2YP6A

Crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_1000 (etrx2) from streptococcus pneumoniae strain tigr4 in complex with cyclofos 3 tm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
IAVGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASWCGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDSQGKIGKIQFGAISNADAEAAFKEMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN FAMILY PROTEIN
publication title Molecular Architecture of Streptococcus Pneumoniae Surface Thioredoxin-Fold Lipoproteins Crucial for Extracellular Oxidative Stress Resistance and Maintenance of Virulence.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
total genus 41
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yp6A00
2Z9SA 5ID2A 4ECJA 2C1YA 4O5RA 1SK2A 3FZ5A 2WRTA 3F3RA 2L4CA 3L4NA 2GVPA 1OC8A 2GSSA 2WGRA 3HD5A 4HUAA 1PL1A 5IMCA 3KP9A 1A24A 2H1AA 1VGLA 2PERA 3HA9A 5HR1A 2I81A 3TKSA 3TKSC 1HQOA 2A2SA 4WR4A 5AISA 5EY6A 3GFKA 1TDIA 1X9SB 5A4WA 3ZYWA 2A4VA 3LORA 4L8EA 4O92A 6GSUA 2L59A 3FKFA 4DSSA 1ON4A 5ECKB 1JHBA 4YQUA 1FO5A 2E0QA 4PNGA 3KCMA 2LEGA 2NTOA 5IMDA 2DC5A 1K0AA 3IK9A 4OD7A 1K0NA 4MPGA 1DE2A 2VUPA 3H8QA 3QD9A 2YWIA 2H1GA 2OA7A 2DJKA 2QC7A 4XS4A 3ZMLA 1V2AA 2KLXA 1ZMAA 4MZWA 4EUYA 3D4MA 4V1Ap 1XZOA 1F37A 3UBLA 4KDYA 2F8FA 4PQHA 5EPFA 4PX1A 5KN1A 3C1SA 1ERTA 1XVQA 1ZOFA 4ZBDA 4IQAA 3N9JA 2XPDA 3D21A 3DEXA 3F8UA 3HDCA 1ML6A 1PKWA 3ZMKA 3P90A 1FVJA 2KUCA 1T1VA 1PN9A 3KP8A 2H73A 4MLYA 2GGTA 3F6FA 5G30A 1EEMA 2H1BA 2C0FA 1HNCA 3E3EA 2C3QA 2FHEA 2R5GA 1R4WA 1CQHA 1URMA 2K9FA 3ME8A 2FWGA 1XBSA 4LMWA 4WXTA 3QAVA 4TR3A 1GULA 1QK8A 2PMTA 3DWVA 2H0HA 1N8JA 2LSTA 3GUSA 2LS5A 3GTUB 3HHVA 3RPNA 3LSZA 2RM5A 4YAPA 3GX0A 1YF0A 3M9JA 3EE2A 4IELA 3UOMA 1J9BA 4DVCA 3KEBA 5JCGA 1G7OA 1VF1A 2B7JA 5F07A 4K7OA 2C0GA 2YNXA 3D6IA 4ECCA 4BVYA 1LU4A 3L9UA 3I69A 5H5SA 5IMAA 3UARA 3LYPA 2KP1A 3ED3A 1O73A 3QMXA 2V32A 4XRAA 4L0WA 2QGVA 18GSA 1AXDA 2IPAA 4MZBA 2VIMA 2LRTA 4KAEA 3KTLA 2N5BA 2CQ9A 3PH9A 3IDVA 2IMEA 1XXUA 1GRXA 2OE1A 1M7TA 4KW6A 2CVDA 3TRPA 3ZITA 5G31A 2CT6A 4V2MA 3SBCA 5J9CA 2PVQA 2HI7A 1E2YA 2FUG2 1WIKA 1EOHA 4K0NA 5A5KA 2VCTA 5GSSA 2B1KA 3UVTA 2ZNMA 5D96A 3M3MA 2PPTA 3TJBA 5ECQB 2AV4A 1FB0A 5CP1A 3H93A 2L5OA 2V1MA 3ZIJA 1EP8A 4WETA 2VL3A 3MDKA 4EF0A 4D73B 4QL9A 3NIVA 4AJ6A 4F2IA 3RHBA 3E0UA 4V1Ag 3IBHA 3GL5A 4I2TA 5ENUA 5LD0A 2H6YA 2HXKA 4AF2A 2VD1A 2HSYA 3C73A 2ON7A 1Q98A 2DSAA 3KIJA 2PBJA 1ABAA 1FAAA 2H8LA 4PUFC 1LJRA 4Q5NA 3FZAA 4KE3A 4NAXA 1B48A 1BEDA 4JEDA 5D9VA 3VWUA 3L9VA 1HD2A 1FG4A 4L5LA 2B6MA 4EXJA 5EL8A 3LJRA 4ILFA 4RI6A 2FLSA 1OC9A 2AJQB 1V58A 4X0XA 4OWYA 4H86A 2H70A 4CHSA 4POBA 1LBKA 4EKZA 1YEPA 5HFIA 1F3BA 2XPEA 22GSA 3CMIA 4MH3A 3LG6A 3QCPA 1Y6EA 3L78A 3WGDA 5J5NA 3ZFLA 2GT6A 3HXSA 4TKYA 1UN2A 1TI1A 4IN0A 2MZCA 3FHKA 3Q74A 3TRXA 5DQSA 2LJAA 1XPVA 1DBYA 5A4UA 2YOIA 1B9YC 1MD3A 2LRNA 5IMVA 1A0RP 3DMLA 2GDRA 3QDNA 3UAPA 3HVSA 5CRDA 1GTAA 4RUVA 2FA4A 5DALA 1A0FA 4EDYA 6GSVA 4PUAA 1XFLA 1TJDA 3TJKA 3W6GA 5LNKe 3HY2A 1X5EA 4AJ7A 3GL3A 4O7HA 5ID2B 5J4UA 2D2ZA 2J23A 5G1KA 4TRXA 2RUEA 2G2QA 3C1RA 3VPTA 2HZEA 4FYCA 2RLIA 2HT9A 4LLRA 4KX4A 2YWOA 1XVWA 5D9WA 4ECBA 3NOFA 3TOUA 1S3AA 3ME7A 4G10A 2KP2A 1DE1A 4OFMA 1E6BA 1YY7A 3U5RE 1JZWA 3TRQA 1J08A 3O3TA 3VWXA 4NMUA 4KSMA 1M9BA 4J56E 6GSXA 3CTFA 1GTUA 3EMXA 4DSSB 5HFKA 4WBRD 1QMVA 1H75A 1PX7A 1I5GA 4ZBBA 1Z9HA 1A23A 1K0MA 4IQ1A 4LMVA 3UJ1A 4XS1A 5C00A 3GURA 1PSQA 3EYTA 3ZIVA 3PGTA 2K8VA 2CVKA 4XS4B 2E2MA 4WF5A 2P5QA 2DJ2A 2JZTA 4ML1A 4K6XA 1JZDA 4EL1A 2B1LA 4E8EA 3IPZA 3TDGA 2YJ7A 2XHFA 3EU4A 5D8IA 4OFTA 3TOTA 4PNFA 4IJ3A 1NW2A 1EEJA 4HU7A 5B7CA 4BPYA 5DQYA 4QQ7A 3CYNA 1YDKA 1V57A 4MPFA 2C4JA 4Z7XA 3WD6A 3RPPA 5HR3A 4GXZA 2MBSA 2AAWA 2C3NA 1UA5A 2NPBA 3VURA 3HCZA 2M72A 3QAWA 5ECRB 3C71A 3FZ9A 3V1WA 1XW6A 4I6XA 2VLUA 1BYEA 3LYKA 3GV1A 2A2RA 1F2EA 4TR4A 1DSBA 1OVNA 1A2JA 3IV4A 1MDJA 2O89A 2DIYA 5C04A 1K0DA 3F0IA 4AGSA 2WULA 1X5CA 3MAKA 2JACA 3TKRA 5G5EA 2R2JA 1CQGA 4MCUA 3PINA 4TXOA 1TU8A 2FD3A 1EGOA 1SD8A 2QSIA 3IA1A 3HJOA 1PD21 4L5OA 4GCIA 2EIOA 2V2GA 1XWCA 1G6YA 2WCIA 1G7EA 2I4AA 3ZLPA 5AN1A 4I8BA 13GSA 2R37A 5HQPA 4K9ZA 1GUKA 2IFQA 5FWGA 3TCOA 5J3RA 4CW9A 4CDOA 3W8SA 6GSYA 1ZZYA 5DAKA 2X8CA 4ID0A 1GNEA 4OCFA 4OO5A 1XWGA 4ZIJA 4FO5A 1GUHA 1O8WA 1K0BA 1V98A 1JLVA 3EWLA 2EIQA 4QL7A 5B8BA 2VD0A 1ERWA 3IAM2 5IM9A 4E8HA 3G7YA 1Z6NA 1FHEA 4HU9A 2GQLA 3UIWA 3UEMA 4NHWA 3O76A 2PVOC 1VF4A 2GZPA 4IHUA 3I9V2 3APQA 4IP1A 1OKTA 4HZ2A 4YQVA 4HZ4A 4N30A 3TGZA 4NHZA 3IC4A 2H74A 4KCEA 5ECLB 3VI5A 1SK0A 1JFUA 5J41A 1O8XA 4YH2A 3KMNA 2HE3A 5CRHA 5G2ZA 4F03A 4N11A 2YN1A 3BJ5A 3DIEA 4JU5A 1NSWA 1XCCA 2EIRA 2M80A 2CX4A 4TXVA 1QFNA 1SENA 1U6TA 4KH7A 5FHIA 1OC9B 4K0GA 1QUWA 4PQIA 5COHA 2OBIA 3EVIA 3F6DA 3IRAA 2CA8A 1QXHA 3HKRA 4IS0A 3HYPA 2H71A 3UBKA 2CAIA 4V2LA 2PUKC 5CO3A 4XRDA 2IWTA 3Q19A 4MF5A 3GH9A 2YWMA 1Y25A 1EV4A 2PN8A 5B6NA 1JZRA 3LXTA 3EURA 5IOWA 2AYTA 4HEA2 3WGXA 4ISDA 1ZL9A 4LL1B 1R5AA 4MDCA 2VL2A 1PX6A 2VL2C 2ZCTA 2PGTA 5ECOB 1MDKA 3S9FA 3F63A 3RBTA 1ZYQB 4KNDA 8GSSA 5DCGA 1G6WA 2F3MA 2OKAA 1GP1A 1AQWA 2LQOA 3FZ4A 3DXBA 1OAZA 2LKUA 4TOPA 2NBSA 1GSFA 5ELGA 4POKA 3ISOA 2DJJA 2F51A 2EC4A 2FY6A 1TW9A 2L5LA 2B5XA 5DALB 3MNGA 4XCSA 1GLQA 1KEBA 4PGTA 1THOA 5E59A 5DJMA 5J9BA 2NDOA 2I3YA 2VLVA 1IYIA 4G2EA 4TW5A 1FB6A 2IJYA 1EP7A 3ERGA 2HZEB 1SKRB 4X1UA 3VPQA 2DBCA 3ZVJD 5HR2A 2JSZA 2O85A 1K0OA 4OFNA 1Z7RA 4ZB9A 2P31A 2VL9A 2C80A 4ZL8A 1PMTA 2REMA 2YPMA 1M2BA 2H76A 3LFLA 2HRNA 3VI7A 3LGCA 4F0CA 2ALBA 2VAFA 1UC7A 2R4VA 1I9DA 5F0GA 3IHQA 4ZBAA 2B5EA 3FR3A 4LA1A 4GF0A 4KA0A 3D0ZA 2R6KA 4L0UA 1XWKA 5JWOB 4NWYA 3ZVJA 4MZCA 3LXZA 3GKNA 4WR5A 1W89A 3W8JA 3RDWA 4ZB6A 3Q6OA 2X99A 2I1UA 1GSDA 1M0UA 4G9HA 2VOCA 2WJUA 5HR0A 2TRXA 4TR1A 1SL1B 2O8VB 2YJHA 3DGQA 4KDXA 1BX9A 2H1DA 4EC0A 3TJJA 4HJMA 5ECSA 5G5FA 1B8XA 2GSQA 3OR5A 5AIVA 11GSA 1KTEA 2LV3A 1GSQA 2KOKA 1WE0A 5GAND 2DMMA 3P2AA 2H75A 4DSQA 1MDIA 2K6VA 3GKMA 1XWAA 1T8EB 5ECHB 1M9AA 2IN3A 1GL8A 4KDUA 1SK1A 3KXOA 3HJPA 5ECPB 1TRSA 5IQYA 3QAGA 1XWBA 1O81A 2IMKA 3D22A 3QFAC 4MP4A 2IMFA 1T00A 4O32A 2VCZA 4BL7A 3GIXA 2H01A 1GNWA 1GTBA 3ZZXA 4KGIA 3FEUA 4BVXA 1PQNA 4YQMA 3CSJA 2VM2A 3VWVA 3TJFA 3J7Yk 3CSIA 2E7PA 1IYHA 1XOAA 2XC2A 2V41A 2GQMA 3ERWA 1FOVA 2H19A 3FRCA 3C8EA 5JWRB 4KCAA 1Z5YE 4WKWA 1SJ6A 2YV7A 2XBQA 4TXOB 2OACA 5B8AA 4ZXGA 2YP6A 20GSA 3LWAA 4ZL7A 4TN8A 1SJZA 4OO4A 5DBQA 2BMXA 1ERVA 1SKWB 1ERUA 1T4ZA 9GSSA 4GQCA 3CSHA 5INYA 4OMVA 2LNSA 2JZSA 2O7KA 1F6MC 1EWXA 4IVFA 1EOGA 1AC1A 4MH2A 5JCUA 6GSWA 2DJ0A 2IFQB 5IIZA 1GSSA 3G7JA 2HYXA 5DAKB 2HSHA 1K3YA 2OADA 4XIHA 1FVKA 4N10A 2FCHA 1KNGA 3KH7A 1JZOA 17GSA 1GLPA 4P3YB 14GSA 1R26A 1Z7PA 5AGYA 3HZ4A 1S3DA 1EGRA 4F82A 2LTKA 4MF6A 5HFGA 4NPBA 3TB2A 1O6JA 2OE0A 3IOSA 5H5RA 4JE1A 3PR8A 2CZ3A 1GSUA 3RHCA 2GSRA 3D4TA 1HNAA 2B7KA 1ZCPA 4MJCA 2H72A 3HVXA 5L71A 1AQXA 4Q5FA 2L4QA 1B4QA 2YZHA 16GSA 2GSTA 4K8MA 1M2AA 1YF1A 2GZYA 4K2DA 1HNBA 3C7MA 2VCQA 1KBNA 4XTSA 1PA3A 2CX3A 4EDZA 3M8NA 2G0FA 2YANA 1A8YA 4Q5RA 3US3A 1ACVA 3GSTA 1V40A 2N5FA 2LQQA 3D5JA 2QKEA 2JSYA 2GS3A 3HJMA 3HVVA 1B4PA 4FYBA 2VCVA 2JU5A 3A3TA 5JCWA 1WOUA 4BA7A 2YWNA 3WT1A 2WS2A 2PWJA 2OBKA 5ELAA 3DKSA 3H79A 1RQMA 1MTCA 2HZFA 3GRXA 2VO4A 3KTBA 5GAPD 3H1NA 3FY7A 5KN2A 2HNLA 2X8GA 1TKDB 4Q5QA 4TR0A 3WGEA 1XW5A 3E9JB 3K8NA 4GSNA 1TRWA 3G9BA 4MA9A 1QGVA 4G19A 3BOAA 5JWQB 3FYGA 1BQ7A 1TRUA 1U3IA 4IJIA 3LQ7A 3FR9A 5CREA 2M46A 1H4OA 4F9ZA 7GSSA 4BWQA 3F3QA 5D93A 5D9XA 1PL2A 4J57E 2V6OA 4NV2A 2FWFA 4NV5A 3ZRDA 2J9HA 3CRTA 3ZFBA 3QOUA 4I97A 2LRCA 3EC3A 1GSYA 2P0GA 2FGXA 3APOA 2B5YA 4HI7A 5D73A 1C72A 2HFDA 5ECIB 1GSEA 1U88A 1PGTA 4RQXA 2CAQA 4ZB8A 4V2NA 5FT3A 2DIZA 4MMMA 1WJKA 1ILOA 5IMZA 2H0GA 1TU7A 3GYKA 4EE0A 1X9WB 1SL0B 2P5RA 5CRWA 1AW9A 1THXA 1NM3A 4HS1A 2L6CA 2FWHA 3EU3A 1ZYEA 3BCIA 1AUCA 2RM6A 3QR6A 4BWSA 4RI7A 1GTIA 3WT2A 2AHEA 4LL4B 3M1GA 2F8AA 4TR1B 2L6DA 6GSTA 2MYGA 19GSA 4KB3A 2LJRA 3DRNA 3LEFA 2CVBA 4HOJA 10GSA 5DCHA 3KZQA 1TK8B 4GSSA 2AUVA 3I6AA 1YZXA 3F9UA 1TP9A 3GMFA 4MK3A 1TRVA 1YQ1A 3M9KA 4EVMA 3WYWA 3EINA 4WBJA 1RW1A 1A8LA 4N0ZA 3A2WA 1R5PA 4ZILA 2VLTA 5CYYA 4JBBA 3QPMA 3IR4A 3ZL5A 2DLXA 4KUNA 1N2AA 3MWHA 2NVLA 1GH2A 2TIRA 4IKHA 1WPIA 1K3LA 2C0DA 2JADA 1FW1A 2IMIA 3RAZA 1SD9A 2OJLA 2H6ZA 1AQVA 2WZ9A 1SKSB 1GUMA 3KH9A 4MABA 3APSA 2MMNA 5CRGA 3A2VA 1AIUA 1SYXA 4HDEA 2CV4A 2DMLA 3GKXA 4ML6A 5G1LA 1T7PB 4X43A 1U3AA 3KD0A 1MEKA 5GZZB 3TKSE 2HRFA 4ACSA 3HZ8A 1YEXA 2ZUPA 3VK9A 1K3OA 12GSA 3IE3A 2L57A 4F0BA 1JLWA 3F4RA 2GLRA 3A5WA 5LCZA 1YJ6A 3GKKA 2DJ1A 3IXRA 4EO3A 5CAXA 2OE3A 1WRYA 2BTOT 2GQKA 3UMAA 3GN3A 1YKAA 1A2MA 3QFBC 2ON5A 2YV9A 2AB6A 4OCEA 3CBUA 3VLNA 5DJLA 3GSSA 1YKCA 2C8UA 1OC3A 1TK5B 1SL2B 4N0VA 2YZUA 2VCXA 2MMOA 2N5AA 4FYUA 1RK4A 4IW9A 3O6TA 1M99A 5F8BA 5F06A 5IO0A 2IMDA 3N5OA 4MF7A 5A4VA 5B6MA 3UL3A 3ERFA 1XOBA 2H0IA 2VM1A 1EZKA 1S3CA 4DEJA 2LNTA 1T3BA 1QQ2A 1W4VA 2GZZA 1GWCA 2WDUA 1J0FA 5AIXA 1BJXA 1SJIA 2DJ3A 5F05A 1DUGA 1O85A 4GLTA 4PURA 3CTGA 4YAVA 3A2XA 1A2LA 4NXIA 2YCDA 4ECIA 6GSSA 2WFCA 2XBIA 1OKDA 2MMZA 1ST9A 4JZQA 2IL3A 3M0FA 3CRUA 1OE7A 4XHMA 1X0RA 2PU9C 4J2FA 2ES7A 5E4WA 4FIWA 3SWLA 4GTUA 2GTUA 1WWJA 4PQ1A 4ZL9A 3UVHA 3GTUA 3FW2A 2JL4A 3TKQA 5IPGA 2F9SA 1TK0B 1USBA 2C3TA 3VWWA 1T4YA 3DD3A 3GX8A 5DDLA 4IGJA 3ZTLA 2FA8A 1TOFA 1X5DA 4K7IA 4GRFA 2V6KA 1SYRA 1VF3A 3EMPA 1TI3A 1TXXA 5ECNB 4MJAA 4MJBA 1VF2A 4GSTA 3KMOA 5GSTA 4RQRA 5ECMB 4GQFA 3CXGA 5IOXA 3TKPA 2WB9A 2MMAA 4K1FA 3DVXA 1NHYA 1WP0A 1PKZA 2KHPA 1R7HA 4DSRA 4ULXA 2R3XA 4TVEA 1OYJA 2B3SA 4GWRA 4IBPA 4POLA 1OE8A 3GA4A 1PRXA 1B9XC 1G0TA 3FR6A 4AJ8A 1XIYA 4WF4A 1X9MB 4JR6A 1BAYA 3VFIA 3GNJA 3KM6A 4WEYA 2TRCP 2K18A 3P8WA 3DYRA 4D73A 3F4TA 4FH8A 3NZNA 4HQSA 1Z3EA 3JCML 1TTZA 3IK7A 1V9WA 4I2UA 3GHAA 1Q4JA 1SU9A 3G7IA 1M2DA 3TUEA 3F4SA 3BBYA 5ABRA 2LJKA 5H5QA 2MBTA 3BD2A 5D9TA 5IMFA 2GT5A 3DVWA 3H4KA 1UVZA 1EV9A 4PXOA 5DVBA 2JZRA 2H30A 4KSOA 4XS6A 5IPHA 3L9SA 2RIIA 2C0EA 1HYUA 1F9MA 1BG5A 3Q18A 1VRSD 1ZGNA 2H6XA 5KEJA 3R2QA 1K0CA 4MJEA 2FWEA 3FK8A 4JRRA 5KN3A 4IP6A 2E2GA 1Z6MA 3I43A 3AY8A 1WMJA 3P7XA 3GH6A 4POMA 5IO2A 3J7Yb 2CZ2A 2X8HA 2BJXA 1O7UA 1AAZA 4K7NA 2HLSA 2IIYA 3U6VA 2RUFA 2X64A 1NHOA 3BCKA 4HQZA 2FNOA 3IAS2 5EVOA 2I9HA 3KGKA 3L0HA 1MD4A 1F3AA 2O87A 2K8SA 1XW9A 1U87A 4JR4A 4HJ2A 3TJGA 4I5QA 5KN0A 3ZREA 2H66A 2VCWA 3KJYA 5CNWA 3MSZA 2LUSA
