A;  2VCV A;  3EMX A;  5AIS A;  1VRS D;  4PNF A;  4KUN A;  3AY8 A;  3A2X A;  3IK7 A;  3ME7 A;  4ZL8 A;  2K8S A;  1PGT A;  4XRD A;  1FB6 A;  3MIX A;  4O92 A;  4Z2T A;  2LST A;  4JZQ A;  1UVZ A;  3TUE A;  1TK5 B;  5F07 A;  3FKF A;  4DSQ A;  3H8Q A;  4NWY A;  1V40 A;  4H86 A;  4IJ3 A;  2MBS A;  1VF4 A;  2DIZ A;  5ECL B;  3F0I A;  1K0O A;  2IWT A;  5D9V A;  3LW9 A;  5D9T A;  2MMA A;  3PGT A;  2PER A;  2VLT A;  5CRH A;  2BMX A;  5IPH A;  1ZOF A;  2H1A A;  3SWL A;  2DIY A;  4WBJ A;  4POL A;  3NZN A;  4KDU A;  2C0E A;  4YAP A;  2VCW A;  4BWS A;  1SYR A;  5ECP B;  4XCS A;  2VM2 A;  2QA2 A;  2VL3 A;  2DMM A;  3IHG A;  3EVI A;  1K0A A;  2H75 A;  4KDY A;  3TOT A;  3FZ4 A;  5A4U A;  3ZL5 A;  3ZVJ D;  1J0F A;  2OAD A;  2FUG 2;  1YF0 A;  5ECR B;  2VIM A;  3D22 A;  1PQN A;  1SJI A;  2CZ2 A;  3HA9 A;  2AB6 A;  2GQK A;  3F4R A;  1XOA A;  1O73 A;  6GSS A;  3LGC A;  1MD4 A;  4MZW A;  1V2A A;  1YQ1 A;  2H1D A;  1XW6 A;  2LEG A;  5ID2 B;  1WJK A;  4V2L A;  3TDG A;  2IPA A;  2AUV A;  3GNJ A;  4K7I A;  3RPP A;  4EF0 A;  4JR6 A;  2OJL A;  5BMU A;  1B4P A;  2ON5 A;  4E8E A;  2PUK C;  5DJM A;  4D73 B;  3ZLP A;  3HKR A;  4ZXG A;  4FH8 A;  2H66 A;  4ZBB A;  1XW5 A;  5ECK B;  4KDX A;  1QMV A;  4CHS A;  2H76 A;  20GS A;  1S3A A;  4NMU A;  2E2G A;  4KND A;  4KSO A;  6GSV A;  1MDK A;  2YCD A;  4ILF A;  4TXO B;  1Y25 A;  2KLX A;  5DJL A;  1FOV A;  4G9H A;  4YKF A;  2FD3 A;  5IM9 A;  3UAR A;  2IME A;  1AQW A;  3R3E A;  3I9V 2;  2YWM A;  2GQL A;  1XOB A;  4TR1 A;  1TU8 A;  1A0R P;  2RII A;  3W6G A;  1GSU A;  2X8H A;  5IPG A;  3CYN A;  2P0G A;  1GTU A;  4IVF A;  2IJY A;  4Q5Q A;  4QL9 A;  5ECS A;  3ZIT A;  3P8W A;  2NTO A;  1SL1 B;  1X5D A;  4K7N A;  1VGL A;  3A2W A;  4N11 A;  1TI3 A;  3TRP A;  4IQA A;  1S3C A;  4HDE A;  2FWH A;  2V1M A;  4XS4 A;  3GTU B;  1JZO A;  3UBL A;  4ULX A;  2NBS A;  2H30 A;  2L5L A;  4MP4 A;  1BED A;  2L6C A;  3ERF A;  2OBI A;  1AW9 A;  3GKM A;  4PXO A;  1MDI A;  4HU9 A;  1GSE A;  3UVH A;  1K0N A;  2HSY A;  4ID0 A;  2FCH A;  3ZRE A;  3HVV A;  5DCG A;  6GSW A;  5ENU A;  1XZO A;  1UA5 A;  4KSM A;  4ML6 A;  5GSS A;  2HNL A;  2VD1 A;  3SBC A;  5GAN D;  1BX9 A;  2X8C A;  5ECI B;  4K8M A;  2BTO T;  1A24 A;  4XS6 A;  4FO5 A;  1EV9 A;  1Q4J A;  4RUV A;  2FLS A;  5BRT A;  2X8G A;  5IOX A;  1PL2 A;  1TK0 B;  3V1W A;  2KP2 A;  3IHQ A;  2C3Q A;  5KN1 A;  2YV9 A;  3CRT A;  3EIN A;  2HE3 A;  3G7I A;  1GLQ A;  1B48 A;  4LA1 A;  5AGY A;  1NHY A;  2YNX A;  5J41 A;  1CQG A;  1E6B A;  5COH A;  2X4A A;  3UVT A;  3O3T A;  2DJ0 A;  3M9J A;  2R2J A;  3TOU A;  2HZE A;  1BQ7 A;  4HJM A;  3EWL A;  4N10 A;  3F6F A;  1HYU A;  2YWO A;  3TJK A;  2KP1 A;  3TKS C;  6GST A;  4FQU A;  5HR2 A;  1Q98 A;  2E7P A;  4KX4 A;  1USB A;  1W89 A;  2R6K A;  1UN2 A;  4RI7 A;  2MBT A;  9GSS A;  2M46 A;  4NV5 A;  2H0I A;  