2YP6A

Crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_1000 (etrx2) from streptococcus pneumoniae strain tigr4 in complex with cyclofos 3 tm
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
IAVGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASWCGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDSQGKIGKIQFGAISNADAEAAFKEMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN FAMILY PROTEIN
publication title Molecular Architecture of Streptococcus Pneumoniae Surface Thioredoxin-Fold Lipoproteins Crucial for Extracellular Oxidative Stress Resistance and Maintenance of Virulence.
pubmed doi rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Oxidoreductase
total genus 41
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yp6A00
3IAM2 3E9JB 1SYXA 4KNDA 4IW9A 5IMVA 2PUKC 3C73A 1B4QA 5AIXA 1FG4A 1FVJA 4NMUA 3UEMA 4V2LA 5ENUA 1S3AA 3H79A 1NM3A 4MH2A 3F9UA 3TCOA 2OE3A 3EVIA 4K7OA 5ECIB 3QFAC 2PWJA 2QGVA 1G7EA 4IVFA 3F4TA 3IXRA 1TW9A 3H1NA 3F63A 5DJMA 4GRFA 2FHEA 2RLIA 3V1WA 4K9ZA 1U3IA 3DD3A 3ZRDA 1R26A 3H8QA 4GSTA 3D21A 1H75A 2PU9C 5ABRA 2AJQB 3ZFBA 2CA8A 2H73A 4PQIA 2F9SA 3LGCA 5AGYA 3KZQA 2JZSA 1ZMAA 2G2QA 4L5LA 3KM6A 2XPEA 3IAS2 5G30A 1XOAA 4OCEA 3L9SA 2C3TA 3DIEA 1UN2A 5ECOB 3MDKA 4WEYA 4ECJA 2VOCA 5FT3A 4NV2A 2GS3A 2GT5A 2RUEA 1KTEA 3ZMLA 4AGSA 1V2AA 3TJJA 3ISOA 1TKDB 2CX4A 5CAXA 4GTUA 4N0VA 4PUAA 3KXOA 5INYA 1Z9HA 3GKMA 4K1FA 2EIRA 1A23A 5ECKB 4XTSA 3L4NA 3C1RA 5IPGA 1FOVA 3A2VA 3LYPA 2JZTA 4EUYA 4N10A 4F0BA 1O7UA 3ERFA 3LSZA 1U88A 3IK9A 4XRAA 1PA3A 4D73A 4GF0A 4WR4A 1YF0A 2GQMA 1JZOA 2RM6A 2L6DA 4TKYA 4HJMA 4YAVA 5HFKA 2XBIA 1YKCA 3UJ1A 1GTIA 1UA5A 4OCFA 1XWCA 2AV4A 20GSA 1FB0A 2KUCA 4MA9A 1XZOA 2B5YA 4OMVA 1G6WA 2H30A 4AJ6A 1G0TA 2E2GA 1T4ZA 2O7KA 4X0XA 2CVDA 3CSJA 4MK3A 3BBYA 4D73B 6GSTA 