chains in the Genus database with same CATH superfamily
2Z9SA 5ID2A 4ECJA 4O5UA 2C1YA 4O5RA 1SK2A 3FZ5A 2WRTA 3F3RA 2L4CA 3L4NA 2GVPA 1OC8A 2GSSA 2WGRA 3HD5A 4HUAA 1PL1A 5IMCA 3KP9A 1A24A 2H1AA 1VGLA 2PERA 3HA9A 5HR1A 2I81A 3TKSA 3TKSC 1HQOA 2A2SA 4WR4A 5AISA 5EY6A 3GFKA 1TDIA 1X9SB 5A4WA 4A5PA 3ZYWA 2A4VA 3LORA 4L8EA 4O92A 6GSUA 2L59A 3FKFA 4DSSA 1ON4A 5ECKB 1JHBA 4YQUA 1FO5A 2E0QA 4PNGA 3KCMA 2LEGA 2NTOA 5IMDA 2DC5A 1K0AA 3IK9A 4OD7A 1K0NA 4MPGA 1DE2A 2VUPA 3H8QA 3QD9A 4CY6A 2YWIA 2H1GA 2OA7A 2DJKA 2QC7A 4XS4A 3ZMLA 1V2AA 2KLXA 1ZMAA 4MZWA 4EUYA 3D4MA 4V1Ap 1XZOA 1F37A 3UBLA 4KDYA 2F8FA 4PQHA 2R0CA 4PX1A 5EPFA 5KN1A 3C1SA 1ERTA 1XVQA 4G0IA 1ZOFA 4ZBDA 4IQAA 3N9JA 2XPDA 3D21A 3DEXA 3F8UA 3HDCA 1ML6A 1PKWA 3ZMKA 3P90A 1FVJA 4G0KA 2KUCA 1T1VA 1PN9A 3KP8A 2H73A 4MLYA 2GGTA 3F6FA 5G30A 1EEMA 2H1BA 2C0FA 1HNCA 3E3EA 2C3QA 2FHEA 2R5GA 1R4WA 1CQHA 1URMA 2K9FA 3ME8A 2FWGA 1XBSA 4LMWA 4WXTA 4TR3A 3QAVA 1GULA 1QK8A 2PMTA 3DWVA 2H0HA 1N8JA 2LSTA 3GUSA 2LS5A 3GTUB 3HHVA 3RPNA 3LSZA 2RM5A 4YAPA 3GX0A 1YF0A 3M9JA 3EE2A 4IELA 3UOMA 1J9BA 4DVCA 4PTSA 3KEBA 4X4JA 5JCGA 1G7OA 1VF1A 2B7JA 5F07A 4K7OA 2DKIA 2C0GA 2YNXA 3D6IA 4ECCA 4BVYA 1LU4A 3L9UA 4Z2TA 3I69A 5H5SA 5IMAA 3UARA 3LYPA 2KP1A 3ED3A 1O73A 3QMXA 2V32A 4XRAA 4L0WA 2QGVA 18GSA 1AXDA 2IPAA 4MZBA 2VIMA 2LRTA 4KAEA 3KTLA 2N5BA 2CQ9A 3PH9A 3IDVA 2IMEA 1XXUA 1GRXA 2OE1A 1M7TA 4KW6A 2CVDA 3TRPA 3ZITA 5G31A 2CT6A 4V2MA 3SBCA 5J9CA 2PVQA 2HI7A 1E2YA 2FUG2 1WIKA 1EOHA 4K0NA 5A5KA 2VCTA 5GSSA 2B1KA 3UVTA 2ZNMA 5D96A 3M3MA 2PPTA 3TJBA 5ECQB 2AV4A 1FB0A 5CP1A 3H93A 2L5OA 2V1MA 3ZIJA 1EP8A 4WETA 2VL3A 3MDKA 4EF0A 4D73B 4QL9A 5BMUA 3NIVA 4AJ6A 4F2IA 3RHBA 3E0UA 4V1Ag 3IBHA 3GL5A 4I2TA 5ENUA 5LD0A 2H6YA 2HXKA 4AF2A 2VD1A 4K2XA 2HSYA 3C73A 2ON7A 1Q98A 2DSAA 3KIJA 2PBJA 1ABAA 1FAAA 2H8LA 4PUFC 1LJRA 4Q5NA 3FZAA 4KE3A 4NAXA 1B48A 1BEDA 4JEDA 5D9VA 3VWUA 3L9VA 1HD2A 1FG4A 4L5LA 2B6MA 4EXJA 5EL8A 3LJRA 4ILFA 4RI6A 2FLSA 1OC9A 2AJQB 1V58A 4X0XA 4OWYA 4H86A 2H70A 4CHSA 4POBA 1LBKA 4EKZA 1YEPA 5HFIA 1F3BA 2XPEA 22GSA 3CMIA 4MH3A 3LG6A 3QCPA 1Y6EA 3L78A 3WGDA 5J5NA 3ZFLA 2GT6A 3HXSA 4TKYA 1UN2A 1TI1A 4IN0A 2MZCA 3FHKA 3Q74A 3TRXA 5DQSA 2LJAA 2QA2A 1XPVA 1DBYA 5A4UA 2YOIA 1B9YC 1MD3A 2LRNA 5IMVA 1A0RP 2X49A 3DMLA 2GDRA 3QDNA 3UAPA 3HVSA 5CRDA 1GTAA 4RUVA 2FA4A 5DALA 1A0FA 4EDYA 5KOWA 6GSVA 4PUAA 1XFLA 1TJDA 3TJKA 3W6GA 5LNKe 3HY2A 1X5EA 4AJ7A 3GL3A 4O7HA 5ID2B 5J4UA 2D2ZA 2J23A 5G1KA 4TRXA 2RUEA 2G2QA 3C1RA 3VPTA 2HZEA 4FYCA 2RLIA 2HT9A 4LLRA 4KX4A 2YWOA 1XVWA 5D9WA 4ECBA 3NOFA 3TOUA 1S3AA 3ME7A 4G10A 2KP2A 1DE1A 4OFMA 1E6BA 1YY7A 3U5RE 1JZWA 3TRQA 1J08A 3O3TA 3VWXA 4NMUA 4KSMA 1M9BA 4J56E 6GSXA 3CTFA 1GTUA 3EMXA 4DSSB 5HFKA 4WBRD 1QMVA 1H75A 1PX7A 1I5GA 4ZBBA 1Z9HA 1A23A 1K0MA 4IQ1A 4LMVA 3UJ1A 4XS1A 5C00A 3GURA 1PSQA 3EYTA 3ZIVA 3PGTA 2K8VA 2CVKA 4XS4B 2E2MA 4WF5A 2P5QA 2DJ2A 2JZTA 4ML1A 4K6XA 1JZDA 4EL1A 2B1LA 4E8EA 3IPZA 3TDGA 2YJ7A 2XHFA 3EU4A 5D8IA 4OFTA 3TOTA 4PNFA 4IJ3A 1NW2A 1EEJA 4YKFA 4HU7A 5B7CA 4BPYA 5DQYA 4QQ7A 3CYNA 1YDKA 1V57A 4MPFA 2C4JA 4Z7XA 3WD6A 3RPPA 5HR3A 4GXZA 2MBSA 2AAWA 2C3NA 1UA5A 2NPBA 3VURA 3HCZA 2M72A 3QAWA 5ECRB 3C71A 3FZ9A 3V1WA 1XW6A 4I6XA 1XG8A 2VLUA 1BYEA 3LYKA 3GV1A 2A2RA 1F2EA 4TR4A 1DSBA 1OVNA 1A2JA 4Z2RA 3IV4A 1MDJA 2O89A 2DIYA 4BVYB 5C04A 1K0DA 3F0IA 4AGSA 2WULA 1X5CA 3MAKA 2JACA 3TKRA 5G5EA 2R2JA 1CQGA 4MCUA 3PINA 4TXOA 1TU8A 2FD3A 1EGOA 1SD8A 2QSIA 3IA1A 2X4AA 3HJOA 1PD21 4L5OA 4GCIA 2EIOA 2V2GA 1XWCA 1M3IA 1G6YA 2WCIA 1G7EA 2I4AA 3ZLPA 5AN1A 4I8BA 13GSA 2R37A 5HQPA 4K9ZA 3MIXA 1GUKA 2IFQA 5FWGA 3TCOA 5J3RA 4CW9A 4CDOA 4K5RA 3W8SA 6GSYA 1ZZYA 5DAKA 2X8CA 4ID0A 1GNEA 4OCFA 4OO5A 1XWGA 4ZIJA 4FO5A 1GUHA 1O8WA 1K0BA 1V98A 1JLVA 3EWLA 2EIQA 4QL7A 5B8BA 2VD0A 1ERWA 3IAM2 5IM9A 4E8HA 3G7YA 1Z6NA 1FHEA 4HU9A 2GQLA 3UIWA 3UEMA 4NHWA 3O76A 2PVOC 1VF4A 2GZPA 4IHUA 1ZYPA 3I9V2 3APQA 4IP1A 1OKTA 4HZ2A 4YQVA 4HZ4A 4N30A 3TGZA 4NHZA 3IC4A 2H74A 4KCEA 5ECLB 3VI5A 2HSMA 1SK0A 1JFUA 5J41A 1O8XA 4YH2A 3KMNA 2HE3A 5CRHA 5G2ZA 4F03A 4N11A 2YN1A 3BJ5A 3DIEA 4JU5A 1NSWA 1XCCA 2EIRA 2M80A 2CX4A 4TXVA 1QFNA 1SENA 1U6TA 4KH7A 3PPUA 5FHIA 1OC9B 4K0GA 1QUWA 4PQIA 5COHA 2OBIA 3EVIA 3F6DA 1PN0A 3IRAA 2CA8A 1QXHA 3HKRA 4IS0A 3HYPA 2H71A 3UBKA 2CAIA 4V2LA 2PUKC 5CO3A 4CY8A 4XRDA 2IWTA 3Q19A 4MF5A 3GH9A 2YWMA 1Y25A 1EV4A 2PN8A 5B6NA 1JZRA 3LXTA 3EURA 5IOWA 2AYTA 4HEA2 3WGXA 4ISDA 1ZL9A 4LL1B 1R5AA 4MDCA 2VL2A 1PX6A 2VL2C 2ZCTA 2PGTA 5ECOB 1MDKA 3S9FA 3F63A 3RBTA 1ZYQB 4KNDA 8GSSA 5DCGA 1G6WA 2F3MA 2OKAA 1GP1A 1AQWA 2LQOA 3FZ4A 3DXBA 1OAZA 2LKUA 4TOPA 2NBSA 1GSFA 5ELGA 4POKA 3ISOA 2DJJA 2F51A 2EC4A 2FY6A 1TW9A 2L5LA 2B5XA 5DALB 3MNGA 4XCSA 1GLQA 1KEBA 4PGTA 1THOA 5E59A 5DJMA 2R0GA 2NDOA 2I3YA 5J9BA 2VLVA 1IYIA 4G2EA 4TW5A 1FB6A 2IJYA 1EP7A 4EIPA 3ERGA 2HZEB 1SKRB 4X1UA 3VPQA 2DBCA 3ZVJD 5HR2A 2JSZA 2O85A 1K0OA 4OFNA 1Z7RA 4ZB9A 2P31A 2VL9A 4USSA 2C80A 4ZL8A 1PMTA 2REMA 2YPMA 1M2BA 2H76A 3LFLA 2HRNA 3VI7A 3LGCA 4F0CA 2ALBA 2VAFA 1UC7A 2R4VA 1I9DA 5F0GA 3IHQA 4ZBAA 2B5EA 3FR3A 4LA1A 4GF0A 4KA0A 3D0ZA 2R6KA 4L0UA 1XWKA 5JWOB 4NWYA 3ZVJA 4MZCA 3LXZA 3GKNA 4WR5A 1W89A 3W8JA 3RDWA 4ZB6A 3Q6OA 2X99A 2I1UA 1GSDA 1M0UA 4G9HA 2VOCA 2WJUA 5HR0A 2TRXA 4TR1A 1SL1B 2O8VB 2YJHA 3DGQA 4KDXA 1BX9A 2H1DA 4EC0A 3TJJA 4HJMA 3R3EA 5ECSA 5G5FA 1B8XA 2GSQA 3OR5A 5AIVA 11GSA 1KTEA 2LV3A 4HSCX 1GSQA 2KOKA 1WE0A 5GAND 2DMMA 3P2AA 2H75A 4DSQA 1MDIA 2K6VA 3GKMA 1XWAA 1T8EB 5ECHB 1M9AA 2IN3A 1GL8A 4KDUA 1SK1A 3KXOA 3FMWA 3HJPA 5ECPB 1TRSA 5IQYA 3QAGA 1XWBA 1O81A 2IMKA 3D22A 3QFAC 4MP4A 2IMFA 1T00A 1ZYNA 4O32A 2VCZA 4BL7A 3GIXA 2H01A 1GNWA 1GTBA 4MNNA 3ZZXA 4KGIA 3FEUA 4BVXA 1PQNA 4YQMA 3CSJA 2VM2A 3VWVA 3TJFA 3J7Yk 3CSIA 2E7PA 1IYHA 1XOAA 2XC2A 2V41A 2GQMA 3ERWA 1FOVA 2H19A 3FRCA 3C8EA 5JWRB 4K5SA 4KCAA 1Z5YE 4WKWA 1SJ6A 2YV7A 2XBQA 4TXOB 2OACA 5B8AA 4ZXGA 2YP6A 20GSA 3LWAA 4ZL7A 4TN8A 1SJZA 4OO4A 5DBQA 2BMXA 1ERVA 1SKWB 1ERUA 1T4ZA 9GSSA 4GQCA 3CSHA 5INYA 2DKHA 4OMVA 2LNSA 2JZSA 2O7KA 1F6MC 1EWXA 4IVFA 1EOGA 1AC1A 4MH2A 3IHGA 5JCUA 6GSWA 2DJ0A 2IFQB 5IIZA 1GSSA 3G7JA 2HYXA 5DAKB 2HSHA 1K3YA 2OADA 4XIHA 1FVKA 4N10A 2FCHA 1KNGA 3KH7A 1JZOA 17GSA 1GLPA 4P3YB 14GSA 1R26A 1Z7PA 5AGYA 3HZ4A 1M3JA 1S3DA 1EGRA 4F82A 2LTKA 4ICYA 4MF6A 4NPBA 5HFGA 3TB2A 1O6JA 2OE0A 3IOSA 5H5RA 4JE1A 3PR8A 2CZ3A 1GSUA 3RHCA 2GSRA 3D4TA 1HNAA 2B7KA 1ZCPA 4MJCA 2H72A 3HVXA 5L71A 1AQXA 4Q5FA 2L4QA 1B4QA 2YZHA 16GSA 2GSTA 4K8MA 1M2AA 1YF1A 2GZYA 4K2DA 1HNBA 3C7MA 4O5QA 2VCQA 1KBNA 4XTSA 1PA3A 2CX3A 4EDZA 3M8NA 2G0FA 2YANA 1A8YA 4Q5RA 3US3A 1ACVA 3GSTA 1V40A 2N5FA 2LQQA 3D5JA 2QKEA 2JSYA 2GS3A 3HJMA 3HVVA 1B4PA 4FYBA 2VCVA 2JU5A 3A3TA 5JCWA 1WOUA 4BA7A 2YWNA 3WT1A 2WS2A 2PWJA 3CQFA 2OBKA 5ELAA 3DKSA 3H79A 1RQMA 1MTCA 2HZFA 3GRXA 2VO4A 3KTBA 5GAPD 3H1NA 3FY7A 5KN2A 2HNLA 2X8GA 1TKDB 4Q5QA 4TR0A 3WGEA 1XW5A 3E9JB 3K8NA 4GSNA 1TRWA 3G9BA 4MA9A 1QGVA 4G19A 3BOAA 5JWQB 3FYGA 1BQ7A 1TRUA 1U3IA 4IJIA 3LQ7A 3FR9A 5CREA 2M46A 1H4OA 4F9ZA 7GSSA 3A5IA 4BWQA 3F3QA 5D93A 5D9XA 1PL2A 4J57E 2V6OA 4NV2A 2FWFA 4NV5A 3ZRDA 2J9HA 3CRTA 3ZFBA 3QOUA 4I97A 2LRCA 3EC3A 1GSYA 2P0GA 2FGXA 3APOA 2B5YA 4HI7A 5D73A 1C72A 2HFDA 5ECIB 4FQUA 3EPTA 1GSEA 1U88A 1PGTA 4RQXA 2CAQA 4ZB8A 4V2NA 5FT3A 2A2PA 2DIZA 4MMMA 1WJKA 1ILOA 5IMZA 2H0GA 1TU7A 3GYKA 4EE0A 1X9WB 1SL0B 2P5RA 5CRWA 1AW9A 1THXA 1NM3A 4HS1A 2L6CA 2FWHA 3EU3A 1ZYEA 3BCIA 1AUCA 2RM6A 3QR6A 4BWSA 4RI7A 1GTIA 3WT2A 2AHEA 4LL4B 3M1GA 2F8AA 4TR1B 2L6DA 6GSTA 2MYGA 19GSA 4KB3A 2LJRA 3DRNA 3LEFA 2CVBA 4HOJA 10GSA 5DCHA 3KZQA 1TK8B 4GSSA 2AUVA 3I6AA 1YZXA 3F9UA 1TP9A 2A4HA 3LW9A 3GMFA 4MK3A 1TRVA 1YQ1A 3M9KA 4EVMA 3WYWA 3EINA 4WBJA 1RW1A 1A8LA 4N0ZA 3A2WA 1R5PA 4ZILA 2VLTA 5CYYA 4JBBA 3QPMA 3IR4A 3ZL5A 2DLXA 4KUNA 1N2AA 3MWHA 2NVLA 1GH2A 2TIRA 4IKHA 1WPIA 1K3LA 2C0DA 2JADA 1FW1A 2IMIA 3RAZA 1SD9A 2OJLA 2H6ZA 1AQVA 2WZ9A 4BL7B 1SKSB 1GUMA 3KH9A 4MABA 3APSA 2MMNA 5CRGA 3A2VA 1AIUA 1SYXA 4HDEA 2CV4A 2DMLA 3GKXA 4ML6A 5G1LA 1T7PB 4X43A 4BVXB 1U3AA 3KD0A 1MEKA 5GZZB 3TKSE 2HRFA 2QA1A 4ACSA 3HZ8A 1YEXA 2ZUPA 3VK9A 1K3OA 12GSA 3IE3A 2L57A 4F0BA 1JLWA 3F4RA 4YKGA 2GLRA 3A5WA 5LCZA 1YJ6A 3GKKA 2DJ1A 3IXRA 4EO3A 5CAXA 2OE3A 1WRYA 2BTOT 2GQKA 2UZ8A 3UMAA 3GN3A 1YKAA 1A2MA 3QFBC 2ON5A 2YV9A 2AB6A 4OCEA 3CBUA 3VLNA 5DJLA 3GSSA 1YKCA 2C8UA 1OC3A 1TK5B 1SL2B 4N0VA 2YZUA 2VCXA 2MMOA 2N5AA 4FYUA 1RK4A 4IW9A 3O6TA 1M99A 