2AUVA

Solution structure of hndac : a thioredoxin-like [2fe-2s] ferredoxin involved in the nadp-reducing hydrogenase complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
MVPKGKYPISVCMGTACFVKGADKVVHAFKEQLKIDIGDVTPDGRFSIDTLRCVGGCALAPIVMVGEKVYGNVTPGQVKKILAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords potential NAD-reducing hydrogenase subunit
publication title Solution structure of HndAc: a thioredoxin-like domain involved in the NADP-reducing hydrogenase complex
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
total genus 12
structure length 85
sequence length 85
ec nomenclature ec 1.12.1.3: Hydrogen dehydrogenase (NADP(+)).
pdb deposition date 2005-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2auvA00
3HKRA 2P5QA 4OWYA 1XVWA 2FWFA 1IYHA 4O7HA 3C73A 2IN3A 1JLVA 2NBSA 1YDKA 2HRNA 3BOAA 16GSA 2XBQA 3O76A 1HNBA 2FLSA 3ZZXA 3IR4A 3TJGA 1ZGNA 4OO5A 2GLRA 2GDRA 1HD2A 4Q5QA 1QUWA 2MMNA 2OACA 5J5NA 3C8EA 4FYCA 2WB9A 3IPZA 3D4TA 1YEXA 3FZAA 1FG4A 1GSEA 3WT2A 1KNGA 4K0NA 4TXVA 4OD7A 2FGXA 1MDIA 1FW1A 3E9JB 2H75A 3DMLA 2G2QA 5IMAA 2FA4A 4KX4A 3IV4A 3GRXA 5ECKB 3ZITA 4I97A 3VFIA 2CZ3A 1S3CA 1SENA 4GWRA 2C8UA 2VAFA 4WF4A 2HZFA 1WRYA 2KP1A 4ML1A 3FR9A 3A3TA 3CMIA 1EGRA 5B8BA 3GMFA 4MZCA 5D9XA 1PMTA 1R26A 1XCCA 4GQCA 2DJ2A 3CSIA 2REMA 4OFTA 4ACSA 1JFUA 2B5YA 1OKTA 1R5PA 5EY6A 1XBSA 2E2MA 2B1LA 2H6XA 4K2DA 5HR1A 3F3QA 3HY2A 3FK8A 4N30A 2E7PA 2QSIA 2DJ0A 1M2DA 5A5KA 2I9HA 1Q4JA 3MDKA 2H1AA 4KDXA 2RLIA 2YWOA 1EV9A 2LRCA 4GSNA 2E2GA 3ZL5A 4OCEA 3GL5A 2VO4A 4ZIJA 4ZXGA 3GSSA 3H1NA 3CBUA 4HZ2A 3ZYWA 2LNTA 3DYRA 4ECJA 3CYNA 2YV9A 4POKA 2NTOA 1LBKA 4HEA2 4MPFA 1X5CA 3WT1A 2WZ9A 4K8MA 2K18A 4YQMA 1B4PA 4HJ2A 3WD6A 1O7UA 3F4RA 3ME8A 1YY7A 4F82A 3SWLA 5F8BA 1GNEA 1ST9A 1KBNA 1PL1A 4IS0A 1O8XA 3DVXA 3P2AA 1TDIA 3FR6A 5A4VA 5IIZA 4NWYA 5LD0A 3FZ4A 6GSXA 4XRAA 2C1YA 2LJRA 3O6TA 2H72A 3BCKA 2XPDA 4DEJA 2IMIA 1F3BA 1BJXA 3W8SA 2V41A 1CQHA 4L5LA 3QR6A 4CDOA 3IDVA 2WDUA 1GUKA 3PINA 3GTUB 1Y25A 3ERFA 1E6BA 4QQ7A 3KZQA 2DBCA 4XTSA 4BWSA 2L5LA 2O8VB 1SK0A 1DE2A 4D73A 3EVIA 2LEGA 3VURA 3IAM2 4TR1B 1O85A 2H76A 4PXOA 1K0OA 1TRWA 2R6KA 3KH9A 1B8XA 3WGDA 3CRTA 5ABRA 4EE0A 1AAZA 2V6OA 4XS1A 4GTUA 3KMNA 4PUFC 2GZPA 4RI6A 3LXZA 3H93A 3QDNA 1FVKA 1YQ1A 2MMOA 1ON4A 2CVDA 3HJMA 3C1RA 2YWNA 4XS4B 2TRXA 3QCPA 2HFDA 3TJFA 5G30A 4MJEA 1SJIA 4GSTA 4TR1A 4PQ1A 1NM3A 1VF1A 1Z7PA 4BL7A 1XXUA 5DCHA 4YAPA 2VLVA 1FB0A 2F51A 1XWGA 2O87A 4ECIA 3IE3A 3U6VA 5ECQB 1B48A 1THOA 3D21A 4QL7A 4MH3A 5C04A 4XS4A 1AQXA 2OBKA 5IPHA 2PVOC 3TJJA 4IGJA 3I69A 3SBCA 5IPGA 3L9UA 4WXTA 3IC4A 1ERTA 4EC0A 2V2GA 2CX3A 2X99A 2TRCP 2M80A 2F3MA 1GL8A 1A8YA 2YWIA 2HE3A 1QGVA 2WFCA 1Z3EA 5G1KA 1JZWA 4O5RA 2DJJA 1U6TA 2H0GA 2VL2A 3EYTA 5G31A 3LFLA 1DUGA 4ISDA 2H0IA 2JZRA 1AW9A 3TKQA 4EDZA 5C00A 2H73A 2GGTA 3L9VA 2GSSA 4PQIA 1ML6A 2FHEA 2HSYA 3GKXA 4FYBA 3D6IA 4WF5A 4CHSA 2AUVA 3QPMA 10GSA 1OE7A 2IWTA 2YZHA 4JE1A 1E2YA 1GSUA 1TI3A 2VM2A 1TU7A 2G0FA 2P0GA 1G6YA 2H6ZA 3DD3A 4RUVA 4ULXA 2CAIA 2GT6A 1OC9A 4NMUA 3I6AA 2DMLA 1PA3A 1GWCA 4POBA 2LS5A 3TOUA 1F9MA 3GKMA 1EOHA 1SL2B 4J56E 2M72A 4KH7A 3D22A 2R37A 4WETA 2R2JA 3NOFA 5GZZB 3OR5A 3VLNA 4JEDA 2MBTA 2L6DA 4EO3A 1T4ZA 5F05A 4ZILA 5HR3A 1GLQA 2RUEA 3N9JA 1BG5A 1MTCA 3GUSA 1XZOA 2XC2A 3IK9A 3TOTA 3FHKA 1MDKA 2AB6A 4XHMA 2AYTA 3Q6OA 4BVYA 1YJ6A 2IFQA 1U3IA 4Q5NA 2C0EA 3ISOA 5KEJA 4ZB6A 4KDYA 1A24A 2CA8A 4I6XA 1T00A 3M9JA 1S3AA 3M8NA 1PL2A 1GSFA 4LL1B 5F0GA 3FY7A 7GSSA 4I2TA 3H79A 1XVQA 5IOXA 3HJPA 3HDCA 2JU5A 3GYKA 2OE3A 4KSMA 2N5AA 1NHYA 2L59A 1ZL9A 1LU4A 1AQVA 1V2AA 5DVBA 5ECPB 2IMEA 3CTGA 3HZ8A 4IKHA 4X0XA 1QMVA 2H1GA 4K6XA 2CQ9A 3GHAA 4AJ7A 2HT9A 2JZSA 2L6CA 3HHVA 4POMA 2YJHA 3P7XA 1ZYQB 1I9DA 5JCWA 4ZB9A 3D4MA 4NAXA 1M2AA 2RM5A 4XCSA 3FYGA 2FNOA 3APOA 3HA9A 4J2FA 4NV2A 4DSQA 3M3MA 4YH2A 1M2BA 2GQKA 3JCML 3VWXA 2L4QA 5GSSA 1WOUA 5L71A 3IOSA 4KE3A 4WBRD 5JCUA 5IOWA 5ID2B 2ON7A 1K3YA 2BTOT 4ZBBA 1BEDA 1NW2A 2DLXA 3A2XA 5EVOA 1DSBA 1SJ6A 2CZ2A 1QFNA 4RQRA 1BAYA 4N11A 3G7YA 6GSVA 2OA7A 3ZMKA 4PQHA 3L0HA 1BYEA 5HR0A 2O7KA 5D9VA 1XW6A 3UEMA 4WEYA 2H8LA 1WJKA 1U87A 3KCMA 3NIVA 3TJBA 4E8HA 4E8EA 3MAKA 4IQAA 2LSTA 1CQGA 2YP6A 2H1DA 1V58A 3GNJA 1R4WA 4KSOA 4L0UA 4RQXA 2HRFA 4MJBA 3KP9A 1K3LA 1FB6A 1JZOA 4P3YB 5IMCA 3GV1A 3KD0A 4Q5FA 1OC8A 3LGCA 4Q5RA 3TRPA 2OBIA 2VCXA 2WGRA 1FOVA 5ECOB 4MF6A 3UBLA 14GSA 4OMVA 3VWWA 1RK4A 1ZCPA 2GS3A 3EINA 4EF0A 2FWEA 2IIYA 1AUCA 1YF1A 1KTEA 1B9XC 20GSA 1M99A 1TU8A 2I3YA 3O3TA 1UVZA 1SYXA 4OFMA 3TKSC 2YV7A 4L8EA 5DCGA 2GTUA 6GSTA 4MJAA 3AY8A 3IAS2 5G1LA 1WWJA 3TCOA 1GTAA 1QQ2A 1TI1A 4GRFA 2XBIA 2JL4A 2C0FA 3HVSA 1PN9A 2X8HA 3ZLPA 1SKSB 3ZIVA 3D5JA 3QFBC 2RIIA 1GSDA 2GSRA 5AIXA 1YZXA 4N0ZA 5ELGA 1A2MA 1A2LA 1A0FA 1R7HA 9GSSA 3APQA 1PKWA 2EC4A 4V2LA 1GSYA 2JZTA 2IJYA 4K0GA 4KA0A 1THXA 1ZOFA 2H1BA 2R4VA 3LJRA 4H86A 3UAPA 4NV5A 1OC3A 4IP6A 2L57A 4JRRA 3HVVA 1K0DA 2EIQA 4EL1A 3QMXA 1J08A 2B5XA 1XWBA 4HQSA 3M0FA 3FR3A 1XPVA 4FH8A 2V32A 2OE1A 4OO4A 4X1UA 5H5QA 1VF3A 1T3BA 5INYA 1AQWA 5CO3A 3KXOA 4EDYA 2MBSA 5DQYA 4DSRA 3VPQA 4GSSA 2PMTA 1JZDA 2JSYA 3UJ1A 2B7JA 2ZNMA 1F6MC 5CRGA 3CSHA 2PWJA 1U88A 4IELA 6GSSA 2PGTA 3ED3A 3VI7A 3DWVA 2FA8A 3FKFA 1Z6NA 3CSJA 4KUNA 2JACA 3C7MA 2LKUA 1HYUA 1Z6MA 1GUMA 2VIMA 4TRXA 1N8JA 4MLYA 1WIKA 2DSAA 5G5FA 4GCIA 2EIOA 1ABAA 1Q98A 2AJQB 3EURA 3KTLA 3H4KA 5COHA 4OCFA 5H5RA 3DEXA 2PUKC 1MEKA 4V2NA 2PBJA 4L0WA 2VLTA 3ME7A 4TR0A 3US3A 2GQLA 1OVNA 1TRUA 3EE2A 5DBQA 1XFLA 4MH2A 3QFAC 3UARA 2MMAA 3GTUA 3LYPA 3HD5A 2M46A 3Q74A 3UVTA 2H30A 3ZTLA 1G0TA 5DALB 1XW5A 5B6NA 2KOKA 1JHBA 1TOFA 2KLXA 5KN1A 3CRUA 3RHCA 5KN3A 5GAND 1WE0A 2A4VA 3Q19A 2WRTA 1TK0B 1XWCA 3UVHA 4FO5A 4KDUA 2H71A 1BX9A 1V9WA 2B5EA 2VUPA 2K8SA 4IBPA 2KUCA 5D73A 3MNGA 2YANA 1PD21 1H75A 2HI7A 2DIZA 3IHQA 1X9SB 4NHZA 5D8IA 5DALA 3ERWA 1SK1A 2F8FA 3TKSE 1MD4A 2C0DA 4MABA 2J23A 3LWAA 3PH9A 5J41A 5DAKB 3F4SA 3U5RE 3ZVJA 4MZWA 1FO5A 1XOAA 4K1FA 4WR5A 4I5QA 3BBYA 3DKSA 3BD2A 5IO2A 2DJ1A 5ECSA 4MF5A 3G7JA 1OYJA 2H74A 3DXBA 4ZL8A 3VI5A 6GSWA 1UC7A 1MDJA 5LCZA 4IW9A 5IO0A 2HXKA 2O85A 3ZIJA 4PNGA 1PX6A 3G9BA 2FUG2 1X5EA 5GSTA 1HNCA 4F9ZA 2CVBA 2R5GA 1HNAA 1Y6EA 1NSWA 2VCVA 2H66A 5H5SA 2EIRA 1SU9A 1KEBA 4EXJA 1SJZA 5JWQB 1PRXA 2ZUPA 3DIEA 1GRXA 3RBTA 2VL3A 2C4JA 2YNXA 1WP0A 1TP9A 4GLTA 3D0ZA 2I4AA 1V98A 3BCIA 2CAQA 4ECBA 3I9V2 4V1Ag 1A8LA 3TB2A 1N2AA 1RW1A 3WGEA 5CRWA 4TW5A 1PQNA 4MA9A 2GSQA 4ZL9A 2PU9C 12GSA 2B6MA 2YWMA 4N0VA 1USBA 5ECRB 2IL3A 2GT5A 3F9UA 3MSZA 2P5RA 1GTBA 5JWRB 2OKAA 4JR6A 4GF0A 1C72A 2C3TA 2Z9SA 4O92A 2ZCTA 1I5GA 4KAEA 1SKRB 4JZQA 4K7NA 2X8GA 5CNWA 2CV4A 1X0RA 4HDEA 5CREA 2C0GA 5AIVA 1VGLA 2IPAA 1QK8A 3C71A 3ZREA 2HZEB 4ZBAA 1GNWA 5F07A 1ZMAA 2D2ZA 4I2UA 19GSA 1A0RP 2FWHA 5CRDA 4PGTA 1EP7A 4HZ4A 2VLUA 4ZB8A 3GURA 3LQ7A 3KEBA 5IMDA 2VL9A 4HI7A 5KN0A 4K7OA 4WR4A 5AISA 2VCZA 5IMFA 3EMPA 5DJLA 2HZEA 2B3SA 2VM1A 3L9SA 3GH9A 4HU9A 2OJLA 2WCIA 3W6GA 5FHIA 3DRNA 3GIXA 4MCUA 4TR4A 4X43A 3P8WA 3CXGA 2GSTA 3KJYA 2CVKA 2L4CA 4XS6A 4ID0A 3TJKA 4WKWA 1U3AA 3RAZA 1O6JA 3F3RA 2OE0A 2WS2A 2I81A 3EU4A 3RHBA 4HU7A 5ECHB 1MD3A 1W4VA 4MK3A 2E0QA 2J9HA 5CP1A 3PR8A 4G19A 1EV4A 1K0BA 2H6YA 1FHEA 2XPEA 1X9MB 1EGOA 5IMVA 2A2SA 5D93A 1Z5YE 2HNLA 1R5AA 1V57A 2L5OA 1PX7A 1OE8A 5KN2A 2AV4A 1K0CA 1K3OA 1OKDA 2KP2A 18GSA 1J0FA 3BJ5A 3M1GA 3GKNA 1A23A 5F06A 3TUEA 4CW9A 3FZ9A 3H8QA 5D96A 2VL2C 2PPTA 3LYKA 2X8CA 5IQYA 3R2QA 5FWGA 2C80A 2O89A 3M9KA 4KCEA 4KCAA 3QAGA 2VCWA 6GSYA 3FRCA 1HQOA 4JBBA 3A2WA 3HYPA 4MF7A 5LNKe 4IP1A 5ID2A 1K0MA 1JZRA 3UMAA 1T8EB 4LMVA 1B9YC 1GLPA 2RUFA 4IVFA 4G9HA 1GP1A 4ILFA 2BMXA 3FEUA 3GA4A 4MMMA 5D9TA 2HSHA 1URMA 4DSSB 4ECCA 1IYIA 1AXDA 2ES7A 3VK9A 2BJXA 1G6WA 2P31A 5HR2A 1H4OA 5IM9A 4F0CA 3LEFA 1O73A 4O32A 2AAWA 3TRQA 4IJIA 2LQOA 3KP8A 1GTUA 1GTIA 4HUAA 3FW2A 5EL8A 2DJKA 3VWUA 2GQMA 4DSSA 4BA7A 3GFKA 2C3QA 2IMFA 2H0HA 2QC7A 4WBJA 1TJDA 5JCGA 4GXZA 1AIUA 1GSQA 1V40A 3L78A 3F4TA 3ZRDA 3E0UA 3MWHA 5ECIB 4MDCA 1EZKA 1FVJA 2LJAA 4QL9A 2C3NA 3L4NA 2CX4A 5CYYA 3F63A 2A2RA 3KMOA 4I8BA 1EEMA 5AGYA 3C1SA 2DMMA 5JWOB 1SD9A 2JADA 3HVXA 2NPBA 1ILOA 3ZFBA 3F6DA 5ELAA 3N5OA 2K8VA 5CRHA 4KGIA 4N10A 3V1WA 2GZZA 5ECLB 1T4YA 3TRXA 1B4QA 1TRSA 1F37A 1YKCA 5A4UA 2LRNA 3IBHA 1GUHA 1T1VA 5AN1A 5DJMA 5HFKA 3W8JA 1WMJA 5G5EA 4PX1A 1UN2A 1XOBA 2QKEA 1PSQA 3S9FA 1W89A 3KH7A 2VCQA 4D73B 2JSZA 1SL0B 1Z9HA 3GH6A 4AJ6A 5J9BA 4MZBA 3LORA 1G7OA 1TK5B 4G2EA 4MP4A 1GSSA 22GSA 3WYWA 3GX8A 4PURA 2YPMA 1S3DA 2FY6A 3ERGA 3RPPA 1DBYA 2MZCA 2YZUA 4DVCA 1SD8A 3TKRA 3LXTA 2B1KA 1LJRA 4PUAA 4YAVA 4K9ZA 3PGTA 5B7CA 2F9SA 2LQQA 2YOIA 2H01A 2WULA 2VOCA 4YQVA 4XIHA 3LSZA 5ECNB 1K0NA 1TRVA 2NVLA 1TKDB 2LTKA 5GAPD 5J9CA 1ERVA 2CT6A 2H19A 3TKPA 5ENUA 3KGKA 4J57E 4V1Ap 2DIYA 4HS1A 2MYGA 3G7IA 3F6FA 1EOGA 5HFGA 1QXHA 3I43A 2I1UA 1G7EA 1DE1A 1NHOA 6GSUA 3GL3A 4F0BA 3QOUA 3UL3A 5IMZA 3IXRA 17GSA 3F0IA 1T7PB 4AGSA 4JU5A 5G2ZA 2VD1A 5EPFA 2K6VA 1TK8B 3EWLA 2KHPA 2YJ7A 2VCTA 1TTZA 3Q18A 1EEJA 4IJ3A 2LV3A 3K8NA 3IA1A 3P90A 4BPYA 1ERWA 3KM6A 4ZL7A 4Z7XA 4ZBDA 2H70A 3EU3A 13GSA 1M9BA 3FZ5A 2N5BA 1O8WA 3UBKA 1RQMA 2YN1A 1TW9A 4KNDA 4PNFA 3TDGA 4EVMA 2WJUA 2OADA 2LJKA 3VPTA 5DAKA 2FWGA 4MPGA 2LNSA 4NXIA 4LLRA 5HQPA 1SK2A 3HCZA 1YF0A 3IK7A 2VD0A 5J3RA 2F8AA 1GULA 2FD3A 1BQ7A 3IRAA 1XWKA 1OC9B 3NZNA 4TXOB 1M7TA 2HYXA 1XIYA 2QGVA 3ZFLA 2PVQA 1Z7RA 4FYUA 1F2EA 2PN8A 2GZYA 4TN8A 1YKAA 1X9WB 4F03A 1M0UA 3GSTA 3RDWA 2DC5A 5E4WA 3E3EA 3J7Yk 2TIRA 2PERA 1AC1A 3APSA 5DQSA 1XWAA 4POLA 3F8UA 3UOMA 2ON5A 4TVEA 2AHEA 2N5FA 4L5OA 4V2MA 2IMDA 3VWVA 4LL4B 3A2VA 3HJOA 3J7Yb 1J9BA 4IN0A 11GSA 5HFIA 2V1MA 3HZ4A 4RI7A 4TXOA 2XHFA 4HJMA 1F3AA 2FCHA 2IMKA 1SKWB 4IQ1A 3KIJA 1TXXA 2RM6A 3CTFA 4AF2A 1UA5A 4NHWA 2YCDA 3GX0A 3UIWA 1SYRA 2IFQB 3TKSA 1PGTA 2LUSA 4ML6A 4KW6A 1M9AA 4EUYA 4IHUA 4HOJA 4KB3A 4LA1A 3GKKA 1K0AA 4BVXA 1FAAA 1A2JA 3ZVJD 3TGZA 1XW9A 5B6MA 3EMXA 2LRTA 4LMWA 4FIWA 1EP8A 3WGXA 2V6KA 1ERUA 3LG6A 2NDOA 5B8AA 1X5DA 5FT3A 3A5WA 2K9FA 5ECMB 1VF4A 1GH2A 1YEPA 2GVPA 1O81A 1WPIA 3GN3A 4HQZA 1SL1B 2B7KA 1OAZA 4G10A 5CAXA 4TR3A 2ALBA 2X64A 3DGQA 1PKZA 4XRDA 4EKZA 4TKYA 3KTBA 3EC3A 2MMZA 5DDLA 8GSSA 4TOPA 5D9WA 3QD9A 4K7IA 1ACVA 1JLWA 1ZYEA 5A4WA 4MJCA 1VF2A 2HLSA 1VRSD 5J4UA 4JR4A 5E59A 1ZZYA 4GQFA 4OFNA 3RPNA 4F2IA 4YQUA 4AJ8A 3QAVA 2DJ3A 3HXSA 1EWXA 3QAWA 4NPBA 2R3XA 3ZMLA 3DVWA 4BWQA
