2AUVA

Solution structure of hndac : a thioredoxin-like [2fe-2s] ferredoxin involved in the nadp-reducing hydrogenase complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
85
structure length
85
Chain Sequence
MVPKGKYPISVCMGTACFVKGADKVVHAFKEQLKIDIGDVTPDGRFSIDTLRCVGGCALAPIVMVGEKVYGNVTPGQVKKILAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords potential NAD-reducing hydrogenase subunit
publication title Solution structure of HndAc: a thioredoxin-like domain involved in the NADP-reducing hydrogenase complex
pubmed doi rcsb
source organism Desulfovibrio fructosovorans
molecule tags Oxidoreductase
total genus 12
structure length 85
sequence length 85
ec nomenclature ec 1.12.1.3: Hydrogen dehydrogenase (NADP(+)).
pdb deposition date 2005-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2auvA00
4TXOB 1XWBA 2VAFA 3D0ZA 1Z7RA 1X9MB 3NOFA 3O6TA 1S3AA 4OFTA 1KEBA 5JWRB 1GUMA 2DJJA 3M0FA 1YY7A 3M9KA 4ECIA 1MD3A 4F2IA 3FKFA 3KZQA 3KXOA 3TJKA 1F37A 2FWFA 1M2DA 1YEXA 5DCHA 3I69A 1OKTA 3F63A 2VM1A 4Q5QA 4ZB9A 3TKQA 4MJCA 1QFNA 4XTSA 2H75A 3GL3A 3CBUA 2MMNA 4EKZA 4POLA 3CRTA 19GSA 1N8JA 1PGTA 1SL1B 3KD0A 4PUAA 2LJAA 2LSTA 2IMEA 4GTUA 1FW1A 4O32A 2MYGA 2L5OA 2BMXA 3ZL5A 3C73A 4NPBA 2LRCA 5B8BA 1Z5YE 1ABAA 2GS3A 1K3LA 3LFLA 4CW9A 4KNDA 3ZMKA 4IHUA 3UJ1A 1UC7A 4TR4A 5ID2B 4YH2A 4WKWA 1M99A 5IMCA 1V40A 4HZ4A 4IP6A 1SJIA 1A0FA 2X64A 1ERTA 4RQXA 1DBYA 2AYTA 4MJBA 2GZYA 4YQVA 3GRXA 5DALA 2V2GA 4V2MA 4J2FA 2JZTA 1XBSA 2TIRA 3N5OA 5HFIA 3RPPA 3HJMA 3H4KA 4XS1A 4MJEA 4TXOA 2H6ZA 4MPFA 5DAKB 5DDLA 3F6FA 2LNTA 4MH2A 3VWXA 2FD3A 4L0UA 4EO3A 3CSJA 4NV5A 2PVQA 1YF0A 2C1YA 2VL2C 2DJ0A 2PWJA 1UA5A 1W89A 4QL7A 1GWCA 2IJYA 2GGTA 4J57E 1DE1A 1N2AA 3HVXA 4WF5A 4DEJA 3HDCA 2GLRA 3QAVA 2DC5A 3ZLPA 3ZFLA 3HXSA 2C0GA 3Q19A 1U3IA 1EP8A 2IMKA 3ERWA 3MSZA 2HT9A 2A2RA 3NIVA 1A2JA 3L9VA 3R2QA 4WR5A 1XWAA 3ZREA 2K6VA 3M8NA 1USBA 1GTBA 1QMVA 1VRSD 4WBJA 5ID2A 3WYWA 1ZCPA 4XCSA 3DVWA 3GURA 4NXIA 18GSA 3LSZA 4GQFA 2DJ3A 3A2VA 5F8BA 3ERGA 2KHPA 1GSUA 2M80A 2AJQB 4LLRA 3FZ9A 1T8EB 2YWIA 2NBSA 1JZOA 5H5SA 5G5EA 1F2EA 4E8EA 1VF2A 1DUGA 2FCHA 5HFKA 1CQGA 1O85A 1CQHA 1OC8A 1V57A 4HJ2A 4MMMA 1WMJA 4KDUA 2EIQA 1GUHA 1T4YA 1T4ZA 2XBIA 1GSDA 4Q5FA 13GSA 3FR9A 2I3YA 5ECNB 4KX4A 1JLVA 5CYYA 4PURA 2QGVA 2OE0A 1GP1A 1V98A 2CAIA 3VWWA 2G0FA 2HLSA 1AQXA 1PKWA 1XW9A 1ZMAA 3P8WA 1M2AA 2JADA 4GRFA 4ACSA 1Z3EA 2VLVA 3US3A 1E6BA 2LKUA 2VCWA 3TJFA 2DSAA 5E59A 4MF7A 3IR4A 16GSA 3F6DA 1ILOA 2QSIA 1WP0A 2MBTA 3FZAA 2CVDA 4ZXGA 3EWLA 4DSSB 2GT5A 5HFGA 1IYIA 3O76A 5EY6A 2F8FA 1EEMA 4IBPA 2M46A 3RAZA 4BL7A 4XS6A 3ME7A 3TJJA 1U6TA 2LS5A 3VFIA 3IXRA 2H72A 2LRTA 1ERWA 1F3AA 4JU5A 3DVXA 4HDEA 2LEGA 1IYHA 4ZL7A 1PX6A 3QAGA 2HNLA 3GMFA 3KTLA 5DVBA 1YJ6A 1R5PA 5E4WA 3BBYA 4TR0A 22GSA 1JZWA 1TI1A 4K9ZA 3M1GA 2AUVA 3GA4A 5AISA 3DD3A 6GSUA 6GSWA 2ZNMA 3W8SA 5J9CA 4PNFA 3TKPA 1SD8A 1Y6EA 2JU5A 2H8LA 5ECKB 1G6WA 2CV4A 4F0BA 3DRNA 3IBHA 4MF6A 3RDWA 4CDOA 4Q5NA 5D73A 5ECOB 4MZWA 4V1Ag 1X0RA 4YAVA 2FWEA 2R3XA 2B5YA 3GFKA 5HR3A 3GKMA 4J56E 5LCZA 1QUWA 2J23A 1G7EA 2GQKA 4GWRA 4KGIA 3TRPA 2B1LA 2ZCTA 4DSSA 1A24A 2YWMA 1ERVA 3GSSA 5GAPD 3KMNA 5G1KA 4PQIA 1WOUA 2GDRA 2B6MA 4EE0A 4KDXA 5F0GA 5G5FA 1G6YA 2PUKC 3QAWA 4GXZA 5F07A 8GSSA 3D22A 2RM5A 2YJHA 1HD2A 4K7NA 3GTUB 4NWYA 2WZ9A 2NTOA 3QCPA 4KUNA 5JCUA 4ECCA 3G7IA 5ECLB 2WJUA 2Z9SA 2C80A 4ECJA 3TDGA 2IL3A 6GSVA 2IPAA 6GSYA 3DIEA 3HKRA 1A23A 2K8VA 4K2DA 3EMPA 3ZTLA 1K0CA 2O89A 2R4VA 1EGOA 1TI3A 1TXXA 2LQOA 2WFCA 1GNWA 2MZCA 1S3CA 1SD9A 2L6DA 4POMA 4EDZA 4OFMA 3U6VA 3C7MA 2B5XA 2K18A 3LGCA 4ECBA 1XOBA 4GQCA 2PGTA 2VL3A 3WT1A 1BJXA 1SJ6A 5B6NA 1SU9A 2DLXA 5GSSA 3ZVJA 2JSYA 4F03A 1GSFA 1KNGA 3UVHA 4I6XA 2WDUA 2YANA 2YV7A 3HZ4A 2AV4A 2NDOA 5CRDA 4TVEA 2FNOA 1TRWA 2RLIA 3RBTA 1Z9HA 1FOVA 1PMTA 2HXKA 2HRFA 5ECRB 2CX3A 5KEJA 3DMLA 4TOPA 1EGRA 3KGKA 5ABRA 3HCZA 1GSQA 5F06A 2GZZA 1F9MA 3D5JA 3I43A 4TRXA 2YZUA 3GTUA 3HHVA 4V1Ap 5AIVA 1GTAA 4OWYA 3HD5A 1M2BA 4IQ1A 2GSTA 1GUKA 4G19A 1TU8A 3LEFA 3IAS2 5HR2A 2IFQB 4L8EA 5HR0A 3APSA 14GSA 3ZVJD 4MLYA 2H1DA 2VIMA 2L4CA 3C1SA 1I5GA 3GKKA 4KSMA 3M3MA 4D73B 1DSBA 2E7PA 3LXZA 2DMMA 3IK7A 2EIRA 2WGRA 1XCCA 5JCGA 5A5KA 5IMAA 4WF4A 1GLPA 4YQMA 3TGZA 2HRNA 3UAPA 4BWSA 2DBCA 3TKSE 2PBJA 3BCKA 3GN3A 4BPYA 5D9TA 2A2SA 2H71A 4KSOA 4LA1A 2G2QA 3BD2A 4EVMA 1XPVA 2CX4A 2L57A 1O7UA 4K7OA 4LMWA 2YJ7A 5J9BA 3QFAC 1XWCA 3K8NA 3GYKA 2DIYA 1ZGNA 3NZNA 1ON4A 2CVKA 3UBLA 1NW2A 2CT6A 3GSTA 1EWXA 5KN3A 3QOUA 1QK8A 4LL4B 1TK0B 2VO4A 4WBRD 1WRYA 5LNKe 1YKAA 3Q6OA 1UVZA 2I9HA 1SKSB 3IOSA 3KH9A 1U3AA 3FR6A 1XW5A 3N9JA 5IMVA 3M9JA 3FRCA 3WGDA 3D4MA 2IFQA 4Z7XA 3VPQA 1R4WA 2LJKA 2KOKA 1B9XC 5ECQB 4XRDA 4ZBAA 4D73A 3TCOA 2LV3A 3EURA 3EVIA 1PX7A 1DE2A 4PNGA 1YZXA 4HI7A 4KH7A 3EMXA 2OJLA 1WE0A 2VL9A 3HYPA 3IRAA 3TRQA 2XBQA 1J9BA 4WEYA 3TRXA 4FO5A 1B48A 3KJYA 4PQ1A 3PH9A 5A4UA 1K0DA 4LL1B 1GSSA 2AHEA 3TUEA 1Q98A 4TR3A 4ID0A 4DSRA 4FIWA 1ST9A 1F6MC 1OE8A 5H5QA 3FYGA 5IOWA 2MBSA 1B4QA 5FT3A 1EV4A 2WCIA 3UEMA 4MZCA 4GF0A 3VWVA 2GSSA 2B5EA 4CHSA 5AIXA 2JZRA 1XVQA 2WRTA 4MP4A 5ECIB 3GHAA 3CRUA 4V2NA 2V41A 1KBNA 1VF4A 1YDKA 2OBKA 2H1AA 3TKSA 2YN1A 2CVBA 2R6KA 5COHA 4PGTA 4HUAA 2RUEA 1RQMA 4MH3A 3ISOA 1U87A 3I6AA 5GAND 2R5GA 3O3TA 1X5EA 4P3YB 1K0OA 1M9AA 1JHBA 1Z6NA 2F8AA 4RQRA 4PQHA 3KCMA 3GV1A 3LXTA 4IP1A 4HS1A 4FYBA 2R2JA 4KB3A 1UN2A 4EC0A 2YV9A 4EXJA 2OA7A 4DSQA 1THOA 4G9HA 2GSRA 2PERA 5H5RA 3J7Yk 4BWQA 3KEBA 3F3QA 1O8XA 3DYRA 1VF1A 2V32A 3P90A 4ZBDA 3LWAA 3PINA 3EYTA 4MPGA 1HNBA 1R7HA 3W8JA 2VCQA 3ZYWA 1HYUA 4JEDA 3TJBA 1G7OA 1A2MA 5ENUA 2KP2A 2JSZA 1XWKA 1GH2A 2HZFA 1T00A 4WR4A 1THXA 2H19A 2N5FA 1JZDA 4X43A 5DCGA 2YWOA 3C1RA 3GUSA 2C3QA 3A5WA 3G7YA 4ML6A 2DMLA 1QGVA 4X0XA 5CNWA 3PR8A 3E9JB 1MDKA 4GCIA 3WGEA 2P0GA 2IWTA 5J41A 2VLTA 1AIUA 4OMVA 1TK8B 3VLNA 4O5RA 4NHWA 2VL2A 2PU9C 5ECMB 4V2LA 5DJMA 3C71A 3F4TA 4I97A 5GZZB 1EOGA 5G31A 3SBCA 4KCEA 1XZOA 3CTFA 2LRNA 2C8UA 2XC2A 3DEXA 3A2XA 3E0UA 3BCIA 4I2TA 2ALBA 1EOHA 4AJ8A 1JFUA 3CXGA 3V1WA 2H30A 4N10A 1O6JA 4MABA 3GNJA 4H86A 1V2AA 5C00A 1A8LA 3QR6A 3GIXA 1BG5A 1FG4A 3DKSA 2MMZA 3HVSA 2CZ2A 3Q74A 3HA9A 2VCZA 1BYEA 3CYNA 2B3SA 1TKDB 3UL3A 4HOJA 4ILFA 1FVJA 3KTBA 4XRAA 3MNGA 4IVFA 1PA3A 2F51A 1GLQA 4AJ7A 4ZL9A 1GSYA 3BOAA 4E8HA 2WB9A 2O7KA 2KLXA 4K7IA 2REMA 2YCDA 4ZB8A 4IJ3A 2ON5A 1SK0A 5ECPB 1K0BA 3QFBC 4N0ZA 5IM9A 2F9SA 12GSA 1T3BA 3ZMLA 3IPZA 5IO0A 1TRVA 1XVWA 2WS2A 4IJIA 3VWUA 4IS0A 1PL1A 1R5AA 4XHMA 3TJGA 5IPGA 4OD7A 1YF1A 4FYUA 5J4UA 4XS4B 2I1UA 2HYXA 5CO3A 1PL2A 3MDKA 4TXVA 1GSEA 1OKDA 3ZFBA 4K0NA 1Z6MA 5CAXA 4ZIJA 3D4TA 2R37A 3GX0A 3VI5A 4NV2A 4HQZA 4IQAA 3QMXA 3FK8A 4ZB6A 1O81A 1OE7A 1WIKA 2HE3A 4NHZA 3APQA 2LTKA 1WPIA 2C3TA 3KH7A 4EDYA 1SL0B 3H1NA 3EE2A 4HJMA 3MWHA 1GL8A 5EVOA 2HSYA 1GULA 2O8VB 4KE3A 1HNCA 2NPBA 4PUFC 5GSTA 1TW9A 2HFDA 5B7CA 5HR1A 7GSSA 2LJRA 3VI7A 9GSSA 1NHOA 3C8EA 3ZIJA 1G0TA 1TDIA 3RHCA 2IIYA 2EC4A 2XPEA 2FHEA 1GTUA 3SWLA 4X1UA 2P5RA 5LD0A 2VOCA 2K9FA 5IPHA 1X9SB 4JR6A 5JWQB 4PX1A 3BJ5A 2X8HA 5AN1A 4K8MA 4ML1A 1XFLA 1B4PA 2AB6A 2E0QA 4YQUA 1PN9A 2V6OA 2VCTA 4MJAA 5G1LA 1AC1A 4XS4A 1X9WB 2JZSA 3GH6A 4POKA 3MAKA 2IMDA 2FA8A 2J9HA 2YNXA 4BVXA 2TRCP 4JBBA 2FLSA 3TKRA 3EINA 5EPFA 2A4VA 5CRGA 4KDYA 4L0WA 5G30A 2GZPA 1TU7A 1XIYA 2C0DA 3TKSC 2PPTA 3HJPA 3IAM2 4EL1A 4GLTA 1TTZA 2OADA 3G7JA 4KA0A 5J3RA 2H1GA 3F3RA 2L6CA 3HVVA 4K6XA 2ES7A 4TW5A 5B6MA 1JLWA 1V58A 1J0FA 1SL2B 4MA9A 2B7KA 2ZUPA 3WT2A 2XPDA 1K3YA 1ZOFA 4Q5RA 2QKEA 4O7HA 5KN2A 3P2AA 3LYKA 4ZBBA 1NHYA 3OR5A 3UOMA 3VURA 3ME8A 3FHKA 4OCFA 4AJ6A 5CP1A 2FY6A 4F82A 2HSHA 4POBA 5ELAA 4JR4A 4OO5A 4HU9A 2E2GA 3PGTA 1MDIA 4MDCA 4K1FA 4QL9A 2D2ZA 1XW6A 1W4VA 5IMFA 3CTGA 4NMUA 4JRRA 11GSA 3IK9A 1FB0A 1Y25A 5A4VA 2KP1A 3D6IA 1MTCA 2ON7A 4BA7A 3L78A 5C04A 4RUVA 5B8AA 1R26A 5IQYA 2JL4A 3CMIA 1PQNA 2E2MA 5G2ZA 3FW2A 1BQ7A 2PVOC 2GTUA 2BTOT 4HEA2 1TK5B 2GQMA 3FZ4A 2GQLA 2YWNA 1K0MA 4N0VA 1LBKA 2LQQA 2F3MA 3W6GA 3ZITA 3ED3A 1NM3A 2DJ1A 4ISDA 5HQPA 1AXDA 3IC4A 1T7PB 1YEPA 5IIZA 2H0GA 5EL8A 4DVCA 1EEJA 3IE3A 5D8IA 3EU4A 1GRXA 3L9UA 4AF2A 4FYCA 1TRUA 10GSA 5F05A 1ACVA 4G2EA 1XWGA 4BVYA 3HY2A 2OE3A 3L4NA 1OC3A 1SKRB 1OVNA 1FO5A 2VD0A 1O8WA 1OAZA 1TJDA 1ML6A 3ZZXA 2LNSA 2KUCA 5J5NA 1HQOA 1K0NA 2OACA 4L5OA 1OC9B 5DBQA 4WXTA 2FUG2 4K0GA 3J7Yb 4IW9A 1A2LA 4MK3A 1A8YA 1YQ1A 3TOUA 4I5QA 5INYA 4TN8A 5D96A 1Q4JA 3UMAA 2JACA 1B8XA 3E3EA 1PKZA 3LQ7A 4IELA 4ZL8A 4IKHA 1AW9A 4N30A 3RHBA 4L5LA 1EZKA 1LU4A 1RK4A 4IGJA 1QQ2A 2YOIA 3EC3A 1X5DA 3FEUA 2GSQA 1GNEA 1MEKA 3H8QA 6GSSA 3CSIA 2H6XA 4GSNA 1O73A 4EUYA 2GT6A 3FZ5A 3H93A 4HQSA 4PXOA 5ELGA 1SENA 5CREA 4MCUA 1M0UA 3RPNA 3H79A 5DAKA 3A2WA 2O85A 5JCWA 2V6KA 4TKYA 1ERUA 5D9XA 3VK9A 2M72A 3QPMA 5IOXA 3UIWA 4AGSA 2N5AA 1QXHA 4MF5A 4OCEA 3LYPA 5CRHA 1SKWB 2OBIA 5D9VA 1AQVA 2IN3A 2FGXA 2H6YA 1FVKA 2C3NA 1A0RP 4RI6A 2VCXA 2H0HA 3F4SA 4GSSA 2AAWA 2YPMA 3F0IA 1SYXA 3LORA 2PMTA 6GSTA 3AY8A 3TB2A 1EV9A 3ZRDA 2LUSA 1ZYQB 2BJXA 2MMOA 2FWHA 1T1VA 1JZRA 1OC9A 1LJRA 2RM6A 3GL5A 2X8GA 1M9BA 3F8UA 5FWGA 4GSTA 2FA4A 2C4JA 4KAEA 2L59A 1SJZA 1RW1A 4EF0A 3IDVA 2IMFA 2VUPA 3APOA 1ZZYA 4OO4A 1AAZA 4KW6A 2OE1A 3IA1A 17GSA 5ECSA 4JE1A 2P5QA 3IV4A 3D21A 2H01A 5DQSA 3JCML 1E2YA 1BEDA 1PD21 2I4AA 1NSWA 2HZEB 3UARA 2X99A 3HJOA 3S9FA 20GSA 3P7XA 2VLUA 1X5CA 3ERFA 1URMA 4NAXA 4I8BA 5D93A 1TRSA 1S3DA 3GH9A 2DJKA 1HNAA 2X8CA 2VD1A 3LJRA 4RI7A 2TRXA 2H0IA 4WETA 1TOFA 3VPTA 2IMIA 3HZ8A 1BAYA 1B9YC 1V9WA 5KN0A 2C0EA 2RIIA 1GTIA 6GSXA 2RUFA 3KMOA 3KIJA 2FWGA 2H66A 3LG6A 5A4WA 4XIHA 3I9V2 3IHQA 1AQWA 5L71A 2B1KA 3UBKA 2CAQA 2GVPA 5D9WA 4TR1B 1FAAA 1F3BA 1K0AA 1KTEA 2XHFA 1VGLA 2C0FA 3F4RA 2I81A 4LMVA 2YZHA 1FB6A 5IO2A 1K3OA 3EU3A 1WJKA 1BX9A 3L0HA 2B7JA 4MZBA 3DWVA 2H76A 2L4QA 2H73A 4HZ2A 3G9BA 5DQYA 5KN1A 1MDJA 1EP7A 2CQ9A 1SYRA 3WGXA 4QQ7A 2HZEA 5JWOB 4ULXA 1WWJA 2WULA 4YAPA 1MD4A 4G10A 5IMDA 1ZL9A 1SK1A 1I9DA 1U88A 3FR3A 3F9UA 1Z7PA 5IMZA 2QC7A 2CA8A 2DJ2A 2N5BA 3KP9A 3CSHA 1XOAA 3U5RE 1SK2A 5CRWA 1XXUA 4OFNA 3FY7A 1FHEA 1J08A 3DXBA 2VCVA 3GKXA 3UVTA 4F9ZA 2H70A 2OKAA 5ECHB 3L9SA 1VF3A 2HI7A 3DGQA 3TOTA 3WD6A 3A3TA 2DIZA 2H1BA 1PRXA 5AGYA 1H4OA 4JZQA 4IN0A 3QDNA 3GKNA 2H74A 3KP8A 4KCAA 3GX8A 4HU7A 2MMAA 4TR1A 1M7TA 2P31A 1YKCA 5FHIA 3ZIVA 5DJLA 1AUCA 1PSQA 2CZ3A 3QD9A 2YP6A 4F0CA 1OYJA 2EIOA 2O87A 1C72A 2VM2A 4I2UA 4N11A 5DALB 1H75A 3KM6A 4O92A 2PN8A 2V1MA 4FH8A 2NVLA 2K8SA 2L5LA 4ZILA 3Q18A 1ZYEA 1TP9A
