4K8MA

High resolution structure of m.tb nrdh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
TVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords Glutaredoxin-like protein NrdH
publication title The crystal structure of Mycobacterium tuberculosis NrdH at 0.87 angstrom suggests a possible mode of its activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 24
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k8mA00
3RDWA 1KBNA 1ZYQB 4O7HA 5IO2A 3GL5A 1OVNA 1SD9A 1WP0A 1EP7A 5ECSA 1WOUA 3U6VA 3O76A 2B3SA 5CAXA 4GCIA 3IA1A 3HVVA 3D6IA 2FA8A 2IN3A 5D93A 2GDRA 5J5NA 2I4AA 2Z9SA 1BX9A 2H66A 2FUG2 1YKCA 5G31A 1UC7A 19GSA 11GSA 3KD0A 3VK9A 1A2MA 2F9SA 4LMWA 3IR4A 5DAKA 1BG5A 1EEMA 3ZVJA 2JZSA 1XW9A 5D9TA 1EEJA 2ZUPA 4XS6A 2B5XA 1XWAA 4GTUA 3VPTA 5GSTA 3F4TA 4JZQA 4K9ZA 1KNGA 4HZ4A 3UVHA 4EKZA 4K0NA 1V57A 4IBPA 2WRTA 2AUVA 4RQRA 5CREA 4WF5A 3D5JA 2L5LA 4HU9A 3DGQA 8GSSA 4GQCA 3TOUA 2MMOA 3LSZA 1UVZA 3H8QA 1I9DA 2HSYA 1EGOA 2X8CA 5D96A 5ECQB 3KMOA 1X5CA 3HDCA 2CAQA 4QQ7A 5DVBA 5HFIA 5GZZB 2VCWA 1TRUA 2IMEA 2VL9A 5ECIB 4TR4A 4MZWA 3C73A 3WD6A 1EP8A 2OE0A 4OO4A 5G1LA 1XWCA 2B7JA 3MDKA 5IMZA 3E3EA 3I43A 5D73A 2H72A 5JCWA 2H71A 1PSQA 3FW2A 4OO5A 3ED3A 4KDXA 2LRTA 2B1KA 1CQGA 2HNLA 2LV3A 4EDZA 5LD0A 3L9VA 2X8GA 4ACSA 5FT3A 2O7KA 5B8BA 3GL3A 2VCVA 3WGEA 1J08A 5D9VA 2HE3A 3L9SA 4HZ2A 2JL4A 2HLSA 2DIZA 2VD0A 2CX3A 5LCZA 4PUAA 4HU7A 4BWQA 2VOCA 3KXOA 4X1UA 4AGSA 1O81A 2RUFA 2O85A 3F6FA 3ERGA 4IVFA 5CRGA 1F3BA 2ON5A 2DJ1A 1HNAA 2LQOA 2C3TA 4BWSA 2OADA 4CDOA 2FNOA 4NMUA 1ZYEA 4XIHA 1YF1A 5B8AA 1ERVA 1SYRA 2TRCP 1TKDB 2R5GA 1BJXA 1K3OA 4NHZA 1ABAA 2PU9C 4BL7A 3CMIA 4YH2A 1F2EA 1M2DA 3O3TA 4MPGA 1XCCA 5IO0A 4TRXA 2HZEA 2IWTA 1TTZA 1PRXA 4O32A 1EOHA 4HI7A 4K7OA 3E0UA 1TK0B 1EV4A 1F6MC 3M8NA 2XPEA 1SL0B 3ZIJA 4F0CA 2JU5A 4ECCA 2HZFA 1TI3A 3QOUA 2WCIA 4FO5A 4Q5FA 4OWYA 4DSQA 3ERFA 3SWLA 4K1FA 1Z7RA 2K8SA 5H5QA 2XBQA 1YY7A 3H1NA 3WGXA 2K6VA 2M46A 1ZZYA 3BJ5A 4KCAA 2G0FA 3KTBA 4IP6A 5HR3A 4O92A 3TKQA 3R2QA 1GTAA 1Z9HA 5AGYA 5ECRB 2PGTA 4NXIA 4MJEA 2CZ2A 1HQOA 4QL9A 4ZB9A 5FWGA 3QFAC 4K7NA 4RI7A 2VCXA 2B5YA 2HRFA 2LNSA 3F3RA 5ECOB 3D4MA 3TJGA 2VM2A 1PQNA 1USBA 1XWGA 4NHWA 1PD21 4POBA 2V2GA 4N11A 2MMAA 3DRNA 1SKSB 1B4PA 3UBLA 3EURA 3FYGA 4JEDA 1YF0A 3LQ7A 3PR8A 1XW5A 4JR6A 5KN3A 5ELAA 1OE8A 2VUPA 1BYEA 4YQUA 1A8YA 1R5AA 2QSIA 3EU4A 2EIRA 1GUMA 2C4JA 2WS2A 3LWAA 4J57E 1YDKA 3KCMA 1CQHA 3ZZXA 2JSZA 1GRXA 2B6MA 1SJZA 3A2WA 1JZDA 5G1KA 2H6YA 3BCIA 1NHOA 4IGJA 1FB0A 2JACA 1ON4A 1YQ1A 3GKKA 2PVOC 2NPBA 3NOFA 2E0QA 1WJKA 2HRNA 4H86A 4OCEA 4OD7A 4F9ZA 4IKHA 5IIZA 1O85A 3TB2A 4I97A 4IP1A 4K0GA 1THOA 1PMTA 5EVOA 3LORA 4OCFA 2CVBA 4L0WA 1K0MA 4GF0A 3KP9A 4G2EA 2GLRA 1GL8A 1ACVA 2FWFA 3CRUA 4TR1A 3IBHA 3IXRA 4KCEA 3CSHA 3TJKA 2VL2C 3RAZA 4MK3A 1GTUA 2DBCA 1PGTA 2BMXA 2NTOA 5ENUA 3EMXA 2LRNA 2TRXA 2TIRA 3HY2A 5ID2A 2L5OA 1R5PA 4ECJA 4FYCA 1AXDA 2C8UA 3GSSA 3O6TA 4G10A 5G2ZA 5KEJA 3IHQA 1AQXA 1AQVA 4PXOA 4ZBBA 2VLVA 4N30A 2A2RA 1T4YA 3BBYA 4BPYA 2H1AA 2VIMA 2WB9A 3UAPA 3DKSA 3FY7A 2YZHA 1OYJA 1PL1A 4BVYA 1M9AA 2YV9A 1ML6A 3QAWA 1ZGNA 1TI1A 4ECBA 1ILOA 4POMA 1FB6A 2E2GA 1K0CA 3FZ5A 2QGVA 1GNEA 2ON7A 3GV1A 3ME8A 1V2AA 3FZ4A 3ISOA 4J2FA 2OE3A 4NV2A 3CSJA 1H75A 5AIVA 3WYWA 3UBKA 3EMPA 1A2JA 5CP1A 3HA9A 2C80A 1BEDA 1K0BA 1PN9A 4JRRA 5JWOB 3TOTA 5EY6A 3ME7A 2FWHA 4FIWA 3J7Yb 3FR3A 3I9V2 5G5EA 3D21A 1G0TA 3GURA 2AAWA 2VD1A 2PN8A 1B9XC 4TVEA 5B7CA 3ZYWA 5A5KA 3GH9A 2MMZA 2R4VA 1K0DA 2C0DA 3KEBA 4HS1A 3RPPA 2AJQB 5G30A 3TKRA 2RIIA 1QGVA 2H6ZA 1DE2A 2GVPA 3EVIA 4PGTA 2J23A 4MF5A 2KOKA 2HZEB 4I2TA 3MNGA 5A4UA 3GFKA 2I81A 4KDYA 1X0RA 1OKDA 4V2MA 4Q5QA 3ERWA 1THXA 3CTGA 4DSRA 2DJ3A 3QPMA 3UARA 2MBTA 4XS4A 3ZITA 4P3YB 3VI5A 1WWJA 5L71A 3ZRDA 5DJMA 2VL3A 4OFNA 3ZIVA 1S3CA 4V1Ag 1M2AA 3SBCA 5F0GA 1JFUA 1EZKA 5DCGA 4KB3A 2KP2A 3GA4A 3P8WA 2KUCA 6GSXA 5ECLB 4TKYA 3ZREA 7GSSA 2BTOT 5B6MA 2PPTA 2IPAA 4QL7A 2OKAA 3F63A 1TRSA 5CO3A 5E4WA 3BD2A 1XPVA 3L0HA 2GTUA 2LKUA 2GSRA 2H0HA 1I5GA 2GSTA 1ERUA 4ZBAA 1URMA 3F4SA 3ZMLA 5J9CA 1NW2A 4IQ1A 2CV4A 4X0XA 1R26A 2CA8A 2EIQA 3LGCA 4EXJA 3UMAA 3VLNA 1U3IA 1H4OA 2DIYA 5JCGA 3APQA 2F8AA 2OBKA 2PMTA 1JLWA 3ZVJD 2HT9A 1OE7A 4N0VA 1V40A 4X43A 4D73A 5ECNB 1SD8A 4OFMA 4IN0A 4Q5NA 1MDKA 2ES7A 3AY8A 1M2BA 4L5OA 2P0GA 5CNWA 2H19A 3IV4A 1KTEA 5INYA 4IELA 4EUYA 1X5DA 3FHKA 1LJRA 2H75A 4DVCA 3QAVA 3US3A 2MZCA 1B9YC 3F0IA 4IW9A 3KJYA 4ZL8A 1A23A 3APSA 4EF0A 3FZAA 1VF1A 4XTSA 3N5OA 3IK7A 1B48A 3C1RA 2KP1A 1M9BA 3CSIA 3MWHA 3QR6A 1XWBA 3LXZA 1E6BA 5IMCA 5A4VA 2GT5A 5DALA 4MMMA 2FCHA 2J9HA 4G9HA 1MD4A 5H5RA 1GSQA 3PINA 4XRAA 3L4NA 5IPGA 4IQAA 1J0FA 1OC8A 4DSSA 3UVTA 2KLXA 4Z7XA 4RUVA 2DLXA 2DJ2A 2O87A 4HQZA 3APOA 5IPHA 4TR1B 2XHFA 3IRAA 1GTBA 3Q74A 2XBIA 1WRYA 3V1WA 5JWQB 1XOAA 1T1VA 3C8EA 4I8BA 1G7EA 3D4TA 4YQVA 1U3AA 3QFBC 2R3XA 3TRXA 5ID2B 3P90A 4GSNA 4EDYA 2GZZA 1V58A 1X9WB 2H1BA 4POKA 4IS0A 3GNJA 4J56E 1XVQA 4Q5RA 2HXKA 2H76A 5HQPA 2L6CA 1QMVA 1T8EB 4YAPA 2YOIA 2G2QA 2YCDA 3W8SA 1J9BA 1SU9A 2B1LA 1VF4A 4JU5A 1EGRA 4MABA 3DMLA 2YWNA 1TK5B 4E8EA 3W8JA 2N5FA 4KNDA 3WT2A 2GGTA 2BJXA 3UL3A 4WF4A 2LNTA 4N10A 3F6DA 1MTCA 3UEMA 4KA0A 4XHMA 3H4KA 5DQYA 2IMIA 4ZXGA 4EVMA 2QKEA 22GSA 4I2UA 3GKNA 1GSFA 3N9JA 2IMFA 5H5SA 4CW9A 2AV4A 3FK8A 5DDLA 3TJJA 2WJUA 3PH9A 4YQMA 1GLQA 1NHYA 2R2JA 2LJRA 2LSTA 1O8WA 2LQQA 4ILFA 5IMFA 3S9FA 1QFNA 4ZILA 1AUCA 4WR4A 5KN1A 1GWCA 3LG6A 2VL2A 3KTLA 3P2AA 3TKSC 2DSAA 2REMA 4HQSA 4JR4A 3VWVA 5ELGA 4L0UA 4IJIA 3RHBA 4KSOA 4WEYA 1UA5A 4MZBA 4PNFA 4MF7A 2H73A 2F3MA 4GLTA 1QK8A 1ZCPA 3C7MA 4PURA 2OACA 4XS4B 2ZCTA 2X99A 1MEKA 1DSBA 1Q98A 9GSSA 1QUWA 1T7PB 1A0RP 4NV5A 4MA9A 2GZYA 1GSDA 1K0NA 5DAKB 4ULXA 1FW1A 4HDEA 1WMJA 17GSA 4HJ2A 5JCUA 2VLUA 3JCML 1Q4JA 3VWWA 2NVLA 5IOXA 4WETA 5KN0A 5F06A 1GUHA 2VCTA 5IOWA 3F9UA 2XPDA 5ABRA 3KGKA 2H6XA 1TXXA 3VPQA 3HKRA 3VFIA 2XC2A 3F8UA 1VF2A 1M99A 1FVJA 3QDNA 2M72A 3HJMA 3M0FA 2FA4A 5DCHA 2GT6A 5F07A 1GSUA 1Z6NA 3VWXA 5LNKe 3CRTA 4KAEA 3ZL5A 2F8FA 5FHIA 3CYNA 13GSA 2VM1A 5J9BA 4D73B 1M0UA 2V6KA 1Y25A 5AISA 3GH6A 3FR6A 3Q6OA 2RLIA 3M3MA 1RK4A 5KN2A 2VCQA 1TU8A 4KH7A 3PGTA 1TDIA 2V6OA 3KMNA 1RW1A 4BA7A 4GQFA 4CHSA 4TW5A 2YP6A 5IM9A 4MP4A 4FYBA 1E2YA 1K0AA 1K0OA 3GYKA 1IYIA 2YWOA 3G7IA 4K6XA 2JSYA 3HVXA 3WGDA 1Z6MA 2I1UA 2PWJA 5DALB 1T3BA 2DMLA 3HJPA 2CVKA 2IL3A 3GX8A 5COHA 4DSSB 1YJ6A 2B5EA 4ZBDA 3DYRA 4PUFC 5IMDA 1PX6A 3GTUA 2O8VB 3TJFA 1AW9A 4HJMA 3P7XA 2NDOA 4GWRA 1XZOA 2DJKA 1GSSA 2C0FA 5D9XA 2VO4A 1PKWA 3LYKA 1HNCA 3HYPA 3Q18A 1HD2A 4MH2A 14GSA 5C00A 5IMVA 4TXOA 4MF6A 1LU4A 2IMDA 3DIEA 1OC9A 1ZMAA 1PA3A 4HUAA 4LL1B 5HR1A 2MMNA 1X9SB 4BVXA 2YWMA 4K2DA 2LEGA 1Z7PA 2YWIA 5F8BA 3I6AA 5D8IA 6GSWA 1DUGA 1TRWA 2GSQA 3OR5A 1AC1A 18GSA 1JLVA 2RM6A 3RBTA 2DJJA 4KUNA 2GZPA 4PQHA 5HFKA 3LFLA 4KW6A 1HNBA 2RM5A 4TR3A 3GMFA 4ISDA 4YAVA 3FEUA 2O89A 4MCUA 1AQWA 3DVWA 1G6WA 4AF2A 2FY6A 4RQXA 5ECKB 3L9UA 4MPFA 4AJ8A 1SKWB 4AJ7A 4KX4A 2GQKA 2YNXA 1B8XA 3LXTA 4ZB8A 2FGXA 5F05A 2CT6A 3EYTA 5G5FA 1S3DA 4MLYA 3KZQA 1Z5YE 20GSA 2K9FA 5J41A 1TRVA 4OMVA 3FKFA 4EO3A 12GSA 5AIXA 3ZLPA 3KIJA 4MJAA 4WXTA 1SL1B 2HI7A 3EE2A 1T00A 1XOBA 5HR0A 1SL2B 1F3AA 2GQMA 2H1GA 1OKTA 3ZFLA 2H70A 2OJLA 6GSSA 3UIWA 4JBBA 3C71A 3HCZA 3TCOA 2EC4A 1TOFA 2IIYA 2D2ZA 1V9WA 1FHEA 2OA7A 1ERTA 6GSUA 4N0ZA 3TRQA 1MD3A 3G9BA 1O73A 4GSTA 5GAPD 4MJBA 1G6YA 1M7TA 4JE1A 2C3NA 2IMKA 3EINA 2V41A 3HXSA 3TUEA 1GH2A 4O5RA 1N2AA 3VURA 3IC4A 1TU7A 2VLTA 2FLSA 2VCZA 1X9MB 2IFQA 2H30A 1SJIA 1SKRB 3RPNA 1RQMA 2YJ7A 4ML6A 2H0GA 2E2MA 3KM6A 1GULA 2WFCA 2I9HA 5CYYA 1XW6A 1U6TA 5AN1A 3M1GA 1R4WA 4LMVA 2L59A 4MH3A 5DQSA 2FWEA 4TR0A 1XFLA 1YKAA 1XBSA 2VAFA 1GTIA 1PX7A 2AYTA 2WZ9A 3KH7A 1SYXA 5HFGA 6GSYA 4ECIA 2X8HA 3GIXA 3DVXA 1UN2A 3FZ9A 3CXGA 2P31A 1A8LA 1YEXA 3KP8A 1WPIA 2H0IA 1HYUA 3A5WA 1S3AA 2CVDA 3HJOA 3LYPA 4IJ3A 1TW9A 2L57A 4G19A 2N5AA 1XXUA 3VWUA 5J4UA 4XCSA 3ZTLA 3E9JB 5IQYA 1KEBA 1QQ2A 1WE0A 3TKSA 2H8LA 1WIKA 3ZFBA 3RHCA 1GNWA 3J7Yk 3U5RE 1AIUA 3EC3A 2PUKC 4PX1A 2H74A 1ERWA 5CRHA 4POLA 2A2SA 1GP1A 1FVKA 2JZRA 2B7KA 1F37A 3WT1A 1LBKA 2C0EA 2PVQA 3TJBA 2H01A 4PQIA 2K18A 4KGIA 1SK1A 2P5QA 4L8EA 1X5EA 3I69A 3QCPA 2I3YA 4TOPA 3UJ1A 10GSA 3K8NA 3D22A 4F03A 4ZL9A 3GTUB 1YEPA 4NWYA 1SK0A 2PBJA 1EV9A 4HEA2 5A4WA 2KHPA 2JADA 1A2LA 2L6DA 3LEFA 1NM3A 1ZL9A 4AJ6A 4IHUA 5IMAA 2YANA 3FR9A 2LRCA 16GSA 2V1MA 4MZCA 5DBQA 4WR5A 4I6XA 4TXOB 4F2IA 1PL2A 4EC0A 1PKZA 1XIYA 1OC9B 1A24A 3GUSA 3IOSA 3GKXA 4PNGA 1R7HA 2YN1A 4TN8A 2ZNMA 3TRPA 4MJCA 2AB6A 3DEXA 4FYUA 1MDJA 1BAYA 2QC7A 2F51A 4KSMA 2EIOA 5J3RA 2CQ9A 2AHEA 4LA1A 2X64A 3GX0A 3NIVA 3GHAA 4TXVA 3HZ4A 1GSEA 5ECPB 1K3LA 2LS5A 2C1YA 4KDUA 2DMMA 1TJDA 4LLRA 1GUKA 2M80A 2YPMA 1O6JA 1G7OA 4ZIJA 1JZWA 4LL4B 3UOMA 1OAZA 2L4QA 3G7YA 4E8HA 4KE3A 1AAZA 3FRCA 5ECMB 2L4CA 3TKPA 3F4RA 1FG4A 4K8MA 2PERA 3M9KA 5ECHB 3HVSA 4I5QA 2ALBA 4GRFA 1W89A 3EWLA 2C0GA 1V98A 3IAS2 2HFDA 3IE3A 1FOVA 1IYHA 1OC3A 3L78A 1TP9A 3IPZA 4WBJA 2LTKA 3TKSE 1U88A 2IJYA 3HZ8A 2HYXA 4XRDA 3A2XA 4F0BA 1A0FA 2JZTA 3GRXA 3G7JA 2GS3A 3VI7A 4RI6A 1DE1A 1JHBA 1K3YA 2GSSA 1JZRA 3ZMKA 3GKMA 3DWVA 3HHVA 2DJ0A 2IFQB 3F3QA 1MDIA 1T4ZA 3EU3A 5CRDA 3MSZA 1Z3EA 2A4VA 3H93A 5GSSA 1EWXA 1O8XA 4NAXA 2P5RA 5C04A 1F9MA 4NPBA 4MDCA 1BQ7A 2FWGA 5D9WA 1ZOFA 3CTFA 4GSSA 2FD3A 4FH8A 2FHEA 4K7IA 2HSHA 1DBYA 4WKWA 1GLPA 2LUSA 2OBIA 4DEJA 3IAM2 3BCKA 2R6KA 4ML1A 3NZNA 6GSTA 1ST9A 4ID0A 2DC5A 5E59A 1SJ6A 1TK8B 2NBSA 2CX4A 1VGLA 1XWKA 3IK9A 2YV7A 1B4QA 2OE1A 4V2LA 5EL8A 2H1DA 5CRWA 1FAAA 1SENA 3DXBA 2WULA 3GN3A 3CBUA 3BOAA 4ZL7A 2K8VA 1C72A 4WBRD 5B6NA 3MAKA 2C3QA 1W4VA 4V1Ap 4GXZA 2V32A 5EPFA 3TGZA 3A2VA 3GSTA 1YZXA 4HOJA 4L5LA 4V2NA 3TDGA 3H79A 3LJRA 1SK2A 2CAIA 3D0ZA 1VF3A 1QXHA 2LJKA 3QAGA 2YJHA 2E7PA 3QD9A 3A3TA 1VRSD 3C1SA 1O7UA 1Y6EA 5JWRB 4PQ1A 6GSVA 4F82A 3DD3A 2WGRA 1XVWA 3IDVA 1FO5A 2YZUA 3Q19A 2RUEA 2LJAA 3QMXA 1EOGA 1N8JA 5DJLA 2MBSA 1JZOA 1GSYA 3HD5A 1NSWA 4XS1A 3W6GA 3KH9A 2WDUA 3M9JA 4OFTA 2GQLA 1U87A 4ZB6A 5GAND 2CZ3A 2N5BA 5HR2A 2R37A 4EE0A 4EL1A 2MYGA
