1O81A

Tryparedoxin ii from c.fasciculata solved by sulphur phasing
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
PHMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNVEAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN II
publication title De Novo Phasing of Two Crystal Forms of Tryparedoxin II Using the Anomalous Scattering from S Atoms: A Combination of Small Signal and Medium Resolution Reveals This to be a General Tool for Solving Protein Crystal Structures
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 48
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o81A00
5D9XA 5HFKA 3H8QA 1T1VA 3EMPA 1X5DA 4G19A 1NM3A 2VCVA 2H70A 2P31A 3EINA 4YQUA 3L9SA 4EL1A 1B8XA 4EVMA 4FYUA 2AB6A 5DVBA 2CAQA 3IPZA 2RM6A 2H8LA 2I9HA 2FLSA 4MF5A 5H5SA 2M72A 4PQ1A 5HQPA 2PGTA 1B9YC 5IOWA 1RW1A 3E9JB 3WGEA 3QR6A 1THOA 3LORA 4O32A 1T4ZA 4GTUA 2FGXA 4K7NA 3TRPA 2VD0A 1Z7PA 4IW9A 3VLNA 2H74A 3KJYA 2E7PA 1X5CA 2K8VA 3ZIVA 3TOTA 3K8NA 1U87A 2V6KA 4MCUA 4WR5A 5IMZA 2DMLA 2X99A 1F6MC 4EO3A 1WWJA 2CZ2A 3KZQA 1G0TA 2L4QA 4O5RA 3FYGA 5B7CA 1GTUA 1ERVA 2PN8A 5AIXA 2E0QA 3FR9A 4IBPA 4N30A 1XOAA 4ZXGA 3H4KA 3C71A 3HY2A 4E8EA 3JCML 4BWSA 5A5KA 1A8LA 2NTOA 2AUVA 2H71A 1TDIA 1U3AA 3HZ4A 1EOHA 1T8EB 2TRXA 2VLVA 1SKWB 4K8MA 3CSHA 2XHFA 2OA7A 2VM2A 3F6FA 2YZUA 5F0GA 2NPBA 3G7JA 4DSQA 3HD5A 2BJXA 3EC3A 3HXSA 2K9FA 3MDKA 1W89A 2PUKC 3HCZA 2VCXA 1G6YA 1AUCA 3TOUA 2PMTA 4XCSA 2DJ1A 3QAGA 4HZ2A 1ILOA 3J7Yb 1EGOA 3CRUA 1BX9A 4IP6A 2H75A 4FO5A 1SK1A 2WRTA 2R6KA 3GUSA 5J9BA 2IFQA 2PWJA 2VCWA 2GVPA 5IMDA 2B1KA 1SK0A 3F9UA 3P2AA 3QMXA 5INYA 1UA5A 3N9JA 2PBJA 5IM9A 18GSA 2VIMA 4POMA 5CNWA 1XOBA 2GDRA 2LRNA 3D0ZA 3LYPA 1H4OA 2LQOA 1ML6A 3DRNA 1T3BA 1A2JA 4V2LA 4AJ8A 2PPTA 3HVXA 4L8EA 5GAND 4FYCA 1I5GA 4EKZA 4QL7A 3GN3A 4X0XA 2H1GA 1J9BA 4MABA 1TK0B 1WIKA 2R37A 4MZWA 1V98A 1Z9HA 4YAVA 2P5QA 2GLRA 3ZFBA 1OKTA 2FWFA 1Q98A 2R2JA 3KM6A 1XW9A 3QDNA 2VL2C 4TR3A 3C8EA 5GZZB 3UEMA 2EC4A 5DALB 5EL8A 3PH9A 1PD21 2GT5A 5IO0A 3QOUA 1JZWA 2YWMA 3ZZXA 2L6DA 4TN8A 3BCIA 3TGZA 2FA8A 1LBKA 4TXOB 1PMTA 3IV4A 4FH8A 2IMKA 1RK4A 3KXOA 5ECLB 4KW6A 3IA1A 5ID2A 3KCMA 2X8HA 5AN1A 5E4WA 3QD9A 2GTUA 3UVTA 3M8NA 3ZMKA 4G9HA 1HNAA 1THXA 2DBCA 4ECIA 3F4RA 1FO5A 4TR0A 3ME7A 3L78A 3UAPA 5CO3A 5COHA 2N5FA 4ECBA 1M99A 5KN2A 1SYRA 4IP1A 3TUEA 2JACA 4ML6A 1X5EA 3CSIA 2FWHA 4K1FA 3KP8A 3GH9A 3WD6A 1NHYA 4AGSA 1MTCA 5G5FA 5CYYA 1EEJA 4DSSB 5DJMA 3LXTA 5JWRB 1PGTA 5L71A 1TU7A 4MF7A 1K0CA 4ZB8A 2O89A 22GSA 2FWGA 2VLUA 2YNXA 1GSSA 3KH7A 2JU5A 5DCHA 3QPMA 4J57E 2P0GA 2AV4A 2OKAA 3ERWA 4IJ3A 3SBCA 3LXZA 5IIZA 4MJEA 1X9WB 1TOFA 1IYIA 1OC9B 3L0HA 1AW9A 1V2AA 4N0ZA 2VAFA 2DLXA 1FAAA 4MZCA 4I8BA 1DSBA 1M9BA 1AC1A 1Z6NA 3DWVA 1TK5B 3LGCA 2HLSA 1EZKA 4XS6A 1YDKA 2V41A 1SKSB 2PERA 1YQ1A 5HR2A 2DJ2A 1HNBA 1K0OA 2B5EA 4EC0A 1GSYA 3A2WA 4FYBA 4MF6A 5D9VA 4V2MA 5HFIA 2VL9A 3D22A 5IOXA 2G2QA 1WOUA 2WJUA 2FHEA 4YH2A 3CTFA 2JADA 3HYPA 2H73A 2F9SA 4KAEA 2YWIA 5FHIA 1JZRA 4TR1B 1HQOA 3APOA 1GWCA 4HEA2 2HXKA 3I9V2 2HRNA 5CREA 2OE3A 4HOJA 1SK2A 4F9ZA 1DE1A 3F4SA 1X9MB 2GSQA 2OE1A 4H86A 2YV7A 3P90A 1JLVA 3VWXA 3KTLA 1GSQA 4IKHA 4NHZA 5CRHA 2H30A 3O6TA 1QGVA 1QMVA 1OC3A 2ES7A 3IR4A 3L4NA 4WR4A 5DQYA 2M46A 5G1LA 1JFUA 3CTGA 2CZ3A 3QFBC 6GSVA 4Z7XA 1OC8A 2L59A 1CQGA 1ABAA 3MSZA 1PA3A 5HR1A 5HR0A 5J5NA 1AQVA 5C04A 1YF1A 1OYJA 14GSA 3GKKA 2LSTA 2GQLA 2LNTA 1XIYA 2LV3A 4ISDA 2CQ9A 3EURA 5ECSA 4EF0A 5HR3A 2IJYA 3GKNA 3IXRA 4ZB9A 13GSA 5J4UA 1TI1A 4JR4A 17GSA 4WF5A 3V1WA 1GP1A 2IN3A 4GQCA 3VK9A 1OAZA 3DVWA 3HJMA 3GX8A 1ZZYA 2YN1A 2H72A 3HZ8A 1JHBA 4NXIA 3QCPA 5KEJA 3IC4A 2F8FA 3GYKA 1SYXA 4MA9A 4WBRD 1UVZA 3ZL5A 5G5EA 4KB3A 5FWGA 3TKSC 1B9XC 3SWLA 4MZBA 2H0GA 1DE2A 4L0WA 4AJ7A 3VWWA 2GS3A 2GZYA 1SU9A 4LLRA 3TKQA 1TU8A 3CMIA 2JSYA 4RUVA 4GCIA 1AAZA 2O87A 3RDWA 2YWNA 2CVDA 1TW9A 2REMA 1GNWA 3M9JA 5C00A 4ZBAA 1GH2A 2H1BA 4G2EA 2YJ7A 4RQRA 2OE0A 3D4TA 4K7IA 3BJ5A 1N2AA 4PGTA 4K6XA 2MZCA 1HYUA 4Q5QA 2H19A 4RI7A 2OADA 2XPDA 3D21A 3DYRA 3WT1A 20GSA 1BJXA 3ERGA 2LTKA 3IBHA 5ABRA 2C80A 4BVXA 1J0FA 4I6XA 4DVCA 1XVWA 2FA4A 1SJZA 3LG6A 2XPEA 4PNGA 2CAIA 3L9VA 5ECRB 4PURA 3FKFA 1WRYA 4DSRA 10GSA 1B48A 4OFTA 2MMNA 2HT9A 1M2DA 3C73A 3PINA 2HRFA 4RI6A 2GSSA 3M3MA 3F8UA 2CX3A 1CQHA 3GH6A 1DBYA 5ECHB 4WEYA 4G10A 3GMFA 4MH3A 3ZLPA 2KOKA 4XS1A 1A2MA 3LSZA 1ST9A 3TRQA 1K0AA 4ZL7A 2MMAA 4D73B 2JSZA 1BAYA 3GTUA 3NIVA 1YY7A 2I1UA 3TKRA 1V57A 4PUAA 4I97A 4L5LA 4JZQA 2K8SA 4GSNA 2LUSA 1EP8A 4YQVA 2QGVA 4KX4A 1SL2B 4KDYA 4MDCA 2AYTA 3TB2A 1ON4A 3LYKA 4ZB6A 2FY6A 1AXDA 2A2RA 2WZ9A 2L5LA 5ELAA 2J23A 2TIRA 4F82A 1GNEA 2PU9C 1A0FA 1U6TA 4ECCA 3D4MA 2HZEA 5IPGA 3RHBA 12GSA 3A5WA 5ECIB 4I2UA 1X9SB 4TXOA 4IS0A 5ECPB 2E2MA 5IMVA 3QAVA 2FWEA 2I3YA 1TJDA 5D8IA 2HSHA 2H01A 1TRWA 4TKYA 1GLQA 2NBSA 1GUKA 16GSA 1OE8A 2C3NA 2MYGA 2WS2A 2B6MA 1J08A 1SJIA 4KDUA 5EVOA 4GLTA 3GL3A 4PUFC 4K0GA 4OD7A 4ZBDA 4GRFA 5D9TA 3FK8A 4CDOA 4HI7A 3F4TA 3CBUA 6GSSA 4MLYA 5E59A 1AQXA 2KHPA 1GSEA 1BYEA 2M80A 3DXBA 2LKUA 2YANA 3PR8A 1WPIA 3D6IA 2LNSA 4LL1B 4I5QA 4ZBBA 4HJMA 4OCEA 1MDIA 1KBNA 4IELA 5A4UA 3DGQA 4P3YB 2LJRA 2LEGA 4ZIJA 4J56E 5G2ZA 3EMXA 3CYNA 3HHVA 2LRCA 3MAKA 1M2BA 3GHAA 5DAKA 3ISOA 2H6YA 4N11A 4TRXA 1SL0B 5J9CA 1A24A 3DIEA 4MH2A 1A2LA 2DIYA 1K0DA 4XS4B 1ERWA 4J2FA 3L9UA 2WB9A 4KDXA 3TJKA 2MMZA 4KH7A 3APQA 4MJCA 1PN9A 5JWOB 3ERFA 4HUAA 2RM5A 5F05A 3EU3A 2V1MA 4IJIA 2C3TA 3UOMA 1WE0A 5F06A 2C0FA 3LWAA 2RUFA 2LJKA 6GSUA 1USBA 3S9FA 5KN3A 1M0UA 3WYWA 4EDYA 4WBJA 2L6CA 5AIVA 2HNLA 2O8VB 3I69A 4Q5NA 4KCAA 1TRUA 3NZNA 5KN0A 3UL3A 1TXXA 4LMVA 2C1YA 2A2SA 5ECQB 4IN0A 6GSXA 2C4JA 5A4VA 1MDKA 3A2VA 3H93A 5KN1A 2AJQB 4NPBA 1OKDA 4BL7A 5ID2B 4GSTA 4YQMA 2JL4A 5IMFA 3MNGA 2CVBA 4TXVA 4F0CA 2IMDA 2DJ3A 2VO4A 5LNKe 1FVJA 2B5XA 1F9MA 1GULA 1FB6A 2YOIA 4MJBA 3P7XA 3EU4A 1E2YA 4N10A 5GAPD 3FZAA 2WDUA 11GSA 5D9WA 4ZILA 4PQIA 5CRGA 3W6GA 2J9HA 2KLXA 1YZXA 1AQWA 2F51A 1ZGNA 4ID0A 1FOVA 4IHUA 3UBKA 3ED3A 2VL2A 3EVIA 1ZCPA 4MPFA 4PXOA 1XZOA 3CSJA 4K2DA 3TKSE 3PGTA 3ZVJA 4OFMA 5B6MA 2D2ZA 4JRRA 2CA8A 5GSTA 3VI7A 4TVEA 2C0DA 4GSSA 4K0NA 1T7PB 5HFGA 5IMAA 3IK9A 3WGDA 5GSSA 2DMMA 4NV5A 1XXUA 1OE7A 3E3EA 4ZL8A 5JWQB 4PX1A 1VGLA 5D73A 5ECMB 5H5QA 3LQ7A 3LFLA 2IMIA 1QXHA 1GSUA 4OMVA 1HD2A 2LRTA 2H1AA 3KIJA 1XFLA 2RIIA 4KNDA 4ZL9A 5G30A 3IK7A 4JU5A 8GSSA 1GTBA 2XBIA 3FHKA 2C0EA 5F07A 3CRTA 3KMNA 2VCZA 1M9AA 3F63A 5JCUA 1KNGA 1XWAA 4KE3A 2GQMA 1XWCA 4L5OA 1VF1A 1YKCA 5EY6A 3VFIA 4XRAA 4WETA 3GSSA 4EE0A 1OVNA 2N5AA 1TRVA 3GX0A 2MBSA 3G9BA 1EV4A 3J7Yk 4F2IA 2VLTA 3D5JA 3HVVA 6GSTA 3G7IA 2GSRA 3IOSA 2VL3A 1PSQA 4PQHA 4K9ZA 2OJLA 1T00A 6GSWA 3VWVA 4BWQA 4N0VA 1TTZA 3UJ1A 1MDJA 5ECKB 5IPHA 1O7UA 2DJJA 1PL1A 1ERUA 1BG5A 1M2AA 4WF4A 3R2QA 2BMXA 2YWOA 2FUG2 4HU9A 2K6VA 1SL1B 1TI3A 4HZ4A 3LJRA 3GURA 2L57A 2VUPA 5CAXA 3BCKA 3HKRA 1Z6MA 4V2NA 5IO2A 2MMOA 1S3CA 3KMOA 4LMWA 3FRCA 3W8JA 1F3BA 3HVSA 4OO4A 1S3DA 2GZPA 1H75A 3DVXA 1PL2A 5ELGA 1O85A 3W8SA 3A2XA 3EE2A 4HU7A 1A0RP 1PX6A 2C0GA 3DD3A 1BQ7A 2WCIA 4PNFA 3C1SA 4V1Ag 2IL3A 1ZYQB 3RPNA 1SJ6A 3GKMA 1O8XA 2LJAA 1K3OA 1O6JA 4RQXA 5ENUA 4AF2A 2CV4A 2YPMA 1ZOFA 2P5RA 2R4VA 2FCHA 5FT3A 2IPAA 5LCZA 1V9WA 2DJ0A 2AAWA 2H76A 3KH9A 3FZ4A 4POKA 1FB0A 4HQSA 1GTAA 5J3RA 2EIRA 3F3RA 3ZYWA 1ERTA 1G7EA 2IMFA 1JZDA 1Z5YE 1X0RA 4JEDA 3GV1A 3BD2A 2B5YA 4MPGA 4NV2A 2HE3A 2N5BA 5IQYA 3Q6OA 3DKSA 1IYHA 1QFNA 1Q4JA 5DDLA 2H1DA 1EP7A 4FIWA 2CX4A 2NVLA 1EEMA 3F3QA 2XC2A 1K3YA 2KUCA 4O92A 3P8WA 1ZYEA 3TJBA 1TP9A 3QFAC 5B8AA 2YZHA 3GL5A 1YEXA 5JCWA 1R5PA 5EPFA 3VPTA 1U88A 4ML1A 1B4PA 3U6VA 1A23A 3QAWA 5DALA 3ZTLA 4JR6A 1XWBA 1GUMA 2NDOA 2EIOA 4ILFA 4KCEA 4F03A 1UC7A 3E0UA 3UIWA 1Y6EA 3IRAA 5DJLA 3KTBA 1GL8A 5J41A 1WMJA 2KP1A 3FR6A 3TKSA 3O3TA 4IGJA 2IMEA 1PX7A 1U3IA 3M9KA 4XS4A 2IIYA 3TRXA 3GNJA 2V2GA 3UVHA 4F0BA 6GSYA 3ZMLA 5IMCA 4TW5A 5JCGA 5AISA 3HJPA 2ZUPA 3KD0A 1WP0A 4HDEA 1K0NA 1GSDA 2ZNMA 1XW5A 3HJOA 5DCGA 9GSSA 2G0FA 1F37A 2B3SA 2PVQA 1NSWA 3GA4A 5CRDA 3GTUB 5D96A 4KA0A 1GLPA 1SD9A 1XCCA 3GKXA 5G31A 1VF4A 4MP4A 3VURA 2X64A 2RUEA 4DSSA 4TOPA 4ACSA 2DIZA 2WGRA 1XW6A 3Q19A 1ACVA 4EXJA 1UN2A 5AGYA 4OCFA 4EDZA 2IWTA 2K18A 1URMA 3VPQA 3ZIJA 2YP6A 1SD8A 4NMUA 1YKAA 2XBQA 1R4WA 1ZMAA 2HFDA 1TKDB 2VM1A 2H0IA 3MWHA 4JE1A 2HZEB 3IE3A 3KEBA 4AJ6A 2BTOT 1MD3A 1FG4A 1F2EA 3NOFA 3RPPA 4K7OA 3VWUA 1PKWA 2IFQB 3UBLA 3FZ9A 3A3TA 3UARA 5H5RA 4Q5FA 1OC9A 3FW2A 1XWGA 2I4AA 2VOCA 2KP2A 4POLA 3ZITA 1KTEA 3BOAA 3HA9A 4KUNA 1I9DA 1GTIA 1JLWA 2PVOC 2FD3A 4HS1A 1EOGA 3C7MA 4O7HA 1Z7RA 1NW2A 2ALBA 1KEBA 2TRCP 3HDCA 1VF3A 3ZRDA 2WFCA 1DUGA 4XRDA 4Q5RA 3Q18A 4KSMA 1V40A 5CP1A 5CRWA 5ECNB 1FW1A 2JZSA 2L4CA 4HJ2A 1PKZA 4CHSA 1O73A 5B6NA 1WJKA 4MMMA 4TR1A 3DEXA 1TRSA 3ZFLA 2ZCTA 2OBIA 2I81A 3H1NA 2OACA 4TR4A 1K0MA 2E2GA 4WKWA 4IVFA 5DAKB 5DQSA 4OO5A 1Y25A 3Q74A 2B1LA 5F8BA 19GSA 4NWYA 2Z9SA 1TK8B 2FNOA 3CXGA 3WGXA 3VI5A 2ON7A 4KGIA 1GUHA 3RBTA 3N5OA 2YV9A 3I6AA 1G6WA 1JZOA 1GRXA 1YJ6A 4GXZA 2V32A 5LD0A 2QC7A 2HSYA 4XHMA 7GSSA 3M1GA 2VCQA 3BBYA 4IQAA 3OR5A 1QQ2A 4V1Ap 3GFKA 3U5RE 3M0FA 1K0BA 5D93A 1Z3EA 1V58A 1ZL9A 2YCDA 3FZ5A 3US3A 2DC5A 2VD1A 2EIQA 3APSA 3EWLA 4GWRA 2X8CA 4OFNA 1HNCA 4BPYA 1G7OA 1SKRB 4JBBA 2X8GA 1R26A 4NHWA 2F8AA 2GZZA 2GQKA 2C8UA 1EGRA 1QUWA 3DMLA 4BA7A 3LEFA 1S3AA 4QQ7A 3ME8A 1M7TA 2H66A 1SENA 1MD4A 3TCOA 2H6XA 4ULXA 2CVKA 1XVQA 2YJHA 2DSAA 4E8HA 4YAPA 3KP9A 1NHOA 1PRXA 2V6OA 4MJAA 4LA1A 3FR3A 1XWKA 1MEKA 1EWXA 3IHQA 4LL4B 2LS5A 1E6BA 1B4QA 2HZFA 5B8BA 1QK8A 4NAXA 2JZRA 4ECJA 3C1RA 2H6ZA 1LU4A 2A4VA 3F0IA 4XTSA 3FEUA 5A4WA 1FVKA 4GF0A 3TDGA 1O8WA 2HI7A 4IQ1A 4HQZA 2F3MA 2AHEA 1RQMA 4DEJA 4MK3A 1VF2A 1N8JA 1W4VA 3IAM2 2R5GA 1LJRA 2CT6A 1GSFA 4EUYA 2C3QA 1XPVA 2OBKA 4POBA 2RLIA 2ON5A 4X1UA 3GSTA 5ECOB 1A8YA 2HYXA 3TKPA 2L5OA 4XIHA 1XBSA 4CW9A 2JZTA 2MBTA 3IAS2 2VCTA 4BVYA 1YEPA 1O81A 3GRXA 3ZREA 1EV9A 1R5AA 3FY7A 3TJGA 2GT6A 3EYTA 5G1KA 1FHEA 4OWYA 4QL9A 4GQFA 2DJKA 1C72A 4L0UA 4I2TA 1VRSD 3H79A 1K3LA 3UMAA 3WT2A 5DBQA 2GSTA 3IDVA 2O85A 2QSIA 3G7YA 1YF0A 4D73A 3GIXA 2WULA 3RHCA 3KGKA 1F3AA 3AY8A 3TJJA 2B7KA 4WXTA 2QKEA 3RAZA 3ZVJD 3F6DA 2B7JA 3O76A 3TJFA 2O7KA 4KSOA 1R7HA 1BEDA 2H0HA 2LQQA 2R3XA 3I43A 1PQNA 2GGTA 1AIUA 1T4YA 4X43A