4WF5 A;  1EP7 A;  3GFK A;  4KCE A;  1ZYN A;  4L0U A;  5HR0 A;  5EPF A;  1SJ6 A;  2JAD A;  5IMD A;  5D9W A;  2LRN A;  3PIN A;  3HYP A;  2L4Q A;  3LWA A;  2HT9 A;  3Q18 A;  4ECB A;  3ISO A;  3KTB A;  3QOU A;  4NV2 A;  1GUL A;  4CDO A;  5FHI A;  5EY6 A;  1S3R A;  2VM1 A;  4PX1 A;  3DXB A;  4N0Z A;  4XS1 A;  3F3Q A;  3TKS A;  4TR3 A;  1G0T A;  4LMV A;  3VI5 A;  2CVK A;  1G6W A;  2IL3 A;  1O7U A;  1A2M A;  5ECM B;  2YOI A;  4PTS A;  1K3O A;  3US3 A;  1F6M C;  1SYX A;  3A5W A;  1TK8 B;  2XC2 A;  3DKS A;  5D8I A;  2BJX A;  2EIR A;  3J7Y k;  4WKW A;  2CT6 A;  4TXV A;  4HOJ A;  2H6Y A;  2VUP A;  2H8L A;  1BYE A;  4MAB A;  4V1A p;  4X0X A;  3LJR A;  2R5G A;  1GSF A;  5IMA A;  4GLT A;  3VK9 A;  3IR4 A;  5F06 A;  2OE0 A;  4PQH A;  1ABA A;  2WUL A;  2PU9 C;  3LFL A;  4Q5F A;  4IQ1 A;  1GL8 A;  1B4Q A;  2I9H A;  4IGJ A;  2H74 A;  3FHK A;  4MZB A;  4HEA 2;  1NHO A;  2IMI A;  2VLV A;  4J57 E;  2LNS A;  1H75 A;  2MZC A;  4LL1 B;  4HI7 A;  3FR6 A;  4F0C A;  2VL2 A;  1SL2 B;  4EVM A;  4MPF A;  3I43 A;  4Z2R A;  3VWU A;  1U3A A;  3KD0 A;  4L8E A;  3HXS A;  1I9D A;  4GTU A;  2R37 A;  1OC9 A;  3FR9 A;  1SEN A;  1ZCP A;  3RDW A;  3ZYW A;  4BVX A;  3FR3 A;  7GSS A;  1AUC A;  4OCE A;  3IAM 2;  4DSR A;  2YP6 A;  1AQV A;  3LXZ A;  3F63 A;  2GQM A;  1HNB A;  2GST A;  4O32 A;  2R0P A;  1ZYQ B;  4POM A;  11GS A;  1LU4 A;  2CAI A;  2PGT A;  4PUA A;  2H01 A;  1TI1 A;  4ZIJ A;  4WET A;  1EOH A;  1ZYE A;  5IMV A;  2ZNM A;  1PX6 A;  4AF2 A;  1A2L A;  1GH2 A;  3P2A A;  1PKZ A;  1OE8 A;  1PMT A;  2XBI A;  4V2N A;  2O85 A;  2JZT A;  2A2R A;  1THO A;  3H93 A;  4MF5 A;  2CQ9 A;  5CAX A;  1PN9 A;  4K1F A;  1URM A;  5ELG A;  3TKS E;  1YEP A;  3BJ5 A;  5HQP A;  2YJ7 A;  5C04 A;  1TRS A;  4WEY A;  2AAW A;  5JCU A;  4TVE A;  3MYD A;  4TN8 A;  1O81 A;  2K6V A;  5ECN B;  1A0F A;  1YY7 A;  3ZZX A;  3CTG A;  3JCM L;  2VL9 A;  1XWG A;  5E4W A;  5JCG A;  1SKR B;  3EE2 A;  3U6V A;  2IMF A;  1JZD A;  3DIE A;  4JR4 A;  2LJR A;  2LRT A;  2F3M A;  1TJD A;  4OFT A;  3DRN A;  1UC7 A;  3VFI A;  4WF4 A;  3GN3 A;  2LQQ A;  3WT2 A;  1GSS A;  5KN0 A;  1XPV A;  2RM6 A;  2IIY A;  1OAZ A;  2NPB A;  1IYI A;  4FIW A;  4F82 A;  3M3M A;  2N5B A;  5G31 A;  4BL7 A;  3M1G A;  2M72 A;  1K0C A;  1B8X A;  3VLN A;  3GV1 A;  4TR0 A;  2EIO A;  1XG8 A;  4KB3 A;  2GZZ A;  4GQF A;  2A2S A;  3L9S A;  4GQC A;  5D96 A;  3Q74 A;  4EUY A;  1TW9 A;  5H5R A;  5DBQ A;  2M80 A;  2H72 A;  3EPT A;  5IOW A;  1ML6 A;  2GTU A;  1JZW A;  1VF3 A;  3IBH A;  2IMK A;  2HRK A;  3QMX A;  5KOX A;  3H1N A;  1M3I A;  3CSJ A;  1XBS A;  1JLV A;  3QPM A;  2JZS A;  1K0D A;  3GST A;  3W8S A;  2Z9S A;  2IN3 A;  3DEX A;  4K5S A;  1Z6N A;  1E2Y A;  2KHP A;  1XFL A;  2L5O A;  4TRX A;  3LQ7 A;  1OC9 B;  1F37 A;  2NVL A;  2X64 A;  1LBK A;  3QAG A;  2YZU A;  4BVX B;  5DAK A;  4OWY