2GGTA

Crystal structure of human sco1 complexed with nickel.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
LLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords SCO1 protein homolog, mitochondrial
publication title A hint for the function of human Sco1 from different structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ggtA00
1JLWA 4TR1A 3GKXA 5IPHA 3D0ZA 2B3SA 2GQKA 1XWCA 3Q74A 3FEUA 3GH6A 2PWJA 3IK7A 4AJ8A 2GS3A 1S3DA 1WJKA 1E6BA 3D4MA 3KEBA 2JU5A 4XTSA 2GTUA 1AQXA 2H74A 3W8SA 2RM6A 1UN2A 1OVNA 20GSA 2J23A 2ZUPA 3HHVA 1O8WA 5HR1A 4GF0A 3DRNA 1XOBA 3IXRA 1Z9HA 1F37A 4MMMA 3F6FA 4Z7XA 2K6VA 2OE3A 2OACA 4TR3A 3RAZA 5IM9A 2LNTA 2H6XA 2IMFA 4KGIA 3LXTA 5IMZA 22GSA 3CSHA 4NXIA 3GURA 1VF4A 3ERWA 5IMDA 2CV4A 2PUKC 4RI6A 2OE0A 1SKSB 4MCUA 1SENA 3KH7A 4IVFA 1I5GA 4WBRD 2R6KA 2F8AA 1K3OA 2VO4A 2YZHA 2EIRA 5LCZA 2JZTA 3TJBA 3A5WA 5ECPB 1K0BA 2FY6A 5KN3A 5CREA 1JLVA 1U88A 3C1RA 1XPVA 4O92A 1SJIA 5ECIB 3SWLA 4JRRA 4F9ZA 1GSQA 2HZEA 1BAYA 2ZCTA 3A3TA 4YH2A 3LSZA 3E3EA 3IHQA 14GSA 1FG4A 4HZ4A 3A2WA 3VPQA 2PVQA 4FH8A 3VWWA 2V2GA 1FVKA 3KD0A 2E2GA 3N5OA 1EZKA 2J9HA 3EYTA 1FW1A 5DQSA 2O8VB 1ZZYA 3RBTA 1TXXA 3DXBA 1W89A 2LRTA 3ZTLA 1GTIA 2HT9A 10GSA 1J0FA 4ECCA 4IBPA 3VURA 2LV3A 1QK8A 2HE3A 3GX0A 3TUEA 4KA0A 2DLXA 1F3AA 1XVQA 5IIZA 5IOXA 2GZZA 1YKCA 5DBQA 3OR5A 4HU9A 4V2LA 2VM1A 2E2MA 3WYWA 3I69A 2DMLA 3IE3A 1R26A 1FOVA 1J08A 1MEKA 1ZGNA 3ZREA 1XZOA 2CZ2A 2PVOC 3MSZA 2PPTA 1OC9B 3GN3A 3ERGA 5A4VA 1Z5YE 3VLNA 3ZYWA 3VWVA 4K1FA 1GP1A 12GSA 2JACA 1FB6A 2YNXA 2YN1A 4IJ3A 4GCIA 2I9HA 4RQXA 3L9UA 2X8GA 5AIVA 4YQVA 4OMVA 1JHBA 3Q18A 2OBIA 1H4OA 1YY7A 3EURA 4MK3A 4HI7A 3VWUA 1Q98A 3ZZXA 3QCPA 5B8AA 5JCGA 2MMOA 1G6WA 4CDOA 2V6OA 1HQOA 3HDCA 2IMIA 5IQYA 1G0TA 1ERVA 4LL1B 1DUGA 4DVCA 1TK0B 3IA1A 4WEYA 1C72A 3TJFA 3ZFBA 4IGJA 2VCQA 1TRUA 5E59A 1X9MB 3UBLA 2GSQA 2B5XA 4IKHA 3EU3A 1HYUA 5D73A 4NV2A 1B4QA 2B6MA 4PNFA 2TRCP 3APSA 3PR8A 3H1NA 4ACSA 3FZ5A 4L0WA 2VL2A 1LU4A 3MNGA 4GXZA 1A2JA 4EUYA 3TRQA 1HNBA 2HNLA 4LL4B 4AF2A 2DSAA 5D93A 4FYBA 5G1KA 2DMMA 3UBKA 4I2TA 4KDXA 5HFIA 4PGTA 4OO5A 3GFKA 1Z7RA 2CQ9A 3BOAA 2FNOA 1GWCA 3WT2A 5IMFA 2KP2A 4DSSB 2H70A 3QOUA 2H1BA 1PSQA 3DKSA 2REMA 1K0OA 3LEFA 2P31A 3IBHA 2D2ZA 2BMXA 5FT3A 4N30A 5G5FA 4MLYA 2L59A 3QR6A 2IFQB 1O8XA 2AJQB 3H4KA 1GLQA 3M3MA 3FK8A 2LRNA 3EMXA 2ES7A 4MH3A 4N0ZA 2YOIA 2C0GA 1OAZA 3QDNA 3UJ1A 4ZBBA 5C00A 1PA3A 5JCWA 3QFBC 4G2EA 3GA4A 3GUSA 1XWGA 1PL1A 1TDIA 2YWIA 3LYPA 5E4WA 5ECSA 1ILOA 2O87A 2YV9A 1V40A 4PUFC 4F0CA 1EV9A 1ERTA 3PGTA 2H6ZA 5G5EA 5H5SA 5B6NA 5A4UA 5INYA 1V98A 4AJ7A 1G6YA 2DC5A 2AHEA 1USBA 3APQA 5B7CA 3UEMA 2AAWA 2VL3A 3LXZA 3GSSA 5HR3A 4NHWA 4XCSA 2H75A 3Q6OA 2CAIA 2RUFA 5D9VA 3F63A 2HI7A 2HLSA 2NTOA 5IPGA 3AY8A 1BEDA 1KEBA 5ELAA 1XW9A 1OC9A 1EWXA 2VD1A 5DCGA 1YDKA 4XHMA 4BVYA 2DJJA 3WGDA 1DE1A 1GTUA 4F0BA 2OBKA 3G7YA 3NIVA 1HNCA 3C71A 2HZFA 3DYRA 3ERFA 2NDOA 4K7NA 2YJ7A 2H0IA 2X8CA 2PBJA 4XRAA 2YWOA 4K7IA 1SK2A 3FZAA 3GSTA 5DALB 2L5LA 4IP1A 1I9DA 2GSTA 3L9SA 1JFUA 5D8IA 5GSSA 1SKRB 1ZMAA 4O7HA 1BJXA 2CX3A 2I3YA 2IL3A 3UVHA 2C3NA 3D21A 1BG5A 4XS4B 1A8YA 2ON7A 1R5PA 1VF1A 2R4VA 4FYUA 4TRXA 1H75A 5EPFA 3EMPA 3DMLA 3HD5A 3ME7A 1PD21 1TK5B 4IQAA 4POMA 2GGTA 4TR0A 2OE1A 3NZNA 2MMNA 4DSRA 2FWFA 2E7PA 4ECIA 1PQNA 4N10A 2V41A 2A2SA 4HS1A 3RPPA 2DJ3A 3M9KA 2L6CA 2FCHA 2GDRA 3ZLPA 5GZZB 4DSSA 3O6TA 5A4WA 3CTFA 2AUVA 4JR6A 2R2JA 3FKFA 2B1KA 2PERA 8GSSA 4OCEA 3F4TA 5ENUA 1PL2A 5H5RA 4J56E 1T7PB 3DEXA 3DVWA 4MJBA 3DVXA 4LMVA 4OFTA 4HDEA 3TJKA 6GSVA 2IFQA 1SU9A 4TOPA 3D5JA 3UAPA 4ECBA 1K3LA 1X5EA 2MMZA 3MWHA 4FO5A 3TKSE 1LBKA 4IQ1A 1MDKA 2LJAA 4L0UA 1A24A 3QMXA 1DBYA 3EWLA 1A23A 4KDYA 4BPYA 3QFAC 4IHUA 1J9BA 1B9YC 2IIYA 1PKZA 2JSYA 2N5AA 2EIQA 4F2IA 4JZQA 4KH7A 1GUHA 1A8LA 3BJ5A 3GKMA 2HFDA 4X1UA 2DIYA 2HRNA 2OADA 2F9SA 2VM2A 4L8EA 2GVPA 5AGYA 3DWVA 1A2MA 3KMOA 1NW2A 2DIZA 4E8EA 1SL1B 5ECKB 5GSTA 2NVLA 1ZYQB 5KN2A 2E0QA 3D4TA 4QQ7A 2VIMA 1MD4A 4JE1A 3GRXA 4IELA 16GSA 4ISDA 3FYGA 4IP6A 3DGQA 1YKAA 2A2RA 5ABRA 1WPIA 5ID2A 2YANA 3HVSA 4WETA 1YEPA 4CW9A 2I1UA 3TKQA 2F51A 2LQQA 4V2MA 3IAM2 4KAEA 3VFIA 2JZRA 3LGCA 1OC8A 1K0AA 2WDUA 2DBCA 2ON5A 2PGTA 2H01A 5DALA 3CRTA 2FGXA 3TKRA 1Z3EA 5ELGA 2HXKA 1T3BA 2CVBA 4KB3A 4ULXA 3GIXA 4IW9A 2WFCA 1RQMA 4MPFA 1K0DA 3V1WA 1THXA 3M0FA 2ZNMA 4TVEA 3KTLA 4HZ2A 4HJMA 3WGEA 2KOKA 4HJ2A 3PINA 2WJUA 3O3TA 3UARA 1GULA 2VLTA 1XW6A 3CSIA 4F82A 4Q5FA 3GNJA 4GQCA 3P2AA 5AIXA 1TU7A 4NHZA 4NMUA 1BX9A 1N2AA 3HCZA 4J57E 2WRTA 5F07A 2RUEA 3P7XA 4EKZA 2VUPA 1UC7A 3FR6A 1SJZA 5H5QA 3IV4A 2CVDA 1NHYA 5CO3A 2L5OA 5J9CA 3R2QA 5ECNB 5ECRB 3ZL5A 4ZBAA 3D6IA 1TRSA 2K18A 3ZMLA 5F05A 4LA1A 5LNKe 3QD9A 5DQYA 4DEJA 4MP4A 1Q4JA 4AJ6A 1GLPA 4KSOA 3E9JB 1QUWA 2L57A 4GLTA 3O76A 3A2VA 5D96A 3I6AA 2V1MA 3FR3A 4YQUA 1EOGA 4PQ1A 4GSSA 3W8JA 5CRHA 1PKWA 5G1LA 1QQ2A 3GKNA 2X99A 3IDVA 3P8WA 3F6DA 5ECOB 1SYXA 3F3RA 2LJRA 3EE2A 2B5YA 4PNGA 4TXVA 2V6KA 5L71A 1XCCA 3RHCA 2GZPA 2C3TA 2DJKA 2O7KA 4HUAA 1RK4A 1XXUA 4KW6A 4TN8A 2BTOT 2VCVA 2C0EA 3UOMA 4HEA2 2L4QA 5HR2A 1GH2A 1THOA 2YPMA 3U5RE 4MDCA 1JZOA 3ZIVA 3NOFA 3RDWA 1MDJA 3ZFLA 4PQIA 2QC7A 1X9SB 3FRCA 3IR4A 1TRVA 3CBUA 3D22A 3F3QA 1XFLA 2CZ3A 1B48A 2AYTA 5IMAA 2LSTA 3FY7A 3VWXA 4QL7A 4KUNA 5F8BA 4L5OA 5B6MA 3KP9A 1B4PA 4K2DA 2GQLA 3KGKA 3DD3A 4CHSA 4YAVA 3F4RA 3TRXA 4BWQA 2L4CA 1M2BA 4NAXA 4TXOB 1AAZA 5J4UA 2M80A 3TCOA 4GTUA 4ECJA 4Q5NA 9GSSA 4WF4A 3S9FA 1YF1A 2LKUA 2LS5A 2IWTA 1SL2B 2V32A 5DJLA 4N11A 4MABA 5EL8A 2TRXA 5F06A 2MBSA 3TOUA 4ML6A 4NWYA 5HFGA 4RQRA 4GSTA 6GSSA 4ZL7A 3VK9A 4AGSA 4K6XA 2EC4A 3L4NA 2YWNA 2M46A 4MJAA 3JCML 1OC3A 3KM6A 1OKTA 5CAXA 1F9MA 5HQPA 1KTEA 1YEXA 2JSZA 1TRWA 4Q5RA 2CAQA 1WOUA 2R3XA 3FHKA 3GKKA 2GT5A 4TR4A 3W6GA 4K7OA 5FHIA 1OE8A 4HU7A 1G7OA 3IPZA 1CQGA 3ZVJA 2H19A 3CYNA 4EE0A 5ECHB 2LNSA 2O89A 1R5AA 4ZXGA 2H30A 2KUCA 5CP1A 1M9BA 5JWRB 1GRXA 1U87A 1EEMA 3HVXA 5ECMB 4JEDA 4Q5QA 5DJMA 2VL9A 3TJGA 2VCXA 3PH9A 2WZ9A 3APOA 1ACVA 1GSSA 1U3IA 2XPDA 1YQ1A 3BCKA 3RHBA 1T4ZA 1ZCPA 2OA7A 3I43A 3L0HA 2FD3A 1QXHA 1XVWA 3EINA 4I6XA 4OO4A 3I9V2 2F8FA 4KDUA 1TP9A 2YCDA 2N5BA 1GTAA 4HQZA 1AUCA 1O73A 4HQSA 1EV4A 3WGXA 2LEGA 1EP7A 4G19A 2QKEA 5EY6A 1GSUA 1TK8B 3L9VA 1T00A 2WCIA 1M7TA 3LQ7A 1GL8A 2DJ0A 4XS1A 2WS2A 3GTUB 1AW9A 4POKA 3C73A 1GNEA 4ZL8A 3TOTA 1OYJA 4EC0A 2PN8A 1F6MC 4D73B 5KEJA 4MH2A 2B7JA 3HZ8A 1TU8A 1VF2A 2XBQA 4KSMA 2G0FA 1GSFA 4TKYA 3SBCA 3G9BA 3UL3A 1N8JA 2G2QA 5GAND 3J7Yb 6GSTA 1U6TA 1Y6EA 4XS6A 4EL1A 2KLXA 2C0DA 1F3BA 3CSJA 5D9XA 4QL9A 1Z6MA 3M1GA 1SL0B 3TKSA 4YAPA 2RM5A 2FUG2 3UVTA 4EXJA 1EP8A 4G10A 1SK1A 2CA8A 2OJLA 3QAVA 3KIJA 2FWGA 3ZITA 1IYIA 18GSA 4POBA 1PX7A 2XHFA 1TI1A 1PGTA 3KMNA 3QAWA 2DJ1A 3M9JA 3TDGA 2CX4A 1XWBA 2GSRA 5CYYA 5COHA 4BA7A 4HOJA 5C04A 1QMVA 1MD3A 17GSA 4GQFA 1ST9A 3LJRA 5CRGA 3BCIA 1ERWA 2H8LA 2H1GA 2IPAA 2LUSA 1M0UA 3TKPA 6GSXA 4MZBA 1R4WA 2QSIA 2MYGA 6GSWA 4K0GA 1OKDA 1GSDA 3KH9A 3MAKA 3G7JA 2MBTA 4FIWA 2LRCA 2KHPA 2C4JA 2IMEA 4PQHA 1K0NA 3GX8A 2XBIA 2LTKA 3WD6A 3TKSC 1XW5A 1S3CA 1TI3A 2BJXA 1RW1A 2MMAA 1A0RP 3HY2A 1B9XC 1AQWA 2KP1A 3IRAA 1V2AA 1R7HA 1MDIA 2C0FA 4EDZA 1DSBA 5J41A 5DCHA 2H0GA 4BWSA 3LFLA 4PXOA 2H1AA 4PX1A 5IO0A 3N9JA 4K9ZA 1ZOFA 3EU4A 4WF5A 2H0HA 5AISA 3WT1A 2CT6A 5AN1A 1OE7A 3K8NA 3GL3A 3P90A 1O81A 5CRWA 2NBSA 5JCUA 4TW5A 4L5LA 4DSQA 4BVXA 3CXGA 1T1VA 1NSWA 4ZB9A 2AV4A 4IJIA 4ZILA 5DAKB 1XIYA 3HJMA 1A2LA 1M9AA 5HFKA 5G30A 1GSYA 3E0UA 19GSA 4JBBA 1SYRA 4XS4A 2TIRA 2NPBA 4MF5A 4IS0A 2XC2A 3BD2A 2K9FA 1YJ6A 4J2FA 2WULA 1B8XA 4EVMA 2JL4A 4EF0A 2VAFA 3GTUA 1ERUA 1HNAA 2C8UA 2H71A 1O85A 1S3AA 3H93A 3L78A 4D73A 4X43A 2H66A 3HXSA 1PRXA 2XPEA 2VCWA 3TRPA 1X0RA 4V1Ag 1GNWA 4MF7A 3MDKA 3EVIA 1GSEA 2ALBA 1QFNA 4ILFA 5HR0A 2IMDA 3A2XA 1X5CA 3H8QA 1M99A 1X5DA 4I97A 1NHOA 1SJ6A 5D9WA 1FHEA 3LG6A 2YJHA 2VLVA 5IMVA 1AXDA 1Z6NA 1FB0A 4H86A 2LJKA 2FLSA 2PMTA 4RI7A 1XWKA 2HSHA 1Z7PA 1GTBA 4GRFA 3KJYA 5IMCA 5EVOA 2IJYA 5J3RA 1LJRA 4WBJA 4WXTA 5G2ZA 1QGVA 1K0CA 3US3A 1TW9A 3DIEA 2YV7A 2RIIA 1G7EA 2FWEA 3CRUA 5J9BA 3RPNA 1KNGA 4MJCA 4PUAA 1SD9A 3G7IA 4JU5A 2FA8A 3HJPA 1VGLA 2VOCA 2H1DA 4XRDA 2N5FA 3KZQA 3LWAA 1MTCA 1TJDA 1TTZA 2R5GA 1ZYEA 3F4SA 3C1SA 5LD0A 1YZXA 2YZUA 3F9UA 3C7MA 4NV5A 2A4VA 11GSA 1M2AA 4ML1A 3ZMKA 3ED3A 2VCTA 1ABAA 3GMFA 1TOFA 3EC3A 1XWAA 3HKRA 1E2YA 3ME8A 4RUVA 1UVZA 4KCAA 5ECLB 1WE0A 2GLRA 5CNWA 4MZWA 3KCMA 1VRSD 5F0GA 2HSYA 5JWOB 2YWMA 2B7KA 4ZBDA 2K8SA 1URMA 1IYHA 5ECQB 4WR5A 1X9WB 1CQHA 4GSNA 3VI5A 3VPTA 5JWQB 4N0VA 2PU9C 5DDLA 2VD0A 3ZRDA 4I5QA 1T8EB 2FA4A 2K8VA 1XBSA 3Q19A 1AC1A 3TGZA 5J5NA 2VLUA 1AQVA 4F03A 5B8BA 3LORA 1BQ7A 5DAKA 1JZWA 3UMAA 1A0FA 5KN1A 2WGRA 2YP6A 1ON4A 1VF3A 3HA9A 7GSSA 3M8NA 1FVJA 3QAGA 4V1Ap 1V9WA 2VL2C 4OD7A 4EO3A 4TR1B 3GH9A 1AIUA 1ZL9A 3BBYA 2P5RA 4O5RA 1WRYA 1TKDB 3ISOA 1EEJA 2FHEA 4MZCA 4MF6A 2LQOA 3TB2A 4ID0A 5G31A 2H73A 3H79A 4WKWA 1Y25A 1PMTA 3IAS2 2H76A 1O6JA 1YF0A 13GSA 3VI7A 1WP0A 3ZIJA 1EOHA 2EIOA 4V2NA 4I2UA 1SD8A 2Z9SA 2B1LA 4ZIJA 2C1YA 2GSSA 2GT6A 2X64A 3CTGA 4LLRA 2WB9A 3U6VA 2CVKA 5CRDA 1T4YA 1GUKA 4GWRA 1V58A 4FYCA 4MJEA 2GQMA 3HYPA 3GYKA 4KX4A 4E8HA 1M2DA 4POLA 1XOAA 4KE3A 3QPMA 4I8BA 5A5KA 3IC4A 1BYEA 3GV1A 1WWJA 2I81A 3F0IA 1O7UA 3GL5A 1PN9A 2HYXA 5ID2B 4NPBA 4K0NA 2H72A 2L6DA 1W4VA 1WIKA 5D9TA 1EGOA 4IN0A 3FZ9A 1UA5A 4LMWA 3KXOA 1ML6A 3J7Yk 2QGVA 3FR9A 1V57A 2HZEB 1U3AA 1DE2A 1FAAA 3C8EA 2JADA 1JZDA 2HRFA 1K3YA 2RLIA 4G9HA 6GSYA 1SK0A 1GUMA 6GSUA 4BL7A 2I4AA 1HD2A 3KP8A 4OCFA 4K8MA 4OFMA 2R37A 2P5QA 3FW2A 3IOSA 2GZYA 4JR4A 3F8UA 4OFNA 1KBNA 2IMKA 4X0XA 3TJJA 5DVBA 5FWGA 4ZL9A 2MZCA 2OKAA 2C3QA 4P3YB 2M72A 2B5EA 4PURA 2H6YA 3CMIA 3LYKA 3HVVA 2FWHA 1NM3A 4O32A 4MA9A 3IK9A 4OWYA 4EDYA 2JZSA 2O85A 1PX6A 2VCZA 1WMJA 3UIWA 2F3MA 1SKWB 1FO5A 3HZ4A 3KTBA 1F2EA 5KN0A 4TXOA 5IO2A 3GHAA 5GAPD 2DJ2A 4MPGA 4KCEA 3ZVJD 4ZB6A 2IN3A 4WR4A 4XIHA 2AB6A 4KNDA 5IOWA 1EGRA 2P0GA 2X8HA 4ZB8A 1K0MA 3HJOA 1JZRA 3FZ4A 4YQMA 2C80A