chains in the Genus database with same CATH superfamily
3HKRA 2P5QA 4OWYA 1XVWA 2FWFA 1IYHA 4O7HA 3C73A 2IN3A 1JLVA 2HSMA 2NBSA 1YDKA 2HRNA 3BOAA 16GSA 2XBQA 3O76A 1HNBA 2FLSA 3ZZXA 3IR4A 3TJGA 4Z2UA 1ZGNA 4OO5A 2GLRA 2GDRA 1HD2A 4Q5QA 1QUWA 2MMNA 2OACA 5J5NA 3C8EA 4FYCA 2WB9A 3IPZA 4G0LA 3D4TA 1YEXA 3FZAA 1FG4A 1GSEA 3WT2A 1KNGA 4K0NA 4TXVA 4OD7A 2FGXA 1MDIA 1FW1A 3E9JB 4O5QA 2H75A 3DMLA 2G2QA 5IMAA 2FA4A 4KX4A 3IV4A 3GRXA 5ECKB 3ZITA 4I97A 1M3IA 3VFIA 2CZ3A 1S3CA 1SENA 4GWRA 2C8UA 2VAFA 4WF4A 2HZFA 3FMWA 1WRYA 2KP1A 4ML1A 3FR9A 3A3TA 3CMIA 1EGRA 5B8BA 3GMFA 4MZCA 5D9XA 1PMTA 1R26A 1XCCA 4GQCA 2DJ2A 3CSIA 2REMA 4OFTA 4ACSA 1JFUA 2B5YA 1OKTA 1R5PA 5EY6A 1XBSA 2E2MA 2B1LA 4G0KA 2H6XA 4K2DA 5HR1A 3F3QA 3HY2A 3FK8A 4N30A 2E7PA 2QSIA 2DJ0A 1M2DA 5A5KA 2I9HA 1Q4JA 3MDKA 2H1AA 4KDXA 2RLIA 2YWOA 1EV9A 2LRCA 4GSNA 2E2GA 3ZL5A 4OCEA 3GL5A 2VO4A 4ZIJA 4ZXGA 3GSSA 3H1NA 3CBUA 4HZ2A 3ZYWA 2LNTA 3DYRA 4ECJA 5BRTA 3CYNA 2YV9A 4CY6A 4POKA 2NTOA 1LBKA 4HEA2 4MPFA 1X5CA 3WT1A 2WZ9A 4K8MA 2K18A 4YQMA 1B4PA 4HJ2A 3WD6A 1O7UA 3F4RA 3ME8A 1YY7A 4F82A 3SWLA 5F8BA 1GNEA 1ST9A 1KBNA 1PL1A 4IS0A 1O8XA 3DVXA 3P2AA 1TDIA 3FR6A 5A4VA 5IIZA 4NWYA 5LD0A 3FZ4A 6GSXA 4XRAA 2C1YA 2LJRA 3O6TA 2H72A 3BCKA 2XPDA 4DEJA 2IMIA 1F3BA 1BJXA 1XG8A 3W8SA 2V41A 1CQHA 4X4JA 4L5LA 3QR6A 4CDOA 3IDVA 2WDUA 1GUKA 3PINA 3GTUB 1Y25A 3ERFA 1E6BA 4QQ7A 3KZQA 2DBCA 4XTSA 4BWSA 2L5LA 1ZYPA 2O8VB 1SK0A 1DE2A 4D73A 3EVIA 2LEGA 3VURA 3IAM2 4TR1B 1O85A 2H76A 4PXOA 1K0OA 1TRWA 2R6KA 3KH9A 1B8XA 4BL7B 3WGDA 4BIKA 3CRTA 5ABRA 4EE0A 1AAZA 2V6OA 4XS1A 4GTUA 3KMNA 4PUFC 2GZPA 4RI6A 3LXZA 3H93A 3QDNA 1FVKA 1YQ1A 2MMOA 1ON4A 2CVDA 3HJMA 3C1RA 2YWNA 4XS4B 2TRXA 3QCPA 2HFDA 3TJFA 5G30A 4MJEA 1SJIA 4GSTA 4TR1A 4PQ1A 1NM3A 1VF1A 1Z7PA 4BL7A 1XXUA 5DCHA 4YAPA 2VLVA 2X49A 1FB0A 2F51A 1XWGA 2O87A 4ECIA 3IE3A 3U6VA 5ECQB 1B48A 1THOA 3D21A 2R0PA 4QL7A 4MH3A 5C04A 4XS4A 1AQXA 2OBKA 5IPHA 2PVOC 3TJJA 4IGJA 3I69A 3SBCA 5IPGA 3L9UA 4WXTA 3IC4A 1ERTA 4EC0A 2V2GA 2CX3A 2X99A 2TRCP 2M80A 2F3MA 1GL8A 1A8YA 2YWIA 2HE3A 1QGVA 2WFCA 1Z3EA 5G1KA 1JZWA 4O5RA 2DJJA 1U6TA 2H0GA 2VL2A 3EYTA 5G31A 3LFLA 1DUGA 4ISDA 2H0IA 2JZRA 1AW9A 3TKQA 4EDZA 5C00A 2H73A 2GGTA 3L9VA 2GSSA 4PQIA 1ML6A 2FHEA 2HSYA 3GKXA 4FYBA 5KOWA 3D6IA 4WF5A 4CHSA 2AUVA 3QPMA 10GSA 1OE7A 2IWTA 2YZHA 4JE1A 1E2YA 4K5SA 1GSUA 1TI3A 2VM2A 1TU7A 2G0FA 2P0GA 1G6YA 2H6ZA 3DD3A 4RUVA 4ULXA 2CAIA 2GT6A 3EPTA 1OC9A 4NMUA 3I6AA 2DMLA 1PA3A 1GWCA 4POBA 2LS5A 3TOUA 1F9MA 3GKMA 1EOHA 1SL2B 4J56E 4USSA 2M72A 4KH7A 3D22A 2R37A 4WETA 2R2JA 3NOFA 5GZZB 3OR5A 3VLNA 4JEDA 2MBTA 2L6DA 4EO3A 1T4ZA 5F05A 4ZILA 5HR3A 1GLQA 2RUEA 3N9JA 1BG5A 1MTCA 3GUSA 1XZOA 2XC2A 3IK9A 3TOTA 3FHKA 1MDKA 2AB6A 4XHMA 2AYTA 3Q6OA 4BVYA 1YJ6A 2IFQA 1U3IA 5KOXA 4Q5NA 2C0EA 3ISOA 5KEJA 4ZB6A 4KDYA 1A24A 2CA8A 4I6XA 1T00A 3M9JA 1S3AA 3M8NA 1PL2A 1GSFA 4LL1B 4K2XA 5F0GA 3FY7A 7GSSA 4I2TA 3H79A 1XVQA 5IOXA 3HJPA 3HDCA 2JU5A 3GYKA 2OE3A 4KSMA 2N5AA 1NHYA 2L59A 1ZL9A 1LU4A 1AQVA 1V2AA 5DVBA 5ECPB 2IMEA 3CTGA 3HZ8A 4IKHA 4X0XA 3IHGA 1QMVA 2H1GA 4K6XA 2CQ9A 3GHAA 4AJ7A 2HT9A 2JZSA 2L6CA 3HHVA 4POMA 2YJHA 3P7XA 1ZYQB 1I9DA 5JCWA 4ZB9A 3D4MA 4NAXA 1M2AA 2RM5A 4XCSA 3FYGA 2FNOA 3APOA 3HA9A 4J2FA 4NV2A 4DSQA 3M3MA 4YH2A 1M2BA 2GQKA 3JCML 3VWXA 2L4QA 5GSSA 1WOUA 5L71A 3IOSA 4KE3A 4WBRD 5JCUA 5IOWA 5ID2B 2ON7A 1K3YA 2BTOT 4ZBBA 1BEDA 1NW2A 2DLXA 3A2XA 5EVOA 1DSBA 1SJ6A 2CZ2A 1QFNA 4RQRA 1BAYA 4N11A 3G7YA 6GSVA 2OA7A 3ZMKA 4PQHA 3L0HA 1BYEA 5HR0A 2O7KA 5D9VA 1XW6A 3UEMA 4WEYA 2H8LA 1WJKA 1U87A 3KCMA 3NIVA 3TJBA 4E8HA 4E8EA 3MAKA 4IQAA 2LSTA 1CQGA 2YP6A 2H1DA 1V58A 3GNJA 1R4WA 4KSOA 4L0UA 4RQXA 2HRFA 4MJBA 3KP9A 1K3LA 1FB6A 1JZOA 4P3YB 5IMCA 3GV1A 3KD0A 4Q5FA 1OC8A 2X4AA 3LGCA 4Q5RA 3TRPA 2OBIA 2VCXA 2WGRA 1FOVA 5ECOB 4MF6A 3UBLA 14GSA 4OMVA 3VWWA 1RK4A 1ZCPA 2GS3A 3EINA 4EF0A 2FWEA 2IIYA 1AUCA 1YF1A 1KTEA 1B9XC 20GSA 1M99A 1TU8A 2I3YA 3O3TA 1UVZA 1SYXA 4OFMA 3TKSC 2YV7A 2A2PA 1FOHA 4L8EA 2GTUA 5DCGA 6GSTA 4MJAA 3AY8A 3IAS2 1M3JA 5G1LA 1WWJA 3TCOA 1GTAA 1QQ2A 1TI1A 4G0IA 4GRFA 2XBIA 2JL4A 2C0FA 3HVSA 1PN9A 2X8HA 3ZLPA 1SKSB 3ZIVA 3D5JA 3QFBC 2RIIA 1GSDA 2GSRA 5AIXA 1YZXA 4N0ZA 5ELGA 1A2MA 1A2LA 1A0FA 1R7HA 9GSSA 3APQA 1PKWA 2EC4A 4V2LA 1GSYA 2JZTA 2IJYA 4K0GA 4KA0A 1THXA 1ZOFA 2H1BA 2R4VA 3LJRA 4H86A 3UAPA 4NV5A 1OC3A 4IP6A 2L57A 1PN0A 4JRRA 3HVVA 1K0DA 2EIQA 3R3EA 4EL1A 3QMXA 1J08A 2B5XA 1XWBA 4HQSA 3M0FA 3FR3A 1XPVA 4FH8A 2V32A 2OE1A 4OO4A 4X1UA 5H5QA 1VF3A 1T3BA 5INYA 1AQWA 5CO3A 3KXOA 4EDYA 2MBSA 5DQYA 4DSRA 3VPQA 4GSSA 2PMTA 1JZDA 2JSYA 3UJ1A 2B7JA 2ZNMA 1F6MC 5CRGA 3CSHA 2PWJA 1U88A 4IELA 6GSSA 2PGTA 3ED3A 3VI7A 3DWVA 2FA8A 3FKFA 1Z6NA 3CSJA 4KUNA 2JACA 3C7MA 2LKUA 1HYUA 1Z6MA 1GUMA 2VIMA 4TRXA 4FQUA 1N8JA 4MLYA 1WIKA 2DSAA 5G5FA 4GCIA 4CY8A 4PTSA 2EIOA 1ABAA 1Q98A 2AJQB 3EURA 3KTLA 3H4KA 5COHA 4OCFA 5H5RA 3DEXA 2PUKC 1MEKA 4V2NA 2PBJA 4L0WA 2VLTA 3ME7A 4TR0A 3US3A 4KF9A 2GQLA 1OVNA 1TRUA 3EE2A 5DBQA 1XFLA 4MH2A 3QFAC 3UARA 3MIXA 2MMAA 3GTUA 3LYPA 3HD5A 2M46A 3Q74A 3UVTA 2H30A 4O5UA 3ZTLA 1G0TA 5DALB 1XW5A 5B6NA 2KOKA 4MNNA 1JHBA 1TOFA 2KLXA 5KN1A 3CRUA 3RHCA 5KN3A 5GAND 1WE0A 2A4VA 3Q19A 2WRTA 1TK0B 1XWCA 3UVHA 4FO5A 4KDUA 2H71A 1BX9A 1V9WA 2B5EA 2VUPA 2K8SA 4IBPA 2KUCA 5D73A 3MNGA 2YANA 1PD21 1H75A 2HI7A 2DIZA 3IHQA 1X9SB 4NHZA 5D8IA 5DALA 3ERWA 1SK1A 2F8FA 3TKSE 1MD4A 2C0DA 2DKHA 4MABA 2J23A 3LWAA 3PH9A 5J41A 5DAKB 3F4SA 3U5RE 3ZVJA 4MZWA 1FO5A 1XOAA 4K1FA 4WR5A 4I5QA 3BBYA 3DKSA 3BD2A 5IO2A 2DJ1A 5ECSA 4MF5A 3G7JA 1OYJA 2H74A 3DXBA 4ZL8A 3VI5A 6GSWA 1UC7A 1MDJA 5LCZA 4IW9A 5IO0A 2HXKA 2O85A 3ZIJA 4PNGA 1PX6A 3G9BA 2FUG2 1X5EA 5GSTA 1HNCA 4F9ZA 2CVBA 2R5GA 1HNAA 1Y6EA 1NSWA 2VCVA 2H66A 5H5SA 2EIRA 1SU9A 1KEBA 4EXJA 1SJZA 5JWQB 1PRXA 2ZUPA 3DIEA 1GRXA 3RBTA 2VL3A 2C4JA 2YNXA 1WP0A 1TP9A 4GLTA 3D0ZA 2I4AA 1V98A 3BCIA 2CAQA 4Z2TA 4ECBA 3I9V2 4V1Ag 1A8LA 3TB2A 1N2AA 1RW1A 2HRKA 3WGEA 5CRWA 4TW5A 4BVXB 1PQNA 4MA9A 2GSQA 5BMUA 4ZL9A 2PU9C 12GSA 2B6MA 2HRAA 2YWMA 4N0VA 1USBA 5ECRB 2IL3A 2GT5A 3F9UA 3MSZA 2P5RA 1GTBA 5JWRB 2OKAA 4JR6A 4GF0A 1C72A 2C3TA 2Z9SA 4O92A 2ZCTA 1I5GA 4KAEA 1SKRB 4JZQA 4K7NA 2X8GA 5CNWA 2CV4A 1X0RA 4HDEA 5CREA 2C0GA 5AIVA 4Z2RA 1S3RA 1VGLA 2IPAA 1QK8A 3C71A 3ZREA 2HZEB 4ZBAA 1GNWA 5F07A 1ZMAA 2QA2A 2D2ZA 4I2UA 19GSA 1A0RP 2FWHA 5CRDA 4PGTA 1EP7A 4HZ4A 2VLUA 4ZB8A 3GURA 3LQ7A 3KEBA 5IMDA 2VL9A 4HI7A 5KN0A 4K7OA 4WR4A 5AISA 2VCZA 5IMFA 3EMPA 5DJLA 2HZEA 2B3SA 2VM1A 3L9SA 3GH9A 4HU9A 2OJLA 2WCIA 3W6GA 5FHIA 3DRNA 3GIXA 4MCUA 4TR4A 4X43A 3P8WA 3CXGA 2GSTA 3KJYA 2CVKA 2L4CA 4XS6A 4ID0A 3TJKA 4WKWA 1U3AA 3RAZA 1O6JA 3F3RA 2OE0A 2WS2A 2I81A 3EU4A 3RHBA 4HU7A 5ECHB 1MD3A 1W4VA 4MK3A 2E0QA 2J9HA 5CP1A 3PR8A 3CQFA 4G19A 1EV4A 1K0BA 2H6YA 1FHEA 2XPEA 1X9MB 1EGOA 5IMVA 2A2SA 5D93A 1Z5YE 2HNLA 1R5AA 1V57A 2L5OA 1PX7A 1OE8A 5KN2A 2AV4A 1K0CA 1K3OA 1OKDA 2KP2A 18GSA 1J0FA 2QA1A 3BJ5A 3M1GA 3GKNA 1A23A 5F06A 3TUEA 4K5RA 4CW9A 3FZ9A 3H8QA 5D96A 2VL2C 2PPTA 3LYKA 2X8CA 5IQYA 3R2QA 5FWGA 2C80A 2O89A 3M9KA 4KCEA 4KCAA 3QAGA 2VCWA 6GSYA 3FRCA 1HQOA 4JBBA 3A2WA 3HYPA 4MF7A 5LNKe 4IP1A 5ID2A 1K0MA 1JZRA 3UMAA 1T8EB 4LMVA 1B9YC 1GLPA 2RUFA 4IVFA 4G9HA 1GP1A 4ILFA 2BMXA 3FEUA 3GA4A 4MMMA 5D9TA 2HSHA 1URMA 4DSSB 4ECCA 1IYIA 1AXDA 2ES7A 3VK9A 1PFOA 2BJXA 1G6WA 4HSCX 2P31A 5HR2A 1H4OA 5IM9A 3HVNA 4F0CA 3LEFA 1O73A 4O32A 2AAWA 3TRQA 4IJIA 2LQOA 3KP8A 1GTUA 1GTIA 4HUAA 3FW2A 5EL8A 2DJKA 3VWUA 2GQMA 4DSSA 4BA7A 3GFKA 2C3QA 2IMFA 2H0HA 2QC7A 4WBJA 1TJDA 5JCGA 4GXZA 1AIUA 1GSQA 1V40A 3L78A 3F4TA 3ZRDA 3E0UA 3MWHA 5ECIB 4MDCA 1EZKA 1FVJA 2LJAA 4QL9A 2C3NA 3L4NA 2CX4A 5CYYA 3F63A 2A2RA 3KMOA 4I8BA 1EEMA 4EIPA 5AGYA 3C1SA 2DMMA 5JWOB 1SD9A 2JADA 3HVXA 2NPBA 1ILOA 3ZFBA 3F6DA 5ELAA 3N5OA 2K8VA 5CRHA 4KGIA 4N10A 3V1WA 2GZZA 5ECLB 1T4YA 3TRXA 1B4QA 1TRSA 1F37A 1YKCA 5A4UA 2LRNA 3IBHA 1GUHA 1T1VA 5AN1A 5DJMA 5HFKA 3W8JA 1WMJA 5G5EA 4PX1A 1UN2A 1XOBA 2QKEA 1PSQA 3S9FA 1W89A 3KH7A 2VCQA 4D73B 2JSZA 1SL0B 1Z9HA 3GH6A 4AJ6A 5J9BA 4MZBA 4YKFA 3LORA 1G7OA 1TK5B 4G2EA 4MP4A 3MYDA 1GSSA 22GSA 3WYWA 3GX8A 4PURA 4EIQA 2YPMA 1S3DA 2FY6A 3ERGA 3LW9A 3RPPA 1DBYA 2MZCA 2YZUA 4DVCA 1SD8A 3TKRA 3LXTA 2B1KA 1LJRA 4PUAA 4YAVA 4K9ZA 3PGTA 5B7CA 2F9SA 2LQQA 2YOIA 2H01A 2WULA 2VOCA 4YQVA 4XIHA 3LSZA 5ECNB 1K0NA 1TRVA 4A5PA 2NVLA 1TKDB 2LTKA 5GAPD 5J9CA 1ERVA 2CT6A 2H19A 3TKPA 2R0CA 5ENUA 3KGKA 4J57E 