chains in the Genus database with same CATH superfamily
3RDWA 1KBNA 1ZYQB 4O7HA 5IO2A 3GL5A 1OVNA 1SD9A 5KOWA 1WP0A 1EP7A 5ECSA 1WOUA 3U6VA 3O76A 2B3SA 5CAXA 4GCIA 3IA1A 3HVVA 3D6IA 2FA8A 2IN3A 4G0IA 5D93A 2GDRA 5J5NA 2I4AA 2Z9SA 1BX9A 2H66A 2FUG2 1YKCA 5G31A 1UC7A 19GSA 11GSA 3KD0A 3VK9A 1A2MA 2F9SA 4LMWA 3IR4A 5DAKA 1BG5A 1EEMA 3ZVJA 2JZSA 1XW9A 4K2XA 5D9TA 1EEJA 2ZUPA 4XS6A 2B5XA 1XWAA 4GTUA 3VPTA 5GSTA 3F4TA 4JZQA 4K9ZA 1KNGA 4HZ4A 3UVHA 4EKZA 4K0NA 1V57A 4IBPA 2WRTA 2AUVA 4RQRA 5CREA 4WF5A 3D5JA 2L5LA 4HU9A 3DGQA 8GSSA 4GQCA 3TOUA 1ZYNA 2MMOA 3LSZA 1UVZA 3H8QA 1I9DA 2HSYA 1EGOA 2X8CA 5D96A 5ECQB 3KMOA 1X5CA 3HDCA 2CAQA 4QQ7A 5DVBA 5HFIA 5GZZB 2VCWA 1TRUA 2IMEA 2VL9A 5ECIB 4TR4A 4MZWA 3C73A 3WD6A 1EP8A 2OE0A 4OO4A 5G1LA 1XWCA 2B7JA 5BMUA 3MDKA 5IMZA 3E3EA 3I43A 5D73A 2H72A 5JCWA 2H71A 1PSQA 3FW2A 4OO5A 3ED3A 4KDXA 2LRTA 2B1KA 1CQGA 2HNLA 2LV3A 4EDZA 5LD0A 3L9VA 2X8GA 4ACSA 5FT3A 2O7KA 5B8BA 3GL3A 2VCVA 3WGEA 1J08A 5D9VA 2HE3A 3L9SA 4HZ2A 2JL4A 2HLSA 2DIZA 2VD0A 2CX3A 5LCZA 4PUAA 4HU7A 4BWQA 2VOCA 4MNNA 3KXOA 4X1UA 4AGSA 1O81A 2RUFA 2O85A 3F6FA 3ERGA 4IVFA 5CRGA 2R0PA 1F3BA 2ON5A 2DJ1A 1HNAA 2LQOA 2C3TA 4BWSA 2OADA 4CDOA 2FNOA 4NMUA 2HSMA 1ZYEA 4XIHA 1YF1A 5B8AA 1ERVA 1SYRA 2TRCP 1TKDB 2R5GA 1BJXA 1K3OA 4NHZA 1ABAA 2PU9C 4O5QA 4BL7A 3CMIA 4YH2A 1F2EA 1M2DA 3O3TA 4MPGA 1XCCA 5IO0A 4TRXA 2HZEA 2IWTA 1TTZA 1PRXA 4O32A 1EOHA 4HI7A 4K7OA 3E0UA 1TK0B 1EV4A 1F6MC 3M8NA 2XPEA 1SL0B 3ZIJA 4F0CA 2JU5A 4ECCA 2HZFA 1TI3A 3QOUA 2WCIA 2HRAA 4FO5A 4Q5FA 4OWYA 4DSQA 3ERFA 3A5IA 3SWLA 4K1FA 1Z7RA 2K8SA 5H5QA 2XBQA 1YY7A 3H1NA 3WGXA 2K6VA 2M46A 1ZZYA 3BJ5A 4KCAA 2G0FA 3KTBA 4IP6A 5HR3A 4O92A 3TKQA 3R2QA 1GTAA 1Z9HA 5AGYA 5ECRB 2PGTA 4NXIA 4MJEA 2CZ2A 1HQOA 4QL9A 4ZB9A 5FWGA 3QFAC 4K7NA 4RI7A 2VCXA 2X49A 2B5YA 2HRFA 2LNSA 3F3RA 5ECOB 3D4MA 3TJGA 2VM2A 1PQNA 1USBA 1XWGA 4ICYA 4NHWA 1PD21 4POBA 2V2GA 4N11A 2MMAA 3DRNA 1SKSB 1B4PA 3UBLA 3EURA 3FYGA 4JEDA 1YF0A 3LQ7A 3PR8A 1XW5A 4JR6A 1M3JA 5KN3A 5ELAA 1OE8A 2VUPA 1BYEA 4YQUA 1A8YA 1R5AA 2QSIA 3EU4A 2EIRA 1GUMA 2C4JA 2WS2A 3LWAA 4J57E 1YDKA 3KCMA 1CQHA 3ZZXA 2JSZA 1GRXA 3PPUA 3FMWA 2B6MA 4EIQA 1SJZA 3A2WA 1JZDA 5G1KA 2H6YA 3BCIA 1NHOA 4IGJA 1FB0A 2JACA 1ON4A 1YQ1A 3GKKA 2PVOC 2NPBA 3NOFA 2E0QA 1WJKA 2HRNA 4H86A 4OCEA 4OD7A 4F9ZA 4IKHA 5IIZA 1O85A 3TB2A 4I97A 4IP1A 4K0GA 1THOA 1PMTA 5EVOA 3LORA 4OCFA 2CVBA 4L0WA 1K0MA 4GF0A 3KP9A 4G2EA 2GLRA 1GL8A 1ACVA 2FWFA 3CRUA 4TR1A 3IBHA 3IXRA 4KCEA 3CSHA 3TJKA 2VL2C 3RAZA 4MK3A 1GTUA 2DBCA 1PGTA 2BMXA 2NTOA 5ENUA 3EMXA 2LRNA 2TRXA 2TIRA 3HY2A 5ID2A 2L5OA 2R0CA 1R5PA 4ECJA 4FYCA 1AXDA 2C8UA 3HVNA 3GSSA 3O6TA 4G10A 5G2ZA 5KEJA 3IHQA 1AQXA 1AQVA 4PXOA 4ZBBA 2VLVA 4N30A 2A2RA 1T4YA 3BBYA 4BPYA 2H1AA 2VIMA 2WB9A 3UAPA 3DKSA 3FY7A 2YZHA 1OYJA 1PL1A 4BVYA 1M9AA 2YV9A 1ML6A 3QAWA 1ZGNA 1TI1A 4ECBA 1ILOA 2HRKA 4POMA 1FB6A 2E2GA 1K0CA 3FZ5A 2QGVA 1GNEA 2ON7A 3GV1A 3ME8A 1V2AA 3FZ4A 3ISOA 4J2FA 2OE3A 4NV2A 3CSJA 4CY8A 1H75A 5AIVA 3WYWA 3UBKA 3EMPA 1A2JA 5CP1A 3HA9A 2C80A 1BEDA 1K0BA 1PN9A 4JRRA 5JWOB 3TOTA 5EY6A 3ME7A 2FWHA 4FIWA 3J7Yb 1XG8A 3FR3A 3I9V2 5G5EA 3D21A 1G0TA 3GURA 2AAWA 2VD1A 2PN8A 1B9XC 4TVEA 5B7CA 3ZYWA 5A5KA 3GH9A 2MMZA 2R4VA 1K0DA 2C0DA 3KEBA 4HS1A 3RPPA 2AJQB 5G30A 3TKRA 2RIIA 1QGVA 2H6ZA 1DE2A 2GVPA 3EVIA 4PGTA 2J23A 4MF5A 2KOKA 2HZEB 4I2TA 3MNGA 5A4UA 3GFKA 2I81A 4KDYA 1X0RA 1OKDA 4V2MA 4Q5QA 3ERWA 1THXA 3CTGA 4DSRA 2DJ3A 3QPMA 3UARA 2MBTA 4XS4A 3ZITA 4P3YB 3VI5A 1WWJA 5L71A 3ZRDA 5DJMA 2VL3A 4O5UA 4OFNA 3ZIVA 1S3CA 4V1Ag 1M2AA 3SBCA 5F0GA 1JFUA 1EZKA 1PFOA 5DCGA 4KB3A 2KP2A 3GA4A 3P8WA 2KUCA 6GSXA 5ECLB 4TKYA 3ZREA 7GSSA 2BTOT 5B6MA 2PPTA 2IPAA 4QL7A 2OKAA 3F63A 1TRSA 5CO3A 5E4WA 3BD2A 1XPVA 3L0HA 2GTUA 2LKUA 2GSRA 2H0HA 1I5GA 2GSTA 1ERUA 4ZBAA 1URMA 3F4SA 3ZMLA 5J9CA 1NW2A 4IQ1A 2CV4A 4X0XA 1R26A 2CA8A 3CQFA 2EIQA 3LGCA 4EXJA 3UMAA 3VLNA 1U3IA 1H4OA 2DIYA 5JCGA 3APQA 2F8AA 2OBKA 2PMTA 1JLWA 3ZVJD 2HT9A 1OE7A 4N0VA 1V40A 4X43A 4D73A 5ECNB 1SD8A 4OFMA 4IN0A 4Q5NA 1MDKA 2ES7A 3AY8A 1M2BA 4L5OA 2P0GA 5CNWA 2H19A 3IV4A 1KTEA 5INYA 4IELA 4EUYA 1X5DA 3FHKA 1LJRA 2H75A 4DVCA 3QAVA 3US3A 2MZCA 1B9YC 3F0IA 4IW9A 3KJYA 4ZL8A 1A23A 3APSA 4EF0A 3FZAA 1VF1A 4XTSA 3N5OA 1ZYPA 3IK7A 1B48A 3C1RA 2KP1A 1M9BA 3CSIA 3MWHA 3QR6A 1XWBA 3LXZA 5KOXA 1E6BA 5IMCA 5A4VA 2GT5A 5DALA 4MMMA 2FCHA 2J9HA 4G9HA 1MD4A 5H5RA 1GSQA 3PINA 4XRAA 3L4NA 5IPGA 4IQAA 1J0FA 1OC8A 4DSSA 3UVTA 2KLXA 4Z7XA 4RUVA 2DLXA 2DJ2A 2O87A 4HQZA 3APOA 4Z2TA 4KF9A 5IPHA 4TR1B 4Z2UA 2XHFA 3IRAA 1GTBA 3Q74A 2XBIA 1WRYA 3V1WA 5JWQB 1XOAA 1T1VA 4G0LA 3C8EA 4I8BA 1G7EA 3D4TA 4YQVA 1U3AA 3QFBC 2R3XA 3TRXA 5ID2B 3P90A 4GSNA 4EDYA 2GZZA 1V58A 1X9WB 2H1BA 4POKA 4IS0A 3GNJA 4J56E 1XVQA 4Q5RA 2HXKA 2H76A 5HQPA 2L6CA 1QMVA 1T8EB 4YAPA 2YOIA 2G2QA 2YCDA 3W8SA 1J9BA 1SU9A 2B1LA 1VF4A 4JU5A 1EGRA 4MABA 4BVYB 3DMLA 2YWNA 1TK5B 4E8EA 3W8JA 2N5FA 4KNDA 3WT2A 2GGTA 2BJXA 3UL3A 4WF4A 2LNTA 4N10A 3F6DA 1MTCA 2QA2A 3UEMA 4KA0A 4XHMA 3H4KA 5DQYA 2IMIA 4ZXGA 4EVMA 2QKEA 22GSA 4I2UA 3GKNA 1GSFA 3N9JA 2IMFA 5H5SA 4CW9A 2AV4A 3FK8A 5DDLA 3TJJA 2WJUA 3PH9A 4YQMA 1GLQA 1NHYA 2R2JA 2LJRA 2LSTA 1O8WA 2LQQA 4ILFA 5IMFA 3S9FA 1QFNA 4ZILA 1AUCA 4WR4A 5KN1A 1GWCA 3LG6A 2VL2A 3KTLA 3P2AA 3TKSC 2DSAA 4Z2RA 2REMA 4HQSA 4JR4A 3VWVA 5ELGA 4L0UA 4IJIA 3RHBA 4KSOA 4WEYA 1UA5A 4MZBA 4PNFA 4MF7A 2H73A 2F3MA 4GLTA 1QK8A 1ZCPA 3C7MA 4PURA 2OACA 4XS4B 2ZCTA 2X99A 1MEKA 1DSBA 1Q98A 9GSSA 1QUWA 1T7PB 1A0RP 4NV5A 4MA9A 2GZYA 1GSDA 1K0NA 5DAKB 4ULXA 1FW1A 4HDEA 1WMJA 17GSA 4HJ2A 5JCUA 2VLUA 3JCML 1Q4JA 3VWWA 2NVLA 5IOXA 4WETA 5KN0A 5F06A 1GUHA 2VCTA 5IOWA 3F9UA 2XPDA 5ABRA 3KGKA 2H6XA 3R3EA 1TXXA 3VPQA 3HKRA 3VFIA 2XC2A 3F8UA 1VF2A 1M99A 1FVJA 3QDNA 2M72A 3HJMA 3M0FA 2FA4A 5DCHA 2GT6A 5F07A 1GSUA 1Z6NA 3VWXA 5LNKe 3CRTA 4KAEA 2R0GA 3ZL5A 2F8FA 5FHIA 4A5PA 3CYNA 13GSA 2VM1A 5J9BA 4K5SA 4D73B 1M0UA 2V6KA 1Y25A 5AISA 3GH6A 4G0KA 3FR6A 3Q6OA 2RLIA 3M3MA 1RK4A 5KN2A 2VCQA 1TU8A 4CY6A 4KH7A 3PGTA 1TDIA 2V6OA 3KMNA 4FQUA 1RW1A 4BA7A 4GQFA 4CHSA 4TW5A 2YP6A 5IM9A 4MP4A 4FYBA 1E2YA 1K0AA 1K0OA 3GYKA 1IYIA 2YWOA 3G7IA 4K6XA 2JSYA 3HVXA 3WGDA 1Z6MA 2I1UA 2PWJA 5DALB 1T3BA 2DMLA 3HJPA 2CVKA 2IL3A 3GX8A 5COHA 4DSSB 1YJ6A 2B5EA 4ZBDA 3DYRA 4PUFC 5IMDA 1PX6A 3GTUA 2O8VB 3TJFA 1AW9A 4HJMA 3P7XA 2NDOA 2A2PA 4GWRA 1XZOA 2DJKA 1GSSA 3MIXA 2C0FA 5D9XA 2VO4A 1PKWA 3LYKA 1HNCA 3HYPA 3Q18A 5BRTA 1HD2A 4MH2A 14GSA 5C00A 1FOHA 4TXOA 4MF6A 5IMVA 1LU4A 2IMDA 3DIEA 1OC9A 1ZMAA 1PA3A 4HUAA 4LL1B 5HR1A 2MMNA 1X9SB 4BVXA 2YWMA 4K2DA 2LEGA 1Z7PA 2YWIA 4BL7B 5F8BA 3I6AA 5D8IA 6GSWA 1DUGA 1TRWA 2GSQA 3OR5A 1AC1A 18GSA 1JLVA 2RM6A 3RBTA 2DJJA 4KUNA 2GZPA 4PQHA 5HFKA 3LFLA 4KW6A 1HNBA 2RM5A 4TR3A 3GMFA 4ISDA 4YAVA 3FEUA 2O89A 4MCUA 1AQWA 3DVWA 1G6WA 4AF2A 2FY6A 4RQXA 5ECKB 3L9UA 4MPFA 4AJ8A 1SKWB 4AJ7A 4KX4A 2GQKA 2YNXA 1B8XA 3IC8A 3LXTA 4ZB8A 2FGXA 5F05A 2CT6A 3EYTA 5G5FA 1S3DA 4MLYA 3KZQA 1Z5YE 20GSA 2K9FA 5J41A 1TRVA 4OMVA 3FKFA 4EO3A 12GSA 5AIXA 3ZLPA 3KIJA 4MJAA 4WXTA 1SL1B 2HI7A 3EE2A 1T00A 1XOBA 5HR0A 1SL2B 1F3AA 2GQMA 2H1GA 1OKTA 3ZFLA 2H70A 2OJLA 6GSSA 3UIWA 4JBBA 3C71A 3HCZA 3TCOA 2EC4A 3EPTA 1TOFA 2IIYA 2D2ZA 1V9WA 1FHEA 2OA7A 1ERTA 6GSUA 4N0ZA 3TRQA 1MD3A 3G9BA 1O73A 2DKHA 4GSTA 5GAPD 4MJBA 1G6YA 1M7TA 4JE1A 2C3NA 2IMKA 3EINA 2V41A 3HXSA 3TUEA 1GH2A 4O5RA 1N2AA 3VURA 3IC4A 1TU7A 2VLTA 2QA1A 3MYDA 2FLSA 2VCZA 1X9MB 2IFQA 2H30A 1SJIA 1SKRB 3RPNA 1RQMA 2YJ7A 4ML6A 2H0GA 2E2MA 3KM6A 1GULA 2WFCA 2I9HA 5CYYA 1XW6A 2A4HA 1U6TA 5AN1A 3M1GA 1R4WA 4LMVA 2L59A 4PTSA 4MH3A 5DQSA 2FWEA 4TR0A 1XFLA 1YKAA 1XBSA 2VAFA 1GTIA 1PX7A 2AYTA 2WZ9A 3KH7A 1SYXA 5HFGA 6GSYA 4ECIA 2X8HA 3GIXA 3DVXA 1UN2A 3FZ9A 3CXGA 2P31A 1A8LA 1YEXA 3KP8A 1WPIA 2H0IA 1HYUA 3A5WA 1S3AA 2CVDA 3HJOA 3LYPA 4IJ3A 1TW9A 2L57A 4G19A 2N5AA 1XXUA 3VWUA 5J4UA 4XCSA 3ZTLA 3E9JB 5IQYA 1KEBA 1QQ2A 1WE0A 3TKSA 2H8LA 1WIKA 3ZFBA 3RHCA 1GNWA 3J7Yk 3U5RE 1AIUA 3EC3A 2PUKC 4PX1A 2H74A 1ERWA 5CRHA 4POLA 2A2SA 1GP1A 1FVKA 2JZRA 2B7KA 4HSCX 1F37A 3WT1A 1LBKA 2C0EA 2PVQA 3TJBA 2H01A 4PQIA 2K18A 4KGIA 1SK1A 2P5QA 4L8EA 1X5EA 3I69A 3QCPA 2I3YA 4TOPA 3UJ1A 10GSA 3K8NA 3D22A 4F03A 4ZL9A 3GTUB 1YEPA 4NWYA 1SK0A 2PBJA 1EV9A 4HEA2 5A4WA 2KHPA 2JADA 1A2LA 2L6DA 3LEFA 1NM3A 1ZL9A 4AJ6A 4IHUA 5IMAA 2YANA 3FR9A 2LRCA 16GSA 2V1MA 4MZCA 5DBQA 4WR5A 4I6XA 4TXOB 4F2IA 1PL2A 4EC0A 1PKZA 1XIYA 1OC9B 1A24A 3GUSA 3IOSA 2DKIA 4YKGA 3GKXA 4PNGA 1R7HA 2YN1A 4TN8A 4BVXB 2ZNMA 3TRPA 4MJCA 2AB6A 3DEXA 4FYUA 1MDJA 1BAYA 2QC7A 2F51A 4KSMA 2EIOA 5J3RA 1S3RA 2CQ9A 2AHEA 4LA1A 2X64A 3GX0A 3NIVA 3GHAA 4TXVA 3HZ4A 1GSEA 5ECPB 1K3LA 2LS5A 2C1YA 4KDUA 