chains in the Genus database with same CATH superfamily
4TXOB 1XWBA 2VAFA 3D0ZA 1Z7RA 1X9MB 1M3JA 3NOFA 3O6TA 1S3AA 4OFTA 1KEBA 5JWRB 1GUMA 2DJJA 3M0FA 1YY7A 3M9KA 4ECIA 1MD3A 4F2IA 3FKFA 3KZQA 3KXOA 3TJKA 1F37A 2FWFA 1M2DA 1YEXA 5DCHA 3I69A 1OKTA 3F63A 2VM1A 4Q5QA 4ZB9A 3TKQA 4MJCA 1QFNA 4XTSA 2H75A 3GL3A 3CBUA 2MMNA 4EKZA 4POLA 3CRTA 19GSA 1N8JA 1PGTA 1SL1B 3KD0A 4PUAA 2LJAA 2LSTA 2IMEA 4GTUA 1FW1A 4O32A 2MYGA 2L5OA 2BMXA 3ZL5A 3C73A 4NPBA 2LRCA 5B8BA 1Z5YE 1ABAA 2GS3A 1K3LA 3LFLA 4CW9A 4KNDA 3ZMKA 4IHUA 3UJ1A 1UC7A 4TR4A 5ID2B 4A5PA 4YH2A 4WKWA 1M99A 5IMCA 1V40A 4HZ4A 4IP6A 1SJIA 1A0FA 2X64A 1ERTA 4RQXA 1DBYA 2AYTA 4MJBA 2GZYA 4YQVA 3GRXA 5DALA 2V2GA 4V2MA 4J2FA 2JZTA 1XBSA 2TIRA 3N5OA 5HFIA 3RPPA 3HJMA 3H4KA 4XS1A 4MJEA 4TXOA 2H6ZA 4MPFA 5DAKB 5DDLA 3F6FA 2LNTA 4MH2A 3VWXA 2FD3A 4L0UA 4EO3A 3CSJA 4NV5A 2PVQA 1YF0A 2C1YA 2VL2C 2DJ0A 2PWJA 1UA5A 1W89A 4QL7A 4YKGA 1GWCA 2IJYA 2GGTA 4J57E 1DE1A 1N2AA 3HVXA 4WF5A 4DEJA 3HDCA 2GLRA 3QAVA 2DC5A 3ZLPA 3ZFLA 3HXSA 2C0GA 3Q19A 1U3IA 1EP8A 2IMKA 3ERWA 3MSZA 1FOHA 2HT9A 2A2RA 3NIVA 1A2JA 3L9VA 3R2QA 4WR5A 1XWAA 3ZREA 2K6VA 3M8NA 1USBA 1GTBA 1QMVA 1VRSD 4WBJA 5ID2A 4BL7B 3WYWA 1ZCPA 4XCSA 3DVWA 3GURA 4NXIA 18GSA 3LSZA 4GQFA 2DJ3A 3A2VA 5F8BA 3ERGA 2KHPA 1GSUA 2M80A 2AJQB 4LLRA 3FZ9A 1T8EB 2YWIA 2NBSA 1JZOA 5H5SA 5G5EA 1F2EA 4E8EA 1VF2A 1DUGA 2FCHA 5HFKA 1CQGA 1O85A 1CQHA 1OC8A 1V57A 4HJ2A 4MMMA 1WMJA 4KDUA 2EIQA 1GUHA 1T4YA 1T4ZA 2XBIA 1GSDA 4Q5FA 13GSA 3FR9A 2I3YA 5ECNB 4EIQA 4KX4A 4BIKA 1JLVA 5CYYA 4PURA 2QGVA 2OE0A 1GP1A 1V98A 2CAIA 3VWWA 2G0FA 2HLSA 1AQXA 1PKWA 1XW9A 1ZMAA 3P8WA 1M2AA 2JADA 4GRFA 4ACSA 1Z3EA 4K2XA 2VLVA 3US3A 3CQFA 4EIPA 1E6BA 2LKUA 2VCWA 3TJFA 2DSAA 2QA1A 5E59A 4MF7A 3IR4A 16GSA 3F6DA 1ILOA 2QSIA 1WP0A 2MBTA 3FZAA 2CVDA 4ZXGA 3EWLA 4DSSB 2GT5A 5HFGA 1IYIA 3O76A 5EY6A 2F8FA 1EEMA 4IBPA 2M46A 3RAZA 4BL7A 4XS6A 3ME7A 3TJJA 1U6TA 2LS5A 3VFIA 3IXRA 2H72A 2LRTA 1ERWA 1F3AA 4JU5A 3DVXA 4HDEA 2LEGA 1IYHA 4ZL7A 1PX6A 3QAGA 2HNLA 3GMFA 3KTLA 5DVBA 1YJ6A 1R5PA 5E4WA 3BBYA 4TR0A 22GSA 1JZWA 1TI1A 4K9ZA 3M1GA 2AUVA 3GA4A 5AISA 3DD3A 6GSUA 6GSWA 2ZNMA 3W8SA 5J9CA 4PNFA 3TKPA 1SD8A 1Y6EA 2JU5A 2H8LA 5ECKB 1G6WA 2CV4A 4F0BA 3DRNA 3IBHA 4MF6A 3RDWA 4CDOA 4Q5NA 5D73A 5ECOB 4MZWA 4V1Ag 1X0RA 4YAVA 2FWEA 2R3XA 2B5YA 3GFKA 5HR3A 3GKMA 4J56E 5LCZA 1QUWA 2J23A 1G7EA 2GQKA 4GWRA 4KGIA 3TRPA 2B1LA 2ZCTA 4DSSA 1A24A 2YWMA 1ERVA 3GSSA 5GAPD 3FMWA 3KMNA 5G1KA 4PQIA 1WOUA 2GDRA 2B6MA 4EE0A 4KDXA 5F0GA 5G5FA 1G6YA 2PUKC 3QAWA 4GXZA 5F07A 8GSSA 3D22A 2RM5A 2YJHA 1HD2A 4K7NA 3GTUB 3LW9A 4NWYA 2WZ9A 2NTOA 3QCPA 4KUNA 5JCUA 4ECCA 3G7IA 5ECLB 2WJUA 2HRAA 2Z9SA 2C80A 4ECJA 3TDGA 2IL3A 6GSVA 2IPAA 6GSYA 3DIEA 3HKRA 4USSA 1A23A 2K8VA 4K2DA 3EMPA 3ZTLA 1K0CA 2O89A 2R4VA 1EGOA 1TI3A 1TXXA 2LQOA 2WFCA 1GNWA 2MZCA 1S3CA 1SD9A 2L6DA 4POMA 4EDZA 4OFMA 3U6VA 3C7MA 2B5XA 2K18A 3LGCA 4ECBA 1XOBA 4GQCA 4PTSA 4K5RA 2PGTA 2DKHA 2VL3A 3WT1A 1BJXA 1SJ6A 5B6NA 1SU9A 2DLXA 5GSSA 3ZVJA 2JSYA 4F03A 1GSFA 1KNGA 3UVHA 4I6XA 2WDUA 2YANA 2YV7A 3HZ4A 2AV4A 3MIXA 2NDOA 5CRDA 4TVEA 2FNOA 1TRWA 2RLIA 3RBTA 1Z9HA 2R0PA 5BRTA 1FOVA 1PMTA 2HXKA 2HRFA 5ECRB 2CX3A 5KEJA 3DMLA 4TOPA 1EGRA 3KGKA 5ABRA 3HCZA 1GSQA 5F06A 2GZZA 1F9MA 3D5JA 3I43A 4TRXA 2YZUA 3GTUA 3HHVA 4V1Ap 5AIVA 2R0CA 1GTAA 4OWYA 3HD5A 1M2BA 4IQ1A 2GSTA 1GUKA 4G19A 1TU8A 3LEFA 3IAS2 5HR2A 2IFQB 4L8EA 5HR0A 3APSA 14GSA 3ZVJD 4MLYA 2H1DA 2VIMA 2L4CA 3C1SA 1I5GA 3GKKA 4KSMA 3M3MA 4D73B 1DSBA 2E7PA 3LXZA 2DMMA 3IK7A 2EIRA 2WGRA 1XCCA 5JCGA 4K5SA 5A5KA 5IMAA 4WF4A 1GLPA 4YQMA 3TGZA 2HRNA 3UAPA 4BWSA 2DBCA 3TKSE 2PBJA 3BCKA 3GN3A 4BPYA 5D9TA 2A2SA 2H71A 4KSOA 4LA1A 2G2QA 1ZYNA 3BD2A 4EVMA 1XPVA 2CX4A 2L57A 1O7UA 3HVNA 3PPUA 4K7OA 4LMWA 2YJ7A 5J9BA 3QFAC 1XWCA 3K8NA 3GYKA 2DIYA 1ZGNA 3MYDA 3NZNA 1ON4A 2CVKA 3UBLA 1NW2A 2CT6A 3GSTA 1EWXA 5KN3A 3QOUA 1QK8A 4LL4B 1TK0B 2VO4A 4WBRD 1WRYA 5LNKe 1YKAA 3Q6OA 1UVZA 2I9HA 1SKSB 3IOSA 3KH9A 1U3AA 4Z2TA 3FR6A 1XW5A 3N9JA 5IMVA 3M9JA 3FRCA 3WGDA 3D4MA 2IFQA 4Z7XA 3VPQA 1R4WA 1S3RA 2LJKA 2KOKA 1B9XC 5ECQB 4XRDA 4ZBAA 4D73A 3TCOA 2LV3A 3EURA 3EVIA 1PX7A 1DE2A 4PNGA 1YZXA 4HI7A 4KH7A 3EMXA 2OJLA 1WE0A 1XG8A 4YKFA 2VL9A 3HYPA 3IRAA 3TRQA 2XBQA 1J9BA 4WEYA 3TRXA 4FO5A 1B48A 3KJYA 4PQ1A 3PH9A 5A4UA 1K0DA 4LL1B 1GSSA 2AHEA 3TUEA 1Q98A 4TR3A 4ID0A 4DSRA 4FIWA 1ST9A 1F6MC 1OE8A 5H5QA 3FYGA 5IOWA 2MBSA 1B4QA 5FT3A 1EV4A 2WCIA 3UEMA 4MZCA 4GF0A 3VWVA 2GSSA 2B5EA 4CHSA 5AIXA 2JZRA 1XVQA 2WRTA 4MP4A 5ECIB 3GHAA 3CRUA 4V2NA 2V41A 1KBNA 1VF4A 3A5IA 1YDKA 2OBKA 2H1AA 3TKSA 2YN1A 2CVBA 2R6KA 5COHA 4PGTA 4HUAA 2RUEA 1RQMA 4MH3A 3ISOA 1U87A 3I6AA 5GAND 2R5GA 3O3TA 1X5EA 4P3YB 1K0OA 1M9AA 1JHBA 1Z6NA 1PFOA 2F8AA 4RQRA 4PQHA 3KCMA 3GV1A 3LXTA 4IP1A 4HS1A 4FYBA 2R2JA 4KB3A 1UN2A 4EC0A 2YV9A 2DKIA 4EXJA 2OA7A 4DSQA 1THOA 4G9HA 2GSRA 2PERA 5H5RA 3J7Yk 3IHGA 4BWQA 3KEBA 3F3QA 1O8XA 3DYRA 1VF1A 2V32A 3P90A 4ZBDA 3LWAA 3PINA 3EYTA 4MPGA 1HNBA 1R7HA 3W8JA 2VCQA 3ZYWA 1HYUA 4JEDA 3TJBA 1G7OA 1A2MA 5ENUA 2KP2A 2JSZA 1XWKA 1GH2A 2HZFA 1T00A 4WR4A 1THXA 2H19A 2N5FA 1JZDA 2X4AA 4X43A 5DCGA 2YWOA 3C1RA 3GUSA 2C3QA 3A5WA 3G7YA 4ML6A 2DMLA 1QGVA 4X0XA 5CNWA 3PR8A 3E9JB 1MDKA 4GCIA 3WGEA 2P0GA 2IWTA 5J41A 2VLTA 1AIUA 4OMVA 1TK8B 3VLNA 4O5RA 4NHWA 2VL2A 2PU9C 5ECMB 4V2LA 5DJMA 3C71A 3F4TA 4I97A 5GZZB 1EOGA 5G31A 3SBCA 4KCEA 1XZOA 3CTFA 2LRNA 2C8UA 2XC2A 3DEXA 3A2XA 3E0UA 3BCIA 4I2TA 2ALBA 1EOHA 4AJ8A 1JFUA 3CXGA 3V1WA 2H30A 4N10A 1O6JA 4MABA 3GNJA 4H86A 1V2AA 5C00A 1A8LA 3QR6A 3GIXA 1BG5A 2HSMA 1FG4A 3DKSA 2MMZA 3HVSA 2CZ2A 3Q74A 3HA9A 2VCZA 4CY8A 1BYEA 3CYNA 2B3SA 1TKDB 3UL3A 4HOJA 4ILFA 1FVJA 3KTBA 4XRAA 3MNGA 4IVFA 1PA3A 2F51A 1GLQA 4AJ7A 4ZL9A 1GSYA 3BOAA 4E8HA 2WB9A 2O7KA 2KLXA 4K7IA 2REMA 2YCDA 4ZB8A 4IJ3A 2ON5A 1SK0A 5ECPB 1K0BA 3QFBC 4N0ZA 5IM9A 2F9SA 12GSA 1T3BA 3ZMLA 3IPZA 5IO0A 1TRVA 1XVWA 2WS2A 4IJIA 3VWUA 4IS0A 1PL1A 1R5AA 4XHMA 3TJGA 5IPGA 4OD7A 1YF1A 4FYUA 5J4UA 4XS4B 2I1UA 2HYXA 5CO3A 1PL2A 3MDKA 4TXVA 1GSEA 1OKDA 4O5QA 3ZFBA 4K0NA 1Z6MA 5CAXA 4ZIJA 3D4TA 2R37A 3GX0A 3VI5A 4NV2A 4HQZA 4IQAA 3QMXA 3FK8A 4ZB6A 1O81A 1OE7A 1WIKA 2HE3A 4NHZA 3APQA 2LTKA 1WPIA 2C3TA 3KH7A 4EDYA 1SL0B 3H1NA 3EE2A 4HJMA 2R0GA 3MWHA 1GL8A 5BMUA 5EVOA 2HSYA 1GULA 2O8VB 4KE3A 1HNCA 2NPBA 4PUFC 5GSTA 1TW9A 2HFDA 2QA2A 5B7CA 5HR1A 7GSSA 2LJRA 3VI7A 9GSSA 1NHOA 3C8EA 3ZIJA 1G0TA 1TDIA 3RHCA 2IIYA 2EC4A 2XPEA 2FHEA 1GTUA 3SWLA 4X1UA 2P5RA 5LD0A 2VOCA 2K9FA 3IC8A 3EPTA 5IPHA 1X9SB 4JR6A 5JWQB 4PX1A 3BJ5A 2X8HA 4HSCX 4K8MA 5AN1A 4ML1A 1XFLA 1B4PA 2AB6A 2E0QA 4YQUA 1PN9A 2V6OA 2VCTA 4MJAA 5G1LA 1AC1A 4XS4A 1X9WB 2JZSA 3GH6A 4POKA 3MAKA 2IMDA 2FA8A 2J9HA 2YNXA 4BVXA 2TRCP 4JBBA 2FLSA 3TKRA 3EINA 5EPFA 2HRKA 2A4VA 5CRGA 4KDYA 4L0WA 5G30A 3R3EA 2GZPA 1TU7A 1XIYA 2C0DA 3TKSC 2PPTA 3HJPA 3IAM2 4EL1A 4GLTA 1TTZA 2OADA 3G7JA 1M3IA 4KA0A 5J3RA 2H1GA 3F3RA 2L6CA 3HVVA 4K6XA 2ES7A 4TW5A 5B6MA 1JLWA 1V58A 1J0FA 1SL2B 4MA9A 2B7KA 4Z2RA 5KOXA 2ZUPA 3WT2A 2XPDA 1K3YA 1ZOFA 4BVYB 4Q5RA 2QKEA 4O7HA 5KN2A 3P2AA 3LYKA 4ZBBA 1NHYA 3OR5A 3UOMA 3VURA 3ME8A 3FHKA 4OCFA 4AJ6A 5CP1A 2FY6A 4F82A 2HSHA 4POBA 4ICYA 5ELAA 4JR4A 4OO5A 4HU9A 2E2GA 4KF9A 3PGTA 1MDIA 4MDCA 4K1FA 5KOWA 4QL9A 2D2ZA 1XW6A 1W4VA 1ZYPA 5IMFA 3CTGA 4NMUA 4JRRA 11GSA 3IK9A 1FB0A 1Y25A 5A4VA 2KP1A 3D6IA 1MTCA 2ON7A 4BA7A 3L78A 5C04A 4RUVA 5B8AA 1R26A 5IQYA 2JL4A 3CMIA 1PQNA 2E2MA 4Z2UA 5G2ZA 3FW2A 1BQ7A 2PVOC 4FQUA 2GTUA 2BTOT 4HEA2 1TK5B 2GQMA 3FZ4A 2GQLA 2YWNA 1K0MA 4N0VA 1LBKA 2LQQA 2F3MA 3W6GA 3ZITA 2UZ8A 3ED3A 1NM3A 2DJ1A 4ISDA 5HQPA 1AXDA 3IC4A 1T7PB 1YEPA 5IIZA 2H0GA 5EL8A 4DVCA 1EEJA 3IE3A 5D8IA 3EU4A 1GRXA 3L9UA 4AF2A 4FYCA 1TRUA 10GSA 5F05A 1ACVA 4G2EA 1XWGA 4BVYA 3HY2A 2OE3A 3L4NA 1OC3A 1SKRB 1OVNA 1FO5A 2VD0A 1O8WA 1OAZA 1TJDA 1ML6A 3ZZXA 2LNSA 2KUCA 5J5NA 1HQOA 1K0NA 2OACA 4L5OA 1OC9B 5DBQA 4WXTA 2FUG2 4K0GA 3J7Yb 4IW9A 4X4JA 1A2LA 4MK3A 1A8YA 1YQ1A 3TOUA 4I5QA 5INYA 4TN8A 5D96A 1Q4JA 3UMAA 2JACA 1B8XA 3E3EA 1PKZA 3LQ7A 4IELA 4ZL8A 4IKHA 1AW9A 4N30A 3RHBA 4L5LA 1EZKA 1LU4A 1RK4A 4IGJA 1QQ2A 2YOIA 3EC3A 1X5DA 3FEUA 2GSQA 1GNEA 1MEKA 3H8QA 6GSSA 3CSIA 2H6XA 4GSNA 1O73A 4EUYA 2GT6A 3FZ5A 3H93A 4HQSA 4PXOA 5ELGA 1SENA 5CREA 4MCUA 1M0UA 3RPNA 3H79A 5DAKA 3A2WA 2O85A 1PN0A 5JCWA 2V6KA 4TKYA 1ERUA 5D9XA 3VK9A 2M72A 3QPMA 5IOXA 3UIWA 4AGSA 