A;  2YJH A;  4HZ2 A;  4HQS A;  6GSX A;  2FHE A;  1OC3 A;  5GST A;  3D4M A;  2F8F A;  3U5R E;  3J7Y b;  4PUF C;  2V6K A;  1T7P B;  4K5R A;  1GUM A;  4POK A;  3TCO A;  2ZUP A;  3LSZ A;  3IDV A;  4G0I A;  2AHE A;  2H1G A;  5CRD A;  1WRY A;  2A4V A;  2FA8 A;  4EXJ A;  4G2E A;  2C4J A;  2CVD A;  1A8L A;  4PNG A;  2HRF A;  3KM6 A;  4GSN A;  3E3E A;  4K2D A;  2R4V A;  4IJI A;  4MJC A;  1YEX A;  3IAS 2;  1A8Y A;  1T1V A;  4DEJ A;  4G10 A;  4Q5R A;  1O8X A;  2AJQ B;  2R0C A;  3NOF A;  3GX0 A;  1CQH A;  4KCA A;  3PR8 A;  4I2U A;  5B8B A;  4F9Z A;  4E8H A;  4NXI A;  3H4K A;  5IMZ A;  1R7H A;  2XPD A;  1OVN A;  3O76 A;  1Y6E A;  2RUF A;  3RBT A;  2DKH A;  4IP6 A;  5A4V A;  3W8J A;  1EWX A;  1GUK A;  2O89 A;  2TIR A;  1ERW A;  2GZY A;  3GH6 A;  4O5U A;  2VCX A;  3L9V A;  2C0G A;  3I69 A;  2V32 A;  5J9B A;  2L59 A;  1I5G A;  1GLP A;  4XRA A;  3QR6 A;  4MPG A;  4A5P A;  1XCC A;  2HRA A;  3LYP A;  3M9K A;  5DQS A;  2DJ3 A;  5HFI A;  4TW5 A;  2QA1 A;  3N5O A;  4PGT A;  4MF6 A;  2DBC A;  4FYC A;  3VUR A;  5F0G A;  3KEB A;  2RUE A;  1TRU A;  2LRC A;  2LUS A;  4J56 E;  1SK2 A;  4NPB A;  1THX A;  2JU5 A;  3KCM A;  3F6D A;  1M2D A;  5KEJ A;  3BCK A;  3H79 A;  3EU3 A;  1J9B A;  3ZTL A;  5G30 A;  4F2I A;  4XIH A;  3K8N A;  1FG4 A;  3HVN A;  1X9S B;  2RLI A;  2E0Q A;  2E2M A;  3WGE A;  4I97 A;  3UL3 A;  3TJB A;  1PKW A;  2C3N A;  1M99 A;  5F05 A;  5JWO B;  2H70 A;  4O5R A;  2P31 A;  4L5L A;  1YZX A;  5G1L A;  2B1L A;  2GVP A;  4EIQ A;  3FMW A;  4MJB A;  3HVS A;  4J2F A;  3HZ8 A;  3RAZ A;  3TRX A;  2TRX A;  2I81 A;  1A2J A;  2GS3 A;  3ZMK A;  1RK4 A;  1ERU A;  5DAK B;  3G9B A;  1WP0 A;  2LS5 A;  2OA7 A;  1DE2 A;  2XBQ A;  2DJ1 A;  1SKS B;  1XVW A;  4YQU A;  4NAX A;  2LNT A;  5C00 A;  1KEB A;  2FA4 A;  2L57 A;  2KUC A;  2HSM A;  2HI7 A;  1R4W A;  4OO4 A;  4BWQ A;  2L4C A;  1FVJ A;  3DVW A;  4KE3 A;  4F03 A;  4GF0 A;  4MZC A;  2B5X A;  2C0D A;  4HQZ A;  5B7C A;  4N0V A;  4MH2 A;  3TJG A;  3VPT A;  1YKC A;  4K7O A;  4ECJ A;  5J9C A;  5E59 A;  4P3Y B;  2GSQ A;  1G6Y A;  1EZK A;  1TP9 A;  3A3T A;  1H4O A;  3KMO A;  10GS A;  4GSS A;  4IS0 A;  3NIV A; 
#chains in the Genus database with same CATH homology
 2H19 A;  2H6Z A;  3FY7 A;  1X9W B;  5G5E A;  5H5S A;  2K8V A;  2I4A A;  2AYT A;  2C3T A;  2VLU A;  5A4W A;  1NM3 A;  2AV4 A;  1N2A A;  5DAL A;  5IMF A;  5JWR B;  4OCF A;  1OC8 A;  4I6X A;  1FOH A;  4IKH A;  1EEM A;  2B3S A;  2JAC A;  4TR1 B;  1T00 A;  2K18 A;  3IXR A;  1PX7 A;  4MJE A;  1V9W A;  3TB2 A;  3C8E A;  3IA1 A;  2WFC A;  3DYR A;  3Q19 A;  3VPQ A;  5J3R A;  3BBY A;  1KNG A;  4LMW A;  2V6O A;  3ZIJ A;  1W4V A;  4I5Q A;  3EYT A;  3WGX A;  4X4J A;  4Z7X A;  3IRA A;  3C7M A;  3PH9 A;  5KN2 A;  2CAQ A;  4X1U A;  4JE1 A;  4XS4 B;  2IFQ A;  3C1R A;  2VL2 C;  3KJY A;  13GS A;  4DVC A;  5CO3 A;  