4K8MA

High resolution structure of m.tb nrdh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
TVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaredoxin-like protein NrdH
publication title The crystal structure of Mycobacterium tuberculosis NrdH at 0.87 angstrom suggests a possible mode of its activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Electron transport
total genus 24
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k8mA00
2YCDA 1HNBA 2AUVA 2HNLA 3PINA 3UAPA 1IYHA 3WYWA 2BTOT 4EXJA 1PKWA 12GSA 5D9TA 5LCZA 4FYCA 3GL3A 3VURA 2WDUA 3LEFA 3ZFLA 3WT1A 4EF0A 3VWVA 1JLVA 3ZIVA 4K0NA 4OO4A 4IN0A 3D4MA 4NWYA 5ECNB 2VCWA 1HQOA 1THXA 1DE1A 2CQ9A 2VM1A 3MNGA 2LJAA 5ENUA 3IE3A 1WJKA 1SD9A 3ZTLA 2L6CA 4EE0A 2QKEA 5IMDA 5JCGA 1HYUA 3QD9A 3TJGA 5JCWA 4YAPA 2H6YA 5CRHA 2N5AA 3O76A 2VL9A 4HEA2 1GH2A 3ZL5A 1UVZA 5CRWA 5ECMB 3LGCA 3F3QA 2JADA 4IHUA 4OCFA 4N0ZA 2B6MA 2M46A 4O92A 4NV2A 3VWWA 2KP2A 2MYGA 1TRWA 2X8HA 3WGDA 4GWRA 3TKSA 4ZL7A 3H8QA 2MMOA 4GSNA 1F3AA 2IMFA 4F9ZA 1YJ6A 5DDLA 3ERFA 2DLXA 5A4UA 5ID2B 1XWGA 2P0GA 3GURA 2VL2C 1XWAA 4NV5A 4XS1A 2C3NA 2O85A 5B7CA 1K3OA 3ZFBA 4HJ2A 2LNSA 1NHOA 3HJPA 4GLTA 2QGVA 4RUVA 2WGRA 3K8NA 3DMLA 1QK8A 4Q5QA 5H5SA 4KDXA 1T3BA 2E0QA 2DJJA 2VD1A 3H93A 1VRSD 1SKWB 1CQGA 4MLYA 1BEDA 5A4WA 1DSBA 4KDUA 2VCQA 4BA7A 2L4CA 2AYTA 4O32A 1TK8B 2TRCP 3EINA 2WCIA 3C1SA 4ZL8A 2FWHA 4BWQA 2IMKA 1GRXA 1GSDA 5AN1A 2V32A 2KP1A 5D93A 3KXOA 1FB6A 4WKWA 3C8EA 2OA7A 1E6BA 1WOUA 3TKSE 20GSA 1PL1A 4XS6A 5KN2A 3A2XA 1V57A 3IK7A 4HDEA 5AGYA 3FZAA 2IWTA 3EC3A 4WR5A 4NHWA 2NTOA 3N9JA 2YNXA 3GIXA 4MK3A 5J41A 4PQIA 2GSQA 2OJLA 4LMVA 3IAS2 3QAVA 1EP8A 3J7Yk 3DKSA 4FH8A 3H79A 1OE8A 1V9WA 3LYKA 1V2AA 3CTGA 4GQFA 5IMCA 2QSIA 5AIXA 1TRVA 4AF2A 1KNGA 2AV4A 3NZNA 5DAKA 4KSOA 5DCHA 1XZOA 1RK4A 3RHCA 1ILOA 3EE2A 5ECIB 1TP9A 2H1DA 3N5OA 3C73A 2FA8A 4JRRA 1MD3A 3GKNA 4ECIA 3CMIA 4Z7XA 1O73A 3GX0A 3KTBA 2GZYA 3VWXA 5FHIA 1M7TA 4KUNA 1V58A 4X43A 3P8WA 1JZDA 3DVWA 4XIHA 1Y25A 4IQ1A 1XW6A 5HR2A 4XRAA 4IVFA 2RUEA 2P31A 2YZUA 3UIWA 2RUFA 4HQSA 2WULA 3M9JA 1A2LA 5HR1A 4ULXA 1AXDA 1R26A 3S9FA 2TRXA 1T00A 4HOJA 1A8YA 2GTUA 3VK9A 4F82A 2HLSA 3HD5A 2C1YA 3DXBA 4CHSA 1GSEA 2YP6A 4DVCA 2VCZA 4TXOA 1T4ZA 1PA3A 2WZ9A 3F4RA 3HVSA 2H76A 3UBLA 4KX4A 5INYA 3LJRA 3L9SA 4ML1A 4AJ7A 5DBQA 1EP7A 1MDKA 1I9DA 1F9MA 4XRDA 1U88A 1GTBA 2YPMA 5EPFA 2ON7A 2LUSA 2GQMA 3IDVA 1JFUA 4K2DA 13GSA 4MH2A 3ED3A 1OC3A 2VLTA 1G6WA 3QFAC 2LTKA 3QMXA 3TKRA 1RW1A 3GSTA 3QFBC 3EYTA 1S3DA 2I4AA 5CREA 3H1NA 2XBQA 4AJ8A 1XVWA 5J9CA 1K0DA 2CVKA 5FWGA 3BBYA 4PNGA 3QAGA 4ACSA 1FB0A 5DAKB 4HI7A 2B5YA 4YQVA 2EIRA 1QXHA 1GUHA 3NOFA 3GV1A 3DVXA 4FO5A 2PPTA 3TOTA 3CSHA 3F63A 3UJ1A 2YV7A 4POBA 3ME8A 1NHYA 4PURA 3FR9A 4IBPA 3E9JB 5G1KA 2OADA 1K3LA 3WT2A 4JEDA 3W6GA 4IP1A 1AQVA 4KNDA 4WF5A 5JWRB 5CNWA 4TR4A 4NXIA 2M80A 3ZREA 2YWNA 3RDWA 3A3TA 4N11A 4OO5A 1S3AA 4JU5A 1M9AA 4I8BA 1H4OA 5IO0A 5KN1A 3GH9A 4IGJA 4Q5FA 2OBKA 2DC5A 3M9KA 2KHPA 2L59A 4MCUA 3LXTA 2VCVA 3WGXA 4MJBA 5A4VA 4MMMA 1A24A 4PXOA 4WF4A 3M1GA 3QDNA 3J7Yb 3G7YA 5DQSA 1TDIA 11GSA 2C4JA 3UMAA 2YV9A 2FD3A 3HHVA 2DIZA 14GSA 2WFCA 4TXOB 1EEJA 2R3XA 1K3YA 4OFNA 3D22A 6GSXA 1SJIA 3V1WA 5E4WA 1WRYA 4GF0A 1QUWA 17GSA 2NPBA 2HXKA 5G31A 1QGVA 2R2JA 3A2VA 1X5DA 2LJKA 2PUKC 1YEXA 1YKCA 4K8MA 2NBSA 1OVNA 3F0IA 1KEBA 3SWLA 1GLPA 4ZB9A 4L8EA 4IKHA 1YZXA 5DCGA 2O87A 1VF1A 3TUEA 2RIIA 4EUYA 3KEBA 2YN1A 4K7OA 4QL9A 3QOUA 2VM2A 2H6XA 2VLVA 5EL8A 3IBHA 4IQAA 3ERWA 5D9VA 1YDKA 1XXUA 1A2MA 2YZHA 5G5EA 4K6XA 3ZITA 3LWAA 5GZZB 4EO3A 2MBTA 3TRQA 2ZCTA 2DIYA 4IELA 2LEGA 6GSWA 1GSQA 1AUCA 2OACA 4POMA 2CZ2A 5KEJA 2IPAA 5CO3A 4MZCA 1AAZA 5GAPD 2K8SA 2LQQA 1H75A 5IQYA 2GSRA 2P5RA 1G7EA 3Q18A 1PSQA 3UL3A 4RQXA 9GSSA 4K9ZA 3H4KA 2LJRA 1GLQA 2PMTA 1OE7A 4H86A 1GSFA 1T4YA 3APSA 3A5WA 4FIWA 4PNFA 1ON4A 2HZEA 5LD0A 2CV4A 1A0RP 1K0MA 2JACA 5J3RA 5DJMA 4PQ1A 1O81A 4WXTA 3GH6A 4RI6A 1XIYA 1J08A 3SBCA 5DALA 1EGRA 3E0UA 3I43A 2H1GA 3KP9A 4Q5NA 3M0FA 2JU5A 1TK5B 4I5QA 1EEMA 1LBKA 2H8LA 1X5EA 4KE3A 4YQUA 4ZIJA 3HZ8A 4HS1A 4ZILA 2HFDA 3BOAA 19GSA 1T7PB 1JHBA 3JCML 3GTUA 4L0WA 2GZZA 4MP4A 4GCIA 1SL2B 3FY7A 2MMNA 1NW2A 3C7MA 1YY7A 5FT3A 3ZMKA 2NVLA 5HQPA 1FW1A 2MMZA 2JSYA 1EOGA 1G0TA 3PGTA 5IOXA 1OKTA 1EZKA 2VLUA 1O85A 3KZQA 3HCZA 3UVTA 4BWSA 5EVOA 4KCAA 1N8JA 2CZ3A 1UN2A 3GHAA 5ECSA 2JZTA 1SK0A 6GSTA 2DMMA 3NIVA 4BVXA 2CX4A 3DEXA 3L78A 1B4QA 1GUMA 2DJ3A 3ZIJA 3FZ9A 4LA1A 4NPBA 1PN9A 6GSYA 1GNEA 3CYNA 1TOFA 3O3TA 1DBYA 1WPIA 3I9V2 5H5RA 2XPEA 2AJQB 2JZRA 2VO4A 3LFLA 3MAKA 4POLA 18GSA 2X8GA 4ZBAA 4X1UA 1TTZA 4OMVA 2KLXA 3F6DA 1F2EA 3U5RE 1R5AA 1XFLA 2YWMA 3DYRA 3BCKA 3HVXA 4EL1A 2L4QA 2GLRA 2HZEB 1NSWA 3MDKA 2LQOA 1X9MB 1U87A 5JWOB 3QCPA 1PL2A 3GUSA 2H6ZA 1TKDB 7GSSA 1MDJA 4N30A 3APQA 3U6VA 2V1MA 2C80A 2IMEA 3I6AA 5DALB 4G10A 1FVKA 3D4TA 3CXGA 2F9SA 3IC4A 5AIVA 4MF5A 4TR0A 2GGTA 2J9HA 5A5KA 5JCUA 4PUAA 4MPFA 4J56E 3ZVJA 2P5QA 3CRTA 4FYBA 3Q74A 4KCEA 2B1LA 3GTUB 1BG5A 3LORA 4DEJA 2VD0A 3O6TA 2G2QA 1K0OA 4MJEA 2H66A 5LNKe 2ZUPA 2FLSA 1R4WA 3GNJA 3I69A 1QFNA 2J23A 1W89A 2GSTA 2O8VB 3L4NA 4WBRD 4DSSA 4GTUA 3ME7A 3VPTA 4WETA 3W8SA 4TOPA 1Z7PA 4ISDA 5ECOB 2H72A 3ZYWA 3HYPA 2HI7A 1F37A 2R6KA 4IJIA 3F9UA 1ABAA 1SK2A 1K0AA 3DD3A 4XS4A 2YANA 2FY6A 3EU4A 3QPMA 3EVIA 2WJUA 5HR3A 4F2IA 4EC0A 4CDOA 5IPHA 3FRCA 4KDYA 1J0FA 4PQHA 2FA4A 1XOBA 2VCXA 3D0ZA 5B8AA 2HE3A 3TKPA 1ZCPA 3EURA 2A2RA 2V41A 1TI1A 2H71A 1USBA 2R37A 4J2FA 5ELAA 3PH9A 4MJAA 3WD6A 1GWCA 2DJ1A 3KH7A 3P90A 5IPGA 3F3RA 2AHEA 2FUG2 1YEPA 3HZ4A 1FVJA 3QAWA 4HZ4A 4OFMA 2LNTA 3DIEA 2YOIA 2FHEA 1SYRA 3CBUA 1YKAA 4MPGA 1UA5A 4MA9A 1XW5A 2VOCA 1OAZA 2BMXA 1BX9A 5D9XA 3IV4A 4L5LA 2B5EA 1HNAA 3LQ7A 5IMVA 2X99A 4F0CA 1GSYA 1WWJA 2LKUA 3GN3A 2E2GA 3C1RA 4RQRA 1VF2A 4EDZA 6GSUA 1SYXA 5ABRA 3TKQA 2C3QA 4HQZA 1ZOFA 1SJZA 5IMAA 4AGSA 1THOA 2DJ2A 1O6JA 2I1UA 2CX3A 1ERWA 2K9FA 4JR6A 2ZNMA 2EIQA 3WGEA 1AIUA 3GFKA 2I9HA 1VGLA 2VAFA 2OE1A 1R7HA 5G5FA 1UC7A 1WIKA 1M9BA 3DGQA 2CA8A 3PR8A 4MH3A 2M72A 4DSSB 2ALBA 2D2ZA 2I81A 2NDOA 1V40A 5DVBA 1FG4A 1XPVA 1MDIA 1HD2A 1SKSB 4V2MA 3F4SA 4JE1A 1DE2A 3GKKA 2F8AA 4ECJA 2AB6A 3F8UA 5CP1A 4GRFA 1OKDA 2OKAA 4XS4B 3UBKA 2H70A 3IR4A 3C71A 2YJ7A 4KSMA 3KMNA 3FYGA 1AC1A 2XPDA 2WB9A 4QQ7A 2H1AA 1GUKA 3TJKA 5IIZA 2VIMA 1GNWA 1ZYQB 1ML6A 3TGZA 2PWJA 3AY8A 6GSVA 3UVHA 4JR4A 3QR6A 1ZMAA 4K7NA 5COHA 4E8HA 3FR3A 1X5CA 5JWQB 3BCIA 4TRXA 3VLNA 5ECHB 3TJFA 3HJMA 3VI7A 3M8NA 1ZL9A 1TW9A 1DUGA 4LLRA 3ZMLA 2WRTA 2LSTA 1TK0B 3TKSC 4EVMA 5HFKA 2RM5A 5H5QA 4FYUA 4DSQA 2O89A 5D73A 1KBNA 1QMVA 1V98A 2IFQA 3L9UA 2DMLA 1XVQA 3FZ5A 1AQXA 1S3CA 1X0RA 4GSTA 4V2NA 1VF4A 2H0GA 1TI3A 1J9BA 1EWXA 4KB3A 4HJMA 3KGKA 1F6MC 4QL7A 2C0GA 4OWYA 1C72A 1XWCA 4HUAA 5CRDA 3CRUA 2IIYA 2ES7A 3D5JA 1VF3A 4IW9A 3HDCA 1GSSA 2LRCA 1SK1A 4TN8A 1FHEA 2JZSA 2GDRA 3P2AA 2FWGA 4XCSA 1BQ7A 3TJBA 4ZBDA 1Z6MA 1TXXA 1N2AA 3G9BA 3GRXA 4AJ6A 3ZVJD 2LV3A 3KD0A 1TRUA 2KOKA 5HR0A 4F03A 4K7IA 1TJDA 4IP6A 3EU3A 1M2AA 2C8UA 2GSSA 5ELGA 1LU4A 4K1FA 2N5FA 1TRSA 1JZRA 1BJXA 1W4VA 1SL1B 3ISOA 1MEKA 3TJJA 4D73A 2L6DA 2B1KA 1O7UA 2IN3A 5KN3A 1ERTA 3TOUA 1GTAA 3TRXA 1K0CA 2H30A 3GA4A 3IXRA 4JBBA 2O7KA 4X0XA 2C0FA 2DJKA 4PX1A 5C00A 4V2LA 3RAZA 2H74A 2YWIA 4Q5RA 5F07A 5J5NA 2JSZA 3CTFA 4MDCA 3KJYA 5IOWA 5F05A 3IOSA 2LRNA 2IJYA 3FK8A 3TB2A 2IMDA 1E2YA 2GQLA 4OFTA 4XTSA 2DSAA 2IFQB 4WBJA 2OE0A 3VPQA 1PX6A 5G2ZA 4TW5A 1PD21 2C0DA 5IM9A 1PQNA 2PGTA 2HT9A 4ZXGA 4YAVA 5IMFA 1FO5A 4N10A 3D21A 4I6XA 5G1LA 3BD2A 3GMFA 1ZZYA 2WS2A 1SD8A 8GSSA 3HVVA 1GL8A 1PMTA 4HU9A 3VFIA 4TR3A 3G7IA 4JZQA 1HNCA 1WE0A 5C04A 2HZFA 3LG6A 3MWHA 3KM6A 5GAND 3Q6OA 3ZZXA 3LXZA 4MF7A 5E59A 4IJ3A 2PBJA 2GVPA 1PGTA 3MSZA 4MF6A 2H01A 4MJCA 3RPPA 4TXVA 2ON5A 4O5RA 4ECCA 1XCCA 2F8FA 4ILFA 4IS0A 5F06A 2F51A 2PVOC 1JLWA 1GTUA 2V2GA 3DRNA 2X64A 3IPZA 4NAXA 4D73B 2HRNA 1Q98A 1ERUA 3EMPA 3F6FA 3OR5A 1U3AA 4ZB6A 2EC4A 4GQCA 2H73A 1YF0A 1O8XA 3APOA 5B6MA 1G6YA 4CW9A 3HJOA 3FW2A 2FCHA 2K6VA 4G9HA 2G0FA 4PUFC 2PN8A 4I2TA 2GZPA 1F3BA 1PX7A 2FNOA 4ID0A 4BVYA 1A8LA 2L5OA 3US3A 2OBIA 3VI5A 1ACVA 1B9YC 1A0FA 1M2DA 1GTIA 2GQKA 1EV9A 3KTLA 2H0IA 22GSA 4G2EA 6GSSA 2V6KA 2E2MA 1GP1A 5D96A 4MABA 3IHQA 3HY2A 3IA1A 2CT6A 1Z6NA 1MD4A 4TR1A 1PRXA 2KUCA 2C0EA 4NHZA 3R2QA 5J4UA 3KMOA 4ZBBA 2HYXA 1SENA 2HRFA 1OC9A 2H1BA 1OYJA 1Q4JA 1GSUA 3DWVA 1SJ6A 1K0BA 5D9WA 5B8BA 2VL3A 2B3SA 2FWFA 3F4TA 1O8WA 3IK9A 2REMA 1B9XC 3UOMA 2XBIA 4POKA 1WMJA 5J9BA 2FWEA 2A2SA 2H0HA 3GYKA 5B6NA 3KH9A 2MMAA 3LYPA 4P3YB 1SL0B 4OD7A 2VL2A 3D6IA 3GSSA 1YF1A 4L0UA 1KTEA 2EIOA 4ZL9A 4YH2A 3UARA 3M3MA 3L0HA 1X9WB 3P7XA 4RI7A 4TVEA 1B48A 1AQWA 1XOAA 1M99A 1SU9A 2CVBA 3KIJA 5ECLB 2MZCA 3CSJA 2YJHA 3EMXA 1XBSA 2Z9SA 4GXZA 1EGOA 1G7OA 2L57A 1CQHA 1R5PA 1LJRA 2N5BA 3FEUA 1I5GA 2IMIA 1YQ1A 2CAIA 2E7PA 3IAM2 3IRAA 3KP8A 4NMUA 5AISA 1AW9A 4V1Ag 3ERGA 4LMWA 4YQMA 2JL4A 5L71A 4K0GA 1ZGNA 4BPYA 1URMA 1PKZA 4J57E 2VCTA 2X8CA 2QC7A 1EV4A 1Z7RA 1WP0A 3GX8A 1TU8A 2V6OA 2XC2A 1U3IA 2B7JA 1B4PA 4L5OA 5F0GA 10GSA 1ZYEA 2HSHA 2PERA 4EDYA 2RM6A 3FZ4A 5HFIA 2BJXA 3HXSA 1JZOA 3E3EA 4ML6A 3UEMA 1ST9A 2LS5A 3A2WA 5CYYA 4KA0A 5GSSA 5F8BA 5CAXA 4MZWA 1SKRB 3TRPA 4TR1B 1B8XA 4I2UA 1T1VA 1QQ2A 4MZBA 1OC9B 1M0UA 2XHFA 4ZB8A 1U6TA 3HKRA 2R5GA 5CRGA 4O7HA 2GT5A 4E8EA 3FR6A 3G7JA 4G19A 5KN0A 3VWUA 2TIRA 2CAQA 1BYEA 2MBSA 1K0NA 4PGTA 4V1Ap 2AAWA 3RBTA 2CVDA 3EWLA 1XWKA 1XW9A 4HZ2A 5EY6A 1Z9HA 3HA9A 2C3TA 2F3MA 5IO2A 5D8IA 1IYIA 3CSIA 1X9SB 1Z5YE 1T8EB 3LSZA 1XWBA 1BAYA 5ECKB 2K18A 2DBCA 5GSTA 3FHKA 2B7KA 3FKFA 3GL5A 4KH7A 4TKYA 4OCEA 4KAEA 3W8JA 2LRTA 1JZWA 4WR4A 2A4VA 4XHMA 2FGXA 1A23A 2DJ0A 4KGIA 1A2JA 1M2BA 1Y6EA 4EKZA 1MTCA 4WEYA 2OE3A 5DQYA 5IMZA 1Z3EA 1OC8A 1TU7A 5ECRB 4HU7A 5ID2A 2VUPA 4DSRA 5ECQB 4GSSA 2H75A 1GULA 2PVQA 3ZLPA 1RQMA 3TDGA 2HSYA 1ERVA 4KW6A 3GKMA 4F0BA 2L5LA 2H19A 2R4VA 3TCOA 4LL1B 3ZRDA 2YWOA 3BJ5A 4N0VA 5G30A 1FAAA 5HFGA 2B5XA 3RHBA 3RPNA 3L9VA 4LL4B 2I3YA 4BL7A 5DJLA 1EOHA 1NM3A 4I97A 16GSA 3Q19A 3KCMA 5ECPB 2IL3A 2RLIA 2GT6A 2GS3A 2PU9C 4ECBA 1FOVA 2K8VA 3GKXA