4V1Ap 2DIYA 4HS1A 2MYGA 3G7IA 3F6FA 1EOGA 5HFGA 1QXHA 2A4HA 3I43A 2I1UA 1G7EA 1DE1A 1NHOA 6GSUA 3GL3A 4F0BA 3QOUA 3UL3A 5IMZA 3IXRA 17GSA 3F0IA 1T7PB 4AGSA 4JU5A 5G2ZA 2VD1A 5EPFA 2K6VA 1TK8B 3EWLA 2KHPA 2YJ7A 2VCTA 1TTZA 3Q18A 3IC8A 1EEJA 4IJ3A 2LV3A 3K8NA 3IA1A 3P90A 4BPYA 1ERWA 3KM6A 4ZL7A 4Z7XA 4ZBDA 2H70A 3EU3A 13GSA 1M9BA 3FZ5A 2N5BA 1O8WA 3UBKA 1RQMA 2YN1A 1TW9A 4KNDA 4PNFA 3TDGA 4EVMA 2WJUA 2OADA 2LJKA 3VPTA 5DAKA 2FWGA 4MPGA 2LNSA 4NXIA 2DKIA 4LLRA 5HQPA 1SK2A 3HCZA 1YF0A 3IK7A 2VD0A 5J3RA 2F8AA 1GULA 1ZYNA 2FD3A 1BQ7A 3IRAA 1XWKA 1OC9B 3NZNA 4TXOB 1M7TA 3PPUA 2HYXA 1XIYA 2QGVA 3ZFLA 2PVQA 1Z7RA 4FYUA 1F2EA 2PN8A 2GZYA 4TN8A 1YKAA 1X9WB 4F03A 1M0UA 3GSTA 3RDWA 2DC5A 5E4WA 3E3EA 3J7Yk 2TIRA 2PERA 1AC1A 3APSA 5DQSA 1XWAA 4POLA 3F8UA 3UOMA 2ON5A 4TVEA 2AHEA 2N5FA 4L5OA 4V2MA 2IMDA 3VWVA 4LL4B 3A2VA 3HJOA 3J7Yb 1J9BA 4IN0A 11GSA 5HFIA 2V1MA 3HZ4A 4RI7A 4TXOA 2XHFA 4HJMA 1F3AA 2FCHA 2IMKA 1SKWB 4IQ1A 4ICYA 3KIJA 1TXXA 2RM6A 3CTFA 4AF2A 4BVYB 1UA5A 4NHWA 2YCDA 3GX0A 3UIWA 1SYRA 2IFQB 3TKSA 1PGTA 2LUSA 4ML6A 4KW6A 1M9AA 4YKGA 4EUYA 4IHUA 4HOJA 2R0GA 4KB3A 4LA1A 3GKKA 1K0AA 4BVXA 1FAAA 1A2JA 3ZVJD 3TGZA 1XW9A 5B6MA 3EMXA 2UZ8A 2LRTA 4LMWA 4FIWA 1EP8A 3A5IA 3WGXA 2V6KA 1ERUA 3LG6A 2NDOA 5B8AA 1X5DA 5FT3A 3A5WA 2K9FA 5ECMB 1VF4A 1GH2A 1YEPA 2GVPA 1O81A 1WPIA 3GN3A 4HQZA 1SL1B 2B7KA 1OAZA 4G10A 5CAXA 4TR3A 2ALBA 2X64A 3DGQA 1PKZA 4XRDA 4EKZA 4TKYA 3KTBA 3EC3A 2MMZA 5DDLA 8GSSA 4TOPA 5D9WA 3QD9A 4K7IA 1ACVA 1JLWA 1ZYEA 5A4WA 4MJCA 1VF2A 2HLSA 1VRSD 5J4UA 4JR4A 5E59A 1ZZYA 4GQFA 4OFNA 3RPNA 4F2IA 4YQUA 4AJ8A 3QAVA 2DJ3A 3HXSA 1EWXA 3QAWA 4NPBA 2R3XA 3ZMLA 3DVWA 4BWQA
chains in the Genus database with same CATH topology
3HKRA 2P5QA 4OWYA 1XVWA 2FWFA 1IYHA 4O7HA 3C73A 2IN3A 1JLVA 2HSMA 2NBSA 1YDKA 2HRNA 3BOAA 16GSA 2XBQA 3O76A 1HNBA 2FLSA 3ZZXA 3IR4A 3TJGA 4Z2UA 1ZGNA 4OO5A 2GLRA 2GDRA 1HD2A 4Q5QA 1QUWA 2MMNA 2OACA 5J5NA 3C8EA 4FYCA 2WB9A 3IPZA 4G0LA 3D4TA 1YEXA 3FZAA 1FG4A 1GSEA 3WT2A 1KNGA 4K0NA 4TXVA 4OD7A 2FGXA 1MDIA 1FW1A 3E9JB 4O5QA 2H75A 3DMLA 2G2QA 5IMAA 2FA4A 4KX4A 3IV4A 3GRXA 5ECKB 3ZITA 4I97A 3VFIA 2CZ3A 1S3CA 1SENA 4GWRA 2C8UA 2VAFA 4WF4A 2HZFA 3FMWA 1WRYA 2KP1A 4ML1A 3FR9A 3A3TA 3CMIA 1EGRA 5B8BA 3GMFA 4MZCA 5D9XA 1PMTA 1R26A 1XCCA 4GQCA 2DJ2A 3CSIA 2REMA 4OFTA 4ACSA 1JFUA 2B5YA 1OKTA 1R5PA 5EY6A 1XBSA 2E2MA 2B1LA 4G0KA 2H6XA 4K2DA 5HR1A 3F3QA 3HY2A 3FK8A 4N30A 2E7PA 2QSIA 2DJ0A 1M2DA 5A5KA 2I9HA 1Q4JA 3MDKA 2H1AA 4KDXA 2RLIA 2YWOA 1EV9A 2LRCA 4GSNA 2E2GA 3ZL5A 4OCEA 3GL5A 2VO4A 4ZIJA 4ZXGA 3GSSA 3H1NA 3CBUA 4HZ2A 3ZYWA 2LNTA 3DYRA 4ECJA 5BRTA 3CYNA 2YV9A 4CY6A 4POKA 2NTOA 1LBKA 4HEA2 4MPFA 1X5CA 3WT1A 2WZ9A 4K8MA 2K18A 4YQMA 1B4PA 4HJ2A 3WD6A 1O7UA 3F4RA 3ME8A 1YY7A 4F82A 3SWLA 5F8BA 1GNEA 1ST9A 1KBNA 1PL1A 4IS0A 1O8XA 3DVXA 3P2AA 1TDIA 3FR6A 5A4VA 5IIZA 4NWYA 5LD0A 3FZ4A 6GSXA 4XRAA 2C1YA 2LJRA 3O6TA 2H72A 3BCKA 2XPDA 4DEJA 2IMIA 1F3BA 1BJXA 3W8SA 2V41A 1CQHA 4X4JA 4L5LA 3QR6A 4CDOA 3IDVA 2WDUA 1GUKA 3PINA 3GTUB 1Y25A 3ERFA 1E6BA 4QQ7A 3KZQA 2DBCA 4XTSA 4BWSA 2L5LA 1ZYPA 2O8VB 1SK0A 1DE2A 4D73A 3EVIA 2LEGA 3VURA 3IAM2 4TR1B 1O85A 2H76A 4PXOA 1K0OA 1TRWA 2R6KA 3KH9A 1B8XA 4BL7B 3WGDA 3CRTA 5ABRA 4EE0A 1AAZA 2V6OA 4XS1A 4GTUA 3KMNA 4PUFC 2GZPA 4RI6A 3LXZA 3H93A 3QDNA 1FVKA 1YQ1A 2MMOA 1ON4A 2CVDA 3HJMA 3C1RA 2YWNA 4XS4B 2TRXA 3QCPA 2HFDA 3TJFA 5G30A 4MJEA 1SJIA 4GSTA 4TR1A 4PQ1A 1NM3A 1VF1A 1Z7PA 4BL7A 1XXUA 5DCHA 4YAPA 2VLVA 2X49A 1FB0A 2F51A 1XWGA 2O87A 4ECIA 3IE3A 3U6VA 5ECQB 1B48A 1THOA 3D21A 2R0PA 4QL7A 4MH3A 5C04A 4XS4A 1AQXA 2OBKA 5IPHA 2PVOC 3TJJA 4IGJA 3I69A 3SBCA 5IPGA 3L9UA 4WXTA 3IC4A 1ERTA 4EC0A 2V2GA 2CX3A 2X99A 2TRCP 2M80A 2F3MA 1GL8A 1A8YA 2YWIA 2HE3A 1QGVA 2WFCA 1Z3EA 5G1KA 1JZWA 4O5RA 2DJJA 1U6TA 2H0GA 2VL2A 3EYTA 5G31A 3LFLA 1DUGA 4ISDA 2H0IA 2JZRA 1AW9A 3TKQA 4EDZA 5C00A 2H73A 2GGTA 3L9VA 2GSSA 4PQIA 1ML6A 2FHEA 2HSYA 3GKXA 4FYBA 5KOWA 3D6IA 4WF5A 4CHSA 2AUVA 3QPMA 10GSA 1OE7A 2IWTA 2YZHA 4JE1A 1E2YA 4K5SA 1GSUA 1TI3A 2VM2A 1TU7A 2G0FA 2P0GA 1G6YA 2H6ZA 3DD3A 4RUVA 4ULXA 2CAIA 2GT6A 3EPTA 1OC9A 4NMUA 3I6AA 2DMLA 1PA3A 1GWCA 4POBA 2LS5A 3TOUA 1F9MA 3GKMA 1EOHA 1SL2B 4J56E 4USSA 2M72A 4KH7A 3D22A 2R37A 4WETA 2R2JA 3NOFA 5GZZB 3OR5A 3VLNA 4JEDA 2MBTA 2L6DA 4EO3A 1T4ZA 5F05A 4ZILA 5HR3A 1GLQA 2RUEA 3N9JA 1BG5A 1MTCA 3GUSA 1XZOA 2XC2A 3IK9A 3TOTA 3FHKA 1MDKA 2AB6A 4XHMA 2AYTA 3Q6OA 4BVYA 1YJ6A 2IFQA 1U3IA 5KOXA 4Q5NA 2C0EA 3ISOA 5KEJA 4ZB6A 4KDYA 1A24A 2CA8A 4I6XA 1T00A 3M9JA 1S3AA 3M8NA 1PL2A 1GSFA 4LL1B 4K2XA 5F0GA 3FY7A 7GSSA 4I2TA 3H79A 1XVQA 5IOXA 3HJPA 3HDCA 2JU5A 3GYKA 2OE3A 4KSMA 2N5AA 1NHYA 2L59A 1ZL9A 1LU4A 1AQVA 1V2AA 5DVBA 5ECPB 2IMEA 3CTGA 3HZ8A 4IKHA 4X0XA 3IHGA 1QMVA 2H1GA 4K6XA 2CQ9A 3GHAA 4AJ7A 2HT9A 2JZSA 2L6CA 3HHVA 4POMA 2YJHA 3P7XA 1ZYQB 1I9DA 5JCWA 4ZB9A 3D4MA 4NAXA 1M2AA 2RM5A 4XCSA 3FYGA 2FNOA 3APOA 3HA9A 4J2FA 4NV2A 4DSQA 3M3MA 4YH2A 1M2BA 2GQKA 3JCML 3VWXA 2L4QA 5GSSA 1WOUA 5L71A 3IOSA 4KE3A 4WBRD 5JCUA 5IOWA 5ID2B 2ON7A 1K3YA 2BTOT 4ZBBA 1BEDA 1NW2A 2DLXA 3A2XA 5EVOA 1DSBA 1SJ6A 2CZ2A 1QFNA 4RQRA 1BAYA 4N11A 3G7YA 6GSVA 2OA7A 3ZMKA 4PQHA 3L0HA 1BYEA 5HR0A 2O7KA 5D9VA 1XW6A 3UEMA 4WEYA 2H8LA 1WJKA 1U87A 3KCMA 3NIVA 3TJBA 4E8HA 4E8EA 3MAKA 4IQAA 2LSTA 1CQGA 2YP6A 2H1DA 1V58A 3GNJA 1R4WA 4KSOA 4L0UA 4RQXA 2HRFA 4MJBA 3KP9A 1K3LA 1FB6A 1JZOA 4P3YB 5IMCA 3GV1A 3KD0A 4Q5FA 1OC8A 2X4AA 3LGCA 4Q5RA 3TRPA 2OBIA 2VCXA 2WGRA 1FOVA 5ECOB 4MF6A 3UBLA 14GSA 4OMVA 3VWWA 1RK4A 1ZCPA 2GS3A 3EINA 4EF0A 2FWEA 2IIYA 1AUCA 1YF1A 1KTEA 1B9XC 20GSA 1M99A 1TU8A 2I3YA 3O3TA 1UVZA 1SYXA 4OFMA 3TKSC 2YV7A 2A2PA 1FOHA 4L8EA 2GTUA 5DCGA 6GSTA 4MJAA 3AY8A 3IAS2 5G1LA 1WWJA 3TCOA 1GTAA 1QQ2A 1TI1A 4G0IA 4GRFA 2XBIA 2JL4A 2C0FA 3HVSA 1PN9A 2X8HA 3ZLPA 1SKSB 3ZIVA 3D5JA 3QFBC 2RIIA 1GSDA 2GSRA 5AIXA 1YZXA 4N0ZA 5ELGA 1A2MA 1A2LA 1A0FA 1R7HA 9GSSA 3APQA 1PKWA 2EC4A 4V2LA 1GSYA 2JZTA 2IJYA 4K0GA 4KA0A 1THXA 1ZOFA 2H1BA 2R4VA 3LJRA 4H86A 3UAPA 4NV5A 1OC3A 4IP6A 2L57A 1PN0A 4JRRA 3HVVA 1K0DA 2EIQA 3R3EA 4EL1A 3QMXA 1J08A 2B5XA 1XWBA 4HQSA 3M0FA 3FR3A 1XPVA 4FH8A 2V32A 2OE1A 4OO4A 4X1UA 5H5QA 1VF3A 1T3BA 5INYA 1AQWA 5CO3A 3KXOA 4EDYA 2MBSA 5DQYA 4DSRA 3VPQA 4GSSA 2PMTA 1JZDA 2JSYA 3UJ1A 2B7JA 2ZNMA 1F6MC 5CRGA 3CSHA 2PWJA 1U88A 4IELA 6GSSA 2PGTA 3ED3A 3VI7A 3DWVA 2FA8A 3FKFA 1Z6NA 3CSJA 4KUNA 2JACA 3C7MA 2LKUA 1HYUA 1Z6MA 1GUMA 2VIMA 4TRXA 4FQUA 1N8JA 4MLYA 1WIKA 2DSAA 5G5FA 4GCIA 4CY8A 4PTSA 2EIOA 1ABAA 1Q98A 2AJQB 3EURA 3KTLA 3H4KA 5COHA 4OCFA 5H5RA 3DEXA 2PUKC 1MEKA 4V2NA 2PBJA 4L0WA 2VLTA 3ME7A 4TR0A 3US3A 4KF9A 2GQLA 1OVNA 1TRUA 3EE2A 5DBQA 1XFLA 4MH2A 3QFAC 3UARA 3MIXA 2MMAA 3GTUA 3LYPA 3HD5A 2M46A 3Q74A 3UVTA 2H30A 4O5UA 3ZTLA 1G0TA 5DALB 1XW5A 5B6NA 2KOKA 4MNNA 1JHBA 1TOFA 2KLXA 5KN1A 3CRUA 3RHCA 5KN3A 5GAND 1WE0A 2A4VA 3Q19A 2WRTA 1TK0B 1XWCA 3UVHA 4FO5A 4KDUA 2H71A 1BX9A 1V9WA 2B5EA 2VUPA 2K8SA 4IBPA 2KUCA 5D73A 3MNGA 2YANA 1PD21 1H75A 2HI7A 2DIZA 3IHQA 1X9SB 4NHZA 5D8IA 5DALA 3ERWA 1SK1A 2F8FA 3TKSE 1MD4A 2C0DA 2DKHA 4MABA 2J23A 3LWAA 3PH9A 5J41A 5DAKB 3F4SA 3U5RE 3ZVJA 4MZWA 1FO5A 1XOAA 4K1FA 4WR5A 4I5QA 3BBYA 3DKSA 3BD2A 5IO2A 2DJ1A 5ECSA 4MF5A 3G7JA 1OYJA 2H74A 3DXBA 4ZL8A 3VI5A 6GSWA 1UC7A 1MDJA 5LCZA 4IW9A 5IO0A 2HXKA 2O85A 3ZIJA 4PNGA 1PX6A 3G9BA 2FUG2 1X5EA 5GSTA 1HNCA 4F9ZA 2CVBA 2R5GA 1HNAA 1Y6EA 1NSWA 2VCVA 2H66A 5H5SA 2EIRA 1SU9A 1KEBA 4EXJA 1SJZA 5JWQB 1PRXA 2ZUPA 3DIEA 1GRXA 3RBTA 2VL3A 2C4JA 2YNXA 1WP0A 1TP9A 4GLTA 3D0ZA 2I4AA 1V98A 3BCIA 2CAQA 4Z2TA 4ECBA 3I9V2 4V1Ag 1A8LA 3TB2A 1N2AA 1RW1A 2HRKA 3WGEA 5CRWA 4TW5A 4BVXB 1PQNA 4MA9A 2GSQA 5BMUA 4ZL9A 2PU9C 12GSA 2B6MA 2HRAA 2YWMA 4N0VA 1USBA 5ECRB 2IL3A 2GT5A 3F9UA 3MSZA 2P5RA 1GTBA 5JWRB 2OKAA 4JR6A 4GF0A 1C72A 2C3TA 2Z9SA 4O92A 2ZCTA 1I5GA 4KAEA 1SKRB 4JZQA 4K7NA 2X8GA 5CNWA 2CV4A 1X0RA 4HDEA 5CREA 2C0GA 5AIVA 4Z2RA 1VGLA 2IPAA 1QK8A 3C71A 3ZREA 2HZEB 4ZBAA 1GNWA 5F07A 1ZMAA 2QA2A 2D2ZA 4I2UA 19GSA 1A0RP 2FWHA 5CRDA 4PGTA 1EP7A 4HZ4A 2VLUA 4ZB8A 3GURA 3LQ7A 3KEBA 5IMDA 2VL9A 4HI7A 5KN0A 4K7OA 4WR4A 5AISA 2VCZA 5IMFA 3EMPA 5DJLA 2HZEA 2B3SA 2VM1A 3L9SA 3GH9A 4HU9A 2OJLA 2WCIA 3W6GA 5FHIA 3DRNA 3GIXA 4MCUA 4TR4A 4X43A 3P8WA 3CXGA 2GSTA 3KJYA 2CVKA 2L4CA 4XS6A 4ID0A 3TJKA 4WKWA 1U3AA 3RAZA 1O6JA 3F3RA 2OE0A 2WS2A 2I81A 3EU4A 3RHBA 4HU7A 5ECHB 1MD3A 1W4VA 4MK3A 2E0QA 2J9HA 5CP1A 3PR8A 4G19A 1EV4A 1K0BA 2H6YA 1FHEA 2XPEA 1X9MB 1EGOA 5IMVA 2A2SA 5D93A 1Z5YE 2HNLA 1R5AA 1V57A 2L5OA 1PX7A 1OE8A 5KN2A 2AV4A 1K0CA 1K3OA 1OKDA 2KP2A 18GSA 1J0FA 2QA1A 3BJ5A 3M1GA 3GKNA 1A23A 5F06A 3TUEA 4K5RA 4CW9A 3FZ9A 3H8QA 5D96A 2VL2C 2PPTA 3LYKA 2X8CA 5IQYA 3R2QA 5FWGA 2C80A 2O89A 3M9KA 4KCEA 4KCAA 3QAGA 2VCWA 6GSYA 3FRCA 1HQOA 4JBBA 3A2WA 3HYPA 4MF7A 5LNKe 4IP1A 5ID2A 1K0MA 1JZRA 3UMAA 1T8EB 4LMVA 1B9YC 1GLPA 2RUFA 4IVFA 4G9HA 1GP1A 4ILFA 2BMXA 3FEUA 3GA4A 4MMMA 5D9TA 2HSHA 1URMA 4DSSB 4ECCA 1IYIA 1AXDA 2ES7A 3VK9A 2BJXA 1G6WA 2P31A 5HR2A 1H4OA 5IM9A 4F0CA 3LEFA 1O73A 4O32A 2AAWA 3TRQA 4IJIA 2LQOA 3KP8A 1GTUA 1GTIA 4HUAA 3FW2A 5EL8A 2DJKA 3VWUA 2GQMA 4DSSA 4BA7A 3GFKA 2C3QA 2IMFA 2H0HA 2QC7A 4WBJA 1TJDA 5JCGA 4GXZA 1AIUA 1GSQA 1V40A 3L78A 3F4TA 3ZRDA 3E0UA 3MWHA 5ECIB 4MDCA 1EZKA 1FVJA 2LJAA 4QL9A 2C3NA 3L4NA 2CX4A 5CYYA 3F63A 2A2RA 3KMOA 4I8BA 1EEMA 4EIPA 5AGYA 3C1SA 2DMMA 5JWOB 1SD9A 2JADA 3HVXA 2NPBA 1ILOA 3ZFBA 3F6DA 5ELAA 