1S3D A;  1M0U A;  1GNW A;  2A2P A;  4F0B A;  1VF1 A;  2LKU A;  1O6J A;  4IEL A;  2C0F A;  4MLY A;  2VCT A;  1O85 A;  4MF7 A;  2FWE A;  4G0L A;  1YKA A;  5JCW A;  3FZA A;  4YKG A;  4AJ8 A;  2C8U A;  5B8A A;  1EEJ A;  3CRU A;  3GUR A;  2QSI A;  2YWI A;  3C73 A;  2OKA A;  2YAN A;  5G1K A;  3CSI A;  3MAK A;  1MTC A;  3CTF A;  4ZIL A;  3KTL A;  3ZFL A;  3ZVJ A;  5KN3 A;  2B5E A;  3C1S A;  5CRG A;  2PMT A;  2DLX A;  1T8E B;  3EC3 A;  3D4T A;  2VD0 A;  3WYW A;  2B7K A;  4K0N A;  2XHF A;  4MA9 A;  1NSW A;  2LQO A;  5IO2 A;  3IC8 A;  2O7K A;  1GP1 A;  1OKD A;  4BPY A;  1HD2 A;  3F9U A;  1SL0 B;  1O8W A;  2JSZ A;  2HZE B;  4ZBD A;  2QC7 A;  3GIX A;  2C1Y A;  4N30 A;  1TXX A;  1PN0 A;  3LEF A;  4YH2 A;  3S9F A;  5B6N A;  4JBB A;  3FK8 A;  3M0F A;  5D93 A;  3IE3 A;  4ML1 A;  4ZL9 A;  4HZ4 A;  4LLR A;  1XW9 A;  4GWR A;  2HSH A;  5IQY A;  5LNK e;  4HJ2 A;  2WZ9 A;  4MH3 A;  1F3A A;  5ECO B;  14GS A;  5ID2 A;  1ERV A;  1ERT A;  4PQI A;  1OE7 A;  3PPU A;  3KP8 A;  1KTE A;  2OE1 A;  1PD2 1;  4Z2U A;  2GT6 A;  3EU4 A;  2J9H A;  4EDY A;  2I1U A;  5DAL B;  3A5I A;  2V41 A;  4IBP A;  4D73 A;  1K3Y A;  3FW2 A;  1GWC A;  3G7J A;  1SK1 A;  3QD9 A;  1F2E A;  3GKX A;  3HJO A;  2YPM A;  1EV4 A;  4HS1 A;  1Z9H A;  5ELA A;  3ERG A;  3WD6 A;  3GKN A;  4KH7 A;  4QL7 A;  1JHB A;  3UBK A;  1ZL9 A;  5AN1 A;  1SKW B;  1OYJ A;  3IPZ A;  4DSS A;  4KA0 A;  2ON7 A;  2QGV A;  1TOF A;  1GRX A;  4TXO A;  1R5P A;  1FO5 A;  1ACV A;  1DE1 A;  3C71 A;  2FGX A;  5FWG A;  3TKR A;  4EKZ A;  2N5A A;  1TKD B;  4K0G A;  1BG5 A;  1YF1 A;  1JLW A;  3G7Y A;  1T4Z A;  3KH9 A;  2DJJ A;  4O5Q A;  4BVY A;  1PRX A;  3LG6 A;  1K0M A;  3FRC A;  3E9J B;  4RI6 A;  3QAW A;  2PVQ A;  2H1B A;  4AJ7 A;  2C80 A;  5CP1 A;  2PWJ A;  2VCQ A;  3HZ4 A;  5LD0 A;  3TKQ A;  1V57 A;  4WR5 A;  2B7J A;  3GTU A;  4V2M A;  2JZR A;  3L4N A;  4MK3 A;  2HLS A;  2NDO A;  3EMP A;  3FZ9 A;  4GST A;  2JL4 A;  1GSQ A;  3BCI A;  3IV4 A;  2X49 A;  1WE0 A;  4L0W A;  3APQ A;  3UJ1 A;  1ZZY A;  1U6T A;  4AJ6 A;  2DSA A;  3ZIV A;  1PSQ A;  2VO4 A;  3ED3 A;  3LXT A;  4ZB9 A;  2N5F A;  2UZ8 A;  5ABR A;  4TR4 A;  2PN8 A;  1RW1 A;  3ZML A;  4OFM A;  4NHW A;  4KAE A;  3RPN A;  3VI7 A;  5JWQ B;  2D2Z A;  2ES7 A;  1BAY A;  3DVX A;  4KW6 A;  2CZ3 A;  1GTB A;  5AIV A;  4O7H A;  2HZF A;  5J5N A;  3HY2 A;  3MNG A;  3APO A;  5HFK A;  1FW1 A;  3ERW A;  4EC0 A;  2L6D A;  2VOC A;  2P5R A;  5ECH B;  3E0U A;  1QXH A;  3GX8 A;  1GSY A;  4MCU A;  1GSD A;  1WOU A;  4HU7 A;  4G0K A;  2LJA A;  2H71 A;  3P7X A;  2I3Y A;  1WIK A;  4CW9 A;  1ZMA A;  1XWB A;  4K9Z A;  3OR5 A;  4ZBA A;  5LCZ A;  3P90 A;  4MJA A;  1OKT A;  4HUA A;  2B1K A;  2O8V B;  1V58 A;  1M2B A;  2EIQ A;  2RM5 A;  5CYY A;  5A5K A;  4POB A;  3D6I A;  1QFN A;  2H73 A;  3TGZ A;  5D9X A;  3MWH A;  3KXO A;  4DSS B;  4MNN