2DMMA 1TJDA 4LLRA 1GUKA 2M80A 2YPMA 1O6JA 1G7OA 4ZIJA 4YKFA 1JZWA 4LL4B 3UOMA 1OAZA 2L4QA 3G7YA 4E8HA 4KE3A 1AAZA 3FRCA 5ECMB 2L4CA 3TKPA 3F4RA 1FG4A 4K8MA 2PERA 3M9KA 5ECHB 3HVSA 4I5QA 2ALBA 4GRFA 1W89A 3EWLA 2C0GA 1V98A 3IAS2 2HFDA 3IE3A 1FOVA 1IYHA 1OC3A 3L78A 1TP9A 3IPZA 4WBJA 2LTKA 3TKSE 1U88A 2IJYA 3HZ8A 2HYXA 4XRDA 3A2XA 4F0BA 1A0FA 2JZTA 3GRXA 3G7JA 2GS3A 3VI7A 4RI6A 1DE1A 1JHBA 1K3YA 4EIPA 2GSSA 1M3IA 1JZRA 3ZMKA 2X4AA 3GKMA 3DWVA 3HHVA 2DJ0A 2IFQB 3F3QA 1MDIA 2UZ8A 1T4ZA 3EU3A 5CRDA 3MSZA 1Z3EA 2A4VA 3H93A 5GSSA 1EWXA 1O8XA 4NAXA 2P5RA 3LW9A 4X4JA 5C04A 4USSA 1F9MA 4NPBA 4MDCA 1BQ7A 2FWGA 5D9WA 1ZOFA 3CTFA 4GSSA 2FD3A 4FH8A 2FHEA 4K7IA 2HSHA 1DBYA 4WKWA 1GLPA 2LUSA 2OBIA 4DEJA 3IAM2 3BCKA 2R6KA 4ML1A 3NZNA 6GSTA 1ST9A 4ID0A 2DC5A 5E59A 1SJ6A 1TK8B 2NBSA 4BIKA 2CX4A 1VGLA 1XWKA 3IK9A 2YV7A 1B4QA 2OE1A 4V2LA 5EL8A 2H1DA 5CRWA 1FAAA 1SENA 3DXBA 2WULA 3GN3A 3CBUA 3BOAA 4ZL7A 2K8VA 1C72A 4WBRD 5B6NA 3MAKA 2C3QA 1W4VA 4V1Ap 4GXZA 2V32A 5EPFA 3TGZA 3A2VA 3GSTA 1YZXA 4HOJA 4L5LA 4V2NA 1PN0A 3TDGA 3H79A 3LJRA 1SK2A 2CAIA 3D0ZA 1VF3A 1QXHA 2LJKA 3QAGA 2YJHA 2E7PA 3QD9A 3A3TA 1VRSD 3C1SA 4K5RA 1O7UA 1Y6EA 5JWRB 4PQ1A 6GSVA 4F82A 3DD3A 2WGRA 1XVWA 3IDVA 1FO5A 2YZUA 3Q19A 2RUEA 2LJAA 3QMXA 1EOGA 1N8JA 5DJLA 2MBSA 1JZOA 1GSYA 3HD5A 1NSWA 4XS1A 3W6GA 3KH9A 2WDUA 3M9JA 3IHGA 4OFTA 2GQLA 1U87A 4ZB6A 5GAND 2CZ3A 2N5BA 5HR2A 2R37A 4EE0A 4EL1A 2MYGA
chains in the Genus database with same CATH topology
3RDWA 1KBNA 1ZYQB 4O7HA 5IO2A 3GL5A 1OVNA 1SD9A 5KOWA 1WP0A 1EP7A 5ECSA 1WOUA 3U6VA 3O76A 2B3SA 5CAXA 4GCIA 3IA1A 3HVVA 3D6IA 2FA8A 2IN3A 4G0IA 5D93A 2GDRA 5J5NA 2I4AA 2Z9SA 1BX9A 2H66A 2FUG2 1YKCA 5G31A 1UC7A 19GSA 11GSA 3KD0A 3VK9A 1A2MA 2F9SA 4LMWA 3IR4A 5DAKA 1BG5A 1EEMA 3ZVJA 2JZSA 1XW9A 4K2XA 5D9TA 1EEJA 2ZUPA 4XS6A 2B5XA 1XWAA 4GTUA 3VPTA 5GSTA 3F4TA 4JZQA 4K9ZA 1KNGA 4HZ4A 3UVHA 4EKZA 4K0NA 1V57A 4IBPA 2WRTA 2AUVA 4RQRA 5CREA 4WF5A 3D5JA 2L5LA 4HU9A 3DGQA 8GSSA 4GQCA 3TOUA 1ZYNA 2MMOA 3LSZA 1UVZA 3H8QA 1I9DA 2HSYA 1EGOA 2X8CA 5D96A 5ECQB 3KMOA 1X5CA 3HDCA 2CAQA 4QQ7A 5DVBA 5HFIA 5GZZB 2VCWA 1TRUA 2IMEA 2VL9A 5ECIB 4TR4A 4MZWA 3C73A 3WD6A 1EP8A 2OE0A 4OO4A 5G1LA 1XWCA 2B7JA 5BMUA 3MDKA 5IMZA 3E3EA 3I43A 5D73A 2H72A 5JCWA 2H71A 1PSQA 3FW2A 4OO5A 3ED3A 4KDXA 2LRTA 2B1KA 1CQGA 2HNLA 2LV3A 4EDZA 5LD0A 3L9VA 2X8GA 4ACSA 5FT3A 2O7KA 5B8BA 3GL3A 2VCVA 3WGEA 1J08A 5D9VA 2HE3A 3L9SA 4HZ2A 2JL4A 2HLSA 2DIZA 2VD0A 2CX3A 5LCZA 4PUAA 4HU7A 4BWQA 2VOCA 4MNNA 3KXOA 4X1UA 4AGSA 1O81A 2RUFA 2O85A 3F6FA 3ERGA 4IVFA 5CRGA 2R0PA 1F3BA 2ON5A 2DJ1A 1HNAA 2LQOA 2C3TA 4BWSA 2OADA 4CDOA 2FNOA 4NMUA 2HSMA 1ZYEA 4XIHA 1YF1A 5B8AA 1ERVA 1SYRA 2TRCP 1TKDB 2R5GA 1BJXA 1K3OA 4NHZA 1ABAA 2PU9C 4O5QA 4BL7A 3CMIA 4YH2A 1F2EA 1M2DA 3O3TA 4MPGA 1XCCA 5IO0A 4TRXA 2HZEA 2IWTA 1TTZA 1PRXA 4O32A 1EOHA 4HI7A 4K7OA 3E0UA 1TK0B 1EV4A 1F6MC 3M8NA 2XPEA 1SL0B 3ZIJA 4F0CA 2JU5A 4ECCA 2HZFA 1TI3A 3QOUA 2WCIA 2HRAA 4FO5A 4Q5FA 4OWYA 4DSQA 3ERFA 3A5IA 3SWLA 4K1FA 1Z7RA 2K8SA 5H5QA 2XBQA 1YY7A 3H1NA 3WGXA 2K6VA 2M46A 1ZZYA 3BJ5A 4KCAA 2G0FA 3KTBA 4IP6A 5HR3A 4O92A 3TKQA 3R2QA 1GTAA 1Z9HA 5AGYA 5ECRB 2PGTA 4NXIA 4MJEA 2CZ2A 1HQOA 4QL9A 4ZB9A 5FWGA 3QFAC 4K7NA 4RI7A 2VCXA 2X49A 2B5YA 2HRFA 2LNSA 3F3RA 5ECOB 3D4MA 3TJGA 2VM2A 1PQNA 1USBA 1XWGA 4ICYA 4NHWA 1PD21 4POBA 2V2GA 4N11A 2MMAA 3DRNA 1SKSB 1B4PA 3UBLA 3EURA 3FYGA 4JEDA 1YF0A 3LQ7A 3PR8A 1XW5A 4JR6A 5KN3A 5ELAA 1OE8A 2VUPA 1BYEA 4YQUA 1A8YA 1R5AA 2QSIA 3EU4A 2EIRA 1GUMA 2C4JA 2WS2A 3LWAA 4J57E 1YDKA 3KCMA 1CQHA 3ZZXA 2JSZA 1GRXA 3PPUA 3FMWA 2B6MA 4EIQA 1SJZA 3A2WA 1JZDA 5G1KA 2H6YA 3BCIA 1NHOA 4IGJA 1FB0A 2JACA 1ON4A 1YQ1A 3GKKA 2PVOC 2NPBA 3NOFA 2E0QA 1WJKA 2HRNA 4H86A 4OCEA 4OD7A 4F9ZA 4IKHA 5IIZA 1O85A 3TB2A 4I97A 4IP1A 4K0GA 1THOA 1PMTA 5EVOA 3LORA 4OCFA 2CVBA 4L0WA 1K0MA 4GF0A 3KP9A 4G2EA 2GLRA 1GL8A 1ACVA 2FWFA 3CRUA 4TR1A 3IBHA 3IXRA 4KCEA 3CSHA 3TJKA 2VL2C 3RAZA 4MK3A 1GTUA 2DBCA 1PGTA 2BMXA 2NTOA 5ENUA 3EMXA 2LRNA 2TRXA 2TIRA 3HY2A 5ID2A 2L5OA 2R0CA 1R5PA 4ECJA 4FYCA 1AXDA 2C8UA 3GSSA 3O6TA 4G10A 5G2ZA 5KEJA 3IHQA 1AQXA 1AQVA 4PXOA 4ZBBA 2VLVA 4N30A 2A2RA 1T4YA 3BBYA 4BPYA 2H1AA 2VIMA 2WB9A 3UAPA 3DKSA 3FY7A 2YZHA 1OYJA 1PL1A 4BVYA 1M9AA 2YV9A 1ML6A 3QAWA 1ZGNA 1TI1A 4ECBA 1ILOA 2HRKA 4POMA 1FB6A 2E2GA 1K0CA 3FZ5A 2QGVA 1GNEA 2ON7A 3GV1A 3ME8A 1V2AA 3FZ4A 3ISOA 4J2FA 2OE3A 4NV2A 3CSJA 4CY8A 1H75A 5AIVA 3WYWA 3UBKA 3EMPA 1A2JA 5CP1A 3HA9A 2C80A 1BEDA 1K0BA 1PN9A 4JRRA 5JWOB 3TOTA 5EY6A 3ME7A 2FWHA 4FIWA 3J7Yb 3FR3A 3I9V2 5G5EA 3D21A 1G0TA 3GURA 2AAWA 2VD1A 2PN8A 1B9XC 4TVEA 5B7CA 3ZYWA 5A5KA 3GH9A 2MMZA 2R4VA 1K0DA 2C0DA 3KEBA 4HS1A 3RPPA 2AJQB 5G30A 3TKRA 2RIIA 1QGVA 2H6ZA 1DE2A 2GVPA 3EVIA 4PGTA 2J23A 4MF5A 2KOKA 2HZEB 4I2TA 3MNGA 5A4UA 3GFKA 2I81A 4KDYA 1X0RA 1OKDA 4V2MA 4Q5QA 3ERWA 1THXA 3CTGA 4DSRA 2DJ3A 3QPMA 3UARA 2MBTA 4XS4A 3ZITA 4P3YB 3VI5A 1WWJA 5L71A 3ZRDA 5DJMA 2VL3A 4O5UA 4OFNA 3ZIVA 1S3CA 4V1Ag 1M2AA 3SBCA 5F0GA 1JFUA 1EZKA 5DCGA 4KB3A 2KP2A 3GA4A 3P8WA 2KUCA 6GSXA 5ECLB 4TKYA 3ZREA 7GSSA 2BTOT 5B6MA 2PPTA 2IPAA 4QL7A 2OKAA 3F63A 1TRSA 5CO3A 5E4WA 3BD2A 1XPVA 3L0HA 2GTUA 2LKUA 2GSRA 2H0HA 1I5GA 2GSTA 1ERUA 4ZBAA 1URMA 3F4SA 3ZMLA 5J9CA 1NW2A 4IQ1A 2CV4A 4X0XA 1R26A 2CA8A 2EIQA 3LGCA 4EXJA 3UMAA 3VLNA 1U3IA 1H4OA 2DIYA 5JCGA 3APQA 2F8AA 2OBKA 2PMTA 1JLWA 3ZVJD 2HT9A 1OE7A 4N0VA 1V40A 4X43A 4D73A 5ECNB 1SD8A 4OFMA 4IN0A 4Q5NA 1MDKA 2ES7A 3AY8A 1M2BA 4L5OA 2P0GA 5CNWA 2H19A 3IV4A 1KTEA 5INYA 4IELA 4EUYA 1X5DA 3FHKA 1LJRA 2H75A 4DVCA 3QAVA 3US3A 2MZCA 1B9YC 3F0IA 4IW9A 3KJYA 4ZL8A 1A23A 3APSA 4EF0A 3FZAA 1VF1A 4XTSA 3N5OA 1ZYPA 3IK7A 1B48A 3C1RA 2KP1A 1M9BA 3CSIA 3MWHA 3QR6A 1XWBA 3LXZA 5KOXA 1E6BA 5IMCA 5A4VA 2GT5A 5DALA 4MMMA 2FCHA 2J9HA 4G9HA 1MD4A 5H5RA 1GSQA 3PINA 4XRAA 3L4NA 5IPGA 4IQAA 1J0FA 1OC8A 4DSSA 3UVTA 2KLXA 4Z7XA 4RUVA 2DLXA 2DJ2A 2O87A 4HQZA 3APOA 4Z2TA 4KF9A 5IPHA 4TR1B 4Z2UA 2XHFA 3IRAA 1GTBA 3Q74A 2XBIA 1WRYA 3V1WA 5JWQB 1XOAA 1T1VA 4G0LA 3C8EA 4I8BA 1G7EA 3D4TA 4YQVA 1U3AA 3QFBC 2R3XA 3TRXA 5ID2B 3P90A 4GSNA 4EDYA 2GZZA 1V58A 1X9WB 2H1BA 4POKA 4IS0A 3GNJA 4J56E 1XVQA 4Q5RA 2HXKA 2H76A 5HQPA 2L6CA 1QMVA 1T8EB 4YAPA 2YOIA 2G2QA 2YCDA 3W8SA 1J9BA 1SU9A 2B1LA 1VF4A 4JU5A 1EGRA 4MABA 4BVYB 3DMLA 2YWNA 1TK5B 4E8EA 3W8JA 2N5FA 4KNDA 3WT2A 2GGTA 2BJXA 3UL3A 4WF4A 2LNTA 4N10A 3F6DA 1MTCA 2QA2A 3UEMA 4KA0A 4XHMA 3H4KA 5DQYA 2IMIA 4ZXGA 4EVMA 2QKEA 22GSA 4I2UA 3GKNA 1GSFA 3N9JA 2IMFA 5H5SA 4CW9A 2AV4A 3FK8A 5DDLA 3TJJA 2WJUA 3PH9A 4YQMA 1GLQA 1NHYA 2R2JA 2LJRA 2LSTA 1O8WA 2LQQA 4ILFA 5IMFA 3S9FA 1QFNA 4ZILA 1AUCA 4WR4A 5KN1A 1GWCA 3LG6A 2VL2A 3KTLA 3P2AA 3TKSC 2DSAA 4Z2RA 2REMA 4HQSA 4JR4A 3VWVA 5ELGA 4L0UA 4IJIA 3RHBA 4KSOA 4WEYA 1UA5A 4MZBA 4PNFA 4MF7A 2H73A 2F3MA 4GLTA 1QK8A 1ZCPA 3C7MA 4PURA 2OACA 4XS4B 2ZCTA 2X99A 1MEKA 1DSBA 1Q98A 9GSSA 1QUWA 1T7PB 1A0RP 4NV5A 4MA9A 2GZYA 1GSDA 1K0NA 5DAKB 4ULXA 1FW1A 4HDEA 1WMJA 17GSA 4HJ2A 5JCUA 2VLUA 3JCML 1Q4JA 3VWWA 2NVLA 5IOXA 4WETA 5KN0A 5F06A 1GUHA 2VCTA 5IOWA 3F9UA 2XPDA 5ABRA 3KGKA 2H6XA 3R3EA 1TXXA 3VPQA 3HKRA 3VFIA 2XC2A 3F8UA 1VF2A 1M99A 1FVJA 3QDNA 2M72A 3HJMA 3M0FA 2FA4A 5DCHA 2GT6A 5F07A 1GSUA 1Z6NA 3VWXA 5LNKe 3CRTA 4KAEA 2R0GA 3ZL5A 2F8FA 5FHIA 4A5PA 3CYNA 13GSA 2VM1A 5J9BA 4K5SA 4D73B 1M0UA 2V6KA 1Y25A 5AISA 3GH6A 4G0KA 3FR6A 3Q6OA 2RLIA 3M3MA 1RK4A 5KN2A 2VCQA 1TU8A 4CY6A 4KH7A 3PGTA 1TDIA 2V6OA 3KMNA 4FQUA 1RW1A 4BA7A 4GQFA 4CHSA 4TW5A 2YP6A 5IM9A 4MP4A 4FYBA 1E2YA 1K0AA 1K0OA 3GYKA 1IYIA 2YWOA 3G7IA 4K6XA 2JSYA 3HVXA 3WGDA 1Z6MA 2I1UA 2PWJA 5DALB 1T3BA 2DMLA 3HJPA 2CVKA 2IL3A 3GX8A 5COHA 4DSSB 1YJ6A 2B5EA 4ZBDA 3DYRA 4PUFC 5IMDA 1PX6A 3GTUA 2O8VB 3TJFA 1AW9A 4HJMA 3P7XA 2NDOA 2A2PA 4GWRA 1XZOA 2DJKA 1GSSA 3MIXA 2C0FA 5D9XA 2VO4A 1PKWA 3LYKA 1HNCA 3HYPA 3Q18A 5BRTA 1HD2A 4MH2A 14GSA 5C00A 1FOHA 4TXOA 4MF6A 5IMVA 1LU4A 2IMDA 3DIEA 1OC9A 1ZMAA 1PA3A 4HUAA 4LL1B 5HR1A 2MMNA 1X9SB 4BVXA 2YWMA 4K2DA 2LEGA 1Z7PA 2YWIA 4BL7B 5F8BA 3I6AA 5D8IA 6GSWA 1DUGA 1TRWA 2GSQA 3OR5A 1AC1A 18GSA 1JLVA 2RM6A 3RBTA 2DJJA 4KUNA 2GZPA 4PQHA 5HFKA 3LFLA 4KW6A 1HNBA 2RM5A 4TR3A 3GMFA 4ISDA 4YAVA 3FEUA 2O89A 4MCUA 1AQWA 3DVWA 1G6WA 4AF2A 2FY6A 4RQXA 5ECKB 3L9UA 4MPFA 4AJ8A 1SKWB 4AJ7A 4KX4A 2GQKA 2YNXA 1B8XA 3IC8A 3LXTA 4ZB8A 2FGXA 5F05A 2CT6A 3EYTA 5G5FA 1S3DA 4MLYA 3KZQA 1Z5YE 20GSA 2K9FA 5J41A 1TRVA 4OMVA 3FKFA 4EO3A 12GSA 5AIXA 3ZLPA 3KIJA 4MJAA 4WXTA 1SL1B 2HI7A 3EE2A 1T00A 1XOBA 5HR0A 1SL2B 1F3AA 2GQMA 2H1GA 1OKTA 3ZFLA 2H70A 2OJLA 6GSSA 3UIWA 4JBBA 3C71A 3HCZA 3TCOA 2EC4A 3EPTA 1TOFA 2IIYA 2D2ZA 1V9WA 1FHEA 2OA7A 1ERTA 6GSUA 4N0ZA 3TRQA 1MD3A 3G9BA 1O73A 2DKHA 4GSTA 5GAPD 4MJBA 1G6YA 1M7TA 4JE1A 2C3NA 2IMKA 3EINA 2V41A 3HXSA 3TUEA 1GH2A 4O5RA 1N2AA 3VURA 3IC4A 1TU7A 2VLTA 2QA1A 3MYDA 2FLSA 2VCZA 1X9MB 2IFQA 2H30A 1SJIA 1SKRB 3RPNA 1RQMA 2YJ7A 4ML6A 2H0GA 2E2MA 3KM6A 1GULA 2WFCA 2I9HA 5CYYA 1XW6A 2A4HA 1U6TA 5AN1A 3M1GA 1R4WA 4LMVA 2L59A 4PTSA 4MH3A 5DQSA 2FWEA 4TR0A 1XFLA 1YKAA 1XBSA 2VAFA 1GTIA 1PX7A 2AYTA 2WZ9A 3KH7A 1SYXA 5HFGA 6GSYA 4ECIA 2X8HA 3GIXA 3DVXA 1UN2A 3FZ9A 3CXGA 2P31A 1A8LA 1YEXA 3KP8A 1WPIA 2H0IA 1HYUA 3A5WA 1S3AA 2CVDA 3HJOA 3LYPA 4IJ3A 1TW9A 2L57A 4G19A 2N5AA 1XXUA 3VWUA 5J4UA 4XCSA 3ZTLA 3E9JB 5IQYA 1KEBA 1QQ2A 1WE0A 3TKSA 2H8LA 1WIKA 3ZFBA 3RHCA 1GNWA 3J7Yk 3U5RE 