chains in the Genus database with same CATH superfamily
1JLWA 4TR1A 3GKXA 5IPHA 3D0ZA 2B3SA 2GQKA 1XWCA 3Q74A 3FEUA 3GH6A 2PWJA 3IK7A 2X4AA 4AJ8A 2GS3A 1S3DA 1WJKA 1E6BA 3D4MA 3KEBA 2JU5A 4XTSA 2GTUA 1AQXA 2H74A 3W8SA 2RM6A 1UN2A 1OVNA 20GSA 2J23A 2ZUPA 3HHVA 1O8WA 5HR1A 4GF0A 3DRNA 1XOBA 3IXRA 1Z9HA 3PPUA 1F37A 4MMMA 3F6FA 4Z7XA 2K6VA 2OE3A 2OACA 4TR3A 3RAZA 5IM9A 2LNTA 2H6XA 2IMFA 4KGIA 3LXTA 5IMZA 22GSA 3CSHA 4NXIA 4Z2UA 3GURA 2X49A 1VF4A 3ERWA 5IMDA 2CV4A 2PUKC 4RI6A 2OE0A 1SKSB 4MCUA 1SENA 3KH7A 4IVFA 1I5GA 4WBRD 2R6KA 2F8AA 1K3OA 2R0CA 2VO4A 2YZHA 2EIRA 5LCZA 2JZTA 3TJBA 3A5WA 5ECPB 1K0BA 2FY6A 5KN3A 5CREA 1JLVA 1U88A 3C1RA 1XPVA 4O92A 1SJIA 5ECIB 3SWLA 4JRRA 4F9ZA 1GSQA 4ICYA 2HZEA 1BAYA 2ZCTA 3A3TA 4YH2A 3LSZA 3E3EA 3IHQA 14GSA 1FG4A 4HZ4A 3A2WA 3VPQA 2PVQA 4FH8A 3VWWA 2V2GA 1FVKA 3KD0A 2E2GA 3N5OA 1EZKA 2J9HA 3EYTA 1FW1A 5DQSA 2O8VB 1FOHA 1ZZYA 3RBTA 1TXXA 3DXBA 1W89A 2LRTA 3ZTLA 1GTIA 2HT9A 10GSA 1J0FA 4ECCA 4IBPA 3VURA 2LV3A 1QK8A 2HE3A 3GX0A 3TUEA 4KA0A 2DLXA 1F3AA 1XVQA 5IIZA 5IOXA 2GZZA 1YKCA 5DBQA 3OR5A 4HU9A 4V2LA 2VM1A 2E2MA 3WYWA 3I69A 2DMLA 3IE3A 4G0LA 1R26A 1FOVA 1J08A 1MEKA 1ZGNA 3ZREA 1XZOA 2CZ2A 2PVOC 3MSZA 2A2PA 2PPTA 1OC9B 3GN3A 3R3EA 3ERGA 5A4VA 1Z5YE 4BVYB 3VLNA 3ZYWA 3VWVA 4K1FA 1GP1A 12GSA 2JACA 1FB6A 2YNXA 2YN1A 4IJ3A 4GCIA 2I9HA 4RQXA 3L9UA 2X8GA 5AIVA 4YQVA 4OMVA 1JHBA 3Q18A 2OBIA 1H4OA 1YY7A 3EURA 4MK3A 4HI7A 3VWUA 1Q98A 3ZZXA 3QCPA 5B8AA 5JCGA 2MMOA 1G6WA 4CDOA 2V6OA 1HQOA 3HDCA 2IMIA 5IQYA 1G0TA 1ERVA 4LL1B 1DUGA 4DVCA 1TK0B 3IA1A 4WEYA 1C72A 3TJFA 3ZFBA 4IGJA 2VCQA 1TRUA 5E59A 1X9MB 3UBLA 2GSQA 2B5XA 4IKHA 3EU3A 1HYUA 5D73A 4NV2A 1B4QA 2B6MA 4PNFA 2TRCP 3APSA 3PR8A 3H1NA 4ACSA 3FZ5A 4L0WA 2VL2A 1LU4A 3MNGA 4GXZA 1A2JA 4EUYA 3TRQA 1HNBA 2HNLA 4LL4B 4AF2A 3FMWA 2DSAA 5D93A 5BMUA 4FYBA 5G1KA 2DMMA 3UBKA 4I2TA 4KDXA 5HFIA 4PGTA 4OO5A 3GFKA 1Z7RA 2CQ9A 3BOAA 2FNOA 1GWCA 3WT2A 5IMFA 2KP2A 4DSSB 2H70A 1PN0A 3QOUA 2H1BA 1PSQA 3DKSA 2REMA 1K0OA 1ZYNA 3LEFA 2P31A 3IBHA 2D2ZA 2BMXA 5FT3A 4N30A 5G5FA 4MLYA 2L59A 4BIKA 3QR6A 2IFQB 1O8XA 2AJQB 3H4KA 1GLQA 3M3MA 3FK8A 2LRNA 3EMXA 2ES7A 4MH3A 4N0ZA 2YOIA 2C0GA 1OAZA 3QDNA 3UJ1A 4ZBBA 5C00A 1PA3A 5JCWA 3QFBC 4G2EA 3GA4A 3GUSA 1XWGA 1PL1A 1TDIA 2YWIA 3LYPA 5E4WA 5ECSA 1ILOA 2O87A 2YV9A 1V40A 4PUFC 4F0CA 1EV9A 1ERTA 3PGTA 2H6ZA 5G5EA 5H5SA 5B6NA 5A4UA 5INYA 1V98A 4AJ7A 1G6YA 2DC5A 2AHEA 1USBA 3APQA 5B7CA 3UEMA 2AAWA 4USSA 2VL3A 3LXZA 3GSSA 5HR3A 4NHWA 4XCSA 2H75A 3Q6OA 2CAIA 4K5RA 2RUFA 5D9VA 3F63A 2HI7A 2HLSA 2NTOA 5IPGA 3AY8A 1BEDA 1KEBA 5ELAA 1XW9A 1OC9A 1YDKA 2VD1A 1EWXA 5DCGA 4XHMA 4BVYA 2DJJA 3WGDA 1DE1A 1GTUA 4F0BA 2OBKA 3G7YA 3NIVA 1HNCA 3C71A 2HZFA 3DYRA 3ERFA 2NDOA 4K7NA 2YJ7A 2H0IA 2X8CA 2PBJA 4XRAA 2YWOA 4K7IA 1SK2A 3FZAA 3GSTA 5DALB 2L5LA 4IP1A 1I9DA 2GSTA 3L9SA 1JFUA 5D8IA 5GSSA 1SKRB 1ZMAA 4O7HA 1BJXA 2CX3A 2I3YA 2IL3A 3UVHA 2C3NA 3D21A 1BG5A 4XS4B 1A8YA 2ON7A 1R5PA 1VF1A 4Z2TA 2R4VA 4FYUA 4TRXA 1H75A 5EPFA 3EMPA 3DMLA 3HD5A 3ME7A 1PD21 1TK5B 4IQAA 4POMA 2GGTA 4TR0A 2OE1A 3NZNA 2MMNA 4DSRA 2FWFA 2E7PA 4ECIA 2R0GA 1PQNA 4N10A 2V41A 2A2SA 4HS1A 3RPPA 2DJ3A 3M9KA 2L6CA 2FCHA 2GDRA 2HSMA 3ZLPA 5GZZB 4DSSA 3O6TA 5A4WA 3CTFA 2AUVA 3IC8A 4JR6A 2R2JA 3FKFA 2B1KA 2PERA 8GSSA 4OCEA 3F4TA 5ENUA 1PL2A 5H5RA 4J56E 1T7PB 3DEXA 3DVWA 3LW9A 4MJBA 3DVXA 4LMVA 4OFTA 4HDEA 3TJKA 6GSVA 2IFQA 1SU9A 4TOPA 3D5JA 3UAPA 4ECBA 1K3LA 4K5SA 1X5EA 2MMZA 3MWHA 4FO5A 3TKSE 1LBKA 4IQ1A 1MDKA 2LJAA 4L0UA 1A24A 3QMXA 1DBYA 3EWLA 1A23A 4KDYA 4BPYA 3QFAC 4IHUA 1J9BA 1B9YC 2IIYA 1PKZA 2JSYA 4MNNA 2N5AA 2EIQA 4F2IA 4JZQA 4KH7A 1GUHA 1A8LA 3BJ5A 2DKHA 3GKMA 2HFDA 4X1UA 2DIYA 2HRNA 2OADA 2F9SA 2VM2A 4L8EA 2GVPA 5AGYA 1M3IA 3DWVA 1A2MA 3KMOA 1NW2A 1M3JA 2DIZA 4E8EA 1SL1B 5ECKB 5GSTA 2NVLA 1ZYQB 5KN2A 2E0QA 3D4TA 4QQ7A 2VIMA 1MD4A 4JE1A 3GRXA 4IELA 16GSA 4ISDA 3FYGA 4A5PA 4IP6A 3DGQA 1YKAA 2A2RA 5ABRA 1WPIA 5ID2A 2YANA 3HVSA 4WETA 1YEPA 5KOWA 4CW9A 2I1UA 3TKQA 2F51A 1XG8A 2LQQA 4V2MA 3IAM2 4KAEA 3VFIA 2JZRA 3LGCA 1OC8A 1K0AA 2WDUA 2DBCA 2ON5A 2PGTA 2H01A 5DALA 3CRTA 2FGXA 3TKRA 1Z3EA 5ELGA 2HXKA 1T3BA 2CVBA 4KB3A 4ULXA 3GIXA 4IW9A 2WFCA 1RQMA 4MPFA 1K0DA 3V1WA 1THXA 3M0FA 2ZNMA 4TVEA 3KTLA 4HZ2A 4HJMA 3WGEA 2KOKA 4HJ2A 3PINA 2WJUA 3O3TA 3UARA 1GULA 2VLTA 1XW6A 3CSIA 4F82A 4Q5FA 3GNJA 4GQCA 3P2AA 5AIXA 1TU7A 4NHZA 4NMUA 1BX9A 1N2AA 3HCZA 4J57E 2WRTA 5F07A 2RUEA 3P7XA 4EKZA 2VUPA 1UC7A 3FR6A 1SJZA 5H5QA 3IV4A 2CVDA 1NHYA 5CO3A 2L5OA 5J9CA 3R2QA 5ECNB 5ECRB 3ZL5A 2DKIA 4ZBAA 3D6IA 1TRSA 2K18A 3ZMLA 5F05A 4LA1A 5LNKe 3QD9A 5DQYA 4DEJA 4MP4A 1Q4JA 4AJ6A 1GLPA 4KSOA 3E9JB 1QUWA 2L57A 4GLTA 3O76A 4CY8A 3A2VA 5D96A 3I6AA 2V1MA 3FR3A 4YQUA 1EOGA 4PQ1A 4GSSA 3W8JA 5CRHA 1PKWA 3MIXA 5G1LA 1QQ2A 4HSCX 3GKNA 2X99A 3IDVA 3A5IA 3P8WA 3F6DA 5ECOB 1SYXA 3F3RA 2LJRA 3EE2A 2B5YA 4PNGA 4TXVA 2V6KA 5L71A 1XCCA 3RHCA 2GZPA 2C3TA 2DJKA 2O7KA 4HUAA 1RK4A 1XXUA 4KW6A 4G0IA 4TN8A 2BTOT 2VCVA 2C0EA 3UOMA 1PFOA 4HEA2 2L4QA 5HR2A 1GH2A 1THOA 2YPMA 3U5RE 4MDCA 1JZOA 3ZIVA 3NOFA 3RDWA 1MDJA 3ZFLA 2QA2A 4PQIA 2QC7A 1X9SB 3FRCA 3IR4A 1TRVA 3CBUA 3D22A 3F3QA 1XFLA 2CZ3A 1B48A 2AYTA 5IMAA 2LSTA 3FY7A 3VWXA 4QL7A 4KUNA 5F8BA 4L5OA 5B6MA 3KP9A 1B4PA 4K2DA 2GQLA 3KGKA 3DD3A 4CHSA 4YAVA 3F4RA 3TRXA 4BWQA 2L4CA 1M2BA 4NAXA 4TXOB 1AAZA 5J4UA 2M80A 3TCOA 4GTUA 4ECJA 4Q5NA 9GSSA 4WF4A 3S9FA 1YF1A 2LKUA 2LS5A 2IWTA 1SL2B 2V32A 5DJLA 2QA1A 4N11A 4MABA 5EL8A 3MYDA 2TRXA 5F06A 2MBSA 3TOUA 4ML6A 4NWYA 5HFGA 4RQRA 4GSTA 6GSSA 4ZL7A 3VK9A 4AGSA 4K6XA 2EC4A 3L4NA 2YWNA 2M46A 4MJAA 3JCML 1OC3A 3KM6A 1OKTA 5CAXA 1F9MA 5HQPA 1KTEA 1YEXA 4K2XA 2JSZA 1TRWA 4Q5RA 2CAQA 1WOUA 2R3XA 4Z2RA 3FHKA 3GKKA 2GT5A 4TR4A 3W6GA 4K7OA 5FHIA 1OE8A 4HU7A 1G7OA 3IPZA 1CQGA 3ZVJA 2H19A 3CYNA 4EE0A 5ECHB 2LNSA 2O89A 1R5AA 4ZXGA 2H30A 2KUCA 5CP1A 1M9BA 5JWRB 1GRXA 1U87A 1EEMA 3HVXA 5ECMB 4JEDA 4Q5QA 5DJMA 2VL9A 3TJGA 2VCXA 3PH9A 2WZ9A 3APOA 1ACVA 1GSSA 1U3IA 2XPDA 1YQ1A 3BCKA 3RHBA 4BVXB 1T4ZA 1ZCPA 2OA7A 3I43A 3L0HA 2FD3A 1QXHA 1XVWA 3EINA 4I6XA 4OO4A 3I9V2 2F8FA 4KDUA 1TP9A 2YCDA 2N5BA 1GTAA 4HQZA 1AUCA 1O73A 4HQSA 1EV4A 3WGXA 1S3RA 2LEGA 1EP7A 4G19A 5BRTA 2QKEA 5EY6A 1GSUA 1TK8B 1ZYPA 3L9VA 1T00A 2WCIA 1M7TA 3LQ7A 1GL8A 2DJ0A 4XS1A 2WS2A 3GTUB 1AW9A 4POKA 3C73A 1GNEA 4ZL8A 3TOTA 1OYJA 4EC0A 2PN8A 1F6MC 4D73B 5KEJA 4MH2A 2B7JA 3HZ8A 1TU8A 1VF2A 4CY6A 2XBQA 4KSMA 2G0FA 1GSFA 4TKYA 3SBCA 3G9BA 3UL3A 1N8JA 2G2QA 5GAND 3J7Yb 6GSTA 1U6TA 1Y6EA 4XS6A 4EL1A 2KLXA 2C0DA 1F3BA 3CSJA 5D9XA 4QL9A 1Z6MA 3M1GA 1SL0B 3TKSA 4YAPA 2RM5A 2FUG2 3UVTA 4EXJA 1EP8A 4G10A 1SK1A 2CA8A 2OJLA 3QAVA 3KIJA 2FWGA 3ZITA 1IYIA 18GSA 4POBA 1PX7A 2XHFA 1TI1A 1PGTA 3KMNA 3QAWA 2DJ1A 3M9JA 3TDGA 2CX4A 1XWBA 2GSRA 5CYYA 5COHA 3IHGA 4BA7A 4HOJA 5C04A 1QMVA 1MD3A 17GSA 4GQFA 4FQUA 1ST9A 3LJRA 5CRGA 3BCIA 1ERWA 2H8LA 2H1GA 2IPAA 2LUSA 1M0UA 3TKPA 6GSXA 4MZBA 1R4WA 2QSIA 2MYGA 6GSWA 2HRKA 4K0GA 1OKDA 1GSDA 3KH9A 3MAKA 3G7JA 2MBTA 4FIWA 2LRCA 2KHPA 2C4JA 2IMEA 4PQHA 1K0NA 3GX8A 2XBIA 2LTKA 3WD6A 3TKSC 1XW5A 1S3CA 1TI3A 2BJXA 1RW1A 2MMAA 1A0RP 3HY2A 1B9XC 1AQWA 2KP1A 3IRAA 1V2AA 1R7HA 1MDIA 2C0FA 4EDZA 1DSBA 5J41A 5DCHA 2H0GA 4BWSA 3LFLA 4PXOA 2H1AA 4PX1A 5IO0A 3N9JA 4K9ZA 1ZOFA 3EU4A 4WF5A 2H0HA 5AISA 3WT1A 2CT6A 1OE7A 5AN1A 3K8NA 3GL3A 3P90A 1O81A 5CRWA 2NBSA 5JCUA 4TW5A 4L5LA 4DSQA 4BVXA 3CXGA 1T1VA 1NSWA 4ZB9A 2AV4A 4IJIA 4ZILA 5DAKB 1XIYA 3HJMA 1A2LA 1M9AA 5HFKA 5G30A 1GSYA 3E0UA 19GSA 4JBBA 1SYRA 4XS4A 2TIRA 4O5UA 2NPBA 4MF5A 4IS0A 2XC2A 3BD2A 2K9FA 1YJ6A 4J2FA 2WULA 1B8XA 4EVMA 2JL4A 4EF0A 2VAFA 3GTUA 1ERUA 1HNAA 2C8UA 2H71A 1O85A 1S3AA 3H93A 3L78A 4D73A 4X43A 2H66A 3HXSA 1PRXA 2XPEA 2VCWA 3TRPA 1X0RA 4V1Ag 1GNWA 4MF7A 4X4JA 3MDKA 3EVIA 1GSEA 2ALBA 1QFNA 4ILFA 5HR0A 2IMDA 3A2XA 1X5CA 4YKFA 3H8QA 1M99A 1X5DA 4I97A 1NHOA 1SJ6A 5D9WA 1FHEA 3LG6A 2YJHA 2VLVA 5IMVA 1AXDA 1Z6NA 1FB0A 4H86A 2LJKA 2FLSA 2PMTA 4RI7A 1XWKA 2HSHA 1Z7PA 1GTBA 4GRFA 3KJYA 5IMCA 5EVOA 2IJYA 5J3RA 1LJRA 4WBJA 4WXTA 5G2ZA 1QGVA 1K0CA 3US3A 1TW9A 3DIEA 2YV7A 2RIIA 1G7EA 2FWEA 3CRUA 2UZ8A 5J9BA 3RPNA 1KNGA 4MJCA 4PUAA 1SD9A 4O5QA 3G7IA 4JU5A 2FA8A 3HJPA 1VGLA 2VOCA 3HVNA 2H1DA 4XRDA 2N5FA 3KZQA 3LWAA 1MTCA 1TJDA 1TTZA 2R5GA 1ZYEA 3F4SA 2A4HA 3C1SA 5LD0A 5KOXA 1YZXA 2YZUA 3F9UA 3C7MA 4BL7B 4NV5A 2A4VA 11GSA 1M2AA 4ML1A 3ZMKA 3ED3A 2VCTA 1ABAA 3GMFA 1TOFA 3EC3A 1XWAA 3HKRA 1E2YA 3ME8A 4RUVA 1UVZA 4KCAA 5ECLB 1WE0A 2GLRA 5CNWA 4MZWA 3KCMA 1VRSD 5F0GA 2HSYA 5JWOB 2YWMA 2B7KA 4ZBDA 4G0KA 2K8SA 1URMA 1IYHA 5ECQB 4WR5A 1X9WB 1CQHA 4GSNA 3VI5A 3VPTA 5JWQB 4N0VA 4PTSA 2PU9C 5DDLA 4YKGA 2VD0A 3ZRDA 4I5QA 1T8EB 2FA4A 2K8VA 1XBSA 3Q19A 1AC1A 3TGZA 5J5NA 2VLUA 1AQVA 4F03A 5B8BA 3LORA 1BQ7A 5DAKA 1JZWA 3UMAA 1A0FA 5KN1A 2WGRA 2YP6A 1ON4A 1VF3A 3HA9A 2HRAA 7GSSA 3M8NA 1FVJA 3QAGA 4V1Ap 1V9WA 2VL2C 4OD7A 4EO3A 4TR1B 3GH9A 1AIUA 1ZL9A 3BBYA 2P5RA 4O5RA 1WRYA 1TKDB 3ISOA 1EEJA 2FHEA 4MZCA 4MF6A 3EPTA 2LQOA 3TB2A 4ID0A 5G31A 2H73A 3H79A 4WKWA 1Y25A 1PMTA 3IAS2 2H76A 1O6JA 1YF0A 13GSA 3VI7A 1WP0A 3ZIJA 1EOHA 2EIOA 4V2NA 4I2UA 2R0PA 1SD8A 2Z9SA 2B1LA 4ZIJA 2C1YA 2GSSA 2GT6A 2X64A 3CTGA 4LLRA 3CQFA 2WB9A 3U6VA 2CVKA 5CRDA 1T4YA 1GUKA 4GWRA 1V58A 4FYCA 4MJEA 2GQMA 3HYPA 3GYKA 4KX4A 4E8HA 1M2DA 4POLA 1XOAA 4KE3A 4KF9A 3QPMA 4I8BA 5A5KA 3IC4A 1BYEA 3GV1A 1WWJA 2I81A 3F0IA 1O7UA 3GL5A 1PN9A 2HYXA 5ID2B 4NPBA 4K0NA 2H72A 2L6DA 1W4VA 1WIKA 5D9TA 1EGOA 4IN0A 3FZ9A 1UA5A 4LMWA 3KXOA 1ML6A 3J7Yk 2QGVA 3FR9A 1V57A 2HZEB 1U3AA 1DE2A 1FAAA 3C8EA 2JADA 1JZDA 2HRFA 1K3YA 2RLIA 4G9HA 6GSYA 1SK0A 1GUMA 6GSUA 4BL7A 2I4AA 1HD2A 3KP8A 4EIQA 4OCFA 4K8MA 4OFMA 2R37A 2P5QA 3FW2A 3IOSA 2GZYA 4JR4A 3F8UA 4OFNA 1KBNA 2IMKA 4X0XA 3TJJA 5DVBA 5FWGA 4ZL9A 2MZCA 2OKAA 2C3QA 4P3YB 2M72A 2B5EA 4PURA 2H6YA 3CMIA 3LYKA 3HVVA 2FWHA 1NM3A 4O32A 4MA9A 3IK9A 4OWYA 4EDYA 2JZSA 2O85A 1PX6A 2VCZA 1WMJA 3UIWA 2F3MA 1SKWB 1FO5A 3HZ4A 3KTBA 1F2EA 5KN0A 4TXOA 5IO2A 3GHAA 4EIPA 5GAPD 2DJ2A 4MPGA 4KCEA 3ZVJD 4ZB6A 2IN3A 4WR4A 4XIHA 2AB6A 4KNDA 5IOWA 1EGRA 2P0GA 2X8HA 4ZB8A 1K0MA 3HJOA 1JZRA 3FZ4A 4YQMA 2C80A