2OBKA 1VF4A 2O8VB 5CP1A 2YOIA 2H1GA 3KP8A 2OKAA 3IHQA 4YH2A 2C0GA 2JL4A 1F3BA 1X5EA 1SJ6A 3TKSE 1DUGA 3TKSC 4HU9A 6GSSA 4XS1A 1SKRB 3G9BA 3IE3A 2GDRA 4KCAA 4TR3A 1YDKA 4N30A 3VK9A 1YQ1A 2H8LA 4GWRA 2PN8A 3IC4A 4WBJA 1PQNA 4KH7A 2O89A 1A8YA 1EV4A 5C00A 4LMVA 1THXA 3VI5A 4IS0A 3UAPA 4L0WA 3M3MA 4JU5A 4L0UA 1BX9A 1SK2A 3NOFA 4HZ4A 1NHYA 4FYUA 3W8SA 4ML6A 2H0HA 2YANA 2VD1A 1EOHA 3APOA 1MDIA 5F0GA 1K0MA 5ELAA 1O81A 4NWYA 4TR0A 3MSZA 1G6YA 2DMLA 2LV3A 1PD21 3FR6A 2FNOA 4EF0A 1QQ2A 3FZAA 3UMAA 2TRXA 1KNGA 1A0FA 2HZFA 3FR9A 1T3BA 1X5CA 2YJ7A 4ILFA 3US3A 1TI3A 2H71A 2L5OA 4OWYA 2R3XA 3VLNA 3FK8A 2QC7A 3DGQA 4MPFA 2OBIA 3LXTA 1AW9A 4MJBA 3N9JA 3RDWA 2N5FA 2VL2A 2FCHA 3L9VA 2X64A 1BJXA 6GSUA 1DBYA 4ZILA 2I9HA 1QXHA 2PVOC 2FD3A 5J5NA 1DE2A 3IA1A 4GQCA 5D73A 5JWOB 4Z7XA 1Z6NA 5DDLA 1SL1B 1M9BA 1GUHA 4KDXA 4YQMA 3Q18A 2JADA 3UIWA 1AQXA 3BD2A 3CBUA 3DVWA 1BG5A 4POMA 11GSA 3ZVJD 3FRCA 1B8XA 1NHOA 2FWGA 2FA8A 4EL1A 2K18A 3UL3A 4KCEA 1MDJA 4BPYA 3SWLA 1WE0A 3CRUA 4IJ3A 4V2NA 2P5QA 4E8HA 2LEGA 2KP2A 5ECSA 3GFKA 2YCDA 4J2FA 4LA1A 3LWAA 4TVEA 5HR2A 3GIXA 1Z3EA 1J0FA 1F3AA 3ZFLA 1R5PA 4NAXA 4EKZA 4F0CA 1ERWA 5DALA 2EC4A 5EPFA 1VF3A 1NW2A 4G10A 1R4WA 3M8NA 2VLUA 5IMZA 1IYHA 1C72A 4CDOA 1K0OA 2H0GA 1TOFA 3TDGA 1LJRA 4K0NA 3IPZA 3VWUA 3APQA 1U3AA 2PMTA 3RAZA 4LL4B 1GH2A 2AUVA 5DALB 4IHUA 2ES7A 5JCWA 3TKRA 1OE8A 1XBSA 4J57E 1HYUA 1XW9A 1Z6MA 3QAGA 3ED3A 3H93A 3ZREA 3HA9A 2OADA 3G7YA 1EGRA 4XHMA 1GP1A 1O85A 2DJ0A 3ERWA 3GSTA 5DQSA 2RM5A 4EC0A 2E0QA 3GHAA 5HQPA 4YAPA 3QMXA 3KH9A 1M2AA 3KMOA 3TB2A 1SD9A 2OE0A 2LS5A 4LLRA 4KW6A 1QGVA 1QK8A 4ZXGA 3BCIA 5CRWA 3VWXA 4ZB8A 1ERTA 2KLXA 4OFTA 3ZL5A 4KSMA 1A2JA 4FYCA 3FZ9A 3SBCA 1RK4A 5F8BA 5IOXA 1X9WB 2ON7A 2IN3A 5CNWA 5KEJA 3PR8A 1V98A 4DVCA 2WFCA 1XWAA 4KGIA 1UC7A 1E2YA 3C8EA 4FH8A 3LJRA 5ECQB 