A;  2PVO C;  1WPI A;  1X0R A;  2OAC A;  4MMM A;  1HQO A;  1Z7R A;  3VWX A;  4ZB8 A;  3LOR A;  5DDL A;  1SD8 A;  1AQX A;  1XIY A;  3KMN A;  3VWW A;  3DGQ A;  1G7O A;  3M8N A;  3DML A;  3FYG A;  12GS A;  1F3B A;  3TKP A;  2WB9 A;  1NW2 A;  4BVY B;  2OBK A;  1R5A A;  5HR1 A;  1B9Y C;  3CMI A;  2FNO A;  4BL7 B;  1TU7 A;  3HJP A;  2TRC P;  1AXD A;  4OMV A;  1HNA A;  2WDU A;  1XVQ A;  2LTK A;  4WBR D;  3HD5 A;  1EGO A;  4RQX A;  2ZCT A;  3EUR A;  4EDZ A;  2ALB A;  2R0G A;  3CXG A;  2F9S A;  1TTZ A;  2XPE A;  4EE0 A;  2GDR A;  1HNC A;  5EVO A;  3HVX A;  2PBJ A;  4YQV A;  1ON4 A;  4IN0 A;  1TRV A;  3UEM A;  1XWK A;  2FWG A;  3I6A A;  3TRQ A;  1AAZ A;  1DUG A;  1DSB A;  1WMJ A;  2DML A;  4WXT A;  3DD3 A;  3MDK A;  2K9F A;  3O6T A;  1JZR A;  3ZRD A;  2HRN A;  2MMN A;  2REM A;  1FAA A;  4KF9 A;  1T4Y A;  2DC5 A;  5F8B A;  1U87 A;  1JFU A;  2QKE A;  3KZQ A;  2H0G A;  5HR3 A;  1FB0 A;  1ILO A;  3FZ5 A;  4K2X A;  1K3L A;  5HFG A;  4TKY A;  1XWA A;  3GYK A;  2WGR A;  4IHU A;  19GS A;  1EP8 A;  1QK8 A;  2YN1 A;  1GTA A;  2YV7 A;  2WS2 A;  1Z5Y E;  1SD9 A;  2FWF A;  2YWN A;  3F4T A;  1ZYP A;  2B5Y A;  1MEK A;  2CX3 A;  3GUS A;  3GMF A;  3ME8 A;  1AC1 A;  4X43 A;  2DJK A;  6GSU A;  2HYX A;  2B6M A;  1F9M A;  3L78 A;  2HFD A;  4JED A;  3UAP A;  3HHV A;  2MYG A;  2WCI A;  3GL3 A;  2VAF A;  4TOP A;  2G0F A;  2MMO A;  3Q6O A;  3F3R A;  5B6M A;  1YDK A;  4ECC A;  1RQM A;  2V2G A;  4FYB A;  2F51 A;  1GNE A;  5KOW A;  5DCH A;  1U3I A;  3UOM A;  3HCZ A;  3D5J A;  5L71 A;  1FVK A;  3GH9 A;  1BJX A;  2GZP A;  1LJR A;  5DQY A;  1XWC A;  1C72 A;  2H0H A;  1MDJ A;  3UMA A;  2EC4 A;  2WRT A;  1X9M B;  5H5Q A;  1QGV A;  3FEU A;  4BA7 A;  5GAP D;  1G7E A;  4QQ7 A;  8GSS A;  2OE3 A;  3WT1 A;  2GT5 A;  1Z3E A;  2CV4 A;  1GUH A;  4FYU A;  18GS A;  1GTI A;  3KIJ A;  2GSR A;  5G2Z A;  4PUR A;  1PA3 A;  2GSS A;  4YAV A;  5GZZ B;  1Z7P A;  4ZB6 A;  3ZFB A;  1B9X C;  3L0H A;  1IYH A;  4KGI A;  4IW9 A;  2J23 A;  6GSY A;  3F4S A;  4ZL7 A;  2KOK A;  5IMC A;  4USS A;  4Q5N A;  1N8J A;  4OO5 A;  3QDN A;  1U88 A;  2PPT A;  1J08 A;  4IP1 A;  3RHC A;  3BOA A;  1MD3 A;  2X99 A;  3BD2 A;  4I8B A;  5CRW A;  4XHM A;  5CRE A;  3GKK A;  4AGS A;  4ACS A;  4I2T A;  1ZGN A;  2JSY A;  5AIX A;  3CSH A;  3APS A;  2YZH A;  2DKI A;  5CNW A;  1WWJ A;  1TRW A;  2DJ2 A;  1A23 A;  2O87 A;  3IC4 A;  2FY6 A;  3HJM A;  2GLR A;  4CY6 A;  3MSZ A;  1X5C A;  4YQM A;  4LL4 B;  1QQ2 A;  3IOS A;  3GRX A;  3GSS A;  1XXU A;  1KBN A;  5IO0 A;  3D21 A;  1FHE A;  5DVB A;  2CA8 A;  4V1A g;  1DBY A;  17GS A;  2H6X A;  1R26 A;  3UIW A;  2VCZ A;  1T3B A;  4GXZ A;  1K0B A;  1VF2 A;  1EGR A;  16GS A;  3QCP A;  3R2Q A;  4JRR A;  4JU5 A;  3QFA C;  2MMZ A;  4NHZ A;  3QAV A;  4OD7 A;  3GHA A;  3LYK A;  4RQR A;  5D73 A;  5EL8 A;  1QUW A;  1Z6M A;  1SK0 A;  