2N5AA 1QXHA 2A4HA 4O5UA 4MF5A 4OCEA 3LYPA 5CRHA 1SKWB 2OBIA 5D9VA 1AQVA 2IN3A 2FGXA 2H6YA 1FVKA 2C3NA 1A0RP 4RI6A 2VCXA 2H0HA 3F4SA 4GSSA 2A2PA 2AAWA 2YPMA 3F0IA 1SYXA 3LORA 2PMTA 6GSTA 3AY8A 3TB2A 1EV9A 3ZRDA 2LUSA 1ZYQB 2BJXA 2MMOA 2FWHA 1T1VA 1JZRA 1OC9A 4G0KA 1LJRA 2RM6A 3GL5A 2X8GA 1M9BA 3F8UA 5FWGA 4GSTA 2FA4A 2C4JA 4KAEA 2L59A 1SJZA 1RW1A 4EF0A 3IDVA 2IMFA 2VUPA 3APOA 1ZZYA 4OO4A 1AAZA 4KW6A 2OE1A 3IA1A 17GSA 5ECSA 4JE1A 2P5QA 3IV4A 3D21A 2H01A 5DQSA 3JCML 1E2YA 1BEDA 1PD21 2I4AA 1NSWA 2HZEB 3UARA 2X99A 3HJOA 3S9FA 20GSA 3P7XA 2VLUA 1X5CA 3ERFA 1URMA 4NAXA 4I8BA 5D93A 1TRSA 1S3DA 3GH9A 2DJKA 1HNAA 2X8CA 2VD1A 3LJRA 4RI7A 2TRXA 2H0IA 4WETA 1TOFA 3VPTA 2IMIA 3HZ8A 1BAYA 1B9YC 1V9WA 5KN0A 2C0EA 2RIIA 1GTIA 6GSXA 2RUFA 3KMOA 3KIJA 2FWGA 2H66A 4MNNA 3LG6A 5A4WA 4XIHA 3I9V2 3IHQA 1AQWA 5L71A 2B1KA 3UBKA 2CAQA 2GVPA 5D9WA 4TR1B 1FAAA 1F3BA 1K0AA 1KTEA 2XHFA 1VGLA 2C0FA 3F4RA 2I81A 4LMVA 2YZHA 1FB6A 5IO2A 1K3OA 3EU3A 1WJKA 1BX9A 3L0HA 2B7JA 4MZBA 3DWVA 2H76A 2L4QA 2H73A 4HZ2A 3G9BA 5DQYA 4G0IA 5KN1A 1MDJA 1EP7A 2CQ9A 4BVXB 1SYRA 3WGXA 4QQ7A 2X49A 2HZEA 5JWOB 4CY6A 4ULXA 1WWJA 2WULA 4YAPA 1MD4A 4G10A 5IMDA 1ZL9A 1SK1A 1I9DA 1U88A 3FR3A 3F9UA 1Z7PA 5IMZA 2QC7A 2CA8A 2DJ2A 2N5BA 3KP9A 3CSHA 1XOAA 3U5RE 1SK2A 5CRWA 1XXUA 4G0LA 4OFNA 3FY7A 1FHEA 1J08A 3DXBA 2VCVA 3GKXA 3UVTA 4F9ZA 2H70A 2OKAA 5ECHB 3L9SA 1VF3A 2HI7A 3DGQA 3TOTA 3WD6A 3A3TA 2DIZA 2H1BA 1PRXA 5AGYA 1H4OA 4JZQA 4IN0A 3QDNA 3GKNA 2H74A 3KP8A 4KCAA 3GX8A 4HU7A 2MMAA 4TR1A 1M7TA 2P31A 1YKCA 5FHIA 3ZIVA 5DJLA 1AUCA 1PSQA 2CZ3A 3QD9A 2YP6A 4F0CA 1OYJA 2EIOA 2O87A 1C72A 2VM2A 4I2UA 4N11A 5DALB 1H75A 3KM6A 4O92A 2PN8A 2V1MA 4FH8A 2NVLA 2K8SA 2L5LA 4ZILA 3Q18A 1ZYEA 1TP9A
chains in the Genus database with same CATH topology
4TXOB 1XWBA 2VAFA 3D0ZA 1Z7RA 1X9MB 3NOFA 3O6TA 1S3AA 4OFTA 1KEBA 5JWRB 1GUMA 2DJJA 3M0FA 1YY7A 3M9KA 4ECIA 1MD3A 4F2IA 3FKFA 3KZQA 3KXOA 3TJKA 1F37A 2FWFA 1M2DA 1YEXA 5DCHA 3I69A 1OKTA 3F63A 2VM1A 4Q5QA 4ZB9A 3TKQA 4MJCA 1QFNA 4XTSA 2H75A 3GL3A 3CBUA 2MMNA 4EKZA 4POLA 3CRTA 19GSA 1N8JA 1PGTA 1SL1B 3KD0A 4PUAA 2LJAA 2LSTA 2IMEA 4GTUA 1FW1A 4O32A 2MYGA 2L5OA 2BMXA 3ZL5A 3C73A 4NPBA 2LRCA 5B8BA 1Z5YE 1ABAA 2GS3A 1K3LA 3LFLA 4CW9A 4KNDA 3ZMKA 4IHUA 3UJ1A 1UC7A 4TR4A 5ID2B 4A5PA 4YH2A 4WKWA 1M99A 5IMCA 1V40A 4HZ4A 4IP6A 1SJIA 1A0FA 2X64A 1ERTA 4RQXA 1DBYA 2AYTA 4MJBA 2GZYA 4YQVA 3GRXA 5DALA 2V2GA 4V2MA 4J2FA 2JZTA 1XBSA 2TIRA 3N5OA 5HFIA 3RPPA 3HJMA 3H4KA 4XS1A 4MJEA 4TXOA 2H6ZA 4MPFA 5DAKB 5DDLA 3F6FA 2LNTA 4MH2A 3VWXA 2FD3A 4L0UA 4EO3A 3CSJA 4NV5A 2PVQA 1YF0A 2C1YA 2VL2C 2DJ0A 2PWJA 1UA5A 1W89A 4QL7A 4YKGA 1GWCA 2IJYA 2GGTA 4J57E 1DE1A 1N2AA 3HVXA 4WF5A 4DEJA 3HDCA 2GLRA 3QAVA 2DC5A 3ZLPA 3ZFLA 3HXSA 2C0GA 3Q19A 1U3IA 1EP8A 2IMKA 3ERWA 3MSZA 1FOHA 2HT9A 2A2RA 3NIVA 1A2JA 3L9VA 3R2QA 4WR5A 1XWAA 3ZREA 2K6VA 3M8NA 1USBA 1GTBA 1QMVA 1VRSD 4WBJA 5ID2A 4BL7B 3WYWA 1ZCPA 4XCSA 3DVWA 3GURA 4NXIA 18GSA 3LSZA 4GQFA 2DJ3A 3A2VA 5F8BA 3ERGA 2KHPA 1GSUA 2M80A 2AJQB 4LLRA 3FZ9A 1T8EB 2YWIA 2NBSA 1JZOA 5H5SA 5G5EA 1F2EA 4E8EA 1VF2A 1DUGA 2FCHA 5HFKA 1CQGA 1O85A 1CQHA 1OC8A 1V57A 4HJ2A 4MMMA 1WMJA 4KDUA 2EIQA 1GUHA 1T4YA 1T4ZA 2XBIA 1GSDA 4Q5FA 13GSA 3FR9A 2I3YA 5ECNB 4EIQA 4KX4A 1JLVA 5CYYA 4PURA 2QGVA 2OE0A 1GP1A 1V98A 2CAIA 3VWWA 2G0FA 2HLSA 1AQXA 1PKWA 1XW9A 1ZMAA 3P8WA 1M2AA 2JADA 4GRFA 4ACSA 1Z3EA 4K2XA 2VLVA 3US3A 4EIPA 1E6BA 2LKUA 2VCWA 3TJFA 2DSAA 2QA1A 5E59A 4MF7A 3IR4A 16GSA 3F6DA 1ILOA 2QSIA 1WP0A 2MBTA 3FZAA 2CVDA 4ZXGA 3EWLA 4DSSB 2GT5A 5HFGA 1IYIA 3O76A 5EY6A 2F8FA 1EEMA 4IBPA 2M46A 3RAZA 4BL7A 4XS6A 3ME7A 3TJJA 1U6TA 2LS5A 3VFIA 3IXRA 2H72A 2LRTA 1ERWA 1F3AA 4JU5A 3DVXA 4HDEA 2LEGA 1IYHA 4ZL7A 1PX6A 3QAGA 2HNLA 3GMFA 3KTLA 5DVBA 1YJ6A 1R5PA 5E4WA 3BBYA 4TR0A 22GSA 1JZWA 1TI1A 4K9ZA 3M1GA 2AUVA 3GA4A 5AISA 3DD3A 6GSUA 6GSWA 2ZNMA 3W8SA 5J9CA 4PNFA 3TKPA 1SD8A 1Y6EA 2JU5A 2H8LA 5ECKB 1G6WA 2CV4A 4F0BA 3DRNA 3IBHA 4MF6A 3RDWA 4CDOA 4Q5NA 5D73A 5ECOB 4MZWA 4V1Ag 1X0RA 4YAVA 2FWEA 2R3XA 2B5YA 3GFKA 5HR3A 3GKMA 4J56E 5LCZA 1QUWA 2J23A 1G7EA 2GQKA 4GWRA 4KGIA 3TRPA 2B1LA 2ZCTA 4DSSA 1A24A 2YWMA 1ERVA 3GSSA 5GAPD 3FMWA 3KMNA 5G1KA 4PQIA 1WOUA 2GDRA 2B6MA 4EE0A 4KDXA 5F0GA 5G5FA 1G6YA 2PUKC 3QAWA 4GXZA 5F07A 8GSSA 3D22A 2RM5A 2YJHA 1HD2A 4K7NA 3GTUB 3LW9A 4NWYA 2WZ9A 2NTOA 3QCPA 4KUNA 5JCUA 4ECCA 3G7IA 5ECLB 2WJUA 2HRAA 2Z9SA 2C80A 4ECJA 3TDGA 2IL3A 6GSVA 2IPAA 6GSYA 3DIEA 3HKRA 4USSA 1A23A 2K8VA 4K2DA 3EMPA 3ZTLA 1K0CA 2O89A 2R4VA 1EGOA 1TI3A 1TXXA 2LQOA 2WFCA 1GNWA 2MZCA 1S3CA 1SD9A 2L6DA 4POMA 4EDZA 4OFMA 3U6VA 3C7MA 2B5XA 2K18A 3LGCA 4ECBA 1XOBA 4GQCA 4PTSA 4K5RA 2PGTA 2DKHA 2VL3A 3WT1A 1BJXA 1SJ6A 5B6NA 1SU9A 2DLXA 5GSSA 3ZVJA 2JSYA 4F03A 1GSFA 1KNGA 3UVHA 4I6XA 2WDUA 2YANA 2YV7A 3HZ4A 2AV4A 3MIXA 2NDOA 5CRDA 4TVEA 2FNOA 1TRWA 2RLIA 3RBTA 1Z9HA 2R0PA 5BRTA 1FOVA 1PMTA 2HXKA 2HRFA 5ECRB 2CX3A 5KEJA 3DMLA 4TOPA 1EGRA 3KGKA 5ABRA 3HCZA 1GSQA 5F06A 2GZZA 1F9MA 3D5JA 3I43A 4TRXA 2YZUA 3GTUA 3HHVA 4V1Ap 5AIVA 2R0CA 1GTAA 4OWYA 3HD5A 1M2BA 4IQ1A 2GSTA 1GUKA 4G19A 1TU8A 3LEFA 3IAS2 5HR2A 2IFQB 4L8EA 5HR0A 3APSA 14GSA 3ZVJD 4MLYA 2H1DA 2VIMA 2L4CA 3C1SA 1I5GA 3GKKA 4KSMA 3M3MA 4D73B 1DSBA 2E7PA 3LXZA 2DMMA 3IK7A 2EIRA 2WGRA 1XCCA 5JCGA 4K5SA 5A5KA 5IMAA 4WF4A 1GLPA 4YQMA 3TGZA 2HRNA 3UAPA 4BWSA 2DBCA 3TKSE 2PBJA 3BCKA 3GN3A 4BPYA 5D9TA 2A2SA 2H71A 4KSOA 4LA1A 2G2QA 1ZYNA 3BD2A 4EVMA 1XPVA 2CX4A 2L57A 1O7UA 3PPUA 4K7OA 4LMWA 2YJ7A 5J9BA 3QFAC 1XWCA 3K8NA 3GYKA 2DIYA 1ZGNA 3MYDA 3NZNA 1ON4A 2CVKA 3UBLA 1NW2A 2CT6A 3GSTA 1EWXA 5KN3A 3QOUA 1QK8A 4LL4B 1TK0B 2VO4A 4WBRD 1WRYA 5LNKe 1YKAA 3Q6OA 1UVZA 2I9HA 1SKSB 3IOSA 3KH9A 1U3AA 4Z2TA 3FR6A 1XW5A 3N9JA 5IMVA 3M9JA 3FRCA 3WGDA 3D4MA 2IFQA 4Z7XA 3VPQA 1R4WA 2LJKA 2KOKA 1B9XC 5ECQB 4XRDA 4ZBAA 4D73A 3TCOA 2LV3A 3EURA 3EVIA 1PX7A 1DE2A 4PNGA 1YZXA 4HI7A 4KH7A 3EMXA 2OJLA 1WE0A 4YKFA 2VL9A 3HYPA 3IRAA 3TRQA 2XBQA 1J9BA 4WEYA 3TRXA 4FO5A 1B48A 3KJYA 4PQ1A 3PH9A 5A4UA 1K0DA 4LL1B 1GSSA 2AHEA 3TUEA 1Q98A 4TR3A 4ID0A 4DSRA 4FIWA 1ST9A 1F6MC 1OE8A 5H5QA 3FYGA 5IOWA 2MBSA 1B4QA 5FT3A 1EV4A 2WCIA 3UEMA 4MZCA 4GF0A 3VWVA 2GSSA 2B5EA 4CHSA 5AIXA 2JZRA 1XVQA 2WRTA 4MP4A 5ECIB 3GHAA 3CRUA 4V2NA 2V41A 1KBNA 1VF4A 3A5IA 1YDKA 2OBKA 2H1AA 3TKSA 2YN1A 2CVBA 2R6KA 5COHA 4PGTA 4HUAA 2RUEA 1RQMA 4MH3A 3ISOA 1U87A 3I6AA 5GAND 2R5GA 3O3TA 1X5EA 4P3YB 1K0OA 1M9AA 1JHBA 1Z6NA 2F8AA 4RQRA 4PQHA 3KCMA 3GV1A 3LXTA 4IP1A 4HS1A 4FYBA 2R2JA 4KB3A 1UN2A 4EC0A 2YV9A 2DKIA 4EXJA 2OA7A 4DSQA 1THOA 4G9HA 2GSRA 2PERA 5H5RA 3J7Yk 3IHGA 4BWQA 3KEBA 3F3QA 1O8XA 3DYRA 1VF1A 2V32A 3P90A 4ZBDA 3LWAA 3PINA 3EYTA 4MPGA 1HNBA 1R7HA 3W8JA 2VCQA 3ZYWA 1HYUA 4JEDA 3TJBA 1G7OA 1A2MA 5ENUA 2KP2A 2JSZA 1XWKA 1GH2A 2HZFA 1T00A 4WR4A 1THXA 2H19A 2N5FA 1JZDA 2X4AA 4X43A 5DCGA 2YWOA 3C1RA 3GUSA 2C3QA 3A5WA 3G7YA 4ML6A 2DMLA 1QGVA 4X0XA 5CNWA 3PR8A 3E9JB 1MDKA 4GCIA 3WGEA 2P0GA 2IWTA 5J41A 2VLTA 1AIUA 4OMVA 1TK8B 3VLNA 4O5RA 4NHWA 2VL2A 2PU9C 5ECMB 4V2LA 5DJMA 3C71A 3F4TA 4I97A 5GZZB 1EOGA 5G31A 3SBCA 4KCEA 1XZOA 3CTFA 2LRNA 2C8UA 2XC2A 3DEXA 3A2XA 3E0UA 3BCIA 4I2TA 2ALBA 1EOHA 4AJ8A 1JFUA 3CXGA 3V1WA 2H30A 4N10A 1O6JA 4MABA 3GNJA 4H86A 1V2AA 5C00A 1A8LA 3QR6A 3GIXA 1BG5A 2HSMA 1FG4A 3DKSA 2MMZA 3HVSA 2CZ2A 3Q74A 3HA9A 2VCZA 4CY8A 1BYEA 3CYNA 2B3SA 1TKDB 3UL3A 4HOJA 4ILFA 1FVJA 3KTBA 4XRAA 3MNGA 4IVFA 1PA3A 2F51A 1GLQA 4AJ7A 4ZL9A 1GSYA 3BOAA 4E8HA 2WB9A 2O7KA 2KLXA 4K7IA 2REMA 2YCDA 4ZB8A 4IJ3A 2ON5A 1SK0A 5ECPB 1K0BA 3QFBC 4N0ZA 5IM9A 2F9SA 12GSA 1T3BA 3ZMLA 3IPZA 5IO0A 1TRVA 1XVWA 2WS2A 4IJIA 3VWUA 4IS0A 1PL1A 1R5AA 4XHMA 3TJGA 5IPGA 4OD7A 1YF1A 4FYUA 5J4UA 4XS4B 2I1UA 2HYXA 5CO3A 1PL2A 3MDKA 4TXVA 1GSEA 1OKDA 4O5QA 3ZFBA 4K0NA 1Z6MA 5CAXA 4ZIJA 3D4TA 2R37A 3GX0A 3VI5A 4NV2A 4HQZA 4IQAA 3QMXA 3FK8A 4ZB6A 1O81A 1OE7A 1WIKA 2HE3A 4NHZA 3APQA 2LTKA 1WPIA 2C3TA 3KH7A 4EDYA 1SL0B 3H1NA 3EE2A 4HJMA 2R0GA 3MWHA 1GL8A 5BMUA 5EVOA 2HSYA 1GULA 2O8VB 4KE3A 1HNCA 2NPBA 4PUFC 5GSTA 1TW9A 2HFDA 2QA2A 5B7CA 5HR1A 7GSSA 2LJRA 3VI7A 9GSSA 1NHOA 3C8EA 3ZIJA 1G0TA 1TDIA 3RHCA 2IIYA 2EC4A 2XPEA 2FHEA 1GTUA 3SWLA 4X1UA 2P5RA 5LD0A 2VOCA 2K9FA 3IC8A 3EPTA 5IPHA 1X9SB 4JR6A 5JWQB 4PX1A 3BJ5A 2X8HA 5AN1A 4K8MA 4ML1A 1XFLA 1B4PA 2AB6A 2E0QA 4YQUA 1PN9A 2V6OA 2VCTA 4MJAA 5G1LA 1AC1A 4XS4A 1X9WB 2JZSA 3GH6A 4POKA 3MAKA 2IMDA 2FA8A 2J9HA 2YNXA 4BVXA 2TRCP 4JBBA 2FLSA 3TKRA 3EINA 5EPFA 2HRKA 2A4VA 5CRGA 4KDYA 4L0WA 5G30A 3R3EA 2GZPA 1TU7A 1XIYA 2C0DA 3TKSC 2PPTA 3HJPA 3IAM2 4EL1A 4GLTA 1TTZA 2OADA 3G7JA 4KA0A 5J3RA 2H1GA 3F3RA 2L6CA 3HVVA 4K6XA 2ES7A 4TW5A 5B6MA 1JLWA 1V58A 1J0FA 1SL2B 4MA9A 2B7KA 4Z2RA 5KOXA 2ZUPA 3WT2A 2XPDA 1K3YA 1ZOFA 4BVYB 4Q5RA 2QKEA 4O7HA 5KN2A 3P2AA 3LYKA 4ZBBA 1NHYA 3OR5A 3UOMA 3VURA 3ME8A 3FHKA 4OCFA 4AJ6A 5CP1A 2FY6A 4F82A 2HSHA 4POBA 4ICYA 5ELAA 4JR4A 4OO5A 4HU9A 2E2GA 4KF9A 3PGTA 1MDIA 4MDCA 4K1FA 5KOWA 4QL9A 2D2ZA 1XW6A 1W4VA 1ZYPA 5IMFA 3CTGA 4NMUA 4JRRA 11GSA 3IK9A 1FB0A 1Y25A 5A4VA 2KP1A 3D6IA 1MTCA 2ON7A 4BA7A 3L78A 5C04A 4RUVA 5B8AA 1R26A 5IQYA 2JL4A 3CMIA 1PQNA 2E2MA 4Z2UA 5G2ZA 3FW2A 1BQ7A 2PVOC 4FQUA 2GTUA 2BTOT 4HEA2 1TK5B 2GQMA 3FZ4A 2GQLA 2YWNA 1K0MA 4N0VA 1LBKA 2LQQA 2F3MA 3W6GA 3ZITA 2UZ8A 3ED3A 1NM3A 2DJ1A 4ISDA 5HQPA 1AXDA 3IC4A 1T7PB 1YEPA 5IIZA 2H0GA 5EL8A 4DVCA 1EEJA 3IE3A 5D8IA 3EU4A 1GRXA 3L9UA 4AF2A 4FYCA 1TRUA 10GSA 5F05A 1ACVA 4G2EA 