2JSYA

Solution structure of tpx in the oxidized state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVCDAQTRRFNEEAAKLGDVNVYTISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIEAAKALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thiol peroxidase
publication title Reversible conformational switch revealed by the redox structures of Bacillus subtilis thiol peroxidase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jsyA00
2QKEA 4MA9A 3OR5A 3W8SA 5ECRB 3IXRA 3BJ5A 2I81A 3US3A 1PN9A 2YJHA 3ZRDA 5G5FA 1MEKA 3Q18A 3UMAA 1EZKA 3TKPA 4EDYA 6GSYA 3M9KA 5ID2A 1TU8A 2GZZA 2O7KA 3DWVA 3TJJA 1TRVA 1AC1A 4HEA2 3I6AA 1XIYA 1GUMA 1LU4A 5J4UA 3Q74A 2JZRA 2M80A 5DVBA 2R2JA 3HCZA 2YZUA 2P5QA 2VL9A 4MDCA 4G2EA 3ZL5A 4EDZA 2H1DA 4BVYA 1A8YA 1FOVA 2LS5A 2PERA 1SU9A 4QL9A 4K7OA 4I2UA 3F4SA 3GUSA 3F4TA 3TRXA 4DVCA 3RHBA 2J23A 3GH6A 4IQAA 5F05A 4D73B 4IW9A 1WWJA 2YWOA 2CX3A 2K6VA 3LSZA 2WFCA 3H1NA 5GAPD 3I9V2 5ECMB 1DE2A 4KDUA 4MCUA 3SWLA 4GSNA 4XIHA 1R7HA 3N5OA 4K7NA 2H72A 2JADA 4OCFA 3QFAC 1ERWA 1GSSA 3ERGA 4PNGA 3J7Yb 9GSSA 2AAWA 4BVXA 3GTUB 4EE0A 1SL0B 4MP4A 2B7JA 3PH9A 5AN1A 1ERTA 1WRYA 5KN0A 4PURA 2E7PA 4G19A 1EP8A 4HS1A 2YCDA 3F6DA 2DJKA 4IQ1A 2PBJA 4E8EA 2FD3A 2YWNA 1J0FA 2C8UA 2F51A 5IQYA 1TK5B 4TXVA 3F9UA 4JU5A 3ME8A 1TK0B 1O85A 3GA4A 4ZBBA 1HNAA 2GZYA 4IBPA 2AYTA 3GSTA 2JZTA 3F8UA 3BCIA 2QGVA 2YWMA 2WGRA 1JZWA 3WT2A 1PL1A 2YOIA 2YZHA 4NHWA 5A4VA 3VPTA 2VL3A 4ZBDA 4HUAA 2AB6A 5DALA 1ZL9A 1GSYA 3D22A 1ZOFA 1YKAA 1BX9A 3FEUA 1OC8A 1AAZA 1EV9A 1GSDA 4F82A 4RI6A 1YJ6A 1JLVA 5IM9A 2IN3A 4IS0A 2OA7A 4MZCA 2XBIA 2A4VA 4N0ZA 3TJFA 4BPYA 2CAQA 4ZXGA 1EEJA 1GTBA 5KN2A 1WOUA 2QSIA 4DSQA 4K0NA 1N2AA 2OADA 4ZB6A 3L9VA 4J2FA 2IMEA 4ECCA 3O76A 1KBNA 4NV5A 2WDUA 4HQSA 2DJ1A 5C00A 3C8EA 3QDNA 3GRXA 4HI7A 3ZVJA 1LBKA 4ZBAA 3PGTA 1SYRA 2YJ7A 1T7PB 2LJKA 4ISDA 2IMDA 1YY7A 1UC7A 4GSTA 1XWGA 4X0XA 3RPPA 4ZL7A 3HDCA 3E9JB 5HR1A 1NM3A 2HFDA 1T4YA 1HYUA 1XZOA 3CSHA 4MMMA 2YWIA 3D21A 2C80A 4J56E 4WETA 3HZ8A 3LQ7A 1PKZA 2PN8A 4QL7A 2IPAA 5H5QA 4FYBA 3ZFBA 3KTBA 4ZIJA 1EOHA 3L9SA 5HR3A 1MD4A 3HVSA 1DE1A 2PPTA 2VCVA 4BWSA 2LJAA 2NTOA 5G1KA 4FO5A 4XCSA 2YP6A 3QAVA 2C0EA 1GSFA 3IRAA 1OC3A 5FHIA 3KH9A 1M99A 2IIYA 6GSWA 4PQIA 2N5FA 4I6XA 4EXJA 1RK4A 1T1VA 1EP7A 3MSZA 3MNGA 3LWAA 2I1UA 2GGTA 1SL1B 2OE3A 3PINA 2TIRA 5A4WA 2O89A 5ELAA 2IWTA 3M0FA 1F2EA 3I69A 1USBA 2B5YA 2KLXA 4RQXA 3ZLPA 1OYJA 1PX7A 4YQVA 5ECHB 1W89A 4JZQA 4WBRD 2HE3A 4IP1A 1GNWA 3UARA 1AQVA 1O73A 4K2DA 2LUSA 5IMCA 2A2SA 3A2XA 1F3AA 4MH3A 2LRNA 2P5RA 8GSSA 3FHKA 2KHPA 1ON4A 3H8QA 5J41A 2YPMA 3GX8A 1K0CA 2M46A 5F07A 3TRPA 1AXDA 3TKSE 3L0HA 1IYHA 3IC4A 4PXOA 4IJIA 2DMMA 3O6TA 20GSA 2VLUA 2FWEA 1H4OA 4N11A 1OC9B 3LXTA 3ED3A 4Q5RA 1O8WA 2PVQA 1F37A 17GSA 3P7XA 1WPIA 1U3IA 2F8AA 1TU7A 4HJ2A 5LNKe 2XPEA 3GKMA 5B6MA 2CX4A 5HQPA 3LJRA 5ECOB 1EOGA 1Z3EA 1AW9A 4N0VA 2FWFA 1ZYEA 3QPMA 2DJ2A 5ECSA 4L8EA 1TK8B 3IK9A 1OKTA 3VFIA 2R37A 3GH9A 4DSSA 1DSBA 3HD5A 2LQQA 3KD0A 2HT9A 3LGCA 2NBSA 1GTUA 1H75A 4OFMA 3M8NA 5DCGA 16GSA 4LA1A 3L4NA 3ZYWA 2G2QA 1JLWA 2RM5A 4GCIA 1B9YC 4F03A 3HVVA 5IPGA 2HZEA 2VIMA 2VCQA 3Q6OA 4KUNA 4K0GA 1PMTA 4TR1A 2DJJA 3U5RE 2X8CA 1TI3A 3CRTA 3IAM2 2V41A 2CA8A 4OO4A 1HQOA 1A2MA 3F0IA 1FHEA 3V1WA 1YF1A 3IA1A 1EGOA 5CYYA 4MF7A 2D2ZA 2ZUPA 4POBA 3CTFA 2LTKA 4ML6A 1GSQA 4ID0A 3BBYA 3A2WA 1O8XA 2XPDA 1YQ1A 3DD3A 1X9WB 3CBUA 5B7CA 5G31A 1TP9A 2JL4A 1U88A 1V98A 4OWYA 2VM2A 2H76A 4TN8A 6GSSA 5DQYA 1GLQA 5ECPB 1K0MA 3TJBA 3C7MA 1AQWA 1G7EA 4XRDA 5DAKB 1AQXA 2XBQA 3D5JA 4V2LA 4MABA 3F3RA 1CQGA 5DDLA 2LQOA 4X1UA 4WF5A 4MF5A 5KN1A 1Y25A 4MPFA 1FVKA 1A0RP 3DYRA 5G1LA 5JCGA 4MPGA 1THOA 4I97A 3N9JA 2B5XA 1F6MC 4L0UA 5IO0A 1DBYA 5AISA 5A5KA 5IIZA 1QGVA 3ZZXA 1KEBA 3TRQA 3C73A 1W4VA 4RQRA 2MMAA 3KEBA 4POKA 2GDRA 1K3LA 1VF1A 2PMTA 1FB0A 3WGDA 1Z7PA 2OKAA 4ECJA 5ELGA 5ECKB 1BEDA 3GFKA 2VCXA 2HZFA 3G7IA 3VLNA 1M0UA 3F6FA 3CXGA 4OMVA 2HRNA 4K9ZA 1T8EB 2H0HA 2WJUA 1SD9A 3E3EA 4V1Ag 2H01A 4NXIA 3TCOA 2E2GA 3GHAA 3WYWA 3QCPA 3J7Yk 5ABRA 1WMJA 3TKQA 3QMXA 3HYPA 5GAND 1AUCA 3DEXA 1HNCA 1A2LA 4ILFA 2NPBA 1SJ6A 4TXOB 2CVDA 5CRGA 1MDJA 2R4VA 3KZQA 3AY8A 3FZ5A 4ML1A 2MMZA 2GLRA 1ILOA 1M2BA 5J9CA 1M9AA 1O81A 3ZMKA 4IHUA 4MJBA 3P2AA 4KCAA 3KXOA 4D73A 2YNXA 3G9BA 4MJCA 1X5EA 2GQKA 2B5EA 4KSMA 3D6IA 4X43A 4TRXA 3GL5A 5G2ZA 1G6WA 3RDWA 3NZNA 3K8NA 4TVEA 5INYA 3HA9A 3ZFLA 2CVKA 2GS3A 3QFBC 2FA8A 1NSWA 2MBSA 3UEMA 2RUFA 2HYXA 5G5EA 1JFUA 4O7HA 3GV1A 3A2VA 2KUCA 3KMOA 4PX1A 3GTUA 1EGRA 2ON7A 3LYKA 3EMPA 3KCMA 19GSA 3LORA 3UBKA 1OAZA 1PA3A 4ACSA 3IAS2 1BAYA 2IMIA 3ZREA 1R5PA 4OFNA 3UAPA 4O92A 4PQHA 1GUKA 2GSRA 3EU4A 1GH2A 2A2RA 1SK2A 2L4CA 2GVPA 5D8IA 1G7OA 3FYGA 5D73A 2OJLA 1V58A 4ZB9A 3CTGA 2G0FA 2F9SA 2B1LA 4EKZA 3TUEA 2OE1A 3HZ4A 1IYIA 2C3QA 2FLSA 1K0NA 2VAFA 4JE1A 3VWXA 2B3SA 3TJGA 2OE0A 2NVLA 5D9VA 4MH2A 4MK3A 4WKWA 4NMUA 3H79A 2N5AA 4JBBA 1K0DA 2K9FA 3DVXA 2GZPA 10GSA 3FZ9A 3LEFA 3KMNA 5CREA 3TB2A 2N5BA 4TOPA 1M9BA 2LRCA 3CSIA 2EIRA 2JSZA 1BYEA 3ME7A 4N10A 2FCHA 2L5OA 2AUVA 2FY6A 2ZCTA 5IOWA 1PKWA 1XPVA 3TKSC 3KH7A 2M72A 1VGLA 2VOCA 2DSAA 4G9HA 1MDIA 3GX0A 1EEMA 1B8XA 2CQ9A 2L6DA 5B6NA 3BOAA 11GSA 5ECQB 1BQ7A 3FKFA 2VL2C 1T3BA 2B7KA 4BWQA 1PX6A 2VLTA 2K18A 4EL1A 2H71A 3FRCA 4FH8A 5J3RA 2H0GA 3EWLA 3A5WA 1OE7A 1OKDA 3UOMA 5CAXA 3WD6A 3IOSA 1XW6A 5D9TA 4ZL8A 2ZNMA 3GSSA 3BCKA 4EF0A 3LG6A 1B4QA 5CRHA 3HY2A 4WBJA 2H73A 3FY7A 4YAVA 5GSTA 2O85A 2R6KA 1A2JA 3GYKA 2DIZA 4GXZA 1A0FA 3VPQA 4V1Ap 5A4UA 2FHEA 1KNGA 1A24A 1Z6MA 2BMXA 4L0WA 1V2AA 4KDYA 4ZILA 4XS4B 1VF2A 1XCCA 2IMFA 1R4WA 4YQUA 4Q5NA 1GUHA 1OVNA 5ENUA 5IO2A 1EV4A 4FYCA 18GSA 1JHBA 5CNWA 1QXHA 1RQMA 3U6VA 1SKRB 3KIJA 3KJYA 3ZMLA 1AIUA 3R2QA 3HJOA 4TW5A 3IHQA 1Z5YE 1WP0A 4OO5A 1TTZA 1Z9HA 4WXTA 3EMXA 4MJEA 4EVMA 3GKKA 5IMZA 4I2TA 4WEYA 2TRXA 1MDKA 2LNTA 3RAZA 3TOTA 3GURA 2R3XA 1TW9A 1LJRA 1Y6EA 5ECNB 1WE0A 3TKSA 4DEJA 1THXA 4LMWA 2GQLA 1SYXA 4IN0A 5H5SA 5JWRB 4GLTA 4K7IA 4BL7A 2Z9SA 1SK0A 4OD7A 3UBLA 3L78A 5E59A 4EUYA 3GL3A 2VL2A 2CV4A 1OC9A 1YEPA 3IDVA 3MAKA 4MJAA 4PNFA 4KX4A 3FR3A 2ES7A 2VD0A 2TRCP 2K8VA 3P90A 1GLPA 4KH7A 1TOFA 2O8VB 4L5LA 1J08A 4XTSA 1XBSA 2JSYA 3KGKA 1R26A 2GSTA 5DCHA 4CW9A 4KSOA 1SJIA 1UVZA 1TDIA 2AJQB 3UVTA 3QD9A 1SK1A 2HLSA 1R5AA 1JZRA 1WIKA 1M7TA 4YQMA 4ECIA 2EC4A 2CAIA 1X9SB 1QMVA 1YZXA 1GSEA 2VLVA 1QUWA 1DUGA 4F0CA 1Z7RA 4XS1A 4J57E 3ZIJA 3C71A 4DSRA 4POMA 4HQZA 4HZ4A 4YAPA 2FNOA 3ZVJD 2L5LA 2MMNA 2YANA 5G30A 2MYGA 6GSTA 2V6KA 4KGIA 1E6BA 1U6TA 3DRNA 2V6OA 1YKCA 4MF6A 2WZ9A 1K0OA 2CZ2A 5HR2A 4NAXA 1CQHA 2C1YA 5D9WA 1C72A 4O32A 5AGYA 2H1GA 1K3OA 3FR6A 1YF0A 2C0FA 3GN3A 3QOUA 4KB3A 1HD2A 4PUAA 4NPBA 2FWGA 2DC5A 3EVIA 3DMLA 4MZBA 5KN3A 1K0AA 2PU9C 2YV7A 2IFQB 2HSHA 2LEGA 2YV9A 5EY6A 3DKSA 2MBTA 2BJXA 3IK7A 3UJ1A 3WGXA 3KP8A 3L9UA 2VCZA 3HJPA 1YDKA 1TRUA 4CDOA 2H1AA 3QR6A 4GSSA 1XOAA 2LKUA 2DJ3A 3FZAA 2I4AA 1FO5A 1Z6NA 3TOUA 1TRWA 4IKHA 2X8HA 2I9HA 5IMDA 1RW1A 2DBCA 5ID2B 5DAKA 1F3BA 4RUVA 2IJYA 4K8MA 3G7JA 2HNLA 3IPZA 2EIOA 4NV2A 4IJ3A 3DGQA 4NWYA 4LMVA 5B8BA 1A23A 5FWGA 5D93A 3M9JA 1PSQA 4AGSA 2FUG2 4AF2A 2CZ3A 2IMKA 2JU5A 5J9BA 1FB6A 1Q98A 4TR4A 1X5DA 2E0QA 5DJMA 2CVBA 4WR4A 3HXSA 13GSA 4HZ2A 3HHVA 5EL8A 4HOJA 3TDGA 5L71A 1E2YA 4GTUA 2J9HA 3JCML 3C1SA 3GKXA 3F63A 2KP2A 3GIXA 1TXXA 3WGEA 1N8JA 1UA5A 1XOBA 1NHOA 1F9MA 1GTAA 4HU9A 4GQFA 3F3QA 1ERVA 4FYUA 2L59A 2H6YA 3CRUA 5JWOB 3UL3A 3CSJA 2P31A 12GSA 5DQSA 5IOXA 1A8LA 2DJ0A 1FVJA 3CMIA 2B1KA 1TJDA 3CYNA 4HJMA 3UIWA 1XFLA 5CO3A 2CT6A 5COHA 2MMOA 2BTOT 4JRRA 4ZL9A 1SENA 3FK8A 2JZSA 4FIWA 3DXBA 1MD3A 3VWVA 3ERWA 5CRDA 4ECBA 2WRTA 5HFGA 2RM6A 2VCTA 4TXOA 4I8BA 1ST9A 2KOKA 2XHFA 3GNJA 5JWQB 3NIVA 1O6JA 1XWBA 2LV3A 2VUPA 3UVHA 1GNEA 1V57A 3E0UA 3TGZA 4KA0A 3TKRA 1GRXA 2I3YA 5CP1A 2PUKC 5IMFA 5DALB 3ZITA 3MWHA 1U87A 2LRTA 3LXZA 2WULA 2X99A 4KE3A 2MZCA 2QC7A 4AJ6A 4BA7A 1EWXA 2V1MA 3D0ZA 4MLYA 1BG5A 5F8BA 2NDOA 1M2DA 5AIVA 4IVFA 5DBQA 3O3TA 1ERUA 4EC0A 3ZTLA 3NOFA 2C4JA 3M3MA 3F4RA 5B8AA 2H75A 1X0RA 1B48A 3IE3A 2IL3A 2VCWA 1FG4A 2AV4A 2E2MA 4F0BA 5C04A 2R5GA 4NHZA 2X64A 1FAAA 1SKSB 3HKRA 3RBTA 3IBHA 3VK9A 2YN1A 2AHEA 3APQA 3SBCA 1I9DA 2L4QA 1URMA 4V2NA 2F8FA 5LD0A 4EO3A 3RPNA 1G0TA 4GRFA 2C0GA 1ABAA 4IP6A 2H8LA 3EYTA 5D96A 5JCWA 1XWKA 1GULA 22GSA 3G7YA 2XC2A 2H6XA 1O7UA 4G10A 2FGXA 5IMVA 4YH2A 1PRXA 2P0GA 3IV4A 4JEDA 5EVOA 1G6YA 4IGJA 4F2IA 2OACA 3C1RA 4MZWA 6GSVA 5GZZB 3VI5A 4JR4A 3D4MA 4H86A 1M2AA 3M1GA 1GP1A 3HJMA 1NW2A 2OBIA 2DMLA 4AJ8A 3FZ4A 3LYPA 3KM6A 3EINA 1PQNA 1UN2A 2V2GA 5EPFA 4N30A 1T00A 2KP1A 1XXUA 3KTLA 7GSSA 3Q19A 2F3MA 1JZOA 5DJLA 1ZZYA 2PGTA 2H1BA 1PGTA 4GWRA 5F06A 5CRWA 4RI7A 1XW5A 4E8HA 3EURA 2GSSA 4O5RA 4XRAA 2HSYA 3P8WA 2C3TA 2GTUA 2GSQA 3EC3A 3GKNA 4LLRA 1YEXA 4I5QA 3DVWA 3PR8A 3QAWA 3ERFA 4Q5QA 4PQ1A 1B4PA 2LNSA 3QAGA 4OFTA 1SD8A 2PVOC 1V9WA 2VM1A 4KCEA 2DIYA 4CHSA 1BJXA 4OCEA 2V32A 2B6MA 4JR6A 4KW6A 1XWCA 2H70A 2PWJA 5AIXA 1S3DA 3EU3A 4ZB8A 2ON5A 4K6XA 1K3YA 3APOA 3H93A 3I43A 4XS4A 5HFKA 1VF4A 3VWWA 1VRSD 3ISOA 4TR3A 1XVWA 4GQCA 3A3TA 1XW9A 3WT1A 1GSUA 2WCIA 1SJZA 4TR0A 4HU7A 5IMAA 4Q5FA 5LCZA 3EE2A 2C0DA 4DSSB 4HDEA 2RUEA 1KTEA 1TI1A 2VO4A 3RHCA 1NHYA 1U3AA 5ECLB 2HI7A 2JACA 2REMA 2FA4A 2C3NA 1I5GA 2EIQA 1HNBA 2HZEB 2LSTA 2H19A 3S9FA 3MDKA 4XS6A 1V40A 1SL2B 4TR1B 1QFNA 3W8JA 1PD21 3LFLA 1X5CA 14GSA 1B9XC 3BD2A 4TKYA 4WF4A 1ZGNA 1ZYQB 2HRFA 4Z7XA 4L5OA 3H4KA 1QQ2A 2H6ZA 4V2MA 1XWAA 2HXKA 2OBKA 1VF3A 1WJKA 2LJRA 2H30A 1Q4JA 2H66A 4KAEA 3W6GA 1GTIA 4KDXA 1OE8A 3VI7A 1S3AA 4F9ZA 4GF0A 2H0IA 1ZMAA 4P3YB 3D4TA 2FWHA 1J9BA 4QQ7A 6GSUA 2L57A 2GT5A 1ZCPA 2O87A 4KNDA 1GL8A 3ZIVA 3FW2A 1FW1A 1TRSA 2GQMA 1X9MB 2VD1A 3HVXA 4ULXA 5F0GA 1XVQA 1GWCA 5FT3A 5H5RA 1SKWB 1PL2A 4LL1B 5IPHA 5J5NA 4POLA 3KP9A 5KEJA 4LL4B 4XHMA 1JZDA 5HFIA 1ACVA 1S3CA 4IELA 1K0BA 1MTCA 5E4WA 2RLIA 6GSXA 5HR0A 5ECIB 4PGTA 1T4ZA 2K8SA 3IR4A 3VWUA 4WR5A 2RIIA 4K1FA 3GMFA 2ALBA 3DIEA 2X8GA 2WB9A 1ML6A 3APSA 2L6CA 3VURA 2IFQA 5D9XA 2DLXA 3FR9A 4PUFC 1TKDB 2GT6A 2H74A 2WS2A 3TJKA 1QK8A 5JCUA 4AJ7A 5GSSA