chains in the Genus database with same CATH superfamily
5D9XA 5HFKA 3H8QA 1T1VA 3EMPA 4K5RA 1X5DA 4G19A 1NM3A 2VCVA 2H70A 2P31A 3EINA 4YQUA 3L9SA 4EL1A 1B8XA 4EVMA 4FYUA 2AB6A 5DVBA 2CAQA 3IPZA 2RM6A 2H8LA 2I9HA 2FLSA 4MF5A 5H5SA 2M72A 4PQ1A 5HQPA 2PGTA 1B9YC 5IOWA 1RW1A 3E9JB 3WGEA 3QR6A 1THOA 3LORA 4O32A 1T4ZA 2DKIA 4GTUA 2FGXA 4K7NA 3TRPA 2VD0A 1Z7PA 4IW9A 3VLNA 2H74A 2HSMA 3KJYA 2E7PA 1X5CA 2K8VA 3ZIVA 3TOTA 3K8NA 1U87A 2V6KA 4MCUA 4WR5A 5IMZA 2DMLA 2X99A 1F6MC 4EO3A 1WWJA 2CZ2A 3KZQA 1G0TA 2L4QA 4O5RA 3FYGA 5B7CA 1GTUA 1ERVA 2PN8A 5AIXA 2E0QA 3FR9A 4IBPA 4N30A 1XOAA 4ZXGA 3H4KA 3C71A 3HY2A 4E8EA 3JCML 4BWSA 5A5KA 1A8LA 2NTOA 2AUVA 2H71A 1TDIA 1U3AA 3HZ4A 1EOHA 1T8EB 2TRXA 2VLVA 1SKWB 4K8MA 3CSHA 2XHFA 2OA7A 2VM2A 3F6FA 2YZUA 5F0GA 2NPBA 3G7JA 4DSQA 3HD5A 2BJXA 3EC3A 3HXSA 2K9FA 3MDKA 1W89A 5BRTA 2PUKC 3HCZA 2VCXA 1G6YA 1AUCA 3TOUA 2PMTA 4XCSA 2DJ1A 3QAGA 4HZ2A 1ILOA 3J7Yb 1EGOA 3CRUA 1BX9A 4IP6A 2H75A 4FO5A 1SK1A 2WRTA 2R6KA 3GUSA 5J9BA 5KOXA 2IFQA 2PWJA 2VCWA 2GVPA 5IMDA 2B1KA 1SK0A 3F9UA 3P2AA 3QMXA 4EIPA 5INYA 1UA5A 3N9JA 2PBJA 5IM9A 18GSA 2VIMA 4POMA 5CNWA 1XOBA 2GDRA 2LRNA 3D0ZA 2UZ8A 3LYPA 1H4OA 2LQOA 1ML6A 3DRNA 1T3BA 1A2JA 4V2LA 4AJ8A 2PPTA 3HVXA 4L8EA 5GAND 4FYCA 1I5GA 4EKZA 2HRKA 4QL7A 3GN3A 4X0XA 2H1GA 1J9BA 4MABA 1TK0B 1WIKA 2R37A 4MZWA 1V98A 1Z9HA 4YAVA 2P5QA 2GLRA 3ZFBA 1OKTA 2FWFA 1Q98A 2R2JA 3KM6A 1XW9A 3QDNA 4YKGA 2VL2C 4TR3A 3C8EA 1ZYPA 5GZZB 3UEMA 2EC4A 4Z2RA 5DALB 5EL8A 3PH9A 1PD21 2GT5A 5IO0A 3QOUA 1JZWA 2YWMA 3ZZXA 2L6DA 4TN8A 3BCIA 3TGZA 2FA8A 1LBKA 4TXOB 1PMTA 3IV4A 4FH8A 2IMKA 1RK4A 3KXOA 5ECLB 4KW6A 3IA1A 5ID2A 3KCMA 2X8HA 5AN1A 5E4WA 3A5IA 3QD9A 2GTUA 3UVTA 3M8NA 3ZMKA 4G9HA 1HNAA 1XG8A 1THXA 4G0IA 2DBCA 4ECIA 3F4RA 1FO5A 4TR0A 3ME7A 3L78A 3UAPA 5COHA 5CO3A 2N5FA 4ECBA 1M99A 4X4JA 5KN2A 1SYRA 4G0KA 4IP1A 3TUEA 2JACA 4ML6A 1X5EA 3CSIA 2FWHA 4K1FA 3KP8A 3GH9A 3WD6A 1NHYA 4AGSA 1MTCA 5G5FA 5CYYA 1EEJA 4DSSB 5DJMA 3LXTA 5JWRB 1PGTA 5L71A 1TU7A 4MF7A 1K0CA 4ZB8A 2O89A 22GSA 2FWGA 2VLUA 2YNXA 1GSSA 3KH7A 2JU5A 5DCHA 3QPMA 4J57E 2P0GA 2AV4A 2OKAA 3ERWA 4IJ3A 3SBCA 3LXZA 5IIZA 4MJEA 1X9WB 1TOFA 1IYIA 2R0PA 1OC9B 3L0HA 1AW9A 3IC8A 1V2AA 4N0ZA 2VAFA 2DLXA 1FAAA 4MZCA 4I8BA 1DSBA 1M9BA 1AC1A 1Z6NA 3DWVA 1TK5B 3LGCA 2HLSA 1EZKA 4XS6A 1S3RA 1YDKA 2V41A 1SKSB 1M3IA 2PERA 1YQ1A 5HR2A 2DJ2A 1HNBA 1K0OA 2B5EA 4EC0A 1GSYA 3A2WA 4FYBA 3CQFA 4MF6A 5D9VA 4V2MA 5HFIA 2VL9A 3D22A 5IOXA 2G2QA 1WOUA 2WJUA 2FHEA 4YH2A 3CTFA 2JADA 3HYPA 2H73A 2F9SA 4KAEA 2YWIA 5FHIA 1JZRA 4TR1B 1HQOA 3APOA 1GWCA 4HEA2 2HXKA 3I9V2 2HRNA 5CREA 2OE3A 4HOJA 1SK2A 4F9ZA 1DE1A 3F4SA 1X9MB 4Z2UA 2GSQA 2OE1A 4H86A 2YV7A 3P90A 1JLVA 3VWXA 3KTLA 1GSQA 4IKHA 4NHZA 5CRHA 1M3JA 2H30A 3O6TA 1QGVA 1QMVA 1OC3A 2ES7A 3IR4A 3L4NA 4WR4A 5DQYA 2M46A 5G1LA 1JFUA 3CTGA 4K5SA 2CZ3A 3QFBC 6GSVA 4Z7XA 1OC8A 2L59A 1CQGA 1ABAA 3MSZA 1PA3A 5HR1A 3LW9A 5HR0A 5J5NA 1AQVA 5C04A 1YF1A 1OYJA 14GSA 3GKKA 2LSTA 2GQLA 2LNTA 1XIYA 2LV3A 4ISDA 2CQ9A 3EURA 5ECSA 4EF0A 5HR3A 2IJYA 3GKNA 3IXRA 4ZB9A 13GSA 5J4UA 1TI1A 4JR4A 17GSA 4WF5A 3V1WA 1GP1A 2IN3A 4GQCA 3VK9A 1OAZA 3DVWA 3HJMA 3GX8A 1ZZYA 2YN1A 2H72A 3HZ8A 1JHBA 4NXIA 3QCPA 5KEJA 3IC4A 2F8FA 3GYKA 1SYXA 4MA9A 4WBRD 1UVZA 3ZL5A 5G5EA 4KB3A 5FWGA 3TKSC 1B9XC 3SWLA 4MZBA 3HVNA 2H0GA 1DE2A 4L0WA 4AJ7A 3VWWA 2GS3A 2GZYA 1SU9A 4LLRA 2A2PA 3TKQA 1TU8A 3CMIA 2JSYA 4RUVA 5BMUA 4GCIA 1AAZA 2O87A 3RDWA 2YWNA 2CVDA 1TW9A 2REMA 1GNWA 3M9JA 5C00A 4ZBAA 1GH2A 2H1BA 4G2EA 2YJ7A 4RQRA 2OE0A 3D4TA 4K7IA 3BJ5A 1N2AA 4PGTA 4K6XA 2MZCA 1HYUA 4Q5QA 4YKFA 4O5UA 2HRAA 2H19A 4RI7A 2OADA 2XPDA 3D21A 3DYRA 3WT1A 20GSA 1BJXA 3ERGA 2LTKA 3IBHA 5ABRA 2C80A 4BVXA 1J0FA 4I6XA 4DVCA 1XVWA 2FA4A 1SJZA 3LG6A 2XPEA 4PNGA 2CAIA 3L9VA 5ECRB 4PURA 3FKFA 1WRYA 4DSRA 4BVYB 10GSA 1B48A 4OFTA 2MMNA 2HT9A 1M2DA 3C73A 3PINA 2HRFA 4RI6A 2GSSA 3M3MA 1PN0A 3F8UA 2CX3A 1CQHA 3GH6A 1DBYA 5ECHB 4WEYA 4G10A 3GMFA 4MH3A 3ZLPA 2KOKA 4XS1A 1A2MA 3LSZA 1ST9A 3TRQA 4A5PA 1K0AA 4ZL7A 2MMAA 4D73B 2JSZA 1BAYA 3GTUA 3NIVA 1YY7A 2I1UA 3TKRA 1V57A 4PUAA 4I97A 4L5LA 4PTSA 4JZQA 2K8SA 4GSNA 2LUSA 1EP8A 4YQVA 2QGVA 4KX4A 1SL2B 4KDYA 4MDCA 2AYTA 4HSCX 3TB2A 1ON4A 3LYKA 4ZB6A 2FY6A 1AXDA 2A2RA 2WZ9A 2L5LA 5ELAA 2J23A 2TIRA 4F82A 1GNEA 2PU9C 1A0FA 1U6TA 4ECCA 3D4MA 2HZEA 5IPGA 3RHBA 12GSA 3A5WA 5ECIB 4I2UA 1X9SB 4TXOA 4IS0A 5ECPB 2E2MA 5IMVA 3QAVA 2FWEA 2I3YA 1TJDA 5D8IA 2HSHA 2H01A 1TRWA 4TKYA 1GLQA 2NBSA 1GUKA 16GSA 1OE8A 2C3NA 2MYGA 3R3EA 2WS2A 2B6MA 1J08A 1SJIA 2X4AA 2X49A 4KDUA 5EVOA 4GLTA 3GL3A 4PUFC 4K0GA 4OD7A 4ZBDA 4GRFA 5D9TA 3FK8A 4CDOA 4HI7A 3F4TA 3CBUA 6GSSA 4MLYA 1AQXA 5E59A 2KHPA 1GSEA 1BYEA 2M80A 3DXBA 2LKUA 2YANA 3PR8A 1WPIA 3D6IA 2LNSA 4LL1B 4I5QA 2A4HA 4ZBBA 4HJMA 4OCEA 1MDIA 1KBNA 4IELA 5A4UA 3DGQA 4P3YB 2LJRA 2LEGA 4ZIJA 4J56E 5G2ZA 3EMXA 3CYNA 3HHVA 2LRCA 3MAKA 1M2BA 3GHAA 5DAKA 3ISOA 2H6YA 4N11A 4TRXA 1SL0B 5J9CA 1A24A 3DIEA 4MH2A 1A2LA 2DIYA 1K0DA 4XS4B 1ERWA 4J2FA 3L9UA 2WB9A 4KDXA 3TJKA 2MMZA 4KH7A 3APQA 4MJCA 3FMWA 1PN9A 5JWOB 3ERFA 4HUAA 2RM5A 5F05A 3EU3A 2V1MA 4IJIA 2C3TA 3UOMA 1WE0A 5F06A 2C0FA 3LWAA 2RUFA 2LJKA 6GSUA 1USBA 3S9FA 5KN3A 1M0UA 3WYWA 4EDYA 4WBJA 2L6CA 5AIVA 2HNLA 2O8VB 3I69A 4Q5NA 4KCAA 1TRUA 3NZNA 5KN0A 3UL3A 1TXXA 4LMVA 2C1YA 2A2SA 5ECQB 4IN0A 6GSXA 2C4JA 5A4VA 1MDKA 3A2VA 3H93A 5KN1A 2AJQB 4NPBA 1OKDA 4BL7A 5ID2B 4GSTA 4YQMA 2JL4A 5IMFA 3MNGA 2CVBA 4TXVA 4F0CA 2IMDA 2DJ3A 2VO4A 5LNKe 1FVJA 2B5XA 1F9MA 1GULA 1FB6A 2YOIA 4MJBA 3P7XA 3EU4A 1E2YA 4N10A 5GAPD 3FZAA 1PFOA 2WDUA 11GSA 5D9WA 4ZILA 4PQIA 5CRGA 3W6GA 2J9HA 2KLXA 4G0LA 1YZXA 1AQWA 2F51A 1ZGNA 4ID0A 1FOVA 4IHUA 3UBKA 3ED3A 2VL2A 3EVIA 1ZCPA 4MPFA 4PXOA 1XZOA 3CSJA 4K2DA 3TKSE 3PGTA 3ZVJA 4OFMA 5B6MA 2D2ZA 4JRRA 2CA8A 5GSTA 3VI7A 4TVEA 2C0DA 4GSSA 4K0NA 1T7PB 5HFGA 5IMAA 3IK9A 3WGDA 5GSSA 2DMMA 4NV5A 1XXUA 1OE7A 3E3EA 4ZL8A 5JWQB 4PX1A 1VGLA 5D73A 5ECMB 5H5QA 3LQ7A 3LFLA 2IMIA 1QXHA 1GSUA 4OMVA 1HD2A 2LRTA 2H1AA 3KIJA 1XFLA 2RIIA 4KNDA 4ZL9A 5G30A 3IK7A 4JU5A 4MNNA 8GSSA 1GTBA 2XBIA 3FHKA 4FQUA 2C0EA 3CRTA 5F07A 3KMNA 2VCZA 1M9AA 3F63A 5JCUA 1KNGA 1XWAA 4KE3A 2GQMA 1XWCA 4L5OA 1VF1A 1YKCA 5EY6A 3VFIA 4XRAA 4WETA 3GSSA 4EE0A 1OVNA 2N5AA 1TRVA 3GX0A 2MBSA 3G9BA 1EV4A 3J7Yk 4F2IA 2VLTA 3D5JA 3HVVA 6GSTA 3G7IA 2GSRA 3IOSA 2VL3A 1PSQA 4PQHA 4K9ZA 2OJLA 4CY6A 1T00A 6GSWA 3VWVA 4BWQA 4N0VA 1TTZA 3UJ1A 1MDJA 5ECKB 5IPHA 1O7UA 2DJJA 1PL1A 1ERUA 1BG5A 1M2AA 4WF4A 3R2QA 2BMXA 2YWOA 2FUG2 4HU9A 3PPUA 2K6VA 1SL1B 1TI3A 3EPTA 4HZ4A 3LJRA 3GURA 2L57A 2VUPA 5CAXA 3BCKA 3HKRA 1Z6MA 4V2NA 5IO2A 2MMOA 4USSA 1S3CA 3KMOA 4LMWA 3FRCA 3W8JA 1F3BA 3HVSA 4OO4A 1S3DA 2GZPA 1H75A 3DVXA 1PL2A 5ELGA 1O85A 3W8SA 3A2XA 3EE2A 4HU7A 1A0RP 1PX6A 2C0GA 3DD3A 1BQ7A 2WCIA 4PNFA 3C1SA 4V1Ag 2IL3A 1ZYQB 3RPNA 1SJ6A 3GKMA 1O8XA 2LJAA 1K3OA 1O6JA 4RQXA 5ENUA 4AF2A 2CV4A 2YPMA 1ZOFA 2P5RA 2R4VA 2FCHA 5FT3A 2IPAA 5LCZA 1V9WA 2DJ0A 2AAWA 2H76A 3KH9A 3FZ4A 4POKA 1FB0A 4HQSA 1GTAA 5J3RA 2EIRA 3F3RA 3ZYWA 1ERTA 1G7EA 2IMFA 1JZDA 1Z5YE 1X0RA 4JEDA 3GV1A 3BD2A 2B5YA 4CY8A 4MPGA 4NV2A 2HE3A 2N5BA 5IQYA 3Q6OA 3DKSA 1IYHA 1QFNA 1Q4JA 5DDLA 2H1DA 1EP7A 4FIWA 2CX4A 2NVLA 1EEMA 3F3QA 2XC2A 1K3YA 2KUCA 4O92A 3P8WA 2QA2A 1ZYEA 3TJBA 1TP9A 3QFAC 5B8AA 2YZHA 3GL5A 1YEXA 5JCWA 1R5PA 5EPFA 3VPTA 1U88A 4ML1A 1B4PA 3U6VA 1A23A 3QAWA 5DALA 3ZTLA 4JR6A 1XWBA 1GUMA 2NDOA 4EIQA 2EIOA 4ILFA 4KCEA 4F03A 1UC7A 3E0UA 3UIWA 1Y6EA 3IRAA 5DJLA 4BVXB 3KTBA 1GL8A 5J41A 1WMJA 2KP1A 3FR6A 3TKSA 3O3TA 4IGJA 2IMEA 4ICYA 1PX7A 1U3IA 3M9KA 4XS4A 2IIYA 3TRXA 3GNJA 2V2GA 3UVHA 4F0BA 6GSYA 3ZMLA 5IMCA 4TW5A 5JCGA 5AISA 3HJPA 2ZUPA 3KD0A 1WP0A 4HDEA 1K0NA 1GSDA 2ZNMA 1XW5A 3HJOA 5DCGA 9GSSA 2G0FA 1F37A 2B3SA 2PVQA 1NSWA 3GA4A 5CRDA 3GTUB 5D96A 4KA0A 1GLPA 1SD9A 1XCCA 3GKXA 5G31A 1VF4A 4MP4A 3VURA 2X64A 4K2XA 2RUEA 4DSSA 4TOPA 4ACSA 2DIZA 2WGRA 1XW6A 3Q19A 1ACVA 4EXJA 1UN2A 5AGYA 4OCFA 4EDZA 2IWTA 2K18A 1URMA 3VPQA 3ZIJA 2YP6A 1SD8A 4NMUA 1YKAA 2XBQA 1R4WA 1ZMAA 2HFDA 1TKDB 2VM1A 2H0IA 3MWHA 4JE1A 2HZEB 3IE3A 3KEBA 4AJ6A 2BTOT 4O5QA 1MD3A 1FG4A 1F2EA 3NOFA 3RPPA 4K7OA 3VWUA 1PKWA 4KF9A 2IFQB 3UBLA 4BIKA 3FZ9A 3A3TA 3UARA 2DKHA 5H5RA 4Q5FA 1OC9A 3FW2A 5KOWA 1XWGA 2I4AA 2VOCA 2KP2A 4POLA 3ZITA 1KTEA 3BOAA 3HA9A 4KUNA 1I9DA 1GTIA 1JLWA 2PVOC 2FD3A 2R0CA 4HS1A 1EOGA 3C7MA 4O7HA 1Z7RA 1NW2A 2ALBA 1KEBA 2TRCP 3HDCA 1VF3A 3ZRDA 2WFCA 1DUGA 4XRDA 4Q5RA 3Q18A 4KSMA 1V40A 5CP1A 5CRWA 5ECNB 1FW1A 2JZSA 2L4CA 4HJ2A 1PKZA 4CHSA 1O73A 5B6NA 1WJKA 