1XWGA 4BVYA 3HY2A 2OE3A 3L4NA 1OC3A 1SKRB 1OVNA 1FO5A 2VD0A 1O8WA 1OAZA 1TJDA 1ML6A 3ZZXA 2LNSA 2KUCA 5J5NA 1HQOA 1K0NA 2OACA 4L5OA 1OC9B 5DBQA 4WXTA 2FUG2 4K0GA 3J7Yb 4IW9A 4X4JA 1A2LA 4MK3A 1A8YA 1YQ1A 3TOUA 4I5QA 5INYA 4TN8A 5D96A 1Q4JA 3UMAA 2JACA 1B8XA 3E3EA 1PKZA 3LQ7A 4IELA 4ZL8A 4IKHA 1AW9A 4N30A 3RHBA 4L5LA 1EZKA 1LU4A 1RK4A 4IGJA 1QQ2A 2YOIA 3EC3A 1X5DA 3FEUA 2GSQA 1GNEA 1MEKA 3H8QA 6GSSA 3CSIA 2H6XA 4GSNA 1O73A 4EUYA 2GT6A 3FZ5A 3H93A 4HQSA 4PXOA 5ELGA 1SENA 5CREA 4MCUA 1M0UA 3RPNA 3H79A 5DAKA 3A2WA 2O85A 1PN0A 5JCWA 2V6KA 4TKYA 1ERUA 5D9XA 3VK9A 2M72A 3QPMA 5IOXA 3UIWA 4AGSA 2N5AA 1QXHA 2A4HA 4O5UA 4MF5A 4OCEA 3LYPA 5CRHA 1SKWB 2OBIA 5D9VA 1AQVA 2IN3A 2FGXA 2H6YA 1FVKA 2C3NA 1A0RP 4RI6A 2VCXA 2H0HA 3F4SA 4GSSA 2A2PA 2AAWA 2YPMA 3F0IA 1SYXA 3LORA 2PMTA 6GSTA 3AY8A 3TB2A 1EV9A 3ZRDA 2LUSA 1ZYQB 2BJXA 2MMOA 2FWHA 1T1VA 1JZRA 1OC9A 4G0KA 1LJRA 2RM6A 3GL5A 2X8GA 1M9BA 3F8UA 5FWGA 4GSTA 2FA4A 2C4JA 4KAEA 2L59A 1SJZA 1RW1A 4EF0A 3IDVA 2IMFA 2VUPA 3APOA 1ZZYA 4OO4A 1AAZA 4KW6A 2OE1A 3IA1A 17GSA 5ECSA 4JE1A 2P5QA 3IV4A 3D21A 2H01A 5DQSA 3JCML 1E2YA 1BEDA 1PD21 2I4AA 1NSWA 2HZEB 3UARA 2X99A 3HJOA 3S9FA 20GSA 3P7XA 2VLUA 1X5CA 3ERFA 1URMA 4NAXA 4I8BA 5D93A 1TRSA 1S3DA 3GH9A 2DJKA 1HNAA 2X8CA 2VD1A 3LJRA 4RI7A 2TRXA 2H0IA 4WETA 1TOFA 3VPTA 2IMIA 3HZ8A 1BAYA 1B9YC 1V9WA 5KN0A 2C0EA 2RIIA 1GTIA 6GSXA 2RUFA 3KMOA 3KIJA 2FWGA 2H66A 4MNNA 3LG6A 5A4WA 4XIHA 3I9V2 3IHQA 1AQWA 5L71A 2B1KA 3UBKA 2CAQA 2GVPA 5D9WA 4TR1B 1FAAA 1F3BA 1K0AA 1KTEA 2XHFA 1VGLA 2C0FA 3F4RA 2I81A 4LMVA 2YZHA 1FB6A 5IO2A 1K3OA 3EU3A 1WJKA 1BX9A 3L0HA 2B7JA 4MZBA 3DWVA 2H76A 2L4QA 2H73A 4HZ2A 3G9BA 5DQYA 4G0IA 5KN1A 1MDJA 1EP7A 2CQ9A 4BVXB 1SYRA 3WGXA 4QQ7A 2X49A 2HZEA 5JWOB 4CY6A 4ULXA 1WWJA 2WULA 4YAPA 1MD4A 4G10A 5IMDA 1ZL9A 1SK1A 1I9DA 1U88A 3FR3A 3F9UA 1Z7PA 5IMZA 2QC7A 2CA8A 2DJ2A 2N5BA 3KP9A 3CSHA 1XOAA 3U5RE 1SK2A 5CRWA 1XXUA 4G0LA 4OFNA 3FY7A 1FHEA 1J08A 3DXBA 2VCVA 3GKXA 3UVTA 4F9ZA 2H70A 2OKAA 5ECHB 3L9SA 1VF3A 2HI7A 3DGQA 3TOTA 3WD6A 3A3TA 2DIZA 2H1BA 1PRXA 5AGYA 1H4OA 4JZQA 4IN0A 3QDNA 3GKNA 2H74A 3KP8A 4KCAA 3GX8A 4HU7A 2MMAA 4TR1A 1M7TA 2P31A 1YKCA 5FHIA 3ZIVA 5DJLA 1AUCA 1PSQA 2CZ3A 3QD9A 2YP6A 4F0CA 1OYJA 2EIOA 2O87A 1C72A 2VM2A 4I2UA 4N11A 5DALB 1H75A 3KM6A 4O92A 2PN8A 2V1MA 4FH8A 2NVLA 2K8SA 2L5LA 4ZILA 3Q18A 1ZYEA 1TP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXO B;  1XWB A;  2VAF A;  3D0Z A;  1Z7R A;  1X9M B;  3NOF A;  3O6T A;  1S3A A;  4OFT A;  1KEB A;  5JWR B;  1GUM A;  2DJJ A;  3M0F A;  1YY7 A;  3M9K A;  4ECI A;  1MD3 A;  4F2I A;  3FKF A;  3KZQ A;  3KXO A;  3TJK A;  1F37 A;  2FWF A;  1M2D A;  1YEX A;  5DCH A;  3I69 A;  1OKT A;  3F63 A;  2VM1 A;  4Q5Q A;  4ZB9 A;  3TKQ A;  4MJC A;  1QFN A;  4XTS A;  2H75 A;  3GL3 A;  3CBU A;  2MMN A;  4EKZ A;  4POL A;  3CRT A;  19GS A;  1N8J A;  1PGT A;  1SL1 B;  3KD0 A;  4PUA A;  2LJA A;  2LST A;  2IME A;  4GTU A;  1FW1 A;  4O32 A;  2MYG A;  2L5O A;  2BMX A;  3ZL5 A;  3C73 A;  4NPB A;  2LRC A;  5B8B A;  1Z5Y E;  1ABA A;  2GS3 A;  1K3L A;  3LFL A;  4CW9 A;  4KND A;  3ZMK A;  4IHU A;  3UJ1 A;  1UC7 A;  4TR4 A;  5ID2 B;  4YH2 A;  4WKW A;  1M99 A;  5IMC A;  1V40 A;  4HZ4 A;  4IP6 A;  1SJI A;  1A0F A;  2X64 A;  1ERT A;  4RQX A;  1DBY A;  2AYT A;  4MJB A;  2GZY A;  4YQV A;  3GRX A;  5DAL A;  2V2G A;  4V2M A;  4J2F A;  2JZT A;  1XBS A;  2TIR A;  3N5O A;  5HFI A;  3RPP A;  3HJM A;  3H4K A;  4XS1 A;  4MJE A;  4TXO A;  2H6Z A;  4MPF A;  5DAK B;  5DDL A;  3F6F A;  2LNT A;  4MH2 A;  3VWX A;  2FD3 A;  4L0U A;  4EO3 A;  3CSJ A;  4NV5 A;  2PVQ A;  1YF0 A;  2C1Y A;  2VL2 C;  2DJ0 A;  2PWJ A;  1UA5 A;  1W89 A;  4QL7 A;  1GWC A;  2IJY A;  2GGT A;  4J57 E;  1DE1 A;  1N2A A;  3HVX A;  4WF5 A;  4DEJ A;  3HDC A;  2GLR A;  3QAV A;  2DC5 A;  3ZLP A;  3ZFL A;  3HXS A;  2C0G A;  3Q19 A;  1U3I A;  1EP8 A;  2IMK A;  3ERW A;  3MSZ A;  2HT9 A;  2A2R A;  3NIV A;  1A2J A;  3L9V A;  3R2Q A;  4WR5 A;  1XWA A;  3ZRE A;  2K6V A;  3M8N A;  1USB A;  1GTB A;  1QMV A;  1VRS D;  4WBJ A;  5ID2 A;  3WYW A;  1ZCP A;  4XCS A;  3DVW A;  3GUR A;  4NXI A;  18GS A;  3LSZ A;  4GQF A;  2DJ3 A;  3A2V A;  5F8B A;  3ERG A;  2KHP A;  1GSU A;  2M80 A;  2AJQ B;  4LLR A;  3FZ9 A;  1T8E B;  2YWI A;  2NBS A;  1JZO A;  5H5S A;  5G5E A;  1F2E A;  4E8E A;  1VF2 A;  1DUG A;  2FCH A;  5HFK A;  1CQG A;  1O85 A;  1CQH A;  1OC8 A;  1V57 A;  4HJ2 A;  4MMM A;  1WMJ A;  4KDU A;  2EIQ A;  1GUH A;  1T4Y A;  1T4Z A;  2XBI A;  1GSD A;  4Q5F A;  13GS A;  3FR9 A;  2I3Y A;  5ECN B;  4KX4 A;  1JLV A;  5CYY A;  4PUR A;  2QGV A;  2OE0 A;  1GP1 A;  1V98 A;  2CAI A;  3VWW A;  2G0F A;  2HLS A;  1AQX A;  1PKW A;  1XW9 A;  1ZMA A;  3P8W A;  1M2A A;  2JAD A;  4GRF A;  4ACS A;  1Z3E A;  2VLV A;  3US3 A;  1E6B A;  2LKU A;  2VCW A;  3TJF A;  2DSA A;  5E59 A;  4MF7 A;  3IR4 A;  16GS A;  3F6D A;  1ILO A;  2QSI A;  1WP0 A;  2MBT A;  3FZA A;  2CVD A;  4ZXG A;  3EWL A;  4DSS B;  2GT5 A;  5HFG A;  1IYI A;  3O76 A;  5EY6 A;  2F8F A;  1EEM A;  4IBP A;  2M46 A;  3RAZ A;  4BL7 A;  4XS6 A;  3ME7 A;  3TJJ A;  1U6T A;  2LS5 A;  3VFI A;  3IXR A;  2H72 A;  2LRT A;  1ERW A;  1F3A A;  4JU5 A;  3DVX A;  4HDE A;  2LEG A;  1IYH A;  4ZL7 A;  1PX6 A;  3QAG A;  2HNL A;  3GMF A;  3KTL A;  5DVB A;  1YJ6 A;  1R5P A;  5E4W A;  3BBY A;  4TR0 A;  22GS A;  1JZW A;  1TI1 A;  4K9Z A;  3M1G A;  2AUV A;  3GA4 A;  5AIS A;  3DD3 A;  6GSU A;  6GSW A;  2ZNM A;  3W8S A;  5J9C A;  4PNF A;  3TKP A;  1SD8 A;  1Y6E A;  2JU5 A;  2H8L A;  5ECK B;  1G6W A;  2CV4 A;  4F0B A;  3DRN A;  3IBH A;  4MF6 A;  3RDW A;  4CDO A;  4Q5N A;  5D73 A;  5ECO B;  4MZW A;  4V1A g;  1X0R A;  4YAV A;  2FWE A;  2R3X A;  2B5Y A;  3GFK A;  5HR3 A;  3GKM A;  4J56 E;  5LCZ A;  1QUW A;  2J23 A;  1G7E A;  2GQK A;  4GWR A;  4KGI A;  3TRP A;  2B1L A;  2ZCT A;  4DSS A;  1A24 A;  2YWM A;  1ERV A;  3GSS A;  5GAP D;  3KMN A;  5G1K A;  4PQI A;  1WOU A;  2GDR A;  2B6M A;  4EE0 A;  4KDX A;  5F0G A;  5G5F A;  1G6Y A;  2PUK C;  3QAW A;  4GXZ A;  5F07 A;  8GSS A;  3D22 A;  2RM5 A;  2YJH A;  1HD2 A;  4K7N A;  3GTU B;  4NWY A;  2WZ9 A;  2NTO A;  3QCP A;  4KUN A;  5JCU A;  4ECC A;  3G7I A;  5ECL B;  2WJU A;  2Z9S A;  2C80 A;  4ECJ A;  3TDG A;  2IL3 A;  6GSV A;  2IPA A;  6GSY A;  3DIE A;  3HKR A;  1A23 A;  2K8V A;  4K2D A;  3EMP A;  3ZTL A;  1K0C A;  2O89 A;  2R4V A;  1EGO A;  1TI3 A;  1TXX A;  2LQO A;  2WFC A;  1GNW A;  2MZC A;  1S3C A;  1SD9 A;  2L6D A;  4POM A;  4EDZ A;  4OFM A;  3U6V A;  3C7M A;  2B5X A;  2K18 A;  3LGC A;  4ECB A;  1XOB A;  4GQC A;  2PGT A;  2VL3 A;  3WT1 A;  1BJX A;  1SJ6 A;  5B6N A;  1SU9 A;  2DLX A;  5GSS A;  3ZVJ A;  2JSY A;  4F03 A;  1GSF A;  1KNG A;  3UVH A;  4I6X A;  2WDU A;  2YAN A;  2YV7 A;  3HZ4 A;  2AV4 A;  2NDO A;  5CRD A;  4TVE A;  2FNO A;  1TRW A;  2RLI A;  3RBT A;  1Z9H A;  1FOV A;  1PMT A;  2HXK A;  2HRF A;  5ECR B;  2CX3 A;  5KEJ A;  3DML A;  4TOP A;  1EGR A;  3KGK A;  5ABR A;  3HCZ A;  1GSQ A;  5F06 A;  2GZZ A;  1F9M A;  3D5J A;  3I43 A;  4TRX A;  2YZU A;  3GTU A;  3HHV A;  4V1A p;  5AIV A;  1GTA A;  4OWY A;  3HD5 A;  1M2B A;  4IQ1 A;  2GST A;  1GUK A;  4G19 A;  1TU8 A;  3LEF A;  3IAS 2;  5HR2 A;  2IFQ B;  4L8E A;  5HR0 A;  3APS A;  14GS A;  3ZVJ D;  4MLY A;  2H1D A;  2VIM A;  2L4C A;  3C1S A;  1I5G A;  3GKK A;  4KSM A;  3M3M A;  4D73 B;  1DSB A;  2E7P A;  3LXZ A;  2DMM A;  3IK7 A;  2EIR A;  2WGR A;  1XCC A;  5JCG A;  5A5K A;  5IMA A;  4WF4 A;  1GLP A;  4YQM A;  3TGZ A;  2HRN A;  3UAP A;  4BWS A;  2DBC A;  3TKS E;  2PBJ A;  3BCK A;  3GN3 A;  4BPY A;  5D9T A;  2A2S A;  2H71 A;  4KSO A;  4LA1 A;  2G2Q A;  3BD2 A;  4EVM A;  1XPV A;  2CX4 A;  2L57 A;  1O7U A;  4K7O A;  4LMW A;  2YJ7 A;  5J9B A;  3QFA C;  1XWC A;  3K8N A;  3GYK A;  2DIY A;  1ZGN A;  3NZN A;  1ON4 A;  2CVK A;  3UBL A;  1NW2 A;  2CT6 A;  3GST A;  1EWX A;  5KN3 A;  3QOU A;  1QK8 A;  4LL4 B;  1TK0 B;  2VO4 A;  4WBR D;  1WRY A;  5LNK e;  1YKA A;  3Q6O A;  1UVZ A;  2I9H A;  1SKS B;  3IOS A;  3KH9 A;  1U3A A;  3FR6 A;  1XW5 A;  3N9J A;  5IMV A;  3M9J A;  3FRC A;  3WGD A;  3D4M A;  2IFQ A;  4Z7X A;  3VPQ A;  1R4W A;  2LJK A;  2KOK A;  1B9X C;  5ECQ B;  4XRD A;  4ZBA A;  4D73 A;  3TCO A;  2LV3 A;  3EUR A;  3EVI A;  1PX7 A;  1DE2 A;  4PNG A;  1YZX A;  4HI7 A;  4KH7 A;  3EMX A;  2OJL A;  1WE0 A;  2VL9 A;  3HYP A;  3IRA A;  3TRQ A;  2XBQ A;  1J9B A;  4WEY A;  3TRX A;  4FO5 A;  1B48 A;  3KJY A;  4PQ1 A;  3PH9 A;  5A4U A;  1K0D A;  4LL1 B;  1GSS A;  2AHE A;  3TUE A;  1Q98 A;  4TR3 A;  4ID0 A;  4DSR A;  4FIW A;  1ST9 A;  1F6M C;  1OE8 A;  5H5Q A;  3FYG A;  5IOW A;  2MBS A;  1B4Q A;  5FT3 A;  1EV4 A;  2WCI A;  3UEM A;  4MZC A;  4GF0 A;  3VWV A;  2GSS A;  2B5E A;  4CHS A;  5AIX A;  2JZR A;  1XVQ A;  2WRT A;  4MP4 A;  5ECI B;  3GHA A;  3CRU A;  4V2N A;  2V41 A;  1KBN A;  1VF4 A;  1YDK A;  2OBK A;  2H1A A;  3TKS A;  2YN1 A;  2CVB A;  2R6K A;  5COH A;  4PGT A;  4HUA A;  2RUE A;  1RQM A;  4MH3 A;  3ISO A;  1U87 A;  3I6A A;  5GAN D;  2R5G A;  3O3T A;  1X5E A;  4P3Y B;  1K0O A;  1M9A A;  1JHB A;  1Z6N A;  2F8A A;  4RQR A;  4PQH A;  3KCM A;  3GV1 A;  3LXT A;  4IP1 A;  4HS1 A;  4FYB A;  2R2J A;  4KB3 A;  1UN2 A;  4EC0 A;  2YV9 A;  4EXJ A;  2OA7 A;  4DSQ A;  1THO A;  4G9H A;  2GSR A;  2PER A;  5H5R A;  3J7Y k;  4BWQ A;  3KEB A;  3F3Q A;  1O8X A;  3DYR A;  1VF1 A;  2V32 