chains in the Genus database with same CATH superfamily
2QKEA 4MA9A 3OR5A 3W8SA 5ECRB 3IXRA 3BJ5A 2I81A 3US3A 1PN9A 2YJHA 3ZRDA 5G5FA 1MEKA 3Q18A 3UMAA 1EZKA 3TKPA 4EDYA 6GSYA 3M9KA 5ID2A 1TU8A 2GZZA 2O7KA 3DWVA 3TJJA 1TRVA 1AC1A 4HEA2 3I6AA 1XIYA 1GUMA 1LU4A 5J4UA 3Q74A 2JZRA 2M80A 5DVBA 2R2JA 3HCZA 2YZUA 4ICYA 2P5QA 2VL9A 4MDCA 4G2EA 3ZL5A 4EDZA 2H1DA 4BVYA 1A8YA 1FOVA 2LS5A 2PERA 1SU9A 4QL9A 4K7OA 4I2UA 3F4SA 3GUSA 3F4TA 3TRXA 4DVCA 3RHBA 2J23A 3GH6A 4IQAA 5F05A 4D73B 4IW9A 1WWJA 2YWOA 2CX3A 2K6VA 3LSZA 2WFCA 3H1NA 5GAPD 3I9V2 5ECMB 1DE2A 4KDUA 4MCUA 3SWLA 4GSNA 4XIHA 1R7HA 3N5OA 4K7NA 2H72A 2JADA 4OCFA 3QFAC 1ERWA 1GSSA 3ERGA 4PNGA 3J7Yb 9GSSA 2AAWA 4BVXA 3GTUB 4EE0A 1SL0B 4MP4A 2B7JA 3PH9A 5AN1A 1ERTA 1WRYA 5KN0A 4PURA 2E7PA 4G19A 1M3IA 1EP8A 4HS1A 2YCDA 3F6DA 2DJKA 4IQ1A 2PBJA 4E8EA 2FD3A 2YWNA 1J0FA 2C8UA 2F51A 5IQYA 1TK5B 4TXVA 3F9UA 4JU5A 3ME8A 1TK0B 1O85A 3GA4A 4ZBBA 1HNAA 2GZYA 4IBPA 2AYTA 3GSTA 2JZTA 3F8UA 3BCIA 2QGVA 2YWMA 2WGRA 1JZWA 3WT2A 1PL1A 2YOIA 2YZHA 4NHWA 5A4VA 3VPTA 2VL3A 4ZBDA 4HUAA 2AB6A 5DALA 1ZL9A 1GSYA 3D22A 1ZOFA 1YKAA 1BX9A 3FEUA 1OC8A 1AAZA 1EV9A 1GSDA 4F82A 4RI6A 1YJ6A 1JLVA 5IM9A 2IN3A 4IS0A 2OA7A 4MZCA 2XBIA 2A4VA 4N0ZA 3TJFA 4BPYA 2CAQA 4ZXGA 1EEJA 1GTBA 5KN2A 1WOUA 2QSIA 4DSQA 4K0NA 1N2AA 2OADA 4ZB6A 3L9VA 4J2FA 2IMEA 4ECCA 3O76A 1KBNA 4NV5A 2WDUA 4HQSA 2DJ1A 5C00A 3C8EA 3QDNA 3GRXA 4HI7A 3ZVJA 1LBKA 4ZBAA 3PGTA 1SYRA 2YJ7A 1T7PB 3FMWA 2LJKA 4ISDA 2IMDA 1YY7A 1UC7A 4GSTA 1XWGA 4X0XA 3RPPA 4ZL7A 3HDCA 3E9JB 5HR1A 1NM3A 2HFDA 1T4YA 1HYUA 1XZOA 3CSHA 4MMMA 2YWIA 3D21A 2C80A 4J56E 4WETA 3HZ8A 3LQ7A 1PKZA 2PN8A 4QL7A 2IPAA 5H5QA 4FYBA 3ZFBA 3KTBA 4ZIJA 1EOHA 3L9SA 5HR3A 1MD4A 3HVSA 4O5QA 1DE1A 2PPTA 2VCVA 4BWSA 2LJAA 2NTOA 5G1KA 1S3RA 4FO5A 4K5SA 4XCSA 2YP6A 3QAVA 2C0EA 1GSFA 3IRAA 1OC3A 5FHIA 3KH9A 1M99A 2IIYA 6GSWA 4PQIA 2N5FA 4I6XA 4EXJA 1RK4A 1T1VA 1EP7A 3MSZA 3MNGA 3LWAA 2I1UA 2GGTA 1SL1B 2OE3A 3PINA 4G0IA 2TIRA 5A4WA 2O89A 5ELAA 2IWTA 3M0FA 1F2EA 3I69A 1USBA 2B5YA 2KLXA 4RQXA 3ZLPA 1OYJA 1PX7A 4YQVA 5ECHB 1W89A 4JZQA 4WBRD 2HE3A 4IP1A 1GNWA 2UZ8A 3UARA 1AQVA 1O73A 4K2DA 2LUSA 5IMCA 2A2SA 3A2XA 1F3AA 4MH3A 2LRNA 2P5RA 8GSSA 3FHKA 2KHPA 4BL7B 1ON4A 3H8QA 5J41A 2YPMA 3GX8A 1K0CA 2M46A 1PN0A 5F07A 3TRPA 1AXDA 3TKSE 3L0HA 1IYHA 3IC4A 4PXOA 4IJIA 2DMMA 3O6TA 20GSA 2VLUA 2FWEA 1H4OA 4N11A 1OC9B 3LXTA 3ED3A 4Q5RA 1O8WA 2PVQA 1F37A 17GSA 3P7XA 1WPIA 1U3IA 2F8AA 1TU7A 4HJ2A 5LNKe 2XPEA 3GKMA 5B6MA 2CX4A 5HQPA 3LJRA 5ECOB 1EOGA 1Z3EA 1AW9A 4N0VA 2FWFA 1ZYEA 3QPMA 2DJ2A 5ECSA 4L8EA 1TK8B 3IK9A 1OKTA 3VFIA 2R37A 3GH9A 4DSSA 1DSBA 3HD5A 2LQQA 3KD0A 2HT9A 3LGCA 2NBSA 1GTUA 1H75A 4OFMA 3M8NA 5DCGA 16GSA 4LA1A 3L4NA 3ZYWA 2G2QA 1JLWA 2RM5A 4GCIA 1B9YC 4F03A 3HVVA 5IPGA 2HZEA 2VIMA 4O5UA 2VCQA 3Q6OA 4KUNA 4K0GA 1PMTA 4TR1A 2DJJA 3U5RE 2X8CA 1TI3A 3CRTA 3IAM2 2V41A 2CA8A 4OO4A 1HQOA 1A2MA 3F0IA 1FHEA 3V1WA 1YF1A 3IA1A 1EGOA 5CYYA 4MF7A 2D2ZA 4K2XA 2ZUPA 4POBA 3CTFA 2LTKA 4ML6A 1GSQA 4ID0A 3BBYA 3A2WA 1O8XA 2XPDA 1YQ1A 3DD3A 1X9WB 3CBUA 5B7CA 5G31A 1TP9A 2JL4A 1U88A 1V98A 4OWYA 2VM2A 2H76A 4TN8A 6GSSA 5DQYA 1GLQA 2HRKA 5ECPB 1K0MA 3TJBA 3C7MA 1AQWA 2R0PA 4MNNA 1G7EA 4XRDA 5DAKB 1AQXA 2XBQA 3D5JA 4V2LA 4MABA 3F3RA 1CQGA 5DDLA 2LQOA 4X1UA 4WF5A 4MF5A 5KOWA 5KN1A 1Y25A 4MPFA 5KOXA 1FVKA 1A0RP 3IHGA 3DYRA 2X4AA 5G1LA 5JCGA 4MPGA 1THOA 4I97A 3N9JA 2B5XA 1F6MC 4L0UA 5IO0A 1DBYA 5AISA 5A5KA 5IIZA 1QGVA 3ZZXA 1KEBA 3TRQA 3C73A 1W4VA 4RQRA 2MMAA 3KEBA 4POKA 2GDRA 1K3LA 1VF1A 2PMTA 1FB0A 3WGDA 1Z7PA 2OKAA 4ECJA 5ELGA 5ECKB 1BEDA 3GFKA 2VCXA 2HZFA 3G7IA 3VLNA 2R0GA 1M0UA 3F6FA 3CXGA 4OMVA 2HRNA 4K9ZA 1T8EB 2H0HA 2WJUA 1SD9A 3E3EA 4V1Ag 2H01A 4NXIA 3TCOA 2E2GA 3GHAA 3WYWA 3QCPA 3J7Yk 5ABRA 1WMJA 3TKQA 3QMXA 3HYPA 5GAND 1AUCA 3DEXA 1HNCA 1A2LA 4ILFA 1PFOA 2NPBA 1SJ6A 4TXOB 2CVDA 5CRGA 1MDJA 2R4VA 3KZQA 3AY8A 3FZ5A 4ML1A 2MMZA 4HSCX 2GLRA 1ILOA 1M2BA 5J9CA 1M9AA 1O81A 3ZMKA 4IHUA 4MJBA 3P2AA 4KCAA 3KXOA 4D73A 2YNXA 3G9BA 4MJCA 1X5EA 2GQKA 2B5EA 4KSMA 3D6IA 4X43A 4TRXA 3GL5A 5G2ZA 1G6WA 3RDWA 3NZNA 3K8NA 4TVEA 5INYA 3HA9A 3ZFLA 3LW9A 2CVKA 2GS3A 3QFBC 2FA8A 1NSWA 2MBSA 3UEMA 2RUFA 2HRAA 2HYXA 5G5EA 1JFUA 4O7HA 3GV1A 3A2VA 2KUCA 3KMOA 4PX1A 3GTUA 1EGRA 2ON7A 3LYKA 3EMPA 3KCMA 19GSA 3LORA 3UBKA 1OAZA 1PA3A 4ACSA 3IAS2 1BAYA 2IMIA 3ZREA 1R5PA 4OFNA 3UAPA 4O92A 4PQHA 1GUKA 2GSRA 3EU4A 1GH2A 2A2RA 1SK2A 2L4CA 2GVPA 4YKFA 5D8IA 1G7OA 3FYGA 5D73A 2OJLA 1V58A 4ZB9A 3CTGA 2G0FA 2F9SA 2B1LA 4EKZA 3TUEA 2OE1A 3HZ4A 1IYIA 2C3QA 2FLSA 1K0NA 2VAFA 4JE1A 3VWXA 2B3SA 3TJGA 2OE0A 2NVLA 5D9VA 4MH2A 4MK3A 4WKWA 4NMUA 3H79A 2N5AA 4JBBA 1K0DA 2K9FA 3DVXA 2GZPA 10GSA 3FZ9A 3LEFA 3KMNA 5CREA 3TB2A 2N5BA 4TOPA 1M9BA 1M3JA 2LRCA 3CSIA 2EIRA 2JSZA 1BYEA 3ME7A 4N10A 2FCHA 2L5OA 3PPUA 2AUVA 2FY6A 2ZCTA 5IOWA 1PKWA 1XPVA 3TKSC 3KH7A 2M72A 1VGLA 2VOCA 2DSAA 4G9HA 1MDIA 3GX0A 1EEMA 4Z2RA 1B8XA 2CQ9A 2L6DA 5B6NA 3CQFA 3BOAA 11GSA 5ECQB 1BQ7A 3FKFA 2VL2C 4EIPA 1T3BA 2B7KA 4BWQA 1PX6A 2VLTA 2K18A 4EL1A 2H71A 3FRCA 4FH8A 5J3RA 2H0GA 3EWLA 3A5WA 1OE7A 1OKDA 3UOMA 5CAXA 3WD6A 3IOSA 1XW6A 5D9TA 4ZL8A 2ZNMA 3GSSA 3BCKA 4EF0A 3LG6A 1B4QA 5CRHA 3HY2A 4WBJA 2H73A 3FY7A 1ZYNA 4YAVA 5GSTA 2O85A 2R6KA 1A2JA 3GYKA 2DIZA 4GXZA 1A0FA 3VPQA 4V1Ap 5A4UA 2FHEA 4K5RA 1KNGA 1A24A 1Z6MA 2BMXA 4L0WA 1V2AA 4KDYA 4ZILA 4XS4B 1VF2A 1XCCA 2IMFA 1R4WA 2DKHA 4YQUA 4Q5NA 1GUHA 1OVNA 5ENUA 5IO2A 1EV4A 4FYCA 18GSA 2QA2A 1JHBA 5CNWA 1QXHA 1RQMA 3U6VA 1SKRB 3KIJA 3KJYA 3ZMLA 1AIUA 3R2QA 3HJOA 4Z2UA 4TW5A 3IHQA 1Z5YE 1WP0A 4OO5A 1TTZA 1Z9HA 4WXTA 3EMXA 4MJEA 4EVMA 3GKKA 5IMZA 4I2TA 4WEYA 2TRXA 1MDKA 2LNTA 3RAZA 3HVNA 3TOTA 3GURA 2R3XA 1TW9A 4PTSA 5BMUA 1LJRA 1Y6EA 5ECNB 1WE0A 3TKSA 4DEJA 1THXA 4LMWA 2GQLA 1SYXA 4IN0A 5H5SA 5JWRB 4GLTA 4K7IA 4BL7A 2Z9SA 1SK0A 4OD7A 3UBLA 3L78A 5E59A 4EUYA 3GL3A 2VL2A 2CV4A 1OC9A 1YEPA 3IDVA 3MAKA 4MJAA 4PNFA 4KX4A 3FR3A 2ES7A 2VD0A 2TRCP 2K8VA 3P90A 1GLPA 4KH7A 1TOFA 2O8VB 4L5LA 1J08A 4XTSA 1XBSA 2JSYA 3KGKA 1R26A 2GSTA 5DCHA 1FOHA 4CW9A 4KSOA 1SJIA 1UVZA 1TDIA 2AJQB 3UVTA 3QD9A 1SK1A 2HLSA 1R5AA 1JZRA 1WIKA 1M7TA 4YQMA 4X4JA 4ECIA 2EC4A 2CAIA 1X9SB 1QMVA 1YZXA 4A5PA 1GSEA 2VLVA 1QUWA 1DUGA 4F0CA 1Z7RA 4XS1A 4J57E 3ZIJA 3C71A 4DSRA 4POMA 4HQZA 4HZ4A 4YAPA 2FNOA 3ZVJD 2L5LA 2MMNA 2YANA 5G30A 2MYGA 6GSTA 2V6KA 4KGIA 1E6BA 1U6TA 3DRNA 2V6OA 1YKCA 4MF6A 2WZ9A 1K0OA 2CZ2A 5HR2A 4NAXA 1CQHA 2C1YA 5D9WA 1C72A 4O32A 5AGYA 2H1GA 1K3OA 3FR6A 1YF0A 2C0FA 3GN3A 3QOUA 4KB3A 1HD2A 4PUAA 4NPBA 2FWGA 2DC5A 3EVIA 3DMLA 4MZBA 5KN3A 1K0AA 2PU9C 2YV7A 2IFQB 2HSHA 2LEGA 2YV9A 5EY6A 3DKSA 2MBTA 2BJXA 3IK7A 3UJ1A 3WGXA 3KP8A 3L9UA 2VCZA 2A2PA 3HJPA 1YDKA 1TRUA 4CDOA 2H1AA 3QR6A 4GSSA 4Z2TA 1XOAA 2LKUA 2DJ3A 3FZAA 2I4AA 1FO5A 1Z6NA 3TOUA 2R0CA 1TRWA 4IKHA 4KF9A 2X8HA 2I9HA 5IMDA 1RW1A 2DBCA 5ID2B 5DAKA 1F3BA 4RUVA 2IJYA 4K8MA 3G7JA 2HNLA 3IPZA 2EIOA 4NV2A 4IJ3A 3DGQA 4NWYA 4LMVA 5B8BA 1A23A 5FWGA 5D93A 3M9JA 1PSQA 4AGSA 2FUG2 4AF2A 2CZ3A 4BVYB 2IMKA 2JU5A 5J9BA 1FB6A 1Q98A 4TR4A 1X5DA 2E0QA 5DJMA 2CVBA 4WR4A 2DKIA 3HXSA 13GSA 4HZ2A 3HHVA 5EL8A 4HOJA 3TDGA 5L71A 1E2YA 3MIXA 4GTUA 2J9HA 3JCML 3C1SA 3GKXA 3F63A 2KP2A 3GIXA 1TXXA 3WGEA 1N8JA 1UA5A 1XOBA 1NHOA 1F9MA 1GTAA 4HU9A 4GQFA 3F3QA 1ERVA 4FYUA 2L59A 2H6YA 3CRUA 5JWOB 3UL3A 3CSJA 2P31A 4BVXB 12GSA 5DQSA 5IOXA 1A8LA 2DJ0A 4G0LA 1FVJA 3CMIA 2B1KA 1TJDA 3CYNA 4HJMA 3UIWA 1XFLA 5CO3A 2CT6A 5COHA 2MMOA 2BTOT 4JRRA 4ZL9A 1SENA 3FK8A 2JZSA 4FIWA 3DXBA 1MD3A 3VWVA 3ERWA 5CRDA 4ECBA 2WRTA 5HFGA 2RM6A 2VCTA 4TXOA 4I8BA 1ST9A 2KOKA 2XHFA 3GNJA 5JWQB 3NIVA 1O6JA 1XWBA 2LV3A 2VUPA 3UVHA 1GNEA 1V57A 3E0UA 3TGZA 4KA0A 3TKRA 1GRXA 2I3YA 5BRTA 5CP1A 2PUKC 4CY6A 5IMFA 5DALB 3ZITA 3MWHA 1U87A 2LRTA 3LXZA 2WULA 2X99A 4KE3A 2MZCA 2QC7A 4AJ6A 4BA7A 1EWXA 2V1MA 3D0ZA 4MLYA 1BG5A 5F8BA 2NDOA 1M2DA 5AIVA 4IVFA 5DBQA 3O3TA 1ERUA 4EC0A 3ZTLA 3NOFA 2C4JA 3M3MA 3F4RA 5B8AA 2H75A 1X0RA 1B48A 3IE3A 2IL3A 2VCWA 1FG4A 2AV4A 2E2MA 4F0BA 5C04A 2R5GA 4NHZA 2X64A 1FAAA 1SKSB 3HKRA 3RBTA 3IBHA 3VK9A 2YN1A 2AHEA 3APQA 3SBCA 1I9DA 2L4QA 1URMA 4V2NA 2F8FA 5LD0A 4EO3A 3RPNA 2HSMA 1G0TA 4GRFA 2C0GA 1ABAA 4IP6A 4FQUA 4YKGA 2H8LA 3EYTA 5D96A 5JCWA 1XWKA 1GULA 22GSA 3G7YA 2XC2A 4USSA 2H6XA 1O7UA 4G10A 2FGXA 5IMVA 4YH2A 1PRXA 2P0GA 3IV4A 4JEDA 5EVOA 1G6YA 4IGJA 4F2IA 2OACA 3C1RA 4MZWA 6GSVA 5GZZB 3VI5A 3EPTA 4JR4A 3D4MA 4H86A 1M2AA 3M1GA 1GP1A 3MYDA 3HJMA 1NW2A 2OBIA 1ZYPA 2DMLA 4AJ8A 3FZ4A 3LYPA 3KM6A 3EINA 1PQNA 1UN2A 2V2GA 5EPFA 4N30A 1T00A 2KP1A 1XXUA 3KTLA 7GSSA 3Q19A 2F3MA 1JZOA 5DJLA 1ZZYA 2PGTA 2H1BA 1PGTA 4GWRA 5F06A 5CRWA 4RI7A 1XW5A 4E8HA 