3QFB C;  4MDC A;  1TDI A;  3VWV A;  4ECI A;  5ECQ B;  5J4U A;  3D0Z A;  3L9U A;  4G19 A;  3CBU A;  3KP9 A;  1PL1 A;  4ISD A;  4GRF A;  4EO3 A;  4GCI A;  2G2Q A;  3KH7 A;  5G5F A;  4L5O A;  4CY8 A;  2A4H A;  3KGK A;  2IMD A;  4WR4 A;  4EL1 A;  1X5E A;  2HXK A;  3GA4 A;  3WGD A;  5INY A;  1M9A A;  3F8U A;  1M2A A;  1ST9 A;  4K6X A;  3DWV A;  4EIP A;  3GL5 A;  3TJF A;  2LV3 A;  1V98 A;  2CX4 A;  22GS A;  2F8A A;  5IIZ A;  1YJ6 A;  2LJK A;  2P5Q A;  3RHB A;  3TJJ A;  1M7T A;  3A2V A;  1SU9 A;  3IK9 A;  1EOG A;  2CVB A;  5FT3 A;  4OFN A;  4PQ1 A;  4ICY A;  1AIU A;  1M9B A;  2IFQ B;  4XTS A;  3HDC A;  1SJZ A;  2GGT A;  3N9J A;  2WJU A;  2R3X A;  2VCV A;  3EMX A;  5AIS A;  1VRS D;  4PNF A;  4KUN A;  3AY8 A;  3A2X A;  3IK7 A;  3ME7 A;  4ZL8 A;  2K8S A;  1PGT A;  4XRD A;  1FB6 A;  3MIX A;  4O92 A;  4Z2T A;  2LST A;  4JZQ A;  1UVZ A;  3TUE A;  1TK5 B;  5F07 A;  3FKF A;  4DSQ A;  3H8Q A;  4NWY A;  1V40 A;  4H86 A;  4IJ3 A;  2MBS A;  1VF4 A;  2DIZ A;  5ECL B;  3F0I A;  1K0O A;  2IWT A;  5D9V A;  3LW9 A;  5D9T A;  2MMA A;  3PGT A;  2PER A;  2VLT A;  5CRH A;  2BMX A;  5IPH A;  1ZOF A;  2H1A A;  3SWL A;  2DIY A;  4WBJ A;  4POL A;  3NZN A;  4KDU A;  2C0E A;  4YAP A;  2VCW A;  4BWS A;  1SYR A;  5ECP B;  4XCS A;  2VM2 A;  2QA2 A;  2VL3 A;  2DMM A;  3IHG A;  3EVI A;  1K0A A;  2H75 A;  4KDY A;  3TOT A;  3FZ4 A;  5A4U A;  3ZL5 A;  3ZVJ D;  1J0F A;  2OAD A;  2FUG 2;  1YF0 A;  5ECR B;  2VIM A;  3D22 A;  1PQN A;  1SJI A;  2CZ2 A;  3HA9 A;  2AB6 A;  2GQK A;  3F4R A;  1XOA A;  1O73 A;  6GSS A;  3LGC A;  1MD4 A;  4MZW A;  1V2A A;  1YQ1 A;  2H1D A;  1XW6 A;  2LEG A;  5ID2 B;  1WJK A;  4V2L A;  3TDG A;  2IPA A;  2AUV A;  3GNJ A;  4K7I A;  3RPP A;  4EF0 A;  4JR6 A;  2OJL A;  5BMU A;  1B4P A;  2ON5 A;  4E8E A;  2PUK C;  5DJM A;  4D73 B;  3ZLP A;  3HKR A;  4ZXG A;  4FH8 A;  2H66 A;  4ZBB A;  1XW5 A;  5ECK B;  4KDX A;  1QMV A;  4CHS A;  2H76 A;  20GS A;  1S3A A;  4NMU A;  2E2G A;  4KND A;  4KSO A;  6GSV A;  1MDK A;  2YCD A;  4ILF A;  4TXO B;  1Y25 A;  2KLX A;  5DJL A;  1FOV A;  4G9H A;  4YKF A;  2FD3 A;  5IM9 A;  3UAR A;  2IME A;  1AQW A;  3R3E A;  3I9V 2;  2YWM A;  2GQL A;  1XOB A;  4TR1 A;  1TU8 A;  1A0R P;  2RII A;  3W6G A;  1GSU A;  2X8H A;  5IPG A;  3CYN A;  2P0G A;  1GTU A;  4IVF A;  2IJY A;  4Q5Q A;  4QL9 A;  5ECS A;  3ZIT A;  3P8W A;  2NTO A;  1SL1 B;  1X5D A;  4K7N A;  1VGL A;  3A2W A;  4N11 A;  1TI3 A;  3TRP A;  4IQA A;  1S3C A;  4HDE A;  2FWH A;  2V1M A;  4XS4 A;  3GTU B;  1JZO A;  3UBL A;  4ULX A;  2NBS A;  2H30 A;  2L5L A;  4MP4 A;  1BED A;  2L6C A;  3ERF A;  2OBI A;  1AW9 A;  3GKM A;  4PXO A;  1MDI A;  4HU9 A;  1GSE A;  3UVH A;  1K0N A;  2HSY A;  4ID0 A;  2FCH A;  3ZRE A;  3HVV A;  5DCG A;  6GSW A;  5ENU A;  1XZO A;  1UA5 A;  4KSM A;  4ML6 A;  5GSS A;  2HNL A;  2VD1 A;  3SBC A;  5GAN