A;  3P90 A;  4ZBD A;  3LWA A;  3PIN A;  3EYT A;  4MPG A;  1HNB A;  1R7H A;  3W8J A;  2VCQ A;  3ZYW A;  1HYU A;  4JED A;  3TJB A;  1G7O A;  1A2M A;  5ENU A;  2KP2 A;  2JSZ A;  1XWK A;  1GH2 A;  2HZF A;  1T00 A;  4WR4 A;  1THX A;  2H19 A;  2N5F A;  1JZD A;  4X43 A;  5DCG A;  2YWO A;  3C1R A;  3GUS A;  2C3Q A;  3A5W A;  3G7Y A;  4ML6 A;  2DML A;  1QGV A;  4X0X A;  5CNW A;  3PR8 A;  3E9J B;  1MDK A;  4GCI A;  3WGE A;  2P0G A;  2IWT A;  5J41 A;  2VLT A;  1AIU A;  4OMV A;  1TK8 B;  3VLN A;  4O5R A;  4NHW A;  2VL2 A;  2PU9 C;  5ECM B;  4V2L A;  5DJM A;  3C71 A;  3F4T A;  4I97 A;  5GZZ B;  1EOG A;  5G31 A;  3SBC A;  4KCE A;  1XZO A;  3CTF A;  2LRN A;  2C8U A;  2XC2 A;  3DEX A;  3A2X A;  3E0U A;  3BCI A;  4I2T A;  2ALB A;  1EOH A;  4AJ8 A;  1JFU A;  3CXG A;  3V1W A;  2H30 A;  4N10 A;  1O6J A;  4MAB A;  3GNJ A;  4H86 A;  1V2A A;  5C00 A;  1A8L A;  3QR6 A;  3GIX A;  1BG5 A;  1FG4 A;  3DKS A;  2MMZ A;  3HVS A;  2CZ2 A;  3Q74 A;  3HA9 A;  2VCZ A;  1BYE A;  3CYN A;  2B3S A;  1TKD B;  3UL3 A;  4HOJ A;  4ILF A;  1FVJ A;  3KTB A;  4XRA A;  3MNG A;  4IVF A;  1PA3 A;  2F51 A;  1GLQ A;  4AJ7 A;  4ZL9 A;  1GSY A;  3BOA A;  4E8H A;  2WB9 A;  2O7K A;  2KLX A;  4K7I A;  2REM A;  2YCD A;  4ZB8 A;  4IJ3 A;  2ON5 A;  1SK0 A;  5ECP B;  1K0B A;  3QFB C;  4N0Z A;  5IM9 A;  2F9S A;  12GS A;  1T3B A;  3ZML A;  3IPZ A;  5IO0 A;  1TRV A;  1XVW A;  2WS2 A;  4IJI A;  3VWU A;  4IS0 A;  1PL1 A;  1R5A A;  4XHM A;  3TJG A;  5IPG A;  4OD7 A;  1YF1 A;  4FYU A;  5J4U A;  4XS4 B;  2I1U A;  2HYX A;  5CO3 A;  1PL2 A;  3MDK A;  4TXV A;  1GSE A;  1OKD A;  3ZFB A;  4K0N A;  1Z6M A;  5CAX A;  4ZIJ A;  3D4T A;  2R37 A;  3GX0 A;  3VI5 A;  4NV2 A;  4HQZ A;  4IQA A;  3QMX A;  3FK8 A;  4ZB6 A;  1O81 A;  1OE7 A;  1WIK A;  2HE3 A;  4NHZ A;  3APQ A;  2LTK A;  1WPI A;  2C3T A;  3KH7 A;  4EDY A;  1SL0 B;  3H1N A;  3EE2 A;  4HJM A;  3MWH A;  1GL8 A;  5EVO A;  2HSY A;  1GUL A;  2O8V B;  4KE3 A;  1HNC A;  2NPB A;  4PUF C;  5GST A;  1TW9 A;  2HFD A;  5B7C A;  5HR1 A;  7GSS A;  2LJR A;  3VI7 A;  9GSS A;  1NHO A;  3C8E A;  3ZIJ A;  1G0T A;  1TDI A;  3RHC A;  2IIY A;  2EC4 A;  2XPE A;  2FHE A;  1GTU A;  3SWL A;  4X1U A;  2P5R A;  5LD0 A;  2VOC A;  2K9F A;  5IPH A;  1X9S B;  4JR6 A;  5JWQ B;  4PX1 A;  3BJ5 A;  2X8H A;  5AN1 A;  4K8M A;  4ML1 A;  1XFL A;  1B4P A;  2AB6 A;  2E0Q A;  4YQU A;  1PN9 A;  2V6O A;  2VCT A;  4MJA A;  5G1L A;  1AC1 A;  4XS4 A;  1X9W B;  2JZS A;  3GH6 A;  4POK A;  3MAK A;  2IMD A;  2FA8 A;  2J9H A;  2YNX A;  4BVX A;  2TRC P;  4JBB A;  2FLS A;  3TKR A;  3EIN A;  5EPF A;  2A4V A;  5CRG A;  4KDY A;  4L0W A;  5G30 A;  2GZP A;  1TU7 A;  1XIY A;  2C0D A;  3TKS C;  2PPT A;  3HJP A;  3IAM 2;  4EL1 A;  4GLT A;  1TTZ A;  2OAD A;  3G7J A;  4KA0 A;  5J3R A;  2H1G A;  3F3R A;  2L6C A;  3HVV A;  4K6X A;  2ES7 A;  4TW5 A;  5B6M A;  1JLW A;  1V58 A;  1J0F A;  1SL2 B;  4MA9 A;  2B7K A;  2ZUP A;  3WT2 A;  2XPD A;  1K3Y A;  1ZOF A;  4Q5R A;  2QKE A;  4O7H A;  5KN2 A;  3P2A A;  3LYK A;  4ZBB A;  1NHY A;  3OR5 A;  3UOM A;  3VUR A;  3ME8 A;  3FHK A;  4OCF A;  4AJ6 A;  5CP1 A;  2FY6 A;  4F82 A;  2HSH A;  4POB A;  5ELA A;  4JR4 A;  4OO5 A;  4HU9 A;  2E2G A;  3PGT A;  1MDI A;  4MDC A;  4K1F A;  4QL9 A;  2D2Z A;  1XW6 A;  1W4V A;  5IMF A;  3CTG A;  4NMU A;  4JRR A;  11GS A;  3IK9 A;  1FB0 A;  1Y25 A;  5A4V A;  2KP1 A;  3D6I A;  1MTC A;  2ON7 A;  4BA7 A;  3L78 A;  5C04 A;  4RUV A;  5B8A A;  1R26 A;  5IQY A;  2JL4 A;  3CMI A;  1PQN A;  2E2M A;  5G2Z A;  3FW2 A;  1BQ7 A;  2PVO C;  2GTU A;  2BTO T;  4HEA 2;  1TK5 B;  2GQM A;  3FZ4 A;  2GQL A;  2YWN A;  1K0M A;  4N0V A;  1LBK A;  2LQQ A;  2F3M A;  3W6G A;  3ZIT A;  3ED3 A;  1NM3 A;  2DJ1 A;  4ISD A;  5HQP A;  1AXD A;  3IC4 A;  1T7P B;  1YEP A;  5IIZ A;  2H0G A;  5EL8 A;  4DVC A;  1EEJ A;  3IE3 A;  5D8I A;  3EU4 A;  1GRX A;  3L9U A;  4AF2 A;  4FYC A;  1TRU A;  10GS A;  5F05 A;  1ACV A;  4G2E A;  1XWG A;  4BVY A;  3HY2 A;  2OE3 A;  3L4N A;  1OC3 A;  1SKR B;  1OVN A;  1FO5 A;  2VD0 A;  1O8W A;  1OAZ A;  1TJD A;  1ML6 A;  3ZZX A;  2LNS A;  2KUC A;  5J5N A;  1HQO A;  1K0N A;  2OAC A;  4L5O A;  1OC9 B;  5DBQ A;  4WXT A;  2FUG 2;  4K0G A;  3J7Y b;  4IW9 A;  1A2L A;  4MK3 A;  1A8Y A;  1YQ1 A;  3TOU A;  4I5Q A;  5INY A;  4TN8 A;  5D96 A;  1Q4J A;  3UMA A;  2JAC A;  1B8X A;  3E3E A;  1PKZ A;  3LQ7 A;  4IEL A;  4ZL8 A;  4IKH A;  1AW9 A;  4N30 A;  3RHB A;  4L5L A;  1EZK A;  1LU4 A;  1RK4 A;  4IGJ A;  1QQ2 A;  2YOI A;  3EC3 A;  1X5D A;  3FEU A;  2GSQ A;  1GNE A;  1MEK A;  3H8Q A;  6GSS A;  3CSI A;  2H6X A;  4GSN A;  1O73 A;  4EUY A;  2GT6 A;  3FZ5 A;  3H93 A;  4HQS A;  4PXO A;  5ELG A;  1SEN A;  5CRE A;  4MCU A;  1M0U A;  3RPN A;  3H79 A;  5DAK A;  3A2W A;  2O85 A;  5JCW A;  2V6K A;  4TKY A;  1ERU A;  5D9X A;  3VK9 A;  2M72 A;  3QPM A;  5IOX A;  3UIW A;  4AGS A;  2N5A A;  1QXH A;  4MF5 A;  4OCE A;  3LYP A;  5CRH A;  1SKW B;  2OBI A;  5D9V A;  1AQV A;  2IN3 A;  2FGX A;  2H6Y A;  1FVK A;  2C3N A;  1A0R P;  4RI6 A;  2VCX A;  2H0H A;  3F4S A;  4GSS A;  2AAW A;  2YPM A;  3F0I A;  1SYX A;  3LOR A;  2PMT A;  6GST A;  3AY8 A;  3TB2 A;  1EV9 A;  3ZRD A;  2LUS A;  1ZYQ B;  2BJX A;  2MMO A;  2FWH A;  1T1V A;  1JZR A;  1OC9 A;  1LJR A;  2RM6 A;  3GL5 A;  2X8G A;  1M9B A;  3F8U A;  5FWG A;  4GST A;  2FA4 A;  2C4J A;  4KAE A;  2L59 A;  1SJZ A;  1RW1 A;  4EF0 A;  3IDV A;  2IMF A;  2VUP A;  3APO A;  1ZZY A;  4OO4 A;  1AAZ A;  4KW6 A;  2OE1 A;  3IA1 A;  17GS A;  5ECS A;  4JE1 A;  2P5Q A;  3IV4 A;  3D21 A;  2H01 A;  5DQS A;  3JCM L;  1E2Y A;  1BED A;  1PD2 1;  2I4A A;  1NSW A;  2HZE B;  3UAR A;  2X99 A;  3HJO A;  3S9F A;  20GS A;  3P7X A;  2VLU A;  1X5C A;  3ERF A;  1URM A;  4NAX A;  4I8B A;  5D93 A;  1TRS A;  1S3D A;  3GH9 A;  2DJK A;  1HNA A;  2X8C A;  2VD1 A;  3LJR A;  4RI7 A;  2TRX A;  2H0I A;  4WET A;  1TOF A;  3VPT A;  2IMI A;  3HZ8 A;  1BAY A;  1B9Y C;  1V9W A;  5KN0 A;  2C0E A;  2RII A;  1GTI A;  6GSX A;  2RUF A;  3KMO A;  3KIJ A;  2FWG A;  2H66 A;  3LG6 A;  5A4W A;  4XIH A;  3I9V 2;  3IHQ A;  1AQW A;  5L71 A;  2B1K A;  3UBK A;  2CAQ A;  2GVP A;  5D9W A;  4TR1 B;  1FAA A;  1F3B A;  1K0A A;  1KTE A;  2XHF A;  1VGL A;  2C0F A;  3F4R A;  2I81 A;  4LMV A;  2YZH A;  1FB6 A;  5IO2 A;  1K3O A;  3EU3 A;  1WJK A;  1BX9 A;  3L0H A;  2B7J A;  4MZB A;  3DWV A;  2H76 A;  2L4Q A;  2H73 A;  4HZ2 A;  3G9B A;  5DQY A;  5KN1 A;  1MDJ A;  1EP7 A;  2CQ9 A;  1SYR A;  3WGX A;  4QQ7 A;  2HZE A;  5JWO B;  4ULX A;  1WWJ A;  2WUL A;  4YAP A;  1MD4 A;  4G10 A;  5IMD A;  1ZL9 A;  1SK1 A;  1I9D A;  1U88 A;  3FR3 A;  3F9U A;  1Z7P A;  5IMZ A;  2QC7 A;  2CA8 A;  2DJ2 A;  2N5B A;  3KP9 A;  3CSH A;  1XOA A;  3U5R E;  1SK2 A;  5CRW A;  1XXU A;  4OFN A;  3FY7 A;  1FHE A;  1J08 A;  3DXB A;  2VCV A;  3GKX A;  3UVT A;  4F9Z A;  2H70 A;  2OKA A;  5ECH B;  3L9S A;  1VF3 A;  2HI7 A;  3DGQ A;  3TOT A;  3WD6 A;  3A3T A;  2DIZ A;  2H1B A;  1PRX A;  5AGY A;  1H4O A;  4JZQ A;  4IN0 A;  3QDN A;  3GKN A;  2H74 A;  3KP8 A;  4KCA A;  3GX8 A;  4HU7 A;  2MMA A;  4TR1 A;  1M7T A;  2P31 A;  1YKC A;  5FHI A;  3ZIV A;  5DJL A;  1AUC A;  1PSQ A;  2CZ3 A;  3QD9 A;  2YP6 A;  4F0C A;  1OYJ A;  2EIO A;  2O87 A;  1C72 A;  2VM2 A;  4I2U A;  4N11 A;  5DAL B;  1H75 A;  3KM6 A;  4O92 A;  2PN8 A;  2V1M A;  4FH8 A;  2NVL A;  2K8S A;  2L5L A;  4ZIL A;  3Q18 A;  1ZYE A;  1TP9 A; 
#chains in the Genus database with same CATH topology
 4TXO B;  1XWB A;  2VAF A;  3D0Z A;  1Z7R A;  1X9M B;  1M3J A;  3NOF A;  3O6T A;  1S3A A;  4OFT A;  1KEB A;  5JWR B;  1GUM A;  2DJJ A;  3M0F A;  1YY7 A;  3M9K A;  4ECI A;  1MD3 A;  4F2I A;  3FKF A;  3KZQ A;  3KXO A;  3TJK A;  1F37 A;  2FWF A;  1M2D A;  1YEX A;  5DCH A;  3I69 A;  1OKT A;  3F63 A;  2VM1 A;  4Q5Q A;  4ZB9 A;  3TKQ A;  4MJC A;  1QFN A;  4XTS A;  2H75 A;  3GL3 A;  3CBU A;  2MMN A;  4EKZ A;  4POL A;  3CRT A;  19GS A;  1N8J A;  1PGT A;  1SL1 B;  3KD0 A;  4PUA A;  2LJA A;  2LST A;  2IME A;  4GTU A;  1FW1 A;  4O32 A;  2MYG A;  2L5O A;  2BMX A;  3ZL5 A;  3C73 A;  4NPB A;  2LRC A;  5B8B A;  1Z5Y E;  1ABA A;  2GS3 A;  1K3L A;  3LFL A;  4CW9 A;  4KND A;  3ZMK A;  4IHU A;  3UJ1 A;  1UC7 A;  4TR4 A;  5ID2 B;  4A5P A;  4YH2 A;  4WKW A;  1M99 A;  5IMC A;  1V40 A;  4HZ4 A;  4IP6 A;  1SJI A;  1A0F A;  2X64 A;  1ERT A;  4RQX A;  1DBY A;  2AYT A;  4MJB A;  2GZY A;  4YQV A;  3GRX A;  5DAL A;  2V2G A;  4V2M A;  4J2F A;  2JZT A;  1XBS A;  2TIR A;  3N5O A;  5HFI A;  3RPP A;  3HJM A;  3H4K A;  4XS1 A;  4MJE A;  4TXO A;  2H6Z A;  4MPF A;  5DAK B;  5DDL A;  3F6F A;  2LNT A;  4MH2 A;  3VWX A;  2FD3 A;  4L0U A;  4EO3 A;  3CSJ A;  4NV5 A;  2PVQ A;  1YF0 A;  2C1Y A;  2VL2 C;  2DJ0 A;  2PWJ A;  1UA5 A;  1W89 A;  4QL7 A;  4YKG A;  1GWC A;  2IJY A;  2GGT A;  4J57 E;  1DE1 A;  1N2A A;  3HVX A;  4WF5 A;  4DEJ A;  3HDC A;  2GLR A;  3QAV A;  2DC5 A;  3ZLP A;  3ZFL A;  3HXS A;  2C0G A;  3Q19 A;  1U3I A;  1EP8 A;  2IMK A;  3ERW A;  3MSZ A;  1FOH A;  2HT9 A;  2A2R A;  3NIV A;  1A2J A;  3L9V A;  3R2Q A;  4WR5 A;  1XWA A;  3ZRE A;  2K6V A;  3M8N A;  1USB A;  1GTB A;  1QMV A;  1VRS D;  4WBJ A;  5ID2 A;  4BL7 B;  3WYW A;  1ZCP A;  4XCS A;  3DVW A;  3GUR A;  4NXI A;  18GS A;  3LSZ A;  4GQF A;  2DJ3 A;  3A2V A;  5F8B A;  3ERG A;  2KHP A;  1GSU A;  2M80 A;  2AJQ B;  4LLR A;  3FZ9 A;  1T8E B;  2YWI A;  2NBS A;  1JZO A;  