chains in the Genus database with same CATH topology
1JLWA 4TR1A 3GKXA 5IPHA 3D0ZA 2B3SA 2GQKA 1XWCA 3Q74A 3FEUA 3GH6A 2PWJA 3IK7A 2X4AA 4AJ8A 2GS3A 1S3DA 1WJKA 1E6BA 3D4MA 3KEBA 2JU5A 4XTSA 2GTUA 1AQXA 2H74A 3W8SA 2RM6A 1UN2A 1OVNA 20GSA 2J23A 2ZUPA 3HHVA 1O8WA 5HR1A 4GF0A 3DRNA 1XOBA 3IXRA 1Z9HA 3PPUA 1F37A 4MMMA 3F6FA 4Z7XA 2K6VA 2OE3A 2OACA 4TR3A 3RAZA 5IM9A 2LNTA 2H6XA 2IMFA 4KGIA 3LXTA 5IMZA 22GSA 3CSHA 4NXIA 4Z2UA 3GURA 2X49A 1VF4A 3ERWA 5IMDA 2CV4A 2PUKC 4RI6A 2OE0A 1SKSB 4MCUA 1SENA 3KH7A 4IVFA 1I5GA 4WBRD 2R6KA 2F8AA 1K3OA 2R0CA 2VO4A 2YZHA 2EIRA 5LCZA 2JZTA 3TJBA 3A5WA 5ECPB 1K0BA 2FY6A 5KN3A 5CREA 1JLVA 1U88A 3C1RA 1XPVA 4O92A 1SJIA 5ECIB 3SWLA 4JRRA 4F9ZA 1GSQA 4ICYA 2HZEA 1BAYA 2ZCTA 3A3TA 4YH2A 3LSZA 3E3EA 3IHQA 14GSA 1FG4A 4HZ4A 3A2WA 3VPQA 2PVQA 4FH8A 3VWWA 2V2GA 1FVKA 3KD0A 2E2GA 3N5OA 1EZKA 2J9HA 3EYTA 1FW1A 5DQSA 2O8VB 1FOHA 1ZZYA 3RBTA 1TXXA 3DXBA 1W89A 2LRTA 3ZTLA 1GTIA 2HT9A 10GSA 1J0FA 4ECCA 4IBPA 3VURA 2LV3A 1QK8A 2HE3A 3GX0A 3TUEA 4KA0A 2DLXA 1F3AA 1XVQA 5IIZA 5IOXA 2GZZA 1YKCA 5DBQA 3OR5A 4HU9A 4V2LA 2VM1A 2E2MA 3WYWA 3I69A 2DMLA 3IE3A 4G0LA 1R26A 1FOVA 1J08A 1MEKA 1ZGNA 3ZREA 1XZOA 2CZ2A 2PVOC 3MSZA 2A2PA 2PPTA 1OC9B 3GN3A 3R3EA 3ERGA 5A4VA 1Z5YE 4BVYB 3VLNA 3ZYWA 3VWVA 4K1FA 1GP1A 12GSA 2JACA 1FB6A 2YNXA 2YN1A 4IJ3A 4GCIA 2I9HA 4RQXA 3L9UA 2X8GA 5AIVA 4YQVA 4OMVA 1JHBA 3Q18A 2OBIA 1H4OA 1YY7A 3EURA 4MK3A 4HI7A 3VWUA 1Q98A 3ZZXA 3QCPA 5B8AA 5JCGA 2MMOA 1G6WA 4CDOA 2V6OA 1HQOA 3HDCA 2IMIA 5IQYA 1G0TA 1ERVA 4LL1B 1DUGA 4DVCA 1TK0B 3IA1A 4WEYA 1C72A 3TJFA 3ZFBA 4IGJA 2VCQA 1TRUA 5E59A 1X9MB 3UBLA 2GSQA 2B5XA 4IKHA 3EU3A 1HYUA 5D73A 4NV2A 1B4QA 2B6MA 4PNFA 2TRCP 3APSA 3PR8A 3H1NA 4ACSA 3FZ5A 4L0WA 2VL2A 1LU4A 3MNGA 4GXZA 1A2JA 4EUYA 3TRQA 1HNBA 2HNLA 4LL4B 4AF2A 3FMWA 2DSAA 5D93A 5BMUA 4FYBA 5G1KA 2DMMA 3UBKA 4I2TA 4KDXA 5HFIA 4PGTA 4OO5A 3GFKA 1Z7RA 2CQ9A 3BOAA 2FNOA 1GWCA 3WT2A 5IMFA 2KP2A 4DSSB 2H70A 1PN0A 3QOUA 2H1BA 1PSQA 3DKSA 2REMA 1K0OA 1ZYNA 3LEFA 2P31A 3IBHA 2D2ZA 2BMXA 5FT3A 4N30A 5G5FA 4MLYA 2L59A 3QR6A 2IFQB 1O8XA 2AJQB 3H4KA 1GLQA 3M3MA 3FK8A 2LRNA 3EMXA 2ES7A 4MH3A 4N0ZA 2YOIA 2C0GA 1OAZA 3QDNA 3UJ1A 4ZBBA 5C00A 1PA3A 5JCWA 3QFBC 4G2EA 3GA4A 3GUSA 1XWGA 1PL1A 1TDIA 2YWIA 3LYPA 5E4WA 5ECSA 1ILOA 2O87A 2YV9A 1V40A 4PUFC 4F0CA 1EV9A 1ERTA 3PGTA 2H6ZA 5G5EA 5H5SA 5B6NA 5A4UA 5INYA 1V98A 4AJ7A 1G6YA 2DC5A 2AHEA 1USBA 3APQA 5B7CA 3UEMA 2AAWA 4USSA 2VL3A 3LXZA 3GSSA 5HR3A 4NHWA 4XCSA 2H75A 3Q6OA 2CAIA 4K5RA 2RUFA 5D9VA 3F63A 2HI7A 2HLSA 2NTOA 5IPGA 3AY8A 1BEDA 1KEBA 5ELAA 1XW9A 1OC9A 1EWXA 2VD1A 1YDKA 5DCGA 4XHMA 4BVYA 2DJJA 3WGDA 1DE1A 1GTUA 4F0BA 2OBKA 3G7YA 3NIVA 1HNCA 3C71A 2HZFA 3DYRA 3ERFA 2NDOA 4K7NA 2YJ7A 2H0IA 2X8CA 2PBJA 4XRAA 2YWOA 4K7IA 1SK2A 3FZAA 3GSTA 5DALB 2L5LA 4IP1A 1I9DA 2GSTA 3L9SA 1JFUA 5D8IA 5GSSA 1SKRB 1ZMAA 4O7HA 1BJXA 2CX3A 2I3YA 2IL3A 3UVHA 2C3NA 3D21A 1BG5A 4XS4B 1A8YA 2ON7A 1R5PA 1VF1A 4Z2TA 2R4VA 4FYUA 4TRXA 1H75A 5EPFA 3EMPA 3DMLA 3HD5A 3ME7A 1PD21 1TK5B 4IQAA 4POMA 2GGTA 4TR0A 2OE1A 3NZNA 2MMNA 4DSRA 2FWFA 2E7PA 4ECIA 2R0GA 1PQNA 4N10A 2V41A 2A2SA 4HS1A 3RPPA 2DJ3A 3M9KA 2L6CA 2FCHA 2GDRA 2HSMA 3ZLPA 5GZZB 4DSSA 3O6TA 5A4WA 3CTFA 2AUVA 3IC8A 4JR6A 2R2JA 3FKFA 2B1KA 2PERA 8GSSA 4OCEA 3F4TA 5ENUA 1PL2A 5H5RA 4J56E 1T7PB 3DEXA 3DVWA 3LW9A 4MJBA 3DVXA 4LMVA 4OFTA 4HDEA 3TJKA 6GSVA 2IFQA 1SU9A 4TOPA 3D5JA 3UAPA 4ECBA 1K3LA 4K5SA 1X5EA 2MMZA 3MWHA 4FO5A 3TKSE 1LBKA 4IQ1A 1MDKA 2LJAA 4L0UA 1A24A 3QMXA 1DBYA 3EWLA 1A23A 4KDYA 4BPYA 3QFAC 4IHUA 1J9BA 1B9YC 2IIYA 1PKZA 2JSYA 4MNNA 2N5AA 2EIQA 4F2IA 4JZQA 4KH7A 1GUHA 1A8LA 3BJ5A 2DKHA 3GKMA 2HFDA 4X1UA 2DIYA 2HRNA 2OADA 2F9SA 2VM2A 4L8EA 2GVPA 5AGYA 3DWVA 1A2MA 3KMOA 1NW2A 2DIZA 4E8EA 1SL1B 5ECKB 5GSTA 2NVLA 1ZYQB 5KN2A 2E0QA 3D4TA 4QQ7A 2VIMA 1MD4A 4JE1A 3GRXA 4IELA 16GSA 4ISDA 3FYGA 4A5PA 4IP6A 3DGQA 1YKAA 2A2RA 5ABRA 1WPIA 5ID2A 2YANA 3HVSA 4WETA 1YEPA 5KOWA 4CW9A 2I1UA 3TKQA 2F51A 2LQQA 4V2MA 3IAM2 4KAEA 3VFIA 2JZRA 3LGCA 1OC8A 1K0AA 2WDUA 2DBCA 2ON5A 2PGTA 2H01A 5DALA 3CRTA 2FGXA 3TKRA 1Z3EA 5ELGA 2HXKA 1T3BA 2CVBA 4KB3A 4ULXA 3GIXA 4IW9A 2WFCA 1RQMA 4MPFA 1K0DA 3V1WA 1THXA 3M0FA 2ZNMA 4TVEA 3KTLA 4HZ2A 4HJMA 3WGEA 2KOKA 4HJ2A 3PINA 2WJUA 3O3TA 3UARA 1GULA 2VLTA 1XW6A 3CSIA 4F82A 4Q5FA 3GNJA 4GQCA 3P2AA 5AIXA 1TU7A 4NHZA 4NMUA 1BX9A 1N2AA 3HCZA 4J57E 2WRTA 5F07A 2RUEA 3P7XA 4EKZA 2VUPA 1UC7A 3FR6A 1SJZA 5H5QA 3IV4A 2CVDA 1NHYA 5CO3A 2L5OA 5J9CA 3R2QA 5ECNB 5ECRB 3ZL5A 2DKIA 4ZBAA 3D6IA 1TRSA 2K18A 3ZMLA 5F05A 4LA1A 5LNKe 3QD9A 5DQYA 4DEJA 4MP4A 1Q4JA 4AJ6A 1GLPA 4KSOA 3E9JB 1QUWA 2L57A 4GLTA 3O76A 4CY8A 3A2VA 5D96A 3I6AA 2V1MA 3FR3A 4YQUA 1EOGA 4PQ1A 4GSSA 3W8JA 5CRHA 1PKWA 3MIXA 5G1LA 1QQ2A 3GKNA 2X99A 3IDVA 3A5IA 3P8WA 3F6DA 5ECOB 1SYXA 3F3RA 2LJRA 3EE2A 2B5YA 4PNGA 4TXVA 2V6KA 5L71A 1XCCA 3RHCA 2GZPA 2C3TA 2DJKA 2O7KA 4HUAA 1RK4A 1XXUA 4KW6A 4G0IA 4TN8A 2BTOT 2VCVA 2C0EA 3UOMA 4HEA2 2L4QA 5HR2A 1GH2A 1THOA 2YPMA 3U5RE 4MDCA 1JZOA 3ZIVA 3NOFA 3RDWA 1MDJA 3ZFLA 2QA2A 4PQIA 2QC7A 1X9SB 3FRCA 3IR4A 1TRVA 3CBUA 3D22A 3F3QA 1XFLA 2CZ3A 1B48A 2AYTA 5IMAA 2LSTA 3FY7A 3VWXA 4QL7A 4KUNA 5F8BA 4L5OA 5B6MA 3KP9A 1B4PA 4K2DA 2GQLA 3KGKA 3DD3A 4CHSA 4YAVA 3F4RA 3TRXA 4BWQA 2L4CA 1M2BA 4NAXA 4TXOB 1AAZA 5J4UA 2M80A 3TCOA 4GTUA 4ECJA 4Q5NA 9GSSA 4WF4A 3S9FA 1YF1A 2LKUA 2LS5A 2IWTA 1SL2B 2V32A 5DJLA 2QA1A 4N11A 4MABA 5EL8A 3MYDA 2TRXA 5F06A 2MBSA 3TOUA 4ML6A 4NWYA 5HFGA 4RQRA 4GSTA 6GSSA 4ZL7A 3VK9A 4AGSA 4K6XA 2EC4A 3L4NA 2YWNA 2M46A 4MJAA 3JCML 1OC3A 3KM6A 1OKTA 5CAXA 1F9MA 5HQPA 1KTEA 1YEXA 4K2XA 2JSZA 1TRWA 4Q5RA 2CAQA 1WOUA 2R3XA 4Z2RA 3FHKA 3GKKA 2GT5A 4TR4A 3W6GA 4K7OA 5FHIA 1OE8A 4HU7A 1G7OA 3IPZA 1CQGA 3ZVJA 2H19A 3CYNA 4EE0A 5ECHB 2LNSA 2O89A 1R5AA 4ZXGA 2H30A 2KUCA 5CP1A 1M9BA 5JWRB 1GRXA 1U87A 1EEMA 3HVXA 5ECMB 4JEDA 4Q5QA 5DJMA 2VL9A 3TJGA 2VCXA 3PH9A 2WZ9A 3APOA 1ACVA 1GSSA 1U3IA 2XPDA 1YQ1A 3BCKA 3RHBA 4BVXB 1T4ZA 1ZCPA 2OA7A 3I43A 3L0HA 2FD3A 1QXHA 1XVWA 3EINA 4I6XA 4OO4A 3I9V2 2F8FA 4KDUA 1TP9A 2YCDA 2N5BA 1GTAA 4HQZA 1AUCA 1O73A 4HQSA 1EV4A 3WGXA 2LEGA 1EP7A 4G19A 5BRTA 2QKEA 5EY6A 1GSUA 1TK8B 1ZYPA 3L9VA 1T00A 2WCIA 1M7TA 3LQ7A 1GL8A 2DJ0A 4XS1A 2WS2A 3GTUB 1AW9A 4POKA 3C73A 1GNEA 4ZL8A 3TOTA 1OYJA 4EC0A 2PN8A 1F6MC 4D73B 5KEJA 4MH2A 2B7JA 3HZ8A 1TU8A 1VF2A 4CY6A 2XBQA 4KSMA 2G0FA 1GSFA 4TKYA 3SBCA 3G9BA 3UL3A 1N8JA 2G2QA 5GAND 3J7Yb 6GSTA 1U6TA 1Y6EA 4XS6A 4EL1A 2KLXA 2C0DA 1F3BA 3CSJA 5D9XA 4QL9A 1Z6MA 3M1GA 1SL0B 3TKSA 4YAPA 2RM5A 2FUG2 3UVTA 4EXJA 1EP8A 4G10A 1SK1A 2CA8A 2OJLA 3QAVA 3KIJA 2FWGA 3ZITA 1IYIA 18GSA 4POBA 1PX7A 2XHFA 1TI1A 1PGTA 3KMNA 3QAWA 2DJ1A 3M9JA 3TDGA 2CX4A 1XWBA 2GSRA 5CYYA 5COHA 3IHGA 4BA7A 4HOJA 5C04A 1QMVA 1MD3A 17GSA 4GQFA 4FQUA 1ST9A 3LJRA 5CRGA 3BCIA 1ERWA 2H8LA 2H1GA 2IPAA 2LUSA 1M0UA 3TKPA 6GSXA 4MZBA 1R4WA 2QSIA 2MYGA 6GSWA 2HRKA 4K0GA 1OKDA 1GSDA 3KH9A 3MAKA 3G7JA 2MBTA 4FIWA 2LRCA 2KHPA 2C4JA 2IMEA 4PQHA 1K0NA 3GX8A 2XBIA 2LTKA 3WD6A 3TKSC 1XW5A 1S3CA 1TI3A 2BJXA 1RW1A 2MMAA 1A0RP 3HY2A 1B9XC 1AQWA 2KP1A 3IRAA 1V2AA 1R7HA 1MDIA 2C0FA 4EDZA 1DSBA 5J41A 5DCHA 2H0GA 4BWSA 3LFLA 4PXOA 2H1AA 4PX1A 5IO0A 3N9JA 4K9ZA 1ZOFA 3EU4A 4WF5A 2H0HA 5AISA 3WT1A 2CT6A 1OE7A 5AN1A 3K8NA 3GL3A 3P90A 1O81A 5CRWA 2NBSA 5JCUA 4TW5A 4L5LA 4DSQA 4BVXA 3CXGA 1T1VA 1NSWA 4ZB9A 2AV4A 4IJIA 4ZILA 5DAKB 1XIYA 3HJMA 1A2LA 1M9AA 5HFKA 5G30A 1GSYA 3E0UA 19GSA 4JBBA 1SYRA 4XS4A 2TIRA 4O5UA 2NPBA 4MF5A 4IS0A 2XC2A 3BD2A 2K9FA 1YJ6A 4J2FA 2WULA 1B8XA 4EVMA 2JL4A 4EF0A 2VAFA 3GTUA 1ERUA 1HNAA 2C8UA 2H71A 1O85A 1S3AA 3H93A 3L78A 4D73A 4X43A 2H66A 3HXSA 1PRXA 2XPEA 2VCWA 3TRPA 1X0RA 4V1Ag 1GNWA 4MF7A 4X4JA 3MDKA 3EVIA 1GSEA 2ALBA 1QFNA 4ILFA 5HR0A 2IMDA 3A2XA 1X5CA 4YKFA 3H8QA 1M99A 1X5DA 4I97A 1NHOA 1SJ6A 5D9WA 1FHEA 3LG6A 2YJHA 2VLVA 5IMVA 1AXDA 1Z6NA 1FB0A 4H86A 2LJKA 2FLSA 2PMTA 4RI7A 1XWKA 2HSHA 1Z7PA 1GTBA 4GRFA 3KJYA 5IMCA 5EVOA 2IJYA 5J3RA 1LJRA 4WBJA 4WXTA 