4MMMA 4TR1A 3DEXA 1TRSA 3ZFLA 2ZCTA 2OBIA 2I81A 3H1NA 2OACA 4TR4A 1K0MA 2E2GA 4WKWA 4IVFA 5DAKB 5DQSA 4OO5A 1Y25A 3Q74A 2B1LA 5F8BA 19GSA 4NWYA 2Z9SA 1TK8B 2FNOA 3CXGA 3WGXA 3VI5A 2ON7A 4KGIA 1GUHA 3RBTA 3N5OA 2YV9A 3I6AA 1G6WA 1JZOA 1GRXA 1YJ6A 4GXZA 2V32A 3IHGA 4Z2TA 5LD0A 2QC7A 2HSYA 4XHMA 7GSSA 3M1GA 2VCQA 3BBYA 4IQAA 3OR5A 1QQ2A 4V1Ap 3GFKA 3U5RE 3M0FA 1K0BA 5D93A 1Z3EA 1V58A 1ZL9A 2YCDA 3FZ5A 3US3A 2DC5A 2VD1A 2EIQA 3APSA 3EWLA 4GWRA 2X8CA 4OFNA 1HNCA 4BPYA 1G7OA 1SKRB 4JBBA 2X8GA 1R26A 4NHWA 2F8AA 2GZZA 1FOHA 2GQKA 2C8UA 1EGRA 1QUWA 3DMLA 4BA7A 3LEFA 1S3AA 4QQ7A 3ME8A 1M7TA 2H66A 1SENA 1MD4A 3TCOA 2H6XA 4ULXA 2CVKA 1XVQA 2YJHA 2DSAA 4E8HA 4YAPA 3KP9A 1NHOA 1PRXA 2V6OA 4MJAA 4LA1A 3FR3A 1XWKA 1MEKA 1EWXA 3IHQA 4LL4B 2LS5A 1E6BA 1B4QA 2HZFA 5B8BA 1QK8A 4NAXA 2JZRA 4ECJA 3C1RA 2H6ZA 1LU4A 4BL7B 2A4VA 3F0IA 4XTSA 3FEUA 5A4WA 1FVKA 4GF0A 3TDGA 1O8WA 2HI7A 4IQ1A 4HQZA 2F3MA 2AHEA 1RQMA 4DEJA 4MK3A 1VF2A 1N8JA 1W4VA 3IAM2 2R5GA 1LJRA 2CT6A 1GSFA 4EUYA 2C3QA 1XPVA 2OBKA 4POBA 2RLIA 2ON5A 4X1UA 3GSTA 5ECOB 1A8YA 2HYXA 3TKPA 2L5OA 4XIHA 1XBSA 4CW9A 2JZTA 2MBTA 3IAS2 2VCTA 4BVYA 1YEPA 1O81A 3GRXA 3MIXA 3ZREA 1EV9A 1R5AA 3FY7A 3TJGA 2GT6A 3EYTA 5G1KA 1FHEA 4OWYA 4QL9A 4GQFA 2DJKA 1C72A 4L0UA 4I2TA 1VRSD 3H79A 1K3LA 3UMAA 3WT2A 5DBQA 2GSTA 3IDVA 2O85A 2QSIA 3G7YA 1YF0A 4D73A 3GIXA 2WULA 3RHCA 3KGKA 2QA1A 1F3AA 3AY8A 1ZYNA 3TJJA 2B7KA 2R0GA 4WXTA 2QKEA 3RAZA 3ZVJD 3F6DA 2B7JA 3O76A 3TJFA 2O7KA 4KSOA 1R7HA 1BEDA 2H0HA 2LQQA 2R3XA 3I43A 3MYDA 1PQNA 2GGTA 1AIUA 1T4YA 4X43A
chains in the Genus database with same CATH topology
5D9XA 5HFKA 3H8QA 1T1VA 3EMPA 4K5RA 1X5DA 4G19A 1NM3A 2VCVA 2H70A 2P31A 3EINA 4YQUA 3L9SA 4EL1A 1B8XA 4EVMA 4FYUA 2AB6A 5DVBA 2CAQA 3IPZA 2RM6A 2H8LA 2I9HA 2FLSA 4MF5A 5H5SA 2M72A 4PQ1A 5HQPA 2PGTA 1B9YC 5IOWA 1RW1A 3E9JB 3WGEA 3QR6A 1THOA 3LORA 4O32A 1T4ZA 2DKIA 4GTUA 2FGXA 4K7NA 3TRPA 2VD0A 1Z7PA 4IW9A 3VLNA 2H74A 2HSMA 3KJYA 2E7PA 1X5CA 2K8VA 3ZIVA 3TOTA 3K8NA 1U87A 2V6KA 4MCUA 4WR5A 5IMZA 2DMLA 2X99A 1F6MC 4EO3A 1WWJA 2CZ2A 3KZQA 1G0TA 2L4QA 4O5RA 3FYGA 5B7CA 1GTUA 1ERVA 2PN8A 5AIXA 2E0QA 3FR9A 4IBPA 4N30A 1XOAA 4ZXGA 3H4KA 3C71A 3HY2A 4E8EA 3JCML 4BWSA 5A5KA 1A8LA 2NTOA 2AUVA 2H71A 1TDIA 1U3AA 3HZ4A 1EOHA 1T8EB 2TRXA 2VLVA 1SKWB 4K8MA 3CSHA 2XHFA 2OA7A 2VM2A 3F6FA 2YZUA 5F0GA 2NPBA 3G7JA 4DSQA 3HD5A 2BJXA 3EC3A 3HXSA 2K9FA 3MDKA 1W89A 5BRTA 2PUKC 3HCZA 2VCXA 1G6YA 1AUCA 3TOUA 2PMTA 4XCSA 2DJ1A 3QAGA 4HZ2A 1ILOA 3J7Yb 1EGOA 3CRUA 1BX9A 4IP6A 2H75A 4FO5A 1SK1A 2WRTA 2R6KA 3GUSA 5J9BA 5KOXA 2IFQA 2PWJA 2VCWA 2GVPA 5IMDA 2B1KA 1SK0A 3F9UA 3P2AA 3QMXA 4EIPA 5INYA 1UA5A 3N9JA 2PBJA 5IM9A 18GSA 2VIMA 4POMA 5CNWA 1XOBA 2GDRA 2LRNA 3D0ZA 2UZ8A 3LYPA 1H4OA 2LQOA 1ML6A 3DRNA 1T3BA 1A2JA 4V2LA 4AJ8A 2PPTA 3HVXA 4L8EA 5GAND 4FYCA 1I5GA 4EKZA 2HRKA 4QL7A 3GN3A 4X0XA 2H1GA 1J9BA 4MABA 1TK0B 1WIKA 2R37A 4MZWA 1V98A 1Z9HA 4YAVA 2P5QA 2GLRA 3ZFBA 1OKTA 2FWFA 1Q98A 2R2JA 3KM6A 1XW9A 3QDNA 4YKGA 2VL2C 4TR3A 3C8EA 1ZYPA 5GZZB 3UEMA 2EC4A 4Z2RA 5DALB 5EL8A 3PH9A 1PD21 2GT5A 5IO0A 3QOUA 1JZWA 2YWMA 3ZZXA 2L6DA 4TN8A 3BCIA 3TGZA 2FA8A 1LBKA 4TXOB 1PMTA 3IV4A 4FH8A 2IMKA 1RK4A 3KXOA 5ECLB 4KW6A 3IA1A 5ID2A 3KCMA 2X8HA 5AN1A 5E4WA 3A5IA 3QD9A 2GTUA 3UVTA 3M8NA 3ZMKA 4G9HA 1HNAA 1THXA 4G0IA 2DBCA 4ECIA 3F4RA 1FO5A 4TR0A 3ME7A 3L78A 3UAPA 5COHA 5CO3A 2N5FA 4ECBA 1M99A 4X4JA 5KN2A 1SYRA 4G0KA 4IP1A 3TUEA 2JACA 4ML6A 1X5EA 3CSIA 2FWHA 4K1FA 3KP8A 3GH9A 3WD6A 1NHYA 4AGSA 1MTCA 5G5FA 5CYYA 1EEJA 4DSSB 5DJMA 3LXTA 5JWRB 1PGTA 5L71A 1TU7A 4MF7A 1K0CA 4ZB8A 2O89A 22GSA 2FWGA 2VLUA 2YNXA 1GSSA 3KH7A 2JU5A 5DCHA 3QPMA 4J57E 2P0GA 2AV4A 2OKAA 3ERWA 4IJ3A 3SBCA 3LXZA 5IIZA 4MJEA 1X9WB 1TOFA 1IYIA 2R0PA 1OC9B 3L0HA 1AW9A 3IC8A 1V2AA 4N0ZA 2VAFA 2DLXA 1FAAA 4MZCA 4I8BA 1DSBA 1M9BA 1AC1A 1Z6NA 3DWVA 1TK5B 3LGCA 2HLSA 1EZKA 4XS6A 1YDKA 2V41A 1SKSB 2PERA 1YQ1A 5HR2A 2DJ2A 1HNBA 1K0OA 2B5EA 4EC0A 1GSYA 3A2WA 4FYBA 4MF6A 5D9VA 4V2MA 5HFIA 2VL9A 3D22A 5IOXA 2G2QA 1WOUA 2WJUA 2FHEA 4YH2A 3CTFA 2JADA 3HYPA 2H73A 2F9SA 4KAEA 2YWIA 5FHIA 1JZRA 4TR1B 1HQOA 3APOA 1GWCA 4HEA2 2HXKA 3I9V2 2HRNA 5CREA 2OE3A 4HOJA 1SK2A 4F9ZA 1DE1A 3F4SA 1X9MB 4Z2UA 2GSQA 2OE1A 4H86A 2YV7A 3P90A 1JLVA 3VWXA 3KTLA 1GSQA 4IKHA 4NHZA 5CRHA 2H30A 3O6TA 1QGVA 1QMVA 1OC3A 2ES7A 3IR4A 3L4NA 4WR4A 5DQYA 2M46A 5G1LA 1JFUA 3CTGA 4K5SA 2CZ3A 3QFBC 6GSVA 4Z7XA 1OC8A 2L59A 1CQGA 1ABAA 3MSZA 1PA3A 5HR1A 3LW9A 5HR0A 5J5NA 1AQVA 5C04A 1YF1A 1OYJA 14GSA 3GKKA 2LSTA 2GQLA 2LNTA 1XIYA 2LV3A 4ISDA 2CQ9A 3EURA 5ECSA 4EF0A 5HR3A 2IJYA 3GKNA 3IXRA 4ZB9A 13GSA 5J4UA 1TI1A 4JR4A 17GSA 4WF5A 3V1WA 1GP1A 2IN3A 4GQCA 3VK9A 1OAZA 3DVWA 3HJMA 3GX8A 1ZZYA 2YN1A 2H72A 3HZ8A 1JHBA 4NXIA 3QCPA 5KEJA 3IC4A 2F8FA 3GYKA 1SYXA 4MA9A 4WBRD 1UVZA 3ZL5A 5G5EA 4KB3A 5FWGA 3TKSC 1B9XC 3SWLA 4MZBA 2H0GA 1DE2A 4L0WA 4AJ7A 3VWWA 2GS3A 2GZYA 1SU9A 4LLRA 2A2PA 3TKQA 1TU8A 3CMIA 2JSYA 4RUVA 5BMUA 4GCIA 1AAZA 2O87A 3RDWA 2YWNA 2CVDA 1TW9A 2REMA 1GNWA 3M9JA 5C00A 4ZBAA 1GH2A 2H1BA 4G2EA 2YJ7A 4RQRA 2OE0A 3D4TA 4K7IA 3BJ5A 1N2AA 4PGTA 4K6XA 2MZCA 1HYUA 4Q5QA 4YKFA 4O5UA 2HRAA 2H19A 4RI7A 2OADA 2XPDA 3D21A 3DYRA 3WT1A 20GSA 1BJXA 3ERGA 2LTKA 3IBHA 5ABRA 2C80A 4BVXA 1J0FA 4I6XA 4DVCA 1XVWA 2FA4A 1SJZA 3LG6A 2XPEA 4PNGA 2CAIA 3L9VA 5ECRB 4PURA 3FKFA 1WRYA 4DSRA 4BVYB 10GSA 1B48A 4OFTA 2MMNA 2HT9A 1M2DA 3C73A 3PINA 2HRFA 4RI6A 2GSSA 3M3MA 1PN0A 3F8UA 2CX3A 1CQHA 3GH6A 1DBYA 5ECHB 4WEYA 4G10A 3GMFA 4MH3A 3ZLPA 2KOKA 4XS1A 1A2MA 3LSZA 1ST9A 3TRQA 4A5PA 1K0AA 4ZL7A 2MMAA 4D73B 2JSZA 1BAYA 3GTUA 3NIVA 1YY7A 2I1UA 3TKRA 1V57A 4PUAA 4I97A 4L5LA 4PTSA 4JZQA 2K8SA 4GSNA 2LUSA 1EP8A 4YQVA 2QGVA 4KX4A 1SL2B 4KDYA 4MDCA 2AYTA 3TB2A 1ON4A 3LYKA 4ZB6A 2FY6A 1AXDA 2A2RA 2WZ9A 2L5LA 5ELAA 2J23A 2TIRA 4F82A 1GNEA 2PU9C 1A0FA 1U6TA 4ECCA 3D4MA 2HZEA 5IPGA 3RHBA 12GSA 3A5WA 5ECIB 4I2UA 1X9SB 4TXOA 4IS0A 5ECPB 2E2MA 5IMVA 3QAVA 2FWEA 2I3YA 1TJDA 5D8IA 2HSHA 2H01A 1TRWA 4TKYA 1GLQA 2NBSA 1GUKA 16GSA 1OE8A 2C3NA 2MYGA 3R3EA 2WS2A 2B6MA 1J08A 1SJIA 2X4AA 2X49A 4KDUA 5EVOA 4GLTA 3GL3A 4PUFC 4K0GA 4OD7A 4ZBDA 4GRFA 5D9TA 3FK8A 4CDOA 4HI7A 3F4TA 3CBUA 6GSSA 4MLYA 1AQXA 5E59A 2KHPA 1GSEA 1BYEA 2M80A 3DXBA 2LKUA 2YANA 3PR8A 1WPIA 3D6IA 2LNSA 4LL1B 4I5QA 2A4HA 4ZBBA 4HJMA 4OCEA 1MDIA 1KBNA 4IELA 5A4UA 3DGQA 4P3YB 2LJRA 2LEGA 4ZIJA 4J56E 5G2ZA 3EMXA 3CYNA 3HHVA 2LRCA 3MAKA 1M2BA 3GHAA 5DAKA 3ISOA 2H6YA 4N11A 4TRXA 1SL0B 5J9CA 1A24A 3DIEA 4MH2A 1A2LA 2DIYA 1K0DA 4XS4B 1ERWA 4J2FA 3L9UA 2WB9A 4KDXA 3TJKA 2MMZA 4KH7A 3APQA 4MJCA 3FMWA 1PN9A 5JWOB 3ERFA 4HUAA 2RM5A 5F05A 3EU3A 2V1MA 4IJIA 2C3TA 3UOMA 1WE0A 5F06A 2C0FA 3LWAA 2RUFA 2LJKA 6GSUA 1USBA 3S9FA 5KN3A 1M0UA 3WYWA 4EDYA 4WBJA 2L6CA 5AIVA 2HNLA 2O8VB 3I69A 4Q5NA 4KCAA 1TRUA 3NZNA 5KN0A 3UL3A 1TXXA 4LMVA 2C1YA 2A2SA 5ECQB 4IN0A 6GSXA 2C4JA 5A4VA 1MDKA 3A2VA 3H93A 5KN1A 2AJQB 4NPBA 1OKDA 4BL7A 5ID2B 4GSTA 4YQMA 2JL4A 5IMFA 3MNGA 2CVBA 4TXVA 4F0CA 2IMDA 2DJ3A 2VO4A 5LNKe 1FVJA 2B5XA 1F9MA 1GULA 1FB6A 2YOIA 4MJBA 3P7XA 3EU4A 1E2YA 4N10A 5GAPD 3FZAA 2WDUA 11GSA 5D9WA 4ZILA 4PQIA 5CRGA 3W6GA 2J9HA 2KLXA 4G0LA 1YZXA 1AQWA 2F51A 1ZGNA 4ID0A 1FOVA 4IHUA 3UBKA 3ED3A 2VL2A 3EVIA 1ZCPA 4MPFA 4PXOA 1XZOA 3CSJA 4K2DA 3TKSE 3PGTA 3ZVJA 4OFMA 5B6MA 2D2ZA 4JRRA 2CA8A 5GSTA 3VI7A 4TVEA 2C0DA 4GSSA 4K0NA 1T7PB 5HFGA 5IMAA 3IK9A 3WGDA 5GSSA 2DMMA 4NV5A 1XXUA 1OE7A 3E3EA 4ZL8A 5JWQB 4PX1A 1VGLA 5D73A 5ECMB 5H5QA 3LQ7A 3LFLA 2IMIA 1QXHA 1GSUA 4OMVA 1HD2A 2LRTA 2H1AA 3KIJA 1XFLA 2RIIA 4KNDA 4ZL9A 5G30A 3IK7A 4JU5A 4MNNA 8GSSA 1GTBA 2XBIA 3FHKA 4FQUA 2C0EA 3CRTA 5F07A 3KMNA 2VCZA 1M9AA 3F63A 5JCUA 1KNGA 1XWAA 4KE3A 2GQMA 1XWCA 4L5OA 1VF1A 1YKCA 5EY6A 3VFIA 4XRAA 4WETA 3GSSA 4EE0A 1OVNA 2N5AA 1TRVA 3GX0A 2MBSA 3G9BA 1EV4A 3J7Yk 4F2IA 2VLTA 3D5JA 3HVVA 6GSTA 3G7IA 2GSRA 3IOSA 2VL3A 1PSQA 4PQHA 4K9ZA 2OJLA 4CY6A 1T00A 6GSWA 3VWVA 4BWQA 4N0VA 1TTZA 3UJ1A 1MDJA 5ECKB 5IPHA 1O7UA 2DJJA 1PL1A 1ERUA 1BG5A 1M2AA 4WF4A 3R2QA 2BMXA 2YWOA 2FUG2 4HU9A 3PPUA 2K6VA 1SL1B 1TI3A 3EPTA 4HZ4A 3LJRA 3GURA 2L57A 2VUPA 5CAXA 3BCKA 3HKRA 1Z6MA 4V2NA 5IO2A 2MMOA 4USSA 1S3CA 3KMOA 4LMWA 3FRCA 3W8JA 1F3BA 3HVSA 4OO4A 1S3DA 2GZPA 1H75A 3DVXA 1PL2A 5ELGA 1O85A 3W8SA 3A2XA 3EE2A 4HU7A 1A0RP 1PX6A 2C0GA 3DD3A 1BQ7A 2WCIA 4PNFA 3C1SA 4V1Ag 2IL3A 1ZYQB 3RPNA 1SJ6A 3GKMA 1O8XA 2LJAA 1K3OA 1O6JA 4RQXA 5ENUA 4AF2A 2CV4A 2YPMA 1ZOFA 2P5RA 2R4VA 2FCHA 5FT3A 2IPAA 5LCZA 1V9WA 2DJ0A 2AAWA 2H76A 3KH9A 3FZ4A 4POKA 1FB0A 4HQSA 1GTAA 5J3RA 2EIRA 3F3RA 3ZYWA 1ERTA 1G7EA 2IMFA 1JZDA 1Z5YE 1X0RA 4JEDA 3GV1A 3BD2A 2B5YA 4CY8A 4MPGA 4NV2A 2HE3A 2N5BA 5IQYA 3Q6OA 3DKSA 1IYHA 1QFNA 1Q4JA 5DDLA 2H1DA 1EP7A 4FIWA 2CX4A 2NVLA 1EEMA 3F3QA 2XC2A 1K3YA 2KUCA 4O92A 3P8WA 2QA2A 1ZYEA 3TJBA 1TP9A 3QFAC 5B8AA 2YZHA 3GL5A 1YEXA 5JCWA 1R5PA 5EPFA 3VPTA 1U88A 4ML1A 1B4PA 3U6VA 1A23A 3QAWA 5DALA 3ZTLA 4JR6A 1XWBA 1GUMA 2NDOA 4EIQA 2EIOA 4ILFA 4KCEA 4F03A 1UC7A 3E0UA 3UIWA 1Y6EA 3IRAA 5DJLA 4BVXB 3KTBA 1GL8A 5J41A 1WMJA 2KP1A 3FR6A 3TKSA 3O3TA 4IGJA 2IMEA 4ICYA 1PX7A 1U3IA 3M9KA 4XS4A 2IIYA 3TRXA 3GNJA 2V2GA 3UVHA 4F0BA 6GSYA 3ZMLA 5IMCA 4TW5A 5JCGA 5AISA 3HJPA 2ZUPA 3KD0A 1WP0A 4HDEA 1K0NA 1GSDA 2ZNMA 1XW5A 3HJOA 5DCGA 9GSSA 2G0FA 1F37A 2B3SA 2PVQA 1NSWA 3GA4A 5CRDA 3GTUB 5D96A 4KA0A 1GLPA 1SD9A 1XCCA 3GKXA 5G31A 1VF4A 4MP4A 3VURA 2X64A 4K2XA 2RUEA 