chains in the Genus database with same CATH superfamily
2YCDA 1HNBA 2AUVA 2HNLA 3PINA 3UAPA 1IYHA 3WYWA 2BTOT 4EXJA 1PKWA 12GSA 5D9TA 5LCZA 4FYCA 3GL3A 3VURA 2WDUA 3LEFA 3ZFLA 3WT1A 4EF0A 3IC8A 3VWVA 1JLVA 3ZIVA 4K0NA 4OO4A 4IN0A 3D4MA 4NWYA 5ECNB 2VCWA 1HQOA 1THXA 1DE1A 2CQ9A 2VM1A 3MNGA 2LJAA 5ENUA 3IE3A 1WJKA 1SD9A 3ZTLA 2L6CA 3CQFA 4EE0A 1PFOA 2QKEA 1PN0A 5IMDA 5JCGA 1HYUA 1ZYPA 3QD9A 3TJGA 5JCWA 4YAPA 2H6YA 5CRHA 2N5AA 3O76A 2VL9A 4HEA2 1GH2A 3ZL5A 1UVZA 5CRWA 5ECMB 3LGCA 3F3QA 2JADA 4IHUA 4OCFA 4N0ZA 2B6MA 2M46A 4O92A 4NV2A 3VWWA 2KP2A 2MYGA 1TRWA 2X8HA 3WGDA 4GWRA 3TKSA 4ZL7A 3H8QA 2MMOA 4GSNA 1F3AA 2A4HA 2IMFA 4F9ZA 1YJ6A 5DDLA 3ERFA 2DLXA 5A4UA 5ID2B 1XWGA 2P0GA 3GURA 2VL2C 1XWAA 4NV5A 4XS1A 2C3NA 2O85A 5B7CA 1K3OA 3ZFBA 4HJ2A 2LNSA 1NHOA 3HJPA 4GLTA 2QGVA 4RUVA 2WGRA 3K8NA 3DMLA 1QK8A 4Q5QA 5H5SA 4KDXA 1T3BA 2E0QA 2DJJA 2R0GA 2VD1A 3H93A 1VRSD 1SKWB 1CQGA 4MLYA 1BEDA 5A4WA 1DSBA 4BL7B 4KDUA 2VCQA 4BA7A 2L4CA 2AYTA 4O32A 1TK8B 2TRCP 3EINA 2WCIA 3C1SA 4ZL8A 2FWHA 4KF9A 4BWQA 3A5IA 2IMKA 1GRXA 1GSDA 5AN1A 2V32A 2KP1A 5D93A 3KXOA 1FB6A 4WKWA 3C8EA 2OA7A 1E6BA 1WOUA 3TKSE 20GSA 1PL1A 4XS6A 5KN2A 3A2XA 1V57A 4HDEA 2DKHA 3IK7A 5AGYA 3FZAA 2IWTA 3EC3A 4WR5A 4NHWA 2NTOA 3N9JA 2YNXA 3GIXA 4MK3A 5J41A 4PQIA 2GSQA 2OJLA 4LMVA 3IAS2 3QAVA 1EP8A 3J7Yk 1S3RA 3DKSA 4FH8A 3H79A 1OE8A 1V9WA 3LYKA 4O5QA 1V2AA 3CTGA 4GQFA 5IMCA 2QSIA 5AIXA 1TRVA 4AF2A 1KNGA 2AV4A 3NZNA 5DAKA 4KSOA 5DCHA 1XZOA 1RK4A 3RHCA 1ILOA 3EE2A 1TP9A 5ECIB 2H1DA 3N5OA 3C73A 2FA8A 4JRRA 5KOXA 1MD3A 3GKNA 4ECIA 3CMIA 4Z7XA 1O73A 3GX0A 3KTBA 2GZYA 3MIXA 3VWXA 5FHIA 1M7TA 4KUNA 1V58A 4X43A 3P8WA 1JZDA 3DVWA 4XIHA 1Y25A 4IQ1A 1XW6A 5HR2A 4XRAA 4IVFA 2RUEA 2P31A 2YZUA 3UIWA 2RUFA 4HQSA 2X49A 2WULA 3M9JA 1A2LA 5HR1A 4ULXA 1AXDA 1R26A 3S9FA 2TRXA 1T00A 4HOJA 1A8YA 2GTUA 3VK9A 4F82A 4EIPA 2HLSA 3HD5A 2C1YA 3DXBA 4CHSA 1GSEA 2YP6A 4DVCA 2VCZA 4TXOA 1T4ZA 1PA3A 2WZ9A 3F4RA 3HVSA 2H76A 3UBLA 4KX4A 5INYA 3LJRA 3L9SA 4ML1A 4AJ7A 1EP7A 5DBQA 1MDKA 1I9DA 1F9MA 4XRDA 1U88A 1GTBA 2YPMA 5EPFA 2ON7A 2LUSA 2GQMA 3IDVA 1JFUA 4K2DA 13GSA 4MH2A 3ED3A 1OC3A 2VLTA 1G6WA 3QFAC 2LTKA 3QMXA 3TKRA 1RW1A 3GSTA 3QFBC 2UZ8A 3EYTA 1S3DA 2I4AA 5CREA 3H1NA 2XBQA 4AJ8A 1XVWA 5J9CA 1K0DA 2CVKA 5FWGA 3BBYA 4PNGA 3QAGA 4ACSA 1FB0A 5DAKB 4HI7A 2B5YA 2R0PA 4YQVA 2EIRA 1QXHA 2X4AA 1GUHA 3NOFA 3GV1A 3DVXA 4FO5A 2PPTA 3TOTA 3CSHA 3F63A 3UJ1A 2YV7A 4POBA 3ME8A 1NHYA 4PURA 3FR9A 4IBPA 3E9JB 5G1KA 2OADA 1K3LA 5BRTA 3WT2A 4JEDA 3W6GA 4IP1A 1AQVA 4KNDA 4WF5A 5JWRB 5CNWA 4TR4A 4NXIA 2M80A 3ZREA 2YWNA 3RDWA 3A3TA 4N11A 4OO5A 1S3AA 4JU5A 1M9AA 4I8BA 1H4OA 4G0IA 5IO0A 5KN1A 2QA2A 3GH9A 4IGJA 4Q5FA 2OBKA 2DC5A 3M9KA 2KHPA 2L59A 4MCUA 3LXTA 2VCVA 3WGXA 4MJBA 5A4VA 4MMMA 1A24A 4PXOA 4WF4A 3M1GA 3QDNA 3J7Yb 3G7YA 5DQSA 1TDIA 11GSA 2C4JA 3UMAA 2YV9A 2FD3A 3HHVA 2DIZA 14GSA 2WFCA 4TXOB 1EEJA 2R3XA 1K3YA 4OFNA 3D22A 6GSXA 1SJIA 3V1WA 5E4WA 1WRYA 4GF0A 1QUWA 17GSA 2NPBA 2HXKA 5G31A 1QGVA 2R2JA 3A2VA 1X5DA 2LJKA 2PUKC 1YEXA 1YKCA 4K8MA 2NBSA 1OVNA 3F0IA 1KEBA 3SWLA 1GLPA 4ZB9A 4L8EA 4IKHA 1YZXA 5DCGA 2O87A 1VF1A 3TUEA 2RIIA 4EUYA 3KEBA 2YN1A 4K7OA 4QL9A 3QOUA 2VM2A 2H6XA 2VLVA 5EL8A 3IBHA 4IQAA 3ERWA 5D9VA 1YDKA 1XXUA 1A2MA 2YZHA 5G5EA 4K6XA 3ZITA 3LWAA 5GZZB 4EO3A 2MBTA 2HSMA 3TRQA 2ZCTA 2DIYA 4IELA 2LEGA 6GSWA 1GSQA 1AUCA 2OACA 4POMA 2CZ2A 5KEJA 2IPAA 5CO3A 4MZCA 1AAZA 5GAPD 2K8SA 2LQQA 1H75A 5IQYA 2GSRA 2P5RA 1G7EA 3Q18A 3PPUA 1PSQA 3UL3A 4RQXA 9GSSA 4K9ZA 3H4KA 2LJRA 1GLQA 2PMTA 1OE7A 4H86A 1GSFA 1T4YA 3APSA 3A5WA 4FIWA 4PNFA 1ON4A 2HZEA 5LD0A 2CV4A 1A0RP 1K0MA 2JACA 5J3RA 5DJMA 4PQ1A 1O81A 4WXTA 3GH6A 4RI6A 4O5UA 1XIYA 1J08A 3SBCA 5DALA 3LW9A 1EGRA 3E0UA 3I43A 2H1GA 3KP9A 4Q5NA 3M0FA 2JU5A 1TK5B 4I5QA 1EEMA 1LBKA 2H8LA 1X5EA 4MNNA 4KE3A 4YQUA 4ZIJA 3HZ8A 4HS1A 4ZILA 2HFDA 3BOAA 19GSA 1T7PB 1JHBA 3JCML 3GTUA 4L0WA 2GZZA 4MP4A 4GCIA 1SL2B 3FY7A 2MMNA 1NW2A 3C7MA 1YY7A 5FT3A 3ZMKA 2NVLA 5HQPA 1FW1A 2MMZA 2JSYA 1EOGA 1G0TA 3PGTA 5IOXA 1OKTA 1EZKA 2VLUA 4YKGA 1O85A 3KZQA 3HCZA 3UVTA 4BWSA 5EVOA 4KCAA 1N8JA 2CZ3A 1UN2A 3GHAA 5ECSA 2JZTA 1SK0A 6GSTA 2DMMA 4A5PA 3NIVA 4BVXA 2CX4A 3DEXA 3L78A 1B4QA 1GUMA 2DJ3A 3ZIJA 3FZ9A 4LA1A 4NPBA 1PN9A 6GSYA 1GNEA 3CYNA 1TOFA 3O3TA 1DBYA 4PTSA 1WPIA 3I9V2 5H5RA 2XPEA 2AJQB 2JZRA 2VO4A 3LFLA 3MAKA 4POLA 18GSA 2X8GA 4ZBAA 4X1UA 1TTZA 4OMVA 2KLXA 3F6DA 1F2EA 3U5RE 1R5AA 1XFLA 2YWMA 3DYRA 3BCKA 3HVXA 4EL1A 2L4QA 2GLRA 2HZEB 1NSWA 3MDKA 2LQOA 1X9MB 1U87A 5JWOB 3QCPA 1PL2A 3GUSA 2H6ZA 1TKDB 7GSSA 1MDJA 4N30A 3APQA 3U6VA 2V1MA 2C80A 2IMEA 3I6AA 5DALB 4G10A 1FVKA 3D4TA 3CXGA 2F9SA 3IC4A 5AIVA 4MF5A 4TR0A 2GGTA 2J9HA 5A5KA 5JCUA 4PUAA 4MPFA 4J56E 3ZVJA 2P5QA 3CRTA 4FYBA 3Q74A 4KCEA 2B1LA 3GTUB 1BG5A 3LORA 4DEJA 2VD0A 3O6TA 2G2QA 1K0OA 4MJEA 2H66A 5LNKe 2ZUPA 2FLSA 1R4WA 3GNJA 3I69A 1QFNA 2J23A 1W89A 2GSTA 2O8VB 3L4NA 4WBRD 4DSSA 4GTUA 3ME7A 3VPTA 4WETA 3W8SA 4TOPA 1Z7PA 1XG8A 4ISDA 5ECOB 2H72A 3ZYWA 3HYPA 2HI7A 1F37A 2R6KA 4IJIA 3F9UA 1ABAA 1SK2A 1K0AA 3DD3A 4XS4A 2YANA 2FY6A 3EU4A 3QPMA 3EVIA 2WJUA 5HR3A 4F2IA 4BVXB 4EC0A 4CDOA 5IPHA 3FRCA 4KDYA 1J0FA 4PQHA 2FA4A 1XOBA 2VCXA 3D0ZA 5B8AA 2HE3A 3TKPA 1ZCPA 3EURA 2A2RA 2V41A 1TI1A 3EPTA 2H71A 1M3IA 1USBA 2R37A 4J2FA 5ELAA 3PH9A 4MJAA 3WD6A 1GWCA 2DJ1A 3KH7A 3P90A 5IPGA 3F3RA 2AHEA 2FUG2 1YEPA 3HZ4A 1FVJA 3QAWA 4HZ4A 4OFMA 2LNTA 3DIEA 2YOIA 2FHEA 1SYRA 3CBUA 1YKAA 4MPGA 1UA5A 2A2PA 4MA9A 1XW5A 2VOCA 1OAZA 2BMXA 1BX9A 5D9XA 3IV4A 4L5LA 2B5EA 1HNAA 2DKIA 3LQ7A 5IMVA 2X99A 4F0CA 1GSYA 1WWJA 2LKUA 3GN3A 2E2GA 3C1RA 4RQRA 1VF2A 4EDZA 6GSUA 1SYXA 5ABRA 3TKQA 2C3QA 4HQZA 1ZOFA 1SJZA 5IMAA 4AGSA 1THOA 2DJ2A 1O6JA 2I1UA 2CX3A 1ERWA 2K9FA 4JR6A 2ZNMA 2EIQA 3WGEA 1AIUA 3GFKA 2I9HA 1VGLA 2VAFA 2OE1A 1R7HA 5G5FA 1UC7A 1WIKA 1M9BA 3DGQA 2CA8A 1M3JA 3PR8A 4MH3A 2M72A 4DSSB 2ALBA 2D2ZA 2I81A 1FOHA 2NDOA 1V40A 4YKFA 5DVBA 1FG4A 1XPVA 1MDIA 1HD2A 1SKSB 4V2MA 3F4SA 4JE1A 1DE2A 3GKKA 2F8AA 4ECJA 2AB6A 3F8UA 5CP1A 4GRFA 1OKDA 4X4JA 2OKAA 4XS4B 5BMUA 3UBKA 2H70A 3IR4A 3C71A 2YJ7A 4KSMA 3KMNA 3FYGA 1AC1A 2XPDA 2WB9A 4QQ7A 2H1AA 1GUKA 3TJKA 5IIZA 2VIMA 1GNWA 1ZYQB 1ML6A 3TGZA 2PWJA 3AY8A 6GSVA 3UVHA 4JR4A 3QR6A 1ZMAA 4K7NA 5COHA 4E8HA 3FR3A 1X5CA 5JWQB 3BCIA 4TRXA 3VLNA 5ECHB 3TJFA 3FMWA 4K2XA 3HJMA 3VI7A 3M8NA 1ZL9A 1TW9A 1DUGA 4LLRA 3ZMLA 2WRTA 2LSTA 1TK0B 3TKSC 4EVMA 5HFKA 2RM5A 5H5QA 4FYUA 3R3EA 4DSQA 2O89A 5D73A 1KBNA 1QMVA 1V98A 2IFQA 3L9UA 2DMLA 1XVQA 3FZ5A 1AQXA 1S3CA 1X0RA 4GSTA 4V2NA 1VF4A 2H0GA 1TI3A 1J9BA 1EWXA 4KB3A 4HJMA 3KGKA 1F6MC 4BIKA 4QL7A 2C0GA 4OWYA 1C72A 1XWCA 4HUAA 5CRDA 3CRUA 2IIYA 2ES7A 3D5JA 1VF3A 4IW9A 3HDCA 1GSSA 2LRCA 1SK1A 4TN8A 1FHEA 2JZSA 2GDRA 3P2AA 2FWGA 4XCSA 1BQ7A 3TJBA 4ZBDA 1Z6MA 1TXXA 1N2AA 3G9BA 3GRXA 4AJ6A 3ZVJD 2LV3A 3KD0A 1TRUA 2KOKA 2QA1A 4F03A 5HR0A 4K7IA 1TJDA 4IP6A 3EU3A 1M2AA 2C8UA 2GSSA 5ELGA 4HSCX 1LU4A 4K1FA 2N5FA 1TRSA 1JZRA 1BJXA 1W4VA 1SL1B 3ISOA 1MEKA 3TJJA 4D73A 2L6DA 2B1KA 1O7UA 2R0CA 2IN3A 5KN3A 4Z2TA 1ERTA 3HVNA 3TOUA 1GTAA 3TRXA 1K0CA 2H30A 3GA4A 3IXRA 4JBBA 2O7KA 4X0XA 2C0FA 2DJKA 4PX1A 5C00A 4V2LA 3RAZA 2H74A 2YWIA 4Q5RA 5F07A 5J5NA 2JSZA 3CTFA 4MDCA 3KJYA 5IOWA 5F05A 3IOSA 2LRNA 2IJYA 3FK8A 3TB2A 1ZYNA 2IMDA 4K5SA 1E2YA 2GQLA 4OFTA 4XTSA 2DSAA 2IFQB 4WBJA 2OE0A 3VPQA 1PX6A 5G2ZA 4TW5A 1PD21 2C0DA 5IM9A 1PQNA 2PGTA 2HT9A 4ZXGA 4YAVA 5IMFA 1FO5A 4N10A 3D21A 4I6XA 5G1LA 3IHGA 3BD2A 3GMFA 1ZZYA 2WS2A 1SD8A 8GSSA 3HVVA 1GL8A 1PMTA 4HU9A 3VFIA 4TR3A 3G7IA 4JZQA 1HNCA 1WE0A 5C04A 2HZFA 3LG6A 3MWHA 3KM6A 5GAND 3Q6OA 3ZZXA 3LXZA 4MF7A 5E59A 4IJ3A 2PBJA 2GVPA 1PGTA 3MSZA 4MF6A 2H01A 4MJCA 3RPPA 4TXVA 2ON5A 4O5RA 4ECCA 1XCCA 2F8FA 4ILFA 4IS0A 5F06A 2F51A 2PVOC 1JLWA 1GTUA 2V2GA 3DRNA 2X64A 3IPZA 4NAXA 4D73B 2HRNA 1Q98A 1ERUA 3EMPA 3F6FA 3OR5A 1U3AA 4ZB6A 2EC4A 4GQCA 2H73A 1YF0A 1O8XA 3APOA 4CY8A 5B6MA 1G6YA 4CW9A 3HJOA 3FW2A 2FCHA 2K6VA 4G9HA 2G0FA 4PUFC 2PN8A 4ICYA 4I2TA 2GZPA 1F3BA 1PX7A 2FNOA 4ID0A 4BVYA 1A8LA 2L5OA 4Z2RA 3US3A 4EIQA 2OBIA 3VI5A 1ACVA 1B9YC 1A0FA 2HRKA 1M2DA 1GTIA 2GQKA 1EV9A 3KTLA 2H0IA 22GSA 4G2EA 6GSSA 2V6KA 2E2MA 1GP1A 5D96A 4MABA 3IHQA 3HY2A 3IA1A 2CT6A 1Z6NA 1MD4A 4TR1A 1PRXA 2KUCA 2C0EA 4NHZA 3R2QA 5J4UA 3KMOA 4ZBBA 2HYXA 1SENA 2HRFA 1OC9A 2H1BA 1OYJA 1Q4JA 1GSUA 3DWVA 1SJ6A 1K0BA 5D9WA 5B8BA 2VL3A 2B3SA 2FWFA 3F4TA 1O8WA 3IK9A 2REMA 1B9XC 3UOMA 2XBIA 4POKA 1WMJA 5J9BA 2FWEA 2A2SA 2H0HA 3GYKA 5B6NA 5KOWA 3KH9A 4G0KA 2MMAA 3LYPA 4P3YB 1SL0B 4OD7A 2VL2A 3D6IA 3GSSA 1YF1A 4L0UA 1KTEA 2EIOA 4ZL9A 4YH2A 3UARA 3M3MA 3L0HA 1X9WB 3P7XA 4RI7A 4TVEA 1B48A 1AQWA 1XOAA 1M99A 