5H5S A;  5G5E A;  1F2E A;  4E8E A;  1VF2 A;  1DUG A;  2FCH A;  5HFK A;  1CQG A;  1O85 A;  1CQH A;  1OC8 A;  1V57 A;  4HJ2 A;  4MMM A;  1WMJ A;  4KDU A;  2EIQ A;  1GUH A;  1T4Y A;  1T4Z A;  2XBI A;  1GSD A;  4Q5F A;  13GS A;  3FR9 A;  2I3Y A;  5ECN B;  4EIQ A;  4KX4 A;  4BIK A;  1JLV A;  5CYY A;  4PUR A;  2QGV A;  2OE0 A;  1GP1 A;  1V98 A;  2CAI A;  3VWW A;  2G0F A;  2HLS A;  1AQX A;  1PKW A;  1XW9 A;  1ZMA A;  3P8W A;  1M2A A;  2JAD A;  4GRF A;  4ACS A;  1Z3E A;  4K2X A;  2VLV A;  3US3 A;  3CQF A;  4EIP A;  1E6B A;  2LKU A;  2VCW A;  3TJF A;  2DSA A;  2QA1 A;  5E59 A;  4MF7 A;  3IR4 A;  16GS A;  3F6D A;  1ILO A;  2QSI A;  1WP0 A;  2MBT A;  3FZA A;  2CVD A;  4ZXG A;  3EWL A;  4DSS B;  2GT5 A;  5HFG A;  1IYI A;  3O76 A;  5EY6 A;  2F8F A;  1EEM A;  4IBP A;  2M46 A;  3RAZ A;  4BL7 A;  4XS6 A;  3ME7 A;  3TJJ A;  1U6T A;  2LS5 A;  3VFI A;  3IXR A;  2H72 A;  2LRT A;  1ERW A;  1F3A A;  4JU5 A;  3DVX A;  4HDE A;  2LEG A;  1IYH A;  4ZL7 A;  1PX6 A;  3QAG A;  2HNL A;  3GMF A;  3KTL A;  5DVB A;  1YJ6 A;  1R5P A;  5E4W A;  3BBY A;  4TR0 A;  22GS A;  1JZW A;  1TI1 A;  4K9Z A;  3M1G A;  2AUV A;  3GA4 A;  5AIS A;  3DD3 A;  6GSU A;  6GSW A;  2ZNM A;  3W8S A;  5J9C A;  4PNF A;  3TKP A;  1SD8 A;  1Y6E A;  2JU5 A;  2H8L A;  5ECK B;  1G6W A;  2CV4 A;  4F0B A;  3DRN A;  3IBH A;  4MF6 A;  3RDW A;  4CDO A;  4Q5N A;  5D73 A;  5ECO B;  4MZW A;  4V1A g;  1X0R A;  4YAV A;  2FWE A;  2R3X A;  2B5Y A;  3GFK A;  5HR3 A;  3GKM A;  4J56 E;  5LCZ A;  1QUW A;  2J23 A;  1G7E A;  2GQK A;  4GWR A;  4KGI A;  3TRP A;  2B1L A;  2ZCT A;  4DSS A;  1A24 A;  2YWM A;  1ERV A;  3GSS A;  5GAP D;  3FMW A;  3KMN A;  5G1K A;  4PQI A;  1WOU A;  2GDR A;  2B6M A;  4EE0 A;  4KDX A;  5F0G A;  5G5F A;  1G6Y A;  2PUK C;  3QAW A;  4GXZ A;  5F07 A;  8GSS A;  3D22 A;  2RM5 A;  2YJH A;  1HD2 A;  4K7N A;  3GTU B;  3LW9 A;  4NWY A;  2WZ9 A;  2NTO A;  3QCP A;  4KUN A;  5JCU A;  4ECC A;  3G7I A;  5ECL B;  2WJU A;  2HRA A;  2Z9S A;  2C80 A;  4ECJ A;  3TDG A;  2IL3 A;  6GSV A;  2IPA A;  6GSY A;  3DIE A;  3HKR A;  4USS A;  1A23 A;  2K8V A;  4K2D A;  3EMP A;  3ZTL A;  1K0C A;  2O89 A;  2R4V A;  1EGO A;  1TI3 A;  1TXX A;  2LQO A;  2WFC A;  1GNW A;  2MZC A;  1S3C A;  1SD9 A;  2L6D A;  4POM A;  4EDZ A;  4OFM A;  3U6V A;  3C7M A;  2B5X A;  2K18 A;  3LGC A;  4ECB A;  1XOB A;  4GQC A;  4PTS A;  4K5R A;  2PGT A;  2DKH A;  2VL3 A;  3WT1 A;  1BJX A;  1SJ6 A;  5B6N A;  1SU9 A;  2DLX A;  5GSS A;  3ZVJ A;  2JSY A;  4F03 A;  1GSF A;  1KNG A;  3UVH A;  4I6X A;  2WDU A;  2YAN A;  2YV7 A;  3HZ4 A;  2AV4 A;  3MIX A;  2NDO A;  5CRD A;  4TVE A;  2FNO A;  1TRW A;  2RLI A;  3RBT A;  1Z9H A;  2R0P A;  5BRT A;  1FOV A;  1PMT A;  2HXK A;  2HRF A;  5ECR B;  2CX3 A;  5KEJ A;  3DML A;  4TOP A;  1EGR A;  3KGK A;  5ABR A;  3HCZ A;  1GSQ A;  5F06 A;  2GZZ A;  1F9M A;  3D5J A;  3I43 A;  4TRX A;  2YZU A;  3GTU A;  3HHV A;  4V1A p;  5AIV A;  2R0C A;  1GTA A;  4OWY A;  3HD5 A;  1M2B A;  4IQ1 A;  2GST A;  1GUK A;  4G19 A;  1TU8 A;  3LEF A;  3IAS 2;  5HR2 A;  2IFQ B;  4L8E A;  5HR0 A;  3APS A;  14GS A;  3ZVJ D;  4MLY A;  2H1D A;  2VIM A;  2L4C A;  3C1S A;  1I5G A;  3GKK A;  4KSM A;  3M3M A;  4D73 B;  1DSB A;  2E7P A;  3LXZ A;  2DMM A;  3IK7 A;  2EIR A;  2WGR A;  1XCC A;  5JCG A;  4K5S A;  5A5K A;  5IMA A;  4WF4 A;  1GLP A;  4YQM A;  3TGZ A;  2HRN A;  3UAP A;  4BWS A;  2DBC A;  3TKS E;  2PBJ A;  3BCK A;  3GN3 A;  4BPY A;  5D9T A;  2A2S A;  2H71 A;  4KSO A;  4LA1 A;  2G2Q A;  1ZYN A;  3BD2 A;  4EVM A;  1XPV A;  2CX4 A;  2L57 A;  1O7U A;  3HVN A;  3PPU A;  4K7O A;  4LMW A;  2YJ7 A;  5J9B A;  3QFA C;  1XWC A;  3K8N A;  3GYK A;  2DIY A;  1ZGN A;  3MYD A;  3NZN A;  1ON4 A;  2CVK A;  3UBL A;  1NW2 A;  2CT6 A;  3GST A;  1EWX A;  5KN3 A;  3QOU A;  1QK8 A;  4LL4 B;  1TK0 B;  2VO4 A;  4WBR D;  1WRY A;  5LNK e;  1YKA A;  3Q6O A;  1UVZ A;  2I9H A;  1SKS B;  3IOS A;  3KH9 A;  1U3A A;  4Z2T A;  3FR6 A;  1XW5 A;  3N9J A;  5IMV A;  3M9J A;  3FRC A;  3WGD A;  3D4M A;  2IFQ A;  4Z7X A;  3VPQ A;  1R4W A;  1S3R A;  2LJK A;  2KOK A;  1B9X C;  5ECQ B;  4XRD A;  4ZBA A;  4D73 A;  3TCO A;  2LV3 A;  3EUR A;  3EVI A;  1PX7 A;  1DE2 A;  4PNG A;  1YZX A;  4HI7 A;  4KH7 A;  3EMX A;  2OJL A;  1WE0 A;  1XG8 A;  4YKF A;  2VL9 A;  3HYP A;  3IRA A;  3TRQ A;  2XBQ A;  1J9B A;  4WEY A;  3TRX A;  4FO5 A;  1B48 A;  3KJY A;  4PQ1 A;  3PH9 A;  5A4U A;  1K0D A;  4LL1 B;  1GSS A;  2AHE A;  3TUE A;  1Q98 A;  4TR3 A;  4ID0 A;  4DSR A;  4FIW A;  1ST9 A;  1F6M C;  1OE8 A;  5H5Q A;  3FYG A;  5IOW A;  2MBS A;  1B4Q A;  5FT3 A;  1EV4 A;  2WCI A;  3UEM A;  4MZC A;  4GF0 A;  3VWV A;  2GSS A;  2B5E A;  4CHS A;  5AIX A;  2JZR A;  1XVQ A;  2WRT A;  4MP4 A;  5ECI B;  3GHA A;  3CRU A;  4V2N A;  2V41 A;  1KBN A;  1VF4 A;  3A5I A;  1YDK A;  2OBK A;  2H1A A;  3TKS A;  2YN1 A;  2CVB A;  2R6K A;  5COH A;  4PGT A;  4HUA A;  2RUE A;  1RQM A;  4MH3 A;  3ISO A;  1U87 A;  3I6A A;  5GAN D;  2R5G A;  3O3T A;  1X5E A;  4P3Y B;  1K0O A;  1M9A A;  1JHB A;  1Z6N A;  1PFO A;  2F8A A;  4RQR A;  4PQH A;  3KCM A;  3GV1 A;  3LXT A;  4IP1 A;  4HS1 A;  4FYB A;  2R2J A;  4KB3 A;  1UN2 A;  4EC0 A;  2YV9 A;  2DKI A;  4EXJ A;  2OA7 A;  4DSQ A;  1THO A;  4G9H A;  2GSR A;  2PER A;  5H5R A;  3J7Y k;  3IHG A;  4BWQ A;  3KEB A;  3F3Q A;  1O8X A;  3DYR A;  1VF1 A;  2V32 A;  3P90 A;  4ZBD A;  3LWA A;  3PIN A;  3EYT A;  4MPG A;  1HNB A;  1R7H A;  3W8J A;  2VCQ A;  3ZYW A;  1HYU A;  4JED A;  3TJB A;  1G7O A;  1A2M A;  5ENU A;  2KP2 A;  2JSZ A;  1XWK A;  1GH2 A;  2HZF A;  1T00 A;  4WR4 A;  1THX A;  2H19 A;  2N5F A;  1JZD A;  2X4A A;  4X43 A;  5DCG A;  2YWO A;  3C1R A;  3GUS A;  2C3Q A;  3A5W A;  3G7Y A;  4ML6 A;  2DML A;  1QGV A;  4X0X A;  5CNW A;  3PR8 A;  3E9J B;  1MDK A;  4GCI A;  3WGE A;  2P0G A;  2IWT A;  5J41 A;  2VLT A;  1AIU A;  4OMV A;  1TK8 B;  3VLN A;  4O5R A;  4NHW A;  2VL2 A;  2PU9 C;  5ECM B;  4V2L A;  5DJM A;  3C71 A;  3F4T A;  4I97 A;  5GZZ B;  1EOG A;  5G31 A;  3SBC A;  4KCE A;  1XZO A;  3CTF A;  2LRN A;  2C8U A;  2XC2 A;  3DEX A;  3A2X A;  3E0U A;  3BCI A;  4I2T A;  2ALB A;  1EOH A;  4AJ8 A;  1JFU A;  3CXG A;  3V1W A;  2H30 A;  4N10 A;  1O6J A;  4MAB A;  3GNJ A;  4H86 A;  1V2A A;  5C00 A;  1A8L A;  3QR6 A;  3GIX A;  1BG5 A;  2HSM A;  1FG4 A;  3DKS A;  2MMZ A;  3HVS A;  2CZ2 A;  3Q74 A;  3HA9 A;  2VCZ A;  4CY8 A;  1BYE A;  3CYN A;  2B3S A;  1TKD B;  3UL3 A;  4HOJ A;  4ILF A;  1FVJ A;  3KTB A;  4XRA A;  3MNG A;  4IVF A;  1PA3 A;  2F51 A;  1GLQ A;  4AJ7 A;  4ZL9 A;  1GSY A;  3BOA A;  4E8H A;  2WB9 A;  2O7K A;  2KLX A;  4K7I A;  2REM A;  2YCD A;  4ZB8 A;  4IJ3 A;  2ON5 A;  1SK0 A;  5ECP B;  1K0B A;  3QFB C;  4N0Z A;  5IM9 A;  2F9S A;  12GS A;  1T3B A;  3ZML A;  3IPZ A;  5IO0 A;  1TRV A;  1XVW A;  2WS2 A;  4IJI A;  3VWU A;  4IS0 A;  1PL1 A;  1R5A A;  4XHM A;  3TJG A;  5IPG A;  4OD7 A;  1YF1 A;  4FYU A;  5J4U A;  4XS4 B;  2I1U A;  2HYX A;  5CO3 A;  1PL2 A;  3MDK A;  4TXV A;  1GSE A;  1OKD A;  4O5Q A;  3ZFB A;  4K0N A;  1Z6M A;  5CAX A;  4ZIJ A;  3D4T A;  2R37 A;  3GX0 A;  3VI5 A;  4NV2 A;  4HQZ A;  4IQA A;  3QMX A;  3FK8 A;  4ZB6 A;  1O81 A;  1OE7 A;  1WIK A;  2HE3 A;  4NHZ A;  3APQ A;  2LTK A;  1WPI A;  2C3T A;  3KH7 A;  4EDY A;  1SL0 B;  3H1N A;  3EE2 A;  4HJM A;  2R0G A;  3MWH A;  1GL8 A;  5BMU A;  5EVO A;  2HSY A;  1GUL A;  2O8V B;  4KE3 A;  1HNC A;  2NPB A;  4PUF C;  5GST A;  1TW9 A;  2HFD A;  2QA2 A;  5B7C A;  5HR1 A;  7GSS A;  2LJR A;  3VI7 A;  9GSS A;  1NHO A;  3C8E A;  3ZIJ A;  1G0T A;  1TDI A;  3RHC A;  2IIY A;  2EC4 A;  2XPE A;  2FHE A;  1GTU A;  3SWL A;  4X1U A;  2P5R A;  5LD0 A;  2VOC A;  2K9F A;  3IC8 A;  3EPT A;  5IPH A;  1X9S B;  4JR6 A;  5JWQ B;  4PX1 A;  3BJ5 A;  2X8H A;  4HSC X;  4K8M A;  5AN1 A;  4ML1 A;  1XFL A;  1B4P A;  2AB6 A;  2E0Q A;  4YQU A;  1PN9 A;  2V6O A;  2VCT A;  4MJA A;  5G1L A;  1AC1 A;  4XS4 A;  1X9W B;  2JZS A;  3GH6 A;  4POK A;  3MAK A;  2IMD A;  2FA8 A;  2J9H A;  2YNX A;  4BVX A;  2TRC P;  4JBB A;  2FLS A;  3TKR A;  3EIN A;  5EPF A;  2HRK A;  2A4V A;  5CRG A;  4KDY A;  4L0W A;  5G30 A;  3R3E A;  2GZP A;  1TU7 A;  1XIY A;  2C0D A;  3TKS C;  2PPT A;  3HJP A;  3IAM 2;  4EL1 A;  4GLT A;  1TTZ A;  2OAD A;  3G7J A;  1M3I A;  4KA0 A;  5J3R A;  2H1G A;  3F3R A;  2L6C A;  3HVV A;  4K6X A;  2ES7 A;  4TW5 A;  5B6M A;  1JLW A;  1V58 A;  1J0F A;  1SL2 B;  4MA9 A;  2B7K A;  4Z2R A;  5KOX A;  2ZUP A;  3WT2 A;  2XPD A;  1K3Y A;  1ZOF A;  4BVY B;  4Q5R A;  2QKE A;  4O7H A;  5KN2 A;  3P2A A;  3LYK A;  4ZBB A;  1NHY A;  3OR5 A;  3UOM A;  3VUR A;  3ME8 A;  3FHK A;  4OCF A;  4AJ6 A;  5CP1 A;  2FY6 A;  4F82 A;  2HSH A;  4POB A;  4ICY A;  5ELA A;  4JR4 A;  4OO5 A;  4HU9 A;  2E2G A;  4KF9 A;  3PGT A;  1MDI A;  4MDC A;  4K1F A;  5KOW A;  4QL9 A;  2D2Z A;  1XW6 A;  1W4V A;  1ZYP A;  5IMF A;  3CTG A;  4NMU A;  4JRR A;  11GS A;  3IK9 A;  1FB0 A;  1Y25 A;  5A4V A;  2KP1 A;  3D6I A;  1MTC A;  2ON7 A;  4BA7 A;  3L78 A;  5C04 A;  4RUV A;  5B8A A;  1R26 A;  5IQY A;  2JL4 A;  3CMI A;  1PQN A;  2E2M A;  4Z2U A;  5G2Z A;  3FW2 A;  1BQ7 A;  2PVO C;  4FQU A;  2GTU A;  2BTO T;  4HEA 2;  1TK5 B;  2GQM A;  3FZ4 A;  2GQL A;  2YWN A;  1K0M A;  4N0V A;  1LBK A;  2LQQ A;  2F3M A;  3W6G A;  3ZIT A;  2UZ8 A;  3ED3 A;  1NM3 A;  2DJ1 A;  4ISD A;  5HQP A;  1AXD A;  3IC4 A;  1T7P B;  1YEP A;  5IIZ A;  2H0G A;  5EL8 A;  4DVC A;  1EEJ A;  3IE3 A;  5D8I A;  3EU4 A;  1GRX A;  3L9U A;  4AF2 A;  4FYC A;  1TRU A;  10GS A;  5F05 A;  1ACV A;  4G2E A;  1XWG A;  4BVY A;  3HY2 A;  2OE3 A;  3L4N A;  1OC3 A;  1SKR B;  1OVN A;  1FO5 A;  2VD0 A;  1O8W A;  1OAZ A;  1TJD A;  1ML6 A;  3ZZX A;  2LNS A;  2KUC A;  5J5N A;  1HQO A;  1K0N A;  2OAC A;  4L5O A;  1OC9 B;  5DBQ A;  4WXT A;  2FUG 2;  4K0G A;  3J7Y b;  4IW9 A;  4X4J A;  1A2L A;  4MK3 A;  1A8Y A;  1YQ1 A;  3TOU A;  4I5Q A;  5INY A;  4TN8 A;  5D96 A;  1Q4J A;  3UMA A;  2JAC A;  1B8X A;  3E3E A;  1PKZ A;  3LQ7 A;  4IEL A;  4ZL8 A;  4IKH A;  1AW9 A;  4N30 A;  3RHB A;  4L5L A;  1EZK A;  1LU4 A;  1RK4 A;  4IGJ A;  1QQ2 A;  2YOI A;  3EC3 A;  1X5D A;  3FEU A;  2GSQ A;  1GNE A;  1MEK A;  3H8Q A;  6GSS A;  3CSI A;  2H6X A;  4GSN A;  1O73 A;  4EUY A;  2GT6 A;  3FZ5 A;  3H93 A;  4HQS A;  4PXO A;  5ELG A;  1SEN A;  5CRE A;  4MCU A;  1M0U A;  3RPN A;  3H79 A;  5DAK A;  3A2W A;  2O85 A;  1PN0 A;  5JCW A;  2V6K A;  4TKY A;  1ERU A;  5D9X A;  3VK9 A;  2M72 A;  3QPM A;  5IOX A;  3UIW A;  4AGS A;  2N5A A;  1QXH A;  2A4H A;  4O5U A;  4MF5 A;  4OCE A;  3LYP A;  5CRH A;  1SKW B;  2OBI A;  5D9V A;  1AQV A;  2IN3 A;  2FGX A;  2H6Y A;  1FVK A;  2C3N A;  1A0R P;  4RI6 A;  2VCX A;  2H0H A;  3F4S A;  4GSS A;  2A2P A;  2AAW A;  2YPM A;  3F0I A;  1SYX A;  3LOR A;  2PMT A;  6GST A;  3AY8 A;  3TB2 A;  1EV9 A;  3ZRD A;  2LUS A;  1ZYQ B;  2BJX A;  2MMO A;  2FWH A;  1T1V A;  1JZR A;  1OC9 A;  4G0K A;  1LJR A;  2RM6 A;  3GL5 A;  2X8G A;  1M9B A;  3F8U A;  5FWG A;  4GST A;  2FA4 A;  2C4J A;  4KAE A;  2L59 A;  1SJZ A;  1RW1 A;  4EF0 A;  3IDV A;  2IMF A;  2VUP A;  3APO A;  1ZZY A;  4OO4 A;  1AAZ A;  4KW6 A;  2OE1 A;  3IA1 A;  17GS A;  5ECS A;  4JE1 A;  2P5Q A;  3IV4 A;  3D21 A;  2H01 A;  5DQS A;  3JCM L;  1E2Y A;  1BED A;  1PD2 1;  2I4A A;  1NSW A;  2HZE B;  3UAR A;  2X99 A;  3HJO A;  3S9F A;  20GS A;  3P7X A;  2VLU A;  1X5C A;  3ERF A;  1URM A;  4NAX A;  4I8B A;  5D93 A;  1TRS A;  1S3D A;  3GH9 A;  2DJK A;  1HNA A;  2X8C A;  2VD1 A;  3LJR A;  4RI7 A;  2TRX A;  2H0I A;  4WET A;  1TOF A;  3VPT A;  2IMI A;  3HZ8 A;  1BAY A;  1B9Y C;  1V9W A;  5KN0 A;  2C0E A;  2RII A;  1GTI A;  6GSX A;  2RUF A;  3KMO A;  3KIJ A;  2FWG A;  2H66 A;  4MNN A;  3LG6 A;  5A4W A;  4XIH A;  3I9V 2;  3IHQ A;  1AQW A;  5L71 A;  2B1K A;  3UBK A;  2CAQ A;  2GVP A;  5D9W A;  4TR1 B;  1FAA A;  1F3B A;  1K0A A;  1KTE A;  2XHF A;  1VGL A;  2C0F A;  3F4R A;  2I81 A;  4LMV A;  2YZH A;  1FB6 A;  5IO2 A;  1K3O A;  3EU3 A;  1WJK A;  1BX9 A;  3L0H A;  2B7J A;  4MZB A;  3DWV A;  2H76 A;  2L4Q A;  2H73 A;  4HZ2 A;  3G9B A;  5DQY A;  4G0I A;  5KN1 A;  1MDJ A;  1EP7 A;  2CQ9 A;  4BVX B;  1SYR A;  3WGX A;  4QQ7 A;  2X49 A;  2HZE A;  5JWO B;  4CY6 A;  4ULX A;  1WWJ A;  2WUL A;  4YAP A;  1MD4 A;  4G10 A;  5IMD A;  1ZL9 A;  1SK1 A;  1I9D A;  1U88 A;  3FR3 A;  3F9U A;  1Z7P A;  5IMZ A;  2QC7 A;  2CA8 A;  2DJ2 A;  2N5B A;  3KP9 A;  3CSH A;  1XOA A;  3U5R E;  1SK2 A;  5CRW A;  1XXU A;  4G0L A;  4OFN A;  3FY7 A;  1FHE A;  1J08 A;  3DXB A;  2VCV A;  3GKX A;  3UVT A;  4F9Z A;  2H70 A;  2OKA A;  5ECH B;  3L9S A;  1VF3 A;  2HI7 A;  3DGQ A;  3TOT A;  3WD6 A;  3A3T A;  2DIZ A;  2H1B A;  1PRX A;  5AGY A;  1H4O A;  4JZQ A;  4IN0 A;  3QDN A;  3GKN A;  2H74 A;  3KP8 A;  4KCA A;  3GX8 A;  4HU7 A;  2MMA A;  4TR1 A;  1M7T A;  2P31 A;  1YKC A;  5FHI A;  3ZIV A;  5DJL A;  1AUC A;  1PSQ A;  2CZ3 A;  3QD9 A;  2YP6 A;  4F0C A;  1OYJ A;  2EIO A;  2O87 A;  1C72 A;  2VM2 A;  4I2U A;  4N11 A;  5DAL B;  1H75 A;  3KM6 A;  4O92 A;  2PN8 A;  2V1M A;  4FH8 A;  2NVL A;  2K8S A;  2L5L A;  4ZIL A;  3Q18 A;  1ZYE A;  1TP9 A; 
#chains in the Genus database with same CATH homology
 4TXO B;  1XWB A;  2VAF A;  3D0Z A;  1Z7R A;  1X9M B;  3NOF A;  3O6T A;  1S3A A;  4OFT A;  1KEB A;  5JWR B;  1GUM A;  2DJJ A;  3M0F A;  1YY7 A;  3M9K A;  4ECI A;  1MD3 A;  4F2I A;  3FKF A;  3KZQ A;  3KXO A;  3TJK A;  1F37 A;  2FWF A;  1M2D A;  1YEX A;  5DCH A;  3I69 A;  1OKT A;  3F63 A;  2VM1 A;  4Q5Q A;  4ZB9 A;  3TKQ A;  4MJC A;  1QFN A;  4XTS A;  2H75 A;  3GL3 A;  3CBU A;  2MMN A;  4EKZ A;  4POL A;  3CRT A;  19GS A;  1N8J A;  1PGT A;  1SL1 B;  3KD0 A;  4PUA A;  2LJA A;  2LST A;  2IME A;  4GTU A;  1FW1 A;  4O32 A;  2MYG A;  2L5O A;  2BMX A;  3ZL5 A;  3C73 A;  4NPB A;  2LRC A;  5B8B A;  1Z5Y E;  1ABA A;  2GS3 A;  1K3L A;  3LFL A;  4CW9 A;  4KND A;  3ZMK A;  4IHU A;  3UJ1 A;  1UC7 A;  4TR4 A;  5ID2 B;  4A5P A;  4YH2 A;  4WKW A;  1M99 A;  5IMC A;  1V40 A;  4HZ4 A;  4IP6 A;  1SJI A;  1A0F A;  2X64 A;  1ERT A;  4RQX A;  1DBY A;  2AYT A;  4MJB A;  2GZY A;  4YQV A;  3GRX A;  5DAL A;  2V2G A;  4V2M A;  4J2F A;  2JZT A;  1XBS A;  2TIR A;  3N5O A;  5HFI A;  3RPP A;  3HJM A;  3H4K A;  4XS1 A;  4MJE A;  4TXO A;  2H6Z A;  4MPF A;  5DAK B;  5DDL A;  3F6F A;  2LNT A;  4MH2 A;  3VWX A;  2FD3 A;  4L0U A;  4EO3 A;  3CSJ A;  4NV5 A;  2PVQ A;  1YF0 A;  2C1Y A;  2VL2 C;  2DJ0 A;  2PWJ A;  1UA5 A;  1W89 A;  4QL7 A;  4YKG A;  1GWC A;  2IJY A;  2GGT A;  4J57 E;  1DE1 A;  1N2A A;  3HVX A;  4WF5 A;  4DEJ A;  3HDC A;  2GLR A;  3QAV A;  2DC5 A;  3ZLP A;  3ZFL A;  3HXS A;  2C0G A;  3Q19 A;  1U3I A;  1EP8 A;  2IMK A;  3ERW A;  3MSZ A;  1FOH A;  2HT9 A;  2A2R A;  3NIV A;  1A2J A;  3L9V A;  3R2Q A;  4WR5 A;  1XWA A;  3ZRE A;  2K6V A;  3M8N A;  1USB A;  1GTB A;  1QMV A;  1VRS D;  4WBJ A;  5ID2 A;  4BL7 B;  3WYW A;  1ZCP A;  4XCS A;  3DVW A;  3GUR A;  4NXI A;  18GS A;  3LSZ A;  4GQF A;  2DJ3 A;  3A2V A;  5F8B A;  3ERG A;  2KHP A;  1GSU A;  2M80 A;  2AJQ B;  4LLR A;  3FZ9 A;  1T8E B;  2YWI A;  2NBS A;  1JZO A;  5H5S A;  5G5E A;  1F2E A;  4E8E A;  1VF2 A;  1DUG A;  2FCH A;  5HFK A;  1CQG A;  1O85 A;  1CQH A;  1OC8 A;  1V57 A;  4HJ2 A;  4MMM A;  1WMJ A;  4KDU A;  2EIQ A;  1GUH A;  1T4Y A;  1T4Z A;  2XBI A;  1GSD A;  4Q5F A;  13GS A;  3FR9 A;  2I3Y A;  5ECN B;  4EIQ A;  4KX4 A;  1JLV A;  5CYY A;  4PUR A;  2QGV A;  2OE0 A;  1GP1 A;  1V98 A;  2CAI A;  3VWW A;  2G0F A;  2HLS A;  1AQX A;  1PKW A;  1XW9 A;  1ZMA A;  3P8W A;  1M2A A;  2JAD A;  4GRF A;  4ACS A;  1Z3E A;  4K2X A;  2VLV A;  3US3 A;  4EIP A;  1E6B A;  2LKU A;  2VCW A;  3TJF A;  2DSA A;  2QA1 A;  5E59 A;  4MF7 A;  3IR4 A;  16GS A;  3F6D A;  1ILO A;  2QSI A;  1WP0 A;  2MBT A;  3FZA A;  2CVD A;  4ZXG A;  3EWL A;  4DSS B;  2GT5 A;  5HFG A;  1IYI A;  3O76 A;  5EY6 A;  2F8F A;  1EEM A;  4IBP A;  2M46 A;  3RAZ A;  4BL7 A;  4XS6 A;  3ME7 A;  3TJJ A;  1U6T A;  2LS5 A;  3VFI A;  3IXR A;  2H72 A;  2LRT A;  1ERW A;  1F3A A;  4JU5 A;  3DVX A;  4HDE A;  2LEG A;  1IYH A;  4ZL7 A;  1PX6 A;  3QAG A;  2HNL A;  3GMF A;  3KTL A;  5DVB A;  1YJ6 A;  1R5P A;  5E4W A;  3BBY A;  4TR0 A;  22GS A;  1JZW A;  1TI1 A;  4K9Z A;  3M1G A;  2AUV A;  3GA4 A;  5AIS A;  3DD3 A;  6GSU A;  6GSW A;  2ZNM A;  3W8S A;  5J9C A;  4PNF A;  3TKP A;  1SD8 A;  1Y6E A;  2JU5 A;  2H8L A;  5ECK B;  1G6W A;  2CV4 A;  4F0B A;  3DRN A;  3IBH A;  4MF6 A;  3RDW A;  4CDO A;  4Q5N A;  5D73 A;  5ECO B;  4MZW A;  4V1A g;  1X0R A;  4YAV A;  2FWE A;  2R3X A;  2B5Y A;  3GFK A;  5HR3 A;  3GKM A;  4J56 E;  5LCZ A;  1QUW A;  2J23 A;  1G7E A;  2GQK A;  4GWR A;  4KGI A;  3TRP A;  2B1L A;  2ZCT A;  4DSS A;  1A24 A;  2YWM A;  1ERV A;  3GSS A;  5GAP D;  3FMW A;  3KMN A;  5G1K A;  4PQI A;  1WOU A;  2GDR A;  2B6M A;  4EE0 A;  4KDX A;  5F0G A;  5G5F A;  1G6Y A;  2PUK C;  3QAW A;  4GXZ A;  5F07 A;  8GSS A;  3D22 A;  2RM5 A;  2YJH A;  1HD2 A;  4K7N A;  3GTU B;  3LW9 A;  4NWY A;  2WZ9 A;  2NTO A;  3QCP A;  4KUN A;  5JCU A;  4ECC A;  3G7I A;  5ECL B;  2WJU A;  2HRA A;  2Z9S A;  2C80 A;  4ECJ A;  3TDG A;  2IL3 A;  6GSV A;  2IPA A;  6GSY A;  3DIE A;  3HKR A;  4USS A;  1A23 A;  2K8V A;  4K2D A;  3EMP A;  3ZTL A;  1K0C A;  2O89 A;  2R4V A;  1EGO A;  1TI3 A;  1TXX A;  2LQO A;  2WFC A;  1GNW A;  2MZC A;  1S3C A;  1SD9 A;  2L6D A;  4POM A;  4EDZ A;  4OFM A;  3U6V A;  3C7M A;  2B5X A;  2K18 A;  3LGC A;  4ECB A;  1XOB A;  4GQC A;  4PTS A;  4K5R A;  2PGT A;  2DKH A;  2VL3 A;  3WT1 A;  1BJX A;  1SJ6 A;  5B6N A;  1SU9 A;  2DLX A;  5GSS A;  3ZVJ A;  2JSY A;  4F03 A;  1GSF A;  1KNG A;  3UVH A;  4I6X A;  2WDU A;  2YAN A;  2YV7 A;  3HZ4 A;  2AV4 A;  3MIX A;  2NDO A;  5CRD A;  4TVE A;  2FNO A;  1TRW A;  2RLI A;  3RBT A;  1Z9H A;  2R0P A;  5BRT A;  1FOV A;  1PMT A;  2HXK A;  2HRF A;  5ECR B;  2CX3 A;  5KEJ A;  3DML A;  4TOP A;  1EGR A;  3KGK A;  5ABR A;  3HCZ A;  1GSQ A;  5F06 A;  2GZZ A;  1F9M A;  3D5J A;  3I43 A;  4TRX A;  2YZU A;  3GTU A;  3HHV A;  4V1A p;  5AIV A;  2R0C A;  1GTA A;  4OWY A;  3HD5 A;  1M2B A;  4IQ1 A;  2GST A;  1GUK A;  4G19 A;  1TU8 A;  3LEF A;  3IAS 2;  5HR2 A;  2IFQ B;  4L8E A;  5HR0 A;  3APS A;  14GS A;  3ZVJ D;  4MLY A;  2H1D A;  2VIM A;  2L4C A;  3C1S A;  1I5G A;  3GKK A;  4KSM A;  3M3M A;  4D73 B;  1DSB A;  2E7P A;  3LXZ A;  2DMM A;  3IK7 A;  2EIR A;  2WGR A;  1XCC A;  5JCG A;  4K5S A;  5A5K A;  5IMA A;  4WF4 A;  1GLP A;  4YQM A;  3TGZ A;  2HRN A;  3UAP A;  4BWS A;  2DBC A;  3TKS E;  2PBJ A;  3BCK A;  3GN3 A;  4BPY A;  5D9T A;  2A2S A;  2H71 A;  4KSO A;  4LA1 A;  2G2Q A;  1ZYN A;  3BD2 A;  4EVM A;  1XPV A;  2CX4 A;  2L57 A;  1O7U A;  3PPU A;  4K7O A;  4LMW A;  2YJ7 A;  5J9B A;  3QFA C;  1XWC A;  3K8N A;  3GYK A;  2DIY A;  1ZGN A;  3MYD A;  3NZN A;  