5F8BA 5F06A 5IO0A 2IMDA 3N5OA 4MF7A 5A4VA 5B6MA 3UL3A 3ERFA 1XOBA 1S3RA 2H0IA 2VM1A 1EZKA 1S3CA 4DEJA 2LNTA 1T3BA 1QQ2A 1W4VA 2GZZA 1GWCA 2WDUA 1J0FA 5AIXA 1BJXA 1SJIA 2DJ3A 5F05A 1DUGA 1O85A 4KF9A 4GLTA 4PURA 3CTGA 4YAVA 3A2XA 1A2LA 4NXIA 2YCDA 4ECIA 6GSSA 2WFCA 2XBIA 5BRTA 4EIQA 1OKDA 2MMZA 1ST9A 4JZQA 2IL3A 3M0FA 3CRUA 1OE7A 4XHMA 1X0RA 2PU9C 4J2FA 4BIKA 2ES7A 5E4WA 4FIWA 3SWLA 4GTUA 2GTUA 1WWJA 4PQ1A 4ZL9A 3UVHA 3GTUA 3FW2A 2JL4A 3TKQA 5IPGA 2F9SA 1TK0B 1USBA 2C3TA 3VWWA 1T4YA 3DD3A 4Z2UA 3GX8A 5DDLA 4IGJA 3ZTLA 2FA8A 1TOFA 1X5DA 4K7IA 1PFOA 4GRFA 2V6KA 1SYRA 1VF3A 3EMPA 1TI3A 1TXXA 5ECNB 4MJAA 4MJBA 1VF2A 4GSTA 3KMOA 5GSTA 4RQRA 5ECMB 4GQFA 4G0LA 3CXGA 5IOXA 3TKPA 2WB9A 2MMAA 4K1FA 3DVXA 1NHYA 1WP0A 1PKZA 2KHPA 1R7HA 4DSRA 4ULXA 2R3XA 4TVEA 1OYJA 2B3SA 2R0PA 4GWRA 4IBPA 4POLA 1OE8A 3GA4A 1PRXA 1B9XC 1G0TA 3FR6A 4AJ8A 1XIYA 4WF4A 1X9MB 4JR6A 1BAYA 3VFIA 3GNJA 3KM6A 4WEYA 2TRCP 2K18A 3P8WA 3DYRA 4D73A 3F4TA 4FH8A 3NZNA 4HQSA 1Z3EA 3JCML 1TTZA 3IK7A 1V9WA 4I2UA 3GHAA 1Q4JA 1SU9A 3G7IA 1M2DA 3TUEA 3F4SA 3HVNA 3BBYA 5ABRA 2LJKA 5H5QA 2MBTA 3BD2A 5D9TA 5IMFA 2GT5A 3DVWA 3H4KA 1UVZA 1EV9A 4PXOA 5DVBA 2JZRA 2H30A 4KSOA 4XS6A 5IPHA 3L9SA 2RIIA 2C0EA 1HYUA 1F9MA 1BG5A 3Q18A 1VRSD 1ZGNA 2H6XA 5KEJA 3R2QA 1K0CA 4MJEA 2FWEA 3FK8A 4JRRA 5KN3A 4IP6A 3MYDA 2E2GA 1Z6MA 3I43A 3AY8A 1WMJA 3P7XA 3GH6A 4POMA 5IO2A 3J7Yb 2CZ2A 2X8HA 2BJXA 1O7UA 1AAZA 4K7NA 2HLSA 2IIYA 3U6VA 2RUFA 2X64A 1NHOA 3BCKA 4HQZA 2FNOA 3IAS2 5EVOA 2I9HA 2HRAA 3KGKA 3L0HA 1MD4A 1F3AA 2O87A 2K8SA 1XW9A 1U87A 4JR4A 1FOHA 4HJ2A 3TJGA 4I5QA 5KN0A 3IC8A 3ZREA 2H66A 2VCWA 5KOXA 2HRKA 3KJYA 5CNWA 3MSZA 2LUSA
chains in the Genus database with same CATH topology
2Z9SA 5ID2A 4ECJA 4O5UA 2C1YA 4O5RA 1SK2A 3FZ5A 2WRTA 3F3RA 2L4CA 3L4NA 2GVPA 1OC8A 2GSSA 2WGRA 3HD5A 4HUAA 1PL1A 5IMCA 3KP9A 1A24A 2H1AA 1VGLA 2PERA 3HA9A 5HR1A 2I81A 3TKSA 3TKSC 1HQOA 2A2SA 4WR4A 5AISA 5EY6A 3GFKA 1TDIA 1X9SB 5A4WA 4A5PA 3ZYWA 2A4VA 3LORA 4L8EA 4O92A 6GSUA 2L59A 3FKFA 4DSSA 1ON4A 5ECKB 1JHBA 4YQUA 1FO5A 2E0QA 4PNGA 3KCMA 2LEGA 2NTOA 5IMDA 2DC5A 1K0AA 3IK9A 4OD7A 1K0NA 4MPGA 1DE2A 2VUPA 3H8QA 3QD9A 4CY6A 2YWIA 2H1GA 2OA7A 2DJKA 2QC7A 4XS4A 3ZMLA 1V2AA 2KLXA 1ZMAA 4MZWA 4EUYA 3D4MA 4V1Ap 1XZOA 1F37A 3UBLA 4KDYA 2F8FA 4PQHA 2R0CA 4PX1A 5EPFA 5KN1A 3C1SA 1ERTA 1XVQA 4G0IA 1ZOFA 4ZBDA 4IQAA 3N9JA 2XPDA 3D21A 3DEXA 3F8UA 3HDCA 1ML6A 1PKWA 3ZMKA 3P90A 1FVJA 4G0KA 2KUCA 1T1VA 1PN9A 3KP8A 2H73A 4MLYA 2GGTA 3F6FA 5G30A 1EEMA 2H1BA 2C0FA 1HNCA 3E3EA 2C3QA 2FHEA 2R5GA 1R4WA 1CQHA 1URMA 2K9FA 3ME8A 2FWGA 1XBSA 4LMWA 4WXTA 4TR3A 3QAVA 1GULA 1QK8A 2PMTA 3DWVA 2H0HA 1N8JA 2LSTA 3GUSA 2LS5A 3GTUB 3HHVA 3RPNA 3LSZA 2RM5A 4YAPA 3GX0A 1YF0A 3M9JA 3EE2A 4IELA 3UOMA 1J9BA 4DVCA 4PTSA 3KEBA 4X4JA 5JCGA 1G7OA 1VF1A 2B7JA 5F07A 4K7OA 2DKIA 2C0GA 2YNXA 3D6IA 4ECCA 4BVYA 1LU4A 3L9UA 4Z2TA 3I69A 5H5SA 5IMAA 3UARA 3LYPA 2KP1A 3ED3A 1O73A 3QMXA 2V32A 4XRAA 4L0WA 2QGVA 18GSA 1AXDA 2IPAA 4MZBA 2VIMA 2LRTA 4KAEA 3KTLA 2N5BA 2CQ9A 3PH9A 3IDVA 2IMEA 1XXUA 1GRXA 2OE1A 1M7TA 4KW6A 2CVDA 3TRPA 3ZITA 5G31A 2CT6A 4V2MA 3SBCA 5J9CA 2PVQA 2HI7A 1E2YA 2FUG2 1WIKA 1EOHA 4K0NA 5A5KA 2VCTA 5GSSA 2B1KA 3UVTA 2ZNMA 5D96A 3M3MA 2PPTA 3TJBA 5ECQB 2AV4A 1FB0A 5CP1A 3H93A 2L5OA 2V1MA 3ZIJA 1EP8A 4WETA 2VL3A 3MDKA 4EF0A 4D73B 4QL9A 5BMUA 3NIVA 4AJ6A 4F2IA 3RHBA 3E0UA 4V1Ag 3IBHA 3GL5A 4I2TA 5ENUA 5LD0A 2H6YA 2HXKA 4AF2A 2VD1A 4K2XA 2HSYA 3C73A 2ON7A 1Q98A 2DSAA 3KIJA 2PBJA 1ABAA 1FAAA 2H8LA 4PUFC 1LJRA 4Q5NA 3FZAA 4KE3A 4NAXA 1B48A 1BEDA 4JEDA 5D9VA 3VWUA 3L9VA 1HD2A 1FG4A 4L5LA 2B6MA 4EXJA 5EL8A 3LJRA 4ILFA 4RI6A 2FLSA 1OC9A 2AJQB 1V58A 4X0XA 4OWYA 4H86A 2H70A 4CHSA 4POBA 1LBKA 4EKZA 1YEPA 5HFIA 1F3BA 2XPEA 22GSA 3CMIA 4MH3A 3LG6A 3QCPA 1Y6EA 3L78A 3WGDA 5J5NA 3ZFLA 2GT6A 3HXSA 4TKYA 1UN2A 1TI1A 4IN0A 2MZCA 3FHKA 3Q74A 3TRXA 5DQSA 2LJAA 2QA2A 1XPVA 1DBYA 5A4UA 2YOIA 1B9YC 1MD3A 2LRNA 5IMVA 1A0RP 2X49A 3DMLA 2GDRA 3QDNA 3UAPA 3HVSA 5CRDA 1GTAA 4RUVA 2FA4A 5DALA 1A0FA 4EDYA 5KOWA 6GSVA 4PUAA 1XFLA 1TJDA 3TJKA 3W6GA 5LNKe 3HY2A 1X5EA 4AJ7A 3GL3A 4O7HA 5ID2B 5J4UA 2D2ZA 2J23A 5G1KA 4TRXA 2RUEA 2G2QA 3C1RA 3VPTA 2HZEA 4FYCA 2RLIA 2HT9A 4LLRA 4KX4A 2YWOA 1XVWA 5D9WA 4ECBA 3NOFA 3TOUA 1S3AA 3ME7A 4G10A 2KP2A 1DE1A 4OFMA 1E6BA 1YY7A 3U5RE 1JZWA 3TRQA 1J08A 3O3TA 3VWXA 4NMUA 4KSMA 1M9BA 4J56E 6GSXA 3CTFA 1GTUA 3EMXA 4DSSB 5HFKA 4WBRD 1QMVA 1H75A 1PX7A 1I5GA 4ZBBA 1Z9HA 1A23A 1K0MA 4IQ1A 4LMVA 3UJ1A 4XS1A 5C00A 3GURA 1PSQA 3EYTA 3ZIVA 3PGTA 2K8VA 2CVKA 4XS4B 2E2MA 4WF5A 2P5QA 2DJ2A 2JZTA 4ML1A 4K6XA 1JZDA 4EL1A 2B1LA 4E8EA 3IPZA 3TDGA 2YJ7A 2XHFA 3EU4A 5D8IA 4OFTA 3TOTA 4PNFA 4IJ3A 1NW2A 1EEJA 4YKFA 4HU7A 5B7CA 4BPYA 5DQYA 4QQ7A 3CYNA 1YDKA 1V57A 4MPFA 2C4JA 4Z7XA 3WD6A 3RPPA 5HR3A 4GXZA 2MBSA 2AAWA 2C3NA 1UA5A 2NPBA 3VURA 3HCZA 2M72A 3QAWA 5ECRB 3C71A 3FZ9A 3V1WA 1XW6A 4I6XA 2VLUA 1BYEA 3LYKA 3GV1A 2A2RA 1F2EA 4TR4A 1DSBA 1OVNA 1A2JA 4Z2RA 3IV4A 1MDJA 2O89A 2DIYA 4BVYB 5C04A 1K0DA 3F0IA 4AGSA 2WULA 1X5CA 3MAKA 2JACA 3TKRA 5G5EA 2R2JA 1CQGA 4MCUA 3PINA 4TXOA 1TU8A 2FD3A 1EGOA 1SD8A 2QSIA 3IA1A 2X4AA 3HJOA 1PD21 4L5OA 4GCIA 2EIOA 2V2GA 1XWCA 1G6YA 2WCIA 1G7EA 2I4AA 3ZLPA 5AN1A 4I8BA 13GSA 2R37A 5HQPA 4K9ZA 3MIXA 1GUKA 2IFQA 5FWGA 3TCOA 5J3RA 4CW9A 4CDOA 4K5RA 3W8SA 6GSYA 1ZZYA 5DAKA 2X8CA 4ID0A 1GNEA 4OCFA 4OO5A 1XWGA 4ZIJA 4FO5A 1GUHA 1O8WA 1K0BA 1V98A 1JLVA 3EWLA 2EIQA 4QL7A 5B8BA 2VD0A 1ERWA 3IAM2 5IM9A 4E8HA 3G7YA 1Z6NA 1FHEA 4HU9A 2GQLA 3UIWA 3UEMA 4NHWA 3O76A 2PVOC 1VF4A 2GZPA 4IHUA 1ZYPA 3I9V2 3APQA 4IP1A 1OKTA 4HZ2A 4YQVA 4HZ4A 4N30A 3TGZA 4NHZA 3IC4A 2H74A 4KCEA 5ECLB 3VI5A 2HSMA 1SK0A 1JFUA 5J41A 1O8XA 4YH2A 3KMNA 2HE3A 5CRHA 5G2ZA 4F03A 4N11A 2YN1A 3BJ5A 3DIEA 4JU5A 1NSWA 1XCCA 2EIRA 2M80A 2CX4A 4TXVA 1QFNA 1SENA 1U6TA 4KH7A 3PPUA 5FHIA 1OC9B 4K0GA 1QUWA 4PQIA 5COHA 2OBIA 3EVIA 3F6DA 1PN0A 3IRAA 2CA8A 1QXHA 3HKRA 4IS0A 3HYPA 2H71A 3UBKA 2CAIA 4V2LA 2PUKC 5CO3A 4CY8A 4XRDA 2IWTA 3Q19A 4MF5A 3GH9A 2YWMA 1Y25A 1EV4A 2PN8A 5B6NA 1JZRA 3LXTA 3EURA 5IOWA 2AYTA 4HEA2 3WGXA 4ISDA 1ZL9A 4LL1B 1R5AA 4MDCA 2VL2A 1PX6A 2VL2C 2ZCTA 2PGTA 5ECOB 1MDKA 3S9FA 3F63A 3RBTA 1ZYQB 4KNDA 8GSSA 5DCGA 1G6WA 2F3MA 2OKAA 1GP1A 1AQWA 2LQOA 3FZ4A 3DXBA 1OAZA 2LKUA 4TOPA 2NBSA 1GSFA 5ELGA 4POKA 3ISOA 2DJJA 2F51A 2EC4A 2FY6A 1TW9A 2L5LA 2B5XA 5DALB 3MNGA 4XCSA 1GLQA 1KEBA 4PGTA 1THOA 5E59A 5DJMA 2R0GA 2NDOA 2I3YA 5J9BA 2VLVA 1IYIA 4G2EA 4TW5A 1FB6A 2IJYA 1EP7A 4EIPA 3ERGA 2HZEB 1SKRB 4X1UA 3VPQA 2DBCA 3ZVJD 5HR2A 2JSZA 2O85A 1K0OA 4OFNA 1Z7RA 4ZB9A 2P31A 2VL9A 4USSA 2C80A 4ZL8A 1PMTA 2REMA 2YPMA 1M2BA 2H76A 3LFLA 2HRNA 3VI7A 3LGCA 4F0CA 2ALBA 2VAFA 1UC7A 2R4VA 1I9DA 5F0GA 3IHQA 4ZBAA 2B5EA 3FR3A 4LA1A 4GF0A 4KA0A 3D0ZA 2R6KA 4L0UA 1XWKA 5JWOB 4NWYA 3ZVJA 4MZCA 3LXZA 3GKNA 4WR5A 1W89A 3W8JA 3RDWA 4ZB6A 3Q6OA 2X99A 2I1UA 1GSDA 1M0UA 4G9HA 2VOCA 2WJUA 5HR0A 2TRXA 4TR1A 1SL1B 2O8VB 2YJHA 3DGQA 4KDXA 1BX9A 2H1DA 4EC0A 3TJJA 4HJMA 3R3EA 5ECSA 5G5FA 1B8XA 2GSQA 3OR5A 5AIVA 11GSA 1KTEA 2LV3A 1GSQA 2KOKA 1WE0A 5GAND 2DMMA 3P2AA 2H75A 4DSQA 1MDIA 2K6VA 3GKMA 1XWAA 1T8EB 5ECHB 1M9AA 2IN3A 1GL8A 4KDUA 1SK1A 3KXOA 3FMWA 3HJPA 5ECPB 1TRSA 5IQYA 3QAGA 1XWBA 1O81A 2IMKA 3D22A 3QFAC 4MP4A 2IMFA 1T00A 1ZYNA 4O32A 2VCZA 4BL7A 3GIXA 2H01A 1GNWA 1GTBA 4MNNA 3ZZXA 4KGIA 3FEUA 4BVXA 1PQNA 4YQMA 3CSJA 2VM2A 3VWVA 3TJFA 3J7Yk 3CSIA 2E7PA 1IYHA 1XOAA 2XC2A 2V41A 2GQMA 3ERWA 1FOVA 2H19A 3FRCA 3C8EA 5JWRB 4K5SA 4KCAA 1Z5YE 4WKWA 1SJ6A 2YV7A 2XBQA 4TXOB 2OACA 5B8AA 4ZXGA 2YP6A 20GSA 3LWAA 4ZL7A 4TN8A 1SJZA 4OO4A 5DBQA 2BMXA 1ERVA 1SKWB 1ERUA 1T4ZA 9GSSA 4GQCA 3CSHA 5INYA 2DKHA 4OMVA 2LNSA 2JZSA 2O7KA 1F6MC 1EWXA 4IVFA 1EOGA 1AC1A 4MH2A 3IHGA 5JCUA 6GSWA 2DJ0A 2IFQB 5IIZA 1GSSA 3G7JA 2HYXA 5DAKB 2HSHA 1K3YA 2OADA 4XIHA 1FVKA 4N10A 2FCHA 1KNGA 3KH7A 1JZOA 17GSA 1GLPA 4P3YB 14GSA 1R26A 1Z7PA 5AGYA 3HZ4A 1S3DA 1EGRA 4F82A 2LTKA 4ICYA 4MF6A 4NPBA 5HFGA 3TB2A 1O6JA 2OE0A 3IOSA 5H5RA 4JE1A 3PR8A 2CZ3A 1GSUA 3RHCA 2GSRA 3D4TA 1HNAA 2B7KA 1ZCPA 4MJCA 2H72A 3HVXA 5L71A 1AQXA 4Q5FA 2L4QA 1B4QA 2YZHA 16GSA 2GSTA 4K8MA 1M2AA 1YF1A 2GZYA 4K2DA 1HNBA 3C7MA 4O5QA 2VCQA 1KBNA 4XTSA 1PA3A 2CX3A 4EDZA 3M8NA 2G0FA 2YANA 1A8YA 4Q5RA 3US3A 1ACVA 3GSTA 1V40A 2N5FA 2LQQA 3D5JA 2QKEA 2JSYA 2GS3A 3HJMA 3HVVA 1B4PA 4FYBA 2VCVA 2JU5A 3A3TA 5JCWA 1WOUA 4BA7A 2YWNA 3WT1A 2WS2A 2PWJA 2OBKA 5ELAA 3DKSA 3H79A 1RQMA 1MTCA 2HZFA 3GRXA 2VO4A 3KTBA 5GAPD 3H1NA 3FY7A 5KN2A 2HNLA 2X8GA 1TKDB 4Q5QA 4TR0A 3WGEA 1XW5A 3E9JB 3K8NA 4GSNA 1TRWA 3G9BA 4MA9A 1QGVA 4G19A 3BOAA 5JWQB 3FYGA 1BQ7A 1TRUA 1U3IA 4IJIA 3LQ7A 3FR9A 5CREA 2M46A 1H4OA 4F9ZA 7GSSA 3A5IA 4BWQA 3F3QA 5D93A 5D9XA 1PL2A 4J57E 2V6OA 4NV2A 2FWFA 4NV5A 3ZRDA 2J9HA 3CRTA 3ZFBA 3QOUA 4I97A 2LRCA 3EC3A 1GSYA 2P0GA 2FGXA 3APOA 2B5YA 4HI7A 5D73A 1C72A 2HFDA 5ECIB 4FQUA 3EPTA 1GSEA 1U88A 1PGTA 4RQXA 2CAQA 4ZB8A 4V2NA 5FT3A 2A2PA 2DIZA 4MMMA 1WJKA 1ILOA 5IMZA 2H0GA 1TU7A 3GYKA 4EE0A 1X9WB 1SL0B 2P5RA 5CRWA 1AW9A 1THXA 1NM3A 4HS1A 2L6CA 2FWHA 3EU3A 1ZYEA 3BCIA 1AUCA 2RM6A 3QR6A 4BWSA 4RI7A 1GTIA 3WT2A 2AHEA 4LL4B 3M1GA 2F8AA 4TR1B 2L6DA 6GSTA 2MYGA 19GSA 4KB3A 2LJRA 3DRNA 3LEFA 2CVBA 4HOJA 10GSA 5DCHA 3KZQA 1TK8B 4GSSA 2AUVA 3I6AA 1YZXA 3F9UA 1TP9A 2A4HA 3LW9A 3GMFA 4MK3A 1TRVA 1YQ1A 3M9KA 4EVMA 3WYWA 3EINA 4WBJA 1RW1A 1A8LA 4N0ZA 3A2WA 1R5PA 4ZILA 2VLTA 5CYYA 