4TRXA 1H4OA 1JZRA 1YKAA 2MMNA 2PERA 3K8NA 3PGTA 1A24A 4BL7A 3GKXA 3IOSA 1ZZYA 4NV5A 3WT1A 4MH3A 3VPTA 1OE7A 5IOWA 3LG6A 2NTOA 3TJGA 3HD5A 2DJ2A 4GXZA 5E59A 1GTBA 3F3QA 4GQFA 3HKRA 4MLYA 3HY2A 1KEBA 3QDNA 1GULA 4WBRD 1K0AA 4IN0A 16GSA 1V9WA 2L57A 2OJLA 3RBTA 5AIVA 1AIUA 2C0DA 1ML6A 1SD8A 3GH6A 3LQ7A 4MZWA 4QL9A 4KX4A 3BOAA 3ZIJA 1BAYA 1JHBA 4DSSA 5LD0A 2OACA 4ZB9A 3MAKA 1WPIA 4ISDA 3EINA 2YV7A 5CO3A 1T8EB 1HQOA 5G1KA 2V6KA 1GL8A 2LJKA 4ZL9A 3A3TA 2B7KA 3TOTA 2M80A 2CVKA 3W8JA 2V41A 3QD9A 1K0NA 5GSTA 3DMLA 5DJLA 1DE1A 1USBA 2VCVA 4I8BA 4DSSB 5J9CA 2B3SA 1TTZA 2VL2C 2MMAA 2GT6A 1XWBA 2VD0A 1SK0A 3UVHA 1K3LA 2XBQA 2V6OA 3P2AA 5J3RA 2JSZA 4MCUA 2DC5A 1GUMA 3HVSA 1A2LA 3EU4A 2A4VA 3I43A 2LJRA 4BVYA 4EXJA 3C7MA 4QL7A 3DKSA 4EDYA 2A2SA 3DYRA 4YQVA 4HQSA 1RQMA 5IPHA 4KB3A 1J9BA 3GX8A 2VLVA 4N0ZA 3J7Yb 2LKUA 1TRUA 2AB6A 2P0GA 1T00A 3F3RA 3KP9A 3IDVA 4MF5A 2C0FA 3UOMA 4K6XA 3BJ5A 1CQGA 1GNWA 3FZ5A 2YWIA 2LQOA 2REMA 4HDEA 5DVBA 2J23A 1F37A 1M2BA 3VPQA 4PXOA 1XPVA 3TKQA 2F8AA 4MJAA 2O85A 6GSVA 1EWXA 1VF1A 2M72A 2B5EA 5C04A 3EMXA 2LNSA 1K0BA 4ZBAA 2LQQA 2LRCA 4JR4A 3WGXA 3VI7A 5LCZA 1JZDA 3GRXA 1Q4JA 2BJXA 4K2DA 1W89A 1XFLA 3KJYA 3RPPA 2NPBA 3I6AA 1OVNA 3LXZA 1THOA 2DMMA 2FY6A 3VWVA 3TOUA 2IPAA 5IMFA 1PKZA 3HJPA 3LORA 2A2RA 3EURA 2VCWA 1PSQA 3A2XA 2E2MA 4IQAA 3NIVA 4LMWA 3GURA 2VO4A 4ZBBA 2FUG2 3ZMKA 2OA7A 5A4UA 3I9V2 3E3EA 3WT2A 5IMDA 2KHPA 2JZRA 1GTAA 1YJ6A 2LRNA 1IYIA 1BYEA 1R5AA 1AUCA 4RI7A 5G5FA 1QMVA 2H6ZA 5G31A 4KE3A 4RI6A 1G7OA 2ON5A 2AHEA 4I2TA 2JU5A 1ZYQB 3HVVA 4OFNA 3KEBA 5DCHA 3N5OA 5CRGA 3FW2A 1FB6A 2MBTA 2LTKA 2H1AA 2YP6A 1SKSB 2CZ2A 1TXXA 2IMDA 1OC3A 3EE2A 5B8BA 2IWTA 3KIJA 3TRPA 3OR5A 5D9XA 2WGRA 4BA7A 3GN3A 4K0GA 2IMKA 2C3QA 1PN9A 5H5QA 1SL2B 3QFBC 5B8AA 1F6MC 2EIQA 5CYYA 4F03A 4O7HA 4ZL8A 4TXOA 2X8GA 1AQVA 