4DSSA 4TOPA 4ACSA 2DIZA 2WGRA 1XW6A 3Q19A 1ACVA 4EXJA 1UN2A 5AGYA 4OCFA 4EDZA 2IWTA 2K18A 1URMA 3VPQA 3ZIJA 2YP6A 1SD8A 4NMUA 1YKAA 2XBQA 1R4WA 1ZMAA 2HFDA 1TKDB 2VM1A 2H0IA 3MWHA 4JE1A 2HZEB 3IE3A 3KEBA 4AJ6A 2BTOT 4O5QA 1MD3A 1FG4A 1F2EA 3NOFA 3RPPA 4K7OA 3VWUA 1PKWA 4KF9A 2IFQB 3UBLA 3FZ9A 3A3TA 3UARA 2DKHA 5H5RA 4Q5FA 1OC9A 3FW2A 5KOWA 1XWGA 2I4AA 2VOCA 2KP2A 4POLA 3ZITA 1KTEA 3BOAA 3HA9A 4KUNA 1I9DA 1GTIA 1JLWA 2PVOC 2FD3A 2R0CA 4HS1A 1EOGA 3C7MA 4O7HA 1Z7RA 1NW2A 2ALBA 1KEBA 2TRCP 3HDCA 1VF3A 3ZRDA 2WFCA 1DUGA 4XRDA 4Q5RA 3Q18A 4KSMA 1V40A 5CP1A 5CRWA 5ECNB 1FW1A 2JZSA 2L4CA 4HJ2A 1PKZA 4CHSA 1O73A 5B6NA 1WJKA 4MMMA 4TR1A 3DEXA 1TRSA 3ZFLA 2ZCTA 2OBIA 2I81A 3H1NA 2OACA 4TR4A 1K0MA 2E2GA 4WKWA 4IVFA 5DAKB 5DQSA 4OO5A 1Y25A 3Q74A 2B1LA 5F8BA 19GSA 4NWYA 2Z9SA 1TK8B 2FNOA 3CXGA 3WGXA 3VI5A 2ON7A 4KGIA 1GUHA 3RBTA 3N5OA 2YV9A 3I6AA 1G6WA 1JZOA 1GRXA 1YJ6A 4GXZA 2V32A 3IHGA 4Z2TA 5LD0A 2QC7A 2HSYA 4XHMA 7GSSA 3M1GA 2VCQA 3BBYA 4IQAA 3OR5A 1QQ2A 4V1Ap 3GFKA 3U5RE 3M0FA 1K0BA 5D93A 1Z3EA 1V58A 1ZL9A 2YCDA 3FZ5A 3US3A 2DC5A 2VD1A 2EIQA 3APSA 3EWLA 4GWRA 2X8CA 4OFNA 1HNCA 4BPYA 1G7OA 1SKRB 4JBBA 2X8GA 1R26A 4NHWA 2F8AA 2GZZA 1FOHA 2GQKA 2C8UA 1EGRA 1QUWA 3DMLA 4BA7A 3LEFA 1S3AA 4QQ7A 3ME8A 1M7TA 2H66A 1SENA 1MD4A 3TCOA 2H6XA 4ULXA 2CVKA 1XVQA 2YJHA 2DSAA 4E8HA 4YAPA 3KP9A 1NHOA 1PRXA 2V6OA 4MJAA 4LA1A 3FR3A 1XWKA 1MEKA 1EWXA 3IHQA 4LL4B 2LS5A 1E6BA 1B4QA 2HZFA 5B8BA 1QK8A 4NAXA 2JZRA 4ECJA 3C1RA 2H6ZA 1LU4A 4BL7B 2A4VA 3F0IA 4XTSA 3FEUA 5A4WA 1FVKA 4GF0A 3TDGA 1O8WA 2HI7A 4IQ1A 4HQZA 2F3MA 2AHEA 1RQMA 4DEJA 4MK3A 1VF2A 1N8JA 1W4VA 3IAM2 2R5GA 1LJRA 2CT6A 1GSFA 4EUYA 2C3QA 1XPVA 2OBKA 4POBA 2RLIA 2ON5A 4X1UA 3GSTA 5ECOB 1A8YA 2HYXA 3TKPA 2L5OA 4XIHA 1XBSA 4CW9A 2JZTA 2MBTA 3IAS2 2VCTA 4BVYA 1YEPA 1O81A 3GRXA 3MIXA 3ZREA 1EV9A 1R5AA 3FY7A 3TJGA 2GT6A 3EYTA 5G1KA 1FHEA 4OWYA 4QL9A 4GQFA 2DJKA 1C72A 4L0UA 4I2TA 1VRSD 3H79A 1K3LA 3UMAA 3WT2A 5DBQA 2GSTA 3IDVA 2O85A 2QSIA 3G7YA 1YF0A 4D73A 3GIXA 2WULA 3RHCA 3KGKA 2QA1A 1F3AA 3AY8A 1ZYNA 3TJJA 2B7KA 2R0GA 4WXTA 2QKEA 3RAZA 3ZVJD 3F6DA 2B7JA 3O76A 3TJFA 2O7KA 4KSOA 1R7HA 1BEDA 2H0HA 2LQQA 2R3XA 3I43A 3MYDA 1PQNA 2GGTA 1AIUA 1T4YA 4X43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9X A;  5HFK A;  3H8Q A;  1T1V A;  3EMP A;  1X5D A;  4G19 A;  1NM3 A;  2VCV A;  2H70 A;  2P31 A;  3EIN A;  4YQU A;  3L9S A;  4EL1 A;  1B8X A;  4EVM A;  4FYU A;  2AB6 A;  5DVB A;  2CAQ A;  3IPZ A;  2RM6 A;  2H8L A;  2I9H A;  2FLS A;  4MF5 A;  5H5S A;  2M72 A;  4PQ1 A;  5HQP A;  2PGT A;  1B9Y C;  5IOW A;  1RW1 A;  3E9J B;  3WGE A;  3QR6 A;  1THO A;  3LOR A;  4O32 A;  1T4Z A;  4GTU A;  2FGX A;  4K7N A;  3TRP A;  2VD0 A;  1Z7P A;  4IW9 A;  3VLN A;  2H74 A;  3KJY A;  2E7P A;  1X5C A;  2K8V A;  3ZIV A;  3TOT A;  3K8N A;  1U87 A;  2V6K A;  4MCU A;  4WR5 A;  5IMZ A;  2DML A;  2X99 A;  1F6M C;  4EO3 A;  1WWJ A;  2CZ2 A;  3KZQ A;  1G0T A;  2L4Q A;  4O5R A;  3FYG A;  5B7C A;  1GTU A;  1ERV A;  2PN8 A;  5AIX A;  2E0Q A;  3FR9 A;  4IBP A;  4N30 A;  1XOA A;  4ZXG A;  3H4K A;  3C71 A;  3HY2 A;  4E8E A;  3JCM L;  4BWS A;  5A5K A;  1A8L A;  2NTO A;  2AUV A;  2H71 A;  1TDI A;  1U3A A;  3HZ4 A;  1EOH A;  1T8E B;  2TRX A;  2VLV A;  1SKW B;  4K8M A;  3CSH A;  2XHF A;  2OA7 A;  2VM2 A;  3F6F A;  2YZU A;  5F0G A;  2NPB A;  3G7J A;  4DSQ A;  3HD5 A;  2BJX A;  3EC3 A;  3HXS A;  2K9F A;  3MDK A;  1W89 A;  2PUK C;  3HCZ A;  2VCX A;  1G6Y A;  1AUC A;  3TOU A;  2PMT A;  4XCS A;  2DJ1 A;  3QAG A;  4HZ2 A;  1ILO A;  3J7Y b;  1EGO A;  3CRU A;  1BX9 A;  4IP6 A;  2H75 A;  4FO5 A;  1SK1 A;  2WRT A;  2R6K A;  3GUS A;  5J9B A;  2IFQ A;  2PWJ A;  2VCW A;  2GVP A;  5IMD A;  2B1K A;  1SK0 A;  3F9U A;  3P2A A;  3QMX A;  5INY A;  1UA5 A;  3N9J A;  2PBJ A;  5IM9 A;  18GS A;  2VIM A;  4POM A;  5CNW A;  1XOB A;  2GDR A;  2LRN A;  3D0Z A;  3LYP A;  1H4O A;  2LQO A;  1ML6 A;  3DRN A;  1T3B A;  1A2J A;  4V2L A;  4AJ8 A;  2PPT A;  3HVX A;  4L8E A;  5GAN D;  4FYC A;  1I5G A;  4EKZ A;  4QL7 A;  3GN3 A;  4X0X A;  2H1G A;  1J9B A;  4MAB A;  1TK0 B;  1WIK A;  2R37 A;  4MZW A;  1V98 A;  1Z9H A;  4YAV A;  2P5Q A;  2GLR A;  3ZFB A;  1OKT A;  2FWF A;  1Q98 A;  2R2J A;  3KM6 A;  1XW9 A;  3QDN A;  2VL2 C;  4TR3 A;  3C8E A;  5GZZ B;  3UEM A;  2EC4 A;  5DAL B;  5EL8 A;  3PH9 A;  1PD2 1;  2GT5 A;  5IO0 A;  3QOU A;  1JZW A;  2YWM A;  3ZZX A;  2L6D A;  4TN8 A;  3BCI A;  3TGZ A;  2FA8 A;  1LBK A;  4TXO B;  1PMT A;  3IV4 A;  4FH8 A;  2IMK A;  1RK4 A;  3KXO A;  5ECL B;  4KW6 A;  3IA1 A;  5ID2 A;  3KCM A;  2X8H A;  5AN1 A;  5E4W A;  3QD9 A;  2GTU A;  3UVT A;  3M8N A;  3ZMK A;  4G9H A;  1HNA A;  1THX A;  2DBC A;  4ECI A;  3F4R A;  1FO5 A;  4TR0 A;  3ME7 A;  3L78 A;  3UAP A;  5CO3 A;  5COH A;  2N5F A;  4ECB A;  1M99 A;  5KN2 A;  1SYR A;  4IP1 A;  3TUE A;  2JAC A;  4ML6 A;  1X5E A;  3CSI A;  2FWH A;  4K1F A;  3KP8 A;  3GH9 A;  3WD6 A;  1NHY A;  4AGS A;  1MTC A;  5G5F A;  5CYY A;  1EEJ A;  4DSS B;  5DJM A;  3LXT A;  5JWR B;  1PGT A;  5L71 A;  1TU7 A;  4MF7 A;  1K0C A;  4ZB8 A;  2O89 A;  22GS A;  2FWG A;  2VLU A;  2YNX A;  1GSS A;  3KH7 A;  2JU5 A;  5DCH A;  3QPM A;  4J57 E;  2P0G A;  2AV4 A;  2OKA A;  3ERW A;  4IJ3 A;  3SBC A;  3LXZ A;  5IIZ A;  4MJE A;  1X9W B;  1TOF A;  1IYI A;  1OC9 B;  3L0H A;  1AW9 A;  1V2A A;  4N0Z A;  2VAF A;  2DLX A;  1FAA A;  4MZC A;  4I8B A;  1DSB A;  1M9B A;  1AC1 A;  1Z6N A;  3DWV A;  1TK5 B;  3LGC A;  2HLS A;  1EZK A;  4XS6 A;  1YDK A;  2V41 A;  1SKS B;  2PER A;  1YQ1 A;  5HR2 A;  2DJ2 A;  1HNB A;  1K0O A;  2B5E A;  4EC0 A;  1GSY A;  3A2W A;  4FYB A;  4MF6 A;  5D9V A;  4V2M A;  5HFI A;  2VL9 A;  3D22 A;  5IOX A;  2G2Q A;  1WOU A;  2WJU A;  2FHE A;  4YH2 A;  3CTF A;  2JAD A;  3HYP A;  2H73 A;  2F9S A;  4KAE A;  2YWI A;  5FHI A;  1JZR A;  4TR1 B;  1HQO A;  3APO A;  1GWC A;  4HEA 2;  2HXK A;  3I9V 2;  2HRN A;  5CRE A;  2OE3 A;  4HOJ A;  1SK2 A;  4F9Z A;  1DE1 A;  3F4S A;  1X9M B;  2GSQ A;  2OE1 A;  4H86 A;  2YV7 A;  3P90 A;  1JLV A;  3VWX A;  3KTL A;  1GSQ A;  4IKH A;  4NHZ A;  5CRH A;  2H30 A;  3O6T A;  1QGV A;  1QMV A;  1OC3 A;  2ES7 A;  3IR4 A;  3L4N A;  4WR4 A;  5DQY A;  2M46 A;  5G1L A;  1JFU A;  3CTG A;  2CZ3 A;  3QFB C;  6GSV A;  4Z7X A;  1OC8 A;  2L59 A;  1CQG A;  1ABA A;  3MSZ A;  1PA3 A;  5HR1 A;  5HR0 A;  5J5N A;  1AQV A;  5C04 A;  1YF1 A;  1OYJ A;  14GS A;  3GKK A;  2LST A;  2GQL A;  2LNT A;  1XIY A;  2LV3 A;  4ISD A;  2CQ9 A;  3EUR A;  5ECS A;  4EF0 A;  5HR3 A;  2IJY A;  3GKN A;  3IXR A;  4ZB9 A;  13GS A;  5J4U A;  1TI1 A;  4JR4 A;  17GS A;  4WF5 A;  3V1W A;  1GP1 A;  2IN3 A;  4GQC A;  3VK9 A;  1OAZ A;  3DVW A;  3HJM A;  3GX8 A;  1ZZY A;  2YN1 A;  2H72 A;  3HZ8 A;  1JHB A;  4NXI A;  3QCP A;  5KEJ A;  3IC4 A;  2F8F A;  3GYK A;  1SYX A;  4MA9 A;  4WBR D;  1UVZ A;  3ZL5 A;  5G5E A;  4KB3 A;  5FWG A;  3TKS C;  1B9X C;  3SWL A;  4MZB A;  2H0G A;  1DE2 A;  4L0W A;  4AJ7 A;  3VWW A;  2GS3 A;  2GZY A;  1SU9 A;  4LLR A;  3TKQ A;  1TU8 A;  3CMI A;  2JSY A;  4RUV A;  4GCI A;  1AAZ A;  2O87 A;  3RDW A;  2YWN A;  2CVD A;  1TW9 A;  2REM A;  1GNW A;  3M9J A;  5C00 A;  4ZBA A;  1GH2 A;  2H1B A;  4G2E A;  2YJ7 A;  4RQR A;  2OE0 A;  3D4T A;  4K7I A;  3BJ5 A;  1N2A A;  4PGT A;  4K6X A;  2MZC A;  1HYU A;  4Q5Q A;  2H19 A;  4RI7 A;  2OAD A;  2XPD A;  3D21 A;  3DYR A;  3WT1 A;  20GS A;  1BJX A;  3ERG A;  2LTK A;  3IBH A;  5ABR A;  2C80 A;  4BVX A;  1J0F A;  4I6X A;  4DVC A;  1XVW A;  2FA4 A;  1SJZ A;  3LG6 A;  2XPE A;  4PNG A;  2CAI A;  3L9V A;  5ECR B;  4PUR A;  3FKF A;  1WRY A;  4DSR A;  10GS A;  1B48 A;  4OFT A;  2MMN A;  2HT9 A;  1M2D A;  3C73 A;  3PIN A;  2HRF A;  4RI6 A;  2GSS A;  3M3M A;  3F8U A;  2CX3 A;  1CQH A;  3GH6 A;  1DBY A;  5ECH B;  4WEY A;  4G10 A;  3GMF A;  4MH3 A;  3ZLP A;  2KOK A;  4XS1 A;  1A2M A;  3LSZ A;  1ST9 A;  3TRQ A;  1K0A A;  4ZL7 A;  2MMA A;  4D73 B;  2JSZ A;  1BAY A;  3GTU A;  3NIV A;  1YY7 A;  2I1U A;  3TKR A;  1V57 A;  4PUA A;  4I97 A;  4L5L A;  4JZQ A;  2K8S A;  4GSN A;  2LUS A;  1EP8 A;  4YQV A;  2QGV A;  4KX4 A;  1SL2 B;  4KDY A;  4MDC A;  2AYT A;  3TB2 A;  1ON4 A;  3LYK A;  4ZB6 A;  2FY6 A;  1AXD A;  2A2R A;  2WZ9 A;  2L5L A;  5ELA A;  2J23 A;  2TIR A;  4F82 A;  1GNE A;  2PU9 C;  1A0F A;  1U6T A;  4ECC A;  3D4M A;  2HZE A;  5IPG A;  3RHB A;  12GS A;  3A5W A;  5ECI B;  4I2U A;  1X9S B;  4TXO A;  4IS0 A;  5ECP B;  2E2M A;  5IMV A;  3QAV A;  2FWE A;  2I3Y A;  1TJD A;  5D8I A;  2HSH A;  2H01 A;  1TRW A;  4TKY A;  1GLQ A;  2NBS A;  1GUK A;  16GS A;  1OE8 A;  2C3N A;  2MYG A;  2WS2 A;  2B6M A;  1J08 A;  1SJI A;  4KDU A;  5EVO A;  4GLT A;  3GL3 A;  4PUF C;  4K0G A;  4OD7 A;  4ZBD A;  4GRF A;  5D9T A;  3FK8 A;  4CDO A;  4HI7 A;  3F4T A;  3CBU A;  6GSS A;  4MLY A;  5E59 A;  1AQX A;  2KHP A;  1GSE A;  1BYE A;  2M80 A;  3DXB A;  2LKU A;  2YAN A;  3PR8 A;  1WPI A;  3D6I A;  2LNS A;  4LL1 B;  4I5Q A;  4ZBB A;  4HJM A;  4OCE A;  1MDI A;  1KBN A;  4IEL A;  5A4U A;  3DGQ A;  4P3Y B;  2LJR A;  2LEG A;  4ZIJ A;  4J56 E;  5G2Z A;  3EMX A;  3CYN A;  3HHV A;  2LRC A;  3MAK A;  1M2B A;  3GHA A;  5DAK A;  3ISO A;  2H6Y A;  4N11 A;  4TRX A;  1SL0 B;  5J9C A;  1A24 A;  3DIE A;  4MH2 A;  1A2L A;  2DIY A;  1K0D A;  4XS4 B;  1ERW A;  4J2F A;  3L9U A;  2WB9 A;  4KDX A;  3TJK A;  2MMZ A;  4KH7 A;  3APQ A;  4MJC A;  1PN9 A;  5JWO B;  3ERF A;  4HUA A;  2RM5 A;  5F05 A;  3EU3 A;  2V1M A;  4IJI A;  2C3T A;  3UOM A;  1WE0 A;  5F06 A;  2C0F A;  3LWA A;  2RUF A;  2LJK A;  6GSU A;  1USB A;  3S9F A;  5KN3 A;  1M0U A;  3WYW A;  4EDY A;  4WBJ A;  2L6C A;  5AIV A;  2HNL A;  2O8V B;  3I69 A;  4Q5N A;  4KCA A;  1TRU A;  3NZN A;  5KN0 A;  3UL3 A;  1TXX A;  4LMV A;  2C1Y A;  2A2S A;  5ECQ B;  4IN0 A;  6GSX A;  2C4J A;  5A4V A;  1MDK A;  3A2V A;  3H93 A;  5KN1 A;  2AJQ B;  4NPB A;  1OKD A;  4BL7 A;  5ID2 B;  4GST A;  4YQM A;  2JL4 A;  5IMF A;  3MNG A;  2CVB A;  4TXV A;  4F0C A;  2IMD A;  2DJ3 A;  2VO4 A;  5LNK e;  1FVJ A;  2B5X A;  1F9M A;  1GUL A;  1FB6 A;  2YOI A;  4MJB A;  3P7X A;  3EU4 A;  1E2Y A;  4N10 A;  5GAP D;  3FZA A;  2WDU A;  11GS A;  5D9W A;  4ZIL A;  4PQI A;  5CRG A;  3W6G A;  2J9H A;  2KLX A;  1YZX A;  1AQW A;  2F51 A;  1ZGN A;  4ID0 A;  1FOV A;  4IHU A;  3UBK A;  3ED3 A;  2VL2 A;  3EVI A;  1ZCP A;  4MPF A;  4PXO A;  1XZO A;  3CSJ A;  4K2D A;  3TKS E;  3PGT A;  3ZVJ A;  4OFM A;  5B6M A;  2D2Z A;  4JRR A;  2CA8 A;  5GST A;  3VI7 A;  4TVE A;  2C0D A;  4GSS A;  4K0N A;  1T7P B;  5HFG A;  5IMA A;  3IK9 A;  3WGD A;  5GSS A;  2DMM A;  4NV5 A;  1XXU A;  1OE7 A;  3E3E A;  4ZL8 A;  5JWQ B;  4PX1 A;  1VGL A;  5D73 A;  5ECM B;  5H5Q A;  3LQ7 A;  3LFL A;  2IMI A;  1QXH A;  1GSU A;  4OMV A;  1HD2 A;  2LRT A;  2H1A A;  3KIJ A;  1XFL A;  2RII A;  4KND A;  4ZL9 A;  5G30 A;  3IK7 A;  4JU5 A;  8GSS A;  1GTB A;  2XBI A;  3FHK A;  2C0E A;  5F07 A;  3CRT A;  3KMN A;  2VCZ A;  1M9A A;  3F63 A;  5JCU A;  1KNG A;  1XWA A;  4KE3 A;  2GQM A;  1XWC A;  4L5O A;  1VF1 A;  1YKC A;  5EY6 A;  3VFI A;  4XRA A;  4WET A;  3GSS A;  4EE0 A;  1OVN A;  2N5A A;  1TRV A;  3GX0 A;  2MBS A;  3G9B A;  1EV4 A;  3J7Y k;  4F2I A;  2VLT A;  3D5J A;  3HVV A;  6GST A;  3G7I A;  2GSR A;  3IOS A;  2VL3 A;  1PSQ A;  4PQH A;  4K9Z A;  2OJL A;  1T00 A;  6GSW A;  3VWV A;  4BWQ A;  4N0V A;  1TTZ A;  3UJ1 A;  1MDJ A;  5ECK B;  5IPH A;  1O7U A;  2DJJ A;  1PL1 A;  1ERU A;  1BG5 A;  1M2A A;  4WF4 A;  3R2Q A;  2BMX A;  2YWO A;  2FUG 2;  4HU9 A;  2K6V A;  1SL1 B;  1TI3 A;  4HZ4 A;  3LJR A;  3GUR A;  2L57 A;  2VUP A;  5CAX A;  3BCK A;  3HKR A;  1Z6M A;  4V2N A;  5IO2 A;  2MMO A;  1S3C A;  3KMO A;  4LMW A;  3FRC A;  3W8J A;  1F3B A;  3HVS A;  4OO4 A;  1S3D A;  2GZP A;  1H75 A;  3DVX A;  1PL2 A;  5ELG A;  1O85 A;  3W8S A;  3A2X A;  3EE2 A;  4HU7 A;  1A0R P;  1PX6 A;  2C0G A;  3DD3 A;  1BQ7 A;  2WCI A;  4PNF A;  3C1S A;  4V1A g;  2IL3 A;  1ZYQ B;  3RPN A;  1SJ6 A;  3GKM A;  1O8X A;  2LJA A;  1K3O A;  1O6J A;  4RQX A;  5ENU A;  4AF2 A;  2CV4 A;  2YPM A;  1ZOF A;  2P5R A;  2R4V A;  2FCH A;  5FT3 A;  2IPA A;  5LCZ A;  1V9W A;  2DJ0 A;  2AAW A;  2H76 A;  3KH9 A;  3FZ4 A;  4POK A;  1FB0 A;  4HQS A;  1GTA A;  5J3R A;  2EIR A;  3F3R A;  3ZYW A;  1ERT A;  1G7E A;  2IMF A;  1JZD A;  1Z5Y E;  1X0R A;  4JED A;  3GV1 A;  3BD2 A;  2B5Y A;  4MPG A;  4NV2 A;  2HE3 A;  2N5B A;  5IQY A;  3Q6O A;  3DKS A;  1IYH A;  1QFN A;  1Q4J A;  5DDL A;  2H1D A;  1EP7 A;  4FIW A;  2CX4 A;  2NVL A;  1EEM A;  3F3Q A;  2XC2 A;  1K3Y A;  2KUC A;  4O92 A;  3P8W A;  1ZYE A;  3TJB A;  1TP9 A;  3QFA C;  5B8A A;  2YZH A;  3GL5 A;  1YEX A;  5JCW A;  1R5P A;  5EPF A;  3VPT A;  1U88 A;  4ML1 A;  1B4P A;  3U6V A;  1A23 A;  3QAW A;  5DAL A;  3ZTL A;  4JR6 A;  1XWB A;  1GUM A;  2NDO A;  2EIO A;  4ILF A;  4KCE A;  4F03 A;  1UC7 A;  3E0U A;  3UIW A;  1Y6E A;  3IRA A;  5DJL A;  3KTB A;  1GL8 A;  5J41 A;  1WMJ A;  2KP1 A;  3FR6 A;  3TKS A;  3O3T A;  4IGJ A;  2IME A;  1PX7 A;  1U3I A;  3M9K A;  4XS4 A;  2IIY A;  3TRX A;  3GNJ A;  2V2G A;  3UVH A;  4F0B A;  6GSY A;  3ZML A;  5IMC A;  4TW5 A;  5JCG A;  5AIS A;  3HJP A;  2ZUP A;  3KD0 A;  1WP0 A;  4HDE A;  1K0N A;  1GSD A;  2ZNM A;  1XW5 A;  3HJO A;  5DCG A;  9GSS A;  2G0F A;  1F37 A;  2B3S A;  2PVQ A;  1NSW A;  3GA4 A;  5CRD A;  3GTU B;  5D96 A;  4KA0 A;  1GLP A;  1SD9 A;  1XCC A;  3GKX A;  5G31 A;  1VF4 A;  4MP4 A;  3VUR A;  2X64 A;  2RUE A;  4DSS A;  4TOP A;  4ACS A;  2DIZ A;  2WGR A;  1XW6 A;  3Q19 A;  1ACV A;  4EXJ A;  1UN2 A;  5AGY A;  4OCF A;  4EDZ A;  2IWT A;  2K18 A;  1URM A;  3VPQ A;  3ZIJ A;  2YP6 A;  1SD8 A;  4NMU A;  1YKA A;  2XBQ A;  1R4W A;  1ZMA A;  2HFD A;  1TKD B;  2VM1 A;  2H0I A;  3MWH A;  4JE1 A;  2HZE B;  3IE3 A;  3KEB A;  4AJ6 A;  2BTO T;  1MD3 A;  1FG4 A;  1F2E A;  3NOF A;  3RPP A;  4K7O A;  3VWU A;  1PKW A;  2IFQ B;  3UBL A;  3FZ9 A;  3A3T A;  3UAR A;  5H5R A;  4Q5F A;  1OC9 A;  3FW2 A;  1XWG A;  2I4A A;  2VOC A;  2KP2 A;  4POL A;  3ZIT A;  1KTE A;  3BOA A;  3HA9 A;  4KUN A;  1I9D A;  1GTI A;  1JLW A;  2PVO C;  2FD3 A;  4HS1 A;  1EOG A;  3C7M A;  4O7H A;  1Z7R A;  1NW2 A;  2ALB A;  1KEB A;  2TRC P;  3HDC A;  1VF3 A;  3ZRD A;  2WFC A;  1DUG A;  4XRD A;  4Q5R A;  3Q18 A;  4KSM A;  1V40 A;  5CP1 A;  5CRW A;  5ECN B;  1FW1 A;  2JZS A;  2L4C A;  4HJ2 A;  1PKZ A;  4CHS A;  1O73 A;  5B6N A;  1WJK A;  4MMM A;  4TR1 A;  3DEX A;  1TRS A;  3ZFL A;  2ZCT A;  2OBI A;  2I81 A;  3H1N A;  2OAC A;  4TR4 A;  1K0M A;  2E2G A;  4WKW A;  4IVF A;  5DAK B;  5DQS A;  4OO5 A;  1Y25 A;  3Q74 A;  2B1L A;  5F8B A;  19GS A;  4NWY A;  2Z9S A;  1TK8 B;  2FNO A;  3CXG A;  3WGX A;  3VI5 A;  2ON7 A;  4KGI A;  1GUH A;  3RBT A;  3N5O A;  2YV9 A;  3I6A A;  1G6W A;  1JZO A;  1GRX A;  1YJ6 A;  4GXZ A;  2V32 A;  5LD0 A;  2QC7 A;  2HSY A;  4XHM A;  7GSS A;  3M1G A;  2VCQ A;  3BBY A;  4IQA A;  3OR5 A;  1QQ2 A;  4V1A p;  3GFK A;  3U5R E;  3M0F A;  1K0B A;  5D93 A;  1Z3E A;  1V58 A;  1ZL9 A;  2YCD A;  3FZ5 A;  3US3 A;  2DC5 A;  2VD1 A;  2EIQ A;  3APS A;  3EWL A;  4GWR A;  2X8C A;  4OFN A;  1HNC A;  4BPY A;  1G7O A;  1SKR B;  4JBB A;  2X8G A;  1R26 A;  4NHW A;  2F8A A;  2GZZ A;  2GQK A;  2C8U A;  1EGR A;  1QUW A;  3DML A;  4BA7 A;  3LEF A;  1S3A A;  4QQ7 A;  3ME8 A;  1M7T A;  2H66 A;  1SEN A;  1MD4 A;  3TCO A;  2H6X A;  4ULX A;  2CVK A;  1XVQ A;  2YJH A;  2DSA A;  4E8H A;  4YAP A;  3KP9 A;  1NHO A;  1PRX A;  2V6O A;  4MJA A;  4LA1 A;  3FR3 A;  1XWK A;  1MEK A;  1EWX A;  3IHQ A;  4LL4 B;  2LS5 A;  1E6B A;  1B4Q A;  2HZF A;  5B8B A;  1QK8 A;  4NAX A;  2JZR A;  4ECJ A;  3C1R A;  2H6Z A;  1LU4 A;  2A4V A;  3F0I A;  4XTS A;  3FEU A;  5A4W A;  1FVK A;  4GF0 A;  3TDG A;  1O8W A;  2HI7 A;  4IQ1 A;  4HQZ A;  2F3M A;  2AHE A;  1RQM A;  4DEJ A;  4MK3 A;  1VF2 A;  1N8J A;  1W4V A;  3IAM 2;  2R5G A;  1LJR A;  2CT6 A;  1GSF A;  4EUY A;  2C3Q A;  1XPV A;  2OBK A;  4POB A;  2RLI A;  2ON5 A;  4X1U A;  3GST A;  5ECO B;  1A8Y A;  2HYX A;  3TKP A;  2L5O A;  4XIH A;  1XBS A;  4CW9 A;  2JZT A;  2MBT A;  3IAS 2;  2VCT A;  4BVY A;  1YEP A;  1O81 A;  3GRX A;  3ZRE A;  1EV9 A;  1R5A A;  3FY7 A;  3TJG A;  2GT6 A;  3EYT A;  5G1K A;  1FHE A;  4OWY A;  4QL9 A;  4GQF A;  2DJK A;  1C72 A;  4L0U A;  4I2T A;  1VRS D;  3H79 A;  1K3L A;  3UMA A;  3WT2 A;  5DBQ A;  2GST A;  3IDV A;  2O85 A;  2QSI A;  3G7Y A;  1YF0 A;  4D73 A;  3GIX A;  2WUL A;  3RHC A;  3KGK A;  1F3A A;  3AY8 A;  3TJJ A;  2B7K A;  4WXT A;  2QKE A;  3RAZ A;  3ZVJ D;  3F6D A;  2B7J A;  3O76 A;  3TJF A;  2O7K A;  4KSO A;  1R7H A;  1BED A;  2H0H A;  2LQQ A;  2R3X A;  3I43 A;  1PQN A;  2GGT A;  1AIU A;  1T4Y A;  4X43 A; 
#chains in the Genus database with same CATH topology
 5D9X A;  5HFK A;  3H8Q A;  1T1V A;  3EMP A;  4K5R A;  1X5D A;  4G19 A;  1NM3 A;  2VCV A;  2H70 A;  2P31 A;  3EIN A;  4YQU A;  3L9S A;  4EL1 A;  1B8X A;  4EVM A;  4FYU A;  2AB6 A;  5DVB A;  2CAQ A;  3IPZ A;  2RM6 A;  2H8L A;  2I9H A;  2FLS A;  4MF5 A;  5H5S A;  2M72 A;  4PQ1 A;  5HQP A;  2PGT A;  1B9Y C;  5IOW A;  1RW1 A;  3E9J B;  3WGE A;  3QR6 A;  1THO A;  3LOR A;  4O32 A;  1T4Z A;  2DKI A;  4GTU A;  2FGX A;  4K7N A;  3TRP A;  2VD0 A;  1Z7P A;  4IW9 A;  3VLN A;  2H74 A;  2HSM A;  3KJY A;  2E7P A;  1X5C A;  2K8V A;  3ZIV A;  3TOT A;  3K8N A;  1U87 A;  2V6K A;  4MCU A;  4WR5 A;  5IMZ A;  2DML A;  2X99 A;  1F6M C;  4EO3 A;  1WWJ A;  2CZ2 A;  3KZQ A;  1G0T A;  2L4Q A;  4O5R A;  3FYG A;  5B7C A;  1GTU A;  1ERV A;  2PN8 A;  5AIX A;  2E0Q A;  3FR9 A;  4IBP A;  4N30 A;  1XOA A;  4ZXG A;  3H4K A;  3C71 A;  3HY2 A;  4E8E A;  3JCM L;  4BWS A;  5A5K A;  1A8L A;  2NTO A;  2AUV A;  2H71 A;  1TDI A;  1U3A A;  3HZ4 A;  1EOH A;  1T8E B;  2TRX A;  2VLV A;  1SKW B;  4K8M A;  3CSH A;  2XHF A;  2OA7 A;  2VM2 A;  3F6F A;  2YZU A;  5F0G A;  2NPB A;  3G7J A;  4DSQ A;  3HD5 A;  2BJX A;  3EC3 A;  3HXS A;  2K9F A;  3MDK A;  1W89 A;  5BRT A;  2PUK C;  3HCZ A;  2VCX A;  1G6Y A;  1AUC A;  3TOU A;  2PMT A;  4XCS A;  2DJ1 A;  3QAG A;  4HZ2 A;  1ILO A;  3J7Y b;  1EGO A;  3CRU A;  1BX9 A;  4IP6 A;  2H75 A;  4FO5 A;  1SK1 A;  2WRT A;  2R6K A;  3GUS A;  5J9B A;  5KOX A;  2IFQ A;  2PWJ A;  2VCW A;  2GVP A;  5IMD A;  2B1K A;  1SK0 A;  3F9U A;  3P2A A;  3QMX A;  4EIP A;  5INY A;  1UA5 A;  3N9J A;  2PBJ A;  5IM9 A;  18GS A;  2VIM A;  4POM A;  5CNW A;  1XOB A;  2GDR A;  2LRN A;  3D0Z A;  2UZ8 A;  3LYP A;  1H4O A;  2LQO A;  1ML6 A;  3DRN A;  1T3B A;  1A2J A;  4V2L A;  4AJ8 A;  2PPT A;  3HVX A;  4L8E A;  5GAN D;  4FYC A;  1I5G A;  4EKZ A;  2HRK A;  4QL7 A;  3GN3 A;  4X0X A;  2H1G A;  1J9B A;  4MAB A;  1TK0 B;  1WIK A;  2R37 A;  4MZW A;  1V98 A;  1Z9H A;  4YAV A;  2P5Q A;  2GLR A;  3ZFB A;  1OKT A;  2FWF A;  