4JBBA 3QPMA 3IR4A 3ZL5A 2DLXA 4KUNA 1N2AA 3MWHA 2NVLA 1GH2A 2TIRA 4IKHA 1WPIA 1K3LA 2C0DA 2JADA 1FW1A 2IMIA 3RAZA 1SD9A 2OJLA 2H6ZA 1AQVA 2WZ9A 4BL7B 1SKSB 1GUMA 3KH9A 4MABA 3APSA 2MMNA 5CRGA 3A2VA 1AIUA 1SYXA 4HDEA 2CV4A 2DMLA 3GKXA 4ML6A 5G1LA 1T7PB 4X43A 4BVXB 1U3AA 3KD0A 1MEKA 5GZZB 3TKSE 2HRFA 2QA1A 4ACSA 3HZ8A 1YEXA 2ZUPA 3VK9A 1K3OA 12GSA 3IE3A 2L57A 4F0BA 1JLWA 3F4RA 4YKGA 2GLRA 3A5WA 5LCZA 1YJ6A 3GKKA 2DJ1A 3IXRA 4EO3A 5CAXA 2OE3A 1WRYA 2BTOT 2GQKA 2UZ8A 3UMAA 3GN3A 1YKAA 1A2MA 3QFBC 2ON5A 2YV9A 2AB6A 4OCEA 3CBUA 3VLNA 5DJLA 3GSSA 1YKCA 2C8UA 1OC3A 1TK5B 1SL2B 4N0VA 2YZUA 2VCXA 2MMOA 2N5AA 4FYUA 1RK4A 4IW9A 3O6TA 1M99A 5F8BA 5F06A 5IO0A 2IMDA 3N5OA 4MF7A 5A4VA 5B6MA 3UL3A 3ERFA 1XOBA 2H0IA 2VM1A 1EZKA 1S3CA 4DEJA 2LNTA 1T3BA 1QQ2A 1W4VA 2GZZA 1GWCA 2WDUA 1J0FA 5AIXA 1BJXA 1SJIA 2DJ3A 5F05A 1DUGA 1O85A 4KF9A 4GLTA 4PURA 3CTGA 4YAVA 3A2XA 1A2LA 4NXIA 2YCDA 4ECIA 6GSSA 2WFCA 2XBIA 5BRTA 4EIQA 1OKDA 2MMZA 1ST9A 4JZQA 2IL3A 3M0FA 3CRUA 1OE7A 4XHMA 1X0RA 2PU9C 4J2FA 2ES7A 5E4WA 4FIWA 3SWLA 4GTUA 2GTUA 1WWJA 4PQ1A 4ZL9A 3UVHA 3GTUA 3FW2A 2JL4A 3TKQA 5IPGA 2F9SA 1TK0B 1USBA 2C3TA 3VWWA 1T4YA 3DD3A 4Z2UA 3GX8A 5DDLA 4IGJA 3ZTLA 2FA8A 1TOFA 1X5DA 4K7IA 4GRFA 2V6KA 1SYRA 1VF3A 3EMPA 1TI3A 1TXXA 5ECNB 4MJAA 4MJBA 1VF2A 4GSTA 3KMOA 5GSTA 4RQRA 5ECMB 4GQFA 4G0LA 3CXGA 5IOXA 3TKPA 2WB9A 2MMAA 4K1FA 3DVXA 1NHYA 1WP0A 1PKZA 2KHPA 1R7HA 4DSRA 4ULXA 2R3XA 4TVEA 1OYJA 2B3SA 2R0PA 4GWRA 4IBPA 4POLA 1OE8A 3GA4A 1PRXA 1B9XC 1G0TA 3FR6A 4AJ8A 1XIYA 4WF4A 1X9MB 4JR6A 1BAYA 3VFIA 3GNJA 3KM6A 4WEYA 2TRCP 2K18A 3P8WA 3DYRA 4D73A 3F4TA 4FH8A 3NZNA 4HQSA 1Z3EA 3JCML 1TTZA 3IK7A 1V9WA 4I2UA 3GHAA 1Q4JA 1SU9A 3G7IA 1M2DA 3TUEA 3F4SA 3BBYA 5ABRA 2LJKA 5H5QA 2MBTA 3BD2A 5D9TA 5IMFA 2GT5A 3DVWA 3H4KA 1UVZA 1EV9A 4PXOA 5DVBA 2JZRA 2H30A 4KSOA 4XS6A 5IPHA 3L9SA 2RIIA 2C0EA 1HYUA 1F9MA 1BG5A 3Q18A 1VRSD 1ZGNA 2H6XA 5KEJA 3R2QA 1K0CA 4MJEA 2FWEA 3FK8A 4JRRA 5KN3A 4IP6A 3MYDA 2E2GA 1Z6MA 3I43A 3AY8A 1WMJA 3P7XA 3GH6A 4POMA 5IO2A 3J7Yb 2CZ2A 2X8HA 2BJXA 1O7UA 1AAZA 4K7NA 2HLSA 2IIYA 3U6VA 2RUFA 2X64A 1NHOA 3BCKA 4HQZA 2FNOA 3IAS2 5EVOA 2I9HA 2HRAA 3KGKA 3L0HA 1MD4A 1F3AA 2O87A 2K8SA 1XW9A 1U87A 4JR4A 1FOHA 4HJ2A 3TJGA 4I5QA 5KN0A 3IC8A 3ZREA 2H66A 2VCWA 5KOXA 2HRKA 3KJYA 5CNWA 3MSZA 2LUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9S A;  5ID2 A;  4ECJ A;  2C1Y A;  4O5R A;  1SK2 A;  3FZ5 A;  2WRT A;  3F3R A;  2L4C A;  3L4N A;  2GVP A;  1OC8 A;  2GSS A;  2WGR A;  3HD5 A;  4HUA A;  1PL1 A;  5IMC A;  3KP9 A;  1A24 A;  2H1A A;  1VGL A;  2PER A;  3HA9 A;  5HR1 A;  2I81 A;  3TKS A;  3TKS C;  1HQO A;  2A2S A;  4WR4 A;  5AIS A;  5EY6 A;  3GFK A;  1TDI A;  1X9S B;  5A4W A;  3ZYW A;  2A4V A;  3LOR A;  4L8E A;  4O92 A;  6GSU A;  2L59 A;  3FKF A;  4DSS A;  1ON4 A;  5ECK B;  1JHB A;  4YQU A;  1FO5 A;  2E0Q A;  4PNG A;  3KCM A;  2LEG A;  2NTO A;  5IMD A;  2DC5 A;  1K0A A;  3IK9 A;  4OD7 A;  1K0N A;  4MPG A;  1DE2 A;  2VUP A;  3H8Q A;  3QD9 A;  2YWI A;  2H1G A;  2OA7 A;  2DJK A;  2QC7 A;  4XS4 A;  3ZML A;  1V2A A;  2KLX A;  1ZMA A;  4MZW A;  4EUY A;  3D4M A;  4V1A p;  1XZO A;  1F37 A;  3UBL A;  4KDY A;  2F8F A;  4PQH A;  5EPF A;  4PX1 A;  5KN1 A;  3C1S A;  1ERT A;  1XVQ A;  1ZOF A;  4ZBD A;  4IQA A;  3N9J A;  2XPD A;  3D21 A;  3DEX A;  3F8U A;  3HDC A;  1ML6 A;  1PKW A;  3ZMK A;  3P90 A;  1FVJ A;  2KUC A;  1T1V A;  1PN9 A;  3KP8 A;  2H73 A;  4MLY A;  2GGT A;  3F6F A;  5G30 A;  1EEM A;  2H1B A;  2C0F A;  1HNC A;  3E3E A;  2C3Q A;  2FHE A;  2R5G A;  1R4W A;  1CQH A;  1URM A;  2K9F A;  3ME8 A;  2FWG A;  1XBS A;  4LMW A;  4WXT A;  3QAV A;  4TR3 A;  1GUL A;  1QK8 A;  2PMT A;  3DWV A;  2H0H A;  1N8J A;  2LST A;  3GUS A;  2LS5 A;  3GTU B;  3HHV A;  3RPN A;  3LSZ A;  2RM5 A;  4YAP A;  3GX0 A;  1YF0 A;  3M9J A;  3EE2 A;  4IEL A;  3UOM A;  1J9B A;  4DVC A;  3KEB A;  5JCG A;  1G7O A;  1VF1 A;  2B7J A;  5F07 A;  4K7O A;  2C0G A;  2YNX A;  3D6I A;  4ECC A;  4BVY A;  1LU4 A;  3L9U A;  3I69 A;  5H5S A;  5IMA A;  3UAR A;  3LYP A;  2KP1 A;  3ED3 A;  1O73 A;  3QMX A;  2V32 A;  4XRA A;  4L0W A;  2QGV A;  18GS A;  1AXD A;  2IPA A;  4MZB A;  2VIM A;  2LRT A;  4KAE A;  3KTL A;  2N5B A;  2CQ9 A;  3PH9 A;  3IDV A;  2IME A;  1XXU A;  1GRX A;  2OE1 A;  1M7T A;  4KW6 A;  2CVD A;  3TRP A;  3ZIT A;  5G31 A;  2CT6 A;  4V2M A;  3SBC A;  5J9C A;  2PVQ A;  2HI7 A;  1E2Y A;  2FUG 2;  1WIK A;  1EOH A;  4K0N A;  5A5K A;  2VCT A;  5GSS A;  2B1K A;  3UVT A;  2ZNM A;  5D96 A;  3M3M A;  2PPT A;  3TJB A;  5ECQ B;  2AV4 A;  1FB0 A;  5CP1 A;  3H93 A;  2L5O A;  2V1M A;  3ZIJ A;  1EP8 A;  4WET A;  2VL3 A;  3MDK A;  4EF0 A;  4D73 B;  4QL9 A;  3NIV A;  4AJ6 A;  4F2I A;  3RHB A;  3E0U A;  4V1A g;  3IBH A;  3GL5 A;  4I2T A;  5ENU A;  5LD0 A;  2H6Y A;  2HXK A;  4AF2 A;  2VD1 A;  2HSY A;  3C73 A;  2ON7 A;  1Q98 A;  2DSA A;  3KIJ A;  2PBJ A;  1ABA A;  1FAA A;  2H8L A;  4PUF C;  1LJR A;  4Q5N A;  3FZA A;  4KE3 A;  4NAX A;  1B48 A;  1BED A;  4JED A;  5D9V A;  3VWU A;  3L9V A;  1HD2 A;  1FG4 A;  4L5L A;  2B6M A;  4EXJ A;  5EL8 A;  3LJR A;  4ILF A;  4RI6 A;  2FLS A;  1OC9 A;  2AJQ B;  1V58 A;  4X0X A;  4OWY A;  4H86 A;  2H70 A;  4CHS A;  4POB A;  1LBK A;  4EKZ A;  1YEP A;  5HFI A;  1F3B A;  2XPE A;  22GS A;  3CMI A;  4MH3 A;  3LG6 A;  3QCP A;  1Y6E A;  3L78 A;  3WGD A;  5J5N A;  3ZFL A;  2GT6 A;  3HXS A;  4TKY A;  1UN2 A;  1TI1 A;  4IN0 A;  2MZC A;  3FHK A;  3Q74 A;  3TRX A;  5DQS A;  2LJA A;  1XPV A;  1DBY A;  5A4U A;  2YOI A;  1B9Y C;  1MD3 A;  2LRN A;  5IMV A;  1A0R P;  3DML A;  2GDR A;  3QDN A;  3UAP A;  3HVS A;  5CRD A;  1GTA A;  4RUV A;  2FA4 A;  5DAL A;  1A0F A;  4EDY A;  6GSV A;  4PUA A;  1XFL A;  1TJD A;  3TJK A;  3W6G A;  5LNK e;  3HY2 A;  1X5E A;  4AJ7 A;  3GL3 A;  4O7H A;  5ID2 B;  5J4U A;  2D2Z A;  2J23 A;  5G1K A;  4TRX A;  2RUE A;  2G2Q A;  3C1R A;  3VPT A;  2HZE A;  4FYC A;  2RLI A;  2HT9 A;  4LLR A;  4KX4 A;  2YWO A;  1XVW A;  5D9W A;  4ECB A;  3NOF A;  3TOU A;  1S3A A;  3ME7 A;  4G10 A;  2KP2 A;  1DE1 A;  4OFM A;  1E6B A;  1YY7 A;  3U5R E;  1JZW A;  3TRQ A;  1J08 A;  3O3T A;  3VWX A;  4NMU A;  4KSM A;  1M9B A;  4J56 E;  6GSX A;  3CTF A;  1GTU A;  3EMX A;  4DSS B;  5HFK A;  4WBR D;  1QMV A;  1H75 A;  1PX7 A;  1I5G A;  4ZBB A;  1Z9H A;  1A23 A;  1K0M A;  4IQ1 A;  4LMV A;  3UJ1 A;  4XS1 A;  5C00 A;  3GUR A;  1PSQ A;  3EYT A;  3ZIV A;  3PGT A;  2K8V A;  2CVK A;  4XS4 B;  2E2M A;  4WF5 A;  2P5Q A;  2DJ2 A;  2JZT A;  4ML1 A;  4K6X A;  1JZD A;  4EL1 A;  2B1L A;  4E8E A;  3IPZ A;  3TDG A;  2YJ7 A;  2XHF A;  3EU4 A;  5D8I A;  4OFT A;  3TOT A;  4PNF A;  4IJ3 A;  1NW2 A;  1EEJ A;  4HU7 A;  5B7C A;  4BPY A;  5DQY A;  4QQ7 A;  3CYN A;  1YDK A;  1V57 A;  4MPF A;  2C4J A;  4Z7X A;  3WD6 A;  3RPP A;  5HR3 A;  4GXZ A;  2MBS A;  2AAW A;  2C3N A;  1UA5 A;  2NPB A;  3VUR A;  3HCZ A;  2M72 A;  3QAW A;  5ECR B;  3C71 A;  3FZ9 A;  3V1W A;  1XW6 A;  4I6X A;  2VLU A;  1BYE A;  3LYK A;  3GV1 A;  2A2R A;  1F2E A;  4TR4 A;  1DSB A;  1OVN A;  1A2J A;  3IV4 A;  1MDJ A;  2O89 A;  2DIY A;  5C04 A;  1K0D A;  3F0I A;  4AGS A;  2WUL A;  1X5C A;  3MAK A;  2JAC A;  3TKR A;  5G5E A;  2R2J A;  1CQG A;  4MCU A;  3PIN A;  4TXO A;  1TU8 A;  2FD3 A;  1EGO A;  1SD8 A;  2QSI A;  3IA1 A;  3HJO A;  1PD2 1;  4L5O A;  4GCI A;  2EIO A;  2V2G A;  1XWC A;  1G6Y A;  2WCI A;  1G7E A;  2I4A A;  3ZLP A;  5AN1 A;  4I8B A;  13GS A;  2R37 A;  5HQP A;  4K9Z A;  1GUK A;  2IFQ A;  5FWG A;  3TCO A;  5J3R A;  4CW9 A;  4CDO A;  3W8S A;  6GSY A;  1ZZY A;  5DAK A;  2X8C A;  4ID0 A;  1GNE A;  4OCF A;  4OO5 A;  1XWG A;  4ZIJ A;  4FO5 A;  1GUH A;  1O8W A;  1K0B A;  1V98 A;  1JLV A;  3EWL A;  2EIQ A;  4QL7 A;  5B8B A;  2VD0 A;  1ERW A;  3IAM 2;  5IM9 A;  4E8H A;  3G7Y A;  1Z6N A;  1FHE A;  4HU9 A;  2GQL A;  3UIW A;  3UEM A;  4NHW A;  3O76 A;  2PVO C;  1VF4 A;  2GZP A;  4IHU A;  3I9V 2;  3APQ A;  4IP1 A;  1OKT A;  4HZ2 A;  4YQV A;  4HZ4 A;  4N30 A;  3TGZ A;  4NHZ A;  3IC4 A;  2H74 A;  4KCE A;  5ECL B;  3VI5 A;  1SK0 A;  1JFU A;  5J41 A;  1O8X A;  4YH2 A;  3KMN A;  2HE3 A;  5CRH A;  5G2Z A;  4F03 A;  4N11 A;  2YN1 A;  3BJ5 A;  3DIE A;  4JU5 A;  1NSW A;  1XCC A;  2EIR A;  2M80 A;  2CX4 A;  4TXV A;  1QFN A;  1SEN A;  1U6T A;  4KH7 A;  5FHI A;  1OC9 B;  4K0G A;  1QUW A;  4PQI A;  5COH A;  2OBI A;  3EVI A;  3F6D A;  3IRA A;  2CA8 A;  1QXH A;  3HKR A;  4IS0 A;  3HYP A;  2H71 A;  3UBK A;  2CAI A;  4V2L A;  2PUK C;  5CO3 A;  4XRD A;  2IWT A;  3Q19 A;  4MF5 A;  3GH9 A;  2YWM A;  1Y25 A;  1EV4 A;  2PN8 A;  5B6N A;  1JZR A;  3LXT A;  3EUR A;  5IOW A;  2AYT A;  4HEA 2;  3WGX A;  4ISD A;  1ZL9 A;  4LL1 B;  1R5A A;  4MDC A;  2VL2 A;  1PX6 A;  2VL2 C;  2ZCT A;  2PGT A;  5ECO B;  1MDK A;  3S9F A;  3F63 A;  3RBT A;  1ZYQ B;  4KND A;  8GSS A;  5DCG A;  1G6W A;  2F3M A;  2OKA A;  1GP1 A;  1AQW A;  2LQO A;  3FZ4 A;  3DXB A;  1OAZ A;  2LKU A;  4TOP A;  2NBS A;  1GSF A;  5ELG A;  4POK A;  3ISO A;  2DJJ A;  2F51 A;  2EC4 A;  2FY6 A;  1TW9 A;  2L5L A;  2B5X A;  5DAL B;  3MNG A;  4XCS A;  1GLQ A;  1KEB A;  4PGT A;  1THO A;  5E59 A;  5DJM A;  5J9B A;  2NDO A;  2I3Y A;  2VLV A;  1IYI A;  4G2E A;  4TW5 A;  1FB6 A;  2IJY A;  1EP7 A;  3ERG A;  2HZE B;  1SKR B;  4X1U A;  3VPQ A;  2DBC A;  3ZVJ D;  5HR2 A;  2JSZ A;  2O85 A;  1K0O A;  4OFN A;  1Z7R A;  4ZB9 A;  2P31 A;  2VL9 