3N5OA 2K8VA 5CRHA 4KGIA 4N10A 3V1WA 2GZZA 5ECLB 1T4YA 3TRXA 1B4QA 1TRSA 1F37A 1YKCA 5A4UA 2LRNA 3IBHA 1GUHA 1T1VA 5AN1A 5DJMA 5HFKA 3W8JA 1WMJA 5G5EA 4PX1A 1UN2A 1XOBA 2QKEA 1PSQA 3S9FA 1W89A 3KH7A 2VCQA 4D73B 2JSZA 1SL0B 1Z9HA 3GH6A 4AJ6A 5J9BA 4MZBA 4YKFA 3LORA 1G7OA 1TK5B 4G2EA 4MP4A 3MYDA 1GSSA 22GSA 3WYWA 3GX8A 4PURA 4EIQA 2YPMA 1S3DA 2FY6A 3ERGA 3LW9A 3RPPA 1DBYA 2MZCA 2YZUA 4DVCA 1SD8A 3TKRA 3LXTA 2B1KA 1LJRA 4PUAA 4YAVA 4K9ZA 3PGTA 5B7CA 2F9SA 2LQQA 2YOIA 2H01A 2WULA 2VOCA 4YQVA 4XIHA 3LSZA 5ECNB 1K0NA 1TRVA 4A5PA 2NVLA 1TKDB 2LTKA 5GAPD 5J9CA 1ERVA 2CT6A 2H19A 3TKPA 2R0CA 5ENUA 3KGKA 4J57E 4V1Ap 2DIYA 4HS1A 2MYGA 3G7IA 3F6FA 1EOGA 5HFGA 1QXHA 2A4HA 3I43A 2I1UA 1G7EA 1DE1A 1NHOA 6GSUA 3GL3A 4F0BA 3QOUA 3UL3A 5IMZA 3IXRA 17GSA 3F0IA 1T7PB 4AGSA 4JU5A 5G2ZA 2VD1A 5EPFA 2K6VA 1TK8B 3EWLA 2KHPA 2YJ7A 2VCTA 1TTZA 3Q18A 3IC8A 1EEJA 4IJ3A 2LV3A 3K8NA 3IA1A 3P90A 4BPYA 1ERWA 3KM6A 4ZL7A 4Z7XA 4ZBDA 2H70A 3EU3A 13GSA 1M9BA 3FZ5A 2N5BA 1O8WA 3UBKA 1RQMA 2YN1A 1TW9A 4KNDA 4PNFA 3TDGA 4EVMA 2WJUA 2OADA 2LJKA 3VPTA 5DAKA 2FWGA 4MPGA 2LNSA 4NXIA 2DKIA 4LLRA 5HQPA 1SK2A 3HCZA 1YF0A 3IK7A 2VD0A 5J3RA 2F8AA 1GULA 1ZYNA 2FD3A 1BQ7A 3IRAA 1XWKA 1OC9B 3NZNA 4TXOB 1M7TA 3PPUA 2HYXA 1XIYA 2QGVA 3ZFLA 2PVQA 1Z7RA 4FYUA 1F2EA 2PN8A 2GZYA 4TN8A 1YKAA 1X9WB 4F03A 1M0UA 3GSTA 3RDWA 2DC5A 5E4WA 3E3EA 3J7Yk 2TIRA 2PERA 1AC1A 3APSA 5DQSA 1XWAA 4POLA 3F8UA 3UOMA 2ON5A 4TVEA 2AHEA 2N5FA 4L5OA 4V2MA 2IMDA 3VWVA 4LL4B 3A2VA 3HJOA 3J7Yb 1J9BA 4IN0A 11GSA 5HFIA 2V1MA 3HZ4A 4RI7A 4TXOA 2XHFA 4HJMA 1F3AA 2FCHA 2IMKA 1SKWB 4IQ1A 4ICYA 3KIJA 1TXXA 2RM6A 3CTFA 4AF2A 4BVYB 1UA5A 4NHWA 2YCDA 3GX0A 3UIWA 1SYRA 2IFQB 3TKSA 1PGTA 2LUSA 4ML6A 4KW6A 1M9AA 4YKGA 4EUYA 4IHUA 4HOJA 2R0GA 4KB3A 4LA1A 3GKKA 1K0AA 4BVXA 1FAAA 1A2JA 3ZVJD 3TGZA 1XW9A 5B6MA 3EMXA 2UZ8A 2LRTA 4LMWA 4FIWA 1EP8A 3A5IA 3WGXA 2V6KA 1ERUA 3LG6A 2NDOA 5B8AA 1X5DA 5FT3A 3A5WA 2K9FA 5ECMB 1VF4A 1GH2A 1YEPA 2GVPA 1O81A 1WPIA 3GN3A 4HQZA 1SL1B 2B7KA 1OAZA 4G10A 5CAXA 4TR3A 2ALBA 2X64A 3DGQA 1PKZA 4XRDA 4EKZA 4TKYA 3KTBA 3EC3A 2MMZA 5DDLA 8GSSA 4TOPA 5D9WA 3QD9A 4K7IA 1ACVA 1JLWA 1ZYEA 5A4WA 4MJCA 1VF2A 2HLSA 1VRSD 5J4UA 4JR4A 5E59A 1ZZYA 4GQFA 4OFNA 3RPNA 4F2IA 4YQUA 4AJ8A 3QAVA 2DJ3A 3HXSA 1EWXA 3QAWA 4NPBA 2R3XA 3ZMLA 3DVWA 4BWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKR A;  2P5Q A;  4OWY A;  1XVW A;  2FWF A;  1IYH A;  4O7H A;  3C73 A;  2IN3 A;  1JLV A;  2NBS A;  1YDK A;  2HRN A;  3BOA A;  16GS A;  2XBQ A;  3O76 A;  1HNB A;  2FLS A;  3ZZX A;  3IR4 A;  3TJG A;  1ZGN A;  4OO5 A;  2GLR A;  2GDR A;  1HD2 A;  4Q5Q A;  1QUW A;  2MMN A;  2OAC A;  5J5N A;  3C8E A;  4FYC A;  2WB9 A;  3IPZ A;  3D4T A;  1YEX A;  3FZA A;  1FG4 A;  1GSE A;  3WT2 A;  1KNG A;  4K0N A;  4TXV A;  4OD7 A;  2FGX A;  1MDI A;  1FW1 A;  3E9J B;  2H75 A;  3DML A;  2G2Q A;  5IMA A;  2FA4 A;  4KX4 A;  3IV4 A;  3GRX A;  5ECK B;  3ZIT A;  4I97 A;  3VFI A;  2CZ3 A;  1S3C A;  1SEN A;  4GWR A;  2C8U A;  2VAF A;  4WF4 A;  2HZF A;  1WRY A;  2KP1 A;  4ML1 A;  3FR9 A;  3A3T A;  3CMI A;  1EGR A;  5B8B A;  3GMF A;  4MZC A;  5D9X A;  1PMT A;  1R26 A;  1XCC A;  4GQC A;  2DJ2 A;  3CSI A;  2REM A;  4OFT A;  4ACS A;  1JFU A;  2B5Y A;  1OKT A;  1R5P A;  5EY6 A;  1XBS A;  2E2M A;  2B1L A;  2H6X A;  4K2D A;  5HR1 A;  3F3Q A;  3HY2 A;  3FK8 A;  4N30 A;  2E7P A;  2QSI A;  2DJ0 A;  1M2D A;  5A5K A;  2I9H A;  1Q4J A;  3MDK A;  2H1A A;  4KDX A;  2RLI A;  2YWO A;  1EV9 A;  2LRC A;  4GSN A;  2E2G A;  3ZL5 A;  4OCE A;  3GL5 A;  2VO4 A;  4ZIJ A;  4ZXG A;  3GSS A;  3H1N A;  3CBU A;  4HZ2 A;  3ZYW A;  2LNT A;  3DYR A;  4ECJ A;  3CYN A;  2YV9 A;  4POK A;  2NTO A;  1LBK A;  4HEA 2;  4MPF A;  1X5C A;  3WT1 A;  2WZ9 A;  4K8M A;  2K18 A;  4YQM A;  1B4P A;  4HJ2 A;  3WD6 A;  1O7U A;  3F4R A;  3ME8 A;  1YY7 A;  4F82 A;  3SWL A;  5F8B A;  1GNE A;  1ST9 A;  1KBN A;  1PL1 A;  4IS0 A;  1O8X A;  3DVX A;  3P2A A;  1TDI A;  3FR6 A;  5A4V A;  5IIZ A;  4NWY A;  5LD0 A;  3FZ4 A;  6GSX A;  4XRA A;  2C1Y A;  2LJR A;  3O6T A;  2H72 A;  3BCK A;  2XPD A;  4DEJ A;  2IMI A;  1F3B A;  1BJX A;  3W8S A;  2V41 A;  1CQH A;  4L5L A;  3QR6 A;  4CDO A;  3IDV A;  2WDU A;  1GUK A;  3PIN A;  3GTU B;  1Y25 A;  3ERF A;  1E6B A;  4QQ7 A;  3KZQ A;  2DBC A;  4XTS A;  4BWS A;  2L5L A;  2O8V B;  1SK0 A;  1DE2 A;  4D73 A;  3EVI A;  2LEG A;  3VUR A;  3IAM 2;  4TR1 B;  1O85 A;  2H76 A;  4PXO A;  1K0O A;  1TRW A;  2R6K A;  3KH9 A;  1B8X A;  3WGD A;  3CRT A;  5ABR A;  4EE0 A;  1AAZ A;  2V6O A;  4XS1 A;  4GTU A;  3KMN A;  4PUF C;  2GZP A;  4RI6 A;  3LXZ A;  3H93 A;  3QDN A;  1FVK A;  1YQ1 A;  2MMO A;  1ON4 A;  2CVD A;  3HJM A;  3C1R A;  2YWN A;  4XS4 B;  2TRX A;  3QCP A;  2HFD A;  3TJF A;  5G30 A;  4MJE A;  1SJI A;  4GST A;  4TR1 A;  4PQ1 A;  1NM3 A;  1VF1 A;  1Z7P A;  4BL7 A;  1XXU A;  5DCH A;  4YAP A;  2VLV A;  1FB0 A;  2F51 A;  1XWG A;  2O87 A;  4ECI A;  3IE3 A;  3U6V A;  5ECQ B;  1B48 A;  1THO A;  3D21 A;  4QL7 A;  4MH3 A;  5C04 A;  4XS4 A;  1AQX A;  2OBK A;  5IPH A;  2PVO C;  3TJJ A;  4IGJ A;  3I69 A;  3SBC A;  5IPG A;  3L9U A;  4WXT A;  3IC4 A;  1ERT A;  4EC0 A;  2V2G A;  2CX3 A;  2X99 A;  2TRC P;  2M80 A;  2F3M A;  1GL8 A;  1A8Y A;  2YWI A;  2HE3 A;  1QGV A;  2WFC A;  1Z3E A;  5G1K A;  1JZW A;  4O5R A;  2DJJ A;  1U6T A;  2H0G A;  2VL2 A;  3EYT A;  5G31 A;  3LFL A;  1DUG A;  4ISD A;  2H0I A;  2JZR A;  1AW9 A;  3TKQ A;  4EDZ A;  5C00 A;  2H73 A;  2GGT A;  3L9V A;  2GSS A;  4PQI A;  1ML6 A;  2FHE A;  2HSY A;  3GKX A;  4FYB A;  3D6I A;  4WF5 A;  4CHS A;  2AUV A;  3QPM A;  10GS A;  1OE7 A;  2IWT A;  2YZH A;  4JE1 A;  1E2Y A;  1GSU A;  1TI3 A;  2VM2 A;  1TU7 A;  2G0F A;  2P0G A;  1G6Y A;  2H6Z A;  3DD3 A;  4RUV A;  4ULX A;  2CAI A;  2GT6 A;  1OC9 A;  4NMU A;  3I6A A;  2DML A;  1PA3 A;  1GWC A;  4POB A;  2LS5 A;  3TOU A;  1F9M A;  3GKM A;  1EOH A;  1SL2 B;  4J56 E;  2M72 A;  4KH7 A;  3D22 A;  2R37 A;  4WET A;  2R2J A;  3NOF A;  5GZZ B;  3OR5 A;  3VLN A;  4JED A;  2MBT A;  2L6D A;  4EO3 A;  1T4Z A;  5F05 A;  4ZIL A;  5HR3 A;  1GLQ A;  2RUE A;  3N9J A;  1BG5 A;  1MTC A;  3GUS A;  1XZO A;  2XC2 A;  3IK9 A;  3TOT A;  3FHK A;  1MDK A;  2AB6 A;  4XHM A;  2AYT A;  3Q6O A;  4BVY A;  1YJ6 A;  2IFQ A;  1U3I A;  4Q5N A;  2C0E A;  3ISO A;  5KEJ A;  4ZB6 A;  4KDY A;  1A24 A;  2CA8 A;  4I6X A;  1T00 A;  3M9J A;  1S3A A;  3M8N A;  1PL2 A;  1GSF A;  4LL1 B;  5F0G A;  3FY7 A;  7GSS A;  4I2T A;  3H79 A;  1XVQ A;  5IOX A;  3HJP A;  3HDC A;  2JU5 A;  3GYK A;  2OE3 A;  4KSM A;  2N5A A;  1NHY A;  2L59 A;  1ZL9 A;  1LU4 A;  1AQV A;  1V2A A;  5DVB A;  5ECP B;  2IME A;  3CTG A;  3HZ8 A;  4IKH A;  4X0X A;  1QMV A;  2H1G A;  4K6X A;  2CQ9 A;  3GHA A;  4AJ7 A;  2HT9 A;  2JZS A;  2L6C A;  3HHV A;  4POM A;  2YJH A;  3P7X A;  1ZYQ B;  1I9D A;  5JCW A;  4ZB9 A;  3D4M A;  4NAX A;  1M2A A;  2RM5 A;  4XCS A;  3FYG A;  2FNO A;  3APO A;  3HA9 A;  4J2F A;  4NV2 A;  4DSQ A;  3M3M A;  4YH2 A;  1M2B A;  2GQK A;  3JCM L;  3VWX A;  2L4Q A;  5GSS A;  1WOU A;  5L71 A;  3IOS A;  4KE3 A;  4WBR D;  5JCU A;  5IOW A;  5ID2 B;  2ON7 A;  1K3Y A;  2BTO T;  4ZBB A;  1BED A;  1NW2 A;  2DLX A;  3A2X A;  5EVO A;  1DSB A;  1SJ6 A;  2CZ2 A;  1QFN A;  4RQR A;  1BAY A;  4N11 A;  3G7Y A;  6GSV A;  2OA7 A;  3ZMK A;  4PQH A;  3L0H A;  1BYE A;  5HR0 A;  2O7K A;  5D9V A;  1XW6 A;  3UEM A;  4WEY A;  2H8L A;  1WJK A;  1U87 A;  3KCM A;  3NIV A;  3TJB A;  4E8H A;  4E8E A;  3MAK A;  4IQA A;  2LST A;  1CQG A;  2YP6 A;  2H1D A;  1V58 A;  3GNJ A;  1R4W A;  4KSO A;  4L0U A;  4RQX A;  2HRF A;  4MJB A;  3KP9 A;  1K3L A;  1FB6 A;  1JZO A;  4P3Y B;  5IMC A;  3GV1 A;  3KD0 A;  4Q5F A;  1OC8 A;  3LGC A;  4Q5R A;  3TRP A;  2OBI A;  2VCX A;  2WGR A;  1FOV A;  5ECO B;  4MF6 A;  3UBL A;  14GS A;  4OMV A;  3VWW A;  1RK4 A;  1ZCP A;  2GS3 A;  3EIN A;  4EF0 A;  2FWE A;  2IIY A;  1AUC A;  1YF1 A;  1KTE A;  1B9X C;  20GS A;  1M99 A;  1TU8 A;  2I3Y A;  3O3T A;  1UVZ A;  1SYX A;  4OFM A;  3TKS C;  2YV7 A;  4L8E A;  5DCG A;  2GTU A;  6GST A;  4MJA A;  3AY8 A;  3IAS 2;  5G1L A;  1WWJ A;  3TCO A;  1GTA A;  1QQ2 A;  1TI1 A;  4GRF A;  2XBI A;  2JL4 A;  2C0F A;  3HVS A;  1PN9 A;  2X8H A;  3ZLP A;  1SKS B;  3ZIV A;  3D5J A;  3QFB C;  2RII A;  1GSD A;  2GSR A;  5AIX A;  1YZX A;  4N0Z A;  5ELG A;  1A2M A;  1A2L A;  1A0F A;  1R7H A;  9GSS A;  3APQ A;  1PKW A;  2EC4 A;  4V2L A;  1GSY A;  2JZT A;  2IJY A;  4K0G A;  4KA0 A;  1THX A;  1ZOF A;  2H1B A;  2R4V A;  3LJR A;  4H86 A;  3UAP A;  4NV5 A;  1OC3 A;  4IP6 A;  2L57 A;  4JRR A;  3HVV A;  1K0D A;  2EIQ A;  4EL1 A;  3QMX A;  1J08 A;  2B5X A;  1XWB A;  4HQS A;  3M0F A;  3FR3 A;  1XPV A;  4FH8 A;  2V32 A;  2OE1 A;  4OO4 A;  4X1U A;  5H5Q A;  1VF3 A;  1T3B A;  5INY A;  1AQW A;  5CO3 A;  3KXO A;  4EDY A;  2MBS A;  5DQY A;  4DSR A;  3VPQ A;  4GSS A;  2PMT A;  1JZD A;  2JSY A;  3UJ1 A;  2B7J A;  2ZNM A;  1F6M C;  5CRG A;  3CSH A;  2PWJ A;  1U88 A;  4IEL A;  6GSS A;  2PGT A;  3ED3 A;  3VI7 A;  3DWV A;  2FA8 A;  3FKF A;  1Z6N A;  3CSJ A;  4KUN A;  2JAC A;  3C7M A;  2LKU A;  1HYU A;  1Z6M A;  1GUM A;  2VIM A;  4TRX A;  1N8J A;  4MLY A;  1WIK A;  2DSA A;  5G5F A;  4GCI A;  2EIO A;  1ABA A;  1Q98 A;  2AJQ B;  3EUR A;  3KTL A;  3H4K A;  5COH A;  4OCF A;  5H5R A;  3DEX A;  2PUK C;  1MEK A;  4V2N A;  2PBJ A;  4L0W A;  2VLT A;  3ME7 A;  