1AIUA 3EC3A 2PUKC 4PX1A 2H74A 1ERWA 5CRHA 4POLA 2A2SA 1GP1A 1FVKA 2JZRA 2B7KA 1F37A 3WT1A 1LBKA 2C0EA 2PVQA 3TJBA 2H01A 4PQIA 2K18A 4KGIA 1SK1A 2P5QA 4L8EA 1X5EA 3I69A 3QCPA 2I3YA 4TOPA 3UJ1A 10GSA 3K8NA 3D22A 4F03A 4ZL9A 3GTUB 1YEPA 4NWYA 1SK0A 2PBJA 1EV9A 4HEA2 5A4WA 2KHPA 2JADA 1A2LA 2L6DA 3LEFA 1NM3A 1ZL9A 4AJ6A 4IHUA 5IMAA 2YANA 3FR9A 2LRCA 16GSA 2V1MA 4MZCA 5DBQA 4WR5A 4I6XA 4TXOB 4F2IA 1PL2A 4EC0A 1PKZA 1XIYA 1OC9B 1A24A 3GUSA 3IOSA 2DKIA 4YKGA 3GKXA 4PNGA 1R7HA 2YN1A 4TN8A 4BVXB 2ZNMA 3TRPA 4MJCA 2AB6A 3DEXA 4FYUA 1MDJA 1BAYA 2QC7A 2F51A 4KSMA 2EIOA 5J3RA 2CQ9A 2AHEA 4LA1A 2X64A 3GX0A 3NIVA 3GHAA 4TXVA 3HZ4A 1GSEA 5ECPB 1K3LA 2LS5A 2C1YA 4KDUA 2DMMA 1TJDA 4LLRA 1GUKA 2M80A 2YPMA 1O6JA 1G7OA 4ZIJA 4YKFA 1JZWA 4LL4B 3UOMA 1OAZA 2L4QA 3G7YA 4E8HA 4KE3A 1AAZA 3FRCA 5ECMB 2L4CA 3TKPA 3F4RA 1FG4A 4K8MA 2PERA 3M9KA 5ECHB 3HVSA 4I5QA 2ALBA 4GRFA 1W89A 3EWLA 2C0GA 1V98A 3IAS2 2HFDA 3IE3A 1FOVA 1IYHA 1OC3A 3L78A 1TP9A 3IPZA 4WBJA 2LTKA 3TKSE 1U88A 2IJYA 3HZ8A 2HYXA 4XRDA 3A2XA 4F0BA 1A0FA 2JZTA 3GRXA 3G7JA 2GS3A 3VI7A 4RI6A 1DE1A 1JHBA 1K3YA 4EIPA 2GSSA 1JZRA 3ZMKA 2X4AA 3GKMA 3DWVA 3HHVA 2DJ0A 2IFQB 3F3QA 1MDIA 2UZ8A 1T4ZA 3EU3A 5CRDA 3MSZA 1Z3EA 2A4VA 3H93A 5GSSA 1EWXA 1O8XA 4NAXA 2P5RA 3LW9A 4X4JA 5C04A 4USSA 1F9MA 4NPBA 4MDCA 1BQ7A 2FWGA 5D9WA 1ZOFA 3CTFA 4GSSA 2FD3A 4FH8A 2FHEA 4K7IA 2HSHA 1DBYA 4WKWA 1GLPA 2LUSA 2OBIA 4DEJA 3IAM2 3BCKA 2R6KA 4ML1A 3NZNA 6GSTA 1ST9A 4ID0A 2DC5A 5E59A 1SJ6A 1TK8B 2NBSA 2CX4A 1VGLA 1XWKA 3IK9A 2YV7A 1B4QA 2OE1A 4V2LA 5EL8A 2H1DA 5CRWA 1FAAA 1SENA 3DXBA 2WULA 3GN3A 3CBUA 3BOAA 4ZL7A 2K8VA 1C72A 4WBRD 5B6NA 3MAKA 2C3QA 1W4VA 4V1Ap 4GXZA 2V32A 5EPFA 3TGZA 3A2VA 3GSTA 1YZXA 4HOJA 4L5LA 4V2NA 1PN0A 3TDGA 3H79A 3LJRA 1SK2A 2CAIA 3D0ZA 1VF3A 1QXHA 2LJKA 3QAGA 2YJHA 2E7PA 3QD9A 3A3TA 1VRSD 3C1SA 4K5RA 1O7UA 1Y6EA 5JWRB 4PQ1A 6GSVA 4F82A 3DD3A 2WGRA 1XVWA 3IDVA 1FO5A 2YZUA 3Q19A 2RUEA 2LJAA 3QMXA 1EOGA 1N8JA 5DJLA 2MBSA 1JZOA 1GSYA 3HD5A 1NSWA 4XS1A 3W6GA 3KH9A 2WDUA 3M9JA 3IHGA 4OFTA 2GQLA 1U87A 4ZB6A 5GAND 2CZ3A 2N5BA 5HR2A 2R37A 4EE0A 4EL1A 2MYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RDW A;  1KBN A;  1ZYQ B;  4O7H A;  5IO2 A;  3GL5 A;  1OVN A;  1SD9 A;  1WP0 A;  1EP7 A;  5ECS A;  1WOU A;  3U6V A;  3O76 A;  2B3S A;  5CAX A;  4GCI A;  3IA1 A;  3HVV A;  3D6I A;  2FA8 A;  2IN3 A;  5D93 A;  2GDR A;  5J5N A;  2I4A A;  2Z9S A;  1BX9 A;  2H66 A;  2FUG 2;  1YKC A;  5G31 A;  1UC7 A;  19GS A;  11GS A;  3KD0 A;  3VK9 A;  1A2M A;  2F9S A;  4LMW A;  3IR4 A;  5DAK A;  1BG5 A;  1EEM A;  3ZVJ A;  2JZS A;  1XW9 A;  5D9T A;  1EEJ A;  2ZUP A;  4XS6 A;  2B5X A;  1XWA A;  4GTU A;  3VPT A;  5GST A;  3F4T A;  4JZQ A;  4K9Z A;  1KNG A;  4HZ4 A;  3UVH A;  4EKZ A;  4K0N A;  1V57 A;  4IBP A;  2WRT A;  2AUV A;  4RQR A;  5CRE A;  4WF5 A;  3D5J A;  2L5L A;  4HU9 A;  3DGQ A;  8GSS A;  4GQC A;  3TOU A;  2MMO A;  3LSZ A;  1UVZ A;  3H8Q A;  1I9D A;  2HSY A;  1EGO A;  2X8C A;  5D96 A;  5ECQ B;  3KMO A;  1X5C A;  3HDC A;  2CAQ A;  4QQ7 A;  5DVB A;  5HFI A;  5GZZ B;  2VCW A;  1TRU A;  2IME A;  2VL9 A;  5ECI B;  4TR4 A;  4MZW A;  3C73 A;  3WD6 A;  1EP8 A;  2OE0 A;  4OO4 A;  5G1L A;  1XWC A;  2B7J A;  3MDK A;  5IMZ A;  3E3E A;  3I43 A;  5D73 A;  2H72 A;  5JCW A;  2H71 A;  1PSQ A;  3FW2 A;  4OO5 A;  3ED3 A;  4KDX A;  2LRT A;  2B1K A;  1CQG A;  2HNL A;  2LV3 A;  4EDZ A;  5LD0 A;  3L9V A;  2X8G A;  4ACS A;  5FT3 A;  2O7K A;  5B8B A;  3GL3 A;  2VCV A;  3WGE A;  1J08 A;  5D9V A;  2HE3 A;  3L9S A;  4HZ2 A;  2JL4 A;  2HLS A;  2DIZ A;  2VD0 A;  2CX3 A;  5LCZ A;  4PUA A;  4HU7 A;  4BWQ A;  2VOC A;  3KXO A;  4X1U A;  4AGS A;  1O81 A;  2RUF A;  2O85 A;  3F6F A;  3ERG A;  4IVF A;  5CRG A;  1F3B A;  2ON5 A;  2DJ1 A;  1HNA A;  2LQO A;  2C3T A;  4BWS A;  2OAD A;  4CDO A;  2FNO A;  4NMU A;  1ZYE A;  4XIH A;  1YF1 A;  5B8A A;  1ERV A;  1SYR A;  2TRC P;  1TKD B;  2R5G A;  1BJX A;  1K3O A;  4NHZ A;  1ABA A;  2PU9 C;  4BL7 A;  3CMI A;  4YH2 A;  1F2E A;  1M2D A;  3O3T A;  4MPG A;  1XCC A;  5IO0 A;  4TRX A;  2HZE A;  2IWT A;  1TTZ A;  1PRX A;  4O32 A;  1EOH A;  4HI7 A;  4K7O A;  3E0U A;  1TK0 B;  1EV4 A;  1F6M C;  3M8N A;  2XPE A;  1SL0 B;  3ZIJ A;  4F0C A;  2JU5 A;  4ECC A;  2HZF A;  1TI3 A;  3QOU A;  2WCI A;  4FO5 A;  4Q5F A;  4OWY A;  4DSQ A;  3ERF A;  3SWL A;  4K1F A;  1Z7R A;  2K8S A;  5H5Q A;  2XBQ A;  1YY7 A;  3H1N A;  3WGX A;  2K6V A;  2M46 A;  1ZZY A;  3BJ5 A;  4KCA A;  2G0F A;  3KTB A;  4IP6 A;  5HR3 A;  4O92 A;  3TKQ A;  3R2Q A;  1GTA A;  1Z9H A;  5AGY A;  5ECR B;  2PGT A;  4NXI A;  4MJE A;  2CZ2 A;  1HQO A;  4QL9 A;  4ZB9 A;  5FWG A;  3QFA C;  4K7N A;  4RI7 A;  2VCX A;  2B5Y A;  2HRF A;  2LNS A;  3F3R A;  5ECO B;  3D4M A;  3TJG A;  2VM2 A;  1PQN A;  1USB A;  1XWG A;  4NHW A;  1PD2 1;  4POB A;  2V2G A;  4N11 A;  2MMA A;  3DRN A;  1SKS B;  1B4P A;  3UBL A;  3EUR A;  3FYG A;  4JED A;  1YF0 A;  3LQ7 A;  3PR8 A;  1XW5 A;  4JR6 A;  5KN3 A;  5ELA A;  1OE8 A;  2VUP A;  1BYE A;  4YQU A;  1A8Y A;  1R5A A;  2QSI A;  3EU4 A;  2EIR A;  1GUM A;  2C4J A;  2WS2 A;  3LWA A;  4J57 E;  1YDK A;  3KCM A;  1CQH A;  3ZZX A;  2JSZ A;  1GRX A;  2B6M A;  1SJZ A;  3A2W A;  1JZD A;  5G1K A;  2H6Y A;  3BCI A;  1NHO A;  4IGJ A;  1FB0 A;  2JAC A;  1ON4 A;  1YQ1 A;  3GKK A;  2PVO C;  2NPB A;  3NOF A;  2E0Q A;  1WJK A;  2HRN A;  4H86 A;  4OCE A;  4OD7 A;  4F9Z A;  4IKH A;  5IIZ A;  1O85 A;  3TB2 A;  4I97 A;  4IP1 A;  4K0G A;  1THO A;  1PMT A;  5EVO A;  3LOR A;  4OCF A;  2CVB A;  4L0W A;  1K0M A;  4GF0 A;  3KP9 A;  4G2E A;  2GLR A;  1GL8 A;  1ACV A;  2FWF A;  3CRU A;  4TR1 A;  3IBH A;  3IXR A;  4KCE A;  3CSH A;  3TJK A;  2VL2 C;  3RAZ A;  4MK3 A;  1GTU A;  2DBC A;  1PGT A;  2BMX A;  2NTO A;  5ENU A;  3EMX A;  2LRN A;  2TRX A;  2TIR A;  3HY2 A;  5ID2 A;  2L5O A;  1R5P A;  4ECJ A;  4FYC A;  1AXD A;  2C8U A;  3GSS A;  3O6T A;  4G10 A;  5G2Z A;  5KEJ A;  3IHQ A;  1AQX A;  1AQV A;  4PXO A;  4ZBB A;  2VLV A;  4N30 A;  2A2R A;  1T4Y A;  3BBY A;  4BPY A;  2H1A A;  2VIM A;  2WB9 A;  3UAP A;  3DKS A;  3FY7 A;  2YZH A;  1OYJ A;  1PL1 A;  4BVY A;  1M9A A;  2YV9 A;  1ML6 A;  3QAW A;  1ZGN A;  1TI1 A;  4ECB A;  1ILO A;  4POM A;  1FB6 A;  2E2G A;  1K0C A;  3FZ5 A;  2QGV A;  1GNE A;  2ON7 A;  3GV1 A;  3ME8 A;  1V2A A;  3FZ4 A;  3ISO A;  4J2F A;  2OE3 A;  4NV2 A;  3CSJ A;  1H75 A;  5AIV A;  3WYW A;  3UBK A;  3EMP A;  1A2J A;  5CP1 A;  3HA9 A;  2C80 A;  1BED A;  1K0B A;  1PN9 A;  4JRR A;  5JWO B;  3TOT A;  5EY6 A;  3ME7 A;  2FWH A;  4FIW A;  3J7Y b;  3FR3 A;  3I9V 2;  5G5E A;  3D21 A;  1G0T A;  3GUR A;  2AAW A;  2VD1 A;  2PN8 A;  1B9X C;  4TVE A;  5B7C A;  3ZYW A;  5A5K A;  3GH9 A;  2MMZ A;  2R4V A;  1K0D A;  2C0D A;  3KEB A;  4HS1 A;  3RPP A;  2AJQ B;  5G30 A;  3TKR A;  2RII A;  1QGV A;  2H6Z A;  1DE2 A;  2GVP A;  3EVI A;  4PGT A;  2J23 A;  4MF5 A;  2KOK A;  2HZE B;  4I2T A;  3MNG A;  5A4U A;  3GFK A;  2I81 A;  4KDY A;  1X0R A;  1OKD A;  4V2M A;  4Q5Q A;  3ERW A;  1THX A;  3CTG A;  4DSR A;  2DJ3 A;  3QPM A;  3UAR A;  2MBT A;  4XS4 A;  3ZIT A;  4P3Y B;  3VI5 A;  1WWJ A;  5L71 A;  3ZRD A;  5DJM A;  2VL3 A;  4OFN A;  3ZIV A;  1S3C A;  4V1A g;  1M2A A;  3SBC A;  5F0G A;  1JFU A;  1EZK A;  5DCG A;  4KB3 A;  2KP2 A;  3GA4 A;  3P8W A;  2KUC A;  6GSX A;  5ECL B;  4TKY A;  3ZRE A;  7GSS A;  2BTO T;  5B6M A;  2PPT A;  2IPA A;  4QL7 A;  2OKA A;  3F63 A;  1TRS A;  5CO3 A;  5E4W A;  3BD2 A;  1XPV A;  3L0H A;  2GTU A;  2LKU A;  2GSR A;  2H0H A;  1I5G A;  2GST A;  1ERU A;  4ZBA A;  1URM A;  3F4S A;  3ZML A;  5J9C A;  1NW2 A;  4IQ1 A;  2CV4 A;  4X0X A;  1R26 A;  2CA8 A;  2EIQ A;  3LGC A;  4EXJ A;  3UMA A;  3VLN A;  1U3I A;  1H4O A;  2DIY A;  5JCG A;  3APQ A;  2F8A A;  2OBK A;  2PMT A;  1JLW A;  3ZVJ D;  2HT9 A;  1OE7 A;  4N0V A;  1V40 A;  4X43 A;  4D73 A;  5ECN B;  1SD8 A;  4OFM A;  4IN0 A;  4Q5N A;  1MDK A;  2ES7 A;  3AY8 A;  1M2B A;  4L5O A;  2P0G A;  5CNW A;  2H19 A;  3IV4 A;  1KTE A;  5INY A;  4IEL A;  4EUY A;  1X5D A;  3FHK A;  1LJR A;  2H75 A;  4DVC A;  3QAV A;  3US3 A;  2MZC A;  1B9Y C;  3F0I A;  4IW9 A;  3KJY A;  4ZL8 A;  1A23 A;  3APS A;  4EF0 A;  3FZA A;  1VF1 A;  4XTS A;  3N5O A;  3IK7 A;  1B48 A;  3C1R A;  2KP1 A;  1M9B A;  3CSI A;  3MWH A;  3QR6 A;  1XWB A;  3LXZ A;  1E6B A;  5IMC A;  5A4V A;  2GT5 A;  5DAL A;  4MMM A;  2FCH A;  2J9H A;  4G9H A;  1MD4 A;  5H5R A;  1GSQ A;  3PIN A;  4XRA A;  3L4N A;  5IPG A;  4IQA A;  1J0F A;  1OC8 A;  4DSS A;  3UVT A;  2KLX A;  4Z7X A;  4RUV A;  2DLX A;  2DJ2 A;  2O87 A;  4HQZ A;  3APO A;  5IPH A;  4TR1 B;  2XHF A;  3IRA A;  1GTB A;  3Q74 A;  2XBI A;  1WRY A;  3V1W A;  5JWQ B;  1XOA A;  1T1V A;  3C8E A;  4I8B A;  1G7E A;  3D4T A;  4YQV A;  1U3A A;  3QFB C;  2R3X A;  3TRX A;  5ID2 B;  3P90 A;  4GSN A;  4EDY A;  2GZZ A;  1V58 A;  1X9W B;  2H1B A;  4POK A;  4IS0 A;  3GNJ A;  4J56 E;  1XVQ A;  4Q5R A;  2HXK A;  2H76 A;  5HQP A;  2L6C A;  1QMV A;  1T8E B;  4YAP A;  2YOI A;  2G2Q A;  2YCD A;  3W8S A;  1J9B A;  1SU9 A;  2B1L A;  1VF4 A;  4JU5 A;  1EGR A;  4MAB A;  3DML A;  2YWN A;  1TK5 B;  4E8E A;  3W8J A;  2N5F A;  4KND A;  3WT2 A;  2GGT A;  2BJX A;  3UL3 A;  4WF4 A;  2LNT A;  4N10 A;  3F6D A;  1MTC A;  3UEM A;  4KA0 A;  4XHM A;  3H4K A;  5DQY A;  2IMI A;  4ZXG A;  4EVM A;  2QKE A;  22GS