3EURA 2GSSA 4O5RA 4XRAA 2HSYA 3P8WA 2C3TA 2GTUA 2GSQA 3EC3A 3GKNA 4LLRA 1YEXA 4I5QA 3DVWA 3PR8A 3QAWA 3ERFA 4Q5QA 4PQ1A 1B4PA 2LNSA 3QAGA 4OFTA 3IC8A 1SD8A 2PVOC 1V9WA 2VM1A 4KCEA 2DIYA 4CHSA 1BJXA 4OCEA 2V32A 2B6MA 4JR6A 4KW6A 1XWCA 2H70A 2PWJA 5AIXA 1S3DA 1XG8A 3EU3A 4ZB8A 2ON5A 4K6XA 1K3YA 3APOA 3H93A 3I43A 4XS4A 5HFKA 1VF4A 3VWWA 1VRSD 4EIQA 3ISOA 4TR3A 1XVWA 4GQCA 3A3TA 1XW9A 3WT1A 1GSUA 2WCIA 1SJZA 4TR0A 4HU7A 5IMAA 4Q5FA 5LCZA 3EE2A 2C0DA 4DSSB 4HDEA 2RUEA 4G0KA 1KTEA 1TI1A 2VO4A 3RHCA 1NHYA 1U3AA 5ECLB 2HI7A 2JACA 2REMA 2FA4A 2C3NA 1I5GA 2QA1A 2EIQA 1HNBA 2HZEB 3R3EA 2LSTA 2H19A 3S9FA 3MDKA 4XS6A 1V40A 1SL2B 4TR1B 1QFNA 3W8JA 1PD21 3LFLA 1X5CA 14GSA 1B9XC 3BD2A 4TKYA 4WF4A 1ZGNA 3A5IA 1ZYQB 2HRFA 4Z7XA 4L5OA 3H4KA 1QQ2A 2H6ZA 4V2MA 1XWAA 2HXKA 2OBKA 1VF3A 1WJKA 2LJRA 2H30A 1Q4JA 2H66A 4KAEA 3W6GA 1GTIA 4KDXA 1OE8A 3VI7A 1S3AA 4F9ZA 4GF0A 2H0IA 1ZMAA 4P3YB 3D4TA 2FWHA 1J9BA 4QQ7A 6GSUA 2L57A 2GT5A 1ZCPA 2O87A 4KNDA 1GL8A 3ZIVA 3FW2A 1FW1A 4BIKA 1TRSA 2GQMA 1X9MB 2VD1A 3HVXA 4ULXA 5F0GA 1XVQA 1GWCA 5FT3A 5H5RA 1SKWB 1PL2A 4LL1B 5IPHA 5J5NA 4POLA 3KP9A 5KEJA 4LL4B 4XHMA 1JZDA 5HFIA 1ACVA 1S3CA 2X49A 4IELA 1K0BA 1MTCA 5E4WA 2A4HA 2RLIA 6GSXA 5HR0A 5ECIB 4PGTA 1T4ZA 2K8SA 3IR4A 3VWUA 4WR5A 2RIIA 4K1FA 3GMFA 2ALBA 3DIEA 2X8GA 2WB9A 1ML6A 3APSA 2L6CA 3VURA 2IFQA 5D9XA 2DLXA 3FR9A 4PUFC 1TKDB 4CY8A 2GT6A 2H74A 2WS2A 3TJKA 1QK8A 5JCUA 4AJ7A 5GSSA
chains in the Genus database with same CATH topology
2QKEA 4MA9A 3OR5A 3W8SA 5ECRB 3IXRA 3BJ5A 2I81A 3US3A 1PN9A 2YJHA 3ZRDA 5G5FA 1MEKA 3Q18A 3UMAA 1EZKA 3TKPA 4EDYA 6GSYA 3M9KA 5ID2A 1TU8A 2GZZA 2O7KA 3DWVA 3TJJA 1TRVA 1AC1A 4HEA2 3I6AA 1XIYA 1GUMA 1LU4A 5J4UA 3Q74A 2JZRA 2M80A 5DVBA 2R2JA 3HCZA 2YZUA 4ICYA 2P5QA 2VL9A 4MDCA 4G2EA 3ZL5A 4EDZA 2H1DA 4BVYA 1A8YA 1FOVA 2LS5A 2PERA 1SU9A 4QL9A 4K7OA 4I2UA 3F4SA 3GUSA 3F4TA 3TRXA 4DVCA 3RHBA 2J23A 3GH6A 4IQAA 5F05A 4D73B 4IW9A 1WWJA 2YWOA 2CX3A 2K6VA 3LSZA 2WFCA 3H1NA 5GAPD 3I9V2 5ECMB 1DE2A 4KDUA 4MCUA 3SWLA 4GSNA 4XIHA 1R7HA 3N5OA 4K7NA 2H72A 2JADA 4OCFA 3QFAC 1ERWA 1GSSA 3ERGA 4PNGA 3J7Yb 9GSSA 2AAWA 4BVXA 3GTUB 4EE0A 1SL0B 4MP4A 2B7JA 3PH9A 5AN1A 1ERTA 1WRYA 5KN0A 4PURA 2E7PA 4G19A 1EP8A 4HS1A 2YCDA 3F6DA 2DJKA 4IQ1A 2PBJA 4E8EA 2FD3A 2YWNA 1J0FA 2C8UA 2F51A 5IQYA 1TK5B 4TXVA 3F9UA 4JU5A 3ME8A 1TK0B 1O85A 3GA4A 4ZBBA 1HNAA 2GZYA 4IBPA 2AYTA 3GSTA 2JZTA 3F8UA 3BCIA 2QGVA 2YWMA 2WGRA 1JZWA 3WT2A 1PL1A 2YOIA 2YZHA 4NHWA 5A4VA 3VPTA 2VL3A 4ZBDA 4HUAA 2AB6A 5DALA 1ZL9A 1GSYA 3D22A 1ZOFA 1YKAA 1BX9A 3FEUA 1OC8A 1AAZA 1EV9A 1GSDA 4F82A 4RI6A 1YJ6A 1JLVA 5IM9A 2IN3A 4IS0A 2OA7A 4MZCA 2XBIA 2A4VA 4N0ZA 3TJFA 4BPYA 2CAQA 4ZXGA 1EEJA 1GTBA 5KN2A 1WOUA 2QSIA 4DSQA 4K0NA 1N2AA 2OADA 4ZB6A 3L9VA 4J2FA 2IMEA 4ECCA 3O76A 1KBNA 4NV5A 2WDUA 4HQSA 2DJ1A 5C00A 3C8EA 3QDNA 3GRXA 4HI7A 3ZVJA 1LBKA 4ZBAA 3PGTA 1SYRA 2YJ7A 1T7PB 3FMWA 2LJKA 4ISDA 2IMDA 1YY7A 1UC7A 4GSTA 1XWGA 4X0XA 3RPPA 4ZL7A 3HDCA 3E9JB 5HR1A 1NM3A 2HFDA 1T4YA 1HYUA 1XZOA 3CSHA 4MMMA 2YWIA 3D21A 2C80A 4J56E 4WETA 3HZ8A 3LQ7A 1PKZA 2PN8A 4QL7A 2IPAA 5H5QA 4FYBA 3ZFBA 3KTBA 4ZIJA 1EOHA 3L9SA 5HR3A 1MD4A 3HVSA 4O5QA 1DE1A 2PPTA 2VCVA 4BWSA 2LJAA 2NTOA 5G1KA 4FO5A 4K5SA 4XCSA 2YP6A 3QAVA 2C0EA 1GSFA 3IRAA 1OC3A 5FHIA 3KH9A 1M99A 2IIYA 6GSWA 4PQIA 2N5FA 4I6XA 4EXJA 1RK4A 1T1VA 1EP7A 3MSZA 3MNGA 3LWAA 2I1UA 2GGTA 1SL1B 2OE3A 3PINA 4G0IA 2TIRA 5A4WA 2O89A 5ELAA 2IWTA 3M0FA 1F2EA 3I69A 1USBA 2B5YA 2KLXA 4RQXA 3ZLPA 1OYJA 1PX7A 4YQVA 5ECHB 1W89A 4JZQA 4WBRD 2HE3A 4IP1A 1GNWA 2UZ8A 3UARA 1AQVA 1O73A 4K2DA 2LUSA 5IMCA 2A2SA 3A2XA 1F3AA 4MH3A 2LRNA 2P5RA 8GSSA 3FHKA 2KHPA 4BL7B 1ON4A 3H8QA 5J41A 2YPMA 3GX8A 1K0CA 2M46A 1PN0A 5F07A 3TRPA 1AXDA 3TKSE 3L0HA 1IYHA 3IC4A 4PXOA 4IJIA 2DMMA 3O6TA 20GSA 2VLUA 2FWEA 1H4OA 4N11A 1OC9B 3LXTA 3ED3A 4Q5RA 1O8WA 2PVQA 1F37A 17GSA 3P7XA 1WPIA 1U3IA 2F8AA 1TU7A 4HJ2A 5LNKe 2XPEA 3GKMA 5B6MA 2CX4A 5HQPA 3LJRA 5ECOB 1EOGA 1Z3EA 1AW9A 4N0VA 2FWFA 1ZYEA 3QPMA 2DJ2A 5ECSA 4L8EA 1TK8B 3IK9A 1OKTA 3VFIA 2R37A 3GH9A 4DSSA 1DSBA 3HD5A 2LQQA 3KD0A 2HT9A 3LGCA 2NBSA 1GTUA 1H75A 4OFMA 3M8NA 5DCGA 16GSA 4LA1A 3L4NA 3ZYWA 2G2QA 1JLWA 2RM5A 4GCIA 1B9YC 4F03A 3HVVA 5IPGA 2HZEA 2VIMA 4O5UA 2VCQA 3Q6OA 4KUNA 4K0GA 1PMTA 4TR1A 2DJJA 3U5RE 2X8CA 1TI3A 3CRTA 3IAM2 2V41A 2CA8A 4OO4A 1HQOA 1A2MA 3F0IA 1FHEA 3V1WA 1YF1A 3IA1A 1EGOA 5CYYA 4MF7A 2D2ZA 4K2XA 2ZUPA 4POBA 3CTFA 2LTKA 4ML6A 1GSQA 4ID0A 3BBYA 3A2WA 1O8XA 2XPDA 1YQ1A 3DD3A 1X9WB 3CBUA 5B7CA 5G31A 1TP9A 2JL4A 1U88A 1V98A 4OWYA 2VM2A 2H76A 4TN8A 6GSSA 5DQYA 1GLQA 2HRKA 5ECPB 1K0MA 3TJBA 3C7MA 1AQWA 2R0PA 4MNNA 1G7EA 4XRDA 5DAKB 1AQXA 2XBQA 3D5JA 4V2LA 4MABA 3F3RA 1CQGA 5DDLA 2LQOA 4X1UA 4WF5A 4MF5A 5KOWA 5KN1A 1Y25A 4MPFA 5KOXA 1FVKA 1A0RP 3IHGA 3DYRA 2X4AA 5G1LA 5JCGA 4MPGA 1THOA 4I97A 3N9JA 2B5XA 1F6MC 4L0UA 5IO0A 1DBYA 5AISA 5A5KA 5IIZA 1QGVA 3ZZXA 1KEBA 3TRQA 3C73A 1W4VA 4RQRA 2MMAA 3KEBA 4POKA 2GDRA 1K3LA 1VF1A 2PMTA 1FB0A 3WGDA 1Z7PA 2OKAA 4ECJA 5ELGA 5ECKB 1BEDA 3GFKA 2VCXA 2HZFA 3G7IA 3VLNA 2R0GA 1M0UA 3F6FA 3CXGA 4OMVA 2HRNA 4K9ZA 1T8EB 2H0HA 2WJUA 1SD9A 3E3EA 4V1Ag 2H01A 4NXIA 3TCOA 2E2GA 3GHAA 3WYWA 3QCPA 3J7Yk 5ABRA 1WMJA 3TKQA 3QMXA 3HYPA 5GAND 1AUCA 3DEXA 1HNCA 1A2LA 4ILFA 2NPBA 1SJ6A 4TXOB 2CVDA 5CRGA 1MDJA 2R4VA 3KZQA 3AY8A 3FZ5A 4ML1A 2MMZA 2GLRA 1ILOA 1M2BA 5J9CA 1M9AA 1O81A 3ZMKA 4IHUA 4MJBA 3P2AA 4KCAA 3KXOA 4D73A 2YNXA 3G9BA 4MJCA 1X5EA 2GQKA 2B5EA 4KSMA 3D6IA 4X43A 4TRXA 3GL5A 5G2ZA 1G6WA 3RDWA 3NZNA 3K8NA 4TVEA 5INYA 3HA9A 3ZFLA 3LW9A 2CVKA 2GS3A 3QFBC 2FA8A 1NSWA 2MBSA 3UEMA 2RUFA 2HRAA 2HYXA 5G5EA 1JFUA 4O7HA 3GV1A 3A2VA 2KUCA 3KMOA 4PX1A 3GTUA 1EGRA 2ON7A 3LYKA 3EMPA 3KCMA 19GSA 3LORA 3UBKA 1OAZA 1PA3A 4ACSA 3IAS2 1BAYA 2IMIA 3ZREA 1R5PA 4OFNA 3UAPA 4O92A 4PQHA 1GUKA 2GSRA 3EU4A 1GH2A 2A2RA 1SK2A 2L4CA 2GVPA 4YKFA 5D8IA 1G7OA 3FYGA 5D73A 2OJLA 1V58A 4ZB9A 3CTGA 2G0FA 2F9SA 2B1LA 4EKZA 3TUEA 2OE1A 3HZ4A 1IYIA 2C3QA 2FLSA 1K0NA 2VAFA 4JE1A 3VWXA 2B3SA 3TJGA 2OE0A 2NVLA 5D9VA 4MH2A 4MK3A 4WKWA 4NMUA 3H79A 2N5AA 4JBBA 1K0DA 2K9FA 3DVXA 2GZPA 10GSA 3FZ9A 3LEFA 3KMNA 5CREA 3TB2A 2N5BA 4TOPA 1M9BA 2LRCA 3CSIA 2EIRA 2JSZA 1BYEA 3ME7A 4N10A 2FCHA 2L5OA 3PPUA 2AUVA 2FY6A 2ZCTA 5IOWA 1PKWA 1XPVA 3TKSC 3KH7A 2M72A 1VGLA 2VOCA 2DSAA 4G9HA 1MDIA 3GX0A 1EEMA 4Z2RA 1B8XA 2CQ9A 2L6DA 5B6NA 3BOAA 11GSA 5ECQB 1BQ7A 3FKFA 2VL2C 4EIPA 1T3BA 2B7KA 4BWQA 1PX6A 2VLTA 2K18A 4EL1A 2H71A 3FRCA 4FH8A 5J3RA 2H0GA 3EWLA 3A5WA 1OE7A 1OKDA 3UOMA 5CAXA 3WD6A 3IOSA 1XW6A 5D9TA 4ZL8A 2ZNMA 3GSSA 3BCKA 4EF0A 3LG6A 1B4QA 5CRHA 3HY2A 4WBJA 2H73A 3FY7A 1ZYNA 4YAVA 5GSTA 2O85A 2R6KA 1A2JA 3GYKA 2DIZA 4GXZA 1A0FA 3VPQA 4V1Ap 5A4UA 2FHEA 4K5RA 1KNGA 1A24A 1Z6MA 2BMXA 4L0WA 1V2AA 4KDYA 4ZILA 4XS4B 1VF2A 1XCCA 2IMFA 1R4WA 2DKHA 4YQUA 4Q5NA 1GUHA 1OVNA 5ENUA 5IO2A 1EV4A 4FYCA 18GSA 2QA2A 1JHBA 5CNWA 1QXHA 1RQMA 3U6VA 1SKRB 3KIJA 3KJYA 3ZMLA 1AIUA 3R2QA 3HJOA 4Z2UA 4TW5A 3IHQA 1Z5YE 1WP0A 4OO5A 1TTZA 1Z9HA 4WXTA 3EMXA 4MJEA 4EVMA 3GKKA 5IMZA 4I2TA 4WEYA 2TRXA 1MDKA 2LNTA 3RAZA 3TOTA 3GURA 2R3XA 1TW9A 4PTSA 5BMUA 1LJRA 1Y6EA 5ECNB 1WE0A 3TKSA 4DEJA 1THXA 4LMWA 2GQLA 1SYXA 4IN0A 5H5SA 5JWRB 4GLTA 4K7IA 4BL7A 2Z9SA 1SK0A 4OD7A 3UBLA 3L78A 5E59A 4EUYA 3GL3A 2VL2A 2CV4A 1OC9A 1YEPA 3IDVA 3MAKA 4MJAA 4PNFA 4KX4A 3FR3A 2ES7A 2VD0A 2TRCP 2K8VA 3P90A 1GLPA 4KH7A 1TOFA 2O8VB 4L5LA 1J08A 4XTSA 1XBSA 2JSYA 3KGKA 1R26A 2GSTA 5DCHA 1FOHA 4CW9A 4KSOA 1SJIA 1UVZA 1TDIA 2AJQB 3UVTA 3QD9A 1SK1A 2HLSA 1R5AA 1JZRA 1WIKA 1M7TA 4YQMA 4X4JA 4ECIA 2EC4A 2CAIA 1X9SB 1QMVA 1YZXA 4A5PA 1GSEA 2VLVA 1QUWA 1DUGA 4F0CA 1Z7RA 4XS1A 4J57E 3ZIJA 3C71A 4DSRA 4POMA 4HQZA 4HZ4A 4YAPA 2FNOA 3ZVJD 2L5LA 2MMNA 2YANA 5G30A 2MYGA 6GSTA 2V6KA 4KGIA 1E6BA 1U6TA 3DRNA 2V6OA 1YKCA 4MF6A 2WZ9A 1K0OA 2CZ2A 5HR2A 4NAXA 1CQHA 2C1YA 5D9WA 1C72A 4O32A 5AGYA 2H1GA 1K3OA 3FR6A 1YF0A 2C0FA 3GN3A 3QOUA 4KB3A 1HD2A 4PUAA 4NPBA 2FWGA 2DC5A 3EVIA 3DMLA 4MZBA 5KN3A 1K0AA 2PU9C 2YV7A 2IFQB 2HSHA 2LEGA 2YV9A 5EY6A 3DKSA 2MBTA 2BJXA 3IK7A 3UJ1A 3WGXA 3KP8A 3L9UA 2VCZA 2A2PA 3HJPA 1YDKA 1TRUA 4CDOA 2H1AA 3QR6A 4GSSA 4Z2TA 1XOAA 2LKUA 2DJ3A 3FZAA 2I4AA 1FO5A 1Z6NA 3TOUA 2R0CA 1TRWA 4IKHA 4KF9A 2X8HA 2I9HA 5IMDA 1RW1A 2DBCA 5ID2B 5DAKA 1F3BA 4RUVA 2IJYA 4K8MA 3G7JA 2HNLA 3IPZA 2EIOA 4NV2A 4IJ3A 3DGQA 4NWYA 4LMVA 5B8BA 1A23A 5FWGA 5D93A 3M9JA 1PSQA 4AGSA 2FUG2 4AF2A 2CZ3A 4BVYB 2IMKA 2JU5A 5J9BA 1FB6A 1Q98A 4TR4A 1X5DA 2E0QA 5DJMA 2CVBA 4WR4A 2DKIA 3HXSA 13GSA 4HZ2A 3HHVA 5EL8A 4HOJA 3TDGA 5L71A 1E2YA 3MIXA 4GTUA 2J9HA 3JCML 3C1SA 3GKXA 3F63A 2KP2A 3GIXA 1TXXA 3WGEA 1N8JA 1UA5A 1XOBA 1NHOA 1F9MA 1GTAA 4HU9A 4GQFA 3F3QA 1ERVA 4FYUA 2L59A 2H6YA 3CRUA 5JWOB 3UL3A 3CSJA 2P31A 4BVXB 12GSA 5DQSA 5IOXA 1A8LA 2DJ0A 4G0LA 1FVJA 3CMIA 2B1KA 1TJDA 3CYNA 4HJMA 3UIWA 1XFLA 5CO3A 2CT6A 5COHA 2MMOA 2BTOT 4JRRA 4ZL9A 1SENA 3FK8A 2JZSA 4FIWA 3DXBA 1MD3A 3VWVA 3ERWA 5CRDA 4ECBA 2WRTA 5HFGA 2RM6A 2VCTA 4TXOA 4I8BA 1ST9A 2KOKA 2XHFA 3GNJA 5JWQB 3NIVA 1O6JA 1XWBA 2LV3A 2VUPA 3UVHA 1GNEA 1V57A 3E0UA 3TGZA 4KA0A 3TKRA 1GRXA 2I3YA 5BRTA 5CP1A 2PUKC 4CY6A 5IMFA 5DALB 3ZITA 3MWHA 1U87A 2LRTA 3LXZA 2WULA 2X99A 4KE3A 2MZCA 2QC7A 4AJ6A 4BA7A 1EWXA 2V1MA 3D0ZA 4MLYA 1BG5A 5F8BA 2NDOA 1M2DA 5AIVA 4IVFA 5DBQA 3O3TA 1ERUA 4EC0A 3ZTLA 3NOFA 2C4JA 3M3MA 3F4RA 5B8AA 2H75A 1X0RA 