1SU9A 2CVBA 3KIJA 5ECLB 2MZCA 3CSJA 2YJHA 3EMXA 1XBSA 2Z9SA 4GXZA 1EGOA 1G7OA 2L57A 1CQHA 1R5PA 1LJRA 2N5BA 3FEUA 1I5GA 2IMIA 1YQ1A 2CAIA 2E7PA 3IAM2 3IRAA 3KP8A 4NMUA 5AISA 1AW9A 4V1Ag 3ERGA 4LMWA 4YQMA 2JL4A 5L71A 4K0GA 1ZGNA 4BPYA 1URMA 1PKZA 4J57E 2VCTA 2X8CA 2QC7A 1EV4A 1Z7RA 1WP0A 4K5RA 2HRAA 3GX8A 1TU8A 2V6OA 2XC2A 1U3IA 4FQUA 2B7JA 1B4PA 4L5OA 5F0GA 10GSA 4BVYB 1ZYEA 2HSHA 2PERA 4EDYA 2RM6A 3FZ4A 5HFIA 2BJXA 3HXSA 4G0LA 1JZOA 3E3EA 3MYDA 4ML6A 3UEMA 1ST9A 2LS5A 3A2WA 5CYYA 4KA0A 5GSSA 5F8BA 5CAXA 4MZWA 1SKRB 3TRPA 4TR1B 1B8XA 4I2UA 1T1VA 4USSA 1QQ2A 4MZBA 1OC9B 1M0UA 2XHFA 4ZB8A 1U6TA 3HKRA 2R5GA 5CRGA 4O7HA 2GT5A 4E8EA 3FR6A 3G7JA 4G19A 5KN0A 3VWUA 2TIRA 2CAQA 1BYEA 2MBSA 1K0NA 4PGTA 4V1Ap 2AAWA 3RBTA 2CVDA 3EWLA 1XWKA 1XW9A 4HZ2A 5EY6A 1Z9HA 3HA9A 2C3TA 2F3MA 5IO2A 5D8IA 1IYIA 3CSIA 1X9SB 1Z5YE 1T8EB 3LSZA 1XWBA 1BAYA 5ECKB 2K18A 2DBCA 5GSTA 3FHKA 2B7KA 3FKFA 3GL5A 4KH7A 4TKYA 4OCEA 4KAEA 3W8JA 2LRTA 1JZWA 4WR4A 2A4VA 4XHMA 2FGXA 1A23A 2DJ0A 4KGIA 1A2JA 1M2BA 4CY6A 1Y6EA 4EKZA 1MTCA 4WEYA 2OE3A 5DQYA 5IMZA 1Z3EA 1OC8A 1TU7A 5ECRB 4HU7A 5ID2A 2VUPA 4DSRA 5ECQB 4GSSA 2H75A 1GULA 2PVQA 3ZLPA 1RQMA 3TDGA 2HSYA 1ERVA 4KW6A 3GKMA 4F0BA 2L5LA 2H19A 2R4VA 3TCOA 4LL1B 3ZRDA 2YWOA 3BJ5A 4N0VA 5G30A 1FAAA 5HFGA 2B5XA 3RHBA 3RPNA 3L9VA 4LL4B 4Z2UA 2I3YA 4BL7A 5DJLA 1EOHA 1NM3A 4I97A 16GSA 3Q19A 3KCMA 5ECPB 2IL3A 2RLIA 2GT6A 2GS3A 2PU9C 4ECBA 1FOVA 2K8VA 3GKXA
chains in the Genus database with same CATH topology
2YCDA 1HNBA 2AUVA 2HNLA 3PINA 3UAPA 1IYHA 3WYWA 2BTOT 4EXJA 1PKWA 12GSA 5D9TA 5LCZA 4FYCA 3GL3A 3VURA 2WDUA 3LEFA 3ZFLA 3WT1A 4EF0A 3IC8A 3VWVA 1JLVA 3ZIVA 4K0NA 4OO4A 4IN0A 3D4MA 4NWYA 5ECNB 2VCWA 1HQOA 1THXA 1DE1A 2CQ9A 2VM1A 3MNGA 2LJAA 5ENUA 3IE3A 1WJKA 1SD9A 3ZTLA 2L6CA 4EE0A 2QKEA 1PN0A 5IMDA 5JCGA 1HYUA 1ZYPA 3QD9A 3TJGA 5JCWA 4YAPA 2H6YA 5CRHA 2N5AA 3O76A 2VL9A 4HEA2 1GH2A 3ZL5A 1UVZA 5CRWA 5ECMB 3LGCA 3F3QA 2JADA 4IHUA 4OCFA 4N0ZA 2B6MA 2M46A 4O92A 4NV2A 3VWWA 2KP2A 2MYGA 1TRWA 2X8HA 3WGDA 4GWRA 3TKSA 4ZL7A 3H8QA 2MMOA 4GSNA 1F3AA 2A4HA 2IMFA 4F9ZA 1YJ6A 5DDLA 3ERFA 2DLXA 5A4UA 5ID2B 1XWGA 2P0GA 3GURA 2VL2C 1XWAA 4NV5A 4XS1A 2C3NA 2O85A 5B7CA 1K3OA 3ZFBA 4HJ2A 2LNSA 1NHOA 3HJPA 4GLTA 2QGVA 4RUVA 2WGRA 3K8NA 3DMLA 1QK8A 4Q5QA 5H5SA 4KDXA 1T3BA 2E0QA 2DJJA 2R0GA 2VD1A 3H93A 1VRSD 1SKWB 1CQGA 4MLYA 1BEDA 5A4WA 1DSBA 4BL7B 4KDUA 2VCQA 4BA7A 2L4CA 2AYTA 4O32A 1TK8B 2TRCP 3EINA 2WCIA 3C1SA 4ZL8A 2FWHA 4KF9A 4BWQA 3A5IA 2IMKA 1GRXA 1GSDA 5AN1A 2V32A 2KP1A 5D93A 3KXOA 1FB6A 4WKWA 3C8EA 2OA7A 1E6BA 1WOUA 3TKSE 20GSA 1PL1A 4XS6A 5KN2A 3A2XA 1V57A 4HDEA 2DKHA 3IK7A 5AGYA 3FZAA 2IWTA 3EC3A 4WR5A 4NHWA 2NTOA 3N9JA 2YNXA 3GIXA 4MK3A 5J41A 4PQIA 2GSQA 2OJLA 4LMVA 3IAS2 3QAVA 1EP8A 3J7Yk 3DKSA 4FH8A 3H79A 1OE8A 1V9WA 3LYKA 4O5QA 1V2AA 3CTGA 4GQFA 5IMCA 2QSIA 5AIXA 1TRVA 4AF2A 1KNGA 2AV4A 3NZNA 5DAKA 4KSOA 5DCHA 1XZOA 1RK4A 3RHCA 1ILOA 3EE2A 1TP9A 5ECIB 2H1DA 3N5OA 3C73A 2FA8A 4JRRA 5KOXA 1MD3A 3GKNA 4ECIA 3CMIA 4Z7XA 1O73A 3GX0A 3KTBA 2GZYA 3MIXA 3VWXA 5FHIA 1M7TA 4KUNA 1V58A 4X43A 3P8WA 1JZDA 3DVWA 4XIHA 1Y25A 4IQ1A 1XW6A 5HR2A 4XRAA 4IVFA 2RUEA 2P31A 2YZUA 3UIWA 2RUFA 4HQSA 2X49A 2WULA 3M9JA 1A2LA 5HR1A 4ULXA 1AXDA 1R26A 3S9FA 2TRXA 1T00A 4HOJA 1A8YA 2GTUA 3VK9A 4F82A 4EIPA 2HLSA 3HD5A 2C1YA 3DXBA 4CHSA 1GSEA 2YP6A 4DVCA 2VCZA 4TXOA 1T4ZA 1PA3A 2WZ9A 3F4RA 3HVSA 2H76A 3UBLA 4KX4A 5INYA 3LJRA 3L9SA 4ML1A 4AJ7A 1EP7A 5DBQA 1MDKA 1I9DA 1F9MA 4XRDA 1U88A 1GTBA 2YPMA 5EPFA 2ON7A 2LUSA 2GQMA 3IDVA 1JFUA 4K2DA 13GSA 4MH2A 3ED3A 1OC3A 2VLTA 1G6WA 3QFAC 2LTKA 3QMXA 3TKRA 1RW1A 3GSTA 3QFBC 2UZ8A 3EYTA 1S3DA 2I4AA 5CREA 3H1NA 2XBQA 4AJ8A 1XVWA 5J9CA 1K0DA 2CVKA 5FWGA 3BBYA 4PNGA 3QAGA 4ACSA 1FB0A 5DAKB 4HI7A 2B5YA 2R0PA 4YQVA 2EIRA 1QXHA 2X4AA 1GUHA 3NOFA 3GV1A 3DVXA 4FO5A 2PPTA 3TOTA 3CSHA 3F63A 3UJ1A 2YV7A 4POBA 3ME8A 1NHYA 4PURA 3FR9A 4IBPA 3E9JB 5G1KA 2OADA 1K3LA 5BRTA 3WT2A 4JEDA 3W6GA 4IP1A 1AQVA 4KNDA 4WF5A 5JWRB 5CNWA 4TR4A 4NXIA 2M80A 3ZREA 2YWNA 3RDWA 3A3TA 4N11A 4OO5A 1S3AA 4JU5A 1M9AA 4I8BA 1H4OA 4G0IA 5IO0A 5KN1A 2QA2A 3GH9A 4IGJA 4Q5FA 2OBKA 2DC5A 3M9KA 2KHPA 2L59A 4MCUA 3LXTA 2VCVA 3WGXA 4MJBA 5A4VA 4MMMA 1A24A 4PXOA 4WF4A 3M1GA 3QDNA 3J7Yb 3G7YA 5DQSA 1TDIA 11GSA 2C4JA 3UMAA 2YV9A 2FD3A 3HHVA 2DIZA 14GSA 2WFCA 4TXOB 1EEJA 2R3XA 1K3YA 4OFNA 3D22A 6GSXA 1SJIA 3V1WA 5E4WA 1WRYA 4GF0A 1QUWA 17GSA 2NPBA 2HXKA 5G31A 1QGVA 2R2JA 3A2VA 1X5DA 2LJKA 2PUKC 1YEXA 1YKCA 4K8MA 2NBSA 1OVNA 3F0IA 1KEBA 3SWLA 1GLPA 4ZB9A 4L8EA 4IKHA 1YZXA 5DCGA 2O87A 1VF1A 3TUEA 2RIIA 4EUYA 3KEBA 2YN1A 4K7OA 4QL9A 3QOUA 2VM2A 2H6XA 2VLVA 5EL8A 3IBHA 4IQAA 3ERWA 5D9VA 1YDKA 1XXUA 1A2MA 2YZHA 5G5EA 4K6XA 3ZITA 3LWAA 5GZZB 4EO3A 2MBTA 2HSMA 3TRQA 2ZCTA 2DIYA 4IELA 2LEGA 6GSWA 1GSQA 1AUCA 2OACA 4POMA 2CZ2A 5KEJA 2IPAA 5CO3A 4MZCA 1AAZA 5GAPD 2K8SA 2LQQA 1H75A 5IQYA 2GSRA 2P5RA 1G7EA 3Q18A 3PPUA 1PSQA 3UL3A 4RQXA 9GSSA 4K9ZA 3H4KA 2LJRA 1GLQA 2PMTA 1OE7A 4H86A 1GSFA 1T4YA 3APSA 3A5WA 4FIWA 4PNFA 1ON4A 2HZEA 5LD0A 2CV4A 1A0RP 1K0MA 2JACA 5J3RA 5DJMA 4PQ1A 1O81A 4WXTA 3GH6A 4RI6A 4O5UA 1XIYA 1J08A 3SBCA 5DALA 3LW9A 1EGRA 3E0UA 3I43A 2H1GA 3KP9A 4Q5NA 3M0FA 2JU5A 1TK5B 4I5QA 1EEMA 1LBKA 2H8LA 1X5EA 4MNNA 4KE3A 4YQUA 4ZIJA 3HZ8A 4HS1A 4ZILA 2HFDA 3BOAA 19GSA 1T7PB 1JHBA 3JCML 3GTUA 4L0WA 2GZZA 4MP4A 4GCIA 1SL2B 3FY7A 2MMNA 1NW2A 3C7MA 1YY7A 5FT3A 3ZMKA 2NVLA 5HQPA 1FW1A 2MMZA 2JSYA 1EOGA 1G0TA 3PGTA 5IOXA 1OKTA 1EZKA 2VLUA 4YKGA 1O85A 3KZQA 3HCZA 3UVTA 4BWSA 5EVOA 4KCAA 1N8JA 2CZ3A 1UN2A 3GHAA 5ECSA 2JZTA 1SK0A 6GSTA 2DMMA 4A5PA 3NIVA 4BVXA 2CX4A 3DEXA 3L78A 1B4QA 1GUMA 2DJ3A 3ZIJA 3FZ9A 4LA1A 4NPBA 1PN9A 6GSYA 1GNEA 3CYNA 1TOFA 3O3TA 1DBYA 4PTSA 1WPIA 3I9V2 5H5RA 2XPEA 2AJQB 2JZRA 2VO4A 3LFLA 3MAKA 4POLA 18GSA 2X8GA 4ZBAA 4X1UA 1TTZA 4OMVA 2KLXA 3F6DA 1F2EA 3U5RE 1R5AA 1XFLA 2YWMA 3DYRA 3BCKA 3HVXA 4EL1A 2L4QA 2GLRA 2HZEB 1NSWA 3MDKA 2LQOA 1X9MB 1U87A 5JWOB 3QCPA 1PL2A 3GUSA 2H6ZA 1TKDB 7GSSA 1MDJA 4N30A 3APQA 3U6VA 2V1MA 2C80A 2IMEA 3I6AA 5DALB 4G10A 1FVKA 3D4TA 3CXGA 2F9SA 3IC4A 5AIVA 4MF5A 4TR0A 2GGTA 2J9HA 5A5KA 5JCUA 4PUAA 4MPFA 4J56E 3ZVJA 2P5QA 3CRTA 4FYBA 3Q74A 4KCEA 2B1LA 3GTUB 1BG5A 3LORA 4DEJA 2VD0A 3O6TA 2G2QA 1K0OA 4MJEA 2H66A 5LNKe 2ZUPA 2FLSA 1R4WA 3GNJA 3I69A 1QFNA 2J23A 1W89A 2GSTA 2O8VB 3L4NA 4WBRD 4DSSA 4GTUA 3ME7A 3VPTA 4WETA 3W8SA 4TOPA 1Z7PA 4ISDA 5ECOB 2H72A 3ZYWA 3HYPA 2HI7A 1F37A 2R6KA 4IJIA 3F9UA 1ABAA 1SK2A 1K0AA 3DD3A 4XS4A 2YANA 2FY6A 3EU4A 3QPMA 3EVIA 2WJUA 5HR3A 4F2IA 4BVXB 4EC0A 4CDOA 5IPHA 3FRCA 4KDYA 1J0FA 4PQHA 2FA4A 1XOBA 2VCXA 3D0ZA 5B8AA 2HE3A 3TKPA 1ZCPA 3EURA 2A2RA 2V41A 1TI1A 3EPTA 2H71A 1USBA 2R37A 4J2FA 5ELAA 3PH9A 4MJAA 3WD6A 1GWCA 2DJ1A 3KH7A 3P90A 5IPGA 3F3RA 2AHEA 2FUG2 1YEPA 3HZ4A 1FVJA 3QAWA 4HZ4A 4OFMA 2LNTA 3DIEA 2YOIA 2FHEA 1SYRA 3CBUA 1YKAA 4MPGA 1UA5A 2A2PA 4MA9A 1XW5A 2VOCA 1OAZA 2BMXA 1BX9A 5D9XA 3IV4A 4L5LA 2B5EA 1HNAA 2DKIA 3LQ7A 5IMVA 2X99A 4F0CA 1GSYA 1WWJA 2LKUA 3GN3A 2E2GA 3C1RA 4RQRA 1VF2A 4EDZA 6GSUA 1SYXA 5ABRA 3TKQA 2C3QA 4HQZA 1ZOFA 1SJZA 5IMAA 4AGSA 1THOA 2DJ2A 1O6JA 2I1UA 2CX3A 1ERWA 2K9FA 4JR6A 2ZNMA 2EIQA 3WGEA 1AIUA 3GFKA 2I9HA 1VGLA 2VAFA 2OE1A 1R7HA 5G5FA 1UC7A 1WIKA 1M9BA 3DGQA 2CA8A 3PR8A 4MH3A 2M72A 4DSSB 2ALBA 2D2ZA 2I81A 1FOHA 2NDOA 1V40A 4YKFA 5DVBA 1FG4A 1XPVA 1MDIA 1HD2A 1SKSB 4V2MA 3F4SA 4JE1A 1DE2A 3GKKA 2F8AA 4ECJA 2AB6A 3F8UA 5CP1A 4GRFA 1OKDA 4X4JA 2OKAA 4XS4B 5BMUA 3UBKA 2H70A 3IR4A 3C71A 2YJ7A 4KSMA 3KMNA 3FYGA 1AC1A 2XPDA 2WB9A 4QQ7A 2H1AA 1GUKA 3TJKA 5IIZA 2VIMA 1GNWA 1ZYQB 1ML6A 3TGZA 2PWJA 3AY8A 6GSVA 3UVHA 4JR4A 3QR6A 1ZMAA 4K7NA 5COHA 4E8HA 3FR3A 1X5CA 5JWQB 3BCIA 4TRXA 3VLNA 5ECHB 3TJFA 3FMWA 4K2XA 3HJMA 3VI7A 3M8NA 1ZL9A 1TW9A 1DUGA 4LLRA 3ZMLA 2WRTA 2LSTA 1TK0B 3TKSC 4EVMA 5HFKA 2RM5A 5H5QA 4FYUA 3R3EA 4DSQA 2O89A 5D73A 1KBNA 1QMVA 1V98A 2IFQA 3L9UA 2DMLA 1XVQA 3FZ5A 1AQXA 1S3CA 1X0RA 4GSTA 4V2NA 1VF4A 2H0GA 1TI3A 1J9BA 1EWXA 4KB3A 4HJMA 3KGKA 1F6MC 4QL7A 2C0GA 4OWYA 1C72A 1XWCA 4HUAA 5CRDA 3CRUA 2IIYA 2ES7A 3D5JA 1VF3A 4IW9A 3HDCA 1GSSA 2LRCA 1SK1A 4TN8A 1FHEA 2JZSA 2GDRA 3P2AA 2FWGA 4XCSA 1BQ7A 3TJBA 4ZBDA 1Z6MA 1TXXA 1N2AA 3G9BA 3GRXA 4AJ6A 3ZVJD 2LV3A 3KD0A 1TRUA 2KOKA 2QA1A 4F03A 5HR0A 4K7IA 1TJDA 4IP6A 3EU3A 1M2AA 2C8UA 2GSSA 5ELGA 1LU4A 4K1FA 2N5FA 1TRSA 1JZRA 1BJXA 1W4VA 1SL1B 3ISOA 1MEKA 3TJJA 4D73A 2L6DA 2B1KA 1O7UA 2R0CA 2IN3A 5KN3A 4Z2TA 1ERTA 3TOUA 1GTAA 3TRXA 1K0CA 2H30A 3GA4A 3IXRA 4JBBA 2O7KA 4X0XA 2C0FA 2DJKA 4PX1A 5C00A 4V2LA 3RAZA 2H74A 2YWIA 4Q5RA 5F07A 5J5NA 2JSZA 3CTFA 4MDCA 3KJYA 5IOWA 5F05A 3IOSA 2LRNA 2IJYA 3FK8A 3TB2A 1ZYNA 2IMDA 4K5SA 1E2YA 2GQLA 4OFTA 4XTSA 2DSAA 2IFQB 4WBJA 2OE0A 3VPQA 1PX6A 5G2ZA 4TW5A 1PD21 2C0DA 5IM9A 1PQNA 2PGTA 2HT9A 4ZXGA 4YAVA 5IMFA 1FO5A 4N10A 3D21A 4I6XA 5G1LA 3IHGA 3BD2A 3GMFA 1ZZYA 2WS2A 1SD8A 8GSSA 3HVVA 1GL8A 1PMTA 4HU9A 3VFIA 4TR3A 3G7IA 4JZQA 1HNCA 1WE0A 5C04A 2HZFA 3LG6A 3MWHA 3KM6A 5GAND 3Q6OA 3ZZXA 3LXZA 4MF7A 5E59A 4IJ3A 2PBJA 2GVPA 1PGTA 3MSZA 4MF6A 2H01A 4MJCA 3RPPA 4TXVA 2ON5A 4O5RA 4ECCA 1XCCA 2F8FA 4ILFA 4IS0A 5F06A 2F51A 2PVOC 1JLWA 1GTUA 2V2GA 3DRNA 2X64A 3IPZA 4NAXA 4D73B 2HRNA 1Q98A 1ERUA 3EMPA 3F6FA 3OR5A 1U3AA 4ZB6A 2EC4A 4GQCA 2H73A 1YF0A 1O8XA 3APOA 4CY8A 5B6MA 1G6YA 4CW9A 3HJOA 3FW2A 2FCHA 2K6VA 4G9HA 2G0FA 4PUFC 2PN8A 4ICYA 4I2TA 2GZPA 1F3BA 1PX7A 2FNOA 4ID0A 4BVYA 1A8LA 2L5OA 4Z2RA 3US3A 4EIQA 2OBIA 3VI5A 1ACVA 1B9YC 1A0FA 2HRKA 1M2DA 1GTIA 2GQKA 1EV9A 3KTLA 2H0IA 22GSA 4G2EA 6GSSA 2V6KA 2E2MA 1GP1A 5D96A 4MABA 3IHQA 3HY2A 3IA1A 2CT6A 1Z6NA 1MD4A 4TR1A 1PRXA 2KUCA 2C0EA 4NHZA 3R2QA 5J4UA 3KMOA 4ZBBA 2HYXA 1SENA 2HRFA 1OC9A 2H1BA 1OYJA 1Q4JA 1GSUA 3DWVA 1SJ6A 1K0BA 5D9WA 5B8BA 2VL3A 2B3SA 2FWFA 3F4TA 1O8WA 3IK9A 2REMA 1B9XC 3UOMA 2XBIA 4POKA 1WMJA 5J9BA 2FWEA 2A2SA 2H0HA 3GYKA 5B6NA 5KOWA 3KH9A 4G0KA 2MMAA 3LYPA 4P3YB 1SL0B 4OD7A 2VL2A 3D6IA 3GSSA 1YF1A 4L0UA 1KTEA 2EIOA 4ZL9A 4YH2A 3UARA 3M3MA 3L0HA 1X9WB 3P7XA 4RI7A 4TVEA 1B48A 1AQWA 1XOAA 1M99A 1SU9A 2CVBA 3KIJA 5ECLB 2MZCA 3CSJA 2YJHA 3EMXA 1XBSA 2Z9SA 4GXZA 1EGOA 1G7OA 2L57A 1CQHA 1R5PA 1LJRA 2N5BA 3FEUA 1I5GA 2IMIA 1YQ1A 2CAIA 2E7PA 3IAM2 3IRAA 3KP8A 4NMUA 5AISA 1AW9A 4V1Ag 3ERGA 4LMWA 4YQMA 2JL4A 5L71A 4K0GA 1ZGNA 4BPYA 1URMA 1PKZA 4J57E 2VCTA 2X8CA 2QC7A 1EV4A 1Z7RA 1WP0A 4K5RA 2HRAA 3GX8A 1TU8A 2V6OA 2XC2A 1U3IA 4FQUA 2B7JA 1B4PA 4L5OA 5F0GA 10GSA 4BVYB 1ZYEA 2HSHA 2PERA 4EDYA 2RM6A 3FZ4A 5HFIA 2BJXA 3HXSA 4G0LA 1JZOA 3E3EA 3MYDA 4ML6A 3UEMA 1ST9A 2LS5A 3A2WA 5CYYA 4KA0A 5GSSA 5F8BA 5CAXA 4MZWA 1SKRB 3TRPA 4TR1B 1B8XA 4I2UA 1T1VA 4USSA 1QQ2A 4MZBA 1OC9B 1M0UA 2XHFA 4ZB8A 1U6TA 3HKRA 2R5GA 5CRGA 4O7HA 2GT5A 4E8EA 3FR6A 3G7JA 4G19A 5KN0A 3VWUA 2TIRA 2CAQA 1BYEA 2MBSA 1K0NA 4PGTA 4V1Ap 2AAWA 3RBTA 2CVDA 3EWLA 1XWKA 1XW9A 4HZ2A 5EY6A 1Z9HA 3HA9A 2C3TA 2F3MA 5IO2A 5D8IA 1IYIA 3CSIA 1X9SB 1Z5YE 1T8EB 3LSZA 1XWBA 1BAYA 5ECKB 2K18A 2DBCA 5GSTA 3FHKA 2B7KA 3FKFA 3GL5A 4KH7A 4TKYA 4OCEA 4KAEA 3W8JA 2LRTA 1JZWA 4WR4A 2A4VA 4XHMA 2FGXA 1A23A 2DJ0A 4KGIA 1A2JA 1M2BA 4CY6A 1Y6EA 4EKZA 1MTCA 4WEYA 2OE3A 5DQYA 5IMZA 1Z3EA 1OC8A 1TU7A 5ECRB 4HU7A 5ID2A 2VUPA 4DSRA 5ECQB 4GSSA 2H75A 1GULA 2PVQA 3ZLPA 1RQMA 3TDGA 2HSYA 1ERVA 4KW6A 3GKMA 4F0BA 2L5LA 2H19A 2R4VA 3TCOA 4LL1B 3ZRDA 2YWOA 3BJ5A 4N0VA 5G30A 1FAAA 5HFGA 2B5XA 3RHBA 3RPNA 3L9VA 4LL4B 4Z2UA 2I3YA 4BL7A 5DJLA 1EOHA 1NM3A 4I97A 16GSA 3Q19A 3KCMA 5ECPB 2IL3A 2RLIA 2GT6A 2GS3A 2PU9C 4ECBA 1FOVA 2K8VA 3GKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YCD A;  1HNB A;  2AUV A;  2HNL A;  3PIN A;  3UAP A;  1IYH A;  3WYW A;  2BTO T;  4EXJ A;  1PKW A;  12GS A;  5D9T A;  5LCZ A;  4FYC A;  3GL3 A;  3VUR A;  2WDU A;  3LEF A;  3ZFL A;  3WT1 A;  4EF0 A;  3VWV A;  1JLV A;  3ZIV A;  4K0N A;  4OO4 A;  4IN0 A;  3D4M A;  4NWY A;  5ECN B;  2VCW A;  1HQO A;  1THX A;  1DE1 A;  2CQ9 A;  2VM1 A;  3MNG A;  2LJA A;  5ENU A;  3IE3 A;  1WJK A;  1SD9 A;  3ZTL A;  2L6C A;  4EE0 A;  2QKE A;  5IMD A;  5JCG A;  1HYU A;  3QD9 A;  3TJG A;  5JCW A;  4YAP A;  2H6Y A;  5CRH A;  2N5A A;  3O76 A;  2VL9 A;  4HEA 2;  1GH2 A;  3ZL5 A;  1UVZ A;  5CRW A;  5ECM B;  3LGC A;  3F3Q A;  2JAD A;  4IHU A;  4OCF A;  4N0Z A;  2B6M A;  2M46 A;  4O92 A;  4NV2 A;  3VWW A;  2KP2 A;  2MYG A;  1TRW A;  2X8H A;  3WGD A;  4GWR A;  3TKS A;  4ZL7 A;  3H8Q A;  2MMO A;  4GSN A;  1F3A A;  2IMF A;  4F9Z A;  1YJ6 A;  5DDL A;  3ERF A;  2DLX A;  5A4U A;  5ID2 B;  1XWG A;  2P0G A;  3GUR A;  2VL2 C;  1XWA A;  4NV5 A;  4XS1 A;  2C3N A;  2O85 A;  5B7C A;  1K3O A;  3ZFB A;  4HJ2 A;  2LNS A;  1NHO A;  3HJP A;  4GLT A;  2QGV A;  4RUV A;  2WGR A;  3K8N A;  3DML A;  1QK8 A;  4Q5Q A;  5H5S A;  4KDX A;  1T3B A;  2E0Q A;  2DJJ A;  2VD1 A;  3H93 A;  1VRS D;  1SKW B;  1CQG A;  4MLY A;  1BED A;  5A4W A;  1DSB A;  4KDU A;  2VCQ A;  4BA7 A;  2L4C A;  2AYT A;  4O32 A;  1TK8 B;  2TRC P;  3EIN A;  2WCI A;  3C1S A;  4ZL8 A;  2FWH A;  4BWQ A;  2IMK A;  1GRX A;  1GSD A;  5AN1 A;  2V32 A;  2KP1 A;  5D93 A;  3KXO A;  1FB6 A;  4WKW A;  3C8E A;  2OA7 A;  1E6B A;  1WOU A;  3TKS E;  20GS A;  1PL1 A;  4XS6 A;  5KN2 A;  3A2X A;  1V57 A;  3IK7 A;  4HDE A;  5AGY A;  3FZA A;  2IWT A;  3EC3 A;  4WR5 A;  4NHW A;  2NTO A;  3N9J A;  2YNX A;  3GIX A;  4MK3 A;  5J41 A;  4PQI A;  2GSQ A;  2OJL A;  4LMV A;  3IAS 2;  3QAV A;  1EP8 A;  3J7Y k;  3DKS A;  4FH8 A;  3H79 A;  1OE8 A;  1V9W A;  3LYK A;  1V2A A;  3CTG A;  4GQF A;  5IMC A;  2QSI A;  5AIX A;  1TRV A;  4AF2 A;  1KNG A;  2AV4 A;  3NZN A;  5DAK A;  4KSO A;  5DCH A;  1XZO A;  1RK4 A;  3RHC A;  1ILO A;  3EE2 A;  5ECI B;  1TP9 A;  2H1D A;  3N5O A;  3C73 A;  2FA8 A;  4JRR A;  1MD3 A;  3GKN A;  4ECI A;  3CMI A;  4Z7X A;  1O73 A;  3GX0 A;  3KTB A;  2GZY A;  3VWX A;  5FHI A;  1M7T A;  4KUN A;  1V58 A;  4X43 A;  3P8W A;  1JZD A;  3DVW A;  4XIH A;  1Y25 A;  4IQ1 A;  1XW6 A;  5HR2 A;  4XRA A;  4IVF A;  2RUE A;  2P31 A;  2YZU A;  3UIW A;  2RUF A;  4HQS A;  2WUL A;  3M9J A;  1A2L A;  5HR1 A;  4ULX A;  1AXD A;  1R26 A;  3S9F A;  2TRX A;  1T00 A;  4HOJ A;  1A8Y A;  2GTU A;  3VK9 A;  4F82 A;  2HLS A;  3HD5 A;  2C1Y A;  3DXB A;  4CHS A;  1GSE A;  2YP6 A;  4DVC A;  2VCZ A;  4TXO A;  1T4Z A;  1PA3 A;  2WZ9 A;  3F4R A;  3HVS A;  2H76 A;  3UBL A;  4KX4 A;  5INY A;  3LJR A;  3L9S A;  4ML1 A;  4AJ7 A;  5DBQ A;  1EP7 A;  1MDK A;  1I9D A;  1F9M A;  4XRD A;  1U88 A;  1GTB A;  2YPM A;  5EPF A;  2ON7 A;  2LUS A;  2GQM A;  3IDV A;  1JFU A;  4K2D A;  13GS A;  4MH2 A;  3ED3 A;  1OC3 A;  2VLT A;  1G6W A;  3QFA C;  2LTK A;  3QMX A;  3TKR A;  1RW1 A;  3GST A;  3QFB C;  3EYT A;  1S3D A;  2I4A A;  5CRE A;  3H1N A;  2XBQ A;  4AJ8 A;  1XVW A;  5J9C A;  1K0D A;  2CVK A;  5FWG A;  3BBY A;  4PNG A;  3QAG A;  4ACS A;  1FB0 A;  5DAK B;  4HI7 A;  2B5Y A;  4YQV A;  2EIR A;  1QXH A;  1GUH A;  3NOF A;  3GV1 A;  3DVX A;  4FO5 A;  2PPT A;  3TOT A;  3CSH A;  3F63 A;  3UJ1 A;  2YV7 A;  4POB A;  3ME8 A;  1NHY A;  4PUR A;  3FR9 A;  4IBP A;  3E9J B;  5G1K A;  2OAD A;  1K3L A;  3WT2 A;  4JED A;  3W6G A;  4IP1 A;  1AQV A;  4KND A;  4WF5 A;  5JWR B;  5CNW A;  4TR4 A;  4NXI A;  2M80 A;  3ZRE A;  2YWN A;  3RDW A;  3A3T A;  4N11 A;  4OO5 A;  1S3A A;  4JU5 A;  1M9A A;  4I8B A;  1H4O A;  5IO0 A;  5KN1 A;  3GH9 A;  4IGJ A;  4Q5F A;  2OBK A;  2DC5 A;  3M9K A;  2KHP A;  2L59 A;  4MCU A;  3LXT A;  2VCV A;  3WGX A;  4MJB A;  5A4V A;  4MMM A;  1A24 A;  4PXO A;  4WF4 A;  3M1G A;  3QDN A;  3J7Y b;  3G7Y A;  5DQS A;  1TDI A;  11GS A;  2C4J A;  3UMA A;  2YV9 A;  2FD3 A;  3HHV A;  2DIZ A;  14GS A;  2WFC A;  4TXO B;  1EEJ A;  2R3X A;  1K3Y A;  4OFN A;  3D22 A;  6GSX A;  1SJI A;  3V1W A;  5E4W A;  1WRY A;  4GF0 A;  1QUW A;  17GS A;  2NPB A;  2HXK A;  5G31 A;  1QGV A;  2R2J A;  3A2V A;  1X5D A;  2LJK A;  2PUK C;  1YEX A;  1YKC A;  4K8M A;  2NBS A;  1OVN A;  3F0I A;  1KEB A;  3SWL A;  1GLP A;  4ZB9 A;  4L8E A;  4IKH A;  1YZX A;  5DCG A;  2O87 A;  1VF1 A;  3TUE A;  2RII A;  4EUY A;  3KEB A;  2YN1 A;  4K7O A;  4QL9 A;  3QOU A;  2VM2 A;  2H6X A;  2VLV A;  5EL8 A;  3IBH A;  4IQA A;  3ERW A;  5D9V A;  1YDK A;  1XXU A;  1A2M A;  2YZH A;  5G5E A;  4K6X A;  3ZIT A;  3LWA A;  5GZZ B;  4EO3 A;  2MBT A;  3TRQ A;  2ZCT A;  2DIY A;  4IEL A;  2LEG A;  6GSW A;  1GSQ A;  1AUC A;  2OAC A;  4POM A;  2CZ2 A;  5KEJ A;  2IPA A;  5CO3 A;  4MZC A;  1AAZ A;  5GAP D;  2K8S A;  2LQQ A;  1H75 A;  5IQY A;  2GSR A;  2P5R A;  1G7E A;  3Q18 A;  1PSQ A;  3UL3 A;  4RQX A;  9GSS A;  4K9Z A;  3H4K A;  2LJR A;  1GLQ A;  2PMT A;  1OE7 A;  4H86 A;  1GSF A;  1T4Y A;  3APS A;  3A5W A;  4FIW A;  4PNF A;  1ON4 A;  2HZE A;  5LD0 A;  2CV4 A;  1A0R P;  1K0M A;  2JAC A;  5J3R A;  5DJM A;  4PQ1 A;  1O81 A;  4WXT A;  3GH6 A;  4RI6 A;  1XIY A;  1J08 A;  3SBC A;  5DAL A;  1EGR A;  3E0U A;  3I43 A;  2H1G A;  3KP9 A;  4Q5N A;  3M0F A;  2JU5 A;  1TK5 B;  4I5Q A;  1EEM A;  1LBK A;  2H8L A;  1X5E A;  4KE3 A;  4YQU A;  4ZIJ A;  3HZ8 A;  4HS1 A;  4ZIL A;  2HFD A;  3BOA A;  19GS A;  1T7P B;  1JHB A;  3JCM L;  3GTU A;  4L0W A;  2GZZ A;  4MP4 A;  4GCI A;  1SL2 B;  3FY7 A;  2MMN A;  1NW2 A;  3C7M A;  1YY7 A;  5FT3 A;  3ZMK A;  2NVL A;  5HQP A;  1FW1 A;  2MMZ A;  2JSY A;  1EOG A;  1G0T A;  3PGT A;  5IOX A;  1OKT A;  1EZK A;  2VLU A;  1O85 A;  3KZQ A;  3HCZ A;  3UVT A;  4BWS A;  5EVO A;  4KCA A;  1N8J A;  2CZ3 A;  1UN2 A;  3GHA A;  5ECS A;  2JZT A;  1SK0 A;  6GST A;  2DMM A;  3NIV A;  4BVX A;  2CX4 A;  3DEX A;  3L78 A;  1B4Q A;  1GUM A;  2DJ3 A;  3ZIJ A;  3FZ9 A;  4LA1 A;  4NPB A;  1PN9 A;  6GSY A;  1GNE A;  3CYN A;  1TOF A;  3O3T A;  1DBY A;  1WPI A;  3I9V 2;  5H5R A;  2XPE A;  2AJQ B;  2JZR A;  2VO4 A;  3LFL A;  3MAK A;  4POL A;  18GS A;  2X8G A;  4ZBA A;  4X1U A;  1TTZ A;  4OMV A;  2KLX A;  3F6D A;  1F2E A;  3U5R E;  1R5A A;  1XFL A;  2YWM A;  3DYR A;  3BCK A;  3HVX A;  4EL1 A;  2L4Q A;  2GLR A;  2HZE B;  1NSW A;  3MDK A;  2LQO A;  1X9M B;  1U87 A;  5JWO B;  3QCP A;  1PL2 A;  3GUS A;  2H6Z A;  1TKD B;  7GSS A;  1MDJ A;  4N30 A;  3APQ A;  3U6V A;  2V1M A;  2C80 A;  2IME A;  3I6A A;  5DAL B;  4G10 A;  1FVK A;  3D4T A;  3CXG A;  2F9S A;  3IC4 A;  5AIV A;  4MF5 A;  4TR0 A;  2GGT A;  2J9H A;  5A5K A;  5JCU A;  4PUA A;  4MPF A;  4J56 E;  3ZVJ A;  2P5Q A;  3CRT A;  4FYB A;  3Q74 A;  4KCE A;  2B1L A;  3GTU B;  1BG5 A;  3LOR A;  4DEJ A;  2VD0 A;  3O6T A;  2G2Q A;  1K0O A;  4MJE A;  2H66 A;  5LNK e;  2ZUP A;  2FLS A;  1R4W A;  3GNJ A;  3I69 A;  1QFN A;  2J23 A;  1W89 A;  2GST A;  2O8V B;  3L4N A;  4WBR D;  4DSS A;  4GTU A;  3ME7 A;  3VPT A;  4WET A;  3W8S A;  4TOP A;  1Z7P A;  4ISD A;  5ECO B;  2H72 A;  3ZYW A;  3HYP A;  2HI7 A;  1F37 A;  2R6K A;  4IJI A;  3F9U A;  1ABA A;  1SK2 A;  1K0A A;  3DD3 A;  4XS4 A;  2YAN A;  2FY6 A;  3EU4 A;  3QPM A;  3EVI A;  2WJU A;  5HR3 A;  4F2I A;  4EC0 A;  4CDO A;  5IPH A;  3FRC A;  4KDY A;  1J0F A;  4PQH A;  2FA4 A;  1XOB A;  2VCX A;  3D0Z A;  5B8A A;  2HE3 A;  3TKP A;  1ZCP A;  3EUR A;  2A2R A;  2V41 A;  1TI1 A;  2H71 A;  1USB A;  2R37 A;  4J2F A;  5ELA A;  3PH9 A;  4MJA A;  3WD6 A;  1GWC A;  2DJ1 A;  3KH7 A;  3P90 A;  5IPG A;  3F3R A;  2AHE A;  2FUG 2;  1YEP A;  3HZ4 A;  1FVJ A;  3QAW A;  4HZ4 A;  4OFM A;  2LNT A;  3DIE A;  2YOI A;  2FHE A;  1SYR A;  3CBU A;  1YKA A;  4MPG A;  1UA5 A;  4MA9 A;  1XW5 A;  2VOC A;  1OAZ A;  2BMX A;  1BX9 A;  5D9X A;  3IV4 A;  4L5L A;  2B5E A;  1HNA A;  3LQ7 A;  5IMV A;  2X99 A;  4F0C A;  1GSY A;  1WWJ A;  2LKU A;  3GN3 A;  2E2G A;  3C1R A;  4RQR A;  1VF2 A;  4EDZ A;  6GSU A;  1SYX A;  5ABR A;  3TKQ A;  2C3Q A;  4HQZ A;  1ZOF A;  1SJZ A;  5IMA A;  4AGS A;  1THO A;  2DJ2 A;  1O6J A;  2I1U A;  2CX3 A;  1ERW A;  2K9F A;  4JR6 A;  2ZNM A;  2EIQ A;  3WGE A;  1AIU A;  3GFK A;  2I9H A;  1VGL A;  2VAF A;  2OE1 A;  1R7H A;  5G5F A;  1UC7 A;  1WIK A;  1M9B A;  3DGQ A;  2CA8 A;  3PR8 A;  4MH3 A;  2M72 A;  4DSS B;  2ALB A;  2D2Z A;  2I81 A;  2NDO A;  1V40 A;  5DVB A;  1FG4 A;  1XPV A;  1MDI A;  1HD2 A;  1SKS B;  4V2M A;  3F4S A;  4JE1 A;  1DE2 A;  3GKK A;  2F8A A;  4ECJ A;  2AB6 A;  3F8U A;  5CP1 A;  4GRF A;  1OKD A;  2OKA A;  4XS4 B;  3UBK A;  2H70 A;  3IR4 A;  3C71 A;  2YJ7 A;  4KSM A;  3KMN A;  3FYG A;  1AC1 A;  2XPD A;  2WB9 A;  4QQ7 A;  2H1A A;  1GUK A;  3TJK A;  5IIZ A;  2VIM A;  1GNW A;  1ZYQ B;  1ML6 A;  3TGZ A;  2PWJ A;  3AY8 A;  6GSV A;  3UVH A;  4JR4 A;  3QR6 A;  1ZMA A;  4K7N A;  5COH A;  4E8H A;  3FR3 A;  1X5C A;  5JWQ B;  3BCI A;  4TRX A;  3VLN A;  5ECH B;  3TJF A;  3HJM A;  3VI7 A;  3M8N A;  1ZL9 A;  1TW9 A;  1DUG A;  4LLR A;  3ZML A;  2WRT A;  2LST A;  1TK0 B;  3TKS C;  4EVM A;  5HFK A;  2RM5 A;  5H5Q A;  4FYU A;  4DSQ A;  2O89 A;  5D73 A;  1KBN A;  1QMV A;  1V98 A;  2IFQ A;  3L9U A;  2DML A;  1XVQ A;  3FZ5 A;  1AQX A;  1S3C A;  1X0R A;  4GST A;  4V2N A;  1VF4 A;  2H0G A;  1TI3 A;  1J9B A;  1EWX A;  4KB3 A;  4HJM A;  3KGK A;  1F6M C;  4QL7 A;  2C0G A;  4OWY A;  1C72 A;  1XWC A;  4HUA A;  5CRD A;  3CRU A;  2IIY A;  2ES7 A;  3D5J A;  1VF3 A;  4IW9 A;  3HDC A;  1GSS A;  2LRC A;  1SK1 A;  4TN8 A;  1FHE A;  2JZS A;  2GDR A;  3P2A A;  2FWG A;  4XCS A;  1BQ7 A;  3TJB A;  4ZBD A;  1Z6M A;  1TXX A;  1N2A A;  3G9B A;  3GRX A;  4AJ6 A;  3ZVJ D;  2LV3 A;  3KD0 A;  1TRU A;  2KOK A;  5HR0 A;  4F03 A;  4K7I A;  1TJD A;  4IP6 A;  3EU3 A;  1M2A A;  2C8U A;  2GSS A;  5ELG A;  1LU4 A;  4K1F A;  2N5F A;  1TRS A;  1JZR A;  1BJX A;  1W4V A;  1SL1 B;  3ISO A;  1MEK A;  3TJJ A;  4D73 A;  2L6D A;  2B1K A;  1O7U A;  2IN3 A;  5KN3 A;  1ERT A;  3TOU A;  1GTA A;  3TRX A;  1K0C A;  2H30 A;  3GA4 A;  3IXR A;  4JBB A;  2O7K A;  4X0X A;  2C0F A;  2DJK A;  4PX1 A;  5C00 A;  4V2L A;  3RAZ A;  2H74 A;  2YWI A;  4Q5R A;  5F07 A;  5J5N A;  2JSZ A;  3CTF A;  4MDC A;  3KJY A;  5IOW A;  5F05 A;  3IOS A;  2LRN A;  2IJY A;  3FK8 A;  3TB2 A;  2IMD A;  1E2Y A;  2GQL A;  4OFT A;  4XTS A;  2DSA A;  2IFQ B;  4WBJ A;  2OE0 A;  3VPQ A;  1PX6 A;  5G2Z A;  4TW5 A;  1PD2 1;  2C0D A;  5IM9 A;  1PQN A;  2PGT A;  2HT9 A;  4ZXG A;  4YAV A;  5IMF A;  1FO5 A;  4N10 A;  3D21 A;  4I6X A;  5G1L A;  3BD2 A;  3GMF A;  1ZZY A;  2WS2 A;  1SD8 A;  8GSS A;  3HVV A;  1GL8 A;  1PMT A;  4HU9 A;  3VFI A;  4TR3 A;  3G7I A;  4JZQ A;  1HNC A;  1WE0 A;  5C04 A;  2HZF A;  3LG6 A;  3MWH A;  3KM6 A;  5GAN D;  3Q6O A;  3ZZX A;  3LXZ A;  4MF7 A;  5E59 A;  4IJ3 A;  2PBJ A;  2GVP A;  1PGT A;  3MSZ A;  4MF6 A;  2H01 A;  4MJC A;  3RPP A;  4TXV A;  2ON5 A;  4O5R A;  4ECC A;  1XCC A;  2F8F A;  4ILF A;  4IS0 A;  5F06 A;  2F51 A;  2PVO C;  1JLW A;  1GTU A;  2V2G A;  3DRN A;  2X64 A;  3IPZ A;  4NAX A;  4D73 B;  2HRN A;  1Q98 A;  1ERU A;  3EMP A;  3F6F A;  3OR5 A;  1U3A A;  4ZB6 A;  2EC4 A;  4GQC A;  2H73 A;  1YF0 A;  1O8X A;  3APO A;  5B6M A;  1G6Y A;  4CW9 A;  3HJO A;  3FW2 A;  2FCH A;  2K6V A;  4G9H A;  2G0F A;  4PUF C;  2PN8 A;  4I2T A;  2GZP A;  1F3B A;  1PX7 A;  2FNO A;  4ID0 A;  4BVY A;  1A8L A;  2L5O A;  3US3 A;  2OBI A;  3VI5 A;  1ACV A;  1B9Y C;  1A0F A;  1M2D A;  1GTI A;  2GQK A;  1EV9 A;  3KTL A;  2H0I A;  22GS A;  4G2E A;  6GSS A;  2V6K A;  2E2M A;  1GP1 A;  5D96 A;  4MAB A;  3IHQ A;  3HY2 A;  3IA1 A;  2CT6 A;  1Z6N A;  1MD4 A;  4TR1 A;  1PRX A;  2KUC A;  2C0E A;  4NHZ A;  3R2Q A;  5J4U A;  3KMO A;  4ZBB A;  2HYX A;  1SEN A;  2HRF A;  1OC9 A;  2H1B A;  1OYJ A;  1Q4J A;  1GSU A;  3DWV A;  1SJ6 A;  1K0B A;  5D9W A;  5B8B A;  2VL3 A;  2B3S A;  2FWF A;  3F4T A;  1O8W A;  3IK9 A;  2REM A;  1B9X C;  3UOM A;  2XBI A;  4POK A;  1WMJ A;  5J9B A;  2FWE A;  2A2S A;  2H0H A;  3GYK A;  5B6N A;  3KH9 A;  2MMA A;  3LYP A;  4P3Y B;  1SL0 B;  4OD7 A;  2VL2 A;  3D6I A;  3GSS A;  1YF1 A;  4L0U A;  1KTE A;  2EIO A;  4ZL9 A;  4YH2 A;  3UAR A;  3M3M A;  3L0H A;  1X9W B;  3P7X A;  4RI7 A;  4TVE A;  1B48 A;  1AQW A;  1XOA A;  1M99 A;  1SU9 A;  2CVB A;  3KIJ A;  5ECL B;  2MZC A;  3CSJ A;  2YJH A;  3EMX A;  1XBS A;  2Z9S A;  4GXZ A;  1EGO A;  1G7O A;  2L57 A;  1CQH A;  1R5P A;  1LJR A;  2N5B A;  3FEU A;  1I5G A;  2IMI A;  1YQ1 A;  2CAI A;  2E7P A;  3IAM 2;  3IRA A;  3KP8 A;  4NMU A;  5AIS A;  1AW9 A;  4V1A g;  3ERG A;  4LMW A;  4YQM A;  2JL4 A;  5L71 A;  4K0G A;  1ZGN A;  4BPY A;  1URM A;  1PKZ A;  4J57 E;  2VCT A;  2X8C A;  2QC7 A;  1EV4 A;  1Z7R A;  1WP0 A;  3GX8 A;  1TU8 A;  2V6O A;  2XC2 A;  1U3I A;  2B7J A;  1B4P A;  4L5O A;  5F0G A;  10GS A;  1ZYE A;  2HSH A;  2PER A;  4EDY A;  2RM6 A;  3FZ4 A;  5HFI A;  2BJX A;  3HXS A;  1JZO A;  3E3E A;  4ML6 A;  3UEM A;  1ST9 A;  2LS5 A;  3A2W A;  5CYY A;  4KA0 A;  5GSS A;  5F8B A;  5CAX A;  4MZW A;  1SKR B;  3TRP A;  4TR1 B;  1B8X A;  4I2U A;  1T1V A;  1QQ2 A;  4MZB A;  1OC9 B;  1M0U A;  2XHF A;  4ZB8 A;  1U6T A;  3HKR A;  2R5G A;  5CRG A;  4O7H A;  2GT5 A;  4E8E A;  3FR6 A;  3G7J A;  4G19 A;  5KN0 A;  3VWU A;  2TIR A;  2CAQ A;  1BYE A;  2MBS A;  1K0N A;  4PGT A;  4V1A p;  2AAW A;  3RBT A;  2CVD A;  3EWL A;  1XWK A;  1XW9 A;  4HZ2 A;  5EY6 A;  1Z9H A;  3HA9 A;  2C3T A;  2F3M A;  5IO2 A;  5D8I A;  1IYI A;  3CSI A;  1X9S B;  1Z5Y E;  1T8E B;  3LSZ A;  1XWB A;  1BAY A;  5ECK B;  2K18 A;  2DBC A;  5GST A;  3FHK A;  2B7K A;  3FKF A;  3GL5 A;  4KH7 A;  4TKY A;  4OCE A;  4KAE A;  3W8J A;  2LRT A;  1JZW A;  4WR4 A;  2A4V A;  4XHM A;  2FGX A;  1A23 A;  2DJ0 A;  4KGI A;  1A2J A;  1M2B A;  1Y6E A;  4EKZ A;  1MTC A;  4WEY A;  2OE3 A;  5DQY A;  5IMZ A;  1Z3E A;  1OC8 A;  1TU7 A;  5ECR B;  4HU7 A;  5ID2 A;  2VUP A;  4DSR A;  5ECQ B;  4GSS A;  2H75 A;  1GUL A;  2PVQ A;  3ZLP A;  1RQM A;  3TDG A;  2HSY A;  1ERV A;  4KW6 A;  3GKM A;  4F0B A;  2L5L A;  2H19 A;  2R4V A;  3TCO A;  4LL1 B;  3ZRD A;  2YWO A;  3BJ5 A;  4N0V A;  5G30 A;  1FAA A;  5HFG A;  2B5X A;  3RHB A;  3RPN A;  3L9V A;  4LL4 B;  2I3Y A;  4BL7 A;  5DJL A;  1EOH A;  1NM3 A;  4I97 A;  16GS A;  3Q19 A;  3KCM A;  5ECP B;  2IL3 A;  2RLI A;  2GT6 A;  2GS3 A;  2PU9 C;  4ECB A;  1FOV A;  2K8V A;  3GKX A; 
#chains in the Genus database with same CATH topology
 2YCD A;  1HNB A;  2AUV A;  2HNL A;  3PIN A;  3UAP A;  1IYH A;  3WYW A;  2BTO T;  4EXJ A;  1PKW A;  12GS A;  5D9T A;  5LCZ A;  4FYC A;  3GL3 A;  3VUR A;  2WDU A;  3LEF A;  3ZFL A;  3WT1 A;  4EF0 A;  3IC8 A;  3VWV A;  1JLV A;  3ZIV A;  4K0N A;  4OO4 A;  4IN0 A;  3D4M A;  4NWY A;  5ECN B;  2VCW A;  1HQO A;  1THX A;  1DE1 A;  2CQ9 A;  2VM1 A;  3MNG A;  2LJA A;  5ENU A;  3IE3 A;  1WJK A;  1SD9 A;  3ZTL A;  2L6C A;  3CQF A;  4EE0 A;  1PFO A;  2QKE A;  1PN0 A;  5IMD A;  5JCG A;  1HYU A;  1ZYP A;  3QD9 A;  3TJG A;  5JCW A;  4YAP A;  2H6Y A;  5CRH A;  2N5A A;  3O76 A;  2VL9 A;  4HEA 2;  1GH2 A;  3ZL5 A;  1UVZ A;  5CRW A;  5ECM B;  3LGC A;  3F3Q A;  2JAD A;  4IHU A;  4OCF A;  4N0Z A;  2B6M A;  2M46 A;  4O92 A;  4NV2 A;  3VWW A;  2KP2 A;  2MYG A;  1TRW A;  2X8H A;  3WGD A;  4GWR A;  3TKS A;  4ZL7 A;  3H8Q A;  2MMO A;  4GSN A;  1F3A A;  2A4H A;  2IMF A;  4F9Z A;  1YJ6 A;  5DDL A;  3ERF A;  2DLX A;  5A4U A;  5ID2 B;  1XWG A;  2P0G A;  3GUR A;  2VL2 C;  1XWA A;  4NV5 A;  4XS1 A;  2C3N A;  2O85 A;  5B7C A;  1K3O A;  3ZFB A;  4HJ2 A;  2LNS A;  1NHO A;  3HJP A;  4GLT A;  2QGV A;  4RUV A;  2WGR A;  3K8N A;  3DML A;  1QK8 A;  4Q5Q A;  5H5S A;  4KDX A;  1T3B A;  2E0Q A;  2DJJ A;  2R0G A;  2VD1 A;  3H93 A;  1VRS D;  1SKW B;  1CQG A;  4MLY A;  1BED A;  5A4W A;  1DSB A;  4BL7 B;  4KDU A;  2VCQ A;  4BA7 A;  2L4C A;  2AYT A;  4O32 A;  1TK8 B;  2TRC P;  3EIN A;  2WCI A;  3C1S A;  4ZL8 A;  2FWH A;  4KF9 A;  4BWQ A;  3A5I A;  2IMK A;  1GRX A;  1GSD A;  5AN1 A;  2V32 A;  2KP1 A;  5D93 A;  3KXO A;  1FB6 A;  4WKW A;  3C8E A;  2OA7 A;  1E6B A;  1WOU A;  3TKS E;  20GS A;  1PL1 A;  4XS6 A;  5KN2 A;  3A2X A;  1V57 A;  4HDE A;  2DKH A;  3IK7 A;  5AGY A;  3FZA A;  2IWT A;  3EC3 A;  4WR5 A;  4NHW A;  2NTO A;  3N9J A;  2YNX A;  3GIX A;  4MK3 A;  5J41 A;  4PQI A;  2GSQ A;  2OJL A;  4LMV A;  3IAS 2;  3QAV A;  1EP8 A;  3J7Y k;  1S3R A;  3DKS A;  4FH8 A;  3H79 A;  1OE8 A;  1V9W A;  3LYK A;  4O5Q A;  1V2A A;  3CTG A;  4GQF A;  5IMC A;  2QSI A;  5AIX A;  1TRV A;  