A;  4I2U A;  3GKN A;  1GSF A;  3N9J A;  2IMF A;  5H5S A;  4CW9 A;  2AV4 A;  3FK8 A;  5DDL A;  3TJJ A;  2WJU A;  3PH9 A;  4YQM A;  1GLQ A;  1NHY A;  2R2J A;  2LJR A;  2LST A;  1O8W A;  2LQQ A;  4ILF A;  5IMF A;  3S9F A;  1QFN A;  4ZIL A;  1AUC A;  4WR4 A;  5KN1 A;  1GWC A;  3LG6 A;  2VL2 A;  3KTL A;  3P2A A;  3TKS C;  2DSA A;  2REM A;  4HQS A;  4JR4 A;  3VWV A;  5ELG A;  4L0U A;  4IJI A;  3RHB A;  4KSO A;  4WEY A;  1UA5 A;  4MZB A;  4PNF A;  4MF7 A;  2H73 A;  2F3M A;  4GLT A;  1QK8 A;  1ZCP A;  3C7M A;  4PUR A;  2OAC A;  4XS4 B;  2ZCT A;  2X99 A;  1MEK A;  1DSB A;  1Q98 A;  9GSS A;  1QUW A;  1T7P B;  1A0R P;  4NV5 A;  4MA9 A;  2GZY A;  1GSD A;  1K0N A;  5DAK B;  4ULX A;  1FW1 A;  4HDE A;  1WMJ A;  17GS A;  4HJ2 A;  5JCU A;  2VLU A;  3JCM L;  1Q4J A;  3VWW A;  2NVL A;  5IOX A;  4WET A;  5KN0 A;  5F06 A;  1GUH A;  2VCT A;  5IOW A;  3F9U A;  2XPD A;  5ABR A;  3KGK A;  2H6X A;  1TXX A;  3VPQ A;  3HKR A;  3VFI A;  2XC2 A;  3F8U A;  1VF2 A;  1M99 A;  1FVJ A;  3QDN A;  2M72 A;  3HJM A;  3M0F A;  2FA4 A;  5DCH A;  2GT6 A;  5F07 A;  1GSU A;  1Z6N A;  3VWX A;  5LNK e;  3CRT A;  4KAE A;  3ZL5 A;  2F8F A;  5FHI A;  3CYN A;  13GS A;  2VM1 A;  5J9B A;  4D73 B;  1M0U A;  2V6K A;  1Y25 A;  5AIS A;  3GH6 A;  3FR6 A;  3Q6O A;  2RLI A;  3M3M A;  1RK4 A;  5KN2 A;  2VCQ A;  1TU8 A;  4KH7 A;  3PGT A;  1TDI A;  2V6O A;  3KMN A;  1RW1 A;  4BA7 A;  4GQF A;  4CHS A;  4TW5 A;  2YP6 A;  5IM9 A;  4MP4 A;  4FYB A;  1E2Y A;  1K0A A;  1K0O A;  3GYK A;  1IYI A;  2YWO A;  3G7I A;  4K6X A;  2JSY A;  3HVX A;  3WGD A;  1Z6M A;  2I1U A;  2PWJ A;  5DAL B;  1T3B A;  2DML A;  3HJP A;  2CVK A;  2IL3 A;  3GX8 A;  5COH A;  4DSS B;  1YJ6 A;  2B5E A;  4ZBD A;  3DYR A;  4PUF C;  5IMD A;  1PX6 A;  3GTU A;  2O8V B;  3TJF A;  1AW9 A;  4HJM A;  3P7X A;  2NDO A;  4GWR A;  1XZO A;  2DJK A;  1GSS A;  2C0F A;  5D9X A;  2VO4 A;  1PKW A;  3LYK A;  1HNC A;  3HYP A;  3Q18 A;  1HD2 A;  4MH2 A;  14GS A;  5C00 A;  5IMV A;  4TXO A;  4MF6 A;  1LU4 A;  2IMD A;  3DIE A;  1OC9 A;  1ZMA A;  1PA3 A;  4HUA A;  4LL1 B;  5HR1 A;  2MMN A;  1X9S B;  4BVX A;  2YWM A;  4K2D A;  2LEG A;  1Z7P A;  2YWI A;  5F8B A;  3I6A A;  5D8I A;  6GSW A;  1DUG A;  1TRW A;  2GSQ A;  3OR5 A;  1AC1 A;  18GS A;  1JLV A;  2RM6 A;  3RBT A;  2DJJ A;  4KUN A;  2GZP A;  4PQH A;  5HFK A;  3LFL A;  4KW6 A;  1HNB A;  2RM5 A;  4TR3 A;  3GMF A;  4ISD A;  4YAV A;  3FEU A;  2O89 A;  4MCU A;  1AQW A;  3DVW A;  1G6W A;  4AF2 A;  2FY6 A;  4RQX A;  5ECK B;  3L9U A;  4MPF A;  4AJ8 A;  1SKW B;  4AJ7 A;  4KX4 A;  2GQK A;  2YNX A;  1B8X A;  3LXT A;  4ZB8 A;  2FGX A;  5F05 A;  2CT6 A;  3EYT A;  5G5F A;  1S3D A;  4MLY A;  3KZQ A;  1Z5Y E;  20GS A;  2K9F A;  5J41 A;  1TRV A;  4OMV A;  3FKF A;  4EO3 A;  12GS A;  5AIX A;  3ZLP A;  3KIJ A;  4MJA A;  4WXT A;  1SL1 B;  2HI7 A;  3EE2 A;  1T00 A;  1XOB A;  5HR0 A;  1SL2 B;  1F3A A;  2GQM A;  2H1G A;  1OKT A;  3ZFL A;  2H70 A;  2OJL A;  6GSS A;  3UIW A;  4JBB A;  3C71 A;  3HCZ A;  3TCO A;  2EC4 A;  1TOF A;  2IIY A;  2D2Z A;  1V9W A;  1FHE A;  2OA7 A;  1ERT A;  6GSU A;  4N0Z A;  3TRQ A;  1MD3 A;  3G9B A;  1O73 A;  4GST A;  5GAP D;  4MJB A;  1G6Y A;  1M7T A;  4JE1 A;  2C3N A;  2IMK A;  3EIN A;  2V41 A;  3HXS A;  3TUE A;  1GH2 A;  4O5R A;  1N2A A;  3VUR A;  3IC4 A;  1TU7 A;  2VLT A;  2FLS A;  2VCZ A;  1X9M B;  2IFQ A;  2H30 A;  1SJI A;  1SKR B;  3RPN A;  1RQM A;  2YJ7 A;  4ML6 A;  2H0G A;  2E2M A;  3KM6 A;  1GUL A;  2WFC A;  2I9H A;  5CYY A;  1XW6 A;  1U6T A;  5AN1 A;  3M1G A;  1R4W A;  4LMV A;  2L59 A;  4MH3 A;  5DQS A;  2FWE A;  4TR0 A;  1XFL A;  1YKA A;  1XBS A;  2VAF A;  1GTI A;  1PX7 A;  2AYT A;  2WZ9 A;  3KH7 A;  1SYX A;  5HFG A;  6GSY A;  4ECI A;  2X8H A;  3GIX A;  3DVX A;  1UN2 A;  3FZ9 A;  3CXG A;  2P31 A;  1A8L A;  1YEX A;  3KP8 A;  1WPI A;  2H0I A;  1HYU A;  3A5W A;  1S3A A;  2CVD A;  3HJO A;  3LYP A;  4IJ3 A;  1TW9 A;  2L57 A;  4G19 A;  2N5A A;  1XXU A;  3VWU A;  5J4U A;  4XCS A;  3ZTL A;  3E9J B;  5IQY A;  1KEB A;  1QQ2 A;  1WE0 A;  3TKS A;  2H8L A;  1WIK A;  3ZFB A;  3RHC A;  1GNW A;  3J7Y k;  3U5R E;  1AIU A;  3EC3 A;  2PUK C;  4PX1 A;  2H74 A;  1ERW A;  5CRH A;  4POL A;  2A2S A;  1GP1 A;  1FVK A;  2JZR A;  2B7K A;  1F37 A;  3WT1 A;  1LBK A;  2C0E A;  2PVQ A;  3TJB A;  2H01 A;  4PQI A;  2K18 A;  4KGI A;  1SK1 A;  2P5Q A;  4L8E A;  1X5E A;  3I69 A;  3QCP A;  2I3Y A;  4TOP A;  3UJ1 A;  10GS A;  3K8N A;  3D22 A;  4F03 A;  4ZL9 A;  3GTU B;  1YEP A;  4NWY A;  1SK0 A;  2PBJ A;  1EV9 A;  4HEA 2;  5A4W A;  2KHP A;  2JAD A;  1A2L A;  2L6D A;  3LEF A;  1NM3 A;  1ZL9 A;  4AJ6 A;  4IHU A;  5IMA A;  2YAN A;  3FR9 A;  2LRC A;  16GS A;  2V1M A;  4MZC A;  5DBQ A;  4WR5 A;  4I6X A;  4TXO B;  4F2I A;  1PL2 A;  4EC0 A;  1PKZ A;  1XIY A;  1OC9 B;  1A24 A;  3GUS A;  3IOS A;  3GKX A;  4PNG A;  1R7H A;  2YN1 A;  4TN8 A;  2ZNM A;  3TRP A;  4MJC A;  2AB6 A;  3DEX A;  4FYU A;  1MDJ A;  1BAY A;  2QC7 A;  2F51 A;  4KSM A;  2EIO A;  5J3R A;  2CQ9 A;  2AHE A;  4LA1 A;  2X64 A;  3GX0 A;  3NIV A;  3GHA A;  4TXV A;  3HZ4 A;  1GSE A;  5ECP B;  1K3L A;  2LS5 A;  2C1Y A;  4KDU A;  2DMM A;  1TJD A;  4LLR A;  1GUK A;  2M80 A;  2YPM A;  1O6J A;  1G7O A;  4ZIJ A;  1JZW A;  4LL4 B;  3UOM A;  1OAZ A;  2L4Q A;  3G7Y A;  4E8H A;  4KE3 A;  1AAZ A;  3FRC A;  5ECM B;  2L4C A;  3TKP A;  3F4R A;  1FG4 A;  4K8M A;  2PER A;  3M9K A;  5ECH B;  3HVS A;  4I5Q A;  2ALB A;  4GRF A;  1W89 A;  3EWL A;  2C0G A;  1V98 A;  3IAS 2;  2HFD A;  3IE3 A;  1FOV A;  1IYH A;  1OC3 A;  3L78 A;  1TP9 A;  3IPZ A;  4WBJ A;  2LTK A;  3TKS E;  1U88 A;  2IJY A;  3HZ8 A;  2HYX A;  4XRD A;  3A2X A;  4F0B A;  1A0F A;  2JZT A;  3GRX A;  3G7J A;  2GS3 A;  3VI7 A;  4RI6 A;  1DE1 A;  1JHB A;  1K3Y A;  2GSS A;  1JZR A;  3ZMK A;  3GKM A;  3DWV A;  3HHV A;  2DJ0 A;  2IFQ B;  3F3Q A;  1MDI A;  1T4Z A;  3EU3 A;  5CRD A;  3MSZ A;  1Z3E A;  2A4V A;  3H93 A;  5GSS A;  1EWX A;  1O8X A;  4NAX A;  2P5R A;  5C04 A;  1F9M A;  4NPB A;  4MDC A;  1BQ7 A;  2FWG A;  5D9W A;  1ZOF A;  3CTF A;  4GSS A;  2FD3 A;  4FH8 A;  2FHE A;  4K7I A;  2HSH A;  1DBY A;  4WKW A;  1GLP A;  2LUS A;  2OBI A;  4DEJ A;  3IAM 2;  3BCK A;  2R6K A;  4ML1 A;  3NZN A;  6GST A;  1ST9 A;  4ID0 A;  2DC5 A;  5E59 A;  1SJ6 A;  1TK8 B;  2NBS A;  2CX4 A;  1VGL A;  1XWK A;  3IK9 A;  2YV7 A;  1B4Q A;  2OE1 A;  4V2L A;  5EL8 A;  2H1D A;  5CRW A;  1FAA A;  1SEN A;  3DXB A;  2WUL A;  3GN3 A;  3CBU A;  3BOA A;  4ZL7 A;  2K8V A;  1C72 A;  4WBR D;  5B6N A;  3MAK A;  2C3Q A;  1W4V A;  4V1A p;  4GXZ A;  2V32 A;  5EPF A;  3TGZ A;  3A2V A;  3GST A;  1YZX A;  4HOJ A;  4L5L A;  4V2N A;  3TDG A;  3H79 A;  3LJR A;  1SK2 A;  2CAI A;  3D0Z A;  1VF3 A;  1QXH A;  2LJK A;  3QAG A;  2YJH A;  2E7P A;  3QD9 A;  3A3T A;  1VRS D;  3C1S A;  1O7U A;  1Y6E A;  5JWR B;  4PQ1 A;  6GSV A;  4F82 A;  3DD3 A;  2WGR A;  1XVW A;  3IDV A;  1FO5 A;  2YZU A;  3Q19 A;  2RUE A;  2LJA A;  3QMX A;  1EOG A;  1N8J A;  5DJL A;  2MBS A;  1JZO A;  1GSY A;  3HD5 A;  1NSW A;  4XS1 A;  3W6G A;  3KH9 A;  2WDU A;  3M9J A;  4OFT A;  2GQL A;  1U87 A;  4ZB6 A;  5GAN D;  2CZ3 A;  2N5B A;  5HR2 A;  2R37 A;  4EE0 A;  4EL1 A;  2MYG A; 
#chains in the Genus database with same CATH topology
 3RDW A;  1KBN A;  1ZYQ B;  4O7H A;  5IO2 A;  3GL5 A;  1OVN A;  1SD9 A;  5KOW A;  1WP0 A;  1EP7 A;  5ECS A;  1WOU A;  3U6V A;  3O76 A;  2B3S A;  5CAX A;  4GCI A;  3IA1 A;  3HVV A;  3D6I A;  2FA8 A;  2IN3 A;  4G0I A;  5D93 A;  2GDR A;  5J5N A;  2I4A A;  2Z9S A;  1BX9 A;  2H66 A;  2FUG 2;  1YKC A;  5G31 A;  1UC7 A;  19GS A;  11GS A;  3KD0 A;  3VK9 A;  1A2M A;  2F9S A;  4LMW A;  3IR4 A;  5DAK A;  1BG5 A;  1EEM A;  3ZVJ A;  2JZS A;  1XW9 A;  4K2X A;  5D9T A;  1EEJ A;  2ZUP A;  4XS6 A;  2B5X A;  1XWA A;  4GTU A;  3VPT A;  5GST A;  3F4T A;  4JZQ A;  4K9Z A;  1KNG A;  4HZ4 A;  3UVH A;  4EKZ A;  4K0N A;  1V57 A;  4IBP A;  2WRT A;  2AUV A;  4RQR A;  5CRE A;  4WF5 A;  3D5J A;  2L5L A;  4HU9 A;  3DGQ A;  8GSS A;  4GQC A;  3TOU A;  1ZYN A;  2MMO A;  3LSZ A;  1UVZ A;  3H8Q A;  1I9D A;  2HSY A;  1EGO A;  2X8C A;  5D96 A;  5ECQ B;  3KMO A;  1X5C A;  3HDC A;  2CAQ A;  4QQ7 A;  5DVB A;  5HFI A;  5GZZ B;  2VCW A;  1TRU A;  2IME A;  2VL9 A;  5ECI B;  4TR4 A;  4MZW A;  3C73 A;  3WD6 A;  1EP8 A;  2OE0 A;  4OO4 A;  5G1L A;  1XWC A;  2B7J A;  5BMU A;  3MDK A;  5IMZ A;  3E3E A;  3I43 A;  5D73 A;  2H72 A;  5JCW A;  2H71 A;  1PSQ A;  3FW2 A;  4OO5 A;  3ED3 A;  4KDX A;  2LRT A;  2B1K A;  1CQG A;  2HNL A;  2LV3 A;  4EDZ A;  5LD0 A;  3L9V A;  2X8G A;  4ACS A;  5FT3 A;  2O7K A;  5B8B A;  3GL3 A;  2VCV A;  3WGE A;  1J08 A;  5D9V A;  2HE3 A;  3L9S A;  4HZ2 A;  2JL4 A;  2HLS A;  2DIZ A;  2VD0 A;  2CX3 A;  5LCZ A;  4PUA A;  4HU7 A;  4BWQ A;  2VOC A;  4MNN A;  3KXO A;  4X1U A;  4AGS A;  1O81 A;  2RUF A;  2O85 A;  3F6F A;  3ERG A;  4IVF A;  5CRG A;  2R0P A;  1F3B A;  2ON5 A;  2DJ1 A;  1HNA A;  2LQO A;  2C3T A;  4BWS A;  2OAD A;  4CDO A;  2FNO A;  4NMU A;  2HSM A;  1ZYE A;  4XIH A;  1YF1 A;  5B8A A;  1ERV A;  1SYR A;  2TRC P;  1TKD B;  2R5G A;  1BJX A;  1K3O A;  4NHZ A;  1ABA A;  2PU9 C;  4O5Q A;  4BL7 A;  3CMI A;  4YH2 A;  1F2E A;  1M2D A;  3O3T A;  4MPG A;  1XCC A;  5IO0 A;  4TRX A;  2HZE A;  2IWT A;  1TTZ A;  1PRX A;  4O32 A;  1EOH A;  4HI7 A;  4K7O A;  3E0U A;  