4TR0 A;  3US3 A;  2GQL A;  1OVN A;  1TRU A;  3EE2 A;  5DBQ A;  1XFL A;  4MH2 A;  3QFA C;  3UAR A;  2MMA A;  3GTU A;  3LYP A;  3HD5 A;  2M46 A;  3Q74 A;  3UVT A;  2H30 A;  3ZTL A;  1G0T A;  5DAL B;  1XW5 A;  5B6N A;  2KOK A;  1JHB A;  1TOF A;  2KLX A;  5KN1 A;  3CRU A;  3RHC A;  5KN3 A;  5GAN D;  1WE0 A;  2A4V A;  3Q19 A;  2WRT A;  1TK0 B;  1XWC A;  3UVH A;  4FO5 A;  4KDU A;  2H71 A;  1BX9 A;  1V9W A;  2B5E A;  2VUP A;  2K8S A;  4IBP A;  2KUC A;  5D73 A;  3MNG A;  2YAN A;  1PD2 1;  1H75 A;  2HI7 A;  2DIZ A;  3IHQ A;  1X9S B;  4NHZ A;  5D8I A;  5DAL A;  3ERW A;  1SK1 A;  2F8F A;  3TKS E;  1MD4 A;  2C0D A;  4MAB A;  2J23 A;  3LWA A;  3PH9 A;  5J41 A;  5DAK B;  3F4S A;  3U5R E;  3ZVJ A;  4MZW A;  1FO5 A;  1XOA A;  4K1F A;  4WR5 A;  4I5Q A;  3BBY A;  3DKS A;  3BD2 A;  5IO2 A;  2DJ1 A;  5ECS A;  4MF5 A;  3G7J A;  1OYJ A;  2H74 A;  3DXB A;  4ZL8 A;  3VI5 A;  6GSW A;  1UC7 A;  1MDJ A;  5LCZ A;  4IW9 A;  5IO0 A;  2HXK A;  2O85 A;  3ZIJ A;  4PNG A;  1PX6 A;  3G9B A;  2FUG 2;  1X5E A;  5GST A;  1HNC A;  4F9Z A;  2CVB A;  2R5G A;  1HNA A;  1Y6E A;  1NSW A;  2VCV A;  2H66 A;  5H5S A;  2EIR A;  1SU9 A;  1KEB A;  4EXJ A;  1SJZ A;  5JWQ B;  1PRX A;  2ZUP A;  3DIE A;  1GRX A;  3RBT A;  2VL3 A;  2C4J A;  2YNX A;  1WP0 A;  1TP9 A;  4GLT A;  3D0Z A;  2I4A A;  1V98 A;  3BCI A;  2CAQ A;  4ECB A;  3I9V 2;  4V1A g;  1A8L A;  3TB2 A;  1N2A A;  1RW1 A;  3WGE A;  5CRW A;  4TW5 A;  1PQN A;  4MA9 A;  2GSQ A;  4ZL9 A;  2PU9 C;  12GS A;  2B6M A;  2YWM A;  4N0V A;  1USB A;  5ECR B;  2IL3 A;  2GT5 A;  3F9U A;  3MSZ A;  2P5R A;  1GTB A;  5JWR B;  2OKA A;  4JR6 A;  4GF0 A;  1C72 A;  2C3T A;  2Z9S A;  4O92 A;  2ZCT A;  1I5G A;  4KAE A;  1SKR B;  4JZQ A;  4K7N A;  2X8G A;  5CNW A;  2CV4 A;  1X0R A;  4HDE A;  5CRE A;  2C0G A;  5AIV A;  1VGL A;  2IPA A;  1QK8 A;  3C71 A;  3ZRE A;  2HZE B;  4ZBA A;  1GNW A;  5F07 A;  1ZMA A;  2D2Z A;  4I2U A;  19GS A;  1A0R P;  2FWH A;  5CRD A;  4PGT A;  1EP7 A;  4HZ4 A;  2VLU A;  4ZB8 A;  3GUR A;  3LQ7 A;  3KEB A;  5IMD A;  2VL9 A;  4HI7 A;  5KN0 A;  4K7O A;  4WR4 A;  5AIS A;  2VCZ A;  5IMF A;  3EMP A;  5DJL A;  2HZE A;  2B3S A;  2VM1 A;  3L9S A;  3GH9 A;  4HU9 A;  2OJL A;  2WCI A;  3W6G A;  5FHI A;  3DRN A;  3GIX A;  4MCU A;  4TR4 A;  4X43 A;  3P8W A;  3CXG A;  2GST A;  3KJY A;  2CVK A;  2L4C A;  4XS6 A;  4ID0 A;  3TJK A;  4WKW A;  1U3A A;  3RAZ A;  1O6J A;  3F3R A;  2OE0 A;  2WS2 A;  2I81 A;  3EU4 A;  3RHB A;  4HU7 A;  5ECH B;  1MD3 A;  1W4V A;  4MK3 A;  2E0Q A;  2J9H A;  5CP1 A;  3PR8 A;  4G19 A;  1EV4 A;  1K0B A;  2H6Y A;  1FHE A;  2XPE A;  1X9M B;  1EGO A;  5IMV A;  2A2S A;  5D93 A;  1Z5Y E;  2HNL A;  1R5A A;  1V57 A;  2L5O A;  1PX7 A;  1OE8 A;  5KN2 A;  2AV4 A;  1K0C A;  1K3O A;  1OKD A;  2KP2 A;  18GS A;  1J0F A;  3BJ5 A;  3M1G A;  3GKN A;  1A23 A;  5F06 A;  3TUE A;  4CW9 A;  3FZ9 A;  3H8Q A;  5D96 A;  2VL2 C;  2PPT A;  3LYK A;  2X8C A;  5IQY A;  3R2Q A;  5FWG A;  2C80 A;  2O89 A;  3M9K A;  4KCE A;  4KCA A;  3QAG A;  2VCW A;  6GSY A;  3FRC A;  1HQO A;  4JBB A;  3A2W A;  3HYP A;  4MF7 A;  5LNK e;  4IP1 A;  5ID2 A;  1K0M A;  1JZR A;  3UMA A;  1T8E B;  4LMV A;  1B9Y C;  1GLP A;  2RUF A;  4IVF A;  4G9H A;  1GP1 A;  4ILF A;  2BMX A;  3FEU A;  3GA4 A;  4MMM A;  5D9T A;  2HSH A;  1URM A;  4DSS B;  4ECC A;  1IYI A;  1AXD A;  2ES7 A;  3VK9 A;  2BJX A;  1G6W A;  2P31 A;  5HR2 A;  1H4O A;  5IM9 A;  4F0C A;  3LEF A;  1O73 A;  4O32 A;  2AAW A;  3TRQ A;  4IJI A;  2LQO A;  3KP8 A;  1GTU A;  1GTI A;  4HUA A;  3FW2 A;  5EL8 A;  2DJK A;  3VWU A;  2GQM A;  4DSS A;  4BA7 A;  3GFK A;  2C3Q A;  2IMF A;  2H0H A;  2QC7 A;  4WBJ A;  1TJD A;  5JCG A;  4GXZ A;  1AIU A;  1GSQ A;  1V40 A;  3L78 A;  3F4T A;  3ZRD A;  3E0U A;  3MWH A;  5ECI B;  4MDC A;  1EZK A;  1FVJ A;  2LJA A;  4QL9 A;  2C3N A;  3L4N A;  2CX4 A;  5CYY A;  3F63 A;  2A2R A;  3KMO A;  4I8B A;  1EEM A;  5AGY A;  3C1S A;  2DMM A;  5JWO B;  1SD9 A;  2JAD A;  3HVX A;  2NPB A;  1ILO A;  3ZFB A;  3F6D A;  5ELA A;  3N5O A;  2K8V A;  5CRH A;  4KGI A;  4N10 A;  3V1W A;  2GZZ A;  5ECL B;  1T4Y A;  3TRX A;  1B4Q A;  1TRS A;  1F37 A;  1YKC A;  5A4U A;  2LRN A;  3IBH A;  1GUH A;  1T1V A;  5AN1 A;  5DJM A;  5HFK A;  3W8J A;  1WMJ A;  5G5E A;  4PX1 A;  1UN2 A;  1XOB A;  2QKE A;  1PSQ A;  3S9F A;  1W89 A;  3KH7 A;  2VCQ A;  4D73 B;  2JSZ A;  1SL0 B;  1Z9H A;  3GH6 A;  4AJ6 A;  5J9B A;  4MZB A;  3LOR A;  1G7O A;  1TK5 B;  4G2E A;  4MP4 A;  1GSS A;  22GS A;  3WYW A;  3GX8 A;  4PUR A;  2YPM A;  1S3D A;  2FY6 A;  3ERG A;  3RPP A;  1DBY A;  2MZC A;  2YZU A;  4DVC A;  1SD8 A;  3TKR A;  3LXT A;  2B1K A;  1LJR A;  4PUA A;  4YAV A;  4K9Z A;  3PGT A;  5B7C A;  2F9S A;  2LQQ A;  2YOI A;  2H01 A;  2WUL A;  2VOC A;  4YQV A;  4XIH A;  3LSZ A;  5ECN B;  1K0N A;  1TRV A;  2NVL A;  1TKD B;  2LTK A;  5GAP D;  5J9C A;  1ERV A;  2CT6 A;  2H19 A;  3TKP A;  5ENU A;  3KGK A;  4J57 E;  4V1A p;  2DIY A;  4HS1 A;  2MYG A;  3G7I A;  3F6F A;  1EOG A;  5HFG A;  1QXH A;  3I43 A;  2I1U A;  1G7E A;  1DE1 A;  1NHO A;  6GSU A;  3GL3 A;  4F0B A;  3QOU A;  3UL3 A;  5IMZ A;  3IXR A;  17GS A;  3F0I A;  1T7P B;  4AGS A;  4JU5 A;  5G2Z A;  2VD1 A;  5EPF A;  2K6V A;  1TK8 B;  3EWL A;  2KHP A;  2YJ7 A;  2VCT A;  1TTZ A;  3Q18 A;  1EEJ A;  4IJ3 A;  2LV3 A;  3K8N A;  3IA1 A;  3P90 A;  4BPY A;  1ERW A;  3KM6 A;  4ZL7 A;  4Z7X A;  4ZBD A;  2H70 A;  3EU3 A;  13GS A;  1M9B A;  3FZ5 A;  2N5B A;  1O8W A;  3UBK A;  1RQM A;  2YN1 A;  1TW9 A;  4KND A;  4PNF A;  3TDG A;  4EVM A;  2WJU A;  2OAD A;  2LJK A;  3VPT A;  5DAK A;  2FWG A;  4MPG A;  2LNS A;  4NXI A;  4LLR A;  5HQP A;  1SK2 A;  3HCZ A;  1YF0 A;  3IK7 A;  2VD0 A;  5J3R A;  2F8A A;  1GUL A;  2FD3 A;  1BQ7 A;  3IRA A;  1XWK A;  1OC9 B;  3NZN A;  4TXO B;  1M7T A;  2HYX A;  1XIY A;  2QGV A;  3ZFL A;  2PVQ A;  1Z7R A;  4FYU A;  1F2E A;  2PN8 A;  2GZY A;  4TN8 A;  1YKA A;  1X9W B;  4F03 A;  1M0U A;  3GST A;  3RDW A;  2DC5 A;  5E4W A;  3E3E A;  3J7Y k;  2TIR A;  2PER A;  1AC1 A;  3APS A;  5DQS A;  1XWA A;  4POL A;  3F8U A;  3UOM A;  2ON5 A;  4TVE A;  2AHE A;  2N5F A;  4L5O A;  4V2M A;  2IMD A;  3VWV A;  4LL4 B;  3A2V A;  3HJO A;  3J7Y b;  1J9B A;  4IN0 A;  11GS A;  5HFI A;  2V1M A;  3HZ4 A;  4RI7 A;  4TXO A;  2XHF A;  4HJM A;  1F3A A;  2FCH A;  2IMK A;  1SKW B;  4IQ1 A;  3KIJ A;  1TXX A;  2RM6 A;  3CTF A;  4AF2 A;  1UA5 A;  4NHW A;  2YCD A;  3GX0 A;  3UIW A;  1SYR A;  2IFQ B;  3TKS A;  1PGT A;  2LUS A;  4ML6 A;  4KW6 A;  1M9A A;  4EUY A;  4IHU A;  4HOJ A;  4KB3 A;  4LA1 A;  3GKK A;  1K0A A;  4BVX A;  1FAA A;  1A2J A;  3ZVJ D;  3TGZ A;  1XW9 A;  5B6M A;  3EMX A;  2LRT A;  4LMW A;  4FIW A;  1EP8 A;  3WGX A;  2V6K A;  1ERU A;  3LG6 A;  2NDO A;  5B8A A;  1X5D A;  5FT3 A;  3A5W A;  2K9F A;  5ECM B;  1VF4 A;  1GH2 A;  1YEP A;  2GVP A;  1O81 A;  1WPI A;  3GN3 A;  4HQZ A;  1SL1 B;  2B7K A;  1OAZ A;  4G10 A;  5CAX A;  4TR3 A;  2ALB A;  2X64 A;  3DGQ A;  1PKZ A;  4XRD A;  4EKZ A;  4TKY A;  3KTB A;  3EC3 A;  2MMZ A;  5DDL A;  8GSS A;  4TOP A;  5D9W A;  3QD9 A;  4K7I A;  1ACV A;  1JLW A;  1ZYE A;  5A4W A;  4MJC A;  1VF2 A;  2HLS A;  1VRS D;  5J4U A;  4JR4 A;  5E59 A;  1ZZY A;  4GQF A;  4OFN A;  3RPN A;  4F2I A;  4YQU A;  4AJ8 A;  3QAV A;  2DJ3 A;  3HXS A;  1EWX A;  3QAW A;  4NPB A;  2R3X A;  3ZML A;  3DVW A;  4BWQ A; 
#chains in the Genus database with same CATH topology
 3HKR A;  2P5Q A;  4OWY A;  1XVW A;  2FWF A;  1IYH A;  4O7H A;  3C73 A;  2IN3 A;  1JLV A;  2HSM A;  2NBS A;  1YDK A;  2HRN A;  3BOA A;  16GS A;  2XBQ A;  3O76 A;  1HNB A;  2FLS A;  3ZZX A;  3IR4 A;  3TJG A;  4Z2U A;  1ZGN A;  4OO5 A;  2GLR A;  2GDR A;  1HD2 A;  4Q5Q A;  1QUW A;  2MMN A;  2OAC A;  5J5N A;  3C8E A;  4FYC A;  2WB9 A;  3IPZ A;  4G0L A;  3D4T A;  1YEX A;  3FZA A;  1FG4 A;  1GSE A;  3WT2 A;  1KNG A;  4K0N A;  4TXV A;  4OD7 A;  2FGX A;  1MDI A;  1FW1 A;  3E9J B;  4O5Q A;  2H75 A;  3DML A;  2G2Q A;  5IMA A;  2FA4 A;  4KX4 A;  3IV4 A;  3GRX A;  5ECK B;  3ZIT A;  4I97 A;  1M3I A;  3VFI A;  2CZ3 A;  1S3C A;  1SEN A;  4GWR A;  2C8U A;  2VAF A;  4WF4 A;  2HZF A;  3FMW A;  1WRY A;  2KP1 A;  4ML1 A;  3FR9 A;  3A3T A;  3CMI A;  1EGR A;  5B8B A;  3GMF A;  4MZC A;  5D9X A;  1PMT A;  1R26 A;  1XCC A;  4GQC A;  2DJ2 A;  3CSI A;  2REM A;  4OFT A;  4ACS A;  1JFU A;  2B5Y A;  1OKT A;  1R5P A;  5EY6 A;  1XBS A;  2E2M A;  2B1L A;  4G0K A;  2H6X A;  4K2D A;  5HR1 A;  3F3Q A;  3HY2 A;  3FK8 A;  4N30 A;  2E7P A;  2QSI A;  2DJ0 A;  1M2D A;  5A5K A;  2I9H A;  1Q4J A;  3MDK A;  2H1A A;  4KDX A;  2RLI A;  2YWO A;  1EV9 A;  2LRC A;  4GSN A;  2E2G A;  3ZL5 A;  4OCE A;  3GL5 A;  2VO4 A;  4ZIJ A;  4ZXG A;  3GSS A;  3H1N A;  3CBU A;  4HZ2 A;  3ZYW A;  2LNT A;  3DYR A;  4ECJ A;  5BRT A;  3CYN A;  2YV9 A;  4CY6 A;  4POK A;  2NTO A;  1LBK A;  4HEA 2;  4MPF A;  1X5C A;  3WT1 A;  2WZ9 A;  4K8M A;  2K18 A;  4YQM A;  1B4P A;  4HJ2 A;  3WD6 A;  1O7U A;  3F4R A;  3ME8 A;  1YY7 A;  4F82 A;  3SWL A;  5F8B A;  1GNE A;  1ST9 A;  1KBN A;  1PL1 A;  4IS0 A;  1O8X A;  3DVX A;  3P2A A;  1TDI A;  3FR6 A;  5A4V A;  5IIZ A;  4NWY A;  5LD0 A;  3FZ4 A;  6GSX A;  4XRA A;  2C1Y A;  2LJR A;  3O6T A;  2H72 A;  3BCK A;  2XPD A;  4DEJ A;  2IMI A;  1F3B A;  1BJX A;  1XG8 A;  3W8S A;  2V41 A;  1CQH A;  4X4J A;  4L5L A;  3QR6 A;  4CDO A;  3IDV A;  2WDU A;  1GUK A;  