D;  1BX9 A;  2X8C A;  5ECI B;  4K8M A;  2BTO T;  1A24 A;  4XS6 A;  4FO5 A;  1EV9 A;  1Q4J A;  4RUV A;  2FLS A;  5BRT A;  2X8G A;  5IOX A;  1PL2 A;  1TK0 B;  3V1W A;  2KP2 A;  3IHQ A;  2C3Q A;  5KN1 A;  2YV9 A;  3CRT A;  3EIN A;  2HE3 A;  3G7I A;  1GLQ A;  1B48 A;  4LA1 A;  5AGY A;  1NHY A;  2YNX A;  5J41 A;  1CQG A;  1E6B A;  5COH A;  2X4A A;  3UVT A;  3O3T A;  2DJ0 A;  3M9J A;  2R2J A;  3TOU A;  2HZE A;  1BQ7 A;  4HJM A;  3EWL A;  4N10 A;  3F6F A;  1HYU A;  2YWO A;  3TJK A;  2KP1 A;  3TKS C;  6GST A;  4FQU A;  5HR2 A;  1Q98 A;  2E7P A;  4KX4 A;  1USB A;  1W89 A;  2R6K A;  1UN2 A;  4RI7 A;  2MBT A;  9GSS A;  2M46 A;  4NV5 A;  2H0I A;  4WF5 A;  1EP7 A;  3GFK A;  4KCE A;  1ZYN A;  4L0U A;  5HR0 A;  5EPF A;  1SJ6 A;  2JAD A;  5IMD A;  5D9W A;  2LRN A;  3PIN A;  3HYP A;  2L4Q A;  3LWA A;  2HT9 A;  3Q18 A;  4ECB A;  3ISO A;  3KTB A;  3QOU A;  4NV2 A;  1GUL A;  4CDO A;  5FHI A;  5EY6 A;  2VM1 A;  4PX1 A;  3DXB A;  4N0Z A;  4XS1 A;  3F3Q A;  3TKS A;  4TR3 A;  1G0T A;  4LMV A;  3VI5 A;  2CVK A;  1G6W A;  2IL3 A;  1O7U A;  1A2M A;  5ECM B;  2YOI A;  4PTS A;  1K3O A;  3US3 A;  1F6M C;  1SYX A;  3A5W A;  1TK8 B;  2XC2 A;  3DKS A;  5D8I A;  2BJX A;  2EIR A;  3J7Y k;  4WKW A;  2CT6 A;  4TXV A;  4HOJ A;  2H6Y A;  2VUP A;  2H8L A;  1BYE A;  4MAB A;  4V1A p;  4X0X A;  3LJR A;  2R5G A;  1GSF A;  5IMA A;  4GLT A;  3VK9 A;  3IR4 A;  5F06 A;  2OE0 A;  4PQH A;  1ABA A;  2WUL A;  2PU9 C;  3LFL A;  4Q5F A;  4IQ1 A;  1GL8 A;  1B4Q A;  2I9H A;  4IGJ A;  2H74 A;  3FHK A;  4MZB A;  4HEA 2;  1NHO A;  2IMI A;  2VLV A;  4J57 E;  2LNS A;  1H75 A;  2MZC A;  4LL1 B;  4HI7 A;  3FR6 A;  4F0C A;  2VL2 A;  1SL2 B;  4EVM A;  4MPF A;  3I43 A;  4Z2R A;  3VWU A;  1U3A A;  3KD0 A;  4L8E A;  3HXS A;  1I9D A;  4GTU A;  2R37 A;  1OC9 A;  3FR9 A;  1SEN A;  1ZCP A;  3RDW A;  3ZYW A;  4BVX A;  3FR3 A;  7GSS A;  1AUC A;  4OCE A;  3IAM 2;  4DSR A;  2YP6 A;  1AQV A;  3LXZ A;  3F63 A;  2GQM A;  1HNB A;  2GST A;  4O32 A;  2R0P A;  1ZYQ B;  4POM A;  11GS A;  1LU4 A;  2CAI A;  2PGT A;  4PUA A;  2H01 A;  1TI1 A;  4ZIJ A;  4WET A;  1EOH A;  1ZYE A;  5IMV A;  2ZNM A;  1PX6 A;  4AF2 A;  1A2L A;  1GH2 A;  3P2A A;  1PKZ A;  1OE8 A;  1PMT A;  2XBI A;  4V2N A;  2O85 A;  2JZT A;  2A2R A;  1THO A;  3H93 A;  4MF5 A;  2CQ9 A;  5CAX A;  1PN9 A;  4K1F A;  1URM A;  5ELG A;  3TKS E;  1YEP A;  3BJ5 A;  5HQP A;  2YJ7 A;  5C04 A;  1TRS A;  4WEY A;  2AAW A;  5JCU A;  4TVE A;  3MYD A;  4TN8 A;  1O81 A;  2K6V A;  5ECN B;  1A0F A;  1YY7 A;  3ZZX A;  3CTG A;  3JCM L;  2VL9 A;  1XWG A;  5E4W A;  5JCG A;  1SKR B;  3EE2 A;  3U6V A;  2IMF A;  1JZD A;  3DIE A;  4JR4 A;  2LJR A;  2LRT A;  2F3M A;  1TJD A;  4OFT A;  3DRN A;  1UC7 A;  3VFI A;  4WF4 A;  3GN3 A;  2LQQ A;  3WT2 A;  1GSS A;  5KN0 A;  1XPV A;  2RM6 A;  2IIY A;  1OAZ A;  2NPB A;  1IYI A;  