5G2ZA 1QGVA 1K0CA 3US3A 1TW9A 3DIEA 2YV7A 2RIIA 1G7EA 2FWEA 3CRUA 2UZ8A 5J9BA 3RPNA 1KNGA 4MJCA 4PUAA 1SD9A 4O5QA 3G7IA 4JU5A 2FA8A 3HJPA 1VGLA 2VOCA 2H1DA 4XRDA 2N5FA 3KZQA 3LWAA 1MTCA 1TJDA 1TTZA 2R5GA 1ZYEA 3F4SA 2A4HA 3C1SA 5LD0A 5KOXA 1YZXA 2YZUA 3F9UA 3C7MA 4BL7B 4NV5A 2A4VA 11GSA 1M2AA 4ML1A 3ZMKA 3ED3A 2VCTA 1ABAA 3GMFA 1TOFA 3EC3A 1XWAA 3HKRA 1E2YA 3ME8A 4RUVA 1UVZA 4KCAA 5ECLB 1WE0A 2GLRA 5CNWA 4MZWA 3KCMA 1VRSD 5F0GA 2HSYA 5JWOB 2YWMA 2B7KA 4ZBDA 4G0KA 2K8SA 1URMA 1IYHA 5ECQB 4WR5A 1X9WB 1CQHA 4GSNA 3VI5A 3VPTA 5JWQB 4N0VA 4PTSA 2PU9C 5DDLA 4YKGA 2VD0A 3ZRDA 4I5QA 1T8EB 2FA4A 2K8VA 1XBSA 3Q19A 1AC1A 3TGZA 5J5NA 2VLUA 1AQVA 4F03A 5B8BA 3LORA 1BQ7A 5DAKA 1JZWA 3UMAA 1A0FA 5KN1A 2WGRA 2YP6A 1ON4A 1VF3A 3HA9A 2HRAA 7GSSA 3M8NA 1FVJA 3QAGA 4V1Ap 1V9WA 2VL2C 4OD7A 4EO3A 4TR1B 3GH9A 1AIUA 1ZL9A 3BBYA 2P5RA 4O5RA 1WRYA 1TKDB 3ISOA 1EEJA 2FHEA 4MZCA 4MF6A 3EPTA 2LQOA 3TB2A 4ID0A 5G31A 2H73A 3H79A 4WKWA 1Y25A 1PMTA 3IAS2 2H76A 1O6JA 1YF0A 13GSA 3VI7A 1WP0A 3ZIJA 1EOHA 2EIOA 4V2NA 4I2UA 2R0PA 1SD8A 2Z9SA 2B1LA 4ZIJA 2C1YA 2GSSA 2GT6A 2X64A 3CTGA 4LLRA 2WB9A 3U6VA 2CVKA 5CRDA 1T4YA 1GUKA 4GWRA 1V58A 4FYCA 4MJEA 2GQMA 3HYPA 3GYKA 4KX4A 4E8HA 1M2DA 4POLA 1XOAA 4KE3A 4KF9A 3QPMA 4I8BA 5A5KA 3IC4A 1BYEA 3GV1A 1WWJA 2I81A 3F0IA 1O7UA 3GL5A 1PN9A 2HYXA 5ID2B 4NPBA 4K0NA 2H72A 2L6DA 1W4VA 1WIKA 5D9TA 1EGOA 4IN0A 3FZ9A 1UA5A 4LMWA 3KXOA 1ML6A 3J7Yk 2QGVA 3FR9A 1V57A 2HZEB 1U3AA 1DE2A 1FAAA 3C8EA 2JADA 1JZDA 2HRFA 1K3YA 2RLIA 4G9HA 6GSYA 1SK0A 1GUMA 6GSUA 4BL7A 2I4AA 1HD2A 3KP8A 4EIQA 4OCFA 4K8MA 4OFMA 2R37A 2P5QA 3FW2A 3IOSA 2GZYA 4JR4A 3F8UA 4OFNA 1KBNA 2IMKA 4X0XA 3TJJA 5DVBA 5FWGA 4ZL9A 2MZCA 2OKAA 2C3QA 4P3YB 2M72A 2B5EA 4PURA 2H6YA 3CMIA 3LYKA 3HVVA 2FWHA 1NM3A 4O32A 4MA9A 3IK9A 4OWYA 4EDYA 2JZSA 2O85A 1PX6A 2VCZA 1WMJA 3UIWA 2F3MA 1SKWB 1FO5A 3HZ4A 3KTBA 1F2EA 5KN0A 4TXOA 5IO2A 3GHAA 4EIPA 5GAPD 2DJ2A 4MPGA 4KCEA 3ZVJD 4ZB6A 2IN3A 4WR4A 4XIHA 2AB6A 4KNDA 5IOWA 1EGRA 2P0GA 2X8HA 4ZB8A 1K0MA 3HJOA 1JZRA 3FZ4A 4YQMA 2C80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLW A;  4TR1 A;  3GKX A;  5IPH A;  3D0Z A;  2B3S A;  2GQK A;  1XWC A;  3Q74 A;  3FEU A;  3GH6 A;  2PWJ A;  3IK7 A;  4AJ8 A;  2GS3 A;  1S3D A;  1WJK A;  1E6B A;  3D4M A;  3KEB A;  2JU5 A;  4XTS A;  2GTU A;  1AQX A;  2H74 A;  3W8S A;  2RM6 A;  1UN2 A;  1OVN A;  20GS A;  2J23 A;  2ZUP A;  3HHV A;  1O8W A;  5HR1 A;  4GF0 A;  3DRN A;  1XOB A;  3IXR A;  1Z9H A;  1F37 A;  4MMM A;  3F6F A;  4Z7X A;  2K6V A;  2OE3 A;  2OAC A;  4TR3 A;  3RAZ A;  5IM9 A;  2LNT A;  2H6X A;  2IMF A;  4KGI A;  3LXT A;  5IMZ A;  22GS A;  3CSH A;  4NXI A;  3GUR A;  1VF4 A;  3ERW A;  5IMD A;  2CV4 A;  2PUK C;  4RI6 A;  2OE0 A;  1SKS B;  4MCU A;  1SEN A;  3KH7 A;  4IVF A;  1I5G A;  4WBR D;  2R6K A;  2F8A A;  1K3O A;  2VO4 A;  2YZH A;  2EIR A;  5LCZ A;  2JZT A;  3TJB A;  3A5W A;  5ECP B;  1K0B A;  2FY6 A;  5KN3 A;  5CRE A;  1JLV A;  1U88 A;  3C1R A;  1XPV A;  4O92 A;  1SJI A;  5ECI B;  3SWL A;  4JRR A;  4F9Z A;  1GSQ A;  2HZE A;  1BAY A;  2ZCT A;  3A3T A;  4YH2 A;  3LSZ A;  3E3E A;  3IHQ A;  14GS A;  1FG4 A;  4HZ4 A;  3A2W A;  3VPQ A;  2PVQ A;  4FH8 A;  3VWW A;  2V2G A;  1FVK A;  3KD0 A;  2E2G A;  3N5O A;  1EZK A;  2J9H A;  3EYT A;  1FW1 A;  5DQS A;  2O8V B;  1ZZY A;  3RBT A;  1TXX A;  3DXB A;  1W89 A;  2LRT A;  3ZTL A;  1GTI A;  2HT9 A;  10GS A;  1J0F A;  4ECC A;  4IBP A;  3VUR A;  2LV3 A;  1QK8 A;  2HE3 A;  3GX0 A;  3TUE A;  4KA0 A;  2DLX A;  1F3A A;  1XVQ A;  5IIZ A;  5IOX A;  2GZZ A;  1YKC A;  5DBQ A;  3OR5 A;  4HU9 A;  4V2L A;  2VM1 A;  2E2M A;  3WYW A;  3I69 A;  2DML A;  3IE3 A;  1R26 A;  1FOV A;  1J08 A;  1MEK A;  1ZGN A;  3ZRE A;  1XZO A;  2CZ2 A;  2PVO C;  3MSZ A;  2PPT A;  1OC9 B;  3GN3 A;  3ERG A;  5A4V A;  1Z5Y E;  3VLN A;  3ZYW A;  3VWV A;  4K1F A;  1GP1 A;  12GS A;  2JAC A;  1FB6 A;  2YNX A;  2YN1 A;  4IJ3 A;  4GCI A;  2I9H A;  4RQX A;  3L9U A;  2X8G A;  5AIV A;  4YQV A;  4OMV A;  1JHB A;  3Q18 A;  2OBI A;  1H4O A;  1YY7 A;  3EUR A;  4MK3 A;  4HI7 A;  3VWU A;  1Q98 A;  3ZZX A;  3QCP A;  5B8A A;  5JCG A;  2MMO A;  1G6W A;  4CDO A;  2V6O A;  1HQO A;  3HDC A;  2IMI A;  5IQY A;  1G0T A;  1ERV A;  4LL1 B;  1DUG A;  4DVC A;  1TK0 B;  3IA1 A;  4WEY A;  1C72 A;  3TJF A;  3ZFB A;  4IGJ A;  2VCQ A;  1TRU A;  5E59 A;  1X9M B;  3UBL A;  2GSQ A;  2B5X A;  4IKH A;  3EU3 A;  1HYU A;  5D73 A;  4NV2 A;  1B4Q A;  2B6M A;  4PNF A;  2TRC P;  3APS A;  3PR8 A;  3H1N A;  4ACS A;  3FZ5 A;  4L0W A;  2VL2 A;  1LU4 A;  3MNG A;  4GXZ A;  1A2J A;  4EUY A;  3TRQ A;  1HNB A;  2HNL A;  4LL4 B;  4AF2 A;  2DSA A;  5D93 A;  4FYB A;  5G1K A;  2DMM A;  3UBK A;  4I2T A;  4KDX A;  5HFI A;  4PGT A;  4OO5 A;  3GFK A;  1Z7R A;  2CQ9 A;  3BOA A;  2FNO A;  1GWC A;  3WT2 A;  5IMF A;  2KP2 A;  4DSS B;  2H70 A;  3QOU A;  2H1B A;  1PSQ A;  3DKS A;  2REM A;  1K0O A;  3LEF A;  2P31 A;  3IBH A;  2D2Z A;  2BMX A;  5FT3 A;  4N30 A;  5G5F A;  4MLY A;  2L59 A;  3QR6 A;  2IFQ B;  1O8X A;  2AJQ B;  3H4K A;  1GLQ A;  3M3M A;  3FK8 A;  2LRN A;  3EMX A;  2ES7 A;  4MH3 A;  4N0Z A;  2YOI A;  2C0G A;  1OAZ A;  3QDN A;  3UJ1 A;  4ZBB A;  5C00 A;  1PA3 A;  5JCW A;  3QFB C;  4G2E A;  3GA4 A;  3GUS A;  1XWG A;  1PL1 A;  1TDI A;  2YWI A;  3LYP A;  5E4W A;  5ECS A;  1ILO A;  2O87 A;  2YV9 A;  1V40 A;  4PUF C;  4F0C A;  1EV9 A;  1ERT A;  3PGT A;  2H6Z A;  5G5E A;  5H5S A;  5B6N A;  5A4U A;  5INY A;  1V98 A;  4AJ7 A;  1G6Y A;  2DC5 A;  2AHE A;  1USB A;  3APQ A;  5B7C A;  3UEM A;  2AAW A;  2VL3 A;  3LXZ A;  3GSS A;  5HR3 A;  4NHW A;  4XCS A;  2H75 A;  3Q6O A;  2CAI A;  2RUF A;  5D9V A;  3F63 A;  2HI7 A;  2HLS A;  2NTO A;  5IPG A;  3AY8 A;  1BED A;  1KEB A;  5ELA A;  1XW9 A;  1OC9 A;  1EWX A;  2VD1 A;  5DCG A;  1YDK A;  4XHM A;  4BVY A;  2DJJ A;  3WGD A;  1DE1 A;  1GTU A;  4F0B A;  2OBK A;  3G7Y A;  3NIV A;  1HNC A;  3C71 A;  2HZF A;  3DYR A;  3ERF A;  2NDO A;  4K7N A;  2YJ7 A;  2H0I A;  2X8C A;  2PBJ A;  4XRA A;  2YWO A;  4K7I A;  1SK2 A;  3FZA A;  3GST A;  5DAL B;  2L5L A;  4IP1 A;  1I9D A;  2GST A;  3L9S A;  1JFU A;  5D8I A;  5GSS A;  1SKR B;  1ZMA A;  4O7H A;  1BJX A;  2CX3 A;  2I3Y A;  2IL3 A;  3UVH A;  2C3N A;  3D21 A;  1BG5 A;  4XS4 B;  1A8Y A;  2ON7 A;  1R5P A;  1VF1 A;  2R4V A;  4FYU A;  4TRX A;  1H75 A;  5EPF A;  3EMP A;  3DML A;  3HD5 A;  3ME7 A;  1PD2 1;  1TK5 B;  4IQA A;  4POM A;  2GGT A;  4TR0 A;  2OE1 A;  3NZN A;  2MMN A;  4DSR A;  2FWF A;  2E7P A;  4ECI A;  1PQN A;  4N10 A;  2V41 A;  2A2S A;  4HS1 A;  3RPP A;  2DJ3 A;  3M9K A;  2L6C A;  2FCH A;  2GDR A;  3ZLP A;  5GZZ B;  4DSS A;  3O6T A;  5A4W A;  3CTF A;  2AUV A;  4JR6 A;  2R2J A;  3FKF A;  2B1K A;  2PER A;  8GSS A;  4OCE A;  3F4T A;  5ENU A;  1PL2 A;  5H5R A;  4J56 E;  1T7P B;  3DEX A;  3DVW A;  4MJB A;  3DVX A;  4LMV A;  4OFT A;  4HDE A;  3TJK A;  6GSV A;  2IFQ A;  1SU9 A;  4TOP A;  3D5J A;  3UAP A;  4ECB A;  1K3L A;  1X5E A;  2MMZ A;  3MWH A;  4FO5 A;  3TKS E;  1LBK A;  4IQ1 A;  1MDK A;  2LJA A;  4L0U A;  1A24 A;  3QMX A;  1DBY A;  3EWL A;  1A23 A;  4KDY A;  4BPY A;  3QFA C;  4IHU A;  1J9B A;  1B9Y C;  2IIY A;  1PKZ A;  2JSY A;  2N5A A;  2EIQ A;  4F2I A;  4JZQ A;  4KH7 A;  1GUH A;  1A8L A;  3BJ5 A;  3GKM A;  2HFD A;  4X1U A;  2DIY A;  2HRN A;  2OAD A;  2F9S A;  2VM2 A;  4L8E A;  2GVP A;  5AGY A;  3DWV A;  1A2M A;  3KMO A;  1NW2 A;  2DIZ A;  4E8E A;  1SL1 B;  5ECK B;  5GST A;  2NVL A;  1ZYQ B;  5KN2 A;  2E0Q A;  3D4T A;  4QQ7 A;  2VIM A;  1MD4 A;  4JE1 A;  3GRX A;  4IEL A;  16GS A;  4ISD A;  3FYG A;  4IP6 A;  3DGQ A;  1YKA A;  2A2R A;  5ABR A;  1WPI A;  5ID2 A;  2YAN A;  3HVS A;  4WET A;  1YEP A;  4CW9 A;  2I1U A;  3TKQ A;  2F51 A;  2LQQ A;  4V2M A;  3IAM 2;  4KAE A;  3VFI A;  2JZR A;  3LGC A;  1OC8 A;  1K0A A;  2WDU A;  2DBC A;  2ON5 A;  2PGT A;  2H01 A;  5DAL A;  3CRT A;  2FGX A;  3TKR A;  1Z3E A;  5ELG A;  2HXK A;  1T3B A;  2CVB A;  4KB3 A;  4ULX A;  3GIX A;  4IW9 A;  2WFC A;  1RQM A;  4MPF A;  1K0D A;  3V1W A;  1THX A;  3M0F A;  2ZNM A;  4TVE A;  3KTL A;  4HZ2 A;  4HJM A;  3WGE A;  2KOK A;  4HJ2 A;  3PIN A;  2WJU A;  3O3T A;  3UAR A;  1GUL A;  2VLT A;  1XW6 A;  3CSI A;  4F82 A;  4Q5F A;  3GNJ A;  4GQC A;  3P2A A;  5AIX A;  1TU7 A;  4NHZ A;  4NMU A;  1BX9 A;  1N2A A;  3HCZ A;  4J57 E;  2WRT A;  5F07 A;  2RUE A;  3P7X A;  4EKZ A;  2VUP A;  1UC7 A;  3FR6 A;  1SJZ A;  5H5Q A;  3IV4 A;  2CVD A;  1NHY A;  5CO3 A;  2L5O A;  5J9C A;  3R2Q A;  5ECN B;  5ECR B;  3ZL5 A;  4ZBA A;  3D6I A;  1TRS A;  2K18 A;  3ZML A;  5F05 A;  4LA1 A;  5LNK e;  3QD9 A;  5DQY A;  4DEJ A;  4MP4 A;  1Q4J A;  4AJ6 A;  1GLP A;  4KSO A;  3E9J B;  1QUW A;  2L57 A;  4GLT A;  3O76 A;  3A2V A;  5D96 A;  3I6A A;  2V1M A;  3FR3 A;  4YQU A;  1EOG A;  4PQ1 A;  4GSS A;  3W8J A;  5CRH A;  1PKW A;  5G1L A;  1QQ2 A;  3GKN A;  2X99 A;  3IDV A;  3P8W A;  3F6D A;  5ECO B;  1SYX A;  3F3R A;  2LJR A;  3EE2 A;  2B5Y A;  4PNG A;  4TXV A;  2V6K A;  5L71 A;  1XCC A;  3RHC A;  2GZP A;  2C3T A;  2DJK A;  2O7K A;  4HUA A;  1RK4 A;  1XXU A;  4KW6 A;  4TN8 A;  2BTO T;  2VCV A;  2C0E A;  3UOM A;  4HEA 2;  2L4Q A;  5HR2 A;  1GH2 A;  1THO A;  2YPM A;  3U5R E;  4MDC A;  1JZO A;  3ZIV A;  3NOF A;  3RDW A;  1MDJ A;  3ZFL A;  4PQI A;  2QC7 A;  1X9S B;  3FRC A;  3IR4 