3PIN A;  3GTU B;  1Y25 A;  3ERF A;  1E6B A;  4QQ7 A;  3KZQ A;  2DBC A;  4XTS A;  4BWS A;  2L5L A;  1ZYP A;  2O8V B;  1SK0 A;  1DE2 A;  4D73 A;  3EVI A;  2LEG A;  3VUR A;  3IAM 2;  4TR1 B;  1O85 A;  2H76 A;  4PXO A;  1K0O A;  1TRW A;  2R6K A;  3KH9 A;  1B8X A;  4BL7 B;  3WGD A;  4BIK A;  3CRT A;  5ABR A;  4EE0 A;  1AAZ A;  2V6O A;  4XS1 A;  4GTU A;  3KMN A;  4PUF C;  2GZP A;  4RI6 A;  3LXZ A;  3H93 A;  3QDN A;  1FVK A;  1YQ1 A;  2MMO A;  1ON4 A;  2CVD A;  3HJM A;  3C1R A;  2YWN A;  4XS4 B;  2TRX A;  3QCP A;  2HFD A;  3TJF A;  5G30 A;  4MJE A;  1SJI A;  4GST A;  4TR1 A;  4PQ1 A;  1NM3 A;  1VF1 A;  1Z7P A;  4BL7 A;  1XXU A;  5DCH A;  4YAP A;  2VLV A;  2X49 A;  1FB0 A;  2F51 A;  1XWG A;  2O87 A;  4ECI A;  3IE3 A;  3U6V A;  5ECQ B;  1B48 A;  1THO A;  3D21 A;  2R0P A;  4QL7 A;  4MH3 A;  5C04 A;  4XS4 A;  1AQX A;  2OBK A;  5IPH A;  2PVO C;  3TJJ A;  4IGJ A;  3I69 A;  3SBC A;  5IPG A;  3L9U A;  4WXT A;  3IC4 A;  1ERT A;  4EC0 A;  2V2G A;  2CX3 A;  2X99 A;  2TRC P;  2M80 A;  2F3M A;  1GL8 A;  1A8Y A;  2YWI A;  2HE3 A;  1QGV A;  2WFC A;  1Z3E A;  5G1K A;  1JZW A;  4O5R A;  2DJJ A;  1U6T A;  2H0G A;  2VL2 A;  3EYT A;  5G31 A;  3LFL A;  1DUG A;  4ISD A;  2H0I A;  2JZR A;  1AW9 A;  3TKQ A;  4EDZ A;  5C00 A;  2H73 A;  2GGT A;  3L9V A;  2GSS A;  4PQI A;  1ML6 A;  2FHE A;  2HSY A;  3GKX A;  4FYB A;  5KOW A;  3D6I A;  4WF5 A;  4CHS A;  2AUV A;  3QPM A;  10GS A;  1OE7 A;  2IWT A;  2YZH A;  4JE1 A;  1E2Y A;  4K5S A;  1GSU A;  1TI3 A;  2VM2 A;  1TU7 A;  2G0F A;  2P0G A;  1G6Y A;  2H6Z A;  3DD3 A;  4RUV A;  4ULX A;  2CAI A;  2GT6 A;  3EPT A;  1OC9 A;  4NMU A;  3I6A A;  2DML A;  1PA3 A;  1GWC A;  4POB A;  2LS5 A;  3TOU A;  1F9M A;  3GKM A;  1EOH A;  1SL2 B;  4J56 E;  4USS A;  2M72 A;  4KH7 A;  3D22 A;  2R37 A;  4WET A;  2R2J A;  3NOF A;  5GZZ B;  3OR5 A;  3VLN A;  4JED A;  2MBT A;  2L6D A;  4EO3 A;  1T4Z A;  5F05 A;  4ZIL A;  5HR3 A;  1GLQ A;  2RUE A;  3N9J A;  1BG5 A;  1MTC A;  3GUS A;  1XZO A;  2XC2 A;  3IK9 A;  3TOT A;  3FHK A;  1MDK A;  2AB6 A;  4XHM A;  2AYT A;  3Q6O A;  4BVY A;  1YJ6 A;  2IFQ A;  1U3I A;  5KOX A;  4Q5N A;  2C0E A;  3ISO A;  5KEJ A;  4ZB6 A;  4KDY A;  1A24 A;  2CA8 A;  4I6X A;  1T00 A;  3M9J A;  1S3A A;  3M8N A;  1PL2 A;  1GSF A;  4LL1 B;  4K2X A;  5F0G A;  3FY7 A;  7GSS A;  4I2T A;  3H79 A;  1XVQ A;  5IOX A;  3HJP A;  3HDC A;  2JU5 A;  3GYK A;  2OE3 A;  4KSM A;  2N5A A;  1NHY A;  2L59 A;  1ZL9 A;  1LU4 A;  1AQV A;  1V2A A;  5DVB A;  5ECP B;  2IME A;  3CTG A;  3HZ8 A;  4IKH A;  4X0X A;  3IHG A;  1QMV A;  2H1G A;  4K6X A;  2CQ9 A;  3GHA A;  4AJ7 A;  2HT9 A;  2JZS A;  2L6C A;  3HHV A;  4POM A;  2YJH A;  3P7X A;  1ZYQ B;  1I9D A;  5JCW A;  4ZB9 A;  3D4M A;  4NAX A;  1M2A A;  2RM5 A;  4XCS A;  3FYG A;  2FNO A;  3APO A;  3HA9 A;  4J2F A;  4NV2 A;  4DSQ A;  3M3M A;  4YH2 A;  1M2B A;  2GQK A;  3JCM L;  3VWX A;  2L4Q A;  5GSS A;  1WOU A;  5L71 A;  3IOS A;  4KE3 A;  4WBR D;  5JCU A;  5IOW A;  5ID2 B;  2ON7 A;  1K3Y A;  2BTO T;  4ZBB A;  1BED A;  1NW2 A;  2DLX A;  3A2X A;  5EVO A;  1DSB A;  1SJ6 A;  2CZ2 A;  1QFN A;  4RQR A;  1BAY A;  4N11 A;  3G7Y A;  6GSV A;  2OA7 A;  3ZMK A;  4PQH A;  3L0H A;  1BYE A;  5HR0 A;  2O7K A;  5D9V A;  1XW6 A;  3UEM A;  4WEY A;  2H8L A;  1WJK A;  1U87 A;  3KCM A;  3NIV A;  3TJB A;  4E8H A;  4E8E A;  3MAK A;  4IQA A;  2LST A;  1CQG A;  2YP6 A;  2H1D A;  1V58 A;  3GNJ A;  1R4W A;  4KSO A;  4L0U A;  4RQX A;  2HRF A;  4MJB A;  3KP9 A;  1K3L A;  1FB6 A;  1JZO A;  4P3Y B;  5IMC A;  3GV1 A;  3KD0 A;  4Q5F A;  1OC8 A;  2X4A A;  3LGC A;  4Q5R A;  3TRP A;  2OBI A;  2VCX A;  2WGR A;  1FOV A;  5ECO B;  4MF6 A;  3UBL A;  14GS A;  4OMV A;  3VWW A;  1RK4 A;  1ZCP A;  2GS3 A;  3EIN A;  4EF0 A;  2FWE A;  2IIY A;  1AUC A;  1YF1 A;  1KTE A;  1B9X C;  20GS A;  1M99 A;  1TU8 A;  2I3Y A;  3O3T A;  1UVZ A;  1SYX A;  4OFM A;  3TKS C;  2YV7 A;  2A2P A;  1FOH A;  4L8E A;  2GTU A;  5DCG A;  6GST A;  4MJA A;  3AY8 A;  3IAS 2;  1M3J A;  5G1L A;  1WWJ A;  3TCO A;  1GTA A;  1QQ2 A;  1TI1 A;  4G0I A;  4GRF A;  2XBI A;  2JL4 A;  2C0F A;  3HVS A;  1PN9 A;  2X8H A;  3ZLP A;  1SKS B;  3ZIV A;  3D5J A;  3QFB C;  2RII A;  1GSD A;  2GSR A;  5AIX A;  1YZX A;  4N0Z A;  5ELG A;  1A2M A;  1A2L A;  1A0F A;  1R7H A;  9GSS A;  3APQ A;  1PKW A;  2EC4 A;  4V2L A;  1GSY A;  2JZT A;  2IJY A;  4K0G A;  4KA0 A;  1THX A;  1ZOF A;  2H1B A;  2R4V A;  3LJR A;  4H86 A;  3UAP A;  4NV5 A;  1OC3 A;  4IP6 A;  2L57 A;  1PN0 A;  4JRR A;  3HVV A;  1K0D A;  2EIQ A;  3R3E A;  4EL1 A;  3QMX A;  1J08 A;  2B5X A;  1XWB A;  4HQS A;  3M0F A;  3FR3 A;  1XPV A;  4FH8 A;  2V32 A;  2OE1 A;  4OO4 A;  4X1U A;  5H5Q A;  1VF3 A;  1T3B A;  5INY A;  1AQW A;  5CO3 A;  3KXO A;  4EDY A;  2MBS A;  5DQY A;  4DSR A;  3VPQ A;  4GSS A;  2PMT A;  1JZD A;  2JSY A;  3UJ1 A;  2B7J A;  2ZNM A;  1F6M C;  5CRG A;  3CSH A;  2PWJ A;  1U88 A;  4IEL A;  6GSS A;  2PGT A;  3ED3 A;  3VI7 A;  3DWV A;  2FA8 A;  3FKF A;  1Z6N A;  3CSJ A;  4KUN A;  2JAC A;  3C7M A;  2LKU A;  1HYU A;  1Z6M A;  1GUM A;  2VIM A;  4TRX A;  4FQU A;  1N8J A;  4MLY A;  1WIK A;  2DSA A;  5G5F A;  4GCI A;  4CY8 A;  4PTS A;  2EIO A;  1ABA A;  1Q98 A;  2AJQ B;  3EUR A;  3KTL A;  3H4K A;  5COH A;  4OCF A;  5H5R A;  3DEX A;  2PUK C;  1MEK A;  4V2N A;  2PBJ A;  4L0W A;  2VLT A;  3ME7 A;  4TR0 A;  3US3 A;  4KF9 A;  2GQL A;  1OVN A;  1TRU A;  3EE2 A;  5DBQ A;  1XFL A;  4MH2 A;  3QFA C;  3UAR A;  3MIX A;  2MMA A;  3GTU A;  3LYP A;  3HD5 A;  2M46 A;  3Q74 A;  3UVT A;  2H30 A;  4O5U A;  3ZTL A;  1G0T A;  5DAL B;  1XW5 A;  5B6N A;  2KOK A;  4MNN A;  1JHB A;  1TOF A;  2KLX A;  5KN1 A;  3CRU A;  3RHC A;  5KN3 A;  5GAN D;  1WE0 A;  2A4V A;  3Q19 A;  2WRT A;  1TK0 B;  1XWC A;  3UVH A;  4FO5 A;  4KDU A;  2H71 A;  1BX9 A;  1V9W A;  2B5E A;  2VUP A;  2K8S A;  4IBP A;  2KUC A;  5D73 A;  3MNG A;  2YAN A;  1PD2 1;  1H75 A;  2HI7 A;  2DIZ A;  3IHQ A;  1X9S B;  4NHZ A;  5D8I A;  5DAL A;  3ERW A;  1SK1 A;  2F8F A;  3TKS E;  1MD4 A;  2C0D A;  2DKH A;  4MAB A;  2J23 A;  3LWA A;  3PH9 A;  5J41 A;  5DAK B;  3F4S A;  3U5R E;  3ZVJ A;  4MZW A;  1FO5 A;  1XOA A;  4K1F A;  4WR5 A;  4I5Q A;  3BBY A;  3DKS A;  3BD2 A;  5IO2 A;  2DJ1 A;  5ECS A;  4MF5 A;  3G7J A;  1OYJ A;  2H74 A;  3DXB A;  4ZL8 A;  3VI5 A;  6GSW A;  1UC7 A;  1MDJ A;  5LCZ A;  4IW9 A;  5IO0 A;  2HXK A;  2O85 A;  3ZIJ A;  4PNG A;  1PX6 A;  3G9B A;  2FUG 2;  1X5E A;  5GST A;  1HNC A;  4F9Z A;  2CVB A;  2R5G A;  1HNA A;  1Y6E A;  1NSW A;  2VCV A;  2H66 A;  5H5S A;  2EIR A;  1SU9 A;  1KEB A;  4EXJ A;  1SJZ A;  5JWQ B;  1PRX A;  2ZUP A;  3DIE A;  1GRX A;  3RBT A;  2VL3 A;  2C4J A;  2YNX A;  1WP0 A;  1TP9 A;  4GLT A;  3D0Z A;  2I4A A;  1V98 A;  3BCI A;  2CAQ A;  4Z2T A;  4ECB A;  3I9V 2;  4V1A g;  1A8L A;  3TB2 A;  1N2A A;  1RW1 A;  2HRK A;  3WGE A;  5CRW A;  4TW5 A;  4BVX B;  1PQN A;  4MA9 A;  2GSQ A;  5BMU A;  4ZL9 A;  2PU9 C;  12GS A;  2B6M A;  2HRA A;  2YWM A;  4N0V A;  1USB A;  5ECR B;  2IL3 A;  2GT5 A;  3F9U A;  3MSZ A;  2P5R A;  1GTB A;  5JWR B;  2OKA A;  4JR6 A;  4GF0 A;  1C72 A;  2C3T A;  2Z9S A;  4O92 A;  2ZCT A;  1I5G A;  4KAE A;  1SKR B;  4JZQ A;  4K7N A;  2X8G A;  5CNW A;  2CV4 A;  1X0R A;  4HDE A;  5CRE A;  2C0G A;  5AIV A;  4Z2R A;  1S3R A;  1VGL A;  2IPA A;  1QK8 A;  3C71 A;  3ZRE A;  2HZE B;  4ZBA A;  1GNW A;  5F07 A;  1ZMA A;  2QA2 A;  2D2Z A;  4I2U A;  19GS A;  1A0R P;  2FWH A;  5CRD A;  4PGT A;  1EP7 A;  4HZ4 A;  2VLU A;  4ZB8 A;  3GUR A;  3LQ7 A;  3KEB A;  5IMD A;  2VL9 A;  4HI7 A;  5KN0 A;  4K7O A;  4WR4 A;  5AIS A;  2VCZ A;  5IMF A;  3EMP A;  5DJL A;  2HZE A;  2B3S A;  2VM1 A;  3L9S A;  3GH9 A;  4HU9 A;  2OJL A;  2WCI A;  3W6G A;  5FHI A;  3DRN A;  3GIX A;  4MCU A;  4TR4 A;  4X43 A;  3P8W A;  3CXG A;  2GST A;  3KJY A;  2CVK A;  2L4C A;  4XS6 A;  4ID0 A;  3TJK A;  4WKW A;  1U3A A;  3RAZ A;  1O6J A;  3F3R A;  2OE0 A;  2WS2 A;  2I81 A;  3EU4 A;  3RHB A;  4HU7 A;  5ECH B;  1MD3 A;  1W4V A;  4MK3 A;  2E0Q A;  2J9H A;  5CP1 A;  3PR8 A;  3CQF A;  4G19 A;  1EV4 A;  1K0B A;  2H6Y A;  1FHE A;  2XPE A;  1X9M B;  1EGO A;  5IMV A;  2A2S A;  5D93 A;  1Z5Y E;  2HNL A;  1R5A A;  1V57 A;  2L5O A;  1PX7 A;  1OE8 A;  5KN2 A;  2AV4 A;  1K0C A;  1K3O A;  1OKD A;  2KP2 A;  18GS A;  1J0F A;  2QA1 A;  3BJ5 A;  3M1G A;  3GKN A;  1A23 A;  5F06 A;  3TUE A;  4K5R A;  4CW9 A;  3FZ9 A;  3H8Q A;  5D96 A;  2VL2 C;  2PPT A;  3LYK A;  2X8C A;  5IQY A;  3R2Q A;  5FWG A;  2C80 A;  2O89 A;  3M9K A;  4KCE A;  4KCA A;  3QAG A;  2VCW A;  6GSY A;  3FRC A;  1HQO A;  4JBB A;  3A2W A;  3HYP A;  4MF7 A;  5LNK e;  4IP1 A;  5ID2 A;  1K0M A;  1JZR A;  3UMA A;  1T8E B;  4LMV A;  1B9Y C;  1GLP A;  2RUF A;  4IVF A;  4G9H A;  1GP1 A;  4ILF A;  2BMX A;  3FEU A;  3GA4 A;  4MMM A;  5D9T A;  2HSH A;  1URM A;  4DSS B;  4ECC A;  1IYI A;  1AXD A;  2ES7 A;  3VK9 A;  1PFO A;  2BJX A;  1G6W A;  4HSC X;  2P31 A;  5HR2 A;  1H4O A;  5IM9 A;  3HVN A;  4F0C A;  3LEF A;  1O73 A;  4O32 A;  2AAW A;  3TRQ A;  4IJI A;  2LQO A;  3KP8 A;  1GTU A;  1GTI A;  4HUA A;  3FW2 A;  5EL8 A;  2DJK A;  3VWU A;  2GQM A;  4DSS A;  4BA7 A;  3GFK A;  2C3Q A;  2IMF A;  2H0H A;  2QC7 A;  4WBJ A;  1TJD A;  5JCG A;  4GXZ A;  1AIU A;  1GSQ A;  1V40 A;  3L78 A;  3F4T A;  3ZRD A;  3E0U A;  3MWH A;  5ECI B;  4MDC A;  1EZK A;  1FVJ A;  2LJA A;  4QL9 