1TK0 B;  1EV4 A;  1F6M C;  3M8N A;  2XPE A;  1SL0 B;  3ZIJ A;  4F0C A;  2JU5 A;  4ECC A;  2HZF A;  1TI3 A;  3QOU A;  2WCI A;  2HRA A;  4FO5 A;  4Q5F A;  4OWY A;  4DSQ A;  3ERF A;  3A5I A;  3SWL A;  4K1F A;  1Z7R A;  2K8S A;  5H5Q A;  2XBQ A;  1YY7 A;  3H1N A;  3WGX A;  2K6V A;  2M46 A;  1ZZY A;  3BJ5 A;  4KCA A;  2G0F A;  3KTB A;  4IP6 A;  5HR3 A;  4O92 A;  3TKQ A;  3R2Q A;  1GTA A;  1Z9H A;  5AGY A;  5ECR B;  2PGT A;  4NXI A;  4MJE A;  2CZ2 A;  1HQO A;  4QL9 A;  4ZB9 A;  5FWG A;  3QFA C;  4K7N A;  4RI7 A;  2VCX A;  2X49 A;  2B5Y A;  2HRF A;  2LNS A;  3F3R A;  5ECO B;  3D4M A;  3TJG A;  2VM2 A;  1PQN A;  1USB A;  1XWG A;  4ICY A;  4NHW A;  1PD2 1;  4POB A;  2V2G A;  4N11 A;  2MMA A;  3DRN A;  1SKS B;  1B4P A;  3UBL A;  3EUR A;  3FYG A;  4JED A;  1YF0 A;  3LQ7 A;  3PR8 A;  1XW5 A;  4JR6 A;  1M3J A;  5KN3 A;  5ELA A;  1OE8 A;  2VUP A;  1BYE A;  4YQU A;  1A8Y A;  1R5A A;  2QSI A;  3EU4 A;  2EIR A;  1GUM A;  2C4J A;  2WS2 A;  3LWA A;  4J57 E;  1YDK A;  3KCM A;  1CQH A;  3ZZX A;  2JSZ A;  1GRX A;  3PPU A;  3FMW A;  2B6M A;  4EIQ A;  1SJZ A;  3A2W A;  1JZD A;  5G1K A;  2H6Y A;  3BCI A;  1NHO A;  4IGJ A;  1FB0 A;  2JAC A;  1ON4 A;  1YQ1 A;  3GKK A;  2PVO C;  2NPB A;  3NOF A;  2E0Q A;  1WJK A;  2HRN A;  4H86 A;  4OCE A;  4OD7 A;  4F9Z A;  4IKH A;  5IIZ A;  1O85 A;  3TB2 A;  4I97 A;  4IP1 A;  4K0G A;  1THO A;  1PMT A;  5EVO A;  3LOR A;  4OCF A;  2CVB A;  4L0W A;  1K0M A;  4GF0 A;  3KP9 A;  4G2E A;  2GLR A;  1GL8 A;  1ACV A;  2FWF A;  3CRU A;  4TR1 A;  3IBH A;  3IXR A;  4KCE A;  3CSH A;  3TJK A;  2VL2 C;  3RAZ A;  4MK3 A;  1GTU A;  2DBC A;  1PGT A;  2BMX A;  2NTO A;  5ENU A;  3EMX A;  2LRN A;  2TRX A;  2TIR A;  3HY2 A;  5ID2 A;  2L5O A;  2R0C A;  1R5P A;  4ECJ A;  4FYC A;  1AXD A;  2C8U A;  3HVN A;  3GSS A;  3O6T A;  4G10 A;  5G2Z A;  5KEJ A;  3IHQ A;  1AQX A;  1AQV A;  4PXO A;  4ZBB A;  2VLV A;  4N30 A;  2A2R A;  1T4Y A;  3BBY A;  4BPY A;  2H1A A;  2VIM A;  2WB9 A;  3UAP A;  3DKS A;  3FY7 A;  2YZH A;  1OYJ A;  1PL1 A;  4BVY A;  1M9A A;  2YV9 A;  1ML6 A;  3QAW A;  1ZGN A;  1TI1 A;  4ECB A;  1ILO A;  2HRK A;  4POM A;  1FB6 A;  2E2G A;  1K0C A;  3FZ5 A;  2QGV A;  1GNE A;  2ON7 A;  3GV1 A;  3ME8 A;  1V2A A;  3FZ4 A;  3ISO A;  4J2F A;  2OE3 A;  4NV2 A;  3CSJ A;  4CY8 A;  1H75 A;  5AIV A;  3WYW A;  3UBK A;  3EMP A;  1A2J A;  5CP1 A;  3HA9 A;  2C80 A;  1BED A;  1K0B A;  1PN9 A;  4JRR A;  5JWO B;  3TOT A;  5EY6 A;  3ME7 A;  2FWH A;  4FIW A;  3J7Y b;  1XG8 A;  3FR3 A;  3I9V 2;  5G5E A;  3D21 A;  1G0T A;  3GUR A;  2AAW A;  2VD1 A;  2PN8 A;  1B9X C;  4TVE A;  5B7C A;  3ZYW A;  5A5K A;  3GH9 A;  2MMZ A;  2R4V A;  1K0D A;  2C0D A;  3KEB A;  4HS1 A;  3RPP A;  2AJQ B;  5G30 A;  3TKR A;  2RII A;  1QGV A;  2H6Z A;  1DE2 A;  2GVP A;  3EVI A;  4PGT A;  2J23 A;  4MF5 A;  2KOK A;  2HZE B;  4I2T A;  3MNG A;  5A4U A;  3GFK A;  2I81 A;  4KDY A;  1X0R A;  1OKD A;  4V2M A;  4Q5Q A;  3ERW A;  1THX A;  3CTG A;  4DSR A;  2DJ3 A;  3QPM A;  3UAR A;  2MBT A;  4XS4 A;  3ZIT A;  4P3Y B;  3VI5 A;  1WWJ A;  5L71 A;  3ZRD A;  5DJM A;  2VL3 A;  4O5U A;  4OFN A;  3ZIV A;  1S3C A;  4V1A g;  1M2A A;  3SBC A;  5F0G A;  1JFU A;  1EZK A;  1PFO A;  5DCG A;  4KB3 A;  2KP2 A;  3GA4 A;  3P8W A;  2KUC A;  6GSX A;  5ECL B;  4TKY A;  3ZRE A;  7GSS A;  2BTO T;  5B6M A;  2PPT A;  2IPA A;  4QL7 A;  2OKA A;  3F63 A;  1TRS A;  5CO3 A;  5E4W A;  3BD2 A;  1XPV A;  3L0H A;  2GTU A;  2LKU A;  2GSR A;  2H0H A;  1I5G A;  2GST A;  1ERU A;  4ZBA A;  1URM A;  3F4S A;  3ZML A;  5J9C A;  1NW2 A;  4IQ1 A;  2CV4 A;  4X0X A;  1R26 A;  2CA8 A;  3CQF A;  2EIQ A;  3LGC A;  4EXJ A;  3UMA A;  3VLN A;  1U3I A;  1H4O A;  2DIY A;  5JCG A;  3APQ A;  2F8A A;  2OBK A;  2PMT A;  1JLW A;  3ZVJ D;  2HT9 A;  1OE7 A;  4N0V A;  1V40 A;  4X43 A;  4D73 A;  5ECN B;  1SD8 A;  4OFM A;  4IN0 A;  4Q5N A;  1MDK A;  2ES7 A;  3AY8 A;  1M2B A;  4L5O A;  2P0G A;  5CNW A;  2H19 A;  3IV4 A;  1KTE A;  5INY A;  4IEL A;  4EUY A;  1X5D A;  3FHK A;  1LJR A;  2H75 A;  4DVC A;  3QAV A;  3US3 A;  2MZC A;  1B9Y C;  3F0I A;  4IW9 A;  3KJY A;  4ZL8 A;  1A23 A;  3APS A;  4EF0 A;  3FZA A;  1VF1 A;  4XTS A;  3N5O A;  1ZYP A;  3IK7 A;  1B48 A;  3C1R A;  2KP1 A;  1M9B A;  3CSI A;  3MWH A;  3QR6 A;  1XWB A;  3LXZ A;  5KOX A;  1E6B A;  5IMC A;  5A4V A;  2GT5 A;  5DAL A;  4MMM A;  2FCH A;  2J9H A;  4G9H A;  1MD4 A;  5H5R A;  1GSQ A;  3PIN A;  4XRA A;  3L4N A;  5IPG A;  4IQA A;  1J0F A;  1OC8 A;  4DSS A;  3UVT A;  2KLX A;  4Z7X A;  4RUV A;  2DLX A;  2DJ2 A;  2O87 A;  4HQZ A;  3APO A;  4Z2T A;  4KF9 A;  5IPH A;  4TR1 B;  4Z2U A;  2XHF A;  3IRA A;  1GTB A;  3Q74 A;  2XBI A;  1WRY A;  3V1W A;  5JWQ B;  1XOA A;  1T1V A;  4G0L A;  3C8E A;  4I8B A;  1G7E A;  3D4T A;  4YQV A;  1U3A A;  3QFB C;  2R3X A;  3TRX A;  5ID2 B;  3P90 A;  4GSN A;  4EDY A;  2GZZ A;  1V58 A;  1X9W B;  2H1B A;  4POK A;  4IS0 A;  3GNJ A;  4J56 E;  1XVQ A;  4Q5R A;  2HXK A;  2H76 A;  5HQP A;  2L6C A;  1QMV A;  1T8E B;  4YAP A;  2YOI A;  2G2Q A;  2YCD A;  3W8S A;  1J9B A;  1SU9 A;  2B1L A;  1VF4 A;  4JU5 A;  1EGR A;  4MAB A;  4BVY B;  3DML A;  2YWN A;  1TK5 B;  4E8E A;  3W8J A;  2N5F A;  4KND A;  3WT2 A;  2GGT A;  2BJX A;  3UL3 A;  4WF4 A;  2LNT A;  4N10 A;  3F6D A;  1MTC A;  2QA2 A;  3UEM A;  4KA0 A;  4XHM A;  3H4K A;  5DQY A;  2IMI A;  4ZXG A;  4EVM A;  2QKE A;  22GS A;  4I2U A;  3GKN A;  1GSF A;  3N9J A;  2IMF A;  5H5S A;  4CW9 A;  2AV4 A;  3FK8 A;  5DDL A;  3TJJ A;  2WJU A;  3PH9 A;  4YQM A;  1GLQ A;  1NHY A;  2R2J A;  2LJR A;  2LST A;  1O8W A;  2LQQ A;  4ILF A;  5IMF A;  3S9F A;  1QFN A;  4ZIL A;  1AUC A;  4WR4 A;  5KN1 A;  1GWC A;  3LG6 A;  2VL2 A;  3KTL A;  3P2A A;  3TKS C;  2DSA A;  4Z2R A;  2REM A;  4HQS A;  4JR4 A;  3VWV A;  5ELG A;  4L0U A;  4IJI A;  3RHB A;  4KSO A;  4WEY A;  1UA5 A;  4MZB A;  4PNF A;  4MF7 A;  2H73 A;  2F3M A;  4GLT A;  1QK8 A;  1ZCP A;  3C7M A;  4PUR A;  2OAC A;  4XS4 B;  2ZCT A;  2X99 A;  1MEK A;  1DSB A;  1Q98 A;  9GSS A;  1QUW A;  1T7P B;  1A0R P;  4NV5 A;  4MA9 A;  2GZY A;  1GSD A;  1K0N A;  5DAK B;  4ULX A;  1FW1 A;  4HDE A;  1WMJ A;  17GS A;  4HJ2 A;  5JCU A;  2VLU A;  3JCM L;  1Q4J A;  3VWW A;  2NVL A;  5IOX A;  4WET A;  5KN0 A;  5F06 A;  1GUH A;  2VCT A;  5IOW A;  3F9U A;  2XPD A;  5ABR A;  3KGK A;  2H6X A;  3R3E A;  1TXX A;  3VPQ A;  3HKR A;  3VFI A;  2XC2 A;  3F8U A;  1VF2 A;  1M99 A;  1FVJ A;  3QDN A;  2M72 A;  3HJM A;  3M0F A;  2FA4 A;  5DCH A;  2GT6 A;  5F07 A;  1GSU A;  1Z6N A;  3VWX A;  5LNK e;  3CRT A;  4KAE A;  2R0G A;  3ZL5 A;  2F8F A;  5FHI A;  4A5P A;  3CYN A;  13GS A;  2VM1 A;  5J9B A;  4K5S A;  4D73 B;  1M0U A;  2V6K A;  1Y25 A;  5AIS A;  3GH6 A;  4G0K A;  3FR6 A;  3Q6O A;  2RLI A;  3M3M A;  1RK4 A;  5KN2 A;  2VCQ A;  1TU8 A;  4CY6 A;  4KH7 A;  3PGT A;  1TDI A;  2V6O A;  3KMN A;  4FQU A;  1RW1 A;  4BA7 A;  4GQF A;  4CHS A;  4TW5 A;  2YP6 A;  5IM9 A;  4MP4 A;  4FYB A;  1E2Y A;  1K0A A;  1K0O A;  3GYK A;  1IYI A;  2YWO A;  3G7I A;  4K6X A;  2JSY A;  3HVX A;  3WGD A;  1Z6M A;  2I1U A;  2PWJ A;  5DAL B;  1T3B A;  2DML A;  3HJP A;  2CVK A;  2IL3 A;  3GX8 A;  5COH A;  4DSS B;  1YJ6 A;  2B5E A;  4ZBD A;  3DYR A;  4PUF C;  5IMD A;  1PX6 A;  3GTU A;  2O8V B;  3TJF A;  1AW9 A;  4HJM A;  3P7X A;  2NDO A;  2A2P A;  4GWR A;  1XZO A;  2DJK A;  1GSS A;  3MIX A;  2C0F A;  5D9X A;  2VO4 A;  1PKW A;  3LYK A;  1HNC A;  3HYP A;  3Q18 A;  5BRT A;  1HD2 A;  4MH2 A;  14GS A;  5C00 A;  1FOH A;  4TXO A;  4MF6 A;  5IMV A;  1LU4 A;  2IMD A;  3DIE A;  1OC9 A;  1ZMA A;  1PA3 A;  4HUA A;  4LL1 B;  5HR1 A;  2MMN A;  1X9S B;  4BVX A;  2YWM A;  4K2D A;  2LEG A;  1Z7P A;  2YWI A;  4BL7 B;  5F8B A;  3I6A A;  5D8I A;  6GSW A;  1DUG A;  1TRW A;  2GSQ A;  3OR5 A;  1AC1 A;  18GS A;  1JLV A;  2RM6 A;  3RBT A;  2DJJ A;  4KUN A;  2GZP A;  4PQH A;  5HFK A;  3LFL A;  4KW6 A;  1HNB A;  2RM5 A;  4TR3 A;  3GMF A;  4ISD A;  4YAV A;  3FEU A;  2O89 A;  4MCU A;  1AQW A;  3DVW A;  1G6W A;  4AF2 A;  2FY6 A;  4RQX A;  5ECK B;  3L9U A;  4MPF A;  4AJ8 A;  1SKW B;  4AJ7 A;  4KX4 A;  2GQK A;  2YNX A;  1B8X A;  3IC8 A;  3LXT A;  4ZB8 A;  2FGX A;  5F05 A;  2CT6 A;  3EYT A;  5G5F A;  1S3D A;  4MLY A;  3KZQ A;  1Z5Y E;  20GS A;  2K9F A;  5J41 A;  1TRV A;  4OMV A;  3FKF A;  4EO3 A;  12GS A;  5AIX A;  3ZLP A;  3KIJ A;  4MJA A;  4WXT A;  1SL1 B;  2HI7 A;  3EE2 A;  1T00 A;  1XOB A;  5HR0 A;  1SL2 B;  1F3A A;  2GQM A;  2H1G A;  1OKT A;  3ZFL A;  2H70 A;  2OJL A;  6GSS A;  3UIW A;  4JBB A;  3C71 A;  3HCZ A;  3TCO A;  2EC4 A;  3EPT A;  1TOF A;  2IIY A;  2D2Z A;  1V9W A;  1FHE A;  2OA7 A;  1ERT A;  6GSU A;  4N0Z A;  3TRQ A;  1MD3 A;  3G9B A;  1O73 A;  2DKH A;  4GST A;  5GAP D;  4MJB A;  1G6Y A;  1M7T A;  4JE1 A;  2C3N A;  2IMK A;  3EIN A;  2V41 A;  3HXS A;  3TUE A;  1GH2 A;  4O5R A;  1N2A A;  3VUR A;  3IC4 A;  1TU7 A;  2VLT A;  2QA1 A;  3MYD A;  2FLS A;  2VCZ A;  1X9M B;  2IFQ A;  2H30 A;  1SJI A;  1SKR B;  3RPN A;  1RQM A;  2YJ7 A;  4ML6 A;  2H0G A;  2E2M A;  3KM6 A;  1GUL A;  2WFC A;  2I9H A;  5CYY A;  1XW6 A;  2A4H A;  1U6T A;  5AN1 A;  3M1G A;  1R4W A;  4LMV A;  2L59 A;  4PTS A;  4MH3 A;  5DQS A;  2FWE A;  4TR0 A;  1XFL A;  1YKA A;  1XBS A;  2VAF A;  1GTI A;  1PX7 A;  2AYT A;  2WZ9 A;  3KH7 A;  1SYX A;  5HFG A;  6GSY A;  4ECI A;  