A;  1TRV A;  3CBU A;  3D22 A;  3F3Q A;  1XFL A;  2CZ3 A;  1B48 A;  2AYT A;  5IMA A;  2LST A;  3FY7 A;  3VWX A;  4QL7 A;  4KUN A;  5F8B A;  4L5O A;  5B6M A;  3KP9 A;  1B4P A;  4K2D A;  2GQL A;  3KGK A;  3DD3 A;  4CHS A;  4YAV A;  3F4R A;  3TRX A;  4BWQ A;  2L4C A;  1M2B A;  4NAX A;  4TXO B;  1AAZ A;  5J4U A;  2M80 A;  3TCO A;  4GTU A;  4ECJ A;  4Q5N A;  9GSS A;  4WF4 A;  3S9F A;  1YF1 A;  2LKU A;  2LS5 A;  2IWT A;  1SL2 B;  2V32 A;  5DJL A;  4N11 A;  4MAB A;  5EL8 A;  2TRX A;  5F06 A;  2MBS A;  3TOU A;  4ML6 A;  4NWY A;  5HFG A;  4RQR A;  4GST A;  6GSS A;  4ZL7 A;  3VK9 A;  4AGS A;  4K6X A;  2EC4 A;  3L4N A;  2YWN A;  2M46 A;  4MJA A;  3JCM L;  1OC3 A;  3KM6 A;  1OKT A;  5CAX A;  1F9M A;  5HQP A;  1KTE A;  1YEX A;  2JSZ A;  1TRW A;  4Q5R A;  2CAQ A;  1WOU A;  2R3X A;  3FHK A;  3GKK A;  2GT5 A;  4TR4 A;  3W6G A;  4K7O A;  5FHI A;  1OE8 A;  4HU7 A;  1G7O A;  3IPZ A;  1CQG A;  3ZVJ A;  2H19 A;  3CYN A;  4EE0 A;  5ECH B;  2LNS A;  2O89 A;  1R5A A;  4ZXG A;  2H30 A;  2KUC A;  5CP1 A;  1M9B A;  5JWR B;  1GRX A;  1U87 A;  1EEM A;  3HVX A;  5ECM B;  4JED A;  4Q5Q A;  5DJM A;  2VL9 A;  3TJG A;  2VCX A;  3PH9 A;  2WZ9 A;  3APO A;  1ACV A;  1GSS A;  1U3I A;  2XPD A;  1YQ1 A;  3BCK A;  3RHB A;  1T4Z A;  1ZCP A;  2OA7 A;  3I43 A;  3L0H A;  2FD3 A;  1QXH A;  1XVW A;  3EIN A;  4I6X A;  4OO4 A;  3I9V 2;  2F8F A;  4KDU A;  1TP9 A;  2YCD A;  2N5B A;  1GTA A;  4HQZ A;  1AUC A;  1O73 A;  4HQS A;  1EV4 A;  3WGX A;  2LEG A;  1EP7 A;  4G19 A;  2QKE A;  5EY6 A;  1GSU A;  1TK8 B;  3L9V A;  1T00 A;  2WCI A;  1M7T A;  3LQ7 A;  1GL8 A;  2DJ0 A;  4XS1 A;  2WS2 A;  3GTU B;  1AW9 A;  4POK A;  3C73 A;  1GNE A;  4ZL8 A;  3TOT A;  1OYJ A;  4EC0 A;  2PN8 A;  1F6M C;  4D73 B;  5KEJ A;  4MH2 A;  2B7J A;  3HZ8 A;  1TU8 A;  1VF2 A;  2XBQ A;  4KSM A;  2G0F A;  1GSF A;  4TKY A;  3SBC A;  3G9B A;  3UL3 A;  1N8J A;  2G2Q A;  5GAN D;  3J7Y b;  6GST A;  1U6T A;  1Y6E A;  4XS6 A;  4EL1 A;  2KLX A;  2C0D A;  1F3B A;  3CSJ A;  5D9X A;  4QL9 A;  1Z6M A;  3M1G A;  1SL0 B;  3TKS A;  4YAP A;  2RM5 A;  2FUG 2;  3UVT A;  4EXJ A;  1EP8 A;  4G10 A;  1SK1 A;  2CA8 A;  2OJL A;  3QAV A;  3KIJ A;  2FWG A;  3ZIT A;  1IYI A;  18GS A;  4POB A;  1PX7 A;  2XHF A;  1TI1 A;  1PGT A;  3KMN A;  3QAW A;  2DJ1 A;  3M9J A;  3TDG A;  2CX4 A;  1XWB A;  2GSR A;  5CYY A;  5COH A;  4BA7 A;  4HOJ A;  5C04 A;  1QMV A;  1MD3 A;  17GS A;  4GQF A;  1ST9 A;  3LJR A;  5CRG A;  3BCI A;  1ERW A;  2H8L A;  2H1G A;  2IPA A;  2LUS A;  1M0U A;  3TKP A;  6GSX A;  4MZB A;  1R4W A;  2QSI A;  2MYG A;  6GSW A;  4K0G A;  1OKD A;  1GSD A;  3KH9 A;  3MAK A;  3G7J A;  2MBT A;  4FIW A;  2LRC A;  2KHP A;  2C4J A;  2IME A;  4PQH A;  1K0N A;  3GX8 A;  2XBI A;  2LTK A;  3WD6 A;  3TKS C;  1XW5 A;  1S3C A;  1TI3 A;  2BJX A;  1RW1 A;  2MMA A;  1A0R P;  3HY2 A;  1B9X C;  1AQW A;  2KP1 A;  3IRA A;  1V2A A;  1R7H A;  1MDI A;  2C0F A;  4EDZ A;  1DSB A;  5J41 A;  5DCH A;  2H0G A;  4BWS A;  3LFL A;  4PXO A;  2H1A A;  4PX1 A;  5IO0 A;  3N9J A;  4K9Z A;  1ZOF A;  3EU4 A;  4WF5 A;  2H0H A;  5AIS A;  3WT1 A;  2CT6 A;  5AN1 A;  1OE7 A;  3K8N A;  3GL3 A;  3P90 A;  1O81 A;  5CRW A;  2NBS A;  5JCU A;  4TW5 A;  4L5L A;  4DSQ A;  4BVX A;  3CXG A;  1T1V A;  1NSW A;  4ZB9 A;  2AV4 A;  4IJI A;  4ZIL A;  5DAK B;  1XIY A;  3HJM A;  1A2L A;  1M9A A;  5HFK A;  5G30 A;  1GSY A;  3E0U A;  19GS A;  4JBB A;  1SYR A;  4XS4 A;  2TIR A;  2NPB A;  4MF5 A;  4IS0 A;  2XC2 A;  3BD2 A;  2K9F A;  1YJ6 A;  4J2F A;  2WUL A;  1B8X A;  4EVM A;  2JL4 A;  4EF0 A;  2VAF A;  3GTU A;  1ERU A;  1HNA A;  2C8U A;  2H71 A;  1O85 A;  1S3A A;  3H93 A;  3L78 A;  4D73 A;  4X43 A;  2H66 A;  3HXS A;  1PRX A;  2XPE A;  2VCW A;  3TRP A;  1X0R A;  4V1A g;  1GNW A;  4MF7 A;  3MDK A;  3EVI A;  1GSE A;  2ALB A;  1QFN A;  4ILF A;  5HR0 A;  2IMD A;  3A2X A;  1X5C A;  3H8Q A;  1M99 A;  1X5D A;  4I97 A;  1NHO A;  1SJ6 A;  5D9W A;  1FHE A;  3LG6 A;  2YJH A;  2VLV A;  5IMV A;  1AXD A;  1Z6N A;  1FB0 A;  4H86 A;  2LJK A;  2FLS A;  2PMT A;  4RI7 A;  1XWK A;  2HSH A;  1Z7P A;  1GTB A;  4GRF A;  3KJY A;  5IMC A;  5EVO A;  2IJY A;  5J3R A;  1LJR A;  4WBJ A;  4WXT A;  5G2Z A;  1QGV A;  1K0C A;  3US3 A;  1TW9 A;  3DIE A;  2YV7 A;  2RII A;  1G7E A;  2FWE A;  3CRU A;  5J9B A;  3RPN A;  1KNG A;  4MJC A;  4PUA A;  1SD9 A;  3G7I A;  4JU5 A;  2FA8 A;  3HJP A;  1VGL A;  2VOC A;  2H1D A;  4XRD A;  2N5F A;  3KZQ A;  3LWA A;  1MTC A;  1TJD A;  1TTZ A;  2R5G A;  1ZYE A;  3F4S A;  3C1S A;  5LD0 A;  1YZX A;  2YZU A;  3F9U A;  3C7M A;  4NV5 A;  2A4V A;  11GS A;  1M2A A;  4ML1 A;  3ZMK A;  3ED3 A;  2VCT A;  1ABA A;  3GMF A;  1TOF A;  3EC3 A;  1XWA A;  3HKR A;  1E2Y A;  3ME8 A;  4RUV A;  1UVZ A;  4KCA A;  5ECL B;  1WE0 A;  2GLR A;  5CNW A;  4MZW A;  3KCM A;  1VRS D;  5F0G A;  2HSY A;  5JWO B;  2YWM A;  2B7K A;  4ZBD A;  2K8S A;  1URM A;  1IYH A;  5ECQ B;  4WR5 A;  1X9W B;  1CQH A;  4GSN A;  3VI5 A;  3VPT A;  5JWQ B;  4N0V A;  2PU9 C;  5DDL A;  2VD0 A;  3ZRD A;  4I5Q A;  1T8E B;  2FA4 A;  2K8V A;  1XBS A;  3Q19 A;  1AC1 A;  3TGZ A;  5J5N A;  2VLU A;  1AQV A;  4F03 A;  5B8B A;  3LOR A;  1BQ7 A;  5DAK A;  1JZW A;  3UMA A;  1A0F A;  5KN1 A;  2WGR A;  2YP6 A;  1ON4 A;  1VF3 A;  3HA9 A;  7GSS A;  3M8N A;  1FVJ A;  3QAG A;  4V1A p;  1V9W A;  2VL2 C;  4OD7 A;  4EO3 A;  4TR1 B;  3GH9 A;  1AIU A;  1ZL9 A;  3BBY A;  2P5R A;  4O5R A;  1WRY A;  1TKD B;  3ISO A;  1EEJ A;  2FHE A;  4MZC A;  4MF6 A;  2LQO A;  3TB2 A;  4ID0 A;  5G31 A;  2H73 A;  3H79 A;  4WKW A;  1Y25 A;  1PMT A;  3IAS 2;  2H76 A;  1O6J A;  1YF0 A;  13GS A;  3VI7 A;  1WP0 A;  3ZIJ A;  1EOH A;  2EIO A;  4V2N A;  4I2U A;  1SD8 A;  2Z9S A;  2B1L A;  4ZIJ A;  2C1Y A;  2GSS A;  2GT6 A;  2X64 A;  3CTG A;  4LLR A;  2WB9 A;  3U6V A;  2CVK A;  5CRD A;  1T4Y A;  1GUK A;  4GWR A;  1V58 A;  4FYC A;  4MJE A;  2GQM A;  3HYP A;  3GYK A;  4KX4 A;  4E8H A;  1M2D A;  4POL A;  1XOA A;  4KE3 A;  3QPM A;  4I8B A;  5A5K A;  3IC4 A;  1BYE A;  3GV1 A;  1WWJ A;  2I81 A;  3F0I A;  1O7U A;  3GL5 A;  1PN9 A;  2HYX A;  5ID2 B;  4NPB A;  4K0N A;  2H72 A;  2L6D A;  1W4V A;  1WIK A;  5D9T A;  1EGO A;  4IN0 A;  3FZ9 A;  1UA5 A;  4LMW A;  3KXO A;  1ML6 A;  3J7Y k;  2QGV A;  3FR9 A;  1V57 A;  2HZE B;  1U3A A;  1DE2 A;  1FAA A;  3C8E A;  2JAD A;  1JZD A;  2HRF A;  1K3Y A;  2RLI A;  4G9H A;  6GSY A;  1SK0 A;  1GUM A;  6GSU A;  4BL7 A;  2I4A A;  1HD2 A;  3KP8 A;  4OCF A;  4K8M A;  4OFM A;  2R37 A;  2P5Q A;  3FW2 A;  3IOS A;  2GZY A;  4JR4 A;  3F8U A;  4OFN A;  1KBN A;  2IMK A;  4X0X A;  3TJJ A;  5DVB A;  5FWG A;  4ZL9 A;  2MZC A;  2OKA A;  2C3Q A;  4P3Y B;  2M72 A;  2B5E A;  4PUR A;  2H6Y A;  3CMI A;  3LYK A;  3HVV A;  2FWH A;  1NM3 A;  4O32 A;  4MA9 A;  3IK9 A;  4OWY A;  4EDY A;  2JZS A;  2O85 A;  1PX6 A;  2VCZ A;  1WMJ A;  3UIW A;  2F3M A;  1SKW B;  1FO5 A;  3HZ4 A;  3KTB A;  1F2E A;  5KN0 A;  4TXO A;  5IO2 A;  3GHA A;  5GAP D;  2DJ2 A;  4MPG A;  4KCE A;  3ZVJ D;  4ZB6 A;  2IN3 A;  4WR4 A;  4XIH A;  2AB6 A;  4KND A;  5IOW A;  1EGR A;  2P0G A;  2X8H A;  4ZB8 A;  1K0M A;  3HJO A;  1JZR A;  3FZ4 A;  4YQM A;  2C80 A; 
#chains in the Genus database with same CATH topology
 1JLW A;  4TR1 A;  3GKX A;  5IPH A;  3D0Z A;  2B3S A;  2GQK A;  1XWC A;  3Q74 A;  3FEU A;  3GH6 A;  2PWJ A;  3IK7 A;  2X4A A;  4AJ8 A;  2GS3 A;  1S3D A;  1WJK A;  1E6B A;  3D4M A;  3KEB A;  2JU5 A;  4XTS A;  2GTU A;  1AQX A;  2H74 A;  3W8S A;  2RM6 A;  1UN2 A;  1OVN A;  20GS A;  2J23 A;  2ZUP A;  3HHV A;  1O8W A;  5HR1 A;  4GF0 A;  3DRN A;  1XOB A;  3IXR A;  1Z9H A;  3PPU A;  1F37 A;  4MMM A;  3F6F A;  4Z7X A;  2K6V A;  2OE3 A;  2OAC A;  4TR3 A;  3RAZ A;  5IM9 A;  2LNT A;  2H6X A;  2IMF A;  4KGI A;  3LXT A;  5IMZ A;  22GS A;  3CSH A;  4NXI A;  4Z2U A;  3GUR A;  2X49 A;  1VF4 A;  3ERW A;  5IMD A;  2CV4 A;  2PUK C;  4RI6 A;  2OE0 A;  1SKS B;  4MCU A;  1SEN A;  3KH7 A;  4IVF A;  1I5G A;  4WBR D;  2R6K A;  2F8A A;  1K3O A;  2R0C A;  2VO4 A;  2YZH A;  2EIR A;  5LCZ A;  2JZT A;  3TJB A;  3A5W A;  5ECP B;  1K0B A;  2FY6 A;  5KN3 A;  5CRE A;  1JLV A;  1U88 A;  3C1R A;  1XPV A;  4O92 A;  1SJI A;  5ECI B;  3SWL A;  4JRR A;  4F9Z A;  1GSQ A;  4ICY A;  2HZE A;  1BAY A;  2ZCT A;  3A3T A;  4YH2 A;  3LSZ A;  3E3E A;  3IHQ A;  14GS A;  1FG4 A;  4HZ4 A;  3A2W A;  3VPQ A;  2PVQ A;  4FH8 A;  3VWW A;  2V2G A;  1FVK A;  3KD0 A;  2E2G A;  3N5O A;  1EZK A;  2J9H A;  3EYT A;  1FW1 A;  5DQS A;  2O8V B;  1FOH A;  1ZZY A;  3RBT A;  1TXX A;  3DXB A;  1W89 A;  2LRT A;  3ZTL A;  1GTI A;  2HT9 A;  10GS A;  1J0F A;  4ECC A;  4IBP A;  3VUR A;  2LV3 A;  1QK8 A;  2HE3 A;  3GX0 A;  3TUE A;  4KA0 A;  2DLX A;  1F3A A;  1XVQ A;  5IIZ A;  5IOX A;  2GZZ A;  1YKC A;  5DBQ A;  3OR5 A;  4HU9 A;  4V2L A;  2VM1 A;  2E2M A;  3WYW A;  3I69 A;  2DML A;  3IE3 A;  4G0L A;  1R26 A;  1FOV A;  1J08 A;  1MEK A;  1ZGN A;  3ZRE A;  1XZO A;  2CZ2 A;  2PVO C;  3MSZ A;  2A2P A;  2PPT A;  1OC9 B;  3GN3 A;  3R3E A;  3ERG A;  5A4V A;  1Z5Y E;  4BVY B;  3VLN A;  3ZYW A;  3VWV A;  4K1F A;  1GP1 A;  12GS A;  2JAC A;  1FB6 A;  2YNX A;  2YN1 A;  4IJ3 A;  4GCI A;  2I9H A;  4RQX A;  3L9U A;  2X8G A;  5AIV A;  4YQV A;  4OMV A;  1JHB A;  3Q18 A;  2OBI A;  1H4O A;  1YY7 A;  3EUR A;  4MK3 A;  4HI7 A;  3VWU A;  1Q98 A;  3ZZX A;  3QCP