A;  2C80 A;  4ZL8 A;  1PMT A;  2REM A;  2YPM A;  1M2B A;  2H76 A;  3LFL A;  2HRN A;  3VI7 A;  3LGC A;  4F0C A;  2ALB A;  2VAF A;  1UC7 A;  2R4V A;  1I9D A;  5F0G A;  3IHQ A;  4ZBA A;  2B5E A;  3FR3 A;  4LA1 A;  4GF0 A;  4KA0 A;  3D0Z A;  2R6K A;  4L0U A;  1XWK A;  5JWO B;  4NWY A;  3ZVJ A;  4MZC A;  3LXZ A;  3GKN A;  4WR5 A;  1W89 A;  3W8J A;  3RDW A;  4ZB6 A;  3Q6O A;  2X99 A;  2I1U A;  1GSD A;  1M0U A;  4G9H A;  2VOC A;  2WJU A;  5HR0 A;  2TRX A;  4TR1 A;  1SL1 B;  2O8V B;  2YJH A;  3DGQ A;  4KDX A;  1BX9 A;  2H1D A;  4EC0 A;  3TJJ A;  4HJM A;  5ECS A;  5G5F A;  1B8X A;  2GSQ A;  3OR5 A;  5AIV A;  11GS A;  1KTE A;  2LV3 A;  1GSQ A;  2KOK A;  1WE0 A;  5GAN D;  2DMM A;  3P2A A;  2H75 A;  4DSQ A;  1MDI A;  2K6V A;  3GKM A;  1XWA A;  1T8E B;  5ECH B;  1M9A A;  2IN3 A;  1GL8 A;  4KDU A;  1SK1 A;  3KXO A;  3HJP A;  5ECP B;  1TRS A;  5IQY A;  3QAG A;  1XWB A;  1O81 A;  2IMK A;  3D22 A;  3QFA C;  4MP4 A;  2IMF A;  1T00 A;  4O32 A;  2VCZ A;  4BL7 A;  3GIX A;  2H01 A;  1GNW A;  1GTB A;  3ZZX A;  4KGI A;  3FEU A;  4BVX A;  1PQN A;  4YQM A;  3CSJ A;  2VM2 A;  3VWV A;  3TJF A;  3J7Y k;  3CSI A;  2E7P A;  1IYH A;  1XOA A;  2XC2 A;  2V41 A;  2GQM A;  3ERW A;  1FOV A;  2H19 A;  3FRC A;  3C8E A;  5JWR B;  4KCA A;  1Z5Y E;  4WKW A;  1SJ6 A;  2YV7 A;  2XBQ A;  4TXO B;  2OAC A;  5B8A A;  4ZXG A;  2YP6 A;  20GS A;  3LWA A;  4ZL7 A;  4TN8 A;  1SJZ A;  4OO4 A;  5DBQ A;  2BMX A;  1ERV A;  1SKW B;  1ERU A;  1T4Z A;  9GSS A;  4GQC A;  3CSH A;  5INY A;  4OMV A;  2LNS A;  2JZS A;  2O7K A;  1F6M C;  1EWX A;  4IVF A;  1EOG A;  1AC1 A;  4MH2 A;  5JCU A;  6GSW A;  2DJ0 A;  2IFQ B;  5IIZ A;  1GSS A;  3G7J A;  2HYX A;  5DAK B;  2HSH A;  1K3Y A;  2OAD A;  4XIH A;  1FVK A;  4N10 A;  2FCH A;  1KNG A;  3KH7 A;  1JZO A;  17GS A;  1GLP A;  4P3Y B;  14GS A;  1R26 A;  1Z7P A;  5AGY A;  3HZ4 A;  1S3D A;  1EGR A;  4F82 A;  2LTK A;  4MF6 A;  5HFG A;  4NPB A;  3TB2 A;  1O6J A;  2OE0 A;  3IOS A;  5H5R A;  4JE1 A;  3PR8 A;  2CZ3 A;  1GSU A;  3RHC A;  2GSR A;  3D4T A;  1HNA A;  2B7K A;  1ZCP A;  4MJC A;  2H72 A;  3HVX A;  5L71 A;  1AQX A;  4Q5F A;  2L4Q A;  1B4Q A;  2YZH A;  16GS A;  2GST A;  4K8M A;  1M2A A;  1YF1 A;  2GZY A;  4K2D A;  1HNB A;  3C7M A;  2VCQ A;  1KBN A;  4XTS A;  1PA3 A;  2CX3 A;  4EDZ A;  3M8N A;  2G0F A;  2YAN A;  1A8Y A;  4Q5R A;  3US3 A;  1ACV A;  3GST A;  1V40 A;  2N5F A;  2LQQ A;  3D5J A;  2QKE A;  2JSY A;  2GS3 A;  3HJM A;  3HVV A;  1B4P A;  4FYB A;  2VCV A;  2JU5 A;  3A3T A;  5JCW A;  1WOU A;  4BA7 A;  2YWN A;  3WT1 A;  2WS2 A;  2PWJ A;  2OBK A;  5ELA A;  3DKS A;  3H79 A;  1RQM A;  1MTC A;  2HZF A;  3GRX A;  2VO4 A;  3KTB A;  5GAP D;  3H1N A;  3FY7 A;  5KN2 A;  2HNL A;  2X8G A;  1TKD B;  4Q5Q A;  4TR0 A;  3WGE A;  1XW5 A;  3E9J B;  3K8N A;  4GSN A;  1TRW A;  3G9B A;  4MA9 A;  1QGV A;  4G19 A;  3BOA A;  5JWQ B;  3FYG A;  1BQ7 A;  1TRU A;  1U3I A;  4IJI A;  3LQ7 A;  3FR9 A;  5CRE A;  2M46 A;  1H4O A;  4F9Z A;  7GSS A;  4BWQ A;  3F3Q A;  5D93 A;  5D9X A;  1PL2 A;  4J57 E;  2V6O A;  4NV2 A;  2FWF A;  4NV5 A;  3ZRD A;  2J9H A;  3CRT A;  3ZFB A;  3QOU A;  4I97 A;  2LRC A;  3EC3 A;  1GSY A;  2P0G A;  2FGX A;  3APO A;  2B5Y A;  4HI7 A;  5D73 A;  1C72 A;  2HFD A;  5ECI B;  1GSE A;  1U88 A;  1PGT A;  4RQX A;  2CAQ A;  4ZB8 A;  4V2N A;  5FT3 A;  2DIZ A;  4MMM A;  1WJK A;  1ILO A;  5IMZ A;  2H0G A;  1TU7 A;  3GYK A;  4EE0 A;  1X9W B;  1SL0 B;  2P5R A;  5CRW A;  1AW9 A;  1THX A;  1NM3 A;  4HS1 A;  2L6C A;  2FWH A;  3EU3 A;  1ZYE A;  3BCI A;  1AUC A;  2RM6 A;  3QR6 A;  4BWS A;  4RI7 A;  1GTI A;  3WT2 A;  2AHE A;  4LL4 B;  3M1G A;  2F8A A;  4TR1 B;  2L6D A;  6GST A;  2MYG A;  19GS A;  4KB3 A;  2LJR A;  3DRN A;  3LEF A;  2CVB A;  4HOJ A;  10GS A;  5DCH A;  3KZQ A;  1TK8 B;  4GSS A;  2AUV A;  3I6A A;  1YZX A;  3F9U A;  1TP9 A;  3GMF A;  4MK3 A;  1TRV A;  1YQ1 A;  3M9K A;  4EVM A;  3WYW A;  3EIN A;  4WBJ A;  1RW1 A;  1A8L A;  4N0Z A;  3A2W A;  1R5P A;  4ZIL A;  2VLT A;  5CYY A;  4JBB A;  3QPM A;  3IR4 A;  3ZL5 A;  2DLX A;  4KUN A;  1N2A A;  3MWH A;  2NVL A;  1GH2 A;  2TIR A;  4IKH A;  1WPI A;  1K3L A;  2C0D A;  2JAD A;  1FW1 A;  2IMI A;  3RAZ A;  1SD9 A;  2OJL A;  2H6Z A;  1AQV A;  2WZ9 A;  1SKS B;  1GUM A;  3KH9 A;  4MAB A;  3APS A;  2MMN A;  5CRG A;  3A2V A;  1AIU A;  1SYX A;  4HDE A;  2CV4 A;  2DML A;  3GKX A;  4ML6 A;  5G1L A;  1T7P B;  4X43 A;  1U3A A;  3KD0 A;  1MEK A;  5GZZ B;  3TKS E;  2HRF A;  4ACS A;  3HZ8 A;  1YEX A;  2ZUP A;  3VK9 A;  1K3O A;  12GS A;  3IE3 A;  2L57 A;  4F0B A;  1JLW A;  3F4R A;  2GLR A;  3A5W A;  5LCZ A;  1YJ6 A;  3GKK A;  2DJ1 A;  3IXR A;  4EO3 A;  5CAX A;  2OE3 A;  1WRY A;  2BTO T;  2GQK A;  3UMA A;  3GN3 A;  1YKA A;  1A2M A;  3QFB C;  2ON5 A;  2YV9 A;  2AB6 A;  4OCE A;  3CBU A;  3VLN A;  5DJL A;  3GSS A;  1YKC A;  2C8U A;  1OC3 A;  1TK5 B;  1SL2 B;  4N0V A;  2YZU A;  2VCX A;  2MMO A;  2N5A A;  4FYU A;  1RK4 A;  4IW9 A;  3O6T A;  1M99 A;  5F8B A;  5F06 A;  5IO0 A;  2IMD A;  3N5O A;  4MF7 A;  5A4V A;  5B6M A;  3UL3 A;  3ERF A;  1XOB A;  2H0I A;  2VM1 A;  1EZK A;  1S3C A;  4DEJ A;  2LNT A;  1T3B A;  1QQ2 A;  1W4V A;  2GZZ A;  1GWC A;  2WDU A;  1J0F A;  5AIX A;  1BJX A;  1SJI A;  2DJ3 A;  5F05 A;  1DUG A;  1O85 A;  4GLT A;  4PUR A;  3CTG A;  4YAV A;  3A2X A;  1A2L A;  4NXI A;  2YCD A;  4ECI A;  6GSS A;  2WFC A;  2XBI A;  1OKD A;  2MMZ A;  1ST9 A;  4JZQ A;  2IL3 A;  3M0F A;  3CRU A;  1OE7 A;  4XHM A;  1X0R A;  2PU9 C;  4J2F A;  2ES7 A;  5E4W A;  4FIW A;  3SWL A;  4GTU A;  2GTU A;  1WWJ A;  4PQ1 A;  4ZL9 A;  3UVH A;  3GTU A;  3FW2 A;  2JL4 A;  3TKQ A;  5IPG A;  2F9S A;  1TK0 B;  1USB A;  2C3T A;  3VWW A;  1T4Y A;  3DD3 A;  3GX8 A;  5DDL A;  4IGJ A;  3ZTL A;  2FA8 A;  1TOF A;  1X5D A;  4K7I A;  4GRF A;  2V6K A;  1SYR A;  1VF3 A;  3EMP A;  1TI3 A;  1TXX A;  5ECN B;  4MJA A;  4MJB A;  1VF2 A;  4GST A;  3KMO A;  5GST A;  4RQR A;  5ECM B;  4GQF A;  3CXG A;  5IOX A;  3TKP A;  2WB9 A;  2MMA A;  4K1F A;  3DVX A;  1NHY A;  1WP0 A;  1PKZ A;  2KHP A;  1R7H A;  4DSR A;  4ULX A;  2R3X A;  4TVE A;  1OYJ A;  2B3S A;  4GWR A;  4IBP A;  4POL A;  1OE8 A;  3GA4 A;  1PRX A;  1B9X C;  1G0T A;  3FR6 A;  4AJ8 A;  1XIY A;  4WF4 A;  1X9M B;  4JR6 A;  1BAY A;  3VFI A;  3GNJ A;  3KM6 A;  4WEY A;  2TRC P;  2K18 A;  3P8W A;  3DYR A;  4D73 A;  3F4T A;  4FH8 A;  3NZN A;  4HQS A;  1Z3E A;  3JCM L;  1TTZ A;  3IK7 A;  1V9W A;  4I2U A;  3GHA A;  1Q4J A;  1SU9 A;  3G7I A;  1M2D A;  3TUE A;  3F4S A;  3BBY A;  5ABR A;  2LJK A;  5H5Q A;  2MBT A;  3BD2 A;  5D9T A;  5IMF A;  2GT5 A;  3DVW A;  3H4K A;  1UVZ A;  1EV9 A;  4PXO A;  5DVB A;  2JZR A;  2H30 A;  4KSO A;  4XS6 A;  5IPH A;  3L9S A;  2RII A;  2C0E A;  1HYU A;  1F9M A;  1BG5 A;  3Q18 A;  1VRS D;  1ZGN A;  2H6X A;  5KEJ A;  3R2Q A;  1K0C A;  4MJE A;  2FWE A;  3FK8 A;  4JRR A;  5KN3 A;  4IP6 A;  2E2G A;  1Z6M A;  3I43 A;  3AY8 A;  1WMJ A;  3P7X A;  3GH6 A;  4POM A;  5IO2 A;  3J7Y b;  2CZ2 A;  2X8H A;  2BJX A;  1O7U A;  1AAZ A;  4K7N A;  2HLS A;  2IIY A;  3U6V A;  2RUF A;  2X64 A;  1NHO A;  3BCK A;  4HQZ A;  2FNO A;  3IAS 2;  5EVO A;  2I9H A;  3KGK A;  3L0H A;  1MD4 A;  1F3A A;  2O87 A;  2K8S A;  1XW9 A;  1U87 A;  4JR4 A;  4HJ2 A;  3TJG A;  4I5Q A;  5KN0 A;  3ZRE A;  2H66 A;  2VCW A;  3KJY A;  5CNW A;  3MSZ A;  2LUS A; 
#chains in the Genus database with same CATH topology
 2Z9S A;  5ID2 A;  4ECJ A;  4O5U A;  2C1Y A;  4O5R A;  1SK2 A;  3FZ5 A;  2WRT A;  3F3R A;  2L4C A;  3L4N A;  2GVP A;  1OC8 A;  2GSS A;  2WGR A;  3HD5 A;  4HUA A;  1PL1 A;  5IMC A;  3KP9 A;  1A24 A;  2H1A A;  1VGL A;  2PER A;  3HA9 A;  5HR1 A;  2I81 A;  3TKS A;  3TKS C;  1HQO A;  2A2S A;  4WR4 A;  5AIS A;  5EY6 A;  3GFK A;  1TDI A;  1X9S B;  5A4W A;  4A5P A;  3ZYW A;  2A4V A;  3LOR A;  4L8E A;  4O92 A;  6GSU A;  2L59 A;  3FKF A;  4DSS A;  1ON4 A;  5ECK B;  1JHB A;  4YQU A;  1FO5 A;  2E0Q A;  4PNG A;  3KCM A;  2LEG A;  2NTO A;  5IMD A;  2DC5 A;  1K0A A;  3IK9 A;  4OD7 A;  1K0N A;  4MPG A;  1DE2 A;  2VUP A;  3H8Q A;  3QD9 A;  4CY6 A;  2YWI A;  2H1G A;  2OA7 A;  2DJK A;  2QC7 A;  4XS4 A;  3ZML A;  1V2A A;  2KLX A;  1ZMA A;  4MZW A;  4EUY A;  3D4M A;  4V1A p;  1XZO A;  1F37 A;  3UBL A;  4KDY A;  2F8F A;  4PQH A;  2R0C A;  4PX1 A;  5EPF A;  5KN1 A;  3C1S A;  1ERT A;  1XVQ A;  4G0I A;  1ZOF A;  4ZBD A;  4IQA A;  3N9J A;  2XPD A;  3D21 A;  3DEX A;  3F8U A;  3HDC A;  1ML6 A;  1PKW A;  3ZMK A;  3P90 A;  1FVJ A;  4G0K A;  2KUC A;  1T1V A;  1PN9 A;  3KP8 A;  2H73 A;  4MLY A;  2GGT A;  3F6F A;  5G30 A;  1EEM A;  2H1B A;  2C0F A;  1HNC A;  3E3E A;  2C3Q A;  2FHE A;  2R5G A;  1R4W A;  1CQH A;  1URM A;  2K9F A;  3ME8 A;  2FWG A;  1XBS A;  4LMW A;  4WXT A;  4TR3 A;  3QAV A;  1GUL A;  1QK8 A;  2PMT A;  3DWV A;  2H0H A;  1N8J A;  2LST A;  3GUS A;  2LS5 A;  3GTU B;  3HHV A;  3RPN A;  3LSZ A;  2RM5 A;  4YAP A;  3GX0 A;  1YF0 A;  3M9J A;  3EE2 A;  4IEL A;  3UOM A;  1J9B A;  4DVC A;  4PTS A;  3KEB A;  4X4J A;  5JCG A;  1G7O A;  1VF1 A;  2B7J A;  5F07 A;  4K7O A;  2DKI A;  2C0G A;  2YNX A;  3D6I A;  4ECC A;  4BVY A;  1LU4 A;  3L9U A;  4Z2T A;  3I69 A;  5H5S A;  5IMA A;  3UAR A;  3LYP A;  2KP1 A;  3ED3 A;  1O73 A;  3QMX A;  2V32 A;  4XRA A;  4L0W A;  2QGV A;  18GS A;  1AXD A;  2IPA A;  4MZB A;  2VIM A;  2LRT A;  4KAE A;  3KTL A;  2N5B A;  2CQ9 