4FIW A;  4F82 A;  3M3M A;  2N5B A;  5G31 A;  4BL7 A;  3M1G A;  2M72 A;  1K0C A;  1B8X A;  3VLN A;  3GV1 A;  4TR0 A;  2EIO A;  4KB3 A;  2GZZ A;  4GQF A;  2A2S A;  3L9S A;  4GQC A;  5D96 A;  3Q74 A;  4EUY A;  1TW9 A;  5H5R A;  5DBQ A;  2M80 A;  2H72 A;  3EPT A;  5IOW A;  1ML6 A;  2GTU A;  1JZW A;  1VF3 A;  3IBH A;  2IMK A;  2HRK A;  3QMX A;  5KOX A;  3H1N A;  3CSJ A;  1XBS A;  1JLV A;  3QPM A;  2JZS A;  1K0D A;  3GST A;  3W8S A;  2Z9S A;  2IN3 A;  3DEX A;  4K5S A;  1Z6N A;  1E2Y A;  2KHP A;  1XFL A;  2L5O A;  4TRX A;  3LQ7 A;  1OC9 B;  1F37 A;  2NVL A;  2X64 A;  1LBK A;  3QAG A;  2YZU A;  4BVX B;  5DAK A;  4OWY A;  2YJH A;  4HZ2 A;  4HQS A;  6GSX A;  2FHE A;  1OC3 A;  5GST A;  3D4M A;  2F8F A;  3U5R E;  3J7Y b;  4PUF C;  2V6K A;  1T7P B;  4K5R A;  1GUM A;  4POK A;  3TCO A;  2ZUP A;  3LSZ A;  3IDV A;  4G0I A;  2AHE A;  2H1G A;  5CRD A;  1WRY A;  2A4V A;  2FA8 A;  4EXJ A;  4G2E A;  2C4J A;  2CVD A;  1A8L A;  4PNG A;  2HRF A;  3KM6 A;  4GSN A;  3E3E A;  4K2D A;  2R4V A;  4IJI A;  4MJC A;  1YEX A;  3IAS 2;  1A8Y A;  1T1V A;  4DEJ A;  4G10 A;  4Q5R A;  1O8X A;  2AJQ B;  2R0C A;  3NOF A;  3GX0 A;  1CQH A;  4KCA A;  3PR8 A;  4I2U A;  5B8B A;  4F9Z A;  4E8H A;  4NXI A;  3H4K A;  5IMZ A;  1R7H A;  2XPD A;  1OVN A;  3O76 A;  1Y6E A;  2RUF A;  3RBT A;  2DKH A;  4IP6 A;  5A4V A;  3W8J A;  1EWX A;  1GUK A;  2O89 A;  2TIR A;  1ERW A;  2GZY A;  3GH6 A;  4O5U A;  2VCX A;  3L9V A;  2C0G A;  3I69 A;  2V32 A;  5J9B A;  2L59 A;  1I5G A;  1GLP A;  4XRA A;  3QR6 A;  4MPG A;  4A5P A;  1XCC A;  2HRA A;  3LYP A;  3M9K A;  5DQS A;  2DJ3 A;  5HFI A;  4TW5 A;  2QA1 A;  3N5O A;  4PGT A;  4MF6 A;  2DBC A;  4FYC A;  3VUR A;  5F0G A;  3KEB A;  2RUE A;  1TRU A;  2LRC A;  2LUS A;  4J56 E;  1SK2 A;  4NPB A;  1THX A;  2JU5 A;  3KCM A;  3F6D A;  1M2D A;  5KEJ A;  3BCK A;  3H79 A;  3EU3 A;  1J9B A;  3ZTL A;  5G30 A;  4F2I A;  4XIH A;  3K8N A;  1FG4 A;  1X9S B;  2RLI A;  2E0Q A;  2E2M A;  3WGE A;  4I97 A;  3UL3 A;  3TJB A;  1PKW A;  2C3N A;  1M99 A;  5F05 A;  5JWO B;  2H70 A;  4O5R A;  2P31 A;  4L5L A;  1YZX A;  5G1L A;  2B1L A;  2GVP A;  4EIQ A;  3FMW A;  4MJB A;  3HVS A;  4J2F A;  3HZ8 A;  3RAZ A;  3TRX A;  2TRX A;  2I81 A;  1A2J A;  2GS3 A;  3ZMK A;  1RK4 A;  1ERU A;  5DAK B;  3G9B A;  1WP0 A;  2LS5 A;  2OA7 A;  1DE2 A;  2XBQ A;  2DJ1 A;  1SKS B;  1XVW A;  4YQU A;  4NAX A;  2LNT A;  5C00 A;  1KEB A;  2FA4 A;  2L57 A;  2KUC A;  2HSM A;  2HI7 A;  1R4W A;  4OO4 A;  4BWQ A;  2L4C A;  1FVJ A;  3DVW A;  4KE3 A;  4F03 A;  4GF0 A;  4MZC A;  2B5X A;  2C0D A;  4HQZ A;  5B7C A;  4N0V A;  4MH2 A;  3TJG A;  3VPT A;  1YKC A;  4K7O A;  4ECJ A;  5J9C A;  5E59 A;  4P3Y B;  2GSQ A;  1G6Y A;  1EZK A;  1TP9 A;  3A3T A;  1H4O A;  3KMO A;  10GS A;  4GSS A;  4IS0 A;  3NIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...