4AF2 A;  1KNG A;  2AV4 A;  3NZN A;  5DAK A;  4KSO A;  5DCH A;  1XZO A;  1RK4 A;  3RHC A;  1ILO A;  3EE2 A;  1TP9 A;  5ECI B;  2H1D A;  3N5O A;  3C73 A;  2FA8 A;  4JRR A;  5KOX A;  1MD3 A;  3GKN A;  4ECI A;  3CMI A;  4Z7X A;  1O73 A;  3GX0 A;  3KTB A;  2GZY A;  3MIX A;  3VWX A;  5FHI A;  1M7T A;  4KUN A;  1V58 A;  4X43 A;  3P8W A;  1JZD A;  3DVW A;  4XIH A;  1Y25 A;  4IQ1 A;  1XW6 A;  5HR2 A;  4XRA A;  4IVF A;  2RUE A;  2P31 A;  2YZU A;  3UIW A;  2RUF A;  4HQS A;  2X49 A;  2WUL A;  3M9J A;  1A2L A;  5HR1 A;  4ULX A;  1AXD A;  1R26 A;  3S9F A;  2TRX A;  1T00 A;  4HOJ A;  1A8Y A;  2GTU A;  3VK9 A;  4F82 A;  4EIP A;  2HLS A;  3HD5 A;  2C1Y A;  3DXB A;  4CHS A;  1GSE A;  2YP6 A;  4DVC A;  2VCZ A;  4TXO A;  1T4Z A;  1PA3 A;  2WZ9 A;  3F4R A;  3HVS A;  2H76 A;  3UBL A;  4KX4 A;  5INY A;  3LJR A;  3L9S A;  4ML1 A;  4AJ7 A;  1EP7 A;  5DBQ A;  1MDK A;  1I9D A;  1F9M A;  4XRD A;  1U88 A;  1GTB A;  2YPM A;  5EPF A;  2ON7 A;  2LUS A;  2GQM A;  3IDV A;  1JFU A;  4K2D A;  13GS A;  4MH2 A;  3ED3 A;  1OC3 A;  2VLT A;  1G6W A;  3QFA C;  2LTK A;  3QMX A;  3TKR A;  1RW1 A;  3GST A;  3QFB C;  2UZ8 A;  3EYT A;  1S3D A;  2I4A A;  5CRE A;  3H1N A;  2XBQ A;  4AJ8 A;  1XVW A;  5J9C A;  1K0D A;  2CVK A;  5FWG A;  3BBY A;  4PNG A;  3QAG A;  4ACS A;  1FB0 A;  5DAK B;  4HI7 A;  2B5Y A;  2R0P A;  4YQV A;  2EIR A;  1QXH A;  2X4A A;  1GUH A;  3NOF A;  3GV1 A;  3DVX A;  4FO5 A;  2PPT A;  3TOT A;  3CSH A;  3F63 A;  3UJ1 A;  2YV7 A;  4POB A;  3ME8 A;  1NHY A;  4PUR A;  3FR9 A;  4IBP A;  3E9J B;  5G1K A;  2OAD A;  1K3L A;  5BRT A;  3WT2 A;  4JED A;  3W6G A;  4IP1 A;  1AQV A;  4KND A;  4WF5 A;  5JWR B;  5CNW A;  4TR4 A;  4NXI A;  2M80 A;  3ZRE A;  2YWN A;  3RDW A;  3A3T A;  4N11 A;  4OO5 A;  1S3A A;  4JU5 A;  1M9A A;  4I8B A;  1H4O A;  4G0I A;  5IO0 A;  5KN1 A;  2QA2 A;  3GH9 A;  4IGJ A;  4Q5F A;  2OBK A;  2DC5 A;  3M9K A;  2KHP A;  2L59 A;  4MCU A;  3LXT A;  2VCV A;  3WGX A;  4MJB A;  5A4V A;  4MMM A;  1A24 A;  4PXO A;  4WF4 A;  3M1G A;  3QDN A;  3J7Y b;  3G7Y A;  5DQS A;  1TDI A;  11GS A;  2C4J A;  3UMA A;  2YV9 A;  2FD3 A;  3HHV A;  2DIZ A;  14GS A;  2WFC A;  4TXO B;  1EEJ A;  2R3X A;  1K3Y A;  4OFN A;  3D22 A;  6GSX A;  1SJI A;  3V1W A;  5E4W A;  1WRY A;  4GF0 A;  1QUW A;  17GS A;  2NPB A;  2HXK A;  5G31 A;  1QGV A;  2R2J A;  3A2V A;  1X5D A;  2LJK A;  2PUK C;  1YEX A;  1YKC A;  4K8M A;  2NBS A;  1OVN A;  3F0I A;  1KEB A;  3SWL A;  1GLP A;  4ZB9 A;  4L8E A;  4IKH A;  1YZX A;  5DCG A;  2O87 A;  1VF1 A;  3TUE A;  2RII A;  4EUY A;  3KEB A;  2YN1 A;  4K7O A;  4QL9 A;  3QOU A;  2VM2 A;  2H6X A;  2VLV A;  5EL8 A;  3IBH A;  4IQA A;  3ERW A;  5D9V A;  1YDK A;  1XXU A;  1A2M A;  2YZH A;  5G5E A;  4K6X A;  3ZIT A;  3LWA A;  5GZZ B;  4EO3 A;  2MBT A;  2HSM A;  3TRQ A;  2ZCT A;  2DIY A;  4IEL A;  2LEG A;  6GSW A;  1GSQ A;  1AUC A;  2OAC A;  4POM A;  2CZ2 A;  5KEJ A;  2IPA A;  5CO3 A;  4MZC A;  1AAZ A;  5GAP D;  2K8S A;  2LQQ A;  1H75 A;  5IQY A;  2GSR A;  2P5R A;  1G7E A;  3Q18 A;  3PPU A;  1PSQ A;  3UL3 A;  4RQX A;  9GSS A;  4K9Z A;  3H4K A;  2LJR A;  1GLQ A;  2PMT A;  1OE7 A;  4H86 A;  1GSF A;  1T4Y A;  3APS A;  3A5W A;  4FIW A;  4PNF A;  1ON4 A;  2HZE A;  5LD0 A;  2CV4 A;  1A0R P;  1K0M A;  2JAC A;  5J3R A;  5DJM A;  4PQ1 A;  1O81 A;  4WXT A;  3GH6 A;  4RI6 A;  4O5U A;  1XIY A;  1J08 A;  3SBC A;  5DAL A;  3LW9 A;  1EGR A;  3E0U A;  3I43 A;  2H1G A;  3KP9 A;  4Q5N A;  3M0F A;  2JU5 A;  1TK5 B;  4I5Q A;  1EEM A;  1LBK A;  2H8L A;  1X5E A;  4MNN A;  4KE3 A;  4YQU A;  4ZIJ A;  3HZ8 A;  4HS1 A;  4ZIL A;  2HFD A;  3BOA A;  19GS A;  1T7P B;  1JHB A;  3JCM L;  3GTU A;  4L0W A;  2GZZ A;  4MP4 A;  4GCI A;  1SL2 B;  3FY7 A;  2MMN A;  1NW2 A;  3C7M A;  1YY7 A;  5FT3 A;  3ZMK A;  2NVL A;  5HQP A;  1FW1 A;  2MMZ A;  2JSY A;  1EOG A;  1G0T A;  3PGT A;  5IOX A;  1OKT A;  1EZK A;  2VLU A;  4YKG A;  1O85 A;  3KZQ A;  3HCZ A;  3UVT A;  4BWS A;  5EVO A;  4KCA A;  1N8J A;  2CZ3 A;  1UN2 A;  3GHA A;  5ECS A;  2JZT A;  1SK0 A;  6GST A;  2DMM A;  4A5P A;  3NIV A;  4BVX A;  2CX4 A;  3DEX A;  3L78 A;  1B4Q A;  1GUM A;  2DJ3 A;  3ZIJ A;  3FZ9 A;  4LA1 A;  4NPB A;  1PN9 A;  6GSY A;  1GNE A;  3CYN A;  1TOF A;  3O3T A;  1DBY A;  4PTS A;  1WPI A;  3I9V 2;  5H5R A;  2XPE A;  2AJQ B;  2JZR A;  2VO4 A;  3LFL A;  3MAK A;  4POL A;  18GS A;  2X8G A;  4ZBA A;  4X1U A;  1TTZ A;  4OMV A;  2KLX A;  3F6D A;  1F2E A;  3U5R E;  1R5A A;  1XFL A;  2YWM A;  3DYR A;  3BCK A;  3HVX A;  4EL1 A;  2L4Q A;  2GLR A;  2HZE B;  1NSW A;  3MDK A;  2LQO A;  1X9M B;  1U87 A;  5JWO B;  3QCP A;  1PL2 A;  3GUS A;  2H6Z A;  1TKD B;  7GSS A;  1MDJ A;  4N30 A;  3APQ A;  3U6V A;  2V1M A;  2C80 A;  2IME A;  3I6A A;  5DAL B;  4G10 A;  1FVK A;  3D4T A;  3CXG A;  2F9S A;  3IC4 A;  5AIV A;  4MF5 A;  4TR0 A;  2GGT A;  2J9H A;  5A5K A;  5JCU A;  4PUA A;  4MPF A;  4J56 E;  3ZVJ A;  2P5Q A;  3CRT A;  4FYB A;  3Q74 A;  4KCE A;  2B1L A;  3GTU B;  1BG5 A;  3LOR A;  4DEJ A;  2VD0 A;  3O6T A;  2G2Q A;  1K0O A;  4MJE A;  2H66 A;  5LNK e;  2ZUP A;  2FLS A;  1R4W A;  3GNJ A;  3I69 A;  1QFN A;  2J23 A;  1W89 A;  2GST A;  2O8V B;  3L4N A;  4WBR D;  4DSS A;  4GTU A;  3ME7 A;  3VPT A;  4WET A;  3W8S A;  4TOP A;  1Z7P A;  1XG8 A;  4ISD A;  5ECO B;  2H72 A;  3ZYW A;  3HYP A;  2HI7 A;  1F37 A;  2R6K A;  4IJI A;  3F9U A;  1ABA A;  1SK2 A;  1K0A A;  3DD3 A;  4XS4 A;  2YAN A;  2FY6 A;  3EU4 A;  3QPM A;  3EVI A;  2WJU A;  5HR3 A;  4F2I A;  4BVX B;  4EC0 A;  4CDO A;  5IPH A;  3FRC A;  4KDY A;  1J0F A;  4PQH A;  2FA4 A;  1XOB A;  2VCX A;  3D0Z A;  5B8A A;  2HE3 A;  3TKP A;  1ZCP A;  3EUR A;  2A2R A;  2V41 A;  1TI1 A;  3EPT A;  2H71 A;  1M3I A;  1USB A;  2R37 A;  4J2F A;  5ELA A;  3PH9 A;  4MJA A;  3WD6 A;  1GWC A;  2DJ1 A;  3KH7 A;  3P90 A;  5IPG A;  3F3R A;  2AHE A;  2FUG 2;  1YEP A;  3HZ4 A;  1FVJ A;  3QAW A;  4HZ4 A;  4OFM A;  2LNT A;  3DIE A;  2YOI A;  2FHE A;  1SYR A;  3CBU A;  1YKA A;  4MPG A;  1UA5 A;  2A2P A;  4MA9 A;  1XW5 A;  2VOC A;  1OAZ A;  2BMX A;  1BX9 A;  5D9X A;  3IV4 A;  4L5L A;  2B5E A;  1HNA A;  2DKI A;  3LQ7 A;  5IMV A;  2X99 A;  4F0C A;  1GSY A;  1WWJ A;  2LKU A;  3GN3 A;  2E2G A;  3C1R A;  4RQR A;  1VF2 A;  4EDZ A;  6GSU A;  1SYX A;  5ABR A;  3TKQ A;  2C3Q A;  4HQZ A;  1ZOF A;  1SJZ A;  5IMA A;  4AGS A;  1THO A;  2DJ2 A;  1O6J A;  2I1U A;  2CX3 A;  1ERW A;  2K9F A;  4JR6 A;  2ZNM A;  2EIQ A;  3WGE A;  1AIU A;  3GFK A;  2I9H A;  1VGL A;  2VAF A;  2OE1 A;  1R7H A;  5G5F A;  1UC7 A;  1WIK A;  1M9B A;  3DGQ A;  2CA8 A;  1M3J A;  3PR8 A;  4MH3 A;  2M72 A;  4DSS B;  2ALB A;  2D2Z A;  2I81 A;  1FOH A;  2NDO A;  1V40 A;  4YKF A;  5DVB A;  1FG4 A;  1XPV A;  1MDI A;  1HD2 A;  1SKS B;  4V2M A;  3F4S A;  4JE1 A;  1DE2 A;  3GKK A;  2F8A A;  4ECJ A;  2AB6 A;  3F8U A;  5CP1 A;  4GRF A;  1OKD A;  4X4J A;  2OKA A;  4XS4 B;  5BMU A;  3UBK A;  2H70 A;  3IR4 A;  3C71 A;  2YJ7 A;  4KSM A;  3KMN A;  3FYG A;  1AC1 A;  2XPD A;  2WB9 A;  4QQ7 A;  2H1A A;  1GUK A;  3TJK A;  5IIZ A;  2VIM A;  1GNW A;  1ZYQ B;  1ML6 A;  3TGZ A;  2PWJ A;  3AY8 A;  6GSV A;  3UVH A;  4JR4 A;  3QR6 A;  1ZMA A;  4K7N A;  5COH A;  4E8H A;  3FR3 A;  1X5C A;  5JWQ B;  3BCI A;  4TRX A;  3VLN A;  5ECH B;  3TJF A;  3FMW A;  4K2X A;  3HJM A;  3VI7 A;  3M8N A;  1ZL9 A;  1TW9 A;  1DUG A;  4LLR A;  3ZML A;  2WRT A;  2LST A;  1TK0 B;  3TKS C;  4EVM A;  5HFK A;  2RM5 A;  5H5Q A;  4FYU A;  3R3E A;  4DSQ A;  2O89 A;  5D73 A;  1KBN A;  1QMV A;  1V98 A;  2IFQ A;  3L9U A;  2DML A;  1XVQ A;  3FZ5 A;  1AQX A;  1S3C A;  1X0R A;  4GST A;  4V2N A;  1VF4 A;  2H0G A;  1TI3 A;  1J9B A;  1EWX A;  4KB3 A;  4HJM A;  3KGK A;  1F6M C;  4BIK A;  4QL7 A;  2C0G A;  4OWY A;  1C72 A;  1XWC A;  4HUA A;  5CRD A;  3CRU A;  2IIY A;  2ES7 A;  3D5J A;  1VF3 A;  4IW9 A;  3HDC A;  1GSS A;  2LRC A;  1SK1 A;  4TN8 A;  1FHE A;  2JZS A;  2GDR A;  3P2A A;  2FWG A;  4XCS A;  1BQ7 A;  3TJB A;  4ZBD A;  1Z6M A;  1TXX A;  1N2A A;  3G9B A;  3GRX A;  4AJ6 A;  3ZVJ D;  2LV3 A;  3KD0 A;  1TRU A;  2KOK A;  2QA1 A;  4F03 A;  5HR0 A;  4K7I A;  1TJD A;  4IP6 A;  3EU3 A;  1M2A A;  2C8U A;  2GSS A;  5ELG A;  4HSC X;  1LU4 A;  4K1F A;  2N5F A;  1TRS A;  1JZR A;  1BJX A;  1W4V A;  1SL1 B;  3ISO A;  1MEK A;  3TJJ A;  4D73 A;  2L6D A;  2B1K A;  1O7U A;  2R0C A;  2IN3 A;  5KN3 A;  4Z2T A;  1ERT A;  3HVN A;  3TOU A;  1GTA A;  3TRX A;  1K0C A;  2H30 A;  3GA4 A;  3IXR A;  4JBB A;  2O7K A;  4X0X A;  2C0F A;  2DJK A;  4PX1 A;  5C00 A;  4V2L A;  3RAZ A;  2H74 A;  2YWI A;  4Q5R A;  5F07 A;  5J5N A;  2JSZ A;  3CTF A;  4MDC A;  3KJY A;  5IOW A;  5F05 A;  3IOS A;  2LRN A;  2IJY A;  3FK8 A;  3TB2 A;  1ZYN A;  2IMD A;  4K5S A;  1E2Y A;  2GQL A;  4OFT A;  4XTS A;  2DSA A;  2IFQ B;  4WBJ A;  2OE0 A;  3VPQ A;  1PX6 A;  5G2Z A;  4TW5 A;  1PD2 1;  2C0D A;  5IM9 A;  1PQN A;  2PGT A;  2HT9 A;  4ZXG A;  4YAV A;  5IMF A;  1FO5 A;  4N10 A;  3D21 A;  4I6X A;  5G1L A;  3IHG A;  3BD2 A;  3GMF A;  1ZZY A;  2WS2 A;  1SD8 A;  8GSS A;  3HVV A;  1GL8 A;  1PMT A;  4HU9 A;  3VFI A;  4TR3 A;  3G7I A;  4JZQ A;  1HNC A;  1WE0 A;  5C04 A;  2HZF A;  3LG6 A;  3MWH A;  3KM6 A;  5GAN D;  3Q6O A;  3ZZX A;  3LXZ A;  4MF7 A;  5E59 A;  4IJ3 A;  2PBJ A;  2GVP A;  1PGT A;  3MSZ A;  4MF6 A;  2H01 A;  4MJC A;  3RPP A;  4TXV A;  2ON5 