3CXGA 3UBKA 2MMZA 5GAPD 3QCPA 1WJKA 1BEDA 4WXTA 4ACSA 2Z9SA 4MDCA 3FYGA 3CTFA 1Z7PA 1TK5B 5IO0A 2HNLA 4AF2A 3F6FA 1ZCPA 5FHIA 1XXUA 4POLA 3RPNA 2BTOT 2H6XA 10GSA 4TR4A 1B9XC 2WB9A 5ID2A 3DEXA 2GLRA 4TXOB 5COHA 3F4SA 3IV4A 2YNXA 1OC8A 4HUAA 5J9BA 2YZUA 4F82A 3TKPA 4AJ8A 17GSA 1B4PA 1GRXA 3F4RA 1JLVA 4QQ7A 5IM9A 3RHCA 3WYWA 3LFLA 5D96A 2YPMA 5J4UA 1XIYA 3KTBA 2H70A 2QKEA 2X99A 3CTGA 4N11A 2DJJA 5A5KA 3KD0A 5ID2B 2HZEA 2YN1A 3FZ4A 2VUPA 2HRFA 2PPTA 2XHFA 1O8XA 1TRVA 2WDUA 1AQWA 3HHVA 13GSA 5CRHA 4K8MA 4DEJA 3PH9A 1EEJA 4RUVA 3C71A 1U87A 3VWWA 4G2EA 3BCKA 3QAVA 3TJBA 2GGTA 3D4MA 4G19A 3IR4A 2ALBA 4Q5FA 3CMIA 4I5QA 1GSUA 2HZEB 1M99A 2C4JA 4KDUA 18GSA 4ECBA 3D5JA 4MJCA 4ECCA 1DSBA 2AAWA 1HNAA 2L4QA 4J56E 4BWQA 1GSDA 1T7PB 3WGEA 2OE1A 2CV4A 2ZUPA 2H72A 3J7Yk 2CQ9A 3GL5A 4MZBA 1VGLA 2KP1A 4MJEA 1XOBA 3KCMA 2VL9A 3GSSA 2P5RA 1ZL9A 1FO5A 1GSQA 3DVXA 2I81A 2V2GA 3R2QA 1OAZA 1K0DA 1URMA 1VF2A 3RHBA 2LUSA 2VM1A 1OC9A 2DJ3A 3GTUA 1ZYEA 4O32A 5IO2A 2M46A 2H66A 4EE0A 3E0UA 4V1Ag 4JZQA 3TJKA 1PKWA 2MYGA 6GSXA 2IMIA 5ECHB 4XS4A 2GQLA 1TJDA 3MWHA 3DXBA 3L78A 4HOJA 6GSWA 4TN8A 2MMOA 1JFUA 5ECPB 3U5RE 3EMPA 3HJOA 2WRTA 3AY8A 3L0HA 1JZWA 2V1MA 1HNCA 1OC9B 2FWHA 1PX7A 1A8LA 3GTUB 3WD6A 4JE1A 4KA0A 2R5GA 2DJ1A 4PQHA 3HJMA 1EGOA 1BQ7A 5JWRB 1HNBA 1O6JA 2HI7A 3G7JA 4XS4B 5DAKA 1O8WA 3P90A 1UVZA 1TRWA 3QAWA 4ULXA 2XC2A 3Q74A 5GAND 4HQZA 2AYTA 1K3YA 1TRSA 2DSAA 5LNKe 1TP9A 2F8FA 1EV9A 3FHKA 4NPBA 1GLPA 2YWNA 1T1VA 3LYKA 4I2UA 3KGKA 5HR0A 2R37A 1WRYA 2IMEA 4KDYA 5KN1A 3HZ4A 14GSA 4H86A 2L4CA 5JCUA 2YWOA 5DAKB 3O6TA 5ECNB 2HSHA 1PGTA 1GWCA 1Y25A 2C3NA 4POBA 5F05A 2H1BA 1ST9A 3ZIVA 5D8IA 12GSA 5G2ZA 2X8CA 3F0IA 2H75A 4EO3A 2IMFA 3D6IA 5D9WA 1EOGA 1M2DA 2IJYA 1R7HA 4ZL7A 2F3MA 1F9MA 5G5EA 1SK1A 3S9FA 3UVTA 5F06A 1OYJA 3TRQA 5IMAA 1GLQA 5HR3A 4PQ1A 