1B48A 3IE3A 2IL3A 2VCWA 1FG4A 2AV4A 2E2MA 4F0BA 5C04A 2R5GA 4NHZA 2X64A 1FAAA 1SKSB 3HKRA 3RBTA 3IBHA 3VK9A 2YN1A 2AHEA 3APQA 3SBCA 1I9DA 2L4QA 1URMA 4V2NA 2F8FA 5LD0A 4EO3A 3RPNA 2HSMA 1G0TA 4GRFA 2C0GA 1ABAA 4IP6A 4FQUA 4YKGA 2H8LA 3EYTA 5D96A 5JCWA 1XWKA 1GULA 22GSA 3G7YA 2XC2A 4USSA 2H6XA 1O7UA 4G10A 2FGXA 5IMVA 4YH2A 1PRXA 2P0GA 3IV4A 4JEDA 5EVOA 1G6YA 4IGJA 4F2IA 2OACA 3C1RA 4MZWA 6GSVA 5GZZB 3VI5A 3EPTA 4JR4A 3D4MA 4H86A 1M2AA 3M1GA 1GP1A 3MYDA 3HJMA 1NW2A 2OBIA 1ZYPA 2DMLA 4AJ8A 3FZ4A 3LYPA 3KM6A 3EINA 1PQNA 1UN2A 2V2GA 5EPFA 4N30A 1T00A 2KP1A 1XXUA 3KTLA 7GSSA 3Q19A 2F3MA 1JZOA 5DJLA 1ZZYA 2PGTA 2H1BA 1PGTA 4GWRA 5F06A 5CRWA 4RI7A 1XW5A 4E8HA 3EURA 2GSSA 4O5RA 4XRAA 2HSYA 3P8WA 2C3TA 2GTUA 2GSQA 3EC3A 3GKNA 4LLRA 1YEXA 4I5QA 3DVWA 3PR8A 3QAWA 3ERFA 4Q5QA 4PQ1A 1B4PA 2LNSA 3QAGA 4OFTA 3IC8A 1SD8A 2PVOC 1V9WA 2VM1A 4KCEA 2DIYA 4CHSA 1BJXA 4OCEA 2V32A 2B6MA 4JR6A 4KW6A 1XWCA 2H70A 2PWJA 5AIXA 1S3DA 3EU3A 4ZB8A 2ON5A 4K6XA 1K3YA 3APOA 3H93A 3I43A 4XS4A 5HFKA 1VF4A 3VWWA 1VRSD 4EIQA 3ISOA 4TR3A 1XVWA 4GQCA 3A3TA 1XW9A 3WT1A 1GSUA 2WCIA 1SJZA 4TR0A 4HU7A 5IMAA 4Q5FA 5LCZA 3EE2A 2C0DA 4DSSB 4HDEA 2RUEA 4G0KA 1KTEA 1TI1A 2VO4A 3RHCA 1NHYA 1U3AA 5ECLB 2HI7A 2JACA 2REMA 2FA4A 2C3NA 1I5GA 2QA1A 2EIQA 1HNBA 2HZEB 3R3EA 2LSTA 2H19A 3S9FA 3MDKA 4XS6A 1V40A 1SL2B 4TR1B 1QFNA 3W8JA 1PD21 3LFLA 1X5CA 14GSA 1B9XC 3BD2A 4TKYA 4WF4A 1ZGNA 3A5IA 1ZYQB 2HRFA 4Z7XA 4L5OA 3H4KA 1QQ2A 2H6ZA 4V2MA 1XWAA 2HXKA 2OBKA 1VF3A 1WJKA 2LJRA 2H30A 1Q4JA 2H66A 4KAEA 3W6GA 1GTIA 4KDXA 1OE8A 3VI7A 1S3AA 4F9ZA 4GF0A 2H0IA 1ZMAA 4P3YB 3D4TA 2FWHA 1J9BA 4QQ7A 6GSUA 2L57A 2GT5A 1ZCPA 2O87A 4KNDA 1GL8A 3ZIVA 3FW2A 1FW1A 1TRSA 2GQMA 1X9MB 2VD1A 3HVXA 4ULXA 5F0GA 1XVQA 1GWCA 5FT3A 5H5RA 1SKWB 1PL2A 4LL1B 5IPHA 5J5NA 4POLA 3KP9A 5KEJA 4LL4B 4XHMA 1JZDA 5HFIA 1ACVA 1S3CA 2X49A 4IELA 1K0BA 1MTCA 5E4WA 2A4HA 2RLIA 6GSXA 5HR0A 5ECIB 4PGTA 1T4ZA 2K8SA 3IR4A 3VWUA 4WR5A 2RIIA 4K1FA 3GMFA 2ALBA 3DIEA 2X8GA 2WB9A 1ML6A 3APSA 2L6CA 3VURA 2IFQA 5D9XA 2DLXA 3FR9A 4PUFC 1TKDB 4CY8A 2GT6A 2H74A 2WS2A 3TJKA 1QK8A 5JCUA 4AJ7A 5GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKE A;  4MA9 A;  3OR5 A;  3W8S A;  5ECR B;  3IXR A;  3BJ5 A;  2I81 A;  3US3 A;  1PN9 A;  2YJH A;  3ZRD A;  5G5F A;  1MEK A;  3Q18 A;  3UMA A;  1EZK A;  3TKP A;  4EDY A;  6GSY A;  3M9K A;  5ID2 A;  1TU8 A;  2GZZ A;  2O7K A;  3DWV A;  3TJJ A;  1TRV A;  1AC1 A;  4HEA 2;  3I6A A;  1XIY A;  1GUM A;  1LU4 A;  5J4U A;  3Q74 A;  2JZR A;  2M80 A;  5DVB A;  2R2J A;  3HCZ A;  2YZU A;  2P5Q A;  2VL9 A;  4MDC A;  4G2E A;  3ZL5 A;  4EDZ A;  2H1D A;  4BVY A;  1A8Y A;  1FOV A;  2LS5 A;  2PER A;  1SU9 A;  4QL9 A;  4K7O A;  4I2U A;  3F4S A;  3GUS A;  3F4T A;  3TRX A;  4DVC A;  3RHB A;  2J23 A;  3GH6 A;  4IQA A;  5F05 A;  4D73 B;  4IW9 A;  1WWJ A;  2YWO A;  2CX3 A;  2K6V A;  3LSZ A;  2WFC A;  3H1N A;  5GAP D;  3I9V 2;  5ECM B;  1DE2 A;  4KDU A;  4MCU A;  3SWL A;  4GSN A;  4XIH A;  1R7H A;  3N5O A;  4K7N A;  2H72 A;  2JAD A;  4OCF A;  3QFA C;  1ERW A;  1GSS A;  3ERG A;  4PNG A;  3J7Y b;  9GSS A;  2AAW A;  4BVX A;  3GTU B;  4EE0 A;  1SL0 B;  4MP4 A;  2B7J A;  3PH9 A;  5AN1 A;  1ERT A;  1WRY A;  5KN0 A;  4PUR A;  2E7P A;  4G19 A;  1EP8 A;  4HS1 A;  2YCD A;  3F6D A;  2DJK A;  4IQ1 A;  2PBJ A;  4E8E A;  2FD3 A;  2YWN A;  1J0F A;  2C8U A;  2F51 A;  5IQY A;  1TK5 B;  4TXV A;  3F9U A;  4JU5 A;  3ME8 A;  1TK0 B;  1O85 A;  3GA4 A;  4ZBB A;  1HNA A;  2GZY A;  4IBP A;  2AYT A;  3GST A;  2JZT A;  3F8U A;  3BCI A;  2QGV A;  2YWM A;  2WGR A;  1JZW A;  3WT2 A;  1PL1 A;  2YOI A;  2YZH A;  4NHW A;  5A4V A;  3VPT A;  2VL3 A;  4ZBD A;  4HUA A;  2AB6 A;  5DAL A;  1ZL9 A;  1GSY A;  3D22 A;  1ZOF A;  1YKA A;  1BX9 A;  3FEU A;  1OC8 A;  1AAZ A;  1EV9 A;  1GSD A;  4F82 A;  4RI6 A;  1YJ6 A;  1JLV A;  5IM9 A;  2IN3 A;  4IS0 A;  2OA7 A;  4MZC A;  2XBI A;  2A4V A;  4N0Z A;  3TJF A;  4BPY A;  2CAQ A;  4ZXG A;  1EEJ A;  1GTB A;  5KN2 A;  1WOU A;  2QSI A;  4DSQ A;  4K0N A;  1N2A A;  2OAD A;  4ZB6 A;  3L9V A;  4J2F A;  2IME A;  4ECC A;  3O76 A;  1KBN A;  4NV5 A;  2WDU A;  4HQS A;  2DJ1 A;  5C00 A;  3C8E A;  3QDN A;  3GRX A;  4HI7 A;  3ZVJ A;  1LBK A;  4ZBA A;  3PGT A;  1SYR A;  2YJ7 A;  1T7P B;  2LJK A;  4ISD A;  2IMD A;  1YY7 A;  1UC7 A;  4GST A;  1XWG A;  4X0X A;  3RPP A;  4ZL7 A;  3HDC A;  3E9J B;  5HR1 A;  1NM3 A;  2HFD A;  1T4Y A;  1HYU A;  1XZO A;  3CSH A;  4MMM A;  2YWI A;  3D21 A;  2C80 A;  4J56 E;  4WET A;  3HZ8 A;  3LQ7 A;  1PKZ A;  2PN8 A;  4QL7 A;  2IPA A;  5H5Q A;  4FYB A;  3ZFB A;  3KTB A;  4ZIJ A;  1EOH A;  3L9S A;  5HR3 A;  1MD4 A;  3HVS A;  1DE1 A;  2PPT A;  2VCV A;  4BWS A;  2LJA A;  2NTO A;  5G1K A;  4FO5 A;  4XCS A;  2YP6 A;  3QAV A;  2C0E A;  1GSF A;  3IRA A;  1OC3 A;  5FHI A;  3KH9 A;  1M99 A;  2IIY A;  6GSW A;  4PQI A;  2N5F A;  4I6X A;  4EXJ A;  1RK4 A;  1T1V A;  1EP7 A;  3MSZ A;  3MNG A;  3LWA A;  2I1U A;  2GGT A;  1SL1 B;  2OE3 A;  3PIN A;  2TIR A;  5A4W A;  2O89 A;  5ELA A;  2IWT A;  3M0F A;  1F2E A;  3I69 A;  1USB A;  2B5Y A;  2KLX A;  4RQX A;  3ZLP A;  1OYJ A;  1PX7 A;  4YQV A;  5ECH B;  1W89 A;  4JZQ A;  4WBR D;  2HE3 A;  4IP1 A;  1GNW A;  3UAR A;  1AQV A;  1O73 A;  4K2D A;  2LUS A;  5IMC A;  2A2S A;  3A2X A;  1F3A A;  4MH3 A;  2LRN A;  2P5R A;  8GSS A;  3FHK A;  2KHP A;  1ON4 A;  3H8Q A;  5J41 A;  2YPM A;  3GX8 A;  1K0C A;  2M46 A;  5F07 A;  3TRP A;  1AXD A;  3TKS E;  3L0H A;  1IYH A;  3IC4 A;  4PXO A;  4IJI A;  2DMM A;  3O6T A;  20GS A;  2VLU A;  2FWE A;  1H4O A;  4N11 A;  1OC9 B;  3LXT A;  3ED3 A;  4Q5R A;  1O8W A;  2PVQ A;  1F37 A;  17GS A;  3P7X A;  1WPI A;  1U3I A;  2F8A A;  1TU7 A;  4HJ2 A;  5LNK e;  2XPE A;  3GKM A;  5B6M A;  2CX4 A;  5HQP A;  3LJR A;  5ECO B;  1EOG A;  1Z3E A;  1AW9 A;  4N0V A;  2FWF A;  1ZYE A;  3QPM A;  2DJ2 A;  5ECS A;  4L8E A;  1TK8 B;  3IK9 A;  1OKT A;  3VFI A;  2R37 A;  3GH9 A;  4DSS A;  1DSB A;  3HD5 A;  2LQQ A;  3KD0 A;  2HT9 A;  3LGC A;  2NBS A;  1GTU A;  1H75 A;  4OFM A;  3M8N A;  5DCG A;  16GS A;  4LA1 A;  3L4N A;  3ZYW A;  2G2Q A;  1JLW A;  2RM5 A;  4GCI A;  1B9Y C;  4F03 A;  3HVV A;  5IPG A;  2HZE A;  2VIM A;  2VCQ A;  3Q6O A;  4KUN A;  4K0G A;  1PMT A;  4TR1 A;  2DJJ A;  3U5R E;  2X8C A;  1TI3 A;  3CRT A;  3IAM 2;  2V41 A;  2CA8 A;  4OO4 A;  1HQO A;  1A2M A;  3F0I A;  1FHE A;  3V1W A;  1YF1 A;  3IA1 A;  1EGO A;  5CYY A;  4MF7 A;  2D2Z A;  2ZUP A;  4POB A;  3CTF A;  2LTK A;  4ML6 A;  1GSQ A;  4ID0 A;  3BBY A;  3A2W A;  1O8X A;  2XPD A;  1YQ1 A;  3DD3 A;  1X9W B;  3CBU A;  5B7C A;  5G31 A;  1TP9 A;  2JL4 A;  1U88 A;  1V98 A;  4OWY A;  2VM2 A;  2H76 A;  4TN8 A;  6GSS A;  5DQY A;  1GLQ A;  5ECP B;  1K0M A;  3TJB A;  3C7M A;  1AQW A;  1G7E A;  4XRD A;  5DAK B;  1AQX A;  2XBQ A;  3D5J A;  4V2L A;  4MAB A;  3F3R A;  1CQG A;  5DDL A;  2LQO A;  4X1U A;  4WF5 A;  4MF5 A;  5KN1 A;  1Y25 A;  4MPF A;  1FVK A;  1A0R P;  3DYR A;  5G1L A;  5JCG A;  4MPG A;  1THO A;  4I97 A;  3N9J A;  2B5X A;  1F6M C;  4L0U A;  5IO0 A;  1DBY A;  5AIS A;  5A5K A;  5IIZ A;  1QGV A;  3ZZX A;  1KEB A;  3TRQ A;  3C73 A;  1W4V A;  4RQR A;  2MMA A;  3KEB A;  4POK A;  2GDR A;  1K3L A;  1VF1 A;  2PMT A;  1FB0 A;  3WGD A;  1Z7P A;  2OKA A;  4ECJ A;  5ELG A;  5ECK B;  1BED A;  3GFK A;  2VCX A;  2HZF A;  3G7I A;  3VLN A;  1M0U A;  3F6F A;  3CXG A;  4OMV A;  2HRN A;  4K9Z A;  1T8E B;  2H0H A;  2WJU A;  1SD9 A;  3E3E A;  4V1A g;  2H01 A;  4NXI A;  3TCO A;  2E2G A;  3GHA A;  3WYW A;  3QCP A;  3J7Y k;  5ABR A;  1WMJ A;  3TKQ A;  3QMX A;  3HYP A;  5GAN D;  1AUC A;  3DEX A;  1HNC A;  1A2L A;  4ILF A;  2NPB A;  1SJ6 A;  4TXO B;  2CVD A;  5CRG A;  1MDJ A;  2R4V A;  3KZQ A;  3AY8 A;  3FZ5 A;  4ML1 A;  2MMZ A;  2GLR A;  1ILO A;  1M2B A;  5J9C A;  1M9A A;  1O81 A;  3ZMK A;  4IHU A;  4MJB A;  3P2A A;  4KCA A;  3KXO A;  4D73 A;  2YNX A;  3G9B A;  4MJC A;  1X5E A;  2GQK A;  2B5E A;  4KSM A;  3D6I A;  4X43 A;  4TRX A;  3GL5 A;  5G2Z A;  1G6W A;  3RDW A;  3NZN A;  3K8N A;  4TVE A;  5INY A;  3HA9 A;  3ZFL A;  2CVK A;  2GS3 A;  3QFB C;  2FA8 A;  1NSW A;  2MBS A;  3UEM A;  2RUF A;  2HYX A;  5G5E A;  1JFU A;  4O7H A;  3GV1 A;  3A2V A;  2KUC A;  3KMO A;  4PX1 A;  3GTU A;  1EGR A;  2ON7 A;  3LYK A;  3EMP A;  3KCM A;  19GS A;  3LOR A;  3UBK A;  1OAZ A;  1PA3 A;  4ACS A;  3IAS 2;  1BAY A;  2IMI A;  3ZRE A;  1R5P A;  4OFN A;  3UAP A;  4O92 A;  4PQH A;  1GUK A;  2GSR A;  3EU4 A;  1GH2 A;  2A2R A;  1SK2 A;  2L4C A;  2GVP A;  5D8I A;  1G7O A;  3FYG A;  5D73 A;  2OJL A;  1V58 A;  4ZB9 A;  3CTG A;  2G0F A;  2F9S A;  2B1L A;  4EKZ A;  3TUE A;  2OE1 A;  3HZ4 A;  1IYI A;  2C3Q A;  2FLS A;  1K0N A;  2VAF A;  4JE1 A;  3VWX A;  2B3S A;  3TJG A;  2OE0 A;  2NVL A;  5D9V A;  4MH2 A;  4MK3 A;  4WKW A;  4NMU A;  3H79 A;  2N5A A;  4JBB A;  1K0D A;  2K9F A;  3DVX A;  2GZP A;  10GS A;  3FZ9 A;  3LEF A;  3KMN A;  5CRE A;  3TB2 A;  2N5B A;  4TOP A;  1M9B A;  2LRC A;  3CSI A;  2EIR A;  2JSZ A;  1BYE A;  3ME7 A;  4N10 A;  2FCH A;  2L5O A;  2AUV A;  2FY6 A;  2ZCT A;  5IOW A;  1PKW A;  1XPV A;  3TKS C;  3KH7 A;  2M72 A;  1VGL A;  2VOC A;  2DSA A;  4G9H A;  1MDI A;  3GX0 A;  1EEM A;  1B8X A;  2CQ9 A;  2L6D A;  5B6N A;  3BOA A;  11GS A;  5ECQ B;  1BQ7 A;  3FKF A;  2VL2 C;  1T3B A;  2B7K A;  4BWQ A;  1PX6 A;  2VLT