1Q98 A;  2R2J A;  3KM6 A;  1XW9 A;  3QDN A;  4YKG A;  2VL2 C;  4TR3 A;  3C8E A;  1ZYP A;  5GZZ B;  3UEM A;  2EC4 A;  4Z2R A;  5DAL B;  5EL8 A;  3PH9 A;  1PD2 1;  2GT5 A;  5IO0 A;  3QOU A;  1JZW A;  2YWM A;  3ZZX A;  2L6D A;  4TN8 A;  3BCI A;  3TGZ A;  2FA8 A;  1LBK A;  4TXO B;  1PMT A;  3IV4 A;  4FH8 A;  2IMK A;  1RK4 A;  3KXO A;  5ECL B;  4KW6 A;  3IA1 A;  5ID2 A;  3KCM A;  2X8H A;  5AN1 A;  5E4W A;  3A5I A;  3QD9 A;  2GTU A;  3UVT A;  3M8N A;  3ZMK A;  4G9H A;  1HNA A;  1XG8 A;  1THX A;  4G0I A;  2DBC A;  4ECI A;  3F4R A;  1FO5 A;  4TR0 A;  3ME7 A;  3L78 A;  3UAP A;  5COH A;  5CO3 A;  2N5F A;  4ECB A;  1M99 A;  4X4J A;  5KN2 A;  1SYR A;  4G0K A;  4IP1 A;  3TUE A;  2JAC A;  4ML6 A;  1X5E A;  3CSI A;  2FWH A;  4K1F A;  3KP8 A;  3GH9 A;  3WD6 A;  1NHY A;  4AGS A;  1MTC A;  5G5F A;  5CYY A;  1EEJ A;  4DSS B;  5DJM A;  3LXT A;  5JWR B;  1PGT A;  5L71 A;  1TU7 A;  4MF7 A;  1K0C A;  4ZB8 A;  2O89 A;  22GS A;  2FWG A;  2VLU A;  2YNX A;  1GSS A;  3KH7 A;  2JU5 A;  5DCH A;  3QPM A;  4J57 E;  2P0G A;  2AV4 A;  2OKA A;  3ERW A;  4IJ3 A;  3SBC A;  3LXZ A;  5IIZ A;  4MJE A;  1X9W B;  1TOF A;  1IYI A;  2R0P A;  1OC9 B;  3L0H A;  1AW9 A;  3IC8 A;  1V2A A;  4N0Z A;  2VAF A;  2DLX A;  1FAA A;  4MZC A;  4I8B A;  1DSB A;  1M9B A;  1AC1 A;  1Z6N A;  3DWV A;  1TK5 B;  3LGC A;  2HLS A;  1EZK A;  4XS6 A;  1S3R A;  1YDK A;  2V41 A;  1SKS B;  1M3I A;  2PER A;  1YQ1 A;  5HR2 A;  2DJ2 A;  1HNB A;  1K0O A;  2B5E A;  4EC0 A;  1GSY A;  3A2W A;  4FYB A;  3CQF A;  4MF6 A;  5D9V A;  4V2M A;  5HFI A;  2VL9 A;  3D22 A;  5IOX A;  2G2Q A;  1WOU A;  2WJU A;  2FHE A;  4YH2 A;  3CTF A;  2JAD A;  3HYP A;  2H73 A;  2F9S A;  4KAE A;  2YWI A;  5FHI A;  1JZR A;  4TR1 B;  1HQO A;  3APO A;  1GWC A;  4HEA 2;  2HXK A;  3I9V 2;  2HRN A;  5CRE A;  2OE3 A;  4HOJ A;  1SK2 A;  4F9Z A;  1DE1 A;  3F4S A;  1X9M B;  4Z2U A;  2GSQ A;  2OE1 A;  4H86 A;  2YV7 A;  3P90 A;  1JLV A;  3VWX A;  3KTL A;  1GSQ A;  4IKH A;  4NHZ A;  5CRH A;  1M3J A;  2H30 A;  3O6T A;  1QGV A;  1QMV A;  1OC3 A;  2ES7 A;  3IR4 A;  3L4N A;  4WR4 A;  5DQY A;  2M46 A;  5G1L A;  1JFU A;  3CTG A;  4K5S A;  2CZ3 A;  3QFB C;  6GSV A;  4Z7X A;  1OC8 A;  2L59 A;  1CQG A;  1ABA A;  3MSZ A;  1PA3 A;  5HR1 A;  3LW9 A;  5HR0 A;  5J5N A;  1AQV A;  5C04 A;  1YF1 A;  1OYJ A;  14GS A;  3GKK A;  2LST A;  2GQL A;  2LNT A;  1XIY A;  2LV3 A;  4ISD A;  2CQ9 A;  3EUR A;  5ECS A;  4EF0 A;  5HR3 A;  2IJY A;  3GKN A;  3IXR A;  4ZB9 A;  13GS A;  5J4U A;  1TI1 A;  4JR4 A;  17GS A;  4WF5 A;  3V1W A;  1GP1 A;  2IN3 A;  4GQC A;  3VK9 A;  1OAZ A;  3DVW A;  3HJM A;  3GX8 A;  1ZZY A;  2YN1 A;  2H72 A;  3HZ8 A;  1JHB A;  4NXI A;  3QCP A;  5KEJ A;  3IC4 A;  2F8F A;  3GYK A;  1SYX A;  4MA9 A;  4WBR D;  1UVZ A;  3ZL5 A;  5G5E A;  4KB3 A;  5FWG A;  3TKS C;  1B9X C;  3SWL A;  4MZB A;  3HVN A;  2H0G A;  1DE2 A;  4L0W A;  4AJ7 A;  3VWW A;  2GS3 A;  2GZY A;  1SU9 A;  4LLR A;  2A2P A;  3TKQ A;  1TU8 A;  3CMI A;  2JSY A;  4RUV A;  5BMU A;  4GCI A;  1AAZ A;  2O87 A;  3RDW A;  2YWN A;  2CVD A;  1TW9 A;  2REM A;  1GNW A;  3M9J A;  5C00 A;  4ZBA A;  1GH2 A;  2H1B A;  4G2E A;  2YJ7 A;  4RQR A;  2OE0 A;  3D4T A;  4K7I A;  3BJ5 A;  1N2A A;  4PGT A;  4K6X A;  2MZC A;  1HYU A;  4Q5Q A;  4YKF A;  4O5U A;  2HRA A;  2H19 A;  4RI7 A;  2OAD A;  2XPD A;  3D21 A;  3DYR A;  3WT1 A;  20GS A;  1BJX A;  3ERG A;  2LTK A;  3IBH A;  5ABR A;  2C80 A;  4BVX A;  1J0F A;  4I6X A;  4DVC A;  1XVW A;  2FA4 A;  1SJZ A;  3LG6 A;  2XPE A;  4PNG A;  2CAI A;  3L9V A;  5ECR B;  4PUR A;  3FKF A;  1WRY A;  4DSR A;  4BVY B;  10GS A;  1B48 A;  4OFT A;  2MMN A;  2HT9 A;  1M2D A;  3C73 A;  3PIN A;  2HRF A;  4RI6 A;  2GSS A;  3M3M A;  1PN0 A;  3F8U A;  2CX3 A;  1CQH A;  3GH6 A;  1DBY A;  5ECH B;  4WEY A;  4G10 A;  3GMF A;  4MH3 A;  3ZLP A;  2KOK A;  4XS1 A;  1A2M A;  3LSZ A;  1ST9 A;  3TRQ A;  4A5P A;  1K0A A;  4ZL7 A;  2MMA A;  4D73 B;  2JSZ A;  1BAY A;  3GTU A;  3NIV A;  1YY7 A;  2I1U A;  3TKR A;  1V57 A;  4PUA A;  4I97 A;  4L5L A;  4PTS A;  4JZQ A;  2K8S A;  4GSN A;  2LUS A;  1EP8 A;  4YQV A;  2QGV A;  4KX4 A;  1SL2 B;  4KDY A;  4MDC A;  2AYT A;  4HSC X;  3TB2 A;  1ON4 A;  3LYK A;  4ZB6 A;  2FY6 A;  1AXD A;  2A2R A;  2WZ9 A;  2L5L A;  5ELA A;  2J23 A;  2TIR A;  4F82 A;  1GNE A;  2PU9 C;  1A0F A;  1U6T A;  4ECC A;  3D4M A;  2HZE A;  5IPG A;  3RHB A;  12GS A;  3A5W A;  5ECI B;  4I2U A;  1X9S B;  4TXO A;  4IS0 A;  5ECP B;  2E2M A;  5IMV A;  3QAV A;  2FWE A;  2I3Y A;  1TJD A;  5D8I A;  2HSH A;  2H01 A;  1TRW A;  4TKY A;  1GLQ A;  2NBS A;  1GUK A;  16GS A;  1OE8 A;  2C3N A;  2MYG A;  3R3E A;  2WS2 A;  2B6M A;  1J08 A;  1SJI A;  2X4A A;  2X49 A;  4KDU A;  5EVO A;  4GLT A;  3GL3 A;  4PUF C;  4K0G A;  4OD7 A;  4ZBD A;  4GRF A;  5D9T A;  3FK8 A;  4CDO A;  4HI7 A;  3F4T A;  3CBU A;  6GSS A;  4MLY A;  1AQX A;  5E59 A;  2KHP A;  1GSE A;  1BYE A;  2M80 A;  3DXB A;  2LKU A;  2YAN A;  3PR8 A;  1WPI A;  3D6I A;  2LNS A;  4LL1 B;  4I5Q A;  2A4H A;  4ZBB A;  4HJM A;  4OCE A;  1MDI A;  1KBN A;  4IEL A;  5A4U A;  3DGQ A;  4P3Y B;  2LJR A;  2LEG A;  4ZIJ A;  4J56 E;  5G2Z A;  3EMX A;  3CYN A;  3HHV A;  2LRC A;  3MAK A;  1M2B A;  3GHA A;  5DAK A;  3ISO A;  2H6Y A;  4N11 A;  4TRX A;  1SL0 B;  5J9C A;  1A24 A;  3DIE A;  4MH2 A;  1A2L A;  2DIY A;  1K0D A;  4XS4 B;  1ERW A;  4J2F A;  3L9U A;  2WB9 A;  4KDX A;  3TJK A;  2MMZ A;  4KH7 A;  3APQ A;  4MJC A;  3FMW A;  1PN9 A;  5JWO B;  3ERF A;  4HUA A;  2RM5 A;  5F05 A;  3EU3 A;  2V1M A;  4IJI A;  2C3T A;  3UOM A;  1WE0 A;  5F06 A;  2C0F A;  3LWA A;  2RUF A;  2LJK A;  6GSU A;  1USB A;  3S9F A;  5KN3 A;  1M0U A;  3WYW A;  4EDY A;  4WBJ A;  2L6C A;  5AIV A;  2HNL A;  2O8V B;  3I69 A;  4Q5N A;  4KCA A;  1TRU A;  3NZN A;  5KN0 A;  3UL3 A;  1TXX A;  4LMV A;  2C1Y A;  2A2S A;  5ECQ B;  4IN0 A;  6GSX A;  2C4J A;  5A4V A;  1MDK A;  3A2V A;  3H93 A;  5KN1 A;  2AJQ B;  4NPB A;  1OKD A;  4BL7 A;  5ID2 B;  4GST A;  4YQM A;  2JL4 A;  5IMF A;  3MNG A;  2CVB A;  4TXV A;  4F0C A;  2IMD A;  2DJ3 A;  2VO4 A;  5LNK e;  1FVJ A;  2B5X A;  1F9M A;  1GUL A;  1FB6 A;  2YOI A;  4MJB A;  3P7X A;  3EU4 A;  1E2Y A;  4N10 A;  5GAP D;  3FZA A;  1PFO A;  2WDU A;  11GS A;  5D9W A;  4ZIL A;  4PQI A;  5CRG A;  3W6G A;  2J9H A;  2KLX A;  4G0L A;  1YZX A;  1AQW A;  2F51 A;  1ZGN A;  4ID0 A;  1FOV A;  4IHU A;  3UBK A;  3ED3 A;  2VL2 A;  3EVI A;  1ZCP A;  4MPF A;  4PXO A;  1XZO A;  3CSJ A;  4K2D A;  3TKS E;  3PGT A;  3ZVJ A;  4OFM A;  5B6M A;  2D2Z A;  4JRR A;  2CA8 A;  5GST A;  3VI7 A;  4TVE A;  2C0D A;  4GSS A;  4K0N A;  1T7P B;  5HFG A;  5IMA A;  3IK9 A;  3WGD A;  5GSS A;  2DMM A;  4NV5 A;  1XXU A;  1OE7 A;  3E3E A;  4ZL8 A;  5JWQ B;  4PX1 A;  1VGL A;  5D73 A;  5ECM B;  5H5Q A;  3LQ7 A;  3LFL A;  2IMI A;  1QXH A;  1GSU A;  4OMV A;  1HD2 A;  2LRT A;  2H1A A;  3KIJ A;  1XFL A;  2RII A;  4KND A;  4ZL9 A;  5G30 A;  3IK7 A;  4JU5 A;  4MNN A;  8GSS A;  1GTB A;  2XBI A;  3FHK A;  4FQU A;  2C0E A;  3CRT A;  5F07 A;  3KMN A;  2VCZ A;  1M9A A;  3F63 A;  5JCU A;  1KNG A;  1XWA A;  4KE3 A;  2GQM A;  1XWC A;  4L5O A;  1VF1 A;  1YKC A;  5EY6 A;  3VFI A;  4XRA A;  4WET A;  3GSS A;  4EE0 A;  1OVN A;  2N5A A;  1TRV A;  3GX0 A;  2MBS A;  3G9B A;  1EV4 A;  3J7Y k;  4F2I A;  2VLT A;  3D5J A;  3HVV A;  6GST A;  3G7I A;  2GSR A;  3IOS A;  2VL3 A;  1PSQ A;  4PQH A;  4K9Z A;  2OJL A;  4CY6 A;  1T00 A;  6GSW A;  3VWV A;  4BWQ A;  4N0V A;  1TTZ A;  3UJ1 A;  1MDJ A;  5ECK B;  5IPH A;  1O7U A;  2DJJ A;  1PL1 A;  1ERU A;  1BG5 A;  1M2A A;  4WF4 A;  3R2Q A;  2BMX A;  2YWO A;  2FUG 2;  4HU9 A;  3PPU A;  2K6V A;  1SL1 B;  1TI3 A;  3EPT A;  4HZ4 A;  3LJR A;  3GUR A;  2L57 A;  2VUP A;  5CAX A;  3BCK A;  3HKR A;  1Z6M A;  4V2N A;  5IO2 A;  2MMO A;  4USS A;  1S3C A;  3KMO A;  4LMW A;  3FRC A;  3W8J A;  1F3B A;  3HVS A;  4OO4 A;  1S3D A;  2GZP A;  1H75 A;  3DVX A;  1PL2 A;  5ELG A;  1O85 A;  3W8S A;  3A2X A;  3EE2 A;  4HU7 A;  1A0R P;  1PX6 A;  2C0G A;  3DD3 A;  1BQ7 A;  2WCI A;  4PNF A;  3C1S A;  4V1A g;  2IL3 A;  1ZYQ B;  3RPN A;  1SJ6 A;  3GKM A;  1O8X A;  2LJA A;  1K3O A;  1O6J A;  4RQX A;  5ENU A;  4AF2 A;  2CV4 A;  2YPM A;  1ZOF A;  2P5R A;  2R4V A;  2FCH A;  5FT3 A;  2IPA A;  5LCZ A;  1V9W A;  2DJ0 A;  2AAW A;  2H76 A;  3KH9 A;  3FZ4 A;  4POK A;  1FB0 A;  4HQS A;  1GTA A;  5J3R A;  2EIR A;  3F3R A;  3ZYW A;  1ERT A;  1G7E A;  2IMF A;  1JZD A;  1Z5Y E;  1X0R A;  4JED A;  3GV1 A;  3BD2 A;  2B5Y A;  4CY8 A;  4MPG A;  4NV2 A;  2HE3 A;  2N5B A;  5IQY A;  3Q6O A;  3DKS A;  1IYH A;  1QFN A;  1Q4J A;  5DDL A;  2H1D A;  1EP7 A;  4FIW A;  2CX4 A;  2NVL A;  1EEM A;  3F3Q A;  2XC2 A;  1K3Y A;  2KUC A;  4O92 A;  3P8W A;  2QA2 A;  1ZYE A;  3TJB A;  1TP9 A;  3QFA C;  5B8A A;  2YZH A;  3GL5 A;  1YEX A;  5JCW A;  1R5P A;  5EPF A;  3VPT A;  1U88 A;  4ML1 A;  1B4P A;  3U6V A;  1A23 A;  3QAW A;  5DAL A;  3ZTL A;  4JR6 A;  1XWB A;  1GUM A;  2NDO A;  4EIQ A;  2EIO A;  4ILF A;  4KCE A;  4F03 A;  1UC7 A;  3E0U A;  3UIW A;  1Y6E A;  3IRA A;  5DJL A;  4BVX B;  3KTB A;  1GL8 A;  5J41 A;  1WMJ A;  2KP1 A;  3FR6 A;  3TKS A;  3O3T A;  4IGJ A;  2IME A;  4ICY A;  1PX7 A;  1U3I A;  3M9K A;  4XS4 A;  2IIY A;  3TRX A;  3GNJ A;  2V2G A;  3UVH A;  4F0B A;  6GSY A;  3ZML A;  5IMC A;  4TW5 A;  5JCG A;  5AIS A;  3HJP A;  2ZUP