5FWGA 4MF6A 1S3DA 1SJIA 4MMMA 1K0CA 4WKWA 1ON4A 2F51A 2GTUA 4I97A 4FIWA 1NSWA 1V40A 2B1LA 4ML1A 4BWSA 2EIOA 1SL0B 5GZZB 3APSA 4NXIA 4NHWA 5DBQA 5JCGA 4ID0A 2YWMA 2MZCA 2PVQA 4KAEA 2FLSA 2XPDA 2G0FA 4WF5A 4CW9A 3ZZXA 4MPGA 1MDKA 3IRAA 1X9SB 2R4VA 3KH7A 5H5RA 1YY7A 3H4KA 4X43A 3A2WA 2C8UA 2N5BA 3GUSA 1SENA 1AAZA 3U6VA 2HXKA 1OKDA 4MP4A 1TDIA 1Z7RA 5ELGA 2K8SA 1LBKA 2H76A 1HD2A 4HZ2A 5B7CA 2V32A 2MBSA 3JCML 3FR3A 5JWQB 3GH9A 5DQYA 2VCZA 4PUFC 5A4WA 3A5WA 4ZBDA 1GTUA 1XVQA 5CREA 3F8UA 2PGTA 4TW5A 4V1Ap 4GCIA 4OO4A 3CYNA 1TI1A 5HR1A 1TK0B 4PURA 5DCGA 1JLWA 22GSA 1I9DA 2CX3A 2LNTA 2I1UA 4IELA 2HFDA 1WIKA 2NDOA 2GSRA 4IKHA 3GL3A 2RUFA 3FY7A 2HE3A 1PL2A 1ILOA 3M1GA 1FAAA 1EP7A 3QOUA 4Q5RA 5EL8A 1SJZA 2VM2A 2X8HA 1ERVA 1QFNA 1SKWB 2FWFA 5B6NA 1XWGA 2B7JA 4EDZA 3EC3A 1F2EA 1GNEA 2NBSA 2D2ZA 5KN0A 4HU7A 2K9FA 4L5OA 1O73A 2QSIA 4JBBA 1XCCA 2GVPA 3DRNA 7GSSA 3HZ8A 1AXDA 4OFMA 3GA4A 3TRXA 1N2AA 3GMFA 2L59A 2LSTA 1MTCA 3M9JA 4P3YB 1XWKA 4JEDA 4WF4A 3QR6A 5AN1A 1XW6A 3C1SA 4LL1B 5D9VA 3GX0A 2FWEA 3FKFA 3MNGA 4PNGA 4DSQA 2H19A 2DIZA 2K6VA 4FYBA 1A2MA 3ZYWA 2C80A 2WJUA 1X5DA 1N8JA 4JR6A 2DLXA 3ZVJA 3GYKA 1ERUA 2WS2A 2HRNA 2GZPA 4IGJA 4PGTA 2H6YA 4HS1A 1QUWA 2NVLA 2I4AA 1B48A 1EZKA 4IQ1A 5KN2A 5H5SA 1V57A 4DSRA 1GUKA 1RW1A 5IIZA 1ABAA 1OKTA 5F07A 3EU3A 4ZB6A 3HXSA 2L5LA 5ECLB 4XS6A 5ECMB 2H0IA 2VAFA 1XW5A 1PL1A 19GSA 1ACVA 3ME8A 4GLTA 4K7NA 1CQHA 4G9HA 2FA4A 2VCQA 4MABA 5J41A 3HCZA 1WMJA 1AC1A 4IP6A 4K7IA 1PX6A 2GSQA 2GQKA 5B6MA 2VL3A 4O5RA 1LU4A 3PINA 3D4TA 2DJKA 2GSSA 2ZCTA 1WWJA 3CSHA 3Q19A 3EYTA 1PRXA 1MD3A 4XCSA 1WP0A 3ERGA 4O92A 1GSYA 3HVXA 2HLSA 2CAQA 1X0RA 2HYXA 1MEKA 3D0ZA 1VRSD 1V58A 3O3TA 4TOPA 2IFQA 2ZNMA 9GSSA 2H01A 3HYPA 2RIIA 1B9YC 3IBHA 1GSEA 2VCTA 3IK7A 5EY6A 4PX1A 1M7TA 1GSFA 2JSYA 2YV9A 2VIMA 3VURA 4KSOA 1S3CA 