A;  2K18 A;  4EL1 A;  2H71 A;  3FRC A;  4FH8 A;  5J3R A;  2H0G A;  3EWL A;  3A5W A;  1OE7 A;  1OKD A;  3UOM A;  5CAX A;  3WD6 A;  3IOS A;  1XW6 A;  5D9T A;  4ZL8 A;  2ZNM A;  3GSS A;  3BCK A;  4EF0 A;  3LG6 A;  1B4Q A;  5CRH A;  3HY2 A;  4WBJ A;  2H73 A;  3FY7 A;  4YAV A;  5GST A;  2O85 A;  2R6K A;  1A2J A;  3GYK A;  2DIZ A;  4GXZ A;  1A0F A;  3VPQ A;  4V1A p;  5A4U A;  2FHE A;  1KNG A;  1A24 A;  1Z6M A;  2BMX A;  4L0W A;  1V2A A;  4KDY A;  4ZIL A;  4XS4 B;  1VF2 A;  1XCC A;  2IMF A;  1R4W A;  4YQU A;  4Q5N A;  1GUH A;  1OVN A;  5ENU A;  5IO2 A;  1EV4 A;  4FYC A;  18GS A;  1JHB A;  5CNW A;  1QXH A;  1RQM A;  3U6V A;  1SKR B;  3KIJ A;  3KJY A;  3ZML A;  1AIU A;  3R2Q A;  3HJO A;  4TW5 A;  3IHQ A;  1Z5Y E;  1WP0 A;  4OO5 A;  1TTZ A;  1Z9H A;  4WXT A;  3EMX A;  4MJE A;  4EVM A;  3GKK A;  5IMZ A;  4I2T A;  4WEY A;  2TRX A;  1MDK A;  2LNT A;  3RAZ A;  3TOT A;  3GUR A;  2R3X A;  1TW9 A;  1LJR A;  1Y6E A;  5ECN B;  1WE0 A;  3TKS A;  4DEJ A;  1THX A;  4LMW A;  2GQL A;  1SYX A;  4IN0 A;  5H5S A;  5JWR B;  4GLT A;  4K7I A;  4BL7 A;  2Z9S A;  1SK0 A;  4OD7 A;  3UBL A;  3L78 A;  5E59 A;  4EUY A;  3GL3 A;  2VL2 A;  2CV4 A;  1OC9 A;  1YEP A;  3IDV A;  3MAK A;  4MJA A;  4PNF A;  4KX4 A;  3FR3 A;  2ES7 A;  2VD0 A;  2TRC P;  2K8V A;  3P90 A;  1GLP A;  4KH7 A;  1TOF A;  2O8V B;  4L5L A;  1J08 A;  4XTS A;  1XBS A;  2JSY A;  3KGK A;  1R26 A;  2GST A;  5DCH A;  4CW9 A;  4KSO A;  1SJI A;  1UVZ A;  1TDI A;  2AJQ B;  3UVT A;  3QD9 A;  1SK1 A;  2HLS A;  1R5A A;  1JZR A;  1WIK A;  1M7T A;  4YQM A;  4ECI A;  2EC4 A;  2CAI A;  1X9S B;  1QMV A;  1YZX A;  1GSE A;  2VLV A;  1QUW A;  1DUG A;  4F0C A;  1Z7R A;  4XS1 A;  4J57 E;  3ZIJ A;  3C71 A;  4DSR A;  4POM A;  4HQZ A;  4HZ4 A;  4YAP A;  2FNO A;  3ZVJ D;  2L5L A;  2MMN A;  2YAN A;  5G30 A;  2MYG A;  6GST A;  2V6K A;  4KGI A;  1E6B A;  1U6T A;  3DRN A;  2V6O A;  1YKC A;  4MF6 A;  2WZ9 A;  1K0O A;  2CZ2 A;  5HR2 A;  4NAX A;  1CQH A;  2C1Y A;  5D9W A;  1C72 A;  4O32 A;  5AGY A;  2H1G A;  1K3O A;  3FR6 A;  1YF0 A;  2C0F A;  3GN3 A;  3QOU A;  4KB3 A;  1HD2 A;  4PUA A;  4NPB A;  2FWG A;  2DC5 A;  3EVI A;  3DML A;  4MZB A;  5KN3 A;  1K0A A;  2PU9 C;  2YV7 A;  2IFQ B;  2HSH A;  2LEG A;  2YV9 A;  5EY6 A;  3DKS A;  2MBT A;  2BJX A;  3IK7 A;  3UJ1 A;  3WGX A;  3KP8 A;  3L9U A;  2VCZ A;  3HJP A;  1YDK A;  1TRU A;  4CDO A;  2H1A A;  3QR6 A;  4GSS A;  1XOA A;  2LKU A;  2DJ3 A;  3FZA A;  2I4A A;  1FO5 A;  1Z6N A;  3TOU A;  1TRW A;  4IKH A;  2X8H A;  2I9H A;  5IMD A;  1RW1 A;  2DBC A;  5ID2 B;  5DAK A;  1F3B A;  4RUV A;  2IJY A;  4K8M A;  3G7J A;  2HNL A;  3IPZ A;  2EIO A;  4NV2 A;  4IJ3 A;  3DGQ A;  4NWY A;  4LMV A;  5B8B A;  1A23 A;  5FWG A;  5D93 A;  3M9J A;  1PSQ A;  4AGS A;  2FUG 2;  4AF2 A;  2CZ3 A;  2IMK A;  2JU5 A;  5J9B A;  1FB6 A;  1Q98 A;  4TR4 A;  1X5D A;  2E0Q A;  5DJM A;  2CVB A;  4WR4 A;  3HXS A;  13GS A;  4HZ2 A;  3HHV A;  5EL8 A;  4HOJ A;  3TDG A;  5L71 A;  1E2Y A;  4GTU A;  2J9H A;  3JCM L;  3C1S A;  3GKX A;  3F63 A;  2KP2 A;  3GIX A;  1TXX A;  3WGE A;  1N8J A;  1UA5 A;  1XOB A;  1NHO A;  1F9M A;  1GTA A;  4HU9 A;  4GQF A;  3F3Q A;  1ERV A;  4FYU A;  2L59 A;  2H6Y A;  3CRU A;  5JWO B;  3UL3 A;  3CSJ A;  2P31 A;  12GS A;  5DQS A;  5IOX A;  1A8L A;  2DJ0 A;  1FVJ A;  3CMI A;  2B1K A;  1TJD A;  3CYN A;  4HJM A;  3UIW A;  1XFL A;  5CO3 A;  2CT6 A;  5COH A;  2MMO A;  2BTO T;  4JRR A;  4ZL9 A;  1SEN A;  3FK8 A;  2JZS A;  4FIW A;  3DXB A;  1MD3 A;  3VWV A;  3ERW A;  5CRD A;  4ECB A;  2WRT A;  5HFG A;  2RM6 A;  2VCT A;  4TXO A;  4I8B A;  1ST9 A;  2KOK A;  2XHF A;  3GNJ A;  5JWQ B;  3NIV A;  1O6J A;  1XWB A;  2LV3 A;  2VUP A;  3UVH A;  1GNE A;  1V57 A;  3E0U A;  3TGZ A;  4KA0 A;  3TKR A;  1GRX A;  2I3Y A;  5CP1 A;  2PUK C;  5IMF A;  5DAL B;  3ZIT A;  3MWH A;  1U87 A;  2LRT A;  3LXZ A;  2WUL A;  2X99 A;  4KE3 A;  2MZC A;  2QC7 A;  4AJ6 A;  4BA7 A;  1EWX A;  2V1M A;  3D0Z A;  4MLY A;  1BG5 A;  5F8B A;  2NDO A;  1M2D A;  5AIV A;  4IVF A;  5DBQ A;  3O3T A;  1ERU A;  4EC0 A;  3ZTL A;  3NOF A;  2C4J A;  3M3M A;  3F4R A;  5B8A A;  2H75 A;  1X0R A;  1B48 A;  3IE3 A;  2IL3 A;  2VCW A;  1FG4 A;  2AV4 A;  2E2M A;  4F0B A;  5C04 A;  2R5G A;  4NHZ A;  2X64 A;  1FAA A;  1SKS B;  3HKR A;  3RBT A;  3IBH A;  3VK9 A;  2YN1 A;  2AHE A;  3APQ A;  3SBC A;  1I9D A;  2L4Q A;  1URM A;  4V2N A;  2F8F A;  5LD0 A;  4EO3 A;  3RPN A;  1G0T A;  4GRF A;  2C0G A;  1ABA A;  4IP6 A;  2H8L A;  3EYT A;  5D96 A;  5JCW A;  1XWK A;  1GUL A;  22GS A;  3G7Y A;  2XC2 A;  2H6X A;  1O7U A;  4G10 A;  2FGX A;  5IMV A;  4YH2 A;  1PRX A;  2P0G A;  3IV4 A;  4JED A;  5EVO A;  1G6Y A;  4IGJ A;  4F2I A;  2OAC A;  3C1R A;  4MZW A;  6GSV A;  5GZZ B;  3VI5 A;  4JR4 A;  3D4M A;  4H86 A;  1M2A A;  3M1G A;  1GP1 A;  3HJM A;  1NW2 A;  2OBI A;  2DML A;  4AJ8 A;  3FZ4 A;  3LYP A;  3KM6 A;  3EIN A;  1PQN A;  1UN2 A;  2V2G A;  5EPF A;  4N30 A;  1T00 A;  2KP1 A;  1XXU A;  3KTL A;  7GSS A;  3Q19 A;  2F3M A;  1JZO A;  5DJL A;  1ZZY A;  2PGT A;  2H1B A;  1PGT A;  4GWR A;  5F06 A;  5CRW A;  4RI7 A;  1XW5 A;  4E8H A;  3EUR A;  2GSS A;  4O5R A;  4XRA A;  2HSY A;  3P8W A;  2C3T A;  2GTU A;  2GSQ A;  3EC3 A;  3GKN A;  4LLR A;  1YEX A;  4I5Q A;  3DVW A;  3PR8 A;  3QAW A;  3ERF A;  4Q5Q A;  4PQ1 A;  1B4P A;  2LNS A;  3QAG A;  4OFT A;  1SD8 A;  2PVO C;  1V9W A;  2VM1 A;  4KCE A;  2DIY A;  4CHS A;  1BJX A;  4OCE A;  2V32 A;  2B6M A;  4JR6 A;  4KW6 A;  1XWC A;  2H70 A;  2PWJ A;  5AIX A;  1S3D A;  3EU3 A;  4ZB8 A;  2ON5 A;  4K6X A;  1K3Y A;  3APO A;  3H93 A;  3I43 A;  4XS4 A;  5HFK A;  1VF4 A;  3VWW A;  1VRS D;  3ISO A;  4TR3 A;  1XVW A;  4GQC A;  3A3T A;  1XW9 A;  3WT1 A;  1GSU A;  2WCI A;  1SJZ A;  4TR0 A;  4HU7 A;  5IMA A;  4Q5F A;  5LCZ A;  3EE2 A;  2C0D A;  4DSS B;  4HDE A;  2RUE A;  1KTE A;  1TI1 A;  2VO4 A;  3RHC A;  1NHY A;  1U3A A;  5ECL B;  2HI7 A;  2JAC A;  2REM A;  2FA4 A;  2C3N A;  1I5G A;  2EIQ A;  1HNB A;  2HZE B;  2LST A;  2H19 A;  3S9F A;  3MDK A;  4XS6 A;  1V40 A;  1SL2 B;  4TR1 B;  1QFN A;  3W8J A;  1PD2 1;  3LFL A;  1X5C A;  14GS A;  1B9X C;  3BD2 A;  4TKY A;  4WF4 A;  1ZGN A;  1ZYQ B;  2HRF A;  4Z7X A;  4L5O A;  3H4K A;  1QQ2 A;  2H6Z A;  4V2M A;  1XWA A;  2HXK A;  2OBK A;  1VF3 A;  1WJK A;  2LJR A;  2H30 A;  1Q4J A;  2H66 A;  4KAE A;  3W6G A;  1GTI A;  4KDX A;  1OE8 A;  3VI7 A;  1S3A A;  4F9Z A;  4GF0 A;  2H0I A;  1ZMA A;  4P3Y B;  3D4T A;  2FWH A;  1J9B A;  4QQ7 A;  6GSU A;  2L57 A;  2GT5 A;  1ZCP A;  2O87 A;  4KND A;  1GL8 A;  3ZIV A;  3FW2 A;  1FW1 A;  1TRS A;  2GQM A;  1X9M B;  2VD1 A;  3HVX A;  4ULX A;  5F0G A;  1XVQ A;  1GWC A;  5FT3 A;  5H5R A;  1SKW B;  1PL2 A;  4LL1 B;  5IPH A;  5J5N A;  4POL A;  3KP9 A;  5KEJ A;  4LL4 B;  4XHM A;  1JZD A;  5HFI A;  1ACV A;  1S3C A;  4IEL A;  1K0B A;  1MTC A;  5E4W A;  2RLI A;  6GSX A;  5HR0 A;  5ECI B;  4PGT A;  1T4Z A;  2K8S A;  3IR4 A;  3VWU A;  4WR5 A;  2RII A;  4K1F A;  3GMF A;  2ALB A;  3DIE A;  2X8G A;  2WB9 A;  1ML6 A;  3APS A;  2L6C A;  3VUR A;  2IFQ A;  5D9X A;  2DLX A;  3FR9 A;  4PUF C;  1TKD B;  2GT6 A;  2H74 A;  2WS2 A;  3TJK A;  1QK8 A;  5JCU A;  4AJ7 A;  5GSS A; 
#chains in the Genus database with same CATH topology
 2QKE A;  4MA9 A;  3OR5 A;  3W8S A;  5ECR B;  3IXR A;  3BJ5 A;  2I81 A;  3US3 A;  1PN9 A;  2YJH A;  3ZRD A;  5G5F A;  1MEK A;  3Q18 A;  3UMA A;  1EZK A;  3TKP A;  4EDY A;  6GSY A;  3M9K A;  5ID2 A;  1TU8 A;  2GZZ A;  2O7K A;  3DWV A;  3TJJ A;  1TRV A;  1AC1 A;  4HEA 2;  3I6A A;  1XIY A;  1GUM A;  1LU4 A;  5J4U A;  3Q74 A;  2JZR A;  2M80 A;  5DVB A;  2R2J A;  3HCZ A;  2YZU A;  4ICY A;  2P5Q A;  2VL9 A;  4MDC A;  4G2E A;  3ZL5 A;  4EDZ A;  2H1D A;  4BVY A;  1A8Y A;  1FOV A;  2LS5 A;  2PER A;  1SU9 A;  4QL9 A;  4K7O A;  4I2U A;  3F4S A;  3GUS A;  3F4T A;  3TRX A;  4DVC A;  3RHB A;  2J23 A;  3GH6 A;  4IQA A;  5F05 A;  4D73 B;  4IW9 A;  1WWJ A;  2YWO A;  2CX3 A;  2K6V A;  3LSZ A;  2WFC A;  3H1N A;  5GAP D;  3I9V 2;  5ECM B;  1DE2 A;  4KDU A;  4MCU A;  3SWL A;  4GSN A;  4XIH A;  1R7H A;  3N5O A;  4K7N A;  2H72 A;  2JAD A;  4OCF A;  3QFA C;  1ERW A;  1GSS A;  3ERG A;  4PNG A;  3J7Y b;  9GSS A;  2AAW A;  4BVX A;  3GTU B;  4EE0 A;  1SL0 B;  4MP4 A;  2B7J A;  3PH9 A;  5AN1 A;  1ERT A;  1WRY A;  5KN0 A;  4PUR A;  2E7P A;  4G19 A;  1M3I A;  1EP8 A;  4HS1 A;  2YCD A;  3F6D A;  2DJK A;  4IQ1 A;  2PBJ A;  4E8E A;  2FD3 A;  2YWN A;  1J0F A;  2C8U A;  2F51 A;  5IQY A;  1TK5 B;  4TXV A;  3F9U A;  4JU5 A;  3ME8 A;  1TK0 B;  1O85 A;  3GA4 A;  4ZBB A;  1HNA A;  2GZY A;  4IBP A;  2AYT A;  3GST A;  2JZT A;  3F8U A;  3BCI A;  2QGV A;  2YWM A;  2WGR A;  1JZW A;  3WT2 A;  1PL1 A;  2YOI A;  2YZH A;  4NHW A;  5A4V A;  3VPT A;  2VL3 A;  4ZBD A;  4HUA A;  2AB6 A;  5DAL A;  1ZL9 A;  1GSY A;  3D22 A;  1ZOF A;  1YKA A;  1BX9 A;  3FEU A;  1OC8 A;  1AAZ A;  1EV9 A;  1GSD A;  4F82 A;  4RI6 A;  1YJ6 A;  1JLV A;  5IM9 A;  2IN3 A;  4IS0 A;  2OA7 A;  4MZC A;  2XBI A;  2A4V A;  4N0Z A;  3TJF A;  4BPY A;  2CAQ A;  4ZXG A;  1EEJ A;  1GTB A;  5KN2 A;  1WOU A;  2QSI A;  4DSQ A;  4K0N A;  1N2A A;  2OAD A;  4ZB6 A;  3L9V A;  4J2F A;  2IME A;  4ECC A;  3O76 A;  1KBN A;  4NV5 A;  2WDU A;  4HQS A;  2DJ1 A;  5C00 A;  3C8E A;  3QDN A;  3GRX A;  4HI7 A;  3ZVJ A;  1LBK A;  4ZBA