A;  2C3N A;  3L4N A;  2CX4 A;  5CYY A;  3F63 A;  2A2R A;  3KMO A;  4I8B A;  1EEM A;  4EIP A;  5AGY A;  3C1S A;  2DMM A;  5JWO B;  1SD9 A;  2JAD A;  3HVX A;  2NPB A;  1ILO A;  3ZFB A;  3F6D A;  5ELA A;  3N5O A;  2K8V A;  5CRH A;  4KGI A;  4N10 A;  3V1W A;  2GZZ A;  5ECL B;  1T4Y A;  3TRX A;  1B4Q A;  1TRS A;  1F37 A;  1YKC A;  5A4U A;  2LRN A;  3IBH A;  1GUH A;  1T1V A;  5AN1 A;  5DJM A;  5HFK A;  3W8J A;  1WMJ A;  5G5E A;  4PX1 A;  1UN2 A;  1XOB A;  2QKE A;  1PSQ A;  3S9F A;  1W89 A;  3KH7 A;  2VCQ A;  4D73 B;  2JSZ A;  1SL0 B;  1Z9H A;  3GH6 A;  4AJ6 A;  5J9B A;  4MZB A;  4YKF A;  3LOR A;  1G7O A;  1TK5 B;  4G2E A;  4MP4 A;  3MYD A;  1GSS A;  22GS A;  3WYW A;  3GX8 A;  4PUR A;  4EIQ A;  2YPM A;  1S3D A;  2FY6 A;  3ERG A;  3LW9 A;  3RPP A;  1DBY A;  2MZC A;  2YZU A;  4DVC A;  1SD8 A;  3TKR A;  3LXT A;  2B1K A;  1LJR A;  4PUA A;  4YAV A;  4K9Z A;  3PGT A;  5B7C A;  2F9S A;  2LQQ A;  2YOI A;  2H01 A;  2WUL A;  2VOC A;  4YQV A;  4XIH A;  3LSZ A;  5ECN B;  1K0N A;  1TRV A;  4A5P A;  2NVL A;  1TKD B;  2LTK A;  5GAP D;  5J9C A;  1ERV A;  2CT6 A;  2H19 A;  3TKP A;  2R0C A;  5ENU A;  3KGK A;  4J57 E;  4V1A p;  2DIY A;  4HS1 A;  2MYG A;  3G7I A;  3F6F A;  1EOG A;  5HFG A;  1QXH A;  2A4H A;  3I43 A;  2I1U A;  1G7E A;  1DE1 A;  1NHO A;  6GSU A;  3GL3 A;  4F0B A;  3QOU A;  3UL3 A;  5IMZ A;  3IXR A;  17GS A;  3F0I A;  1T7P B;  4AGS A;  4JU5 A;  5G2Z A;  2VD1 A;  5EPF A;  2K6V A;  1TK8 B;  3EWL A;  2KHP A;  2YJ7 A;  2VCT A;  1TTZ A;  3Q18 A;  3IC8 A;  1EEJ A;  4IJ3 A;  2LV3 A;  3K8N A;  3IA1 A;  3P90 A;  4BPY A;  1ERW A;  3KM6 A;  4ZL7 A;  4Z7X A;  4ZBD A;  2H70 A;  3EU3 A;  13GS A;  1M9B A;  3FZ5 A;  2N5B A;  1O8W A;  3UBK A;  1RQM A;  2YN1 A;  1TW9 A;  4KND A;  4PNF A;  3TDG A;  4EVM A;  2WJU A;  2OAD A;  2LJK A;  3VPT A;  5DAK A;  2FWG A;  4MPG A;  2LNS A;  4NXI A;  2DKI A;  4LLR A;  5HQP A;  1SK2 A;  3HCZ A;  1YF0 A;  3IK7 A;  2VD0 A;  5J3R A;  2F8A A;  1GUL A;  1ZYN A;  2FD3 A;  1BQ7 A;  3IRA A;  1XWK A;  1OC9 B;  3NZN A;  4TXO B;  1M7T A;  3PPU A;  2HYX A;  1XIY A;  2QGV A;  3ZFL A;  2PVQ A;  1Z7R A;  4FYU A;  1F2E A;  2PN8 A;  2GZY A;  4TN8 A;  1YKA A;  1X9W B;  4F03 A;  1M0U A;  3GST A;  3RDW A;  2DC5 A;  5E4W A;  3E3E A;  3J7Y k;  2TIR A;  2PER A;  1AC1 A;  3APS A;  5DQS A;  1XWA A;  4POL A;  3F8U A;  3UOM A;  2ON5 A;  4TVE A;  2AHE A;  2N5F A;  4L5O A;  4V2M A;  2IMD A;  3VWV A;  4LL4 B;  3A2V A;  3HJO A;  3J7Y b;  1J9B A;  4IN0 A;  11GS A;  5HFI A;  2V1M A;  3HZ4 A;  4RI7 A;  4TXO A;  2XHF A;  4HJM A;  1F3A A;  2FCH A;  2IMK A;  1SKW B;  4IQ1 A;  4ICY A;  3KIJ A;  1TXX A;  2RM6 A;  3CTF A;  4AF2 A;  4BVY B;  1UA5 A;  4NHW A;  2YCD A;  3GX0 A;  3UIW A;  1SYR A;  2IFQ B;  3TKS A;  1PGT A;  2LUS A;  4ML6 A;  4KW6 A;  1M9A A;  4YKG A;  4EUY A;  4IHU A;  4HOJ A;  2R0G A;  4KB3 A;  4LA1 A;  3GKK A;  1K0A A;  4BVX A;  1FAA A;  1A2J A;  3ZVJ D;  3TGZ A;  1XW9 A;  5B6M A;  3EMX A;  2UZ8 A;  2LRT A;  4LMW A;  4FIW A;  1EP8 A;  3A5I A;  3WGX A;  2V6K A;  1ERU A;  3LG6 A;  2NDO A;  5B8A A;  1X5D A;  5FT3 A;  3A5W A;  2K9F A;  5ECM B;  1VF4 A;  1GH2 A;  1YEP A;  2GVP A;  1O81 A;  1WPI A;  3GN3 A;  4HQZ A;  1SL1 B;  2B7K A;  1OAZ A;  4G10 A;  5CAX A;  4TR3 A;  2ALB A;  2X64 A;  3DGQ A;  1PKZ A;  4XRD A;  4EKZ A;  4TKY A;  3KTB A;  3EC3 A;  2MMZ A;  5DDL A;  8GSS A;  4TOP A;  5D9W A;  3QD9 A;  4K7I A;  1ACV A;  1JLW A;  1ZYE A;  5A4W A;  4MJC A;  1VF2 A;  2HLS A;  1VRS D;  5J4U A;  4JR4 A;  5E59 A;  1ZZY A;  4GQF A;  4OFN A;  3RPN A;  4F2I A;  4YQU A;  4AJ8 A;  3QAV A;  2DJ3 A;  3HXS A;  1EWX A;  3QAW A;  4NPB A;  2R3X A;  3ZML A;  3DVW A;  4BWQ A; 
#chains in the Genus database with same CATH homology
 3HKR A;  2P5Q A;  4OWY A;  1XVW A;  2FWF A;  1IYH A;  4O7H A;  3C73 A;  2IN3 A;  1JLV A;  2HSM A;  2NBS A;  1YDK A;  2HRN A;  3BOA A;  16GS A;  2XBQ A;  3O76 A;  1HNB A;  2FLS A;  3ZZX A;  3IR4 A;  3TJG A;  4Z2U A;  1ZGN A;  4OO5 A;  2GLR A;  2GDR A;  1HD2 A;  4Q5Q A;  1QUW A;  2MMN A;  2OAC A;  5J5N A;  3C8E A;  4FYC A;  2WB9 A;  3IPZ A;  4G0L A;  3D4T A;  1YEX A;  3FZA A;  1FG4 A;  1GSE A;  3WT2 A;  1KNG A;  4K0N A;  4TXV A;  4OD7 A;  2FGX A;  1MDI A;  1FW1 A;  3E9J B;  4O5Q A;  2H75 A;  3DML A;  2G2Q A;  5IMA A;  2FA4 A;  4KX4 A;  3IV4 A;  3GRX A;  5ECK B;  3ZIT A;  4I97 A;  3VFI A;  2CZ3 A;  1S3C A;  1SEN A;  4GWR A;  2C8U A;  2VAF A;  4WF4 A;  2HZF A;  3FMW A;  1WRY A;  2KP1 A;  4ML1 A;  3FR9 A;  3A3T A;  3CMI A;  1EGR A;  5B8B A;  3GMF A;  4MZC A;  5D9X A;  1PMT A;  1R26 A;  1XCC A;  4GQC A;  2DJ2 A;  3CSI A;  2REM A;  4OFT A;  4ACS A;  1JFU A;  2B5Y A;  1OKT A;  1R5P A;  5EY6 A;  1XBS A;  2E2M A;  2B1L A;  4G0K A;  2H6X A;  4K2D A;  5HR1 A;  3F3Q A;  3HY2 A;  3FK8 A;  4N30 A;  2E7P A;  2QSI A;  2DJ0 A;  1M2D A;  5A5K A;  2I9H A;  1Q4J A;  3MDK A;  2H1A A;  4KDX A;  2RLI A;  2YWO A;  1EV9 A;  2LRC A;  4GSN A;  2E2G A;  3ZL5 A;  4OCE A;  3GL5 A;  2VO4 A;  4ZIJ A;  4ZXG A;  3GSS A;  3H1N A;  3CBU A;  4HZ2 A;  3ZYW A;  2LNT A;  3DYR A;  4ECJ A;  5BRT A;  3CYN A;  2YV9 A;  4CY6 A;  4POK A;  2NTO A;  1LBK A;  4HEA 2;  4MPF A;  1X5C A;  3WT1 A;  2WZ9 A;  4K8M A;  2K18 A;  4YQM A;  1B4P A;  4HJ2 A;  3WD6 A;  1O7U A;  3F4R A;  3ME8 A;  1YY7 A;  4F82 A;  3SWL A;  5F8B A;  1GNE A;  1ST9 A;  1KBN A;  1PL1 A;  4IS0 A;  1O8X A;  3DVX A;  3P2A A;  1TDI A;  3FR6 A;  5A4V A;  5IIZ A;  4NWY A;  5LD0 A;  3FZ4 A;  6GSX A;  4XRA A;  2C1Y A;  2LJR A;  3O6T A;  2H72 A;  3BCK A;  2XPD A;  4DEJ A;  2IMI A;  1F3B A;  1BJX A;  3W8S A;  2V41 A;  1CQH A;  4X4J A;  4L5L A;  3QR6 A;  4CDO A;  3IDV A;  2WDU A;  1GUK A;  3PIN A;  3GTU B;  1Y25 A;  3ERF A;  1E6B A;  4QQ7 A;  3KZQ A;  2DBC A;  4XTS A;  4BWS A;  2L5L A;  1ZYP A;  2O8V B;  1SK0 A;  1DE2 A;  4D73 A;  3EVI A;  2LEG A;  3VUR A;  3IAM 2;  4TR1 B;  1O85 A;  2H76 A;  4PXO A;  1K0O A;  1TRW A;  2R6K A;  3KH9 A;  1B8X A;  4BL7 B;  3WGD A;  3CRT A;  5ABR A;  4EE0 A;  1AAZ A;  2V6O A;  4XS1 A;  4GTU A;  3KMN A;  4PUF C;  2GZP A;  4RI6 A;  3LXZ A;  3H93 A;  3QDN A;  1FVK A;  1YQ1 A;  2MMO A;  1ON4 A;  2CVD A;  3HJM A;  3C1R A;  2YWN A;  4XS4 B;  2TRX A;  3QCP A;  2HFD A;  3TJF A;  5G30 A;  4MJE A;  1SJI A;  4GST A;  4TR1 A;  4PQ1 A;  1NM3 A;  1VF1 A;  1Z7P A;  4BL7 A;  1XXU A;  5DCH A;  4YAP A;  2VLV A;  2X49 A;  1FB0 A;  2F51 A;  1XWG A;  2O87 A;  4ECI A;  3IE3 A;  3U6V A;  5ECQ B;  1B48 A;  1THO A;  3D21 A;  2R0P A;  4QL7 A;  4MH3 A;  5C04 A;  4XS4 A;  1AQX A;  2OBK A;  5IPH A;  2PVO C;  3TJJ A;  4IGJ A;  3I69 A;  3SBC A;  5IPG A;  3L9U A;  4WXT A;  3IC4 A;  1ERT A;  4EC0 A;  2V2G A;  2CX3 A;  2X99 A;  2TRC P;  2M80 A;  2F3M A;  1GL8 A;  1A8Y A;  2YWI A;  2HE3 A;  1QGV A;  2WFC A;  1Z3E A;  5G1K A;  1JZW A;  4O5R A;  2DJJ A;  1U6T A;  2H0G A;  2VL2 A;  3EYT A;  5G31 A;  3LFL A;  1DUG A;  4ISD A;  2H0I A;  2JZR A;  1AW9 A;  3TKQ A;  4EDZ A;  5C00 A;  2H73 A;  2GGT A;  3L9V A;  2GSS A;  4PQI A;  1ML6 A;  2FHE A;  2HSY A;  3GKX A;  4FYB A;  5KOW A;  3D6I A;  4WF5 A;  4CHS A;  2AUV A;  3QPM A;  10GS A;  1OE7 A;  2IWT A;  2YZH A;  4JE1 A;  1E2Y A;  4K5S A;  1GSU A;  1TI3 A;  2VM2 A;  1TU7 A;  2G0F A;  2P0G A;  1G6Y A;  2H6Z A;  3DD3 A;  4RUV A;  4ULX A;  2CAI A;  2GT6 A;  3EPT A;  1OC9 A;  4NMU A;  3I6A A;  2DML A;  1PA3 A;  1GWC A;  4POB A;  2LS5 A;  3TOU A;  1F9M A;  3GKM A;  1EOH A;  1SL2 B;  4J56 E;  4USS A;  2M72 A;  4KH7 A;  3D22 A;  2R37 A;  4WET A;  2R2J A;  3NOF A;  5GZZ B;  3OR5 A;  3VLN A;  4JED A;  2MBT A;  2L6D A;  4EO3 A;  1T4Z A;  5F05 A;  4ZIL A;  5HR3 A;  1GLQ A;  2RUE A;  3N9J A;  1BG5 A;  1MTC A;  3GUS A;  1XZO A;  2XC2 A;  3IK9 A;  3TOT A;  3FHK A;  1MDK A;  2AB6 A;  4XHM A;  2AYT A;  3Q6O A;  4BVY A;  1YJ6 A;  2IFQ A;  1U3I A;  5KOX A;  4Q5N A;  2C0E A;  3ISO A;  5KEJ A;  4ZB6 A;  4KDY A;  1A24 A;  2CA8 A;  4I6X A;  1T00 A;  3M9J A;  1S3A A;  3M8N A;  1PL2 A;  1GSF A;  4LL1 B;  4K2X A;  5F0G A;  3FY7 A;  7GSS A;  4I2T A;  3H79 A;  1XVQ A;  5IOX A;  3HJP A;  3HDC A;  2JU5 A;  3GYK A;  2OE3 A;  4KSM A;  2N5A A;  1NHY A;  2L59 A;  1ZL9 A;  1LU4 A;  1AQV A;  1V2A A;  5DVB A;  5ECP B;  2IME A;  3CTG A;  3HZ8 A;  4IKH A;  4X0X A;  3IHG A;  1QMV A;  2H1G A;  4K6X A;  2CQ9 A;  3GHA A;  4AJ7 A;  2HT9 A;  2JZS A;  2L6C A;  3HHV A;  4POM A;  2YJH A;  3P7X A;  1ZYQ B;  1I9D A;  5JCW A;  4ZB9 A;  3D4M A;  4NAX A;  1M2A A;  2RM5 A;  4XCS A;  3FYG A;  2FNO A;  3APO A;  3HA9 A;  4J2F A;  4NV2 A;  4DSQ A;  3M3M A;  4YH2 A;  1M2B A;  2GQK A;  3JCM L;  3VWX A;  2L4Q A;  5GSS A;  1WOU A;  5L71 A;  3IOS A;  4KE3 A;  4WBR D;  5JCU A;  5IOW A;  5ID2 B;  2ON7 A;  1K3Y A;  2BTO T;  4ZBB A;  1BED A;  1NW2 A;  2DLX A;  3A2X A;  5EVO A;  1DSB A;  1SJ6 A;  2CZ2 A;  1QFN A;  4RQR A;  1BAY A;  4N11 A;  3G7Y A;  6GSV A;  2OA7 A;  3ZMK A;  4PQH A;  3L0H A;  1BYE A;  5HR0 A;  2O7K A;  5D9V A;  1XW6 A;  3UEM A;  4WEY A;  2H8L A;  1WJK A;  1U87 A;  3KCM A;  3NIV A;  3TJB A;  4E8H A;  4E8E A;  3MAK A;  4IQA A;  2LST A;  1CQG A;  2YP6 A;  2H1D A;  1V58 A;  3GNJ A;  1R4W A;  4KSO A;  4L0U A;  4RQX A;  2HRF A;  4MJB A;  3KP9 A;  1K3L A;  1FB6 A;  1JZO A;  4P3Y B;  5IMC A;  3GV1 A;  3KD0 A;  4Q5F A;  1OC8 A;  2X4A A;  3LGC A;  4Q5R A;  3TRP A;  2OBI A;  2VCX A;  2WGR A;  1FOV A;  5ECO B;  4MF6 A;  3UBL A;  