1YF1A 5GSSA 3FEUA 4L8EA 4OD7A 6GSYA 4IBPA 3GKKA 2I3YA 4POKA 3P7XA 2CVBA 1Y6EA 1T4YA 1YEPA 2B1KA 3TGZA 2IFQB 4Q5NA 5D9TA 4ZIJA 2B5XA 1KBNA 5D93A 3KTLA 4Q5QA 3UBLA 2R2JA 1M9AA 1ZGNA 8GSSA 5HFIA 1J08A 4WETA 4BVXA 3ME7A 1TU8A 4IJIA 5EVOA 3TKSA 1A0RP 2HT9A 2IL3A 3LEFA 4HEA2 3GV1A 3I69A 1WOUA 2JACA 2CZ3A 2K8VA 1GSSA 1U6TA 2C1YA 2CT6A 2LRTA 5KN3A 2GZYA 1W4VA 3L9UA 3O76A 3M0FA 3VFIA 2YJHA 5CRDA 1E6BA 3P8WA 2TRCP 2PBJA 1FVKA 1PMTA 3UARA 1MD4A 5HFGA 1EEMA 4AJ7A 5AISA 3KMNA 3TJFA 1K3OA 3WGDA 4MF7A 3W6GA 4JRRA 5L71A 1FW1A 1FHEA 3TUEA 4GSNA 4TR1A 4PNFA 2H1DA 1SYRA 2IIYA 4ECIA 1YEXA 1Q98A 4GSSA 2L6CA 3CRTA 4IP1A 5ECRB 4I6XA 4E8EA 2CAIA 2E7PA 3GKNA 2BMXA 2DBCA 4XRDA 4RQRA 2KOKA 1M0UA 2H74A 2DIYA 3ZLPA 3D22A 4WR5A 2FGXA 2VLTA 3QPMA 2O87A 3M9KA 1Z5YE 3G7IA 4KUNA 2WZ9A 5G1LA 4HI7A 4V2MA 4CHSA 4TXVA 2P31A 3HDCA 4TR1B 1TU7A 3CSIA 2HSYA 3NZNA 2YZHA 1ZOFA 4NHZA 1YZXA 2WCIA 2C0EA 3Q6OA 5IQYA 1X9MB 2GZZA 4EVMA 3GNJA 2GSTA 2N5AA 2R6KA 3EWLA 3F6DA 2VCXA 4RQXA 1EP8A 5A4VA 4X1UA 2WULA 5IMCA 4F9ZA 4FO5A 1XVWA 4XIHA 2B6MA 1TK8B 1SU9A 2LJAA 5E4WA 3ZTLA 4HJ2A 3ZITA 2TIRA 4MZCA 3DWVA 4F2IA 1I5GA 2J9HA 4YQUA 4OO5A
chains in the Genus database with same CATH superfamily
3IAM2 3E9JB 1SYXA 4KNDA 4IW9A 5IMVA 2PUKC 3C73A 1B4QA 5AIXA 1FG4A 1FVJA 4NMUA 4G0KA 3UEMA 4V2LA 5ENUA 1S3AA 3H79A 1NM3A 4MH2A 3F9UA 3TCOA 2OE3A 3EVIA 4K7OA 5ECIB 3QFAC 2PWJA 2QGVA 1G7EA 4IVFA 3F4TA 3IXRA 1TW9A 3H1NA 3F63A 5DJMA 4GRFA 2FHEA 2RLIA 3V1WA 4K9ZA 1U3IA 3DD3A 3ZRDA 1R26A 3H8QA 4GSTA 3D21A 1H75A 2PU9C 5ABRA 2AJQB 3ZFBA 2CA8A 2H73A 4PQIA 2F9SA 3LGCA 5AGYA 3KZQA 2JZSA 1ZMAA 2G2QA 4L5LA 3KM6A 2XPEA 3IAS2 5G30A 1XOAA 4OCEA 3L9SA 2C3TA 3DIEA 1UN2A 4WEYA 3MDKA 5ECOB 4ECJA 2VOCA 5FT3A 4NV2A 2GS3A 2GT5A 2RUEA 1KTEA 3PPUA 3ZMLA 4AGSA 1V2AA 3TJJA 3ISOA 1TKDB 2CX4A 5CAXA 4N0VA 4GTUA 4