A;  5B8A A;  5JCG A;  2MMO A;  1G6W A;  4CDO A;  2V6O A;  1HQO A;  3HDC A;  2IMI A;  5IQY A;  1G0T A;  1ERV A;  4LL1 B;  1DUG A;  4DVC A;  1TK0 B;  3IA1 A;  4WEY A;  1C72 A;  3TJF A;  3ZFB A;  4IGJ A;  2VCQ A;  1TRU A;  5E59 A;  1X9M B;  3UBL A;  2GSQ A;  2B5X A;  4IKH A;  3EU3 A;  1HYU A;  5D73 A;  4NV2 A;  1B4Q A;  2B6M A;  4PNF A;  2TRC P;  3APS A;  3PR8 A;  3H1N A;  4ACS A;  3FZ5 A;  4L0W A;  2VL2 A;  1LU4 A;  3MNG A;  4GXZ A;  1A2J A;  4EUY A;  3TRQ A;  1HNB A;  2HNL A;  4LL4 B;  4AF2 A;  3FMW A;  2DSA A;  5D93 A;  5BMU A;  4FYB A;  5G1K A;  2DMM A;  3UBK A;  4I2T A;  4KDX A;  5HFI A;  4PGT A;  4OO5 A;  3GFK A;  1Z7R A;  2CQ9 A;  3BOA A;  2FNO A;  1GWC A;  3WT2 A;  5IMF A;  2KP2 A;  4DSS B;  2H70 A;  1PN0 A;  3QOU A;  2H1B A;  1PSQ A;  3DKS A;  2REM A;  1K0O A;  1ZYN A;  3LEF A;  2P31 A;  3IBH A;  2D2Z A;  2BMX A;  5FT3 A;  4N30 A;  5G5F A;  4MLY A;  2L59 A;  4BIK A;  3QR6 A;  2IFQ B;  1O8X A;  2AJQ B;  3H4K A;  1GLQ A;  3M3M A;  3FK8 A;  2LRN A;  3EMX A;  2ES7 A;  4MH3 A;  4N0Z A;  2YOI A;  2C0G A;  1OAZ A;  3QDN A;  3UJ1 A;  4ZBB A;  5C00 A;  1PA3 A;  5JCW A;  3QFB C;  4G2E A;  3GA4 A;  3GUS A;  1XWG A;  1PL1 A;  1TDI A;  2YWI A;  3LYP A;  5E4W A;  5ECS A;  1ILO A;  2O87 A;  2YV9 A;  1V40 A;  4PUF C;  4F0C A;  1EV9 A;  1ERT A;  3PGT A;  2H6Z A;  5G5E A;  5H5S A;  5B6N A;  5A4U A;  5INY A;  1V98 A;  4AJ7 A;  1G6Y A;  2DC5 A;  2AHE A;  1USB A;  3APQ A;  5B7C A;  3UEM A;  2AAW A;  4USS A;  2VL3 A;  3LXZ A;  3GSS A;  5HR3 A;  4NHW A;  4XCS A;  2H75 A;  3Q6O A;  2CAI A;  4K5R A;  2RUF A;  5D9V A;  3F63 A;  2HI7 A;  2HLS A;  2NTO A;  5IPG A;  3AY8 A;  1BED A;  1KEB A;  5ELA A;  1XW9 A;  1OC9 A;  1YDK A;  2VD1 A;  1EWX A;  5DCG A;  4XHM A;  4BVY A;  2DJJ A;  3WGD A;  1DE1 A;  1GTU A;  4F0B A;  2OBK A;  3G7Y A;  3NIV A;  1HNC A;  3C71 A;  2HZF A;  3DYR A;  3ERF A;  2NDO A;  4K7N A;  2YJ7 A;  2H0I A;  2X8C A;  2PBJ A;  4XRA A;  2YWO A;  4K7I A;  1SK2 A;  3FZA A;  3GST A;  5DAL B;  2L5L A;  4IP1 A;  1I9D A;  2GST A;  3L9S A;  1JFU A;  5D8I A;  5GSS A;  1SKR B;  1ZMA A;  4O7H A;  1BJX A;  2CX3 A;  2I3Y A;  2IL3 A;  3UVH A;  2C3N A;  3D21 A;  1BG5 A;  4XS4 B;  1A8Y A;  2ON7 A;  1R5P A;  1VF1 A;  4Z2T A;  2R4V A;  4FYU A;  4TRX A;  1H75 A;  5EPF A;  3EMP A;  3DML A;  3HD5 A;  3ME7 A;  1PD2 1;  1TK5 B;  4IQA A;  4POM A;  2GGT A;  4TR0 A;  2OE1 A;  3NZN A;  2MMN A;  4DSR A;  2FWF A;  2E7P A;  4ECI A;  2R0G A;  1PQN A;  4N10 A;  2V41 A;  2A2S A;  4HS1 A;  3RPP A;  2DJ3 A;  3M9K A;  2L6C A;  2FCH A;  2GDR A;  2HSM A;  3ZLP A;  5GZZ B;  4DSS A;  3O6T A;  5A4W A;  3CTF A;  2AUV A;  3IC8 A;  4JR6 A;  2R2J A;  3FKF A;  2B1K A;  2PER A;  8GSS A;  4OCE A;  3F4T A;  5ENU A;  1PL2 A;  5H5R A;  4J56 E;  1T7P B;  3DEX A;  3DVW A;  3LW9 A;  4MJB A;  3DVX A;  4LMV A;  4OFT A;  4HDE A;  3TJK A;  6GSV A;  2IFQ A;  1SU9 A;  4TOP A;  3D5J A;  3UAP A;  4ECB A;  1K3L A;  4K5S A;  1X5E A;  2MMZ A;  3MWH A;  4FO5 A;  3TKS E;  1LBK A;  4IQ1 A;  1MDK A;  2LJA A;  4L0U A;  1A24 A;  3QMX A;  1DBY A;  3EWL A;  1A23 A;  4KDY A;  4BPY A;  3QFA C;  4IHU A;  1J9B A;  1B9Y C;  2IIY A;  1PKZ A;  2JSY A;  4MNN A;  2N5A A;  2EIQ A;  4F2I A;  4JZQ A;  4KH7 A;  1GUH A;  1A8L A;  3BJ5 A;  2DKH A;  3GKM A;  2HFD A;  4X1U A;  2DIY A;  2HRN A;  2OAD A;  2F9S A;  2VM2 A;  4L8E A;  2GVP A;  5AGY A;  1M3I A;  3DWV A;  1A2M A;  3KMO A;  1NW2 A;  1M3J A;  2DIZ A;  4E8E A;  1SL1 B;  5ECK B;  5GST A;  2NVL A;  1ZYQ B;  5KN2 A;  2E0Q A;  3D4T A;  4QQ7 A;  2VIM A;  1MD4 A;  4JE1 A;  3GRX A;  4IEL A;  16GS A;  4ISD A;  3FYG A;  4A5P A;  4IP6 A;  3DGQ A;  1YKA A;  2A2R A;  5ABR A;  1WPI A;  5ID2 A;  2YAN A;  3HVS A;  4WET A;  1YEP A;  5KOW A;  4CW9 A;  2I1U A;  3TKQ A;  2F51 A;  1XG8 A;  2LQQ A;  4V2M A;  3IAM 2;  4KAE A;  3VFI A;  2JZR A;  3LGC A;  1OC8 A;  1K0A A;  2WDU A;  2DBC A;  2ON5 A;  2PGT A;  2H01 A;  5DAL A;  3CRT A;  2FGX A;  3TKR A;  1Z3E A;  5ELG A;  2HXK A;  1T3B A;  2CVB A;  4KB3 A;  4ULX A;  3GIX A;  4IW9 A;  2WFC A;  1RQM A;  4MPF A;  1K0D A;  3V1W A;  1THX A;  3M0F A;  2ZNM A;  4TVE A;  3KTL A;  4HZ2 A;  4HJM A;  3WGE A;  2KOK A;  4HJ2 A;  3PIN A;  2WJU A;  3O3T A;  3UAR A;  1GUL A;  2VLT A;  1XW6 A;  3CSI A;  4F82 A;  4Q5F A;  3GNJ A;  4GQC A;  3P2A A;  5AIX A;  1TU7 A;  4NHZ A;  4NMU A;  1BX9 A;  1N2A A;  3HCZ A;  4J57 E;  2WRT A;  5F07 A;  2RUE A;  3P7X A;  4EKZ A;  2VUP A;  1UC7 A;  3FR6 A;  1SJZ A;  5H5Q A;  3IV4 A;  2CVD A;  1NHY A;  5CO3 A;  2L5O A;  5J9C A;  3R2Q A;  5ECN B;  5ECR B;  3ZL5 A;  2DKI A;  4ZBA A;  3D6I A;  1TRS A;  2K18 A;  3ZML A;  5F05 A;  4LA1 A;  5LNK e;  3QD9 A;  5DQY A;  4DEJ A;  4MP4 A;  1Q4J A;  4AJ6 A;  1GLP A;  4KSO A;  3E9J B;  1QUW A;  2L57 A;  4GLT A;  3O76 A;  4CY8 A;  3A2V A;  5D96 A;  3I6A A;  2V1M A;  3FR3 A;  4YQU A;  1EOG A;  4PQ1 A;  4GSS A;  3W8J A;  5CRH A;  1PKW A;  3MIX A;  5G1L A;  1QQ2 A;  4HSC X;  3GKN A;  2X99 A;  3IDV A;  3A5I A;  3P8W A;  3F6D A;  5ECO B;  1SYX A;  3F3R A;  2LJR A;  3EE2 A;  2B5Y A;  4PNG A;  4TXV A;  2V6K A;  5L71 A;  1XCC A;  3RHC A;  2GZP A;  2C3T A;  2DJK A;  2O7K A;  4HUA A;  1RK4 A;  1XXU A;  4KW6 A;  4G0I A;  4TN8 A;  2BTO T;  2VCV A;  2C0E A;  3UOM A;  1PFO A;  4HEA 2;  2L4Q A;  5HR2 A;  1GH2 A;  1THO A;  2YPM A;  3U5R E;  4MDC A;  1JZO A;  3ZIV A;  3NOF A;  3RDW A;  1MDJ A;  3ZFL A;  2QA2 A;  4PQI A;  2QC7 A;  1X9S B;  3FRC A;  3IR4 A;  1TRV A;  3CBU A;  3D22 A;  3F3Q A;  1XFL A;  2CZ3 A;  1B48 A;  2AYT A;  5IMA A;  2LST A;  3FY7 A;  3VWX A;  4QL7 A;  4KUN A;  5F8B A;  4L5O A;  5B6M A;  3KP9 A;  1B4P A;  4K2D A;  2GQL A;  3KGK A;  3DD3 A;  4CHS A;  4YAV A;  3F4R A;  3TRX A;  4BWQ A;  2L4C A;  1M2B A;  4NAX A;  4TXO B;  1AAZ A;  5J4U A;  2M80 A;  3TCO A;  4GTU A;  4ECJ A;  4Q5N A;  9GSS A;  4WF4 A;  3S9F A;  1YF1 A;  2LKU A;  2LS5 A;  2IWT A;  1SL2 B;  2V32 A;  5DJL A;  2QA1 A;  4N11 A;  4MAB A;  5EL8 A;  3MYD A;  2TRX A;  5F06 A;  2MBS A;  3TOU A;  4ML6 A;  4NWY A;  5HFG A;  4RQR A;  4GST A;  6GSS A;  4ZL7 A;  3VK9 A;  4AGS A;  4K6X A;  2EC4 A;  3L4N A;  2YWN A;  2M46 A;  4MJA A;  3JCM L;  1OC3 A;  3KM6 A;  1OKT A;  5CAX A;  1F9M A;  5HQP A;  1KTE A;  1YEX A;  4K2X A;  2JSZ A;  1TRW A;  4Q5R A;  2CAQ A;  1WOU A;  2R3X A;  4Z2R A;  3FHK A;  3GKK A;  2GT5 A;  4TR4 A;  3W6G A;  4K7O A;  5FHI A;  1OE8 A;  4HU7 A;  1G7O A;  3IPZ A;  1CQG A;  3ZVJ A;  2H19 A;  3CYN A;  4EE0 A;  5ECH B;  2LNS A;  2O89 A;  1R5A A;  4ZXG A;  2H30 A;  2KUC A;  5CP1 A;  1M9B A;  5JWR B;  1GRX A;  1U87 A;  1EEM A;  3HVX A;  5ECM B;  4JED A;  4Q5Q A;  5DJM A;  2VL9 A;  3TJG A;  2VCX A;  3PH9 A;  2WZ9 A;  3APO A;  1ACV A;  1GSS A;  1U3I A;  2XPD A;  1YQ1 A;  3BCK A;  3RHB A;  4BVX B;  1T4Z A;  1ZCP A;  2OA7 A;  3I43 A;  3L0H A;  2FD3 A;  1QXH A;  1XVW A;  3EIN A;  4I6X A;  4OO4 A;  3I9V 2;  2F8F A;  4KDU A;  1TP9 A;  2YCD A;  2N5B A;  1GTA A;  4HQZ A;  1AUC A;  1O73 A;  4HQS A;  1EV4 A;  3WGX A;  1S3R A;  2LEG A;  1EP7 A;  4G19 A;  5BRT A;  2QKE A;  5EY6 A;  1GSU A;  1TK8 B;  1ZYP A;  3L9V A;  1T00 A;  2WCI A;  1M7T A;  3LQ7 A;  1GL8 A;  2DJ0 A;  4XS1 A;  2WS2 A;  3GTU B;  1AW9 A;  4POK A;  3C73 A;  1GNE A;  4ZL8 A;  3TOT A;  1OYJ A;  4EC0 A;  2PN8 A;  1F6M C;  4D73 B;  5KEJ A;  4MH2 A;  2B7J A;  3HZ8 A;  1TU8 A;  1VF2 A;  4CY6 A;  2XBQ A;  4KSM A;  2G0F A;  1GSF A;  4TKY A;  3SBC A;  3G9B A;  3UL3 A;  1N8J A;  2G2Q A;  5GAN D;  3J7Y b;  6GST A;  1U6T A;  1Y6E A;  4XS6 A;  4EL1 A;  2KLX A;  2C0D A;  1F3B A;  3CSJ A;  5D9X A;  4QL9 A;  1Z6M A;  3M1G A;  1SL0 B;  3TKS A;  4YAP A;  2RM5 A;  2FUG 2;  3UVT A;  4EXJ A;  1EP8 A;  4G10 A;  1SK1 A;  2CA8 A;  2OJL A;  3QAV A;  3KIJ A;  2FWG A;  3ZIT A;  1IYI A;  18GS A;  4POB A;  1PX7 A;  2XHF A;  1TI1 A;  1PGT A;  3KMN A;  3QAW A;  2DJ1 A;  3M9J A;  3TDG A;  2CX4 A;  1XWB A;  2GSR A;  5CYY A;  5COH A;  3IHG A;  4BA7 A;  4HOJ A;  5C04 A;  1QMV A;  1MD3 A;  17GS A;  4GQF A;  4FQU A;  1ST9 A;  3LJR A;  5CRG A;  3BCI A;  1ERW A;  2H8L A;  2H1G A;  2IPA A;  2LUS A;  1M0U A;  3TKP A;  6GSX A;  4MZB A;  1R4W A;  2QSI A;  2MYG A;  6GSW A;  2HRK A;  4K0G A;  1OKD A;  1GSD A;  3KH9 A;  3MAK A;  3G7J A;  2MBT A;  4FIW A;  2LRC A;  2KHP A;  2C4J A;  2IME A;  4PQH A;  1K0N A;  3GX8 A;  2XBI A;  2LTK A;  3WD6 A;  3TKS C;  1XW5 A;  1S3C A;  1TI3 A;  2BJX A;  1RW1 A;  2MMA A;  1A0R P;  3HY2 A;  1B9X C;  1AQW A;  2KP1 A;  3IRA A;  1V2A A;  1R7H A;  1MDI A;  2C0F A;  4EDZ A;  1DSB A;  5J41 A;  5DCH A;  2H0G A;  4BWS A;  3LFL A;  4PXO A;  2H1A A;  4PX1 A;  5IO0 A;  3N9J A;  4K9Z A;  1ZOF A;  3EU4 A;  4WF5 A;  2H0H A;  5AIS A;  3WT1 A;  2CT6 A;  1OE7 A;  5AN1 A;  3K8N A;  3GL3 A;  3P90 A;  1O81 A;  5CRW A;  2NBS A;  5JCU A;  4TW5 A;  4L5L A;  4DSQ A;  4BVX A;  3CXG A;  1T1V A;  1NSW A;  4ZB9 A;  2AV4 A;  4IJI A;  4ZIL A;  5DAK B;  1XIY A;  3HJM A;  1A2L A;  1M9A A;  5HFK A;  5G30 A;  1GSY A;  3E0U A;  19GS A;  4JBB A;  1SYR A;  4XS4 A;  2TIR A;  4O5U A;  2NPB A;  4MF5 A;  4IS0 A;  2XC2 A;  3BD2 A;  2K9F A;  1YJ6 A;  4J2F A;  2WUL A;  1B8X A;  4EVM A;  2JL4 A;  4EF0 A;  2VAF A;  3GTU A;  1ERU A;  1HNA A;  2C8U A;  2H71 A;  1O85 A;  1S3A A;  3H93 A;  3L78 A;  4D73 A;  4X43 A;  2H66 A;  3HXS A;  1PRX A;  2XPE A;  2VCW