A;  3PH9 A;  3IDV A;  2IME A;  1XXU A;  1GRX A;  2OE1 A;  1M7T A;  4KW6 A;  2CVD A;  3TRP A;  3ZIT A;  5G31 A;  2CT6 A;  4V2M A;  3SBC A;  5J9C A;  2PVQ A;  2HI7 A;  1E2Y A;  2FUG 2;  1WIK A;  1EOH A;  4K0N A;  5A5K A;  2VCT A;  5GSS A;  2B1K A;  3UVT A;  2ZNM A;  5D96 A;  3M3M A;  2PPT A;  3TJB A;  5ECQ B;  2AV4 A;  1FB0 A;  5CP1 A;  3H93 A;  2L5O A;  2V1M A;  3ZIJ A;  1EP8 A;  4WET A;  2VL3 A;  3MDK A;  4EF0 A;  4D73 B;  4QL9 A;  5BMU A;  3NIV A;  4AJ6 A;  4F2I A;  3RHB A;  3E0U A;  4V1A g;  3IBH A;  3GL5 A;  4I2T A;  5ENU A;  5LD0 A;  2H6Y A;  2HXK A;  4AF2 A;  2VD1 A;  4K2X A;  2HSY A;  3C73 A;  2ON7 A;  1Q98 A;  2DSA A;  3KIJ A;  2PBJ A;  1ABA A;  1FAA A;  2H8L A;  4PUF C;  1LJR A;  4Q5N A;  3FZA A;  4KE3 A;  4NAX A;  1B48 A;  1BED A;  4JED A;  5D9V A;  3VWU A;  3L9V A;  1HD2 A;  1FG4 A;  4L5L A;  2B6M A;  4EXJ A;  5EL8 A;  3LJR A;  4ILF A;  4RI6 A;  2FLS A;  1OC9 A;  2AJQ B;  1V58 A;  4X0X A;  4OWY A;  4H86 A;  2H70 A;  4CHS A;  4POB A;  1LBK A;  4EKZ A;  1YEP A;  5HFI A;  1F3B A;  2XPE A;  22GS A;  3CMI A;  4MH3 A;  3LG6 A;  3QCP A;  1Y6E A;  3L78 A;  3WGD A;  5J5N A;  3ZFL A;  2GT6 A;  3HXS A;  4TKY A;  1UN2 A;  1TI1 A;  4IN0 A;  2MZC A;  3FHK A;  3Q74 A;  3TRX A;  5DQS A;  2LJA A;  2QA2 A;  1XPV A;  1DBY A;  5A4U A;  2YOI A;  1B9Y C;  1MD3 A;  2LRN A;  5IMV A;  1A0R P;  2X49 A;  3DML A;  2GDR A;  3QDN A;  3UAP A;  3HVS A;  5CRD A;  1GTA A;  4RUV A;  2FA4 A;  5DAL A;  1A0F A;  4EDY A;  5KOW A;  6GSV A;  4PUA A;  1XFL A;  1TJD A;  3TJK A;  3W6G A;  5LNK e;  3HY2 A;  1X5E A;  4AJ7 A;  3GL3 A;  4O7H A;  5ID2 B;  5J4U A;  2D2Z A;  2J23 A;  5G1K A;  4TRX A;  2RUE A;  2G2Q A;  3C1R A;  3VPT A;  2HZE A;  4FYC A;  2RLI A;  2HT9 A;  4LLR A;  4KX4 A;  2YWO A;  1XVW A;  5D9W A;  4ECB A;  3NOF A;  3TOU A;  1S3A A;  3ME7 A;  4G10 A;  2KP2 A;  1DE1 A;  4OFM A;  1E6B A;  1YY7 A;  3U5R E;  1JZW A;  3TRQ A;  1J08 A;  3O3T A;  3VWX A;  4NMU A;  4KSM A;  1M9B A;  4J56 E;  6GSX A;  3CTF A;  1GTU A;  3EMX A;  4DSS B;  5HFK A;  4WBR D;  1QMV A;  1H75 A;  1PX7 A;  1I5G A;  4ZBB A;  1Z9H A;  1A23 A;  1K0M A;  4IQ1 A;  4LMV A;  3UJ1 A;  4XS1 A;  5C00 A;  3GUR A;  1PSQ A;  3EYT A;  3ZIV A;  3PGT A;  2K8V A;  2CVK A;  4XS4 B;  2E2M A;  4WF5 A;  2P5Q A;  2DJ2 A;  2JZT A;  4ML1 A;  4K6X A;  1JZD A;  4EL1 A;  2B1L A;  4E8E A;  3IPZ A;  3TDG A;  2YJ7 A;  2XHF A;  3EU4 A;  5D8I A;  4OFT A;  3TOT A;  4PNF A;  4IJ3 A;  1NW2 A;  1EEJ A;  4YKF A;  4HU7 A;  5B7C A;  4BPY A;  5DQY A;  4QQ7 A;  3CYN A;  1YDK A;  1V57 A;  4MPF A;  2C4J A;  4Z7X A;  3WD6 A;  3RPP A;  5HR3 A;  4GXZ A;  2MBS A;  2AAW A;  2C3N A;  1UA5 A;  2NPB A;  3VUR A;  3HCZ A;  2M72 A;  3QAW A;  5ECR B;  3C71 A;  3FZ9 A;  3V1W A;  1XW6 A;  4I6X A;  1XG8 A;  2VLU A;  1BYE A;  3LYK A;  3GV1 A;  2A2R A;  1F2E A;  4TR4 A;  1DSB A;  1OVN A;  1A2J A;  4Z2R A;  3IV4 A;  1MDJ A;  2O89 A;  2DIY A;  4BVY B;  5C04 A;  1K0D A;  3F0I A;  4AGS A;  2WUL A;  1X5C A;  3MAK A;  2JAC A;  3TKR A;  5G5E A;  2R2J A;  1CQG A;  4MCU A;  3PIN A;  4TXO A;  1TU8 A;  2FD3 A;  1EGO A;  1SD8 A;  2QSI A;  3IA1 A;  2X4A A;  3HJO A;  1PD2 1;  4L5O A;  4GCI A;  2EIO A;  2V2G A;  1XWC A;  1M3I A;  1G6Y A;  2WCI A;  1G7E A;  2I4A A;  3ZLP A;  5AN1 A;  4I8B A;  13GS A;  2R37 A;  5HQP A;  4K9Z A;  3MIX A;  1GUK A;  2IFQ A;  5FWG A;  3TCO A;  5J3R A;  4CW9 A;  4CDO A;  4K5R A;  3W8S A;  6GSY A;  1ZZY A;  5DAK A;  2X8C A;  4ID0 A;  1GNE A;  4OCF A;  4OO5 A;  1XWG A;  4ZIJ A;  4FO5 A;  1GUH A;  1O8W A;  1K0B A;  1V98 A;  1JLV A;  3EWL A;  2EIQ A;  4QL7 A;  5B8B A;  2VD0 A;  1ERW A;  3IAM 2;  5IM9 A;  4E8H A;  3G7Y A;  1Z6N A;  1FHE A;  4HU9 A;  2GQL A;  3UIW A;  3UEM A;  4NHW A;  3O76 A;  2PVO C;  1VF4 A;  2GZP A;  4IHU A;  1ZYP A;  3I9V 2;  3APQ A;  4IP1 A;  1OKT A;  4HZ2 A;  4YQV A;  4HZ4 A;  4N30 A;  3TGZ A;  4NHZ A;  3IC4 A;  2H74 A;  4KCE A;  5ECL B;  3VI5 A;  2HSM A;  1SK0 A;  1JFU A;  5J41 A;  1O8X A;  4YH2 A;  3KMN A;  2HE3 A;  5CRH A;  5G2Z A;  4F03 A;  4N11 A;  2YN1 A;  3BJ5 A;  3DIE A;  4JU5 A;  1NSW A;  1XCC A;  2EIR A;  2M80 A;  2CX4 A;  4TXV A;  1QFN A;  1SEN A;  1U6T A;  4KH7 A;  3PPU A;  5FHI A;  1OC9 B;  4K0G A;  1QUW A;  4PQI A;  5COH A;  2OBI A;  3EVI A;  3F6D A;  1PN0 A;  3IRA A;  2CA8 A;  1QXH A;  3HKR A;  4IS0 A;  3HYP A;  2H71 A;  3UBK A;  2CAI A;  4V2L A;  2PUK C;  5CO3 A;  4CY8 A;  4XRD A;  2IWT A;  3Q19 A;  4MF5 A;  3GH9 A;  2YWM A;  1Y25 A;  1EV4 A;  2PN8 A;  5B6N A;  1JZR A;  3LXT A;  3EUR A;  5IOW A;  2AYT A;  4HEA 2;  3WGX A;  4ISD A;  1ZL9 A;  4LL1 B;  1R5A A;  4MDC A;  2VL2 A;  1PX6 A;  2VL2 C;  2ZCT A;  2PGT A;  5ECO B;  1MDK A;  3S9F A;  3F63 A;  3RBT A;  1ZYQ B;  4KND A;  8GSS A;  5DCG A;  1G6W A;  2F3M A;  2OKA A;  1GP1 A;  1AQW A;  2LQO A;  3FZ4 A;  3DXB A;  1OAZ A;  2LKU A;  4TOP A;  2NBS A;  1GSF A;  5ELG A;  4POK A;  3ISO A;  2DJJ A;  2F51 A;  2EC4 A;  2FY6 A;  1TW9 A;  2L5L A;  2B5X A;  5DAL B;  3MNG A;  4XCS A;  1GLQ A;  1KEB A;  4PGT A;  1THO A;  5E59 A;  5DJM A;  2R0G A;  2NDO A;  2I3Y A;  5J9B A;  2VLV A;  1IYI A;  4G2E A;  4TW5 A;  1FB6 A;  2IJY A;  1EP7 A;  4EIP A;  3ERG A;  2HZE B;  1SKR B;  4X1U A;  3VPQ A;  2DBC A;  3ZVJ D;  5HR2 A;  2JSZ A;  2O85 A;  1K0O A;  4OFN A;  1Z7R A;  4ZB9 A;  2P31 A;  2VL9 A;  4USS A;  2C80 A;  4ZL8 A;  1PMT A;  2REM A;  2YPM A;  1M2B A;  2H76 A;  3LFL A;  2HRN A;  3VI7 A;  3LGC A;  4F0C A;  2ALB A;  2VAF A;  1UC7 A;  2R4V A;  1I9D A;  5F0G A;  3IHQ A;  4ZBA A;  2B5E A;  3FR3 A;  4LA1 A;  4GF0 A;  4KA0 A;  3D0Z A;  2R6K A;  4L0U A;  1XWK A;  5JWO B;  4NWY A;  3ZVJ A;  4MZC A;  3LXZ A;  3GKN A;  4WR5 A;  1W89 A;  3W8J A;  3RDW A;  4ZB6 A;  3Q6O A;  2X99 A;  2I1U A;  1GSD A;  1M0U A;  4G9H A;  2VOC A;  2WJU A;  5HR0 A;  2TRX A;  4TR1 A;  1SL1 B;  2O8V B;  2YJH A;  3DGQ A;  4KDX A;  1BX9 A;  2H1D A;  4EC0 A;  3TJJ A;  4HJM A;  3R3E A;  5ECS A;  5G5F A;  1B8X A;  2GSQ A;  3OR5 A;  5AIV A;  11GS A;  1KTE A;  2LV3 A;  4HSC X;  1GSQ A;  2KOK A;  1WE0 A;  5GAN D;  2DMM A;  3P2A A;  2H75 A;  4DSQ A;  1MDI A;  2K6V A;  3GKM A;  1XWA A;  1T8E B;  5ECH B;  1M9A A;  2IN3 A;  1GL8 A;  4KDU A;  1SK1 A;  3KXO A;  3FMW A;  3HJP A;  5ECP B;  1TRS A;  5IQY A;  3QAG A;  1XWB A;  1O81 A;  2IMK A;  3D22 A;  3QFA C;  4MP4 A;  2IMF A;  1T00 A;  1ZYN A;  4O32 A;  2VCZ A;  4BL7 A;  3GIX A;  2H01 A;  1GNW A;  1GTB A;  4MNN A;  3ZZX A;  4KGI A;  3FEU A;  4BVX A;  1PQN A;  4YQM A;  3CSJ A;  2VM2 A;  3VWV A;  3TJF A;  3J7Y k;  3CSI A;  2E7P A;  1IYH A;  1XOA A;  2XC2 A;  2V41 A;  2GQM A;  3ERW A;  1FOV A;  2H19 A;  3FRC A;  3C8E A;  5JWR B;  4K5S A;  4KCA A;  1Z5Y E;  4WKW A;  1SJ6 A;  2YV7 A;  2XBQ A;  4TXO B;  2OAC A;  5B8A A;  4ZXG A;  2YP6 A;  20GS A;  3LWA A;  4ZL7 A;  4TN8 A;  1SJZ A;  4OO4 A;  5DBQ A;  2BMX A;  1ERV A;  1SKW B;  1ERU A;  1T4Z A;  9GSS A;  4GQC A;  3CSH A;  5INY A;  2DKH A;  4OMV A;  2LNS A;  2JZS A;  2O7K A;  1F6M C;  1EWX A;  4IVF A;  1EOG A;  1AC1 A;  4MH2 A;  3IHG A;  5JCU A;  6GSW A;  2DJ0 A;  2IFQ B;  5IIZ A;  1GSS A;  3G7J A;  2HYX A;  5DAK B;  2HSH A;  1K3Y A;  2OAD A;  4XIH A;  1FVK A;  4N10 A;  2FCH A;  1KNG A;  3KH7 A;  1JZO A;  17GS A;  1GLP A;  4P3Y B;  14GS A;  1R26 A;  1Z7P A;  5AGY A;  3HZ4 A;  1M3J A;  1S3D A;  1EGR A;  4F82 A;  2LTK A;  4ICY A;  4MF6 A;  4NPB A;  5HFG A;  3TB2 A;  1O6J A;  2OE0 A;  3IOS A;  5H5R A;  4JE1 A;  3PR8 A;  2CZ3 A;  1GSU A;  3RHC A;  2GSR A;  3D4T A;  1HNA A;  2B7K A;  1ZCP A;  4MJC A;  2H72 A;  3HVX A;  5L71 A;  1AQX A;  4Q5F A;  2L4Q A;  1B4Q A;  2YZH A;  16GS A;  2GST A;  4K8M A;  1M2A A;  1YF1 A;  2GZY A;  4K2D A;  1HNB A;  3C7M A;  4O5Q A;  2VCQ A;  1KBN A;  4XTS A;  1PA3 A;  2CX3 A;  4EDZ A;  3M8N A;  2G0F A;  2YAN A;  1A8Y A;  4Q5R A;  3US3 A;  1ACV A;  3GST A;  1V40 A;  2N5F A;  2LQQ A;  3D5J A;  2QKE A;  2JSY A;  2GS3 A;  3HJM A;  3HVV A;  1B4P A;  4FYB A;  2VCV A;  2JU5 A;  3A3T A;  5JCW A;  1WOU A;  4BA7 A;  2YWN A;  3WT1 A;  2WS2 A;  2PWJ A;  3CQF A;  2OBK A;  5ELA A;  3DKS A;  3H79 A;  1RQM A;  1MTC A;  2HZF A;  3GRX A;  2VO4 A;  3KTB A;  5GAP D;  3H1N A;  3FY7 A;  5KN2 A;  2HNL A;  2X8G A;  1TKD B;  4Q5Q A;  4TR0 A;  3WGE A;  1XW5 A;  3E9J B;  3K8N A;  4GSN A;  1TRW A;  3G9B A;  4MA9 A;  1QGV A;  4G19 A;  3BOA A;  5JWQ B;  3FYG A;  1BQ7 A;  1TRU A;  1U3I A;  4IJI A;  3LQ7 A;  3FR9 A;  5CRE A;  2M46 A;  1H4O A;  4F9Z A;  7GSS A;  3A5I A;  4BWQ A;  3F3Q A;  5D93 A;  5D9X A;  1PL2 A;  4J57 E;  2V6O A;  4NV2 A;  2FWF A;  4NV5 A;  3ZRD A;  2J9H A;  3CRT A;  3ZFB A;  3QOU A;  4I97 A;  2LRC A;  3EC3 A;  1GSY A;  2P0G A;  2FGX A;  3APO A;  2B5Y A;  4HI7 A;  5D73 A;  1C72 A;  2HFD A;  5ECI B;  4FQU A;  3EPT A;  1GSE A;  1U88 A;  1PGT A;  4RQX A;  2CAQ A;  4ZB8 A;  4V2N A;  5FT3 A;  2A2P A;  2DIZ A;  4MMM A;  1WJK A;  1ILO A;  5IMZ A;  2H0G A;  1TU7 A;  3GYK A;  4EE0 A;  1X9W B;  1SL0 B;  2P5R A;  5CRW A;  1AW9 A;  1THX A;  1NM3 A;  4HS1 A;  2L6C A;  2FWH A;  3EU3 A;  1ZYE A;  3BCI A;  1AUC A;  2RM6 A;  3QR6 A;  4BWS A;  4RI7 A;  1GTI A;  3WT2 A;  2AHE A;  4LL4 B;  3M1G A;  2F8A A;  4TR1 B;  2L6D A;  6GST A;  2MYG A;  19GS A;  4KB3 A;  2LJR A;  3DRN A;  3LEF A;  2CVB A;  4HOJ A;  10GS A;  5DCH A;  3KZQ A;  1TK8 B;  4GSS A;  2AUV A;  3I6A A;  1YZX A;  3F9U A;  1TP9 A;  2A4H A;  