A;  4O5R A;  4ECC A;  1XCC A;  2F8F A;  4ILF A;  4IS0 A;  5F06 A;  2F51 A;  2PVO C;  1JLW A;  1GTU A;  2V2G A;  3DRN A;  2X64 A;  3IPZ A;  4NAX A;  4D73 B;  2HRN A;  1Q98 A;  1ERU A;  3EMP A;  3F6F A;  3OR5 A;  1U3A A;  4ZB6 A;  2EC4 A;  4GQC A;  2H73 A;  1YF0 A;  1O8X A;  3APO A;  4CY8 A;  5B6M A;  1G6Y A;  4CW9 A;  3HJO A;  3FW2 A;  2FCH A;  2K6V A;  4G9H A;  2G0F A;  4PUF C;  2PN8 A;  4ICY A;  4I2T A;  2GZP A;  1F3B A;  1PX7 A;  2FNO A;  4ID0 A;  4BVY A;  1A8L A;  2L5O A;  4Z2R A;  3US3 A;  4EIQ A;  2OBI A;  3VI5 A;  1ACV A;  1B9Y C;  1A0F A;  2HRK A;  1M2D A;  1GTI A;  2GQK A;  1EV9 A;  3KTL A;  2H0I A;  22GS A;  4G2E A;  6GSS A;  2V6K A;  2E2M A;  1GP1 A;  5D96 A;  4MAB A;  3IHQ A;  3HY2 A;  3IA1 A;  2CT6 A;  1Z6N A;  1MD4 A;  4TR1 A;  1PRX A;  2KUC A;  2C0E A;  4NHZ A;  3R2Q A;  5J4U A;  3KMO A;  4ZBB A;  2HYX A;  1SEN A;  2HRF A;  1OC9 A;  2H1B A;  1OYJ A;  1Q4J A;  1GSU A;  3DWV A;  1SJ6 A;  1K0B A;  5D9W A;  5B8B A;  2VL3 A;  2B3S A;  2FWF A;  3F4T A;  1O8W A;  3IK9 A;  2REM A;  1B9X C;  3UOM A;  2XBI A;  4POK A;  1WMJ A;  5J9B A;  2FWE A;  2A2S A;  2H0H A;  3GYK A;  5B6N A;  5KOW A;  3KH9 A;  4G0K A;  2MMA A;  3LYP A;  4P3Y B;  1SL0 B;  4OD7 A;  2VL2 A;  3D6I A;  3GSS A;  1YF1 A;  4L0U A;  1KTE A;  2EIO A;  4ZL9 A;  4YH2 A;  3UAR A;  3M3M A;  3L0H A;  1X9W B;  3P7X A;  4RI7 A;  4TVE A;  1B48 A;  1AQW A;  1XOA A;  1M99 A;  1SU9 A;  2CVB A;  3KIJ A;  5ECL B;  2MZC A;  3CSJ A;  2YJH A;  3EMX A;  1XBS A;  2Z9S A;  4GXZ A;  1EGO A;  1G7O A;  2L57 A;  1CQH A;  1R5P A;  1LJR A;  2N5B A;  3FEU A;  1I5G A;  2IMI A;  1YQ1 A;  2CAI A;  2E7P A;  3IAM 2;  3IRA A;  3KP8 A;  4NMU A;  5AIS A;  1AW9 A;  4V1A g;  3ERG A;  4LMW A;  4YQM A;  2JL4 A;  5L71 A;  4K0G A;  1ZGN A;  4BPY A;  1URM A;  1PKZ A;  4J57 E;  2VCT A;  2X8C A;  2QC7 A;  1EV4 A;  1Z7R A;  1WP0 A;  4K5R A;  2HRA A;  3GX8 A;  1TU8 A;  2V6O A;  2XC2 A;  1U3I A;  4FQU A;  2B7J A;  1B4P A;  4L5O A;  5F0G A;  10GS A;  4BVY B;  1ZYE A;  2HSH A;  2PER A;  4EDY A;  2RM6 A;  3FZ4 A;  5HFI A;  2BJX A;  3HXS A;  4G0L A;  1JZO A;  3E3E A;  3MYD A;  4ML6 A;  3UEM A;  1ST9 A;  2LS5 A;  3A2W A;  5CYY A;  4KA0 A;  5GSS A;  5F8B A;  5CAX A;  4MZW A;  1SKR B;  3TRP A;  4TR1 B;  1B8X A;  4I2U A;  1T1V A;  4USS A;  1QQ2 A;  4MZB A;  1OC9 B;  1M0U A;  2XHF A;  4ZB8 A;  1U6T A;  3HKR A;  2R5G A;  5CRG A;  4O7H A;  2GT5 A;  4E8E A;  3FR6 A;  3G7J A;  4G19 A;  5KN0 A;  3VWU A;  2TIR A;  2CAQ A;  1BYE A;  2MBS A;  1K0N A;  4PGT A;  4V1A p;  2AAW A;  3RBT A;  2CVD A;  3EWL A;  1XWK A;  1XW9 A;  4HZ2 A;  5EY6 A;  1Z9H A;  3HA9 A;  2C3T A;  2F3M A;  5IO2 A;  5D8I A;  1IYI A;  3CSI A;  1X9S B;  1Z5Y E;  1T8E B;  3LSZ A;  1XWB A;  1BAY A;  5ECK B;  2K18 A;  2DBC A;  5GST A;  3FHK A;  2B7K A;  3FKF A;  3GL5 A;  4KH7 A;  4TKY A;  4OCE A;  4KAE A;  3W8J A;  2LRT A;  1JZW A;  4WR4 A;  2A4V A;  4XHM A;  2FGX A;  1A23 A;  2DJ0 A;  4KGI A;  1A2J A;  1M2B A;  4CY6 A;  1Y6E A;  4EKZ A;  1MTC A;  4WEY A;  2OE3 A;  5DQY A;  5IMZ A;  1Z3E A;  1OC8 A;  1TU7 A;  5ECR B;  4HU7 A;  5ID2 A;  2VUP A;  4DSR A;  5ECQ B;  4GSS A;  2H75 A;  1GUL A;  2PVQ A;  3ZLP A;  1RQM A;  3TDG A;  2HSY A;  1ERV A;  4KW6 A;  3GKM A;  4F0B A;  2L5L A;  2H19 A;  2R4V A;  3TCO A;  4LL1 B;  3ZRD A;  2YWO A;  3BJ5 A;  4N0V A;  5G30 A;  1FAA A;  5HFG A;  2B5X A;  3RHB A;  3RPN A;  3L9V A;  4LL4 B;  4Z2U A;  2I3Y A;  4BL7 A;  5DJL A;  1EOH A;  1NM3 A;  4I97 A;  16GS A;  3Q19 A;  3KCM A;  5ECP B;  2IL3 A;  2RLI A;  2GT6 A;  2GS3 A;  2PU9 C;  4ECB A;  1FOV A;  2K8V A;  3GKX A; 
#chains in the Genus database with same CATH homology
 2YCD A;  1HNB A;  2AUV A;  2HNL A;  3PIN A;  3UAP A;  1IYH A;  3WYW A;  2BTO T;  4EXJ A;  1PKW A;  12GS A;  5D9T A;  5LCZ A;  4FYC A;  3GL3 A;  3VUR A;  2WDU A;  3LEF A;  3ZFL A;  3WT1 A;  4EF0 A;  3IC8 A;  3VWV A;  1JLV A;  3ZIV A;  4K0N A;  4OO4 A;  4IN0 A;  3D4M A;  4NWY A;  5ECN B;  2VCW A;  1HQO A;  1THX A;  1DE1 A;  2CQ9 A;  2VM1 A;  3MNG A;  2LJA A;  5ENU A;  3IE3 A;  1WJK A;  1SD9 A;  3ZTL A;  2L6C A;  4EE0 A;  2QKE A;  1PN0 A;  5IMD A;  5JCG A;  1HYU A;  1ZYP A;  3QD9 A;  3TJG A;  5JCW A;  4YAP A;  2H6Y A;  5CRH A;  2N5A A;  3O76 A;  2VL9 A;  4HEA 2;  1GH2 A;  3ZL5 A;  1UVZ A;  5CRW A;  5ECM B;  3LGC A;  3F3Q A;  2JAD A;  4IHU A;  4OCF A;  4N0Z A;  2B6M A;  2M46 A;  4O92 A;  4NV2 A;  3VWW A;  2KP2 A;  2MYG A;  1TRW A;  2X8H A;  3WGD A;  4GWR A;  3TKS A;  4ZL7 A;  3H8Q A;  2MMO A;  4GSN A;  1F3A A;  2A4H A;  2IMF A;  4F9Z A;  1YJ6 A;  5DDL A;  3ERF A;  2DLX A;  5A4U A;  5ID2 B;  1XWG A;  2P0G A;  3GUR A;  2VL2 C;  1XWA A;  4NV5 A;  4XS1 A;  2C3N A;  2O85 A;  5B7C A;  1K3O A;  3ZFB A;  4HJ2 A;  2LNS A;  1NHO A;  3HJP A;  4GLT A;  2QGV A;  4RUV A;  2WGR A;  3K8N A;  3DML A;  1QK8 A;  4Q5Q A;  5H5S A;  4KDX A;  1T3B A;  2E0Q A;  2DJJ A;  2R0G A;  2VD1 A;  3H93 A;  1VRS D;  1SKW B;  1CQG A;  4MLY A;  1BED A;  5A4W A;  1DSB A;  4BL7 B;  4KDU A;  2VCQ A;  4BA7 A;  2L4C A;  2AYT A;  4O32 A;  1TK8 B;  2TRC P;  3EIN A;  2WCI A;  3C1S A;  4ZL8 A;  2FWH A;  4KF9 A;  4BWQ A;  3A5I A;  2IMK A;  1GRX A;  1GSD A;  5AN1 A;  2V32 A;  2KP1 A;  5D93 A;  3KXO A;  1FB6 A;  4WKW A;  3C8E A;  2OA7 A;  1E6B A;  1WOU A;  3TKS E;  20GS A;  1PL1 A;  4XS6 A;  5KN2 A;  3A2X A;  1V57 A;  4HDE A;  2DKH A;  3IK7 A;  5AGY A;  3FZA A;  2IWT A;  3EC3 A;  4WR5 A;  4NHW A;  2NTO A;  3N9J A;  2YNX A;  3GIX A;  4MK3 A;  5J41 A;  4PQI A;  2GSQ A;  2OJL A;  4LMV A;  3IAS 2;  3QAV A;  1EP8 A;  3J7Y k;  3DKS A;  4FH8 A;  3H79 A;  1OE8 A;  1V9W A;  3LYK A;  4O5Q A;  1V2A A;  3CTG A;  4GQF A;  5IMC A;  2QSI A;  5AIX A;  1TRV A;  4AF2 A;  1KNG A;  2AV4 A;  3NZN A;  5DAK A;  4KSO A;  5DCH A;  1XZO A;  1RK4 A;  3RHC A;  1ILO A;  3EE2 A;  1TP9 A;  5ECI B;  2H1D A;  3N5O A;  3C73 A;  2FA8 A;  4JRR A;  5KOX A;  1MD3 A;  3GKN A;  4ECI A;  3CMI A;  4Z7X A;  1O73 A;  3GX0 A;  3KTB A;  2GZY A;  3MIX A;  3VWX A;  5FHI A;  1M7T A;  4KUN A;  1V58 A;  4X43 A;  3P8W A;  1JZD A;  3DVW A;  4XIH A;  1Y25 A;  4IQ1 A;  1XW6 A;  5HR2 A;  4XRA A;  4IVF A;  2RUE A;  2P31 A;  2YZU A;  3UIW A;  2RUF A;  4HQS A;  2X49 A;  2WUL A;  3M9J A;  1A2L A;  5HR1 A;  4ULX A;  1AXD A;  1R26 A;  3S9F A;  2TRX A;  1T00 A;  4HOJ A;  1A8Y A;  2GTU A;  3VK9 A;  4F82 A;  4EIP A;  2HLS A;  3HD5 A;  2C1Y A;  3DXB A;  4CHS A;  1GSE A;  2YP6 A;  4DVC A;  2VCZ A;  4TXO A;  1T4Z A;  1PA3 A;  2WZ9 A;  3F4R A;  3HVS A;  2H76 A;  3UBL A;  4KX4 A;  5INY A;  3LJR A;  3L9S A;  4ML1 A;  4AJ7 A;  1EP7 A;  5DBQ A;  1MDK A;  1I9D A;  1F9M A;  4XRD A;  1U88 A;  1GTB A;  2YPM A;  5EPF A;  2ON7 A;  2LUS A;  2GQM A;  3IDV A;  1JFU A;  4K2D A;  13GS A;  4MH2 A;  3ED3 A;  1OC3 A;  2VLT A;  1G6W A;  3QFA C;  2LTK A;  3QMX A;  3TKR A;  1RW1 A;  3GST A;  3QFB C;  2UZ8 A;  3EYT A;  1S3D A;  2I4A A;  5CRE A;  3H1N A;  2XBQ A;  4AJ8 A;  1XVW A;  5J9C A;  1K0D A;  2CVK A;  5FWG A;  3BBY A;  4PNG A;  3QAG A;  4ACS A;  1FB0 A;  5DAK B;  4HI7 A;  2B5Y A;  2R0P A;  4YQV A;  2EIR A;  1QXH A;  2X4A A;  1GUH A;  3NOF A;  3GV1 A;  3DVX A;  4FO5 A;  2PPT A;  3TOT A;  3CSH A;  3F63 A;  3UJ1 A;  2YV7 A;  4POB A;  3ME8 A;  1NHY A;  4PUR A;  3FR9 A;  4IBP A;  3E9J B;  5G1K A;  2OAD A;  1K3L A;  5BRT A;  3WT2 A;  4JED A;  3W6G A;  4IP1 A;  1AQV A;  4KND A;  4WF5 A;  5JWR B;  5CNW A;  4TR4 A;  4NXI A;  2M80 A;  3ZRE A;  2YWN A;  3RDW A;  3A3T A;  4N11 A;  4OO5 A;  1S3A A;  4JU5 A;  1M9A A;  4I8B A;  1H4O A;  4G0I A;  5IO0 A;  5KN1 A;  2QA2 A;  3GH9 A;  4IGJ A;  4Q5F A;  2OBK A;  2DC5 A;  3M9K A;  2KHP A;  2L59 A;  4MCU A;  3LXT A;  2VCV A;  3WGX A;  4MJB A;  5A4V A;  4MMM A;  1A24 A;  4PXO A;  4WF4 A;  3M1G A;  3QDN A;  3J7Y b;  3G7Y A;  5DQS A;  1TDI A;  11GS A;  2C4J A;  3UMA A;  2YV9 A;  2FD3 A;  3HHV A;  2DIZ A;  14GS A;  2WFC A;  4TXO B;  1EEJ A;  2R3X A;  1K3Y A;  4OFN A;  3D22 A;  6GSX A;  1SJI A;  3V1W A;  5E4W A;  1WRY A;  4GF0 A;  1QUW A;  17GS A;  2NPB A;  2HXK A;  5G31 A;  1QGV A;  2R2J A;  3A2V A;  1X5D A;  2LJK A;  2PUK C;  1YEX A;  1YKC A;  4K8M A;  2NBS A;  1OVN A;  3F0I A;  1KEB A;  3SWL A;  1GLP A;  4ZB9 A;  4L8E A;  4IKH A;  1YZX A;  5DCG A;  2O87 A;  1VF1 A;  3TUE A;  2RII A;  4EUY A;  3KEB A;  2YN1 A;  4K7O A;  4QL9 A;  3QOU A;  2VM2 A;  2H6X A;  2VLV A;  5EL8 A;  3IBH A;  4IQA A;  3ERW A;  5D9V A;  1YDK A;  1XXU A;  1A2M A;  2YZH A;  5G5E A;  4K6X A;  3ZIT A;  3LWA A;  5GZZ B;  4EO3 A;  2MBT A;  2HSM A;  3TRQ A;  2ZCT A;  2DIY A;  4IEL A;  2LEG A;  6GSW A;  1GSQ A;  1AUC A;  2OAC A;  4POM A;  2CZ2 A;  5KEJ A;  2IPA A;  5CO3 A;  4MZC A;  1AAZ A;  5GAP D;  2K8S A;  2LQQ A;  1H75 A;  5IQY A;  2GSR A;  2P5R A;  1G7E A;  3Q18 A;  3PPU A;  1PSQ A;  3UL3 A;  4RQX A;  9GSS A;  4K9Z A;  3H4K A;  2LJR A;  1GLQ A;  2PMT A;  1OE7 A;  4H86 A;  1GSF A;  1T4Y A;  3APS A;  3A5W A;  4FIW A;  4PNF A;  1ON4 A;  2HZE A;  5LD0 A;  2CV4 A;  1A0R P;  1K0M A;  2JAC A;  5J3R A;  5DJM A;  4PQ1 A;  1O81 A;  4WXT A;  3GH6 A;  4RI6 A;  4O5U A;  1XIY A;  1J08 A;  3SBC A;  5DAL A;  3LW9 A;  1EGR A;  3E0U A;  3I43 A;  2H1G A;  3KP9 A;  4Q5N A;  3M0F A;  2JU5 A;  1TK5 B;  4I5Q A;  1EEM A;  1LBK A;  2H8L A;  1X5E A;  4MNN A;  4KE3 A;  4YQU A;  4ZIJ A;  3HZ8 A;  4HS1 A;  4ZIL A;  