A;  3PGT A;  1SYR A;  2YJ7 A;  1T7P B;  3FMW A;  2LJK A;  4ISD A;  2IMD A;  1YY7 A;  1UC7 A;  4GST A;  1XWG A;  4X0X A;  3RPP A;  4ZL7 A;  3HDC A;  3E9J B;  5HR1 A;  1NM3 A;  2HFD A;  1T4Y A;  1HYU A;  1XZO A;  3CSH A;  4MMM A;  2YWI A;  3D21 A;  2C80 A;  4J56 E;  4WET A;  3HZ8 A;  3LQ7 A;  1PKZ A;  2PN8 A;  4QL7 A;  2IPA A;  5H5Q A;  4FYB A;  3ZFB A;  3KTB A;  4ZIJ A;  1EOH A;  3L9S A;  5HR3 A;  1MD4 A;  3HVS A;  4O5Q A;  1DE1 A;  2PPT A;  2VCV A;  4BWS A;  2LJA A;  2NTO A;  5G1K A;  1S3R A;  4FO5 A;  4K5S A;  4XCS A;  2YP6 A;  3QAV A;  2C0E A;  1GSF A;  3IRA A;  1OC3 A;  5FHI A;  3KH9 A;  1M99 A;  2IIY A;  6GSW A;  4PQI A;  2N5F A;  4I6X A;  4EXJ A;  1RK4 A;  1T1V A;  1EP7 A;  3MSZ A;  3MNG A;  3LWA A;  2I1U A;  2GGT A;  1SL1 B;  2OE3 A;  3PIN A;  4G0I A;  2TIR A;  5A4W A;  2O89 A;  5ELA A;  2IWT A;  3M0F A;  1F2E A;  3I69 A;  1USB A;  2B5Y A;  2KLX A;  4RQX A;  3ZLP A;  1OYJ A;  1PX7 A;  4YQV A;  5ECH B;  1W89 A;  4JZQ A;  4WBR D;  2HE3 A;  4IP1 A;  1GNW A;  2UZ8 A;  3UAR A;  1AQV A;  1O73 A;  4K2D A;  2LUS A;  5IMC A;  2A2S A;  3A2X A;  1F3A A;  4MH3 A;  2LRN A;  2P5R A;  8GSS A;  3FHK A;  2KHP A;  4BL7 B;  1ON4 A;  3H8Q A;  5J41 A;  2YPM A;  3GX8 A;  1K0C A;  2M46 A;  1PN0 A;  5F07 A;  3TRP A;  1AXD A;  3TKS E;  3L0H A;  1IYH A;  3IC4 A;  4PXO A;  4IJI A;  2DMM A;  3O6T A;  20GS A;  2VLU A;  2FWE A;  1H4O A;  4N11 A;  1OC9 B;  3LXT A;  3ED3 A;  4Q5R A;  1O8W A;  2PVQ A;  1F37 A;  17GS A;  3P7X A;  1WPI A;  1U3I A;  2F8A A;  1TU7 A;  4HJ2 A;  5LNK e;  2XPE A;  3GKM A;  5B6M A;  2CX4 A;  5HQP A;  3LJR A;  5ECO B;  1EOG A;  1Z3E A;  1AW9 A;  4N0V A;  2FWF A;  1ZYE A;  3QPM A;  2DJ2 A;  5ECS A;  4L8E A;  1TK8 B;  3IK9 A;  1OKT A;  3VFI A;  2R37 A;  3GH9 A;  4DSS A;  1DSB A;  3HD5 A;  2LQQ A;  3KD0 A;  2HT9 A;  3LGC A;  2NBS A;  1GTU A;  1H75 A;  4OFM A;  3M8N A;  5DCG A;  16GS A;  4LA1 A;  3L4N A;  3ZYW A;  2G2Q A;  1JLW A;  2RM5 A;  4GCI A;  1B9Y C;  4F03 A;  3HVV A;  5IPG A;  2HZE A;  2VIM A;  4O5U A;  2VCQ A;  3Q6O A;  4KUN A;  4K0G A;  1PMT A;  4TR1 A;  2DJJ A;  3U5R E;  2X8C A;  1TI3 A;  3CRT A;  3IAM 2;  2V41 A;  2CA8 A;  4OO4 A;  1HQO A;  1A2M A;  3F0I A;  1FHE A;  3V1W A;  1YF1 A;  3IA1 A;  1EGO A;  5CYY A;  4MF7 A;  2D2Z A;  4K2X A;  2ZUP A;  4POB A;  3CTF A;  2LTK A;  4ML6 A;  1GSQ A;  4ID0 A;  3BBY A;  3A2W A;  1O8X A;  2XPD A;  1YQ1 A;  3DD3 A;  1X9W B;  3CBU A;  5B7C A;  5G31 A;  1TP9 A;  2JL4 A;  1U88 A;  1V98 A;  4OWY A;  2VM2 A;  2H76 A;  4TN8 A;  6GSS A;  5DQY A;  1GLQ A;  2HRK A;  5ECP B;  1K0M A;  3TJB A;  3C7M A;  1AQW A;  2R0P A;  4MNN A;  1G7E A;  4XRD A;  5DAK B;  1AQX A;  2XBQ A;  3D5J A;  4V2L A;  4MAB A;  3F3R A;  1CQG A;  5DDL A;  2LQO A;  4X1U A;  4WF5 A;  4MF5 A;  5KOW A;  5KN1 A;  1Y25 A;  4MPF A;  5KOX A;  1FVK A;  1A0R P;  3IHG A;  3DYR A;  2X4A A;  5G1L A;  5JCG A;  4MPG A;  1THO A;  4I97 A;  3N9J A;  2B5X A;  1F6M C;  4L0U A;  5IO0 A;  1DBY A;  5AIS A;  5A5K A;  5IIZ A;  1QGV A;  3ZZX A;  1KEB A;  3TRQ A;  3C73 A;  1W4V A;  4RQR A;  2MMA A;  3KEB A;  4POK A;  2GDR A;  1K3L A;  1VF1 A;  2PMT A;  1FB0 A;  3WGD A;  1Z7P A;  2OKA A;  4ECJ A;  5ELG A;  5ECK B;  1BED A;  3GFK A;  2VCX A;  2HZF A;  3G7I A;  3VLN A;  2R0G A;  1M0U A;  3F6F A;  3CXG A;  4OMV A;  2HRN A;  4K9Z A;  1T8E B;  2H0H A;  2WJU A;  1SD9 A;  3E3E A;  4V1A g;  2H01 A;  4NXI A;  3TCO A;  2E2G A;  3GHA A;  3WYW A;  3QCP A;  3J7Y k;  5ABR A;  1WMJ A;  3TKQ A;  3QMX A;  3HYP A;  5GAN D;  1AUC A;  3DEX A;  1HNC A;  1A2L A;  4ILF A;  1PFO A;  2NPB A;  1SJ6 A;  4TXO B;  2CVD A;  5CRG A;  1MDJ A;  2R4V A;  3KZQ A;  3AY8 A;  3FZ5 A;  4ML1 A;  2MMZ A;  4HSC X;  2GLR A;  1ILO A;  1M2B A;  5J9C A;  1M9A A;  1O81 A;  3ZMK A;  4IHU A;  4MJB A;  3P2A A;  4KCA A;  3KXO A;  4D73 A;  2YNX A;  3G9B A;  4MJC A;  1X5E A;  2GQK A;  2B5E A;  4KSM A;  3D6I A;  4X43 A;  4TRX A;  3GL5 A;  5G2Z A;  1G6W A;  3RDW A;  3NZN A;  3K8N A;  4TVE A;  5INY A;  3HA9 A;  3ZFL A;  3LW9 A;  2CVK A;  2GS3 A;  3QFB C;  2FA8 A;  1NSW A;  2MBS A;  3UEM A;  2RUF A;  2HRA A;  2HYX A;  5G5E A;  1JFU A;  4O7H A;  3GV1 A;  3A2V A;  2KUC A;  3KMO A;  4PX1 A;  3GTU A;  1EGR A;  2ON7 A;  3LYK A;  3EMP A;  3KCM A;  19GS A;  3LOR A;  3UBK A;  1OAZ A;  1PA3 A;  4ACS A;  3IAS 2;  1BAY A;  2IMI A;  3ZRE A;  1R5P A;  4OFN A;  3UAP A;  4O92 A;  4PQH A;  1GUK A;  2GSR A;  3EU4 A;  1GH2 A;  2A2R A;  1SK2 A;  2L4C A;  2GVP A;  4YKF A;  5D8I A;  1G7O A;  3FYG A;  5D73 A;  2OJL A;  1V58 A;  4ZB9 A;  3CTG A;  2G0F A;  2F9S A;  2B1L A;  4EKZ A;  3TUE A;  2OE1 A;  3HZ4 A;  1IYI A;  2C3Q A;  2FLS A;  1K0N A;  2VAF A;  4JE1 A;  3VWX A;  2B3S A;  3TJG A;  2OE0 A;  2NVL A;  5D9V A;  4MH2 A;  4MK3 A;  4WKW A;  4NMU A;  3H79 A;  2N5A A;  4JBB A;  1K0D A;  2K9F A;  3DVX A;  2GZP A;  10GS A;  3FZ9 A;  3LEF A;  3KMN A;  5CRE A;  3TB2 A;  2N5B A;  4TOP A;  1M9B A;  1M3J A;  2LRC A;  3CSI A;  2EIR A;  2JSZ A;  1BYE A;  3ME7 A;  4N10 A;  2FCH A;  2L5O A;  3PPU A;  2AUV A;  2FY6 A;  2ZCT A;  5IOW A;  1PKW A;  1XPV A;  3TKS C;  3KH7 A;  2M72 A;  1VGL A;  2VOC A;  2DSA A;  4G9H A;  1MDI A;  3GX0 A;  1EEM A;  4Z2R A;  1B8X A;  2CQ9 A;  2L6D A;  5B6N A;  3CQF A;  3BOA A;  11GS A;  5ECQ B;  1BQ7 A;  3FKF A;  2VL2 C;  4EIP A;  1T3B A;  2B7K A;  4BWQ A;  1PX6 A;  2VLT A;  2K18 A;  4EL1 A;  2H71 A;  3FRC A;  4FH8 A;  5J3R A;  2H0G A;  3EWL A;  3A5W A;  1OE7 A;  1OKD A;  3UOM A;  5CAX A;  3WD6 A;  3IOS A;  1XW6 A;  5D9T A;  4ZL8 A;  2ZNM A;  3GSS A;  3BCK A;  4EF0 A;  3LG6 A;  1B4Q A;  5CRH A;  3HY2 A;  4WBJ A;  2H73 A;  3FY7 A;  1ZYN A;  4YAV A;  5GST A;  2O85 A;  2R6K A;  1A2J A;  3GYK A;  2DIZ A;  4GXZ A;  1A0F A;  3VPQ A;  4V1A p;  5A4U A;  2FHE A;  4K5R A;  1KNG A;  1A24 A;  1Z6M A;  2BMX A;  4L0W A;  1V2A A;  4KDY A;  4ZIL A;  4XS4 B;  1VF2 A;  1XCC A;  2IMF A;  1R4W A;  2DKH A;  4YQU A;  4Q5N A;  1GUH A;  1OVN A;  5ENU A;  5IO2 A;  1EV4 A;  4FYC A;  18GS A;  2QA2 A;  1JHB A;  5CNW A;  1QXH A;  1RQM A;  3U6V A;  1SKR B;  3KIJ A;  3KJY A;  3ZML A;  1AIU A;  3R2Q A;  3HJO A;  4Z2U A;  4TW5 A;  3IHQ A;  1Z5Y E;  1WP0 A;  4OO5 A;  1TTZ A;  1Z9H A;  4WXT A;  3EMX A;  4MJE A;  4EVM A;  3GKK A;  5IMZ A;  4I2T A;  4WEY A;  2TRX A;  1MDK A;  2LNT A;  3RAZ A;  3HVN A;  3TOT A;  3GUR A;  2R3X A;  1TW9 A;  4PTS A;  5BMU A;  1LJR A;  1Y6E A;  5ECN B;  1WE0 A;  3TKS A;  4DEJ A;  1THX A;  4LMW A;  2GQL A;  1SYX A;  4IN0 A;  5H5S A;  5JWR B;  4GLT A;  4K7I A;  4BL7 A;  2Z9S A;  1SK0 A;  4OD7 A;  3UBL A;  3L78 A;  5E59 A;  4EUY A;  3GL3 A;  2VL2 A;  2CV4 A;  1OC9 A;  1YEP A;  3IDV A;  3MAK A;  4MJA A;  4PNF A;  4KX4 A;  3FR3 A;  2ES7 A;  2VD0 A;  2TRC P;  2K8V A;  3P90 A;  1GLP A;  4KH7 A;  1TOF A;  2O8V B;  4L5L A;  1J08 A;  4XTS A;  1XBS A;  2JSY A;  3KGK A;  1R26 A;  2GST A;  5DCH A;  1FOH A;  4CW9 A;  4KSO A;  1SJI A;  1UVZ A;  1TDI A;  2AJQ B;  3UVT A;  3QD9 A;  1SK1 A;  2HLS A;  1R5A A;  1JZR A;  1WIK A;  1M7T A;  4YQM A;  4X4J A;  4ECI A;  2EC4 A;  2CAI A;  1X9S B;  1QMV A;  1YZX A;  4A5P A;  1GSE A;  2VLV A;  1QUW A;  1DUG A;  4F0C A;  1Z7R A;  4XS1 A;  4J57 E;  3ZIJ A;  3C71 A;  4DSR A;  4POM A;  4HQZ A;  4HZ4 A;  4YAP A;  2FNO A;  3ZVJ D;  2L5L A;  2MMN A;  2YAN A;  5G30 A;  2MYG A;  6GST A;  2V6K A;  4KGI A;  1E6B A;  1U6T A;  3DRN A;  2V6O A;  1YKC A;  4MF6 A;  2WZ9 A;  1K0O A;  2CZ2 A;  5HR2 A;  4NAX A;  1CQH A;  2C1Y A;  5D9W A;  1C72 A;  4O32 A;  5AGY A;  2H1G A;  1K3O A;  3FR6 A;  1YF0 A;  2C0F A;  3GN3 A;  3QOU A;  4KB3 A;  1HD2 A;  4PUA A;  4NPB A;  2FWG A;  2DC5 A;  3EVI A;  3DML A;  4MZB A;  5KN3 A;  1K0A A;  2PU9 C;  2YV7 A;  2IFQ B;  2HSH A;  2LEG A;  2YV9 A;  5EY6 A;  3DKS A;  2MBT A;  2BJX A;  3IK7 A;  3UJ1 A;  3WGX A;  3KP8 A;  3L9U A;  2VCZ A;  2A2P A;  3HJP A;  1YDK A;  1TRU A;  4CDO A;  2H1A A;  3QR6 A;  4GSS A;  4Z2T A;  1XOA A;  2LKU A;  2DJ3 A;  3FZA A;  2I4A A;  1FO5 A;  1Z6N A;  3TOU A;  2R0C A;  1TRW A;  4IKH A;  4KF9 A;  2X8H A;  2I9H A;  5IMD A;  1RW1 A;  2DBC A;  5ID2 B;  5DAK A;  1F3B A;  4RUV A;  2IJY A;  4K8M A;  3G7J A;  2HNL A;  3IPZ A;  2EIO A;  4NV2 A;  4IJ3 A;  3DGQ A;  4NWY A;  4LMV A;  5B8B A;  1A23 A;  5FWG A;  5D93 A;  3M9J A;  1PSQ A;  4AGS A;  2FUG 2;  4AF2 A;  2CZ3 A;  4BVY B;  2IMK A;  2JU5 A;  5J9B A;  1FB6 A;  1Q98 A;  4TR4 A;  1X5D A;  2E0Q A;  5DJM A;  2CVB A;  4WR4 A;  2DKI A;  3HXS A;  13GS A;  4HZ2 A;  3HHV A;  5EL8 A;  4HOJ A;  3TDG A;  5L71 A;  1E2Y A;  3MIX A;  4GTU A;  2J9H A;  3JCM L;  3C1S A;  3GKX A;  3F63 A;  2KP2 A;  3GIX A;  1TXX A;  3WGE A;  1N8J A;  1UA5 A;  1XOB A;  1NHO A;  1F9M A;  1GTA A;  4HU9 A;  4GQF A;  3F3Q A;  1ERV A;  4FYU A;  2L59 A;  2H6Y A;  3CRU A;  5JWO B;  3UL3 A;  3CSJ A;  2P31 A;  4BVX B;  12GS A;  5DQS A;  5IOX A;  1A8L A;  2DJ0 A;  4G0L A;  1FVJ A;  3CMI A;  2B1K A;  1TJD A;  3CYN A;  4HJM A;  3UIW A;  1XFL A;  5CO3 A;  2CT6 A;  5COH A;  2MMO A;  2BTO T;  4JRR A;  4ZL9 A;  1SEN A;  3FK8 A;  2JZS A;  4FIW A;  3DXB A;  1MD3 A;  3VWV A;  3ERW A;  5CRD A;  4ECB A;  2WRT A;  5HFG A;  2RM6 A;  2VCT A;  4TXO A;  4I8B A;  1ST9 A;  2KOK A;  2XHF A;  3GNJ A;  5JWQ B;  3NIV A;  1O6J A;  1XWB A;  2LV3 A;  2VUP A;  3UVH A;  1GNE A;  1V57 A;  3E0U A;  3TGZ A;  4KA0 A;  3TKR A;  