A;  3KD0 A;  1WP0 A;  4HDE A;  1K0N A;  1GSD A;  2ZNM A;  1XW5 A;  3HJO A;  5DCG A;  9GSS A;  2G0F A;  1F37 A;  2B3S A;  2PVQ A;  1NSW A;  3GA4 A;  5CRD A;  3GTU B;  5D96 A;  4KA0 A;  1GLP A;  1SD9 A;  1XCC A;  3GKX A;  5G31 A;  1VF4 A;  4MP4 A;  3VUR A;  2X64 A;  4K2X A;  2RUE A;  4DSS A;  4TOP A;  4ACS A;  2DIZ A;  2WGR A;  1XW6 A;  3Q19 A;  1ACV A;  4EXJ A;  1UN2 A;  5AGY A;  4OCF A;  4EDZ A;  2IWT A;  2K18 A;  1URM A;  3VPQ A;  3ZIJ A;  2YP6 A;  1SD8 A;  4NMU A;  1YKA A;  2XBQ A;  1R4W A;  1ZMA A;  2HFD A;  1TKD B;  2VM1 A;  2H0I A;  3MWH A;  4JE1 A;  2HZE B;  3IE3 A;  3KEB A;  4AJ6 A;  2BTO T;  4O5Q A;  1MD3 A;  1FG4 A;  1F2E A;  3NOF A;  3RPP A;  4K7O A;  3VWU A;  1PKW A;  4KF9 A;  2IFQ B;  3UBL A;  4BIK A;  3FZ9 A;  3A3T A;  3UAR A;  2DKH A;  5H5R A;  4Q5F A;  1OC9 A;  3FW2 A;  5KOW A;  1XWG A;  2I4A A;  2VOC A;  2KP2 A;  4POL A;  3ZIT A;  1KTE A;  3BOA A;  3HA9 A;  4KUN A;  1I9D A;  1GTI A;  1JLW A;  2PVO C;  2FD3 A;  2R0C A;  4HS1 A;  1EOG A;  3C7M A;  4O7H A;  1Z7R A;  1NW2 A;  2ALB A;  1KEB A;  2TRC P;  3HDC A;  1VF3 A;  3ZRD A;  2WFC A;  1DUG A;  4XRD A;  4Q5R A;  3Q18 A;  4KSM A;  1V40 A;  5CP1 A;  5CRW A;  5ECN B;  1FW1 A;  2JZS A;  2L4C A;  4HJ2 A;  1PKZ A;  4CHS A;  1O73 A;  5B6N A;  1WJK A;  4MMM A;  4TR1 A;  3DEX A;  1TRS A;  3ZFL A;  2ZCT A;  2OBI A;  2I81 A;  3H1N A;  2OAC A;  4TR4 A;  1K0M A;  2E2G A;  4WKW A;  4IVF A;  5DAK B;  5DQS A;  4OO5 A;  1Y25 A;  3Q74 A;  2B1L A;  5F8B A;  19GS A;  4NWY A;  2Z9S A;  1TK8 B;  2FNO A;  3CXG A;  3WGX A;  3VI5 A;  2ON7 A;  4KGI A;  1GUH A;  3RBT A;  3N5O A;  2YV9 A;  3I6A A;  1G6W A;  1JZO A;  1GRX A;  1YJ6 A;  4GXZ A;  2V32 A;  3IHG A;  4Z2T A;  5LD0 A;  2QC7 A;  2HSY A;  4XHM A;  7GSS A;  3M1G A;  2VCQ A;  3BBY A;  4IQA A;  3OR5 A;  1QQ2 A;  4V1A p;  3GFK A;  3U5R E;  3M0F A;  1K0B A;  5D93 A;  1Z3E A;  1V58 A;  1ZL9 A;  2YCD A;  3FZ5 A;  3US3 A;  2DC5 A;  2VD1 A;  2EIQ A;  3APS A;  3EWL A;  4GWR A;  2X8C A;  4OFN A;  1HNC A;  4BPY A;  1G7O A;  1SKR B;  4JBB A;  2X8G A;  1R26 A;  4NHW A;  2F8A A;  2GZZ A;  1FOH A;  2GQK A;  2C8U A;  1EGR A;  1QUW A;  3DML A;  4BA7 A;  3LEF A;  1S3A A;  4QQ7 A;  3ME8 A;  1M7T A;  2H66 A;  1SEN A;  1MD4 A;  3TCO A;  2H6X A;  4ULX A;  2CVK A;  1XVQ A;  2YJH A;  2DSA A;  4E8H A;  4YAP A;  3KP9 A;  1NHO A;  1PRX A;  2V6O A;  4MJA A;  4LA1 A;  3FR3 A;  1XWK A;  1MEK A;  1EWX A;  3IHQ A;  4LL4 B;  2LS5 A;  1E6B A;  1B4Q A;  2HZF A;  5B8B A;  1QK8 A;  4NAX A;  2JZR A;  4ECJ A;  3C1R A;  2H6Z A;  1LU4 A;  4BL7 B;  2A4V A;  3F0I A;  4XTS A;  3FEU A;  5A4W A;  1FVK A;  4GF0 A;  3TDG A;  1O8W A;  2HI7 A;  4IQ1 A;  4HQZ A;  2F3M A;  2AHE A;  1RQM A;  4DEJ A;  4MK3 A;  1VF2 A;  1N8J A;  1W4V A;  3IAM 2;  2R5G A;  1LJR A;  2CT6 A;  1GSF A;  4EUY A;  2C3Q A;  1XPV A;  2OBK A;  4POB A;  2RLI A;  2ON5 A;  4X1U A;  3GST A;  5ECO B;  1A8Y A;  2HYX A;  3TKP A;  2L5O A;  4XIH A;  1XBS A;  4CW9 A;  2JZT A;  2MBT A;  3IAS 2;  2VCT A;  4BVY A;  1YEP A;  1O81 A;  3GRX A;  3MIX A;  3ZRE A;  1EV9 A;  1R5A A;  3FY7 A;  3TJG A;  2GT6 A;  3EYT A;  5G1K A;  1FHE A;  4OWY A;  4QL9 A;  4GQF A;  2DJK A;  1C72 A;  4L0U A;  4I2T A;  1VRS D;  3H79 A;  1K3L A;  3UMA A;  3WT2 A;  5DBQ A;  2GST A;  3IDV A;  2O85 A;  2QSI A;  3G7Y A;  1YF0 A;  4D73 A;  3GIX A;  2WUL A;  3RHC A;  3KGK A;  2QA1 A;  1F3A A;  3AY8 A;  1ZYN A;  3TJJ A;  2B7K A;  2R0G A;  4WXT A;  2QKE A;  3RAZ A;  3ZVJ D;  3F6D A;  2B7J A;  3O76 A;  3TJF A;  2O7K A;  4KSO A;  1R7H A;  1BED A;  2H0H A;  2LQQ A;  2R3X A;  3I43 A;  3MYD A;  1PQN A;  2GGT A;  1AIU A;  1T4Y A;  4X43 A; 
#chains in the Genus database with same CATH homology
 5D9X A;  5HFK A;  3H8Q A;  1T1V A;  3EMP A;  4K5R A;  1X5D A;  4G19 A;  1NM3 A;  2VCV A;  2H70 A;  2P31 A;  3EIN A;  4YQU A;  3L9S A;  4EL1 A;  1B8X A;  4EVM A;  4FYU A;  2AB6 A;  5DVB A;  2CAQ A;  3IPZ A;  2RM6 A;  2H8L A;  2I9H A;  2FLS A;  4MF5 A;  5H5S A;  2M72 A;  4PQ1 A;  5HQP A;  2PGT A;  1B9Y C;  5IOW A;  1RW1 A;  3E9J B;  3WGE A;  3QR6 A;  1THO A;  3LOR A;  4O32 A;  1T4Z A;  2DKI A;  4GTU A;  2FGX A;  4K7N A;  3TRP A;  2VD0 A;  1Z7P A;  4IW9 A;  3VLN A;  2H74 A;  2HSM A;  3KJY A;  2E7P A;  1X5C A;  2K8V A;  3ZIV A;  3TOT A;  3K8N A;  1U87 A;  2V6K A;  4MCU A;  4WR5 A;  5IMZ A;  2DML A;  2X99 A;  1F6M C;  4EO3 A;  1WWJ A;  2CZ2 A;  3KZQ A;  1G0T A;  2L4Q A;  4O5R A;  3FYG A;  5B7C A;  1GTU A;  1ERV A;  2PN8 A;  5AIX A;  2E0Q A;  3FR9 A;  4IBP A;  4N30 A;  1XOA A;  4ZXG A;  3H4K A;  3C71 A;  3HY2 A;  4E8E A;  3JCM L;  4BWS A;  5A5K A;  1A8L A;  2NTO A;  2AUV A;  2H71 A;  1TDI A;  1U3A A;  3HZ4 A;  1EOH A;  1T8E B;  2TRX A;  2VLV A;  1SKW B;  4K8M A;  3CSH A;  2XHF A;  2OA7 A;  2VM2 A;  3F6F A;  2YZU A;  5F0G A;  2NPB A;  3G7J A;  4DSQ A;  3HD5 A;  2BJX A;  3EC3 A;  3HXS A;  2K9F A;  3MDK A;  1W89 A;  5BRT A;  2PUK C;  3HCZ A;  2VCX A;  1G6Y A;  1AUC A;  3TOU A;  2PMT A;  4XCS A;  2DJ1 A;  3QAG A;  4HZ2 A;  1ILO A;  3J7Y b;  1EGO A;  3CRU A;  1BX9 A;  4IP6 A;  2H75 A;  4FO5 A;  1SK1 A;  2WRT A;  2R6K A;  3GUS A;  5J9B A;  5KOX A;  2IFQ A;  2PWJ A;  2VCW A;  2GVP A;  5IMD A;  2B1K A;  1SK0 A;  3F9U A;  3P2A A;  3QMX A;  4EIP A;  5INY A;  1UA5 A;  3N9J A;  2PBJ A;  5IM9 A;  18GS A;  2VIM A;  4POM A;  5CNW A;  1XOB A;  2GDR A;  2LRN A;  3D0Z A;  2UZ8 A;  3LYP A;  1H4O A;  2LQO A;  1ML6 A;  3DRN A;  1T3B A;  1A2J A;  4V2L A;  4AJ8 A;  2PPT A;  3HVX A;  4L8E A;  5GAN D;  4FYC A;  1I5G A;  4EKZ A;  2HRK A;  4QL7 A;  3GN3 A;  4X0X A;  2H1G A;  1J9B A;  4MAB A;  1TK0 B;  1WIK A;  2R37 A;  4MZW A;  1V98 A;  1Z9H A;  4YAV A;  2P5Q A;  2GLR A;  3ZFB A;  1OKT A;  2FWF A;  1Q98 A;  2R2J A;  3KM6 A;  1XW9 A;  3QDN A;  4YKG A;  2VL2 C;  4TR3 A;  3C8E A;  1ZYP A;  5GZZ B;  3UEM A;  2EC4 A;  4Z2R A;  5DAL B;  5EL8 A;  3PH9 A;  1PD2 1;  2GT5 A;  5IO0 A;  3QOU A;  1JZW A;  2YWM A;  3ZZX A;  2L6D A;  4TN8 A;  3BCI A;  3TGZ A;  2FA8 A;  1LBK A;  4TXO B;  1PMT A;  3IV4 A;  4FH8 A;  2IMK A;  1RK4 A;  3KXO A;  5ECL B;  4KW6 A;  3IA1 A;  5ID2 A;  3KCM A;  2X8H A;  5AN1 A;  5E4W A;  3A5I A;  3QD9 A;  2GTU A;  3UVT A;  3M8N A;  3ZMK A;  4G9H A;  1HNA A;  1THX A;  4G0I A;  2DBC A;  4ECI A;  3F4R A;  1FO5 A;  4TR0 A;  3ME7 A;  3L78 A;  3UAP A;  5COH A;  5CO3 A;  2N5F A;  4ECB A;  1M99 A;  4X4J A;  5KN2 A;  1SYR A;  4G0K A;  4IP1 A;  3TUE A;  2JAC A;  4ML6 A;  1X5E A;  3CSI A;  2FWH A;  4K1F A;  3KP8 A;  3GH9 A;  3WD6 A;  1NHY A;  4AGS A;  1MTC A;  5G5F A;  5CYY A;  1EEJ A;  4DSS B;  5DJM A;  3LXT A;  5JWR B;  1PGT A;  5L71 A;  1TU7 A;  4MF7 A;  1K0C A;  4ZB8 A;  2O89 A;  22GS A;  2FWG A;  2VLU A;  2YNX A;  1GSS A;  3KH7 A;  2JU5 A;  5DCH A;  3QPM A;  4J57 E;  2P0G A;  2AV4 A;  2OKA A;  3ERW A;  4IJ3 A;  3SBC A;  3LXZ A;  5IIZ A;  4MJE A;  1X9W B;  1TOF A;  1IYI A;  2R0P A;  1OC9 B;  3L0H A;  1AW9 A;  3IC8 A;  1V2A A;  4N0Z A;  2VAF A;  2DLX A;  1FAA A;  4MZC A;  4I8B A;  1DSB A;  1M9B A;  1AC1 A;  1Z6N A;  3DWV A;  1TK5 B;  3LGC A;  2HLS A;  1EZK A;  4XS6 A;  1YDK A;  2V41 A;  1SKS B;  2PER A;  1YQ1 A;  5HR2 A;  2DJ2 A;  1HNB A;  1K0O A;  2B5E A;  4EC0 A;  1GSY A;  3A2W A;  4FYB A;  4MF6 A;  5D9V A;  4V2M A;  5HFI A;  2VL9 A;  3D22 A;  5IOX A;  2G2Q A;  1WOU A;  2WJU A;  2FHE A;  4YH2 A;  3CTF A;  2JAD A;  3HYP A;  2H73 A;  2F9S A;  4KAE A;  2YWI A;  5FHI A;  1JZR A;  4TR1 B;  1HQO A;  3APO A;  1GWC A;  4HEA 2;  2HXK A;  3I9V 2;  2HRN A;  5CRE A;  2OE3 A;  4HOJ A;  1SK2 A;  4F9Z A;  1DE1 A;  3F4S A;  1X9M B;  4Z2U A;  2GSQ A;  2OE1 A;  4H86 A;  2YV7 A;  3P90 A;  1JLV A;  3VWX A;  3KTL A;  1GSQ A;  4IKH A;  4NHZ A;  5CRH A;  2H30 A;  3O6T A;  1QGV A;  1QMV A;  1OC3 A;  2ES7 A;  3IR4 A;  3L4N A;  4WR4 A;  5DQY A;  2M46 A;  5G1L A;  1JFU A;  3CTG A;  4K5S A;  2CZ3 A;  3QFB C;  6GSV A;  4Z7X A;  1OC8 A;  2L59 A;  1CQG A;  1ABA A;  3MSZ A;  1PA3 A;  5HR1 A;  3LW9 A;  5HR0 A;  5J5N A;  1AQV A;  5C04 A;  1YF1 A;  1OYJ A;  14GS A;  3GKK A;  2LST A;  2GQL A;  2LNT A;  1XIY A;  2LV3 A;  4ISD A;  2CQ9 A;  3EUR A;  5ECS A;  4EF0 A;  5HR3 A;  2IJY A;  3GKN A;  3IXR A;  4ZB9 A;  13GS A;  5J4U A;  1TI1 A;  4JR4 A;  17GS A;  4WF5 A;  3V1W A;  1GP1 A;  2IN3 A;  4GQC A;  3VK9 A;  1OAZ A;  3DVW A;  3HJM A;  3GX8 A;  1ZZY A;  2YN1 A;  2H72 A;  3HZ8 A;  1JHB A;  4NXI A;  3QCP A;  5KEJ A;  3IC4 A;  2F8F A;  3GYK A;  1SYX A;  4MA9 A;  4WBR D;  1UVZ A;  3ZL5 A;  5G5E A;  4KB3 A;  5FWG A;  3TKS C;  1B9X C;  3SWL A;  4MZB A;  2H0G A;  1DE2 A;  4L0W A;  4AJ7 A;  3VWW A;  2GS3 A;  2GZY A;  1SU9 A;  4LLR A;  2A2P A;  3TKQ A;  1TU8 A;  3CMI A;  2JSY A;  4RUV A;  5BMU A;  4GCI A;  1AAZ A;  2O87 A;  3RDW A;  2YWN A;  2CVD A;  1TW9 A;  2REM A;  1GNW A;  3M9J A;  5C00 A;  4ZBA A;  1GH2 A;  2H1B A;  4G2E A;  2YJ7 A;  4RQR A;  2OE0 A;  3D4T A;  4K7I A;  3BJ5 A;  1N2A A;  4PGT A;  4K6X A;  2MZC A;  1HYU A;  4Q5Q A;  4YKF A;  4O5U A;  2HRA A;  2H19 A;  4RI7 A;  2OAD A;  2XPD A;  3D21 A;  3DYR A;  3WT1 A;  20GS A;  1BJX A;  3ERG A;  2LTK A;  3IBH A;  5ABR A;  2C80 A;  4BVX A;  1J0F A;  4I6X A;  4DVC A;  1XVW A;  2FA4 A;  1SJZ A;  3LG6 A;  2XPE A;  4PNG A;  2CAI A;  3L9V A;  5ECR B;  4PUR A;  3FKF A;  1WRY A;  4DSR A;  4BVY B;  10GS A;  1B48 A;  4OFT A;  2MMN A;  2HT9 A;  1M2D A;  3C73 A;  