3LW9 A;  3GMF A;  4MK3 A;  1TRV A;  1YQ1 A;  3M9K A;  4EVM A;  3WYW A;  3EIN A;  4WBJ A;  1RW1 A;  1A8L A;  4N0Z A;  3A2W A;  1R5P A;  4ZIL A;  2VLT A;  5CYY A;  4JBB A;  3QPM A;  3IR4 A;  3ZL5 A;  2DLX A;  4KUN A;  1N2A A;  3MWH A;  2NVL A;  1GH2 A;  2TIR A;  4IKH A;  1WPI A;  1K3L A;  2C0D A;  2JAD A;  1FW1 A;  2IMI A;  3RAZ A;  1SD9 A;  2OJL A;  2H6Z A;  1AQV A;  2WZ9 A;  4BL7 B;  1SKS B;  1GUM A;  3KH9 A;  4MAB A;  3APS A;  2MMN A;  5CRG A;  3A2V A;  1AIU A;  1SYX A;  4HDE A;  2CV4 A;  2DML A;  3GKX A;  4ML6 A;  5G1L A;  1T7P B;  4X43 A;  4BVX B;  1U3A A;  3KD0 A;  1MEK A;  5GZZ B;  3TKS E;  2HRF A;  2QA1 A;  4ACS A;  3HZ8 A;  1YEX A;  2ZUP A;  3VK9 A;  1K3O A;  12GS A;  3IE3 A;  2L57 A;  4F0B A;  1JLW A;  3F4R A;  4YKG A;  2GLR A;  3A5W A;  5LCZ A;  1YJ6 A;  3GKK A;  2DJ1 A;  3IXR A;  4EO3 A;  5CAX A;  2OE3 A;  1WRY A;  2BTO T;  2GQK A;  2UZ8 A;  3UMA A;  3GN3 A;  1YKA A;  1A2M A;  3QFB C;  2ON5 A;  2YV9 A;  2AB6 A;  4OCE A;  3CBU A;  3VLN A;  5DJL A;  3GSS A;  1YKC A;  2C8U A;  1OC3 A;  1TK5 B;  1SL2 B;  4N0V A;  2YZU A;  2VCX A;  2MMO A;  2N5A A;  4FYU A;  1RK4 A;  4IW9 A;  3O6T A;  1M99 A;  5F8B A;  5F06 A;  5IO0 A;  2IMD A;  3N5O A;  4MF7 A;  5A4V A;  5B6M A;  3UL3 A;  3ERF A;  1XOB A;  1S3R A;  2H0I A;  2VM1 A;  1EZK A;  1S3C A;  4DEJ A;  2LNT A;  1T3B A;  1QQ2 A;  1W4V A;  2GZZ A;  1GWC A;  2WDU A;  1J0F A;  5AIX A;  1BJX A;  1SJI A;  2DJ3 A;  5F05 A;  1DUG A;  1O85 A;  4KF9 A;  4GLT A;  4PUR A;  3CTG A;  4YAV A;  3A2X A;  1A2L A;  4NXI A;  2YCD A;  4ECI A;  6GSS A;  2WFC A;  2XBI A;  5BRT A;  4EIQ A;  1OKD A;  2MMZ A;  1ST9 A;  4JZQ A;  2IL3 A;  3M0F A;  3CRU A;  1OE7 A;  4XHM A;  1X0R A;  2PU9 C;  4J2F A;  4BIK A;  2ES7 A;  5E4W A;  4FIW A;  3SWL A;  4GTU A;  2GTU A;  1WWJ A;  4PQ1 A;  4ZL9 A;  3UVH A;  3GTU A;  3FW2 A;  2JL4 A;  3TKQ A;  5IPG A;  2F9S A;  1TK0 B;  1USB A;  2C3T A;  3VWW A;  1T4Y A;  3DD3 A;  4Z2U A;  3GX8 A;  5DDL A;  4IGJ A;  3ZTL A;  2FA8 A;  1TOF A;  1X5D A;  4K7I A;  1PFO A;  4GRF A;  2V6K A;  1SYR A;  1VF3 A;  3EMP A;  1TI3 A;  1TXX A;  5ECN B;  4MJA A;  4MJB A;  1VF2 A;  4GST A;  3KMO A;  5GST A;  4RQR A;  5ECM B;  4GQF A;  4G0L A;  3CXG A;  5IOX A;  3TKP A;  2WB9 A;  2MMA A;  4K1F A;  3DVX A;  1NHY A;  1WP0 A;  1PKZ A;  2KHP A;  1R7H A;  4DSR A;  4ULX A;  2R3X A;  4TVE A;  1OYJ A;  2B3S A;  2R0P A;  4GWR A;  4IBP A;  4POL A;  1OE8 A;  3GA4 A;  1PRX A;  1B9X C;  1G0T A;  3FR6 A;  4AJ8 A;  1XIY A;  4WF4 A;  1X9M B;  4JR6 A;  1BAY A;  3VFI A;  3GNJ A;  3KM6 A;  4WEY A;  2TRC P;  2K18 A;  3P8W A;  3DYR A;  4D73 A;  3F4T A;  4FH8 A;  3NZN A;  4HQS A;  1Z3E A;  3JCM L;  1TTZ A;  3IK7 A;  1V9W A;  4I2U A;  3GHA A;  1Q4J A;  1SU9 A;  3G7I A;  1M2D A;  3TUE A;  3F4S A;  3HVN A;  3BBY A;  5ABR A;  2LJK A;  5H5Q A;  2MBT A;  3BD2 A;  5D9T A;  5IMF A;  2GT5 A;  3DVW A;  3H4K A;  1UVZ A;  1EV9 A;  4PXO A;  5DVB A;  2JZR A;  2H30 A;  4KSO A;  4XS6 A;  5IPH A;  3L9S A;  2RII A;  2C0E A;  1HYU A;  1F9M A;  1BG5 A;  3Q18 A;  1VRS D;  1ZGN A;  2H6X A;  5KEJ A;  3R2Q A;  1K0C A;  4MJE A;  2FWE A;  3FK8 A;  4JRR A;  5KN3 A;  4IP6 A;  3MYD A;  2E2G A;  1Z6M A;  3I43 A;  3AY8 A;  1WMJ A;  3P7X A;  3GH6 A;  4POM A;  5IO2 A;  3J7Y b;  2CZ2 A;  2X8H A;  2BJX A;  1O7U A;  1AAZ A;  4K7N A;  2HLS A;  2IIY A;  3U6V A;  2RUF A;  2X64 A;  1NHO A;  3BCK A;  4HQZ A;  2FNO A;  3IAS 2;  5EVO A;  2I9H A;  2HRA A;  3KGK A;  3L0H A;  1MD4 A;  1F3A A;  2O87 A;  2K8S A;  1XW9 A;  1U87 A;  4JR4 A;  1FOH A;  4HJ2 A;  3TJG A;  4I5Q A;  5KN0 A;  3IC8 A;  3ZRE A;  2H66 A;  2VCW A;  5KOX A;  2HRK A;  3KJY A;  5CNW A;  3MSZ A;  2LUS A; 
#chains in the Genus database with same CATH homology
 2Z9S A;  5ID2 A;  4ECJ A;  4O5U A;  2C1Y A;  4O5R A;  1SK2 A;  3FZ5 A;  2WRT A;  3F3R A;  2L4C A;  3L4N A;  2GVP A;  1OC8 A;  2GSS A;  2WGR A;  3HD5 A;  4HUA A;  1PL1 A;  5IMC A;  3KP9 A;  1A24 A;  2H1A A;  1VGL A;  2PER A;  3HA9 A;  5HR1 A;  2I81 A;  3TKS A;  3TKS C;  1HQO A;  2A2S A;  4WR4 A;  5AIS A;  5EY6 A;  3GFK A;  1TDI A;  1X9S B;  5A4W A;  4A5P A;  3ZYW A;  2A4V A;  3LOR A;  4L8E A;  4O92 A;  6GSU A;  2L59 A;  3FKF A;  4DSS A;  1ON4 A;  5ECK B;  1JHB A;  4YQU A;  1FO5 A;  2E0Q A;  4PNG A;  3KCM A;  2LEG A;  2NTO A;  5IMD A;  2DC5 A;  1K0A A;  3IK9 A;  4OD7 A;  1K0N A;  4MPG A;  1DE2 A;  2VUP A;  3H8Q A;  3QD9 A;  4CY6 A;  2YWI A;  2H1G A;  2OA7 A;  2DJK A;  2QC7 A;  4XS4 A;  3ZML A;  1V2A A;  2KLX A;  1ZMA A;  4MZW A;  4EUY A;  3D4M A;  4V1A p;  1XZO A;  1F37 A;  3UBL A;  4KDY A;  2F8F A;  4PQH A;  2R0C A;  4PX1 A;  5EPF A;  5KN1 A;  3C1S A;  1ERT A;  1XVQ A;  4G0I A;  1ZOF A;  4ZBD A;  4IQA A;  3N9J A;  2XPD A;  3D21 A;  3DEX A;  3F8U A;  3HDC A;  1ML6 A;  1PKW A;  3ZMK A;  3P90 A;  1FVJ A;  4G0K A;  2KUC A;  1T1V A;  1PN9 A;  3KP8 A;  2H73 A;  4MLY A;  2GGT A;  3F6F A;  5G30 A;  1EEM A;  2H1B A;  2C0F A;  1HNC A;  3E3E A;  2C3Q A;  2FHE A;  2R5G A;  1R4W A;  1CQH A;  1URM A;  2K9F A;  3ME8 A;  2FWG A;  1XBS A;  4LMW A;  4WXT A;  4TR3 A;  3QAV A;  1GUL A;  1QK8 A;  2PMT A;  3DWV A;  2H0H A;  1N8J A;  2LST A;  3GUS A;  2LS5 A;  3GTU B;  3HHV A;  3RPN A;  3LSZ A;  2RM5 A;  4YAP A;  3GX0 A;  1YF0 A;  3M9J A;  3EE2 A;  4IEL A;  3UOM A;  1J9B A;  4DVC A;  4PTS A;  3KEB A;  4X4J A;  5JCG A;  1G7O A;  1VF1 A;  2B7J A;  5F07 A;  4K7O A;  2DKI A;  2C0G A;  2YNX A;  3D6I A;  4ECC A;  4BVY A;  1LU4 A;  3L9U A;  4Z2T A;  3I69 A;  5H5S A;  5IMA A;  3UAR A;  3LYP A;  2KP1 A;  3ED3 A;  1O73 A;  3QMX A;  2V32 A;  4XRA A;  4L0W A;  2QGV A;  18GS A;  1AXD A;  2IPA A;  4MZB A;  2VIM A;  2LRT A;  4KAE A;  3KTL A;  2N5B A;  2CQ9 A;  3PH9 A;  3IDV A;  2IME A;  1XXU A;  1GRX A;  2OE1 A;  1M7T A;  4KW6 A;  2CVD A;  3TRP A;  3ZIT A;  5G31 A;  2CT6 A;  4V2M A;  3SBC A;  5J9C A;  2PVQ A;  2HI7 A;  1E2Y A;  2FUG 2;  1WIK A;  1EOH A;  4K0N A;  5A5K A;  2VCT A;  5GSS A;  2B1K A;  3UVT A;  2ZNM A;  5D96 A;  3M3M A;  2PPT A;  3TJB A;  5ECQ B;  2AV4 A;  1FB0 A;  5CP1 A;  3H93 A;  2L5O A;  2V1M A;  3ZIJ A;  1EP8 A;  4WET A;  2VL3 A;  3MDK A;  4EF0 A;  4D73 B;  4QL9 A;  5BMU A;  3NIV A;  4AJ6 A;  4F2I A;  3RHB A;  3E0U A;  4V1A g;  3IBH A;  3GL5 A;  4I2T A;  5ENU A;  5LD0 A;  2H6Y A;  2HXK A;  4AF2 A;  2VD1 A;  4K2X A;  2HSY A;  3C73 A;  2ON7 A;  1Q98 A;  2DSA A;  3KIJ A;  2PBJ A;  1ABA A;  1FAA A;  2H8L A;  4PUF C;  1LJR A;  4Q5N A;  3FZA A;  4KE3 A;  4NAX A;  1B48 A;  1BED A;  4JED A;  5D9V A;  3VWU A;  3L9V A;  1HD2 A;  1FG4 A;  4L5L A;  2B6M A;  4EXJ A;  5EL8 A;  3LJR A;  4ILF A;  4RI6 A;  2FLS A;  1OC9 A;  2AJQ B;  1V58 A;  4X0X A;  4OWY A;  4H86 A;  2H70 A;  4CHS A;  4POB A;  1LBK A;  4EKZ A;  1YEP A;  5HFI A;  1F3B A;  2XPE A;  22GS A;  3CMI A;  4MH3 A;  3LG6 A;  3QCP A;  1Y6E A;  3L78 A;  3WGD A;  5J5N A;  3ZFL A;  2GT6 A;  3HXS A;  4TKY A;  1UN2 A;  1TI1 A;  4IN0 A;  2MZC A;  3FHK A;  3Q74 A;  3TRX A;  5DQS A;  2LJA A;  2QA2 A;  1XPV A;  1DBY A;  5A4U A;  2YOI A;  1B9Y C;  1MD3 A;  2LRN A;  5IMV A;  1A0R P;  2X49 A;  3DML A;  2GDR A;  3QDN A;  3UAP A;  3HVS A;  5CRD A;  1GTA A;  4RUV A;  2FA4 A;  5DAL A;  1A0F A;  4EDY A;  5KOW A;  6GSV A;  4PUA A;  1XFL A;  1TJD A;  3TJK A;  3W6G A;  5LNK e;  3HY2 A;  1X5E A;  4AJ7 A;  3GL3 A;  4O7H A;  5ID2 B;  5J4U A;  2D2Z A;  2J23 A;  5G1K A;  4TRX A;  2RUE A;  2G2Q A;  3C1R A;  3VPT A;  2HZE A;  4FYC A;  2RLI A;  2HT9 A;  4LLR A;  4KX4 A;  2YWO A;  1XVW A;  5D9W A;  4ECB A;  3NOF A;  3TOU A;  1S3A A;  3ME7 A;  4G10 A;  2KP2 A;  1DE1 A;  4OFM A;  1E6B A;  1YY7 A;  3U5R E;  1JZW A;  3TRQ A;  1J08 A;  3O3T A;  3VWX A;  4NMU A;  4KSM A;  1M9B A;  4J56 E;  6GSX A;  3CTF A;  1GTU A;  3EMX A;  4DSS B;  5HFK A;  4WBR D;  1QMV A;  1H75 A;  1PX7 A;  1I5G A;  4ZBB A;  1Z9H A;  1A23 A;  1K0M A;  4IQ1 A;  4LMV A;  3UJ1 A;  4XS1 A;  5C00 A;  3GUR A;  1PSQ A;  3EYT A;  3ZIV A;  3PGT A;  2K8V A;  2CVK A;  4XS4 B;  2E2M A;  4WF5 A;  2P5Q A;  2DJ2 A;  2JZT A;  4ML1 A;  4K6X A;  1JZD A;  4EL1 A;  2B1L A;  4E8E A;  3IPZ A;  3TDG A;  2YJ7 A;  2XHF A;  3EU4 A;  5D8I A;  4OFT A;  3TOT A;  4PNF A;  4IJ3 A;  1NW2 A;  1EEJ A;  4YKF A;  4HU7 A;  5B7C A;  4BPY A;  5DQY A;  4QQ7 A;  3CYN A;  1YDK A;  1V57 A;  4MPF A;  2C4J A;  4Z7X A;  3WD6 A;  3RPP A;  5HR3 A;  4GXZ A;  2MBS A;  2AAW A;  2C3N A;  1UA5 A;  2NPB A;  3VUR A;  3HCZ A;  2M72 A;  3QAW A;  5ECR B;  3C71 A;  3FZ9 A;  3V1W A;  1XW6 A;  4I6X A;  2VLU A;  1BYE A;  3LYK A;  3GV1 A;  2A2R A;  1F2E A;  4TR4 A;  1DSB A;  1OVN A;  1A2J A;  4Z2R A;  3IV4 A;  1MDJ A;  2O89 A;  2DIY A;  4BVY B;  5C04 A;  1K0D A;  3F0I A;  4AGS A;  2WUL A;  1X5C A;  3MAK A;  2JAC A;  3TKR A;  5G5E A;  2R2J A;  1CQG A;  4MCU A;  3PIN A;  4TXO A;  1TU8 A;  2FD3 A;  1EGO A;  1SD8 A;  2QSI A;  3IA1 A;  2X4A A;  3HJO A;  1PD2 1;  4L5O A;  4GCI A;  2EIO A;  2V2G A;  1XWC A;  1G6Y A;  2WCI A;  1G7E A;  2I4A A;  3ZLP A;  5AN1 A;  4I8B A;  13GS A;  2R37 A;  5HQP A;  4K9Z A;  3MIX A;  1GUK A;  2IFQ A;  5FWG A;  3TCO A;  5J3R A;  4CW9 A;  4CDO A;  4K5R A;  3W8S A;  6GSY A;  1ZZY A;  5DAK A;  2X8C A;  4ID0 A;  1GNE A;  4OCF A;  4OO5 A;  1XWG A;  4ZIJ A;  4FO5 A;  1GUH A;  1O8W A;  1K0B A;  1V98 A;  1JLV A;  3EWL A;  2EIQ A;  4QL7 A;  5B8B A;  2VD0 A;  1ERW A;  3IAM 2;  5IM9 A;  4E8H A;  3G7Y A;  