1GRX A;  2I3Y A;  5BRT A;  5CP1 A;  2PUK C;  4CY6 A;  5IMF A;  5DAL B;  3ZIT A;  3MWH A;  1U87 A;  2LRT A;  3LXZ A;  2WUL A;  2X99 A;  4KE3 A;  2MZC A;  2QC7 A;  4AJ6 A;  4BA7 A;  1EWX A;  2V1M A;  3D0Z A;  4MLY A;  1BG5 A;  5F8B A;  2NDO A;  1M2D A;  5AIV A;  4IVF A;  5DBQ A;  3O3T A;  1ERU A;  4EC0 A;  3ZTL A;  3NOF A;  2C4J A;  3M3M A;  3F4R A;  5B8A A;  2H75 A;  1X0R A;  1B48 A;  3IE3 A;  2IL3 A;  2VCW A;  1FG4 A;  2AV4 A;  2E2M A;  4F0B A;  5C04 A;  2R5G A;  4NHZ A;  2X64 A;  1FAA A;  1SKS B;  3HKR A;  3RBT A;  3IBH A;  3VK9 A;  2YN1 A;  2AHE A;  3APQ A;  3SBC A;  1I9D A;  2L4Q A;  1URM A;  4V2N A;  2F8F A;  5LD0 A;  4EO3 A;  3RPN A;  2HSM A;  1G0T A;  4GRF A;  2C0G A;  1ABA A;  4IP6 A;  4FQU A;  4YKG A;  2H8L A;  3EYT A;  5D96 A;  5JCW A;  1XWK A;  1GUL A;  22GS A;  3G7Y A;  2XC2 A;  4USS A;  2H6X A;  1O7U A;  4G10 A;  2FGX A;  5IMV A;  4YH2 A;  1PRX A;  2P0G A;  3IV4 A;  4JED A;  5EVO A;  1G6Y A;  4IGJ A;  4F2I A;  2OAC A;  3C1R A;  4MZW A;  6GSV A;  5GZZ B;  3VI5 A;  3EPT A;  4JR4 A;  3D4M A;  4H86 A;  1M2A A;  3M1G A;  1GP1 A;  3MYD A;  3HJM A;  1NW2 A;  2OBI A;  1ZYP A;  2DML A;  4AJ8 A;  3FZ4 A;  3LYP A;  3KM6 A;  3EIN A;  1PQN A;  1UN2 A;  2V2G A;  5EPF A;  4N30 A;  1T00 A;  2KP1 A;  1XXU A;  3KTL A;  7GSS A;  3Q19 A;  2F3M A;  1JZO A;  5DJL A;  1ZZY A;  2PGT A;  2H1B A;  1PGT A;  4GWR A;  5F06 A;  5CRW A;  4RI7 A;  1XW5 A;  4E8H A;  3EUR A;  2GSS A;  4O5R A;  4XRA A;  2HSY A;  3P8W A;  2C3T A;  2GTU A;  2GSQ A;  3EC3 A;  3GKN A;  4LLR A;  1YEX A;  4I5Q A;  3DVW A;  3PR8 A;  3QAW A;  3ERF A;  4Q5Q A;  4PQ1 A;  1B4P A;  2LNS A;  3QAG A;  4OFT A;  3IC8 A;  1SD8 A;  2PVO C;  1V9W A;  2VM1 A;  4KCE A;  2DIY A;  4CHS A;  1BJX A;  4OCE A;  2V32 A;  2B6M A;  4JR6 A;  4KW6 A;  1XWC A;  2H70 A;  2PWJ A;  5AIX A;  1S3D A;  1XG8 A;  3EU3 A;  4ZB8 A;  2ON5 A;  4K6X A;  1K3Y A;  3APO A;  3H93 A;  3I43 A;  4XS4 A;  5HFK A;  1VF4 A;  3VWW A;  1VRS D;  4EIQ A;  3ISO A;  4TR3 A;  1XVW A;  4GQC A;  3A3T A;  1XW9 A;  3WT1 A;  1GSU A;  2WCI A;  1SJZ A;  4TR0 A;  4HU7 A;  5IMA A;  4Q5F A;  5LCZ A;  3EE2 A;  2C0D A;  4DSS B;  4HDE A;  2RUE A;  4G0K A;  1KTE A;  1TI1 A;  2VO4 A;  3RHC A;  1NHY A;  1U3A A;  5ECL B;  2HI7 A;  2JAC A;  2REM A;  2FA4 A;  2C3N A;  1I5G A;  2QA1 A;  2EIQ A;  1HNB A;  2HZE B;  3R3E A;  2LST A;  2H19 A;  3S9F A;  3MDK A;  4XS6 A;  1V40 A;  1SL2 B;  4TR1 B;  1QFN A;  3W8J A;  1PD2 1;  3LFL A;  1X5C A;  14GS A;  1B9X C;  3BD2 A;  4TKY A;  4WF4 A;  1ZGN A;  3A5I A;  1ZYQ B;  2HRF A;  4Z7X A;  4L5O A;  3H4K A;  1QQ2 A;  2H6Z A;  4V2M A;  1XWA A;  2HXK A;  2OBK A;  1VF3 A;  1WJK A;  2LJR A;  2H30 A;  1Q4J A;  2H66 A;  4KAE A;  3W6G A;  1GTI A;  4KDX A;  1OE8 A;  3VI7 A;  1S3A A;  4F9Z A;  4GF0 A;  2H0I A;  1ZMA A;  4P3Y B;  3D4T A;  2FWH A;  1J9B A;  4QQ7 A;  6GSU A;  2L57 A;  2GT5 A;  1ZCP A;  2O87 A;  4KND A;  1GL8 A;  3ZIV A;  3FW2 A;  1FW1 A;  4BIK A;  1TRS A;  2GQM A;  1X9M B;  2VD1 A;  3HVX A;  4ULX A;  5F0G A;  1XVQ A;  1GWC A;  5FT3 A;  5H5R A;  1SKW B;  1PL2 A;  4LL1 B;  5IPH A;  5J5N A;  4POL A;  3KP9 A;  5KEJ A;  4LL4 B;  4XHM A;  1JZD A;  5HFI A;  1ACV A;  1S3C A;  2X49 A;  4IEL A;  1K0B A;  1MTC A;  5E4W A;  2A4H A;  2RLI A;  6GSX A;  5HR0 A;  5ECI B;  4PGT A;  1T4Z A;  2K8S A;  3IR4 A;  3VWU A;  4WR5 A;  2RII A;  4K1F A;  3GMF A;  2ALB A;  3DIE A;  2X8G A;  2WB9 A;  1ML6 A;  3APS A;  2L6C A;  3VUR A;  2IFQ A;  5D9X A;  2DLX A;  3FR9 A;  4PUF C;  1TKD B;  4CY8 A;  2GT6 A;  2H74 A;  2WS2 A;  3TJK A;  1QK8 A;  5JCU A;  4AJ7 A;  5GSS A; 
#chains in the Genus database with same CATH homology
 2QKE A;  4MA9 A;  3OR5 A;  3W8S A;  5ECR B;  3IXR A;  3BJ5 A;  2I81 A;  3US3 A;  1PN9 A;  2YJH A;  3ZRD A;  5G5F A;  1MEK A;  3Q18 A;  3UMA A;  1EZK A;  3TKP A;  4EDY A;  6GSY A;  3M9K A;  5ID2 A;  1TU8 A;  2GZZ A;  2O7K A;  3DWV A;  3TJJ A;  1TRV A;  1AC1 A;  4HEA 2;  3I6A A;  1XIY A;  1GUM A;  1LU4 A;  5J4U A;  3Q74 A;  2JZR A;  2M80 A;  5DVB A;  2R2J A;  3HCZ A;  2YZU A;  4ICY A;  2P5Q A;  2VL9 A;  4MDC A;  4G2E A;  3ZL5 A;  4EDZ A;  2H1D A;  4BVY A;  1A8Y A;  1FOV A;  2LS5 A;  2PER A;  1SU9 A;  4QL9 A;  4K7O A;  4I2U A;  3F4S A;  3GUS A;  3F4T A;  3TRX A;  4DVC A;  3RHB A;  2J23 A;  3GH6 A;  4IQA A;  5F05 A;  4D73 B;  4IW9 A;  1WWJ A;  2YWO A;  2CX3 A;  2K6V A;  3LSZ A;  2WFC A;  3H1N A;  5GAP D;  3I9V 2;  5ECM B;  1DE2 A;  4KDU A;  4MCU A;  3SWL A;  4GSN A;  4XIH A;  1R7H A;  3N5O A;  4K7N A;  2H72 A;  2JAD A;  4OCF A;  3QFA C;  1ERW A;  1GSS A;  3ERG A;  4PNG A;  3J7Y b;  9GSS A;  2AAW A;  4BVX A;  3GTU B;  4EE0 A;  1SL0 B;  4MP4 A;  2B7J A;  3PH9 A;  5AN1 A;  1ERT A;  1WRY A;  5KN0 A;  4PUR A;  2E7P A;  4G19 A;  1EP8 A;  4HS1 A;  2YCD A;  3F6D A;  2DJK A;  4IQ1 A;  2PBJ A;  4E8E A;  2FD3 A;  2YWN A;  1J0F A;  2C8U A;  2F51 A;  5IQY A;  1TK5 B;  4TXV A;  3F9U A;  4JU5 A;  3ME8 A;  1TK0 B;  1O85 A;  3GA4 A;  4ZBB A;  1HNA A;  2GZY A;  4IBP A;  2AYT A;  3GST A;  2JZT A;  3F8U A;  3BCI A;  2QGV A;  2YWM A;  2WGR A;  1JZW A;  3WT2 A;  1PL1 A;  2YOI A;  2YZH A;  4NHW A;  5A4V A;  3VPT A;  2VL3 A;  4ZBD A;  4HUA A;  2AB6 A;  5DAL A;  1ZL9 A;  1GSY A;  3D22 A;  1ZOF A;  1YKA A;  1BX9 A;  3FEU A;  1OC8 A;  1AAZ A;  1EV9 A;  1GSD A;  4F82 A;  4RI6 A;  1YJ6 A;  1JLV A;  5IM9 A;  2IN3 A;  4IS0 A;  2OA7 A;  4MZC A;  2XBI A;  2A4V A;  4N0Z A;  3TJF A;  4BPY A;  2CAQ A;  4ZXG A;  1EEJ A;  1GTB A;  5KN2 A;  1WOU A;  2QSI A;  4DSQ A;  4K0N A;  1N2A A;  2OAD A;  4ZB6 A;  3L9V A;  4J2F A;  2IME A;  4ECC A;  3O76 A;  1KBN A;  4NV5 A;  2WDU A;  4HQS A;  2DJ1 A;  5C00 A;  3C8E A;  3QDN A;  3GRX A;  4HI7 A;  3ZVJ A;  1LBK A;  4ZBA A;  3PGT A;  1SYR A;  2YJ7 A;  1T7P B;  3FMW A;  2LJK A;  4ISD A;  2IMD A;  1YY7 A;  1UC7 A;  4GST A;  1XWG A;  4X0X A;  3RPP A;  4ZL7 A;  3HDC A;  3E9J B;  5HR1 A;  1NM3 A;  2HFD A;  1T4Y A;  1HYU A;  1XZO A;  3CSH A;  4MMM A;  2YWI A;  3D21 A;  2C80 A;  4J56 E;  4WET A;  3HZ8 A;  3LQ7 A;  1PKZ A;  2PN8 A;  4QL7 A;  2IPA A;  5H5Q A;  4FYB A;  3ZFB A;  3KTB A;  4ZIJ A;  1EOH A;  3L9S A;  5HR3 A;  1MD4 A;  3HVS A;  4O5Q A;  1DE1 A;  2PPT A;  2VCV A;  4BWS A;  2LJA A;  2NTO A;  5G1K A;  4FO5 A;  4K5S A;  4XCS A;  2YP6 A;  3QAV A;  2C0E A;  1GSF A;  3IRA A;  1OC3 A;  5FHI A;  3KH9 A;  1M99 A;  2IIY A;  6GSW A;  4PQI A;  2N5F A;  4I6X A;  4EXJ A;  1RK4 A;  1T1V A;  1EP7 A;  3MSZ A;  3MNG A;  3LWA A;  2I1U A;  2GGT A;  1SL1 B;  2OE3 A;  3PIN A;  4G0I A;  2TIR A;  5A4W A;  2O89 A;  5ELA A;  2IWT A;  3M0F A;  1F2E A;  3I69 A;  1USB A;  2B5Y A;  2KLX A;  4RQX A;  3ZLP A;  1OYJ A;  1PX7 A;  4YQV A;  5ECH B;  1W89 A;  4JZQ A;  4WBR D;  2HE3 A;  4IP1 A;  1GNW A;  2UZ8 A;  3UAR A;  1AQV A;  1O73 A;  4K2D A;  2LUS A;  5IMC A;  2A2S A;  3A2X A;  1F3A A;  4MH3 A;  2LRN A;  2P5R A;  8GSS A;  3FHK A;  2KHP A;  4BL7 B;  1ON4 A;  3H8Q A;  5J41 A;  2YPM A;  3GX8 A;  1K0C A;  2M46 A;  1PN0 A;  5F07 A;  3TRP A;  1AXD A;  3TKS E;  3L0H A;  1IYH A;  3IC4 A;  4PXO A;  4IJI A;  2DMM A;  3O6T A;  20GS A;  2VLU A;  2FWE A;  1H4O A;  4N11 A;  1OC9 B;  3LXT A;  3ED3 A;  4Q5R A;  1O8W A;  2PVQ A;  1F37 A;  17GS A;  3P7X A;  1WPI A;  1U3I A;  2F8A A;  1TU7 A;  4HJ2 A;  5LNK e;  2XPE A;  3GKM A;  5B6M A;  2CX4 A;  5HQP A;  3LJR A;  5ECO B;  1EOG A;  1Z3E A;  1AW9 A;  4N0V A;  2FWF A;  1ZYE A;  3QPM A;  2DJ2 A;  5ECS A;  4L8E A;  1TK8 B;  3IK9 A;  1OKT A;  3VFI A;  2R37 A;  3GH9 A;  4DSS A;  1DSB A;  3HD5 A;  2LQQ A;  3KD0 A;  2HT9 A;  3LGC A;  2NBS A;  1GTU A;  1H75 A;  4OFM A;  3M8N A;  5DCG A;  16GS A;  4LA1 A;  3L4N A;  3ZYW A;  2G2Q A;  1JLW A;  2RM5 A;  4GCI A;  1B9Y C;  4F03 A;  3HVV A;  5IPG A;  2HZE A;  2VIM A;  4O5U A;  2VCQ A;  3Q6O A;  4KUN A;  4K0G A;  1PMT A;  4TR1 A;  2DJJ A;  3U5R E;  2X8C A;  1TI3 A;  3CRT A;  3IAM 2;  2V41 A;  2CA8 A;  4OO4 A;  1HQO A;  1A2M A;  3F0I A;  1FHE A;  3V1W A;  1YF1 A;  3IA1 A;  1EGO A;  5CYY A;  4MF7 A;  2D2Z A;  4K2X A;  2ZUP A;  4POB A;  3CTF A;  2LTK A;  4ML6 A;  1GSQ A;  4ID0 A;  3BBY A;  3A2W A;  1O8X A;  2XPD A;  1YQ1 A;  3DD3 A;  1X9W B;  3CBU A;  5B7C A;  5G31 A;  1TP9 A;  2JL4 A;  1U88 A;  1V98 A;  4OWY A;  2VM2 A;  2H76 A;  4TN8 A;  6GSS A;  5DQY A;  1GLQ A;  2HRK A;  5ECP B;  1K0M A;  3TJB A;  3C7M A;  1AQW A;  2R0P A;  4MNN A;  1G7E A;  4XRD A;  5DAK B;  1AQX A;  2XBQ A;  3D5J A;  4V2L A;  4MAB A;  3F3R A;  1CQG A;  5DDL A;  2LQO A;  4X1U A;  4WF5 A;  4MF5 A;  5KOW A;  5KN1 A;  1Y25 A;  4MPF A;  5KOX A;  1FVK A;  1A0R P;  3IHG A;  3DYR A;  2X4A A;  5G1L A;  5JCG A;  4MPG A;  1THO A;  4I97 A;  3N9J A;  2B5X A;  1F6M C;  4L0U A;  5IO0 A;  1DBY A;  5AIS A;  5A5K A;  5IIZ A;  1QGV A;  3ZZX A;  1KEB A;  3TRQ A;  3C73 A;  1W4V A;  4RQR A;  2MMA A;  3KEB A;  4POK A;  2GDR A;  1K3L A;  1VF1 A;  2PMT A;  1FB0 A;  3WGD A;  1Z7P A;  2OKA A;  4ECJ A;  5ELG A;  5ECK B;  1BED A;  3GFK A;  2VCX A;  2HZF A;  3G7I A;  3VLN A;  2R0G A;  1M0U A;  3F6F A;  3CXG A;  4OMV A;  2HRN A;  4K9Z A;  1T8E B;  2H0H A;  2WJU A;  1SD9 A;  3E3E A;  4V1A g;  2H01 A;  4NXI A;  3TCO A;  2E2G A;  3GHA A;  3WYW A;  3QCP A;  3J7Y k;  5ABR A;  1WMJ A;  3TKQ A;  3QMX A;  3HYP A;  5GAN D;  1AUC A;  3DEX A;  1HNC A;  1A2L A;  4ILF A;  2NPB A;  1SJ6 A;  