2HFD A;  3BOA A;  19GS A;  1T7P B;  1JHB A;  3JCM L;  3GTU A;  4L0W A;  2GZZ A;  4MP4 A;  4GCI A;  1SL2 B;  3FY7 A;  2MMN A;  1NW2 A;  3C7M A;  1YY7 A;  5FT3 A;  3ZMK A;  2NVL A;  5HQP A;  1FW1 A;  2MMZ A;  2JSY A;  1EOG A;  1G0T A;  3PGT A;  5IOX A;  1OKT A;  1EZK A;  2VLU A;  4YKG A;  1O85 A;  3KZQ A;  3HCZ A;  3UVT A;  4BWS A;  5EVO A;  4KCA A;  1N8J A;  2CZ3 A;  1UN2 A;  3GHA A;  5ECS A;  2JZT A;  1SK0 A;  6GST A;  2DMM A;  4A5P A;  3NIV A;  4BVX A;  2CX4 A;  3DEX A;  3L78 A;  1B4Q A;  1GUM A;  2DJ3 A;  3ZIJ A;  3FZ9 A;  4LA1 A;  4NPB A;  1PN9 A;  6GSY A;  1GNE A;  3CYN A;  1TOF A;  3O3T A;  1DBY A;  4PTS A;  1WPI A;  3I9V 2;  5H5R A;  2XPE A;  2AJQ B;  2JZR A;  2VO4 A;  3LFL A;  3MAK A;  4POL A;  18GS A;  2X8G A;  4ZBA A;  4X1U A;  1TTZ A;  4OMV A;  2KLX A;  3F6D A;  1F2E A;  3U5R E;  1R5A A;  1XFL A;  2YWM A;  3DYR A;  3BCK A;  3HVX A;  4EL1 A;  2L4Q A;  2GLR A;  2HZE B;  1NSW A;  3MDK A;  2LQO A;  1X9M B;  1U87 A;  5JWO B;  3QCP A;  1PL2 A;  3GUS A;  2H6Z A;  1TKD B;  7GSS A;  1MDJ A;  4N30 A;  3APQ A;  3U6V A;  2V1M A;  2C80 A;  2IME A;  3I6A A;  5DAL B;  4G10 A;  1FVK A;  3D4T A;  3CXG A;  2F9S A;  3IC4 A;  5AIV A;  4MF5 A;  4TR0 A;  2GGT A;  2J9H A;  5A5K A;  5JCU A;  4PUA A;  4MPF A;  4J56 E;  3ZVJ A;  2P5Q A;  3CRT A;  4FYB A;  3Q74 A;  4KCE A;  2B1L A;  3GTU B;  1BG5 A;  3LOR A;  4DEJ A;  2VD0 A;  3O6T A;  2G2Q A;  1K0O A;  4MJE A;  2H66 A;  5LNK e;  2ZUP A;  2FLS A;  1R4W A;  3GNJ A;  3I69 A;  1QFN A;  2J23 A;  1W89 A;  2GST A;  2O8V B;  3L4N A;  4WBR D;  4DSS A;  4GTU A;  3ME7 A;  3VPT A;  4WET A;  3W8S A;  4TOP A;  1Z7P A;  4ISD A;  5ECO B;  2H72 A;  3ZYW A;  3HYP A;  2HI7 A;  1F37 A;  2R6K A;  4IJI A;  3F9U A;  1ABA A;  1SK2 A;  1K0A A;  3DD3 A;  4XS4 A;  2YAN A;  2FY6 A;  3EU4 A;  3QPM A;  3EVI A;  2WJU A;  5HR3 A;  4F2I A;  4BVX B;  4EC0 A;  4CDO A;  5IPH A;  3FRC A;  4KDY A;  1J0F A;  4PQH A;  2FA4 A;  1XOB A;  2VCX A;  3D0Z A;  5B8A A;  2HE3 A;  3TKP A;  1ZCP A;  3EUR A;  2A2R A;  2V41 A;  1TI1 A;  3EPT A;  2H71 A;  1USB A;  2R37 A;  4J2F A;  5ELA A;  3PH9 A;  4MJA A;  3WD6 A;  1GWC A;  2DJ1 A;  3KH7 A;  3P90 A;  5IPG A;  3F3R A;  2AHE A;  2FUG 2;  1YEP A;  3HZ4 A;  1FVJ A;  3QAW A;  4HZ4 A;  4OFM A;  2LNT A;  3DIE A;  2YOI A;  2FHE A;  1SYR A;  3CBU A;  1YKA A;  4MPG A;  1UA5 A;  2A2P A;  4MA9 A;  1XW5 A;  2VOC A;  1OAZ A;  2BMX A;  1BX9 A;  5D9X A;  3IV4 A;  4L5L A;  2B5E A;  1HNA A;  2DKI A;  3LQ7 A;  5IMV A;  2X99 A;  4F0C A;  1GSY A;  1WWJ A;  2LKU A;  3GN3 A;  2E2G A;  3C1R A;  4RQR A;  1VF2 A;  4EDZ A;  6GSU A;  1SYX A;  5ABR A;  3TKQ A;  2C3Q A;  4HQZ A;  1ZOF A;  1SJZ A;  5IMA A;  4AGS A;  1THO A;  2DJ2 A;  1O6J A;  2I1U A;  2CX3 A;  1ERW A;  2K9F A;  4JR6 A;  2ZNM A;  2EIQ A;  3WGE A;  1AIU A;  3GFK A;  2I9H A;  1VGL A;  2VAF A;  2OE1 A;  1R7H A;  5G5F A;  1UC7 A;  1WIK A;  1M9B A;  3DGQ A;  2CA8 A;  3PR8 A;  4MH3 A;  2M72 A;  4DSS B;  2ALB A;  2D2Z A;  2I81 A;  1FOH A;  2NDO A;  1V40 A;  4YKF A;  5DVB A;  1FG4 A;  1XPV A;  1MDI A;  1HD2 A;  1SKS B;  4V2M A;  3F4S A;  4JE1 A;  1DE2 A;  3GKK A;  2F8A A;  4ECJ A;  2AB6 A;  3F8U A;  5CP1 A;  4GRF A;  1OKD A;  4X4J A;  2OKA A;  4XS4 B;  5BMU A;  3UBK A;  2H70 A;  3IR4 A;  3C71 A;  2YJ7 A;  4KSM A;  3KMN A;  3FYG A;  1AC1 A;  2XPD A;  2WB9 A;  4QQ7 A;  2H1A A;  1GUK A;  3TJK A;  5IIZ A;  2VIM A;  1GNW A;  1ZYQ B;  1ML6 A;  3TGZ A;  2PWJ A;  3AY8 A;  6GSV A;  3UVH A;  4JR4 A;  3QR6 A;  1ZMA A;  4K7N A;  5COH A;  4E8H A;  3FR3 A;  1X5C A;  5JWQ B;  3BCI A;  4TRX A;  3VLN A;  5ECH B;  3TJF A;  3FMW A;  4K2X A;  3HJM A;  3VI7 A;  3M8N A;  1ZL9 A;  1TW9 A;  1DUG A;  4LLR A;  3ZML A;  2WRT A;  2LST A;  1TK0 B;  3TKS C;  4EVM A;  5HFK A;  2RM5 A;  5H5Q A;  4FYU A;  3R3E A;  4DSQ A;  2O89 A;  5D73 A;  1KBN A;  1QMV A;  1V98 A;  2IFQ A;  3L9U A;  2DML A;  1XVQ A;  3FZ5 A;  1AQX A;  1S3C A;  1X0R A;  4GST A;  4V2N A;  1VF4 A;  2H0G A;  1TI3 A;  1J9B A;  1EWX A;  4KB3 A;  4HJM A;  3KGK A;  1F6M C;  4QL7 A;  2C0G A;  4OWY A;  1C72 A;  1XWC A;  4HUA A;  5CRD A;  3CRU A;  2IIY A;  2ES7 A;  3D5J A;  1VF3 A;  4IW9 A;  3HDC A;  1GSS A;  2LRC A;  1SK1 A;  4TN8 A;  1FHE A;  2JZS A;  2GDR A;  3P2A A;  2FWG A;  4XCS A;  1BQ7 A;  3TJB A;  4ZBD A;  1Z6M A;  1TXX A;  1N2A A;  3G9B A;  3GRX A;  4AJ6 A;  3ZVJ D;  2LV3 A;  3KD0 A;  1TRU A;  2KOK A;  2QA1 A;  4F03 A;  5HR0 A;  4K7I A;  1TJD A;  4IP6 A;  3EU3 A;  1M2A A;  2C8U A;  2GSS A;  5ELG A;  1LU4 A;  4K1F A;  2N5F A;  1TRS A;  1JZR A;  1BJX A;  1W4V A;  1SL1 B;  3ISO A;  1MEK A;  3TJJ A;  4D73 A;  2L6D A;  2B1K A;  1O7U A;  2R0C A;  2IN3 A;  5KN3 A;  4Z2T A;  1ERT A;  3TOU A;  1GTA A;  3TRX A;  1K0C A;  2H30 A;  3GA4 A;  3IXR A;  4JBB A;  2O7K A;  4X0X A;  2C0F A;  2DJK A;  4PX1 A;  5C00 A;  4V2L A;  3RAZ A;  2H74 A;  2YWI A;  4Q5R A;  5F07 A;  5J5N A;  2JSZ A;  3CTF A;  4MDC A;  3KJY A;  5IOW A;  5F05 A;  3IOS A;  2LRN A;  2IJY A;  3FK8 A;  3TB2 A;  1ZYN A;  2IMD A;  4K5S A;  1E2Y A;  2GQL A;  4OFT A;  4XTS A;  2DSA A;  2IFQ B;  4WBJ A;  2OE0 A;  3VPQ A;  1PX6 A;  5G2Z A;  4TW5 A;  1PD2 1;  2C0D A;  5IM9 A;  1PQN A;  2PGT A;  2HT9 A;  4ZXG A;  4YAV A;  5IMF A;  1FO5 A;  4N10 A;  3D21 A;  4I6X A;  5G1L A;  3IHG A;  3BD2 A;  3GMF A;  1ZZY A;  2WS2 A;  1SD8 A;  8GSS A;  3HVV A;  1GL8 A;  1PMT A;  4HU9 A;  3VFI A;  4TR3 A;  3G7I A;  4JZQ A;  1HNC A;  1WE0 A;  5C04 A;  2HZF A;  3LG6 A;  3MWH A;  3KM6 A;  5GAN D;  3Q6O A;  3ZZX A;  3LXZ A;  4MF7 A;  5E59 A;  4IJ3 A;  2PBJ A;  2GVP A;  1PGT A;  3MSZ A;  4MF6 A;  2H01 A;  4MJC A;  3RPP A;  4TXV A;  2ON5 A;  4O5R A;  4ECC A;  1XCC A;  2F8F A;  4ILF A;  4IS0 A;  5F06 A;  2F51 A;  2PVO C;  1JLW A;  1GTU A;  2V2G A;  3DRN A;  2X64 A;  3IPZ A;  4NAX A;  4D73 B;  2HRN A;  1Q98 A;  1ERU A;  3EMP A;  3F6F A;  3OR5 A;  1U3A A;  4ZB6 A;  2EC4 A;  4GQC A;  2H73 A;  1YF0 A;  1O8X A;  3APO A;  4CY8 A;  5B6M A;  1G6Y A;  4CW9 A;  3HJO A;  3FW2 A;  2FCH A;  2K6V A;  4G9H A;  2G0F A;  4PUF C;  2PN8 A;  4ICY A;  4I2T A;  2GZP A;  1F3B A;  1PX7 A;  2FNO A;  4ID0 A;  4BVY A;  1A8L A;  2L5O A;  4Z2R A;  3US3 A;  4EIQ A;  2OBI A;  3VI5 A;  1ACV A;  1B9Y C;  1A0F A;  2HRK A;  1M2D A;  1GTI A;  2GQK A;  1EV9 A;  3KTL A;  2H0I A;  22GS A;  4G2E A;  6GSS A;  2V6K A;  2E2M A;  1GP1 A;  5D96 A;  4MAB A;  3IHQ A;  3HY2 A;  3IA1 A;  2CT6 A;  1Z6N A;  1MD4 A;  4TR1 A;  1PRX A;  2KUC A;  2C0E A;  4NHZ A;  3R2Q A;  5J4U A;  3KMO A;  4ZBB A;  2HYX A;  1SEN A;  2HRF A;  1OC9 A;  2H1B A;  1OYJ A;  1Q4J A;  1GSU A;  3DWV A;  1SJ6 A;  1K0B A;  5D9W A;  5B8B A;  2VL3 A;  2B3S A;  2FWF A;  3F4T A;  1O8W A;  3IK9 A;  2REM A;  1B9X C;  3UOM A;  2XBI A;  4POK A;  1WMJ A;  5J9B A;  2FWE A;  2A2S A;  2H0H A;  3GYK A;  5B6N A;  5KOW A;  3KH9 A;  4G0K A;  2MMA A;  3LYP A;  4P3Y B;  1SL0 B;  4OD7 A;  2VL2 A;  3D6I A;  3GSS A;  1YF1 A;  4L0U A;  1KTE A;  2EIO A;  4ZL9 A;  4YH2 A;  3UAR A;  3M3M A;  3L0H A;  1X9W B;  3P7X A;  4RI7 A;  4TVE A;  1B48 A;  1AQW A;  1XOA A;  1M99 A;  1SU9 A;  2CVB A;  3KIJ A;  5ECL B;  2MZC A;  3CSJ A;  2YJH A;  3EMX A;  1XBS A;  2Z9S A;  4GXZ A;  1EGO A;  1G7O A;  2L57 A;  1CQH A;  1R5P A;  1LJR A;  2N5B A;  3FEU A;  1I5G A;  2IMI A;  1YQ1 A;  2CAI A;  2E7P A;  3IAM 2;  3IRA A;  3KP8 A;  4NMU A;  5AIS A;  1AW9 A;  4V1A g;  3ERG A;  4LMW A;  4YQM A;  2JL4 A;  5L71 A;  4K0G A;  1ZGN A;  4BPY A;  1URM A;  1PKZ A;  4J57 E;  2VCT A;  2X8C A;  2QC7 A;  1EV4 A;  1Z7R A;  1WP0 A;  4K5R A;  2HRA A;  3GX8 A;  1TU8 A;  2V6O A;  2XC2 A;  1U3I A;  4FQU A;  2B7J A;  1B4P A;  4L5O A;  5F0G A;  10GS A;  4BVY B;  1ZYE A;  2HSH A;  2PER A;  4EDY A;  2RM6 A;  3FZ4 A;  5HFI A;  2BJX A;  3HXS A;  4G0L A;  1JZO A;  3E3E A;  3MYD A;  4ML6 A;  3UEM A;  1ST9 A;  2LS5 A;  3A2W A;  5CYY A;  4KA0 A;  5GSS A;  5F8B A;  5CAX A;  4MZW A;  1SKR B;  3TRP A;  4TR1 B;  1B8X A;  4I2U A;  1T1V A;  4USS A;  1QQ2 A;  4MZB A;  1OC9 B;  1M0U A;  2XHF A;  4ZB8 A;  1U6T A;  3HKR A;  2R5G A;  5CRG A;  4O7H A;  2GT5 A;  4E8E A;  3FR6 A;  3G7J A;  4G19 A;  5KN0 A;  3VWU A;  2TIR A;  2CAQ A;  1BYE A;  2MBS A;  1K0N A;  4PGT A;  4V1A p;  2AAW A;  3RBT A;  2CVD A;  3EWL A;  1XWK A;  1XW9 A;  4HZ2 A;  5EY6 A;  1Z9H A;  3HA9 A;  2C3T A;  2F3M A;  5IO2 A;  5D8I A;  1IYI A;  3CSI A;  1X9S B;  1Z5Y E;  1T8E B;  3LSZ A;  1XWB A;  1BAY A;  5ECK B;  2K18 A;  2DBC A;  5GST A;  3FHK A;  2B7K A;  3FKF A;  3GL5 A;  4KH7 A;  4TKY A;  4OCE A;  4KAE A;  3W8J A;  2LRT A;  1JZW A;  4WR4 A;  2A4V A;  4XHM A;  2FGX A;  1A23 A;  2DJ0 A;  4KGI A;  1A2J A;  1M2B A;  4CY6 A;  1Y6E A;  4EKZ A;  1MTC A;  4WEY A;  2OE3 A;  5DQY A;  5IMZ A;  1Z3E A;  1OC8 A;  1TU7 A;  5ECR B;  4HU7 A;  5ID2 A;  2VUP A;  4DSR A;  5ECQ B;  4GSS A;  2H75 A;  1GUL A;  2PVQ A;  3ZLP A;  1RQM A;  3TDG A;  2HSY A;  1ERV A;  4KW6 A;  3GKM A;  4F0B A;  2L5L A;  2H19 A;  2R4V A;  3TCO A;  4LL1 B;  3ZRD A;  2YWO A;  3BJ5 A;  4N0V A;  5G30 A;  1FAA A;  5HFG A;  2B5X A;  3RHB A;  3RPN A;  3L9V A;  4LL4 B;  4Z2U A;  2I3Y A;  4BL7 A;  5DJL A;  1EOH A;  1NM3 A;  4I97 A;  16GS A;  3Q19 A;  3KCM A;  5ECP B;  2IL3 A;  2RLI A;  2GT6 A;  2GS3 A;  2PU9 C;  4ECB A;  1FOV A;  2K8V A;  3GKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...