A;  3TRP A;  1X0R A;  4V1A g;  1GNW A;  4MF7 A;  4X4J A;  3MDK A;  3EVI A;  1GSE A;  2ALB A;  1QFN A;  4ILF A;  5HR0 A;  2IMD A;  3A2X A;  1X5C A;  4YKF A;  3H8Q A;  1M99 A;  1X5D A;  4I97 A;  1NHO A;  1SJ6 A;  5D9W A;  1FHE A;  3LG6 A;  2YJH A;  2VLV A;  5IMV A;  1AXD A;  1Z6N A;  1FB0 A;  4H86 A;  2LJK A;  2FLS A;  2PMT A;  4RI7 A;  1XWK A;  2HSH A;  1Z7P A;  1GTB A;  4GRF A;  3KJY A;  5IMC A;  5EVO A;  2IJY A;  5J3R A;  1LJR A;  4WBJ A;  4WXT A;  5G2Z A;  1QGV A;  1K0C A;  3US3 A;  1TW9 A;  3DIE A;  2YV7 A;  2RII A;  1G7E A;  2FWE A;  3CRU A;  2UZ8 A;  5J9B A;  3RPN A;  1KNG A;  4MJC A;  4PUA A;  1SD9 A;  4O5Q A;  3G7I A;  4JU5 A;  2FA8 A;  3HJP A;  1VGL A;  2VOC A;  3HVN A;  2H1D A;  4XRD A;  2N5F A;  3KZQ A;  3LWA A;  1MTC A;  1TJD A;  1TTZ A;  2R5G A;  1ZYE A;  3F4S A;  2A4H A;  3C1S A;  5LD0 A;  5KOX A;  1YZX A;  2YZU A;  3F9U A;  3C7M A;  4BL7 B;  4NV5 A;  2A4V A;  11GS A;  1M2A A;  4ML1 A;  3ZMK A;  3ED3 A;  2VCT A;  1ABA A;  3GMF A;  1TOF A;  3EC3 A;  1XWA A;  3HKR A;  1E2Y A;  3ME8 A;  4RUV A;  1UVZ A;  4KCA A;  5ECL B;  1WE0 A;  2GLR A;  5CNW A;  4MZW A;  3KCM A;  1VRS D;  5F0G A;  2HSY A;  5JWO B;  2YWM A;  2B7K A;  4ZBD A;  4G0K A;  2K8S A;  1URM A;  1IYH A;  5ECQ B;  4WR5 A;  1X9W B;  1CQH A;  4GSN A;  3VI5 A;  3VPT A;  5JWQ B;  4N0V A;  4PTS A;  2PU9 C;  5DDL A;  4YKG A;  2VD0 A;  3ZRD A;  4I5Q A;  1T8E B;  2FA4 A;  2K8V A;  1XBS A;  3Q19 A;  1AC1 A;  3TGZ A;  5J5N A;  2VLU A;  1AQV A;  4F03 A;  5B8B A;  3LOR A;  1BQ7 A;  5DAK A;  1JZW A;  3UMA A;  1A0F A;  5KN1 A;  2WGR A;  2YP6 A;  1ON4 A;  1VF3 A;  3HA9 A;  2HRA A;  7GSS A;  3M8N A;  1FVJ A;  3QAG A;  4V1A p;  1V9W A;  2VL2 C;  4OD7 A;  4EO3 A;  4TR1 B;  3GH9 A;  1AIU A;  1ZL9 A;  3BBY A;  2P5R A;  4O5R A;  1WRY A;  1TKD B;  3ISO A;  1EEJ A;  2FHE A;  4MZC A;  4MF6 A;  3EPT A;  2LQO A;  3TB2 A;  4ID0 A;  5G31 A;  2H73 A;  3H79 A;  4WKW A;  1Y25 A;  1PMT A;  3IAS 2;  2H76 A;  1O6J A;  1YF0 A;  13GS A;  3VI7 A;  1WP0 A;  3ZIJ A;  1EOH A;  2EIO A;  4V2N A;  4I2U A;  2R0P A;  1SD8 A;  2Z9S A;  2B1L A;  4ZIJ A;  2C1Y A;  2GSS A;  2GT6 A;  2X64 A;  3CTG A;  4LLR A;  3CQF A;  2WB9 A;  3U6V A;  2CVK A;  5CRD A;  1T4Y A;  1GUK A;  4GWR A;  1V58 A;  4FYC A;  4MJE A;  2GQM A;  3HYP A;  3GYK A;  4KX4 A;  4E8H A;  1M2D A;  4POL A;  1XOA A;  4KE3 A;  4KF9 A;  3QPM A;  4I8B A;  5A5K A;  3IC4 A;  1BYE A;  3GV1 A;  1WWJ A;  2I81 A;  3F0I A;  1O7U A;  3GL5 A;  1PN9 A;  2HYX A;  5ID2 B;  4NPB A;  4K0N A;  2H72 A;  2L6D A;  1W4V A;  1WIK A;  5D9T A;  1EGO A;  4IN0 A;  3FZ9 A;  1UA5 A;  4LMW A;  3KXO A;  1ML6 A;  3J7Y k;  2QGV A;  3FR9 A;  1V57 A;  2HZE B;  1U3A A;  1DE2 A;  1FAA A;  3C8E A;  2JAD A;  1JZD A;  2HRF A;  1K3Y A;  2RLI A;  4G9H A;  6GSY A;  1SK0 A;  1GUM A;  6GSU A;  4BL7 A;  2I4A A;  1HD2 A;  3KP8 A;  4EIQ A;  4OCF A;  4K8M A;  4OFM A;  2R37 A;  2P5Q A;  3FW2 A;  3IOS A;  2GZY A;  4JR4 A;  3F8U A;  4OFN A;  1KBN A;  2IMK A;  4X0X A;  3TJJ A;  5DVB A;  5FWG A;  4ZL9 A;  2MZC A;  2OKA A;  2C3Q A;  4P3Y B;  2M72 A;  2B5E A;  4PUR A;  2H6Y A;  3CMI A;  3LYK A;  3HVV A;  2FWH A;  1NM3 A;  4O32 A;  4MA9 A;  3IK9 A;  4OWY A;  4EDY A;  2JZS A;  2O85 A;  1PX6 A;  2VCZ A;  1WMJ A;  3UIW A;  2F3M A;  1SKW B;  1FO5 A;  3HZ4 A;  3KTB A;  1F2E A;  5KN0 A;  4TXO A;  5IO2 A;  3GHA A;  4EIP A;  5GAP D;  2DJ2 A;  4MPG A;  4KCE A;  3ZVJ D;  4ZB6 A;  2IN3 A;  4WR4 A;  4XIH A;  2AB6 A;  4KND A;  5IOW A;  1EGR A;  2P0G A;  2X8H A;  4ZB8 A;  1K0M A;  3HJO A;  1JZR A;  3FZ4 A;  4YQM A;  2C80 A; 
#chains in the Genus database with same CATH homology
 1JLW A;  4TR1 A;  3GKX A;  5IPH A;  3D0Z A;  2B3S A;  2GQK A;  1XWC A;  3Q74 A;  3FEU A;  3GH6 A;  2PWJ A;  3IK7 A;  2X4A A;  4AJ8 A;  2GS3 A;  1S3D A;  1WJK A;  1E6B A;  3D4M A;  3KEB A;  2JU5 A;  4XTS A;  2GTU A;  1AQX A;  2H74 A;  3W8S A;  2RM6 A;  1UN2 A;  1OVN A;  20GS A;  2J23 A;  2ZUP A;  3HHV A;  1O8W A;  5HR1 A;  4GF0 A;  3DRN A;  1XOB A;  3IXR A;  1Z9H A;  3PPU A;  1F37 A;  4MMM A;  3F6F A;  4Z7X A;  2K6V A;  2OE3 A;  2OAC A;  4TR3 A;  3RAZ A;  5IM9 A;  2LNT A;  2H6X A;  2IMF A;  4KGI A;  3LXT A;  5IMZ A;  22GS A;  3CSH A;  4NXI A;  4Z2U A;  3GUR A;  2X49 A;  1VF4 A;  3ERW A;  5IMD A;  2CV4 A;  2PUK C;  4RI6 A;  2OE0 A;  1SKS B;  4MCU A;  1SEN A;  3KH7 A;  4IVF A;  1I5G A;  4WBR D;  2R6K A;  2F8A A;  1K3O A;  2R0C A;  2VO4 A;  2YZH A;  2EIR A;  5LCZ A;  2JZT A;  3TJB A;  3A5W A;  5ECP B;  1K0B A;  2FY6 A;  5KN3 A;  5CRE A;  1JLV A;  1U88 A;  3C1R A;  1XPV A;  4O92 A;  1SJI A;  5ECI B;  3SWL A;  4JRR A;  4F9Z A;  1GSQ A;  4ICY A;  2HZE A;  1BAY A;  2ZCT A;  3A3T A;  4YH2 A;  3LSZ A;  3E3E A;  3IHQ A;  14GS A;  1FG4 A;  4HZ4 A;  3A2W A;  3VPQ A;  2PVQ A;  4FH8 A;  3VWW A;  2V2G A;  1FVK A;  3KD0 A;  2E2G A;  3N5O A;  1EZK A;  2J9H A;  3EYT A;  1FW1 A;  5DQS A;  2O8V B;  1FOH A;  1ZZY A;  3RBT A;  1TXX A;  3DXB A;  1W89 A;  2LRT A;  3ZTL A;  1GTI A;  2HT9 A;  10GS A;  1J0F A;  4ECC A;  4IBP A;  3VUR A;  2LV3 A;  1QK8 A;  2HE3 A;  3GX0 A;  3TUE A;  4KA0 A;  2DLX A;  1F3A A;  1XVQ A;  5IIZ A;  5IOX A;  2GZZ A;  1YKC A;  5DBQ A;  3OR5 A;  4HU9 A;  4V2L A;  2VM1 A;  2E2M A;  3WYW A;  3I69 A;  2DML A;  3IE3 A;  4G0L A;  1R26 A;  1FOV A;  1J08 A;  1MEK A;  1ZGN A;  3ZRE A;  1XZO A;  2CZ2 A;  2PVO C;  3MSZ A;  2A2P A;  2PPT A;  1OC9 B;  3GN3 A;  3R3E A;  3ERG A;  5A4V A;  1Z5Y E;  4BVY B;  3VLN A;  3ZYW A;  3VWV A;  4K1F A;  1GP1 A;  12GS A;  2JAC A;  1FB6 A;  2YNX A;  2YN1 A;  4IJ3 A;  4GCI A;  2I9H A;  4RQX A;  3L9U A;  2X8G A;  5AIV A;  4YQV A;  4OMV A;  1JHB A;  3Q18 A;  2OBI A;  1H4O A;  1YY7 A;  3EUR A;  4MK3 A;  4HI7 A;  3VWU A;  1Q98 A;  3ZZX A;  3QCP A;  5B8A A;  5JCG A;  2MMO A;  1G6W A;  4CDO A;  2V6O A;  1HQO A;  3HDC A;  2IMI A;  5IQY A;  1G0T A;  1ERV A;  4LL1 B;  1DUG A;  4DVC A;  1TK0 B;  3IA1 A;  4WEY A;  1C72 A;  3TJF A;  3ZFB A;  4IGJ A;  2VCQ A;  1TRU A;  5E59 A;  1X9M B;  3UBL A;  2GSQ A;  2B5X A;  4IKH A;  3EU3 A;  1HYU A;  5D73 A;  4NV2 A;  1B4Q A;  2B6M A;  4PNF A;  2TRC P;  3APS A;  3PR8 A;  3H1N A;  4ACS A;  3FZ5 A;  4L0W A;  2VL2 A;  1LU4 A;  3MNG A;  4GXZ A;  1A2J A;  4EUY A;  3TRQ A;  1HNB A;  2HNL A;  4LL4 B;  4AF2 A;  3FMW A;  2DSA A;  5D93 A;  5BMU A;  4FYB A;  5G1K A;  2DMM A;  3UBK A;  4I2T A;  4KDX A;  5HFI A;  4PGT A;  4OO5 A;  3GFK A;  1Z7R A;  2CQ9 A;  3BOA A;  2FNO A;  1GWC A;  3WT2 A;  5IMF A;  2KP2 A;  4DSS B;  2H70 A;  1PN0 A;  3QOU A;  2H1B A;  1PSQ A;  3DKS A;  2REM A;  1K0O A;  1ZYN A;  3LEF A;  2P31 A;  3IBH A;  2D2Z A;  2BMX A;  5FT3 A;  4N30 A;  5G5F A;  4MLY A;  2L59 A;  3QR6 A;  2IFQ B;  1O8X A;  2AJQ B;  3H4K A;  1GLQ A;  3M3M A;  3FK8 A;  2LRN A;  3EMX A;  2ES7 A;  4MH3 A;  4N0Z A;  2YOI A;  2C0G A;  1OAZ A;  3QDN A;  3UJ1 A;  4ZBB A;  5C00 A;  1PA3 A;  5JCW A;  3QFB C;  4G2E A;  3GA4 A;  3GUS A;  1XWG A;  1PL1 A;  1TDI A;  2YWI A;  3LYP A;  5E4W A;  5ECS A;  1ILO A;  2O87 A;  2YV9 A;  1V40 A;  4PUF C;  4F0C A;  1EV9 A;  1ERT A;  3PGT A;  2H6Z A;  5G5E A;  5H5S A;  5B6N A;  5A4U A;  5INY A;  1V98 A;  4AJ7 A;  1G6Y A;  2DC5 A;  2AHE A;  1USB A;  3APQ A;  5B7C A;  3UEM A;  2AAW A;  4USS A;  2VL3 A;  3LXZ A;  3GSS A;  5HR3 A;  4NHW A;  4XCS A;  2H75 A;  3Q6O A;  2CAI A;  4K5R A;  2RUF A;  5D9V A;  3F63 A;  2HI7 A;  2HLS A;  2NTO A;  5IPG A;  3AY8 A;  1BED A;  1KEB A;  5ELA A;  1XW9 A;  1OC9 A;  1EWX A;  2VD1 A;  1YDK A;  5DCG A;  4XHM A;  4BVY A;  2DJJ A;  3WGD A;  1DE1 A;  1GTU A;  4F0B A;  2OBK A;  3G7Y A;  3NIV A;  1HNC A;  3C71 A;  2HZF A;  3DYR A;  3ERF A;  2NDO A;  4K7N A;  2YJ7 A;  2H0I A;  2X8C A;  2PBJ A;  4XRA A;  2YWO A;  4K7I A;  1SK2 A;  3FZA A;  3GST A;  5DAL B;  2L5L A;  4IP1 A;  1I9D A;  2GST A;  3L9S A;  1JFU A;  5D8I A;  5GSS A;  1SKR B;  1ZMA A;  4O7H A;  1BJX A;  2CX3 A;  2I3Y A;  2IL3 A;  3UVH A;  2C3N A;  3D21 A;  1BG5 A;  4XS4 B;  1A8Y A;  2ON7 A;  1R5P A;  1VF1 A;  4Z2T A;  2R4V A;  4FYU A;  4TRX A;  1H75 A;  5EPF A;  3EMP A;  3DML A;  3HD5 A;  3ME7 A;  1PD2 1;  1TK5 B;  4IQA A;  4POM A;  2GGT A;  4TR0 A;  2OE1 A;  3NZN A;  2MMN A;  4DSR A;  2FWF A;  2E7P A;  4ECI A;  2R0G A;  1PQN A;  4N10 A;  2V41 A;  2A2S A;  4HS1 A;  3RPP A;  2DJ3 A;  3M9K A;  2L6C A;  2FCH A;  2GDR A;  2HSM A;  3ZLP A;  5GZZ B;  4DSS A;  3O6T A;  5A4W A;  3CTF A;  2AUV A;  3IC8 A;  4JR6 A;  2R2J A;  3FKF A;  2B1K A;  2PER A;  8GSS A;  4OCE A;  3F4T A;  5ENU A;  1PL2 A;  5H5R A;  4J56 E;  1T7P B;  3DEX A;  3DVW A;  3LW9 A;  4MJB A;  3DVX A;  4LMV A;  4OFT A;  4HDE A;  3TJK A;  6GSV A;  2IFQ A;  1SU9 A;  4TOP A;  3D5J A;  3UAP A;  4ECB A;  1K3L A;  4K5S A;  1X5E A;  2MMZ A;  3MWH A;  4FO5 A;  3TKS E;  1LBK A;  4IQ1 A;  1MDK A;  2LJA A;  4L0U A;  1A24 A;  3QMX A;  1DBY A;  3EWL A;  1A23 A;  4KDY A;  4BPY A;  3QFA C;  4IHU A;  1J9B A;  1B9Y C;  2IIY A;  1PKZ A;  2JSY A;  4MNN A;  2N5A A;  2EIQ A;  4F2I A;  4JZQ A;  4KH7 A;  1GUH A;  1A8L A;  3BJ5 A;  2DKH A;  3GKM A;  2HFD A;  4X1U A;  2DIY A;  2HRN A;  2OAD A;  2F9S A;  2VM2 A;  4L8E A;  2GVP A;  5AGY A;  3DWV A;  1A2M A;  3KMO A;  1NW2 A;  2DIZ A;  4E8E A;  1SL1 B;  5ECK B;  5GST A;  2NVL A;  1ZYQ B;  5KN2 A;  2E0Q A;  3D4T A;  4QQ7 A;  2VIM A;  1MD4 A;  4JE1 A;  3GRX