4TXO B;  2CVD A;  5CRG A;  1MDJ A;  2R4V A;  3KZQ A;  3AY8 A;  3FZ5 A;  4ML1 A;  2MMZ A;  2GLR A;  1ILO A;  1M2B A;  5J9C A;  1M9A A;  1O81 A;  3ZMK A;  4IHU A;  4MJB A;  3P2A A;  4KCA A;  3KXO A;  4D73 A;  2YNX A;  3G9B A;  4MJC A;  1X5E A;  2GQK A;  2B5E A;  4KSM A;  3D6I A;  4X43 A;  4TRX A;  3GL5 A;  5G2Z A;  1G6W A;  3RDW A;  3NZN A;  3K8N A;  4TVE A;  5INY A;  3HA9 A;  3ZFL A;  3LW9 A;  2CVK A;  2GS3 A;  3QFB C;  2FA8 A;  1NSW A;  2MBS A;  3UEM A;  2RUF A;  2HRA A;  2HYX A;  5G5E A;  1JFU A;  4O7H A;  3GV1 A;  3A2V A;  2KUC A;  3KMO A;  4PX1 A;  3GTU A;  1EGR A;  2ON7 A;  3LYK A;  3EMP A;  3KCM A;  19GS A;  3LOR A;  3UBK A;  1OAZ A;  1PA3 A;  4ACS A;  3IAS 2;  1BAY A;  2IMI A;  3ZRE A;  1R5P A;  4OFN A;  3UAP A;  4O92 A;  4PQH A;  1GUK A;  2GSR A;  3EU4 A;  1GH2 A;  2A2R A;  1SK2 A;  2L4C A;  2GVP A;  4YKF A;  5D8I A;  1G7O A;  3FYG A;  5D73 A;  2OJL A;  1V58 A;  4ZB9 A;  3CTG A;  2G0F A;  2F9S A;  2B1L A;  4EKZ A;  3TUE A;  2OE1 A;  3HZ4 A;  1IYI A;  2C3Q A;  2FLS A;  1K0N A;  2VAF A;  4JE1 A;  3VWX A;  2B3S A;  3TJG A;  2OE0 A;  2NVL A;  5D9V A;  4MH2 A;  4MK3 A;  4WKW A;  4NMU A;  3H79 A;  2N5A A;  4JBB A;  1K0D A;  2K9F A;  3DVX A;  2GZP A;  10GS A;  3FZ9 A;  3LEF A;  3KMN A;  5CRE A;  3TB2 A;  2N5B A;  4TOP A;  1M9B A;  2LRC A;  3CSI A;  2EIR A;  2JSZ A;  1BYE A;  3ME7 A;  4N10 A;  2FCH A;  2L5O A;  3PPU A;  2AUV A;  2FY6 A;  2ZCT A;  5IOW A;  1PKW A;  1XPV A;  3TKS C;  3KH7 A;  2M72 A;  1VGL A;  2VOC A;  2DSA A;  4G9H A;  1MDI A;  3GX0 A;  1EEM A;  4Z2R A;  1B8X A;  2CQ9 A;  2L6D A;  5B6N A;  3BOA A;  11GS A;  5ECQ B;  1BQ7 A;  3FKF A;  2VL2 C;  4EIP A;  1T3B A;  2B7K A;  4BWQ A;  1PX6 A;  2VLT A;  2K18 A;  4EL1 A;  2H71 A;  3FRC A;  4FH8 A;  5J3R A;  2H0G A;  3EWL A;  3A5W A;  1OE7 A;  1OKD A;  3UOM A;  5CAX A;  3WD6 A;  3IOS A;  1XW6 A;  5D9T A;  4ZL8 A;  2ZNM A;  3GSS A;  3BCK A;  4EF0 A;  3LG6 A;  1B4Q A;  5CRH A;  3HY2 A;  4WBJ A;  2H73 A;  3FY7 A;  1ZYN A;  4YAV A;  5GST A;  2O85 A;  2R6K A;  1A2J A;  3GYK A;  2DIZ A;  4GXZ A;  1A0F A;  3VPQ A;  4V1A p;  5A4U A;  2FHE A;  4K5R A;  1KNG A;  1A24 A;  1Z6M A;  2BMX A;  4L0W A;  1V2A A;  4KDY A;  4ZIL A;  4XS4 B;  1VF2 A;  1XCC A;  2IMF A;  1R4W A;  2DKH A;  4YQU A;  4Q5N A;  1GUH A;  1OVN A;  5ENU A;  5IO2 A;  1EV4 A;  4FYC A;  18GS A;  2QA2 A;  1JHB A;  5CNW A;  1QXH A;  1RQM A;  3U6V A;  1SKR B;  3KIJ A;  3KJY A;  3ZML A;  1AIU A;  3R2Q A;  3HJO A;  4Z2U A;  4TW5 A;  3IHQ A;  1Z5Y E;  1WP0 A;  4OO5 A;  1TTZ A;  1Z9H A;  4WXT A;  3EMX A;  4MJE A;  4EVM A;  3GKK A;  5IMZ A;  4I2T A;  4WEY A;  2TRX A;  1MDK A;  2LNT A;  3RAZ A;  3TOT A;  3GUR A;  2R3X A;  1TW9 A;  4PTS A;  5BMU A;  1LJR A;  1Y6E A;  5ECN B;  1WE0 A;  3TKS A;  4DEJ A;  1THX A;  4LMW A;  2GQL A;  1SYX A;  4IN0 A;  5H5S A;  5JWR B;  4GLT A;  4K7I A;  4BL7 A;  2Z9S A;  1SK0 A;  4OD7 A;  3UBL A;  3L78 A;  5E59 A;  4EUY A;  3GL3 A;  2VL2 A;  2CV4 A;  1OC9 A;  1YEP A;  3IDV A;  3MAK A;  4MJA A;  4PNF A;  4KX4 A;  3FR3 A;  2ES7 A;  2VD0 A;  2TRC P;  2K8V A;  3P90 A;  1GLP A;  4KH7 A;  1TOF A;  2O8V B;  4L5L A;  1J08 A;  4XTS A;  1XBS A;  2JSY A;  3KGK A;  1R26 A;  2GST A;  5DCH A;  1FOH A;  4CW9 A;  4KSO A;  1SJI A;  1UVZ A;  1TDI A;  2AJQ B;  3UVT A;  3QD9 A;  1SK1 A;  2HLS A;  1R5A A;  1JZR A;  1WIK A;  1M7T A;  4YQM A;  4X4J A;  4ECI A;  2EC4 A;  2CAI A;  1X9S B;  1QMV A;  1YZX A;  4A5P A;  1GSE A;  2VLV A;  1QUW A;  1DUG A;  4F0C A;  1Z7R A;  4XS1 A;  4J57 E;  3ZIJ A;  3C71 A;  4DSR A;  4POM A;  4HQZ A;  4HZ4 A;  4YAP A;  2FNO A;  3ZVJ D;  2L5L A;  2MMN A;  2YAN A;  5G30 A;  2MYG A;  6GST A;  2V6K A;  4KGI A;  1E6B A;  1U6T A;  3DRN A;  2V6O A;  1YKC A;  4MF6 A;  2WZ9 A;  1K0O A;  2CZ2 A;  5HR2 A;  4NAX A;  1CQH A;  2C1Y A;  5D9W A;  1C72 A;  4O32 A;  5AGY A;  2H1G A;  1K3O A;  3FR6 A;  1YF0 A;  2C0F A;  3GN3 A;  3QOU A;  4KB3 A;  1HD2 A;  4PUA A;  4NPB A;  2FWG A;  2DC5 A;  3EVI A;  3DML A;  4MZB A;  5KN3 A;  1K0A A;  2PU9 C;  2YV7 A;  2IFQ B;  2HSH A;  2LEG A;  2YV9 A;  5EY6 A;  3DKS A;  2MBT A;  2BJX A;  3IK7 A;  3UJ1 A;  3WGX A;  3KP8 A;  3L9U A;  2VCZ A;  2A2P A;  3HJP A;  1YDK A;  1TRU A;  4CDO A;  2H1A A;  3QR6 A;  4GSS A;  4Z2T A;  1XOA A;  2LKU A;  2DJ3 A;  3FZA A;  2I4A A;  1FO5 A;  1Z6N A;  3TOU A;  2R0C A;  1TRW A;  4IKH A;  4KF9 A;  2X8H A;  2I9H A;  5IMD A;  1RW1 A;  2DBC A;  5ID2 B;  5DAK A;  1F3B A;  4RUV A;  2IJY A;  4K8M A;  3G7J A;  2HNL A;  3IPZ A;  2EIO A;  4NV2 A;  4IJ3 A;  3DGQ A;  4NWY A;  4LMV A;  5B8B A;  1A23 A;  5FWG A;  5D93 A;  3M9J A;  1PSQ A;  4AGS A;  2FUG 2;  4AF2 A;  2CZ3 A;  4BVY B;  2IMK A;  2JU5 A;  5J9B A;  1FB6 A;  1Q98 A;  4TR4 A;  1X5D A;  2E0Q A;  5DJM A;  2CVB A;  4WR4 A;  2DKI A;  3HXS A;  13GS A;  4HZ2 A;  3HHV A;  5EL8 A;  4HOJ A;  3TDG A;  5L71 A;  1E2Y A;  3MIX A;  4GTU A;  2J9H A;  3JCM L;  3C1S A;  3GKX A;  3F63 A;  2KP2 A;  3GIX A;  1TXX A;  3WGE A;  1N8J A;  1UA5 A;  1XOB A;  1NHO A;  1F9M A;  1GTA A;  4HU9 A;  4GQF A;  3F3Q A;  1ERV A;  4FYU A;  2L59 A;  2H6Y A;  3CRU A;  5JWO B;  3UL3 A;  3CSJ A;  2P31 A;  4BVX B;  12GS A;  5DQS A;  5IOX A;  1A8L A;  2DJ0 A;  4G0L A;  1FVJ A;  3CMI A;  2B1K A;  1TJD A;  3CYN A;  4HJM A;  3UIW A;  1XFL A;  5CO3 A;  2CT6 A;  5COH A;  2MMO A;  2BTO T;  4JRR A;  4ZL9 A;  1SEN A;  3FK8 A;  2JZS A;  4FIW A;  3DXB A;  1MD3 A;  3VWV A;  3ERW A;  5CRD A;  4ECB A;  2WRT A;  5HFG A;  2RM6 A;  2VCT A;  4TXO A;  4I8B A;  1ST9 A;  2KOK A;  2XHF A;  3GNJ A;  5JWQ B;  3NIV A;  1O6J A;  1XWB A;  2LV3 A;  2VUP A;  3UVH A;  1GNE A;  1V57 A;  3E0U A;  3TGZ A;  4KA0 A;  3TKR A;  1GRX A;  2I3Y A;  5BRT A;  5CP1 A;  2PUK C;  4CY6 A;  5IMF A;  5DAL B;  3ZIT A;  3MWH A;  1U87 A;  2LRT A;  3LXZ A;  2WUL A;  2X99 A;  4KE3 A;  2MZC A;  2QC7 A;  4AJ6 A;  4BA7 A;  1EWX A;  2V1M A;  3D0Z A;  4MLY A;  1BG5 A;  5F8B A;  2NDO A;  1M2D A;  5AIV A;  4IVF A;  5DBQ A;  3O3T A;  1ERU A;  4EC0 A;  3ZTL A;  3NOF A;  2C4J A;  3M3M A;  3F4R A;  5B8A A;  2H75 A;  1X0R A;  1B48 A;  3IE3 A;  2IL3 A;  2VCW A;  1FG4 A;  2AV4 A;  2E2M A;  4F0B A;  5C04 A;  2R5G A;  4NHZ A;  2X64 A;  1FAA A;  1SKS B;  3HKR A;  3RBT A;  3IBH A;  3VK9 A;  2YN1 A;  2AHE A;  3APQ A;  3SBC A;  1I9D A;  2L4Q A;  1URM A;  4V2N A;  2F8F A;  5LD0 A;  4EO3 A;  3RPN A;  2HSM A;  1G0T A;  4GRF A;  2C0G A;  1ABA A;  4IP6 A;  4FQU A;  4YKG A;  2H8L A;  3EYT A;  5D96 A;  5JCW A;  1XWK A;  1GUL A;  22GS A;  3G7Y A;  2XC2 A;  4USS A;  2H6X A;  1O7U A;  4G10 A;  2FGX A;  5IMV A;  4YH2 A;  1PRX A;  2P0G A;  3IV4 A;  4JED A;  5EVO A;  1G6Y A;  4IGJ A;  4F2I A;  2OAC A;  3C1R A;  4MZW A;  6GSV A;  5GZZ B;  3VI5 A;  3EPT A;  4JR4 A;  3D4M A;  4H86 A;  1M2A A;  3M1G A;  1GP1 A;  3MYD A;  3HJM A;  1NW2 A;  2OBI A;  1ZYP A;  2DML A;  4AJ8 A;  3FZ4 A;  3LYP A;  3KM6 A;  3EIN A;  1PQN A;  1UN2 A;  2V2G A;  5EPF A;  4N30 A;  1T00 A;  2KP1 A;  1XXU A;  3KTL A;  7GSS A;  3Q19 A;  2F3M A;  1JZO A;  5DJL A;  1ZZY A;  2PGT A;  2H1B A;  1PGT A;  4GWR A;  5F06 A;  5CRW A;  4RI7 A;  1XW5 A;  4E8H A;  3EUR A;  2GSS A;  4O5R A;  4XRA A;  2HSY A;  3P8W A;  2C3T A;  2GTU A;  2GSQ A;  3EC3 A;  3GKN A;  4LLR A;  1YEX A;  4I5Q A;  3DVW A;  3PR8 A;  3QAW A;  3ERF A;  4Q5Q A;  4PQ1 A;  1B4P A;  2LNS A;  3QAG A;  4OFT A;  3IC8 A;  1SD8 A;  2PVO C;  1V9W A;  2VM1 A;  4KCE A;  2DIY A;  4CHS A;  1BJX A;  4OCE A;  2V32 A;  2B6M A;  4JR6 A;  4KW6 A;  1XWC A;  2H70 A;  2PWJ A;  5AIX A;  1S3D A;  3EU3 A;  4ZB8 A;  2ON5 A;  4K6X A;  1K3Y A;  3APO A;  3H93 A;  3I43 A;  4XS4 A;  5HFK A;  1VF4 A;  3VWW A;  1VRS D;  4EIQ A;  3ISO A;  4TR3 A;  1XVW A;  4GQC A;  3A3T A;  1XW9 A;  3WT1 A;  1GSU A;  2WCI A;  1SJZ A;  4TR0 A;  4HU7 A;  5IMA A;  4Q5F A;  5LCZ A;  3EE2 A;  2C0D A;  4DSS B;  4HDE A;  2RUE A;  4G0K A;  1KTE A;  1TI1 A;  2VO4 A;  3RHC A;  1NHY A;  1U3A A;  5ECL B;  2HI7 A;  2JAC A;  2REM A;  2FA4 A;  2C3N A;  1I5G A;  2QA1 A;  2EIQ A;  1HNB A;  2HZE B;  3R3E A;  2LST A;  2H19 A;  3S9F A;  3MDK A;  4XS6 A;  1V40 A;  1SL2 B;  4TR1 B;  1QFN A;  3W8J A;  1PD2 1;  3LFL A;  1X5C A;  14GS A;  1B9X C;  3BD2 A;  4TKY A;  4WF4 A;  1ZGN A;  3A5I A;  1ZYQ B;  2HRF A;  4Z7X A;  4L5O A;  3H4K A;  1QQ2 A;  2H6Z A;  4V2M A;  1XWA A;  2HXK A;  2OBK A;  1VF3 A;  1WJK A;  2LJR A;  2H30 A;  1Q4J A;  2H66 A;  4KAE A;  3W6G A;  1GTI A;  4KDX A;  1OE8 A;  3VI7 A;  1S3A A;  4F9Z A;  4GF0 A;  2H0I A;  1ZMA A;  4P3Y B;  3D4T A;  2FWH A;  1J9B A;  4QQ7 A;  6GSU A;  2L57 A;  2GT5 A;  1ZCP A;  2O87 A;  4KND A;  1GL8 A;  3ZIV A;  3FW2 A;  1FW1 A;  1TRS A;  2GQM A;  1X9M B;  2VD1 A;  3HVX A;  4ULX A;  5F0G A;  1XVQ A;  1GWC A;  5FT3 A;  5H5R A;  1SKW B;  1PL2 A;  4LL1 B;  5IPH A;  5J5N A;  4POL A;  3KP9 A;  5KEJ A;  4LL4 B;  4XHM A;  1JZD A;  5HFI A;  1ACV A;  1S3C A;  2X49 A;  4IEL A;  1K0B A;  1MTC A;  5E4W A;  2A4H A;  2RLI A;  6GSX A;  5HR0 A;  5ECI B;  4PGT A;  1T4Z A;  2K8S A;  3IR4 A;  3VWU A;  4WR5 A;  2RII A;  4K1F A;  3GMF A;  2ALB A;  3DIE A;  2X8G A;  2WB9 A;  1ML6 A;  3APS A;  2L6C A;  3VUR A;  2IFQ A;  5D9X A;  2DLX A;  3FR9 A;  4PUF C;  1TKD B;  4CY8 A;  2GT6 A;  2H74 A;  2WS2 A;  3TJK A;  1QK8 A;  5JCU A;  4AJ7 A;  5GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...