14GS A;  4OMV A;  3VWW A;  1RK4 A;  1ZCP A;  2GS3 A;  3EIN A;  4EF0 A;  2FWE A;  2IIY A;  1AUC A;  1YF1 A;  1KTE A;  1B9X C;  20GS A;  1M99 A;  1TU8 A;  2I3Y A;  3O3T A;  1UVZ A;  1SYX A;  4OFM A;  3TKS C;  2YV7 A;  2A2P A;  1FOH A;  4L8E A;  2GTU A;  5DCG A;  6GST A;  4MJA A;  3AY8 A;  3IAS 2;  5G1L A;  1WWJ A;  3TCO A;  1GTA A;  1QQ2 A;  1TI1 A;  4G0I A;  4GRF A;  2XBI A;  2JL4 A;  2C0F A;  3HVS A;  1PN9 A;  2X8H A;  3ZLP A;  1SKS B;  3ZIV A;  3D5J A;  3QFB C;  2RII A;  1GSD A;  2GSR A;  5AIX A;  1YZX A;  4N0Z A;  5ELG A;  1A2M A;  1A2L A;  1A0F A;  1R7H A;  9GSS A;  3APQ A;  1PKW A;  2EC4 A;  4V2L A;  1GSY A;  2JZT A;  2IJY A;  4K0G A;  4KA0 A;  1THX A;  1ZOF A;  2H1B A;  2R4V A;  3LJR A;  4H86 A;  3UAP A;  4NV5 A;  1OC3 A;  4IP6 A;  2L57 A;  1PN0 A;  4JRR A;  3HVV A;  1K0D A;  2EIQ A;  3R3E A;  4EL1 A;  3QMX A;  1J08 A;  2B5X A;  1XWB A;  4HQS A;  3M0F A;  3FR3 A;  1XPV A;  4FH8 A;  2V32 A;  2OE1 A;  4OO4 A;  4X1U A;  5H5Q A;  1VF3 A;  1T3B A;  5INY A;  1AQW A;  5CO3 A;  3KXO A;  4EDY A;  2MBS A;  5DQY A;  4DSR A;  3VPQ A;  4GSS A;  2PMT A;  1JZD A;  2JSY A;  3UJ1 A;  2B7J A;  2ZNM A;  1F6M C;  5CRG A;  3CSH A;  2PWJ A;  1U88 A;  4IEL A;  6GSS A;  2PGT A;  3ED3 A;  3VI7 A;  3DWV A;  2FA8 A;  3FKF A;  1Z6N A;  3CSJ A;  4KUN A;  2JAC A;  3C7M A;  2LKU A;  1HYU A;  1Z6M A;  1GUM A;  2VIM A;  4TRX A;  4FQU A;  1N8J A;  4MLY A;  1WIK A;  2DSA A;  5G5F A;  4GCI A;  4CY8 A;  4PTS A;  2EIO A;  1ABA A;  1Q98 A;  2AJQ B;  3EUR A;  3KTL A;  3H4K A;  5COH A;  4OCF A;  5H5R A;  3DEX A;  2PUK C;  1MEK A;  4V2N A;  2PBJ A;  4L0W A;  2VLT A;  3ME7 A;  4TR0 A;  3US3 A;  4KF9 A;  2GQL A;  1OVN A;  1TRU A;  3EE2 A;  5DBQ A;  1XFL A;  4MH2 A;  3QFA C;  3UAR A;  3MIX A;  2MMA A;  3GTU A;  3LYP A;  3HD5 A;  2M46 A;  3Q74 A;  3UVT A;  2H30 A;  4O5U A;  3ZTL A;  1G0T A;  5DAL B;  1XW5 A;  5B6N A;  2KOK A;  4MNN A;  1JHB A;  1TOF A;  2KLX A;  5KN1 A;  3CRU A;  3RHC A;  5KN3 A;  5GAN D;  1WE0 A;  2A4V A;  3Q19 A;  2WRT A;  1TK0 B;  1XWC A;  3UVH A;  4FO5 A;  4KDU A;  2H71 A;  1BX9 A;  1V9W A;  2B5E A;  2VUP A;  2K8S A;  4IBP A;  2KUC A;  5D73 A;  3MNG A;  2YAN A;  1PD2 1;  1H75 A;  2HI7 A;  2DIZ A;  3IHQ A;  1X9S B;  4NHZ A;  5D8I A;  5DAL A;  3ERW A;  1SK1 A;  2F8F A;  3TKS E;  1MD4 A;  2C0D A;  2DKH A;  4MAB A;  2J23 A;  3LWA A;  3PH9 A;  5J41 A;  5DAK B;  3F4S A;  3U5R E;  3ZVJ A;  4MZW A;  1FO5 A;  1XOA A;  4K1F A;  4WR5 A;  4I5Q A;  3BBY A;  3DKS A;  3BD2 A;  5IO2 A;  2DJ1 A;  5ECS A;  4MF5 A;  3G7J A;  1OYJ A;  2H74 A;  3DXB A;  4ZL8 A;  3VI5 A;  6GSW A;  1UC7 A;  1MDJ A;  5LCZ A;  4IW9 A;  5IO0 A;  2HXK A;  2O85 A;  3ZIJ A;  4PNG A;  1PX6 A;  3G9B A;  2FUG 2;  1X5E A;  5GST A;  1HNC A;  4F9Z A;  2CVB A;  2R5G A;  1HNA A;  1Y6E A;  1NSW A;  2VCV A;  2H66 A;  5H5S A;  2EIR A;  1SU9 A;  1KEB A;  4EXJ A;  1SJZ A;  5JWQ B;  1PRX A;  2ZUP A;  3DIE A;  1GRX A;  3RBT A;  2VL3 A;  2C4J A;  2YNX A;  1WP0 A;  1TP9 A;  4GLT A;  3D0Z A;  2I4A A;  1V98 A;  3BCI A;  2CAQ A;  4Z2T A;  4ECB A;  3I9V 2;  4V1A g;  1A8L A;  3TB2 A;  1N2A A;  1RW1 A;  2HRK A;  3WGE A;  5CRW A;  4TW5 A;  4BVX B;  1PQN A;  4MA9 A;  2GSQ A;  5BMU A;  4ZL9 A;  2PU9 C;  12GS A;  2B6M A;  2HRA A;  2YWM A;  4N0V A;  1USB A;  5ECR B;  2IL3 A;  2GT5 A;  3F9U A;  3MSZ A;  2P5R A;  1GTB A;  5JWR B;  2OKA A;  4JR6 A;  4GF0 A;  1C72 A;  2C3T A;  2Z9S A;  4O92 A;  2ZCT A;  1I5G A;  4KAE A;  1SKR B;  4JZQ A;  4K7N A;  2X8G A;  5CNW A;  2CV4 A;  1X0R A;  4HDE A;  5CRE A;  2C0G A;  5AIV A;  4Z2R A;  1VGL A;  2IPA A;  1QK8 A;  3C71 A;  3ZRE A;  2HZE B;  4ZBA A;  1GNW A;  5F07 A;  1ZMA A;  2QA2 A;  2D2Z A;  4I2U A;  19GS A;  1A0R P;  2FWH A;  5CRD A;  4PGT A;  1EP7 A;  4HZ4 A;  2VLU A;  4ZB8 A;  3GUR A;  3LQ7 A;  3KEB A;  5IMD A;  2VL9 A;  4HI7 A;  5KN0 A;  4K7O A;  4WR4 A;  5AIS A;  2VCZ A;  5IMF A;  3EMP A;  5DJL A;  2HZE A;  2B3S A;  2VM1 A;  3L9S A;  3GH9 A;  4HU9 A;  2OJL A;  2WCI A;  3W6G A;  5FHI A;  3DRN A;  3GIX A;  4MCU A;  4TR4 A;  4X43 A;  3P8W A;  3CXG A;  2GST A;  3KJY A;  2CVK A;  2L4C A;  4XS6 A;  4ID0 A;  3TJK A;  4WKW A;  1U3A A;  3RAZ A;  1O6J A;  3F3R A;  2OE0 A;  2WS2 A;  2I81 A;  3EU4 A;  3RHB A;  4HU7 A;  5ECH B;  1MD3 A;  1W4V A;  4MK3 A;  2E0Q A;  2J9H A;  5CP1 A;  3PR8 A;  4G19 A;  1EV4 A;  1K0B A;  2H6Y A;  1FHE A;  2XPE A;  1X9M B;  1EGO A;  5IMV A;  2A2S A;  5D93 A;  1Z5Y E;  2HNL A;  1R5A A;  1V57 A;  2L5O A;  1PX7 A;  1OE8 A;  5KN2 A;  2AV4 A;  1K0C A;  1K3O A;  1OKD A;  2KP2 A;  18GS A;  1J0F A;  2QA1 A;  3BJ5 A;  3M1G A;  3GKN A;  1A23 A;  5F06 A;  3TUE A;  4K5R A;  4CW9 A;  3FZ9 A;  3H8Q A;  5D96 A;  2VL2 C;  2PPT A;  3LYK A;  2X8C A;  5IQY A;  3R2Q A;  5FWG A;  2C80 A;  2O89 A;  3M9K A;  4KCE A;  4KCA A;  3QAG A;  2VCW A;  6GSY A;  3FRC A;  1HQO A;  4JBB A;  3A2W A;  3HYP A;  4MF7 A;  5LNK e;  4IP1 A;  5ID2 A;  1K0M A;  1JZR A;  3UMA A;  1T8E B;  4LMV A;  1B9Y C;  1GLP A;  2RUF A;  4IVF A;  4G9H A;  1GP1 A;  4ILF A;  2BMX A;  3FEU A;  3GA4 A;  4MMM A;  5D9T A;  2HSH A;  1URM A;  4DSS B;  4ECC A;  1IYI A;  1AXD A;  2ES7 A;  3VK9 A;  2BJX A;  1G6W A;  2P31 A;  5HR2 A;  1H4O A;  5IM9 A;  4F0C A;  3LEF A;  1O73 A;  4O32 A;  2AAW A;  3TRQ A;  4IJI A;  2LQO A;  3KP8 A;  1GTU A;  1GTI A;  4HUA A;  3FW2 A;  5EL8 A;  2DJK A;  3VWU A;  2GQM A;  4DSS A;  4BA7 A;  3GFK A;  2C3Q A;  2IMF A;  2H0H A;  2QC7 A;  4WBJ A;  1TJD A;  5JCG A;  4GXZ A;  1AIU A;  1GSQ A;  1V40 A;  3L78 A;  3F4T A;  3ZRD A;  3E0U A;  3MWH A;  5ECI B;  4MDC A;  1EZK A;  1FVJ A;  2LJA A;  4QL9 A;  2C3N A;  3L4N A;  2CX4 A;  5CYY A;  3F63 A;  2A2R A;  3KMO A;  4I8B A;  1EEM A;  4EIP A;  5AGY A;  3C1S A;  2DMM A;  5JWO B;  1SD9 A;  2JAD A;  3HVX A;  2NPB A;  1ILO A;  3ZFB A;  3F6D A;  5ELA A;  3N5O A;  2K8V A;  5CRH A;  4KGI A;  4N10 A;  3V1W A;  2GZZ A;  5ECL B;  1T4Y A;  3TRX A;  1B4Q A;  1TRS A;  1F37 A;  1YKC A;  5A4U A;  2LRN A;  3IBH A;  1GUH A;  1T1V A;  5AN1 A;  5DJM A;  5HFK A;  3W8J A;  1WMJ A;  5G5E A;  4PX1 A;  1UN2 A;  1XOB A;  2QKE A;  1PSQ A;  3S9F A;  1W89 A;  3KH7 A;  2VCQ A;  4D73 B;  2JSZ A;  1SL0 B;  1Z9H A;  3GH6 A;  4AJ6 A;  5J9B A;  4MZB A;  4YKF A;  3LOR A;  1G7O A;  1TK5 B;  4G2E A;  4MP4 A;  3MYD A;  1GSS A;  22GS A;  3WYW A;  3GX8 A;  4PUR A;  4EIQ A;  2YPM A;  1S3D A;  2FY6 A;  3ERG A;  3LW9 A;  3RPP A;  1DBY A;  2MZC A;  2YZU A;  4DVC A;  1SD8 A;  3TKR A;  3LXT A;  2B1K A;  1LJR A;  4PUA A;  4YAV A;  4K9Z A;  3PGT A;  5B7C A;  2F9S A;  2LQQ A;  2YOI A;  2H01 A;  2WUL A;  2VOC A;  4YQV A;  4XIH A;  3LSZ A;  5ECN B;  1K0N A;  1TRV A;  4A5P A;  2NVL A;  1TKD B;  2LTK A;  5GAP D;  5J9C A;  1ERV A;  2CT6 A;  2H19 A;  3TKP A;  2R0C A;  5ENU A;  3KGK A;  4J57 E;  4V1A p;  2DIY A;  4HS1 A;  2MYG A;  3G7I A;  3F6F A;  1EOG A;  5HFG A;  1QXH A;  2A4H A;  3I43 A;  2I1U A;  1G7E A;  1DE1 A;  1NHO A;  6GSU A;  3GL3 A;  4F0B A;  3QOU A;  3UL3 A;  5IMZ A;  3IXR A;  17GS A;  3F0I A;  1T7P B;  4AGS A;  4JU5 A;  5G2Z A;  2VD1 A;  5EPF A;  2K6V A;  1TK8 B;  3EWL A;  2KHP A;  2YJ7 A;  2VCT A;  1TTZ A;  3Q18 A;  3IC8 A;  1EEJ A;  4IJ3 A;  2LV3 A;  3K8N A;  3IA1 A;  3P90 A;  4BPY A;  1ERW A;  3KM6 A;  4ZL7 A;  4Z7X A;  4ZBD A;  2H70 A;  3EU3 A;  13GS A;  1M9B A;  3FZ5 A;  2N5B A;  1O8W A;  3UBK A;  1RQM A;  2YN1 A;  1TW9 A;  4KND A;  4PNF A;  3TDG A;  4EVM A;  2WJU A;  2OAD A;  2LJK A;  3VPT A;  5DAK A;  2FWG A;  4MPG A;  2LNS A;  4NXI A;  2DKI A;  4LLR A;  5HQP A;  1SK2 A;  3HCZ A;  1YF0 A;  3IK7 A;  2VD0 A;  5J3R A;  2F8A A;  1GUL A;  1ZYN A;  2FD3 A;  1BQ7 A;  3IRA A;  1XWK A;  1OC9 B;  3NZN A;  4TXO B;  1M7T A;  3PPU A;  2HYX A;  1XIY A;  2QGV A;  3ZFL A;  2PVQ A;  1Z7R A;  4FYU A;  1F2E A;  2PN8 A;  2GZY A;  4TN8 A;  1YKA A;  1X9W B;  4F03 A;  1M0U A;  3GST A;  3RDW A;  2DC5 A;  5E4W A;  3E3E A;  3J7Y k;  2TIR A;  2PER A;  1AC1 A;  3APS A;  5DQS A;  1XWA A;  4POL A;  3F8U A;  3UOM A;  2ON5 A;  4TVE A;  2AHE A;  2N5F A;  4L5O A;  4V2M A;  2IMD A;  3VWV A;  4LL4 B;  3A2V A;  3HJO A;  3J7Y b;  1J9B A;  4IN0 A;  11GS A;  5HFI A;  2V1M A;  3HZ4 A;  4RI7 A;  4TXO A;  2XHF A;  4HJM A;  1F3A A;  2FCH A;  2IMK A;  1SKW B;  4IQ1 A;  4ICY A;  3KIJ A;  1TXX A;  2RM6 A;  3CTF A;  4AF2 A;  4BVY B;  1UA5 A;  4NHW A;  2YCD A;  3GX0 A;  3UIW A;  1SYR A;  2IFQ B;  3TKS A;  1PGT A;  2LUS A;  4ML6 A;  4KW6 A;  1M9A A;  4YKG A;  4EUY A;  4IHU A;  4HOJ A;  2R0G A;  4KB3 A;  4LA1 A;  3GKK A;  1K0A A;  4BVX A;  1FAA A;  1A2J A;  3ZVJ D;  3TGZ A;  1XW9 A;  5B6M A;  3EMX A;  2UZ8 A;  2LRT A;  4LMW A;  4FIW A;  1EP8 A;  3A5I A;  3WGX A;  2V6K A;  1ERU A;  3LG6 A;  2NDO A;  5B8A A;  1X5D A;  5FT3 A;  3A5W A;  2K9F A;  5ECM B;  1VF4 A;  1GH2 A;  1YEP A;  2GVP A;  1O81 A;  1WPI A;  3GN3 A;  4HQZ A;  1SL1 B;  2B7K A;  1OAZ A;  4G10 A;  5CAX A;  4TR3 A;  2ALB A;  2X64 A;  3DGQ A;  1PKZ A;  4XRD A;  4EKZ A;  4TKY A;  3KTB A;  3EC3 A;  2MMZ A;  5DDL A;  8GSS A;  4TOP A;  5D9W A;  3QD9 A;  4K7I A;  1ACV A;  1JLW A;  1ZYE A;  5A4W A;  4MJC A;  1VF2 A;  2HLS A;  1VRS D;  5J4U A;  4JR4 A;  5E59 A;  1ZZY A;  4GQF A;  4OFN A;  3RPN A;  4F2I A;  4YQU A;  4AJ8 A;  3QAV A;  2DJ3 A;  3HXS A;  1EWX A;  3QAW A;  4NPB A;  2R3X A;  3ZML A;  3DVW A;  4BWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...