A;  4IEL A;  16GS A;  4ISD A;  3FYG A;  4A5P A;  4IP6 A;  3DGQ A;  1YKA A;  2A2R A;  5ABR A;  1WPI A;  5ID2 A;  2YAN A;  3HVS A;  4WET A;  1YEP A;  5KOW A;  4CW9 A;  2I1U A;  3TKQ A;  2F51 A;  2LQQ A;  4V2M A;  3IAM 2;  4KAE A;  3VFI A;  2JZR A;  3LGC A;  1OC8 A;  1K0A A;  2WDU A;  2DBC A;  2ON5 A;  2PGT A;  2H01 A;  5DAL A;  3CRT A;  2FGX A;  3TKR A;  1Z3E A;  5ELG A;  2HXK A;  1T3B A;  2CVB A;  4KB3 A;  4ULX A;  3GIX A;  4IW9 A;  2WFC A;  1RQM A;  4MPF A;  1K0D A;  3V1W A;  1THX A;  3M0F A;  2ZNM A;  4TVE A;  3KTL A;  4HZ2 A;  4HJM A;  3WGE A;  2KOK A;  4HJ2 A;  3PIN A;  2WJU A;  3O3T A;  3UAR A;  1GUL A;  2VLT A;  1XW6 A;  3CSI A;  4F82 A;  4Q5F A;  3GNJ A;  4GQC A;  3P2A A;  5AIX A;  1TU7 A;  4NHZ A;  4NMU A;  1BX9 A;  1N2A A;  3HCZ A;  4J57 E;  2WRT A;  5F07 A;  2RUE A;  3P7X A;  4EKZ A;  2VUP A;  1UC7 A;  3FR6 A;  1SJZ A;  5H5Q A;  3IV4 A;  2CVD A;  1NHY A;  5CO3 A;  2L5O A;  5J9C A;  3R2Q A;  5ECN B;  5ECR B;  3ZL5 A;  2DKI A;  4ZBA A;  3D6I A;  1TRS A;  2K18 A;  3ZML A;  5F05 A;  4LA1 A;  5LNK e;  3QD9 A;  5DQY A;  4DEJ A;  4MP4 A;  1Q4J A;  4AJ6 A;  1GLP A;  4KSO A;  3E9J B;  1QUW A;  2L57 A;  4GLT A;  3O76 A;  4CY8 A;  3A2V A;  5D96 A;  3I6A A;  2V1M A;  3FR3 A;  4YQU A;  1EOG A;  4PQ1 A;  4GSS A;  3W8J A;  5CRH A;  1PKW A;  3MIX A;  5G1L A;  1QQ2 A;  3GKN A;  2X99 A;  3IDV A;  3A5I A;  3P8W A;  3F6D A;  5ECO B;  1SYX A;  3F3R A;  2LJR A;  3EE2 A;  2B5Y A;  4PNG A;  4TXV A;  2V6K A;  5L71 A;  1XCC A;  3RHC A;  2GZP A;  2C3T A;  2DJK A;  2O7K A;  4HUA A;  1RK4 A;  1XXU A;  4KW6 A;  4G0I A;  4TN8 A;  2BTO T;  2VCV A;  2C0E A;  3UOM A;  4HEA 2;  2L4Q A;  5HR2 A;  1GH2 A;  1THO A;  2YPM A;  3U5R E;  4MDC A;  1JZO A;  3ZIV A;  3NOF A;  3RDW A;  1MDJ A;  3ZFL A;  2QA2 A;  4PQI A;  2QC7 A;  1X9S B;  3FRC A;  3IR4 A;  1TRV A;  3CBU A;  3D22 A;  3F3Q A;  1XFL A;  2CZ3 A;  1B48 A;  2AYT A;  5IMA A;  2LST A;  3FY7 A;  3VWX A;  4QL7 A;  4KUN A;  5F8B A;  4L5O A;  5B6M A;  3KP9 A;  1B4P A;  4K2D A;  2GQL A;  3KGK A;  3DD3 A;  4CHS A;  4YAV A;  3F4R A;  3TRX A;  4BWQ A;  2L4C A;  1M2B A;  4NAX A;  4TXO B;  1AAZ A;  5J4U A;  2M80 A;  3TCO A;  4GTU A;  4ECJ A;  4Q5N A;  9GSS A;  4WF4 A;  3S9F A;  1YF1 A;  2LKU A;  2LS5 A;  2IWT A;  1SL2 B;  2V32 A;  5DJL A;  2QA1 A;  4N11 A;  4MAB A;  5EL8 A;  3MYD A;  2TRX A;  5F06 A;  2MBS A;  3TOU A;  4ML6 A;  4NWY A;  5HFG A;  4RQR A;  4GST A;  6GSS A;  4ZL7 A;  3VK9 A;  4AGS A;  4K6X A;  2EC4 A;  3L4N A;  2YWN A;  2M46 A;  4MJA A;  3JCM L;  1OC3 A;  3KM6 A;  1OKT A;  5CAX A;  1F9M A;  5HQP A;  1KTE A;  1YEX A;  4K2X A;  2JSZ A;  1TRW A;  4Q5R A;  2CAQ A;  1WOU A;  2R3X A;  4Z2R A;  3FHK A;  3GKK A;  2GT5 A;  4TR4 A;  3W6G A;  4K7O A;  5FHI A;  1OE8 A;  4HU7 A;  1G7O A;  3IPZ A;  1CQG A;  3ZVJ A;  2H19 A;  3CYN A;  4EE0 A;  5ECH B;  2LNS A;  2O89 A;  1R5A A;  4ZXG A;  2H30 A;  2KUC A;  5CP1 A;  1M9B A;  5JWR B;  1GRX A;  1U87 A;  1EEM A;  3HVX A;  5ECM B;  4JED A;  4Q5Q A;  5DJM A;  2VL9 A;  3TJG A;  2VCX A;  3PH9 A;  2WZ9 A;  3APO A;  1ACV A;  1GSS A;  1U3I A;  2XPD A;  1YQ1 A;  3BCK A;  3RHB A;  4BVX B;  1T4Z A;  1ZCP A;  2OA7 A;  3I43 A;  3L0H A;  2FD3 A;  1QXH A;  1XVW A;  3EIN A;  4I6X A;  4OO4 A;  3I9V 2;  2F8F A;  4KDU A;  1TP9 A;  2YCD A;  2N5B A;  1GTA A;  4HQZ A;  1AUC A;  1O73 A;  4HQS A;  1EV4 A;  3WGX A;  2LEG A;  1EP7 A;  4G19 A;  5BRT A;  2QKE A;  5EY6 A;  1GSU A;  1TK8 B;  1ZYP A;  3L9V A;  1T00 A;  2WCI A;  1M7T A;  3LQ7 A;  1GL8 A;  2DJ0 A;  4XS1 A;  2WS2 A;  3GTU B;  1AW9 A;  4POK A;  3C73 A;  1GNE A;  4ZL8 A;  3TOT A;  1OYJ A;  4EC0 A;  2PN8 A;  1F6M C;  4D73 B;  5KEJ A;  4MH2 A;  2B7J A;  3HZ8 A;  1TU8 A;  1VF2 A;  4CY6 A;  2XBQ A;  4KSM A;  2G0F A;  1GSF A;  4TKY A;  3SBC A;  3G9B A;  3UL3 A;  1N8J A;  2G2Q A;  5GAN D;  3J7Y b;  6GST A;  1U6T A;  1Y6E A;  4XS6 A;  4EL1 A;  2KLX A;  2C0D A;  1F3B A;  3CSJ A;  5D9X A;  4QL9 A;  1Z6M A;  3M1G A;  1SL0 B;  3TKS A;  4YAP A;  2RM5 A;  2FUG 2;  3UVT A;  4EXJ A;  1EP8 A;  4G10 A;  1SK1 A;  2CA8 A;  2OJL A;  3QAV A;  3KIJ A;  2FWG A;  3ZIT A;  1IYI A;  18GS A;  4POB A;  1PX7 A;  2XHF A;  1TI1 A;  1PGT A;  3KMN A;  3QAW A;  2DJ1 A;  3M9J A;  3TDG A;  2CX4 A;  1XWB A;  2GSR A;  5CYY A;  5COH A;  3IHG A;  4BA7 A;  4HOJ A;  5C04 A;  1QMV A;  1MD3 A;  17GS A;  4GQF A;  4FQU A;  1ST9 A;  3LJR A;  5CRG A;  3BCI A;  1ERW A;  2H8L A;  2H1G A;  2IPA A;  2LUS A;  1M0U A;  3TKP A;  6GSX A;  4MZB A;  1R4W A;  2QSI A;  2MYG A;  6GSW A;  2HRK A;  4K0G A;  1OKD A;  1GSD A;  3KH9 A;  3MAK A;  3G7J A;  2MBT A;  4FIW A;  2LRC A;  2KHP A;  2C4J A;  2IME A;  4PQH A;  1K0N A;  3GX8 A;  2XBI A;  2LTK A;  3WD6 A;  3TKS C;  1XW5 A;  1S3C A;  1TI3 A;  2BJX A;  1RW1 A;  2MMA A;  1A0R P;  3HY2 A;  1B9X C;  1AQW A;  2KP1 A;  3IRA A;  1V2A A;  1R7H A;  1MDI A;  2C0F A;  4EDZ A;  1DSB A;  5J41 A;  5DCH A;  2H0G A;  4BWS A;  3LFL A;  4PXO A;  2H1A A;  4PX1 A;  5IO0 A;  3N9J A;  4K9Z A;  1ZOF A;  3EU4 A;  4WF5 A;  2H0H A;  5AIS A;  3WT1 A;  2CT6 A;  1OE7 A;  5AN1 A;  3K8N A;  3GL3 A;  3P90 A;  1O81 A;  5CRW A;  2NBS A;  5JCU A;  4TW5 A;  4L5L A;  4DSQ A;  4BVX A;  3CXG A;  1T1V A;  1NSW A;  4ZB9 A;  2AV4 A;  4IJI A;  4ZIL A;  5DAK B;  1XIY A;  3HJM A;  1A2L A;  1M9A A;  5HFK A;  5G30 A;  1GSY A;  3E0U A;  19GS A;  4JBB A;  1SYR A;  4XS4 A;  2TIR A;  4O5U A;  2NPB A;  4MF5 A;  4IS0 A;  2XC2 A;  3BD2 A;  2K9F A;  1YJ6 A;  4J2F A;  2WUL A;  1B8X A;  4EVM A;  2JL4 A;  4EF0 A;  2VAF A;  3GTU A;  1ERU A;  1HNA A;  2C8U A;  2H71 A;  1O85 A;  1S3A A;  3H93 A;  3L78 A;  4D73 A;  4X43 A;  2H66 A;  3HXS A;  1PRX A;  2XPE A;  2VCW A;  3TRP A;  1X0R A;  4V1A g;  1GNW A;  4MF7 A;  4X4J A;  3MDK A;  3EVI A;  1GSE A;  2ALB A;  1QFN A;  4ILF A;  5HR0 A;  2IMD A;  3A2X A;  1X5C A;  4YKF A;  3H8Q A;  1M99 A;  1X5D A;  4I97 A;  1NHO A;  1SJ6 A;  5D9W A;  1FHE A;  3LG6 A;  2YJH A;  2VLV A;  5IMV A;  1AXD A;  1Z6N A;  1FB0 A;  4H86 A;  2LJK A;  2FLS A;  2PMT A;  4RI7 A;  1XWK A;  2HSH A;  1Z7P A;  1GTB A;  4GRF A;  3KJY A;  5IMC A;  5EVO A;  2IJY A;  5J3R A;  1LJR A;  4WBJ A;  4WXT A;  5G2Z A;  1QGV A;  1K0C A;  3US3 A;  1TW9 A;  3DIE A;  2YV7 A;  2RII A;  1G7E A;  2FWE A;  3CRU A;  2UZ8 A;  5J9B A;  3RPN A;  1KNG A;  4MJC A;  4PUA A;  1SD9 A;  4O5Q A;  3G7I A;  4JU5 A;  2FA8 A;  3HJP A;  1VGL A;  2VOC A;  2H1D A;  4XRD A;  2N5F A;  3KZQ A;  3LWA A;  1MTC A;  1TJD A;  1TTZ A;  2R5G A;  1ZYE A;  3F4S A;  2A4H A;  3C1S A;  5LD0 A;  5KOX A;  1YZX A;  2YZU A;  3F9U A;  3C7M A;  4BL7 B;  4NV5 A;  2A4V A;  11GS A;  1M2A A;  4ML1 A;  3ZMK A;  3ED3 A;  2VCT A;  1ABA A;  3GMF A;  1TOF A;  3EC3 A;  1XWA A;  3HKR A;  1E2Y A;  3ME8 A;  4RUV A;  1UVZ A;  4KCA A;  5ECL B;  1WE0 A;  2GLR A;  5CNW A;  4MZW A;  3KCM A;  1VRS D;  5F0G A;  2HSY A;  5JWO B;  2YWM A;  2B7K A;  4ZBD A;  4G0K A;  2K8S A;  1URM A;  1IYH A;  5ECQ B;  4WR5 A;  1X9W B;  1CQH A;  4GSN A;  3VI5 A;  3VPT A;  5JWQ B;  4N0V A;  4PTS A;  2PU9 C;  5DDL A;  4YKG A;  2VD0 A;  3ZRD A;  4I5Q A;  1T8E B;  2FA4 A;  2K8V A;  1XBS A;  3Q19 A;  1AC1 A;  3TGZ A;  5J5N A;  2VLU A;  1AQV A;  4F03 A;  5B8B A;  3LOR A;  1BQ7 A;  5DAK A;  1JZW A;  3UMA A;  1A0F A;  5KN1 A;  2WGR A;  2YP6 A;  1ON4 A;  1VF3 A;  3HA9 A;  2HRA A;  7GSS A;  3M8N A;  1FVJ A;  3QAG A;  4V1A p;  1V9W A;  2VL2 C;  4OD7 A;  4EO3 A;  4TR1 B;  3GH9 A;  1AIU A;  1ZL9 A;  3BBY A;  2P5R A;  4O5R A;  1WRY A;  1TKD B;  3ISO A;  1EEJ A;  2FHE A;  4MZC A;  4MF6 A;  3EPT A;  2LQO A;  3TB2 A;  4ID0 A;  5G31 A;  2H73 A;  3H79 A;  4WKW A;  1Y25 A;  1PMT A;  3IAS 2;  2H76 A;  1O6J A;  1YF0 A;  13GS A;  3VI7 A;  1WP0 A;  3ZIJ A;  1EOH A;  2EIO A;  4V2N A;  4I2U A;  2R0P A;  1SD8 A;  2Z9S A;  2B1L A;  4ZIJ A;  2C1Y A;  2GSS A;  2GT6 A;  2X64 A;  3CTG A;  4LLR A;  2WB9 A;  3U6V A;  2CVK A;  5CRD A;  1T4Y A;  1GUK A;  4GWR A;  1V58 A;  4FYC A;  4MJE A;  2GQM A;  3HYP A;  3GYK A;  4KX4 A;  4E8H A;  1M2D A;  4POL A;  1XOA A;  4KE3 A;  4KF9 A;  3QPM A;  4I8B A;  5A5K A;  3IC4 A;  1BYE A;  3GV1 A;  1WWJ A;  2I81 A;  3F0I A;  1O7U A;  3GL5 A;  1PN9 A;  2HYX A;  5ID2 B;  4NPB A;  4K0N A;  2H72 A;  2L6D A;  1W4V A;  1WIK A;  5D9T A;  1EGO A;  4IN0 A;  3FZ9 A;  1UA5 A;  4LMW A;  3KXO A;  1ML6 A;  3J7Y k;  2QGV A;  3FR9 A;  1V57 A;  2HZE B;  1U3A A;  1DE2 A;  1FAA A;  3C8E A;  2JAD A;  1JZD A;  2HRF A;  1K3Y A;  2RLI A;  4G9H A;  6GSY A;  1SK0 A;  1GUM A;  6GSU A;  4BL7 A;  2I4A A;  1HD2 A;  3KP8 A;  4EIQ A;  4OCF A;  4K8M A;  4OFM A;  2R37 A;  2P5Q A;  3FW2 A;  3IOS A;  2GZY A;  4JR4 A;  3F8U A;  4OFN A;  1KBN A;  2IMK A;  4X0X A;  3TJJ A;  5DVB A;  5FWG A;  4ZL9 A;  2MZC A;  2OKA A;  2C3Q A;  4P3Y B;  2M72 A;  2B5E A;  4PUR A;  2H6Y A;  3CMI A;  3LYK A;  3HVV A;  2FWH A;  1NM3 A;  4O32 A;  4MA9 A;  3IK9 A;  4OWY A;  4EDY A;  2JZS A;  2O85 A;  1PX6 A;  2VCZ A;  1WMJ A;  3UIW A;  2F3M A;  1SKW B;  1FO5 A;  3HZ4 A;  3KTB A;  1F2E A;  5KN0 A;  4TXO A;  5IO2 A;  3GHA A;  4EIP A;  5GAP D;  2DJ2 A;  4MPG A;  4KCE A;  3ZVJ D;  4ZB6 A;  2IN3 A;  4WR4 A;  4XIH A;  2AB6 A;  4KND A;  5IOW A;  1EGR A;  2P0G A;  2X8H A;  4ZB8 A;  1K0M A;  3HJO A;  1JZR A;  3FZ4 A;  4YQM A;  2C80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...