3PIN A;  2HRF A;  4RI6 A;  2GSS A;  3M3M A;  1PN0 A;  3F8U A;  2CX3 A;  1CQH A;  3GH6 A;  1DBY A;  5ECH B;  4WEY A;  4G10 A;  3GMF A;  4MH3 A;  3ZLP A;  2KOK A;  4XS1 A;  1A2M A;  3LSZ A;  1ST9 A;  3TRQ A;  4A5P A;  1K0A A;  4ZL7 A;  2MMA A;  4D73 B;  2JSZ A;  1BAY A;  3GTU A;  3NIV A;  1YY7 A;  2I1U A;  3TKR A;  1V57 A;  4PUA A;  4I97 A;  4L5L A;  4PTS A;  4JZQ A;  2K8S A;  4GSN A;  2LUS A;  1EP8 A;  4YQV A;  2QGV A;  4KX4 A;  1SL2 B;  4KDY A;  4MDC A;  2AYT A;  3TB2 A;  1ON4 A;  3LYK A;  4ZB6 A;  2FY6 A;  1AXD A;  2A2R A;  2WZ9 A;  2L5L A;  5ELA A;  2J23 A;  2TIR A;  4F82 A;  1GNE A;  2PU9 C;  1A0F A;  1U6T A;  4ECC A;  3D4M A;  2HZE A;  5IPG A;  3RHB A;  12GS A;  3A5W A;  5ECI B;  4I2U A;  1X9S B;  4TXO A;  4IS0 A;  5ECP B;  2E2M A;  5IMV A;  3QAV A;  2FWE A;  2I3Y A;  1TJD A;  5D8I A;  2HSH A;  2H01 A;  1TRW A;  4TKY A;  1GLQ A;  2NBS A;  1GUK A;  16GS A;  1OE8 A;  2C3N A;  2MYG A;  3R3E A;  2WS2 A;  2B6M A;  1J08 A;  1SJI A;  2X4A A;  2X49 A;  4KDU A;  5EVO A;  4GLT A;  3GL3 A;  4PUF C;  4K0G A;  4OD7 A;  4ZBD A;  4GRF A;  5D9T A;  3FK8 A;  4CDO A;  4HI7 A;  3F4T A;  3CBU A;  6GSS A;  4MLY A;  1AQX A;  5E59 A;  2KHP A;  1GSE A;  1BYE A;  2M80 A;  3DXB A;  2LKU A;  2YAN A;  3PR8 A;  1WPI A;  3D6I A;  2LNS A;  4LL1 B;  4I5Q A;  2A4H A;  4ZBB A;  4HJM A;  4OCE A;  1MDI A;  1KBN A;  4IEL A;  5A4U A;  3DGQ A;  4P3Y B;  2LJR A;  2LEG A;  4ZIJ A;  4J56 E;  5G2Z A;  3EMX A;  3CYN A;  3HHV A;  2LRC A;  3MAK A;  1M2B A;  3GHA A;  5DAK A;  3ISO A;  2H6Y A;  4N11 A;  4TRX A;  1SL0 B;  5J9C A;  1A24 A;  3DIE A;  4MH2 A;  1A2L A;  2DIY A;  1K0D A;  4XS4 B;  1ERW A;  4J2F A;  3L9U A;  2WB9 A;  4KDX A;  3TJK A;  2MMZ A;  4KH7 A;  3APQ A;  4MJC A;  3FMW A;  1PN9 A;  5JWO B;  3ERF A;  4HUA A;  2RM5 A;  5F05 A;  3EU3 A;  2V1M A;  4IJI A;  2C3T A;  3UOM A;  1WE0 A;  5F06 A;  2C0F A;  3LWA A;  2RUF A;  2LJK A;  6GSU A;  1USB A;  3S9F A;  5KN3 A;  1M0U A;  3WYW A;  4EDY A;  4WBJ A;  2L6C A;  5AIV A;  2HNL A;  2O8V B;  3I69 A;  4Q5N A;  4KCA A;  1TRU A;  3NZN A;  5KN0 A;  3UL3 A;  1TXX A;  4LMV A;  2C1Y A;  2A2S A;  5ECQ B;  4IN0 A;  6GSX A;  2C4J A;  5A4V A;  1MDK A;  3A2V A;  3H93 A;  5KN1 A;  2AJQ B;  4NPB A;  1OKD A;  4BL7 A;  5ID2 B;  4GST A;  4YQM A;  2JL4 A;  5IMF A;  3MNG A;  2CVB A;  4TXV A;  4F0C A;  2IMD A;  2DJ3 A;  2VO4 A;  5LNK e;  1FVJ A;  2B5X A;  1F9M A;  1GUL A;  1FB6 A;  2YOI A;  4MJB A;  3P7X A;  3EU4 A;  1E2Y A;  4N10 A;  5GAP D;  3FZA A;  2WDU A;  11GS A;  5D9W A;  4ZIL A;  4PQI A;  5CRG A;  3W6G A;  2J9H A;  2KLX A;  4G0L A;  1YZX A;  1AQW A;  2F51 A;  1ZGN A;  4ID0 A;  1FOV A;  4IHU A;  3UBK A;  3ED3 A;  2VL2 A;  3EVI A;  1ZCP A;  4MPF A;  4PXO A;  1XZO A;  3CSJ A;  4K2D A;  3TKS E;  3PGT A;  3ZVJ A;  4OFM A;  5B6M A;  2D2Z A;  4JRR A;  2CA8 A;  5GST A;  3VI7 A;  4TVE A;  2C0D A;  4GSS A;  4K0N A;  1T7P B;  5HFG A;  5IMA A;  3IK9 A;  3WGD A;  5GSS A;  2DMM A;  4NV5 A;  1XXU A;  1OE7 A;  3E3E A;  4ZL8 A;  5JWQ B;  4PX1 A;  1VGL A;  5D73 A;  5ECM B;  5H5Q A;  3LQ7 A;  3LFL A;  2IMI A;  1QXH A;  1GSU A;  4OMV A;  1HD2 A;  2LRT A;  2H1A A;  3KIJ A;  1XFL A;  2RII A;  4KND A;  4ZL9 A;  5G30 A;  3IK7 A;  4JU5 A;  4MNN A;  8GSS A;  1GTB A;  2XBI A;  3FHK A;  4FQU A;  2C0E A;  3CRT A;  5F07 A;  3KMN A;  2VCZ A;  1M9A A;  3F63 A;  5JCU A;  1KNG A;  1XWA A;  4KE3 A;  2GQM A;  1XWC A;  4L5O A;  1VF1 A;  1YKC A;  5EY6 A;  3VFI A;  4XRA A;  4WET A;  3GSS A;  4EE0 A;  1OVN A;  2N5A A;  1TRV A;  3GX0 A;  2MBS A;  3G9B A;  1EV4 A;  3J7Y k;  4F2I A;  2VLT A;  3D5J A;  3HVV A;  6GST A;  3G7I A;  2GSR A;  3IOS A;  2VL3 A;  1PSQ A;  4PQH A;  4K9Z A;  2OJL A;  4CY6 A;  1T00 A;  6GSW A;  3VWV A;  4BWQ A;  4N0V A;  1TTZ A;  3UJ1 A;  1MDJ A;  5ECK B;  5IPH A;  1O7U A;  2DJJ A;  1PL1 A;  1ERU A;  1BG5 A;  1M2A A;  4WF4 A;  3R2Q A;  2BMX A;  2YWO A;  2FUG 2;  4HU9 A;  3PPU A;  2K6V A;  1SL1 B;  1TI3 A;  3EPT A;  4HZ4 A;  3LJR A;  3GUR A;  2L57 A;  2VUP A;  5CAX A;  3BCK A;  3HKR A;  1Z6M A;  4V2N A;  5IO2 A;  2MMO A;  4USS A;  1S3C A;  3KMO A;  4LMW A;  3FRC A;  3W8J A;  1F3B A;  3HVS A;  4OO4 A;  1S3D A;  2GZP A;  1H75 A;  3DVX A;  1PL2 A;  5ELG A;  1O85 A;  3W8S A;  3A2X A;  3EE2 A;  4HU7 A;  1A0R P;  1PX6 A;  2C0G A;  3DD3 A;  1BQ7 A;  2WCI A;  4PNF A;  3C1S A;  4V1A g;  2IL3 A;  1ZYQ B;  3RPN A;  1SJ6 A;  3GKM A;  1O8X A;  2LJA A;  1K3O A;  1O6J A;  4RQX A;  5ENU A;  4AF2 A;  2CV4 A;  2YPM A;  1ZOF A;  2P5R A;  2R4V A;  2FCH A;  5FT3 A;  2IPA A;  5LCZ A;  1V9W A;  2DJ0 A;  2AAW A;  2H76 A;  3KH9 A;  3FZ4 A;  4POK A;  1FB0 A;  4HQS A;  1GTA A;  5J3R A;  2EIR A;  3F3R A;  3ZYW A;  1ERT A;  1G7E A;  2IMF A;  1JZD A;  1Z5Y E;  1X0R A;  4JED A;  3GV1 A;  3BD2 A;  2B5Y A;  4CY8 A;  4MPG A;  4NV2 A;  2HE3 A;  2N5B A;  5IQY A;  3Q6O A;  3DKS A;  1IYH A;  1QFN A;  1Q4J A;  5DDL A;  2H1D A;  1EP7 A;  4FIW A;  2CX4 A;  2NVL A;  1EEM A;  3F3Q A;  2XC2 A;  1K3Y A;  2KUC A;  4O92 A;  3P8W A;  2QA2 A;  1ZYE A;  3TJB A;  1TP9 A;  3QFA C;  5B8A A;  2YZH A;  3GL5 A;  1YEX A;  5JCW A;  1R5P A;  5EPF A;  3VPT A;  1U88 A;  4ML1 A;  1B4P A;  3U6V A;  1A23 A;  3QAW A;  5DAL A;  3ZTL A;  4JR6 A;  1XWB A;  1GUM A;  2NDO A;  4EIQ A;  2EIO A;  4ILF A;  4KCE A;  4F03 A;  1UC7 A;  3E0U A;  3UIW A;  1Y6E A;  3IRA A;  5DJL A;  4BVX B;  3KTB A;  1GL8 A;  5J41 A;  1WMJ A;  2KP1 A;  3FR6 A;  3TKS A;  3O3T A;  4IGJ A;  2IME A;  4ICY A;  1PX7 A;  1U3I A;  3M9K A;  4XS4 A;  2IIY A;  3TRX A;  3GNJ A;  2V2G A;  3UVH A;  4F0B A;  6GSY A;  3ZML A;  5IMC A;  4TW5 A;  5JCG A;  5AIS A;  3HJP A;  2ZUP A;  3KD0 A;  1WP0 A;  4HDE A;  1K0N A;  1GSD A;  2ZNM A;  1XW5 A;  3HJO A;  5DCG A;  9GSS A;  2G0F A;  1F37 A;  2B3S A;  2PVQ A;  1NSW A;  3GA4 A;  5CRD A;  3GTU B;  5D96 A;  4KA0 A;  1GLP A;  1SD9 A;  1XCC A;  3GKX A;  5G31 A;  1VF4 A;  4MP4 A;  3VUR A;  2X64 A;  4K2X A;  2RUE A;  4DSS A;  4TOP A;  4ACS A;  2DIZ A;  2WGR A;  1XW6 A;  3Q19 A;  1ACV A;  4EXJ A;  1UN2 A;  5AGY A;  4OCF A;  4EDZ A;  2IWT A;  2K18 A;  1URM A;  3VPQ A;  3ZIJ A;  2YP6 A;  1SD8 A;  4NMU A;  1YKA A;  2XBQ A;  1R4W A;  1ZMA A;  2HFD A;  1TKD B;  2VM1 A;  2H0I A;  3MWH A;  4JE1 A;  2HZE B;  3IE3 A;  3KEB A;  4AJ6 A;  2BTO T;  4O5Q A;  1MD3 A;  1FG4 A;  1F2E A;  3NOF A;  3RPP A;  4K7O A;  3VWU A;  1PKW A;  4KF9 A;  2IFQ B;  3UBL A;  3FZ9 A;  3A3T A;  3UAR A;  2DKH A;  5H5R A;  4Q5F A;  1OC9 A;  3FW2 A;  5KOW A;  1XWG A;  2I4A A;  2VOC A;  2KP2 A;  4POL A;  3ZIT A;  1KTE A;  3BOA A;  3HA9 A;  4KUN A;  1I9D A;  1GTI A;  1JLW A;  2PVO C;  2FD3 A;  2R0C A;  4HS1 A;  1EOG A;  3C7M A;  4O7H A;  1Z7R A;  1NW2 A;  2ALB A;  1KEB A;  2TRC P;  3HDC A;  1VF3 A;  3ZRD A;  2WFC A;  1DUG A;  4XRD A;  4Q5R A;  3Q18 A;  4KSM A;  1V40 A;  5CP1 A;  5CRW A;  5ECN B;  1FW1 A;  2JZS A;  2L4C A;  4HJ2 A;  1PKZ A;  4CHS A;  1O73 A;  5B6N A;  1WJK A;  4MMM A;  4TR1 A;  3DEX A;  1TRS A;  3ZFL A;  2ZCT A;  2OBI A;  2I81 A;  3H1N A;  2OAC A;  4TR4 A;  1K0M A;  2E2G A;  4WKW A;  4IVF A;  5DAK B;  5DQS A;  4OO5 A;  1Y25 A;  3Q74 A;  2B1L A;  5F8B A;  19GS A;  4NWY A;  2Z9S A;  1TK8 B;  2FNO A;  3CXG A;  3WGX A;  3VI5 A;  2ON7 A;  4KGI A;  1GUH A;  3RBT A;  3N5O A;  2YV9 A;  3I6A A;  1G6W A;  1JZO A;  1GRX A;  1YJ6 A;  4GXZ A;  2V32 A;  3IHG A;  4Z2T A;  5LD0 A;  2QC7 A;  2HSY A;  4XHM A;  7GSS A;  3M1G A;  2VCQ A;  3BBY A;  4IQA A;  3OR5 A;  1QQ2 A;  4V1A p;  3GFK A;  3U5R E;  3M0F A;  1K0B A;  5D93 A;  1Z3E A;  1V58 A;  1ZL9 A;  2YCD A;  3FZ5 A;  3US3 A;  2DC5 A;  2VD1 A;  2EIQ A;  3APS A;  3EWL A;  4GWR A;  2X8C A;  4OFN A;  1HNC A;  4BPY A;  1G7O A;  1SKR B;  4JBB A;  2X8G A;  1R26 A;  4NHW A;  2F8A A;  2GZZ A;  1FOH A;  2GQK A;  2C8U A;  1EGR A;  1QUW A;  3DML A;  4BA7 A;  3LEF A;  1S3A A;  4QQ7 A;  3ME8 A;  1M7T A;  2H66 A;  1SEN A;  1MD4 A;  3TCO A;  2H6X A;  4ULX A;  2CVK A;  1XVQ A;  2YJH A;  2DSA A;  4E8H A;  4YAP A;  3KP9 A;  1NHO A;  1PRX A;  2V6O A;  4MJA A;  4LA1 A;  3FR3 A;  1XWK A;  1MEK A;  1EWX A;  3IHQ A;  4LL4 B;  2LS5 A;  1E6B A;  1B4Q A;  2HZF A;  5B8B A;  1QK8 A;  4NAX A;  2JZR A;  4ECJ A;  3C1R A;  2H6Z A;  1LU4 A;  4BL7 B;  2A4V A;  3F0I A;  4XTS A;  3FEU A;  5A4W A;  1FVK A;  4GF0 A;  3TDG A;  1O8W A;  2HI7 A;  4IQ1 A;  4HQZ A;  2F3M A;  2AHE A;  1RQM A;  4DEJ A;  4MK3 A;  1VF2 A;  1N8J A;  1W4V A;  3IAM 2;  2R5G A;  1LJR A;  2CT6 A;  1GSF A;  4EUY A;  2C3Q A;  1XPV A;  2OBK A;  4POB A;  2RLI A;  2ON5 A;  4X1U A;  3GST A;  5ECO B;  1A8Y A;  2HYX A;  3TKP A;  2L5O A;  4XIH A;  1XBS A;  4CW9 A;  2JZT A;  2MBT A;  3IAS 2;  2VCT A;  4BVY A;  1YEP A;  1O81 A;  3GRX A;  3MIX A;  3ZRE A;  1EV9 A;  1R5A A;  3FY7 A;  3TJG A;  2GT6 A;  3EYT A;  5G1K A;  1FHE A;  4OWY A;  4QL9 A;  4GQF A;  2DJK A;  1C72 A;  4L0U A;  4I2T A;  1VRS D;  3H79 A;  1K3L A;  3UMA A;  3WT2 A;  5DBQ A;  2GST A;  3IDV A;  2O85 A;  2QSI A;  3G7Y A;  1YF0 A;  4D73 A;  3GIX A;  2WUL A;  3RHC A;  3KGK A;  2QA1 A;  1F3A A;  3AY8 A;  1ZYN A;  3TJJ A;  2B7K A;  2R0G A;  4WXT A;  2QKE A;  3RAZ A;  3ZVJ D;  3F6D A;  2B7J A;  3O76 A;  3TJF A;  2O7K A;  4KSO A;  1R7H A;  1BED A;  2H0H A;  2LQQ A;  2R3X A;  3I43 A;  3MYD A;  1PQN A;  2GGT A;  1AIU A;  1T4Y A;  4X43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...