2X8H A;  3GIX A;  3DVX A;  1UN2 A;  3FZ9 A;  3CXG A;  2P31 A;  1A8L A;  1YEX A;  3KP8 A;  1WPI A;  2H0I A;  1HYU A;  3A5W A;  1S3A A;  2CVD A;  3HJO A;  3LYP A;  4IJ3 A;  1TW9 A;  2L57 A;  4G19 A;  2N5A A;  1XXU A;  3VWU A;  5J4U A;  4XCS A;  3ZTL A;  3E9J B;  5IQY A;  1KEB A;  1QQ2 A;  1WE0 A;  3TKS A;  2H8L A;  1WIK A;  3ZFB A;  3RHC A;  1GNW A;  3J7Y k;  3U5R E;  1AIU A;  3EC3 A;  2PUK C;  4PX1 A;  2H74 A;  1ERW A;  5CRH A;  4POL A;  2A2S A;  1GP1 A;  1FVK A;  2JZR A;  2B7K A;  4HSC X;  1F37 A;  3WT1 A;  1LBK A;  2C0E A;  2PVQ A;  3TJB A;  2H01 A;  4PQI A;  2K18 A;  4KGI A;  1SK1 A;  2P5Q A;  4L8E A;  1X5E A;  3I69 A;  3QCP A;  2I3Y A;  4TOP A;  3UJ1 A;  10GS A;  3K8N A;  3D22 A;  4F03 A;  4ZL9 A;  3GTU B;  1YEP A;  4NWY A;  1SK0 A;  2PBJ A;  1EV9 A;  4HEA 2;  5A4W A;  2KHP A;  2JAD A;  1A2L A;  2L6D A;  3LEF A;  1NM3 A;  1ZL9 A;  4AJ6 A;  4IHU A;  5IMA A;  2YAN A;  3FR9 A;  2LRC A;  16GS A;  2V1M A;  4MZC A;  5DBQ A;  4WR5 A;  4I6X A;  4TXO B;  4F2I A;  1PL2 A;  4EC0 A;  1PKZ A;  1XIY A;  1OC9 B;  1A24 A;  3GUS A;  3IOS A;  2DKI A;  4YKG A;  3GKX A;  4PNG A;  1R7H A;  2YN1 A;  4TN8 A;  4BVX B;  2ZNM A;  3TRP A;  4MJC A;  2AB6 A;  3DEX A;  4FYU A;  1MDJ A;  1BAY A;  2QC7 A;  2F51 A;  4KSM A;  2EIO A;  5J3R A;  1S3R A;  2CQ9 A;  2AHE A;  4LA1 A;  2X64 A;  3GX0 A;  3NIV A;  3GHA A;  4TXV A;  3HZ4 A;  1GSE A;  5ECP B;  1K3L A;  2LS5 A;  2C1Y A;  4KDU A;  2DMM A;  1TJD A;  4LLR A;  1GUK A;  2M80 A;  2YPM A;  1O6J A;  1G7O A;  4ZIJ A;  4YKF A;  1JZW A;  4LL4 B;  3UOM A;  1OAZ A;  2L4Q A;  3G7Y A;  4E8H A;  4KE3 A;  1AAZ A;  3FRC A;  5ECM B;  2L4C A;  3TKP A;  3F4R A;  1FG4 A;  4K8M A;  2PER A;  3M9K A;  5ECH B;  3HVS A;  4I5Q A;  2ALB A;  4GRF A;  1W89 A;  3EWL A;  2C0G A;  1V98 A;  3IAS 2;  2HFD A;  3IE3 A;  1FOV A;  1IYH A;  1OC3 A;  3L78 A;  1TP9 A;  3IPZ A;  4WBJ A;  2LTK A;  3TKS E;  1U88 A;  2IJY A;  3HZ8 A;  2HYX A;  4XRD A;  3A2X A;  4F0B A;  1A0F A;  2JZT A;  3GRX A;  3G7J A;  2GS3 A;  3VI7 A;  4RI6 A;  1DE1 A;  1JHB A;  1K3Y A;  4EIP A;  2GSS A;  1M3I A;  1JZR A;  3ZMK A;  2X4A A;  3GKM A;  3DWV A;  3HHV A;  2DJ0 A;  2IFQ B;  3F3Q A;  1MDI A;  2UZ8 A;  1T4Z A;  3EU3 A;  5CRD A;  3MSZ A;  1Z3E A;  2A4V A;  3H93 A;  5GSS A;  1EWX A;  1O8X A;  4NAX A;  2P5R A;  3LW9 A;  4X4J A;  5C04 A;  4USS A;  1F9M A;  4NPB A;  4MDC A;  1BQ7 A;  2FWG A;  5D9W A;  1ZOF A;  3CTF A;  4GSS A;  2FD3 A;  4FH8 A;  2FHE A;  4K7I A;  2HSH A;  1DBY A;  4WKW A;  1GLP A;  2LUS A;  2OBI A;  4DEJ A;  3IAM 2;  3BCK A;  2R6K A;  4ML1 A;  3NZN A;  6GST A;  1ST9 A;  4ID0 A;  2DC5 A;  5E59 A;  1SJ6 A;  1TK8 B;  2NBS A;  4BIK A;  2CX4 A;  1VGL A;  1XWK A;  3IK9 A;  2YV7 A;  1B4Q A;  2OE1 A;  4V2L A;  5EL8 A;  2H1D A;  5CRW A;  1FAA A;  1SEN A;  3DXB A;  2WUL A;  3GN3 A;  3CBU A;  3BOA A;  4ZL7 A;  2K8V A;  1C72 A;  4WBR D;  5B6N A;  3MAK A;  2C3Q A;  1W4V A;  4V1A p;  4GXZ A;  2V32 A;  5EPF A;  3TGZ A;  3A2V A;  3GST A;  1YZX A;  4HOJ A;  4L5L A;  4V2N A;  1PN0 A;  3TDG A;  3H79 A;  3LJR A;  1SK2 A;  2CAI A;  3D0Z A;  1VF3 A;  1QXH A;  2LJK A;  3QAG A;  2YJH A;  2E7P A;  3QD9 A;  3A3T A;  1VRS D;  3C1S A;  4K5R A;  1O7U A;  1Y6E A;  5JWR B;  4PQ1 A;  6GSV A;  4F82 A;  3DD3 A;  2WGR A;  1XVW A;  3IDV A;  1FO5 A;  2YZU A;  3Q19 A;  2RUE A;  2LJA A;  3QMX A;  1EOG A;  1N8J A;  5DJL A;  2MBS A;  1JZO A;  1GSY A;  3HD5 A;  1NSW A;  4XS1 A;  3W6G A;  3KH9 A;  2WDU A;  3M9J A;  3IHG A;  4OFT A;  2GQL A;  1U87 A;  4ZB6 A;  5GAN D;  2CZ3 A;  2N5B A;  5HR2 A;  2R37 A;  4EE0 A;  4EL1 A;  2MYG A; 
#chains in the Genus database with same CATH homology
 3RDW A;  1KBN A;  1ZYQ B;  4O7H A;  5IO2 A;  3GL5 A;  1OVN A;  1SD9 A;  5KOW A;  1WP0 A;  1EP7 A;  5ECS A;  1WOU A;  3U6V A;  3O76 A;  2B3S A;  5CAX A;  4GCI A;  3IA1 A;  3HVV A;  3D6I A;  2FA8 A;  2IN3 A;  4G0I A;  5D93 A;  2GDR A;  5J5N A;  2I4A A;  2Z9S A;  1BX9 A;  2H66 A;  2FUG 2;  1YKC A;  5G31 A;  1UC7 A;  19GS A;  11GS A;  3KD0 A;  3VK9 A;  1A2M A;  2F9S A;  4LMW A;  3IR4 A;  5DAK A;  1BG5 A;  1EEM A;  3ZVJ A;  2JZS A;  1XW9 A;  4K2X A;  5D9T A;  1EEJ A;  2ZUP A;  4XS6 A;  2B5X A;  1XWA A;  4GTU A;  3VPT A;  5GST A;  3F4T A;  4JZQ A;  4K9Z A;  1KNG A;  4HZ4 A;  3UVH A;  4EKZ A;  4K0N A;  1V57 A;  4IBP A;  2WRT A;  2AUV A;  4RQR A;  5CRE A;  4WF5 A;  3D5J A;  2L5L A;  4HU9 A;  3DGQ A;  8GSS A;  4GQC A;  3TOU A;  1ZYN A;  2MMO A;  3LSZ A;  1UVZ A;  3H8Q A;  1I9D A;  2HSY A;  1EGO A;  2X8C A;  5D96 A;  5ECQ B;  3KMO A;  1X5C A;  3HDC A;  2CAQ A;  4QQ7 A;  5DVB A;  5HFI A;  5GZZ B;  2VCW A;  1TRU A;  2IME A;  2VL9 A;  5ECI B;  4TR4 A;  4MZW A;  3C73 A;  3WD6 A;  1EP8 A;  2OE0 A;  4OO4 A;  5G1L A;  1XWC A;  2B7J A;  5BMU A;  3MDK A;  5IMZ A;  3E3E A;  3I43 A;  5D73 A;  2H72 A;  5JCW A;  2H71 A;  1PSQ A;  3FW2 A;  4OO5 A;  3ED3 A;  4KDX A;  2LRT A;  2B1K A;  1CQG A;  2HNL A;  2LV3 A;  4EDZ A;  5LD0 A;  3L9V A;  2X8G A;  4ACS A;  5FT3 A;  2O7K A;  5B8B A;  3GL3 A;  2VCV A;  3WGE A;  1J08 A;  5D9V A;  2HE3 A;  3L9S A;  4HZ2 A;  2JL4 A;  2HLS A;  2DIZ A;  2VD0 A;  2CX3 A;  5LCZ A;  4PUA A;  4HU7 A;  4BWQ A;  2VOC A;  4MNN A;  3KXO A;  4X1U A;  4AGS A;  1O81 A;  2RUF A;  2O85 A;  3F6F A;  3ERG A;  4IVF A;  5CRG A;  2R0P A;  1F3B A;  2ON5 A;  2DJ1 A;  1HNA A;  2LQO A;  2C3T A;  4BWS A;  2OAD A;  4CDO A;  2FNO A;  4NMU A;  2HSM A;  1ZYE A;  4XIH A;  1YF1 A;  5B8A A;  1ERV A;  1SYR A;  2TRC P;  1TKD B;  2R5G A;  1BJX A;  1K3O A;  4NHZ A;  1ABA A;  2PU9 C;  4O5Q A;  4BL7 A;  3CMI A;  4YH2 A;  1F2E A;  1M2D A;  3O3T A;  4MPG A;  1XCC A;  5IO0 A;  4TRX A;  2HZE A;  2IWT A;  1TTZ A;  1PRX A;  4O32 A;  1EOH A;  4HI7 A;  4K7O A;  3E0U A;  1TK0 B;  1EV4 A;  1F6M C;  3M8N A;  2XPE A;  1SL0 B;  3ZIJ A;  4F0C A;  2JU5 A;  4ECC A;  2HZF A;  1TI3 A;  3QOU A;  2WCI A;  2HRA A;  4FO5 A;  4Q5F A;  4OWY A;  4DSQ A;  3ERF A;  3A5I A;  3SWL A;  4K1F A;  1Z7R A;  2K8S A;  5H5Q A;  2XBQ A;  1YY7 A;  3H1N A;  3WGX A;  2K6V A;  2M46 A;  1ZZY A;  3BJ5 A;  4KCA A;  2G0F A;  3KTB A;  4IP6 A;  5HR3 A;  4O92 A;  3TKQ A;  3R2Q A;  1GTA A;  1Z9H A;  5AGY A;  5ECR B;  2PGT A;  4NXI A;  4MJE A;  2CZ2 A;  1HQO A;  4QL9 A;  4ZB9 A;  5FWG A;  3QFA C;  4K7N A;  4RI7 A;  2VCX A;  2X49 A;  2B5Y A;  2HRF A;  2LNS A;  3F3R A;  5ECO B;  3D4M A;  3TJG A;  2VM2 A;  1PQN A;  1USB A;  1XWG A;  4ICY A;  4NHW A;  1PD2 1;  4POB A;  2V2G A;  4N11 A;  2MMA A;  3DRN A;  1SKS B;  1B4P A;  3UBL A;  3EUR A;  3FYG A;  4JED A;  1YF0 A;  3LQ7 A;  3PR8 A;  1XW5 A;  4JR6 A;  5KN3 A;  5ELA A;  1OE8 A;  2VUP A;  1BYE A;  4YQU A;  1A8Y A;  1R5A A;  2QSI A;  3EU4 A;  2EIR A;  1GUM A;  2C4J A;  2WS2 A;  3LWA A;  4J57 E;  1YDK A;  3KCM A;  1CQH A;  3ZZX A;  2JSZ A;  1GRX A;  3PPU A;  3FMW A;  2B6M A;  4EIQ A;  1SJZ A;  3A2W A;  1JZD A;  5G1K A;  2H6Y A;  3BCI A;  1NHO A;  4IGJ A;  1FB0 A;  2JAC A;  1ON4 A;  1YQ1 A;  3GKK A;  2PVO C;  2NPB A;  3NOF A;  2E0Q A;  1WJK A;  2HRN A;  4H86 A;  4OCE A;  4OD7 A;  4F9Z A;  4IKH A;  5IIZ A;  1O85 A;  3TB2 A;  4I97 A;  4IP1 A;  4K0G A;  1THO A;  1PMT A;  5EVO A;  3LOR A;  4OCF A;  2CVB A;  4L0W A;  1K0M A;  4GF0 A;  3KP9 A;  4G2E A;  2GLR A;  1GL8 A;  1ACV A;  2FWF A;  3CRU A;  4TR1 A;  3IBH A;  3IXR A;  4KCE A;  3CSH A;  3TJK A;  2VL2 C;  3RAZ A;  4MK3 A;  1GTU A;  2DBC A;  1PGT A;  2BMX A;  2NTO A;  5ENU A;  3EMX A;  2LRN A;  2TRX A;  2TIR A;  3HY2 A;  5ID2 A;  2L5O A;  2R0C A;  1R5P A;  4ECJ A;  4FYC A;  1AXD A;  2C8U A;  3GSS A;  3O6T A;  4G10 A;  5G2Z A;  5KEJ A;  3IHQ A;  1AQX A;  1AQV A;  4PXO A;  4ZBB A;  2VLV A;  4N30 A;  2A2R A;  1T4Y A;  3BBY A;  4BPY A;  2H1A A;  2VIM A;  2WB9 A;  3UAP A;  3DKS A;  3FY7 A;  2YZH A;  1OYJ A;  1PL1 A;  4BVY A;  1M9A A;  2YV9 A;  1ML6 A;  3QAW A;  1ZGN A;  1TI1 A;  4ECB A;  1ILO A;  2HRK A;  4POM A;  1FB6 A;  2E2G A;  1K0C A;  3FZ5 A;  2QGV A;  1GNE A;  2ON7 A;  3GV1 A;  3ME8 A;  1V2A A;  3FZ4 A;  3ISO A;  4J2F A;  2OE3 A;  4NV2 A;  3CSJ A;  4CY8 A;  1H75 A;  5AIV A;  3WYW A;  3UBK A;  3EMP A;  1A2J A;  5CP1 A;  3HA9 A;  2C80 A;  1BED A;  1K0B A;  1PN9 A;  4JRR A;  5JWO B;  3TOT A;  5EY6 A;  3ME7 A;  2FWH A;  4FIW A;  3J7Y b;  3FR3 A;  3I9V 2;  5G5E A;  3D21 A;  1G0T A;  3GUR A;  2AAW A;  2VD1 A;  2PN8 A;  1B9X C;  4TVE A;  5B7C A;  3ZYW A;  5A5K A;  3GH9 A;  2MMZ A;  2R4V A;  1K0D A;  2C0D A;  3KEB A;  4HS1 A;  3RPP A;  2AJQ B;  5G30 A;  3TKR A;  2RII A;  1QGV A;  2H6Z A;  1DE2 A;  2GVP A;  3EVI A;  4PGT A;  2J23 A;  4MF5 A;  2KOK A;  2HZE B;  4I2T A;  3MNG A;  5A4U A;  3GFK A;  2I81 A;  4KDY A;  1X0R A;  1OKD A;  4V2M A;  4Q5Q A;  3ERW A;  1THX A;  3CTG A;  4DSR A;  2DJ3 A;  3QPM A;  3UAR A;  2MBT A;  4XS4 A;  3ZIT A;  4P3Y B;  3VI5 A;  1WWJ A;  5L71 A;  3ZRD A;  5DJM A;  2VL3 A;  4O5U A;  4OFN A;  3ZIV A;  1S3C A;  4V1A g;  1M2A A;  3SBC A;  5F0G A;  1JFU A;  1EZK A;  5DCG A;  4KB3 A;  2KP2 A;  3GA4 A;  3P8W A;  2KUC A;  6GSX A;  5ECL B;  4TKY A;  3ZRE A;  7GSS A;  2BTO T;  5B6M A;  2PPT A;  2IPA A;  4QL7 A;  2OKA A;  3F63 A;  1TRS A;  5CO3 A;  5E4W A;  3BD2 A;  1XPV A;  3L0H A;  2GTU A;  2LKU A;  2GSR A;  2H0H A;  1I5G A;  2GST A;  1ERU A;  4ZBA A;  1URM A;  3F4S A;  3ZML A;  5J9C A;  1NW2 A;  4IQ1 A;  2CV4 A;  4X0X A;  1R26 A;  2CA8 