1ON4 A;  2CVK A;  3UBL A;  1NW2 A;  2CT6 A;  3GST A;  1EWX A;  5KN3 A;  3QOU A;  1QK8 A;  4LL4 B;  1TK0 B;  2VO4 A;  4WBR D;  1WRY A;  5LNK e;  1YKA A;  3Q6O A;  1UVZ A;  2I9H A;  1SKS B;  3IOS A;  3KH9 A;  1U3A A;  4Z2T A;  3FR6 A;  1XW5 A;  3N9J A;  5IMV A;  3M9J A;  3FRC A;  3WGD A;  3D4M A;  2IFQ A;  4Z7X A;  3VPQ A;  1R4W A;  2LJK A;  2KOK A;  1B9X C;  5ECQ B;  4XRD A;  4ZBA A;  4D73 A;  3TCO A;  2LV3 A;  3EUR A;  3EVI A;  1PX7 A;  1DE2 A;  4PNG A;  1YZX A;  4HI7 A;  4KH7 A;  3EMX A;  2OJL A;  1WE0 A;  4YKF A;  2VL9 A;  3HYP A;  3IRA A;  3TRQ A;  2XBQ A;  1J9B A;  4WEY A;  3TRX A;  4FO5 A;  1B48 A;  3KJY A;  4PQ1 A;  3PH9 A;  5A4U A;  1K0D A;  4LL1 B;  1GSS A;  2AHE A;  3TUE A;  1Q98 A;  4TR3 A;  4ID0 A;  4DSR A;  4FIW A;  1ST9 A;  1F6M C;  1OE8 A;  5H5Q A;  3FYG A;  5IOW A;  2MBS A;  1B4Q A;  5FT3 A;  1EV4 A;  2WCI A;  3UEM A;  4MZC A;  4GF0 A;  3VWV A;  2GSS A;  2B5E A;  4CHS A;  5AIX A;  2JZR A;  1XVQ A;  2WRT A;  4MP4 A;  5ECI B;  3GHA A;  3CRU A;  4V2N A;  2V41 A;  1KBN A;  1VF4 A;  3A5I A;  1YDK A;  2OBK A;  2H1A A;  3TKS A;  2YN1 A;  2CVB A;  2R6K A;  5COH A;  4PGT A;  4HUA A;  2RUE A;  1RQM A;  4MH3 A;  3ISO A;  1U87 A;  3I6A A;  5GAN D;  2R5G A;  3O3T A;  1X5E A;  4P3Y B;  1K0O A;  1M9A A;  1JHB A;  1Z6N A;  2F8A A;  4RQR A;  4PQH A;  3KCM A;  3GV1 A;  3LXT A;  4IP1 A;  4HS1 A;  4FYB A;  2R2J A;  4KB3 A;  1UN2 A;  4EC0 A;  2YV9 A;  2DKI A;  4EXJ A;  2OA7 A;  4DSQ A;  1THO A;  4G9H A;  2GSR A;  2PER A;  5H5R A;  3J7Y k;  3IHG A;  4BWQ A;  3KEB A;  3F3Q A;  1O8X A;  3DYR A;  1VF1 A;  2V32 A;  3P90 A;  4ZBD A;  3LWA A;  3PIN A;  3EYT A;  4MPG A;  1HNB A;  1R7H A;  3W8J A;  2VCQ A;  3ZYW A;  1HYU A;  4JED A;  3TJB A;  1G7O A;  1A2M A;  5ENU A;  2KP2 A;  2JSZ A;  1XWK A;  1GH2 A;  2HZF A;  1T00 A;  4WR4 A;  1THX A;  2H19 A;  2N5F A;  1JZD A;  2X4A A;  4X43 A;  5DCG A;  2YWO A;  3C1R A;  3GUS A;  2C3Q A;  3A5W A;  3G7Y A;  4ML6 A;  2DML A;  1QGV A;  4X0X A;  5CNW A;  3PR8 A;  3E9J B;  1MDK A;  4GCI A;  3WGE A;  2P0G A;  2IWT A;  5J41 A;  2VLT A;  1AIU A;  4OMV A;  1TK8 B;  3VLN A;  4O5R A;  4NHW A;  2VL2 A;  2PU9 C;  5ECM B;  4V2L A;  5DJM A;  3C71 A;  3F4T A;  4I97 A;  5GZZ B;  1EOG A;  5G31 A;  3SBC A;  4KCE A;  1XZO A;  3CTF A;  2LRN A;  2C8U A;  2XC2 A;  3DEX A;  3A2X A;  3E0U A;  3BCI A;  4I2T A;  2ALB A;  1EOH A;  4AJ8 A;  1JFU A;  3CXG A;  3V1W A;  2H30 A;  4N10 A;  1O6J A;  4MAB A;  3GNJ A;  4H86 A;  1V2A A;  5C00 A;  1A8L A;  3QR6 A;  3GIX A;  1BG5 A;  2HSM A;  1FG4 A;  3DKS A;  2MMZ A;  3HVS A;  2CZ2 A;  3Q74 A;  3HA9 A;  2VCZ A;  4CY8 A;  1BYE A;  3CYN A;  2B3S A;  1TKD B;  3UL3 A;  4HOJ A;  4ILF A;  1FVJ A;  3KTB A;  4XRA A;  3MNG A;  4IVF A;  1PA3 A;  2F51 A;  1GLQ A;  4AJ7 A;  4ZL9 A;  1GSY A;  3BOA A;  4E8H A;  2WB9 A;  2O7K A;  2KLX A;  4K7I A;  2REM A;  2YCD A;  4ZB8 A;  4IJ3 A;  2ON5 A;  1SK0 A;  5ECP B;  1K0B A;  3QFB C;  4N0Z A;  5IM9 A;  2F9S A;  12GS A;  1T3B A;  3ZML A;  3IPZ A;  5IO0 A;  1TRV A;  1XVW A;  2WS2 A;  4IJI A;  3VWU A;  4IS0 A;  1PL1 A;  1R5A A;  4XHM A;  3TJG A;  5IPG A;  4OD7 A;  1YF1 A;  4FYU A;  5J4U A;  4XS4 B;  2I1U A;  2HYX A;  5CO3 A;  1PL2 A;  3MDK A;  4TXV A;  1GSE A;  1OKD A;  4O5Q A;  3ZFB A;  4K0N A;  1Z6M A;  5CAX A;  4ZIJ A;  3D4T A;  2R37 A;  3GX0 A;  3VI5 A;  4NV2 A;  4HQZ A;  4IQA A;  3QMX A;  3FK8 A;  4ZB6 A;  1O81 A;  1OE7 A;  1WIK A;  2HE3 A;  4NHZ A;  3APQ A;  2LTK A;  1WPI A;  2C3T A;  3KH7 A;  4EDY A;  1SL0 B;  3H1N A;  3EE2 A;  4HJM A;  2R0G A;  3MWH A;  1GL8 A;  5BMU A;  5EVO A;  2HSY A;  1GUL A;  2O8V B;  4KE3 A;  1HNC A;  2NPB A;  4PUF C;  5GST A;  1TW9 A;  2HFD A;  2QA2 A;  5B7C A;  5HR1 A;  7GSS A;  2LJR A;  3VI7 A;  9GSS A;  1NHO A;  3C8E A;  3ZIJ A;  1G0T A;  1TDI A;  3RHC A;  2IIY A;  2EC4 A;  2XPE A;  2FHE A;  1GTU A;  3SWL A;  4X1U A;  2P5R A;  5LD0 A;  2VOC A;  2K9F A;  3IC8 A;  3EPT A;  5IPH A;  1X9S B;  4JR6 A;  5JWQ B;  4PX1 A;  3BJ5 A;  2X8H A;  5AN1 A;  4K8M A;  4ML1 A;  1XFL A;  1B4P A;  2AB6 A;  2E0Q A;  4YQU A;  1PN9 A;  2V6O A;  2VCT A;  4MJA A;  5G1L A;  1AC1 A;  4XS4 A;  1X9W B;  2JZS A;  3GH6 A;  4POK A;  3MAK A;  2IMD A;  2FA8 A;  2J9H A;  2YNX A;  4BVX A;  2TRC P;  4JBB A;  2FLS A;  3TKR A;  3EIN A;  5EPF A;  2HRK A;  2A4V A;  5CRG A;  4KDY A;  4L0W A;  5G30 A;  3R3E A;  2GZP A;  1TU7 A;  1XIY A;  2C0D A;  3TKS C;  2PPT A;  3HJP A;  3IAM 2;  4EL1 A;  4GLT A;  1TTZ A;  2OAD A;  3G7J A;  4KA0 A;  5J3R A;  2H1G A;  3F3R A;  2L6C A;  3HVV A;  4K6X A;  2ES7 A;  4TW5 A;  5B6M A;  1JLW A;  1V58 A;  1J0F A;  1SL2 B;  4MA9 A;  2B7K A;  4Z2R A;  5KOX A;  2ZUP A;  3WT2 A;  2XPD A;  1K3Y A;  1ZOF A;  4BVY B;  4Q5R A;  2QKE A;  4O7H A;  5KN2 A;  3P2A A;  3LYK A;  4ZBB A;  1NHY A;  3OR5 A;  3UOM A;  3VUR A;  3ME8 A;  3FHK A;  4OCF A;  4AJ6 A;  5CP1 A;  2FY6 A;  4F82 A;  2HSH A;  4POB A;  4ICY A;  5ELA A;  4JR4 A;  4OO5 A;  4HU9 A;  2E2G A;  4KF9 A;  3PGT A;  1MDI A;  4MDC A;  4K1F A;  5KOW A;  4QL9 A;  2D2Z A;  1XW6 A;  1W4V A;  1ZYP A;  5IMF A;  3CTG A;  4NMU A;  4JRR A;  11GS A;  3IK9 A;  1FB0 A;  1Y25 A;  5A4V A;  2KP1 A;  3D6I A;  1MTC A;  2ON7 A;  4BA7 A;  3L78 A;  5C04 A;  4RUV A;  5B8A A;  1R26 A;  5IQY A;  2JL4 A;  3CMI A;  1PQN A;  2E2M A;  4Z2U A;  5G2Z A;  3FW2 A;  1BQ7 A;  2PVO C;  4FQU A;  2GTU A;  2BTO T;  4HEA 2;  1TK5 B;  2GQM A;  3FZ4 A;  2GQL A;  2YWN A;  1K0M A;  4N0V A;  1LBK A;  2LQQ A;  2F3M A;  3W6G A;  3ZIT A;  2UZ8 A;  3ED3 A;  1NM3 A;  2DJ1 A;  4ISD A;  5HQP A;  1AXD A;  3IC4 A;  1T7P B;  1YEP A;  5IIZ A;  2H0G A;  5EL8 A;  4DVC A;  1EEJ A;  3IE3 A;  5D8I A;  3EU4 A;  1GRX A;  3L9U A;  4AF2 A;  4FYC A;  1TRU A;  10GS A;  5F05 A;  1ACV A;  4G2E A;  1XWG A;  4BVY A;  3HY2 A;  2OE3 A;  3L4N A;  1OC3 A;  1SKR B;  1OVN A;  1FO5 A;  2VD0 A;  1O8W A;  1OAZ A;  1TJD A;  1ML6 A;  3ZZX A;  2LNS A;  2KUC A;  5J5N A;  1HQO A;  1K0N A;  2OAC A;  4L5O A;  1OC9 B;  5DBQ A;  4WXT A;  2FUG 2;  4K0G A;  3J7Y b;  4IW9 A;  4X4J A;  1A2L A;  4MK3 A;  1A8Y A;  1YQ1 A;  3TOU A;  4I5Q A;  5INY A;  4TN8 A;  5D96 A;  1Q4J A;  3UMA A;  2JAC A;  1B8X A;  3E3E A;  1PKZ A;  3LQ7 A;  4IEL A;  4ZL8 A;  4IKH A;  1AW9 A;  4N30 A;  3RHB A;  4L5L A;  1EZK A;  1LU4 A;  1RK4 A;  4IGJ A;  1QQ2 A;  2YOI A;  3EC3 A;  1X5D A;  3FEU A;  2GSQ A;  1GNE A;  1MEK A;  3H8Q A;  6GSS A;  3CSI A;  2H6X A;  4GSN A;  1O73 A;  4EUY A;  2GT6 A;  3FZ5 A;  3H93 A;  4HQS A;  4PXO A;  5ELG A;  1SEN A;  5CRE A;  4MCU A;  1M0U A;  3RPN A;  3H79 A;  5DAK A;  3A2W A;  2O85 A;  1PN0 A;  5JCW A;  2V6K A;  4TKY A;  1ERU A;  5D9X A;  3VK9 A;  2M72 A;  3QPM A;  5IOX A;  3UIW A;  4AGS A;  2N5A A;  1QXH A;  2A4H A;  4O5U A;  4MF5 A;  4OCE A;  3LYP A;  5CRH A;  1SKW B;  2OBI A;  5D9V A;  1AQV A;  2IN3 A;  2FGX A;  2H6Y A;  1FVK A;  2C3N A;  1A0R P;  4RI6 A;  2VCX A;  2H0H A;  3F4S A;  4GSS A;  2A2P A;  2AAW A;  2YPM A;  3F0I A;  1SYX A;  3LOR A;  2PMT A;  6GST A;  3AY8 A;  3TB2 A;  1EV9 A;  3ZRD A;  2LUS A;  1ZYQ B;  2BJX A;  2MMO A;  2FWH A;  1T1V A;  1JZR A;  1OC9 A;  4G0K A;  1LJR A;  2RM6 A;  3GL5 A;  2X8G A;  1M9B A;  3F8U A;  5FWG A;  4GST A;  2FA4 A;  2C4J A;  4KAE A;  2L59 A;  1SJZ A;  1RW1 A;  4EF0 A;  3IDV A;  2IMF A;  2VUP A;  3APO A;  1ZZY A;  4OO4 A;  1AAZ A;  4KW6 A;  2OE1 A;  3IA1 A;  17GS A;  5ECS A;  4JE1 A;  2P5Q A;  3IV4 A;  3D21 A;  2H01 A;  5DQS A;  3JCM L;  1E2Y A;  1BED A;  1PD2 1;  2I4A A;  1NSW A;  2HZE B;  3UAR A;  2X99 A;  3HJO A;  3S9F A;  20GS A;  3P7X A;  2VLU A;  1X5C A;  3ERF A;  1URM A;  4NAX A;  4I8B A;  5D93 A;  1TRS A;  1S3D A;  3GH9 A;  2DJK A;  1HNA A;  2X8C A;  2VD1 A;  3LJR A;  4RI7 A;  2TRX A;  2H0I A;  4WET A;  1TOF A;  3VPT A;  2IMI A;  3HZ8 A;  1BAY A;  1B9Y C;  1V9W A;  5KN0 A;  2C0E A;  2RII A;  1GTI A;  6GSX A;  2RUF A;  3KMO A;  3KIJ A;  2FWG A;  2H66 A;  4MNN A;  3LG6 A;  5A4W A;  4XIH A;  3I9V 2;  3IHQ A;  1AQW A;  5L71 A;  2B1K A;  3UBK A;  2CAQ A;  2GVP A;  5D9W A;  4TR1 B;  1FAA A;  1F3B A;  1K0A A;  1KTE A;  2XHF A;  1VGL A;  2C0F A;  3F4R A;  2I81 A;  4LMV A;  2YZH A;  1FB6 A;  5IO2 A;  1K3O A;  3EU3 A;  1WJK A;  1BX9 A;  3L0H A;  2B7J A;  4MZB A;  3DWV A;  2H76 A;  2L4Q A;  2H73 A;  4HZ2 A;  3G9B A;  5DQY A;  4G0I A;  5KN1 A;  1MDJ A;  1EP7 A;  2CQ9 A;  4BVX B;  1SYR A;  3WGX A;  4QQ7 A;  2X49 A;  2HZE A;  5JWO B;  4CY6 A;  4ULX A;  1WWJ A;  2WUL A;  4YAP A;  1MD4 A;  4G10 A;  5IMD A;  1ZL9 A;  1SK1 A;  1I9D A;  1U88 A;  3FR3 A;  3F9U A;  1Z7P A;  5IMZ A;  2QC7 A;  2CA8 A;  2DJ2 A;  2N5B A;  3KP9 A;  3CSH A;  1XOA A;  3U5R E;  1SK2 A;  5CRW A;  1XXU A;  4G0L A;  4OFN A;  3FY7 A;  1FHE A;  1J08 A;  3DXB A;  2VCV A;  3GKX A;  3UVT A;  4F9Z A;  2H70 A;  2OKA A;  5ECH B;  3L9S A;  1VF3 A;  2HI7 A;  3DGQ A;  3TOT A;  3WD6 A;  3A3T A;  2DIZ A;  2H1B A;  1PRX A;  5AGY A;  1H4O A;  4JZQ A;  4IN0 A;  3QDN A;  3GKN A;  2H74 A;  3KP8 A;  4KCA A;  3GX8 A;  4HU7 A;  2MMA A;  4TR1 A;  1M7T A;  2P31 A;  1YKC A;  5FHI A;  3ZIV A;  5DJL A;  1AUC A;  1PSQ A;  2CZ3 A;  3QD9 A;  2YP6 A;  4F0C A;  1OYJ A;  2EIO A;  2O87 A;  1C72 A;  2VM2 A;  4I2U A;  4N11 A;  5DAL B;  1H75 A;  3KM6 A;  4O92 A;  2PN8 A;  2V1M A;  4FH8 A;  2NVL A;  2K8S A;  2L5L A;  4ZIL A;  3Q18 A;  1ZYE A;  1TP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...