1Z6N A;  1FHE A;  4HU9 A;  2GQL A;  3UIW A;  3UEM A;  4NHW A;  3O76 A;  2PVO C;  1VF4 A;  2GZP A;  4IHU A;  1ZYP A;  3I9V 2;  3APQ A;  4IP1 A;  1OKT A;  4HZ2 A;  4YQV A;  4HZ4 A;  4N30 A;  3TGZ A;  4NHZ A;  3IC4 A;  2H74 A;  4KCE A;  5ECL B;  3VI5 A;  2HSM A;  1SK0 A;  1JFU A;  5J41 A;  1O8X A;  4YH2 A;  3KMN A;  2HE3 A;  5CRH A;  5G2Z A;  4F03 A;  4N11 A;  2YN1 A;  3BJ5 A;  3DIE A;  4JU5 A;  1NSW A;  1XCC A;  2EIR A;  2M80 A;  2CX4 A;  4TXV A;  1QFN A;  1SEN A;  1U6T A;  4KH7 A;  3PPU A;  5FHI A;  1OC9 B;  4K0G A;  1QUW A;  4PQI A;  5COH A;  2OBI A;  3EVI A;  3F6D A;  1PN0 A;  3IRA A;  2CA8 A;  1QXH A;  3HKR A;  4IS0 A;  3HYP A;  2H71 A;  3UBK A;  2CAI A;  4V2L A;  2PUK C;  5CO3 A;  4CY8 A;  4XRD A;  2IWT A;  3Q19 A;  4MF5 A;  3GH9 A;  2YWM A;  1Y25 A;  1EV4 A;  2PN8 A;  5B6N A;  1JZR A;  3LXT A;  3EUR A;  5IOW A;  2AYT A;  4HEA 2;  3WGX A;  4ISD A;  1ZL9 A;  4LL1 B;  1R5A A;  4MDC A;  2VL2 A;  1PX6 A;  2VL2 C;  2ZCT A;  2PGT A;  5ECO B;  1MDK A;  3S9F A;  3F63 A;  3RBT A;  1ZYQ B;  4KND A;  8GSS A;  5DCG A;  1G6W A;  2F3M A;  2OKA A;  1GP1 A;  1AQW A;  2LQO A;  3FZ4 A;  3DXB A;  1OAZ A;  2LKU A;  4TOP A;  2NBS A;  1GSF A;  5ELG A;  4POK A;  3ISO A;  2DJJ A;  2F51 A;  2EC4 A;  2FY6 A;  1TW9 A;  2L5L A;  2B5X A;  5DAL B;  3MNG A;  4XCS A;  1GLQ A;  1KEB A;  4PGT A;  1THO A;  5E59 A;  5DJM A;  2R0G A;  2NDO A;  2I3Y A;  5J9B A;  2VLV A;  1IYI A;  4G2E A;  4TW5 A;  1FB6 A;  2IJY A;  1EP7 A;  4EIP A;  3ERG A;  2HZE B;  1SKR B;  4X1U A;  3VPQ A;  2DBC A;  3ZVJ D;  5HR2 A;  2JSZ A;  2O85 A;  1K0O A;  4OFN A;  1Z7R A;  4ZB9 A;  2P31 A;  2VL9 A;  4USS A;  2C80 A;  4ZL8 A;  1PMT A;  2REM A;  2YPM A;  1M2B A;  2H76 A;  3LFL A;  2HRN A;  3VI7 A;  3LGC A;  4F0C A;  2ALB A;  2VAF A;  1UC7 A;  2R4V A;  1I9D A;  5F0G A;  3IHQ A;  4ZBA A;  2B5E A;  3FR3 A;  4LA1 A;  4GF0 A;  4KA0 A;  3D0Z A;  2R6K A;  4L0U A;  1XWK A;  5JWO B;  4NWY A;  3ZVJ A;  4MZC A;  3LXZ A;  3GKN A;  4WR5 A;  1W89 A;  3W8J A;  3RDW A;  4ZB6 A;  3Q6O A;  2X99 A;  2I1U A;  1GSD A;  1M0U A;  4G9H A;  2VOC A;  2WJU A;  5HR0 A;  2TRX A;  4TR1 A;  1SL1 B;  2O8V B;  2YJH A;  3DGQ A;  4KDX A;  1BX9 A;  2H1D A;  4EC0 A;  3TJJ A;  4HJM A;  3R3E A;  5ECS A;  5G5F A;  1B8X A;  2GSQ A;  3OR5 A;  5AIV A;  11GS A;  1KTE A;  2LV3 A;  1GSQ A;  2KOK A;  1WE0 A;  5GAN D;  2DMM A;  3P2A A;  2H75 A;  4DSQ A;  1MDI A;  2K6V A;  3GKM A;  1XWA A;  1T8E B;  5ECH B;  1M9A A;  2IN3 A;  1GL8 A;  4KDU A;  1SK1 A;  3KXO A;  3FMW A;  3HJP A;  5ECP B;  1TRS A;  5IQY A;  3QAG A;  1XWB A;  1O81 A;  2IMK A;  3D22 A;  3QFA C;  4MP4 A;  2IMF A;  1T00 A;  1ZYN A;  4O32 A;  2VCZ A;  4BL7 A;  3GIX A;  2H01 A;  1GNW A;  1GTB A;  4MNN A;  3ZZX A;  4KGI A;  3FEU A;  4BVX A;  1PQN A;  4YQM A;  3CSJ A;  2VM2 A;  3VWV A;  3TJF A;  3J7Y k;  3CSI A;  2E7P A;  1IYH A;  1XOA A;  2XC2 A;  2V41 A;  2GQM A;  3ERW A;  1FOV A;  2H19 A;  3FRC A;  3C8E A;  5JWR B;  4K5S A;  4KCA A;  1Z5Y E;  4WKW A;  1SJ6 A;  2YV7 A;  2XBQ A;  4TXO B;  2OAC A;  5B8A A;  4ZXG A;  2YP6 A;  20GS A;  3LWA A;  4ZL7 A;  4TN8 A;  1SJZ A;  4OO4 A;  5DBQ A;  2BMX A;  1ERV A;  1SKW B;  1ERU A;  1T4Z A;  9GSS A;  4GQC A;  3CSH A;  5INY A;  2DKH A;  4OMV A;  2LNS A;  2JZS A;  2O7K A;  1F6M C;  1EWX A;  4IVF A;  1EOG A;  1AC1 A;  4MH2 A;  3IHG A;  5JCU A;  6GSW A;  2DJ0 A;  2IFQ B;  5IIZ A;  1GSS A;  3G7J A;  2HYX A;  5DAK B;  2HSH A;  1K3Y A;  2OAD A;  4XIH A;  1FVK A;  4N10 A;  2FCH A;  1KNG A;  3KH7 A;  1JZO A;  17GS A;  1GLP A;  4P3Y B;  14GS A;  1R26 A;  1Z7P A;  5AGY A;  3HZ4 A;  1S3D A;  1EGR A;  4F82 A;  2LTK A;  4ICY A;  4MF6 A;  4NPB A;  5HFG A;  3TB2 A;  1O6J A;  2OE0 A;  3IOS A;  5H5R A;  4JE1 A;  3PR8 A;  2CZ3 A;  1GSU A;  3RHC A;  2GSR A;  3D4T A;  1HNA A;  2B7K A;  1ZCP A;  4MJC A;  2H72 A;  3HVX A;  5L71 A;  1AQX A;  4Q5F A;  2L4Q A;  1B4Q A;  2YZH A;  16GS A;  2GST A;  4K8M A;  1M2A A;  1YF1 A;  2GZY A;  4K2D A;  1HNB A;  3C7M A;  4O5Q A;  2VCQ A;  1KBN A;  4XTS A;  1PA3 A;  2CX3 A;  4EDZ A;  3M8N A;  2G0F A;  2YAN A;  1A8Y A;  4Q5R A;  3US3 A;  1ACV A;  3GST A;  1V40 A;  2N5F A;  2LQQ A;  3D5J A;  2QKE A;  2JSY A;  2GS3 A;  3HJM A;  3HVV A;  1B4P A;  4FYB A;  2VCV A;  2JU5 A;  3A3T A;  5JCW A;  1WOU A;  4BA7 A;  2YWN A;  3WT1 A;  2WS2 A;  2PWJ A;  2OBK A;  5ELA A;  3DKS A;  3H79 A;  1RQM A;  1MTC A;  2HZF A;  3GRX A;  2VO4 A;  3KTB A;  5GAP D;  3H1N A;  3FY7 A;  5KN2 A;  2HNL A;  2X8G A;  1TKD B;  4Q5Q A;  4TR0 A;  3WGE A;  1XW5 A;  3E9J B;  3K8N A;  4GSN A;  1TRW A;  3G9B A;  4MA9 A;  1QGV A;  4G19 A;  3BOA A;  5JWQ B;  3FYG A;  1BQ7 A;  1TRU A;  1U3I A;  4IJI A;  3LQ7 A;  3FR9 A;  5CRE A;  2M46 A;  1H4O A;  4F9Z A;  7GSS A;  3A5I A;  4BWQ A;  3F3Q A;  5D93 A;  5D9X A;  1PL2 A;  4J57 E;  2V6O A;  4NV2 A;  2FWF A;  4NV5 A;  3ZRD A;  2J9H A;  3CRT A;  3ZFB A;  3QOU A;  4I97 A;  2LRC A;  3EC3 A;  1GSY A;  2P0G A;  2FGX A;  3APO A;  2B5Y A;  4HI7 A;  5D73 A;  1C72 A;  2HFD A;  5ECI B;  4FQU A;  3EPT A;  1GSE A;  1U88 A;  1PGT A;  4RQX A;  2CAQ A;  4ZB8 A;  4V2N A;  5FT3 A;  2A2P A;  2DIZ A;  4MMM A;  1WJK A;  1ILO A;  5IMZ A;  2H0G A;  1TU7 A;  3GYK A;  4EE0 A;  1X9W B;  1SL0 B;  2P5R A;  5CRW A;  1AW9 A;  1THX A;  1NM3 A;  4HS1 A;  2L6C A;  2FWH A;  3EU3 A;  1ZYE A;  3BCI A;  1AUC A;  2RM6 A;  3QR6 A;  4BWS A;  4RI7 A;  1GTI A;  3WT2 A;  2AHE A;  4LL4 B;  3M1G A;  2F8A A;  4TR1 B;  2L6D A;  6GST A;  2MYG A;  19GS A;  4KB3 A;  2LJR A;  3DRN A;  3LEF A;  2CVB A;  4HOJ A;  10GS A;  5DCH A;  3KZQ A;  1TK8 B;  4GSS A;  2AUV A;  3I6A A;  1YZX A;  3F9U A;  1TP9 A;  2A4H A;  3LW9 A;  3GMF A;  4MK3 A;  1TRV A;  1YQ1 A;  3M9K A;  4EVM A;  3WYW A;  3EIN A;  4WBJ A;  1RW1 A;  1A8L A;  4N0Z A;  3A2W A;  1R5P A;  4ZIL A;  2VLT A;  5CYY A;  4JBB A;  3QPM A;  3IR4 A;  3ZL5 A;  2DLX A;  4KUN A;  1N2A A;  3MWH A;  2NVL A;  1GH2 A;  2TIR A;  4IKH A;  1WPI A;  1K3L A;  2C0D A;  2JAD A;  1FW1 A;  2IMI A;  3RAZ A;  1SD9 A;  2OJL A;  2H6Z A;  1AQV A;  2WZ9 A;  4BL7 B;  1SKS B;  1GUM A;  3KH9 A;  4MAB A;  3APS A;  2MMN A;  5CRG A;  3A2V A;  1AIU A;  1SYX A;  4HDE A;  2CV4 A;  2DML A;  3GKX A;  4ML6 A;  5G1L A;  1T7P B;  4X43 A;  4BVX B;  1U3A A;  3KD0 A;  1MEK A;  5GZZ B;  3TKS E;  2HRF A;  2QA1 A;  4ACS A;  3HZ8 A;  1YEX A;  2ZUP A;  3VK9 A;  1K3O A;  12GS A;  3IE3 A;  2L57 A;  4F0B A;  1JLW A;  3F4R A;  4YKG A;  2GLR A;  3A5W A;  5LCZ A;  1YJ6 A;  3GKK A;  2DJ1 A;  3IXR A;  4EO3 A;  5CAX A;  2OE3 A;  1WRY A;  2BTO T;  2GQK A;  2UZ8 A;  3UMA A;  3GN3 A;  1YKA A;  1A2M A;  3QFB C;  2ON5 A;  2YV9 A;  2AB6 A;  4OCE A;  3CBU A;  3VLN A;  5DJL A;  3GSS A;  1YKC A;  2C8U A;  1OC3 A;  1TK5 B;  1SL2 B;  4N0V A;  2YZU A;  2VCX A;  2MMO A;  2N5A A;  4FYU A;  1RK4 A;  4IW9 A;  3O6T A;  1M99 A;  5F8B A;  5F06 A;  5IO0 A;  2IMD A;  3N5O A;  4MF7 A;  5A4V A;  5B6M A;  3UL3 A;  3ERF A;  1XOB A;  2H0I A;  2VM1 A;  1EZK A;  1S3C A;  4DEJ A;  2LNT A;  1T3B A;  1QQ2 A;  1W4V A;  2GZZ A;  1GWC A;  2WDU A;  1J0F A;  5AIX A;  1BJX A;  1SJI A;  2DJ3 A;  5F05 A;  1DUG A;  1O85 A;  4KF9 A;  4GLT A;  4PUR A;  3CTG A;  4YAV A;  3A2X A;  1A2L A;  4NXI A;  2YCD A;  4ECI A;  6GSS A;  2WFC A;  2XBI A;  5BRT A;  4EIQ A;  1OKD A;  2MMZ A;  1ST9 A;  4JZQ A;  2IL3 A;  3M0F A;  3CRU A;  1OE7 A;  4XHM A;  1X0R A;  2PU9 C;  4J2F A;  2ES7 A;  5E4W A;  4FIW A;  3SWL A;  4GTU A;  2GTU A;  1WWJ A;  4PQ1 A;  4ZL9 A;  3UVH A;  3GTU A;  3FW2 A;  2JL4 A;  3TKQ A;  5IPG A;  2F9S A;  1TK0 B;  1USB A;  2C3T A;  3VWW A;  1T4Y A;  3DD3 A;  4Z2U A;  3GX8 A;  5DDL A;  4IGJ A;  3ZTL A;  2FA8 A;  1TOF A;  1X5D A;  4K7I A;  4GRF A;  2V6K A;  1SYR A;  1VF3 A;  3EMP A;  1TI3 A;  1TXX A;  5ECN B;  4MJA A;  4MJB A;  1VF2 A;  4GST A;  3KMO A;  5GST A;  4RQR A;  5ECM B;  4GQF A;  4G0L A;  3CXG A;  5IOX A;  3TKP A;  2WB9 A;  2MMA A;  4K1F A;  3DVX A;  1NHY A;  1WP0 A;  1PKZ A;  2KHP A;  1R7H A;  4DSR A;  4ULX A;  2R3X A;  4TVE A;  1OYJ A;  2B3S A;  2R0P A;  4GWR A;  4IBP A;  4POL A;  1OE8 A;  3GA4 A;  1PRX A;  1B9X C;  1G0T A;  3FR6 A;  4AJ8 A;  1XIY A;  4WF4 A;  1X9M B;  4JR6 A;  1BAY A;  3VFI A;  3GNJ A;  3KM6 A;  4WEY A;  2TRC P;  2K18 A;  3P8W A;  3DYR A;  4D73 A;  3F4T A;  4FH8 A;  3NZN A;  4HQS A;  1Z3E A;  3JCM L;  1TTZ A;  3IK7 A;  1V9W A;  4I2U A;  3GHA A;  1Q4J A;  1SU9 A;  3G7I A;  1M2D A;  3TUE A;  3F4S A;  3BBY A;  5ABR A;  2LJK A;  5H5Q A;  2MBT A;  3BD2 A;  5D9T A;  5IMF A;  2GT5 A;  3DVW A;  3H4K A;  1UVZ A;  1EV9 A;  4PXO A;  5DVB A;  2JZR A;  2H30 A;  4KSO A;  4XS6 A;  5IPH A;  3L9S A;  2RII A;  2C0E A;  1HYU A;  1F9M A;  1BG5 A;  3Q18 A;  1VRS D;  1ZGN A;  2H6X A;  5KEJ A;  3R2Q A;  1K0C A;  4MJE A;  2FWE A;  3FK8 A;  4JRR A;  5KN3 A;  4IP6 A;  3MYD A;  2E2G A;  1Z6M A;  3I43 A;  3AY8 A;  1WMJ A;  3P7X A;  3GH6 A;  4POM A;  5IO2 A;  3J7Y b;  2CZ2 A;  2X8H A;  2BJX A;  1O7U A;  1AAZ A;  4K7N A;  2HLS A;  2IIY A;  3U6V A;  2RUF A;  2X64 A;  1NHO A;  3BCK A;  4HQZ A;  2FNO A;  3IAS 2;  5EVO A;  2I9H A;  2HRA A;  3KGK A;  3L0H A;  1MD4 A;  1F3A A;  2O87 A;  2K8S A;  1XW9 A;  1U87 A;  4JR4 A;  1FOH A;  4HJ2 A;  3TJG A;  4I5Q A;  5KN0 A;  3IC8 A;  3ZRE A;  2H66 A;  2VCW A;  5KOX A;  2HRK A;  3KJY A;  5CNW A;  3MSZ A;  2LUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...