A;  2EIQ A;  3LGC A;  4EXJ A;  3UMA A;  3VLN A;  1U3I A;  1H4O A;  2DIY A;  5JCG A;  3APQ A;  2F8A A;  2OBK A;  2PMT A;  1JLW A;  3ZVJ D;  2HT9 A;  1OE7 A;  4N0V A;  1V40 A;  4X43 A;  4D73 A;  5ECN B;  1SD8 A;  4OFM A;  4IN0 A;  4Q5N A;  1MDK A;  2ES7 A;  3AY8 A;  1M2B A;  4L5O A;  2P0G A;  5CNW A;  2H19 A;  3IV4 A;  1KTE A;  5INY A;  4IEL A;  4EUY A;  1X5D A;  3FHK A;  1LJR A;  2H75 A;  4DVC A;  3QAV A;  3US3 A;  2MZC A;  1B9Y C;  3F0I A;  4IW9 A;  3KJY A;  4ZL8 A;  1A23 A;  3APS A;  4EF0 A;  3FZA A;  1VF1 A;  4XTS A;  3N5O A;  1ZYP A;  3IK7 A;  1B48 A;  3C1R A;  2KP1 A;  1M9B A;  3CSI A;  3MWH A;  3QR6 A;  1XWB A;  3LXZ A;  5KOX A;  1E6B A;  5IMC A;  5A4V A;  2GT5 A;  5DAL A;  4MMM A;  2FCH A;  2J9H A;  4G9H A;  1MD4 A;  5H5R A;  1GSQ A;  3PIN A;  4XRA A;  3L4N A;  5IPG A;  4IQA A;  1J0F A;  1OC8 A;  4DSS A;  3UVT A;  2KLX A;  4Z7X A;  4RUV A;  2DLX A;  2DJ2 A;  2O87 A;  4HQZ A;  3APO A;  4Z2T A;  4KF9 A;  5IPH A;  4TR1 B;  4Z2U A;  2XHF A;  3IRA A;  1GTB A;  3Q74 A;  2XBI A;  1WRY A;  3V1W A;  5JWQ B;  1XOA A;  1T1V A;  4G0L A;  3C8E A;  4I8B A;  1G7E A;  3D4T A;  4YQV A;  1U3A A;  3QFB C;  2R3X A;  3TRX A;  5ID2 B;  3P90 A;  4GSN A;  4EDY A;  2GZZ A;  1V58 A;  1X9W B;  2H1B A;  4POK A;  4IS0 A;  3GNJ A;  4J56 E;  1XVQ A;  4Q5R A;  2HXK A;  2H76 A;  5HQP A;  2L6C A;  1QMV A;  1T8E B;  4YAP A;  2YOI A;  2G2Q A;  2YCD A;  3W8S A;  1J9B A;  1SU9 A;  2B1L A;  1VF4 A;  4JU5 A;  1EGR A;  4MAB A;  4BVY B;  3DML A;  2YWN A;  1TK5 B;  4E8E A;  3W8J A;  2N5F A;  4KND A;  3WT2 A;  2GGT A;  2BJX A;  3UL3 A;  4WF4 A;  2LNT A;  4N10 A;  3F6D A;  1MTC A;  2QA2 A;  3UEM A;  4KA0 A;  4XHM A;  3H4K A;  5DQY A;  2IMI A;  4ZXG A;  4EVM A;  2QKE A;  22GS A;  4I2U A;  3GKN A;  1GSF A;  3N9J A;  2IMF A;  5H5S A;  4CW9 A;  2AV4 A;  3FK8 A;  5DDL A;  3TJJ A;  2WJU A;  3PH9 A;  4YQM A;  1GLQ A;  1NHY A;  2R2J A;  2LJR A;  2LST A;  1O8W A;  2LQQ A;  4ILF A;  5IMF A;  3S9F A;  1QFN A;  4ZIL A;  1AUC A;  4WR4 A;  5KN1 A;  1GWC A;  3LG6 A;  2VL2 A;  3KTL A;  3P2A A;  3TKS C;  2DSA A;  4Z2R A;  2REM A;  4HQS A;  4JR4 A;  3VWV A;  5ELG A;  4L0U A;  4IJI A;  3RHB A;  4KSO A;  4WEY A;  1UA5 A;  4MZB A;  4PNF A;  4MF7 A;  2H73 A;  2F3M A;  4GLT A;  1QK8 A;  1ZCP A;  3C7M A;  4PUR A;  2OAC A;  4XS4 B;  2ZCT A;  2X99 A;  1MEK A;  1DSB A;  1Q98 A;  9GSS A;  1QUW A;  1T7P B;  1A0R P;  4NV5 A;  4MA9 A;  2GZY A;  1GSD A;  1K0N A;  5DAK B;  4ULX A;  1FW1 A;  4HDE A;  1WMJ A;  17GS A;  4HJ2 A;  5JCU A;  2VLU A;  3JCM L;  1Q4J A;  3VWW A;  2NVL A;  5IOX A;  4WET A;  5KN0 A;  5F06 A;  1GUH A;  2VCT A;  5IOW A;  3F9U A;  2XPD A;  5ABR A;  3KGK A;  2H6X A;  3R3E A;  1TXX A;  3VPQ A;  3HKR A;  3VFI A;  2XC2 A;  3F8U A;  1VF2 A;  1M99 A;  1FVJ A;  3QDN A;  2M72 A;  3HJM A;  3M0F A;  2FA4 A;  5DCH A;  2GT6 A;  5F07 A;  1GSU A;  1Z6N A;  3VWX A;  5LNK e;  3CRT A;  4KAE A;  2R0G A;  3ZL5 A;  2F8F A;  5FHI A;  4A5P A;  3CYN A;  13GS A;  2VM1 A;  5J9B A;  4K5S A;  4D73 B;  1M0U A;  2V6K A;  1Y25 A;  5AIS A;  3GH6 A;  4G0K A;  3FR6 A;  3Q6O A;  2RLI A;  3M3M A;  1RK4 A;  5KN2 A;  2VCQ A;  1TU8 A;  4CY6 A;  4KH7 A;  3PGT A;  1TDI A;  2V6O A;  3KMN A;  4FQU A;  1RW1 A;  4BA7 A;  4GQF A;  4CHS A;  4TW5 A;  2YP6 A;  5IM9 A;  4MP4 A;  4FYB A;  1E2Y A;  1K0A A;  1K0O A;  3GYK A;  1IYI A;  2YWO A;  3G7I A;  4K6X A;  2JSY A;  3HVX A;  3WGD A;  1Z6M A;  2I1U A;  2PWJ A;  5DAL B;  1T3B A;  2DML A;  3HJP A;  2CVK A;  2IL3 A;  3GX8 A;  5COH A;  4DSS B;  1YJ6 A;  2B5E A;  4ZBD A;  3DYR A;  4PUF C;  5IMD A;  1PX6 A;  3GTU A;  2O8V B;  3TJF A;  1AW9 A;  4HJM A;  3P7X A;  2NDO A;  2A2P A;  4GWR A;  1XZO A;  2DJK A;  1GSS A;  3MIX A;  2C0F A;  5D9X A;  2VO4 A;  1PKW A;  3LYK A;  1HNC A;  3HYP A;  3Q18 A;  5BRT A;  1HD2 A;  4MH2 A;  14GS A;  5C00 A;  1FOH A;  4TXO A;  4MF6 A;  5IMV A;  1LU4 A;  2IMD A;  3DIE A;  1OC9 A;  1ZMA A;  1PA3 A;  4HUA A;  4LL1 B;  5HR1 A;  2MMN A;  1X9S B;  4BVX A;  2YWM A;  4K2D A;  2LEG A;  1Z7P A;  2YWI A;  4BL7 B;  5F8B A;  3I6A A;  5D8I A;  6GSW A;  1DUG A;  1TRW A;  2GSQ A;  3OR5 A;  1AC1 A;  18GS A;  1JLV A;  2RM6 A;  3RBT A;  2DJJ A;  4KUN A;  2GZP A;  4PQH A;  5HFK A;  3LFL A;  4KW6 A;  1HNB A;  2RM5 A;  4TR3 A;  3GMF A;  4ISD A;  4YAV A;  3FEU A;  2O89 A;  4MCU A;  1AQW A;  3DVW A;  1G6W A;  4AF2 A;  2FY6 A;  4RQX A;  5ECK B;  3L9U A;  4MPF A;  4AJ8 A;  1SKW B;  4AJ7 A;  4KX4 A;  2GQK A;  2YNX A;  1B8X A;  3IC8 A;  3LXT A;  4ZB8 A;  2FGX A;  5F05 A;  2CT6 A;  3EYT A;  5G5F A;  1S3D A;  4MLY A;  3KZQ A;  1Z5Y E;  20GS A;  2K9F A;  5J41 A;  1TRV A;  4OMV A;  3FKF A;  4EO3 A;  12GS A;  5AIX A;  3ZLP A;  3KIJ A;  4MJA A;  4WXT A;  1SL1 B;  2HI7 A;  3EE2 A;  1T00 A;  1XOB A;  5HR0 A;  1SL2 B;  1F3A A;  2GQM A;  2H1G A;  1OKT A;  3ZFL A;  2H70 A;  2OJL A;  6GSS A;  3UIW A;  4JBB A;  3C71 A;  3HCZ A;  3TCO A;  2EC4 A;  3EPT A;  1TOF A;  2IIY A;  2D2Z A;  1V9W A;  1FHE A;  2OA7 A;  1ERT A;  6GSU A;  4N0Z A;  3TRQ A;  1MD3 A;  3G9B A;  1O73 A;  2DKH A;  4GST A;  5GAP D;  4MJB A;  1G6Y A;  1M7T A;  4JE1 A;  2C3N A;  2IMK A;  3EIN A;  2V41 A;  3HXS A;  3TUE A;  1GH2 A;  4O5R A;  1N2A A;  3VUR A;  3IC4 A;  1TU7 A;  2VLT A;  2QA1 A;  3MYD A;  2FLS A;  2VCZ A;  1X9M B;  2IFQ A;  2H30 A;  1SJI A;  1SKR B;  3RPN A;  1RQM A;  2YJ7 A;  4ML6 A;  2H0G A;  2E2M A;  3KM6 A;  1GUL A;  2WFC A;  2I9H A;  5CYY A;  1XW6 A;  2A4H A;  1U6T A;  5AN1 A;  3M1G A;  1R4W A;  4LMV A;  2L59 A;  4PTS A;  4MH3 A;  5DQS A;  2FWE A;  4TR0 A;  1XFL A;  1YKA A;  1XBS A;  2VAF A;  1GTI A;  1PX7 A;  2AYT A;  2WZ9 A;  3KH7 A;  1SYX A;  5HFG A;  6GSY A;  4ECI A;  2X8H A;  3GIX A;  3DVX A;  1UN2 A;  3FZ9 A;  3CXG A;  2P31 A;  1A8L A;  1YEX A;  3KP8 A;  1WPI A;  2H0I A;  1HYU A;  3A5W A;  1S3A A;  2CVD A;  3HJO A;  3LYP A;  4IJ3 A;  1TW9 A;  2L57 A;  4G19 A;  2N5A A;  1XXU A;  3VWU A;  5J4U A;  4XCS A;  3ZTL A;  3E9J B;  5IQY A;  1KEB A;  1QQ2 A;  1WE0 A;  3TKS A;  2H8L A;  1WIK A;  3ZFB A;  3RHC A;  1GNW A;  3J7Y k;  3U5R E;  1AIU A;  3EC3 A;  2PUK C;  4PX1 A;  2H74 A;  1ERW A;  5CRH A;  4POL A;  2A2S A;  1GP1 A;  1FVK A;  2JZR A;  2B7K A;  1F37 A;  3WT1 A;  1LBK A;  2C0E A;  2PVQ A;  3TJB A;  2H01 A;  4PQI A;  2K18 A;  4KGI A;  1SK1 A;  2P5Q A;  4L8E A;  1X5E A;  3I69 A;  3QCP A;  2I3Y A;  4TOP A;  3UJ1 A;  10GS A;  3K8N A;  3D22 A;  4F03 A;  4ZL9 A;  3GTU B;  1YEP A;  4NWY A;  1SK0 A;  2PBJ A;  1EV9 A;  4HEA 2;  5A4W A;  2KHP A;  2JAD A;  1A2L A;  2L6D A;  3LEF A;  1NM3 A;  1ZL9 A;  4AJ6 A;  4IHU A;  5IMA A;  2YAN A;  3FR9 A;  2LRC A;  16GS A;  2V1M A;  4MZC A;  5DBQ A;  4WR5 A;  4I6X A;  4TXO B;  4F2I A;  1PL2 A;  4EC0 A;  1PKZ A;  1XIY A;  1OC9 B;  1A24 A;  3GUS A;  3IOS A;  2DKI A;  4YKG A;  3GKX A;  4PNG A;  1R7H A;  2YN1 A;  4TN8 A;  4BVX B;  2ZNM A;  3TRP A;  4MJC A;  2AB6 A;  3DEX A;  4FYU A;  1MDJ A;  1BAY A;  2QC7 A;  2F51 A;  4KSM A;  2EIO A;  5J3R A;  2CQ9 A;  2AHE A;  4LA1 A;  2X64 A;  3GX0 A;  3NIV A;  3GHA A;  4TXV A;  3HZ4 A;  1GSE A;  5ECP B;  1K3L A;  2LS5 A;  2C1Y A;  4KDU A;  2DMM A;  1TJD A;  4LLR A;  1GUK A;  2M80 A;  2YPM A;  1O6J A;  1G7O A;  4ZIJ A;  4YKF A;  1JZW A;  4LL4 B;  3UOM A;  1OAZ A;  2L4Q A;  3G7Y A;  4E8H A;  4KE3 A;  1AAZ A;  3FRC A;  5ECM B;  2L4C A;  3TKP A;  3F4R A;  1FG4 A;  4K8M A;  2PER A;  3M9K A;  5ECH B;  3HVS A;  4I5Q A;  2ALB A;  4GRF A;  1W89 A;  3EWL A;  2C0G A;  1V98 A;  3IAS 2;  2HFD A;  3IE3 A;  1FOV A;  1IYH A;  1OC3 A;  3L78 A;  1TP9 A;  3IPZ A;  4WBJ A;  2LTK A;  3TKS E;  1U88 A;  2IJY A;  3HZ8 A;  2HYX A;  4XRD A;  3A2X A;  4F0B A;  1A0F A;  2JZT A;  3GRX A;  3G7J A;  2GS3 A;  3VI7 A;  4RI6 A;  1DE1 A;  1JHB A;  1K3Y A;  4EIP A;  2GSS A;  1JZR A;  3ZMK A;  2X4A A;  3GKM A;  3DWV A;  3HHV A;  2DJ0 A;  2IFQ B;  3F3Q A;  1MDI A;  2UZ8 A;  1T4Z A;  3EU3 A;  5CRD A;  3MSZ A;  1Z3E A;  2A4V A;  3H93 A;  5GSS A;  1EWX A;  1O8X A;  4NAX A;  2P5R A;  3LW9 A;  4X4J A;  5C04 A;  4USS A;  1F9M A;  4NPB A;  4MDC A;  1BQ7 A;  2FWG A;  5D9W A;  1ZOF A;  3CTF A;  4GSS A;  2FD3 A;  4FH8 A;  2FHE A;  4K7I A;  2HSH A;  1DBY A;  4WKW A;  1GLP A;  2LUS A;  2OBI A;  4DEJ A;  3IAM 2;  3BCK A;  2R6K A;  4ML1 A;  3NZN A;  6GST A;  1ST9 A;  4ID0 A;  2DC5 A;  5E59 A;  1SJ6 A;  1TK8 B;  2NBS A;  2CX4 A;  1VGL A;  1XWK A;  3IK9 A;  2YV7 A;  1B4Q A;  2OE1 A;  4V2L A;  5EL8 A;  2H1D A;  5CRW A;  1FAA A;  1SEN A;  3DXB A;  2WUL A;  3GN3 A;  3CBU A;  3BOA A;  4ZL7 A;  2K8V A;  1C72 A;  4WBR D;  5B6N A;  3MAK A;  2C3Q A;  1W4V A;  4V1A p;  4GXZ A;  2V32 A;  5EPF A;  3TGZ A;  3A2V A;  3GST A;  1YZX A;  4HOJ A;  4L5L A;  4V2N A;  1PN0 A;  3TDG A;  3H79 A;  3LJR A;  1SK2 A;  2CAI A;  3D0Z A;  1VF3 A;  1QXH A;  2LJK A;  3QAG A;  2YJH A;  2E7P A;  3QD9 A;  3A3T A;  1VRS D;  3C1S A;  4K5R A;  1O7U A;  1Y6E A;  5JWR B;  4PQ1 A;  6GSV A;  4F82 A;  3DD3 A;  2WGR A;  1XVW A;  3IDV A;  1FO5 A;  2YZU A;  3Q19 A;  2RUE A;  2LJA A;  3QMX A;  1EOG A;  1N8J A;  5DJL A;  2MBS A;  1JZO A;  1GSY A;  3HD5 A;  1NSW A;  4XS1 A;  3W6G A;  3KH9 A;  2WDU A;  3M9J A;  3IHG A;  4OFT A;  2GQL A;  1U87 A;  4ZB6 A;  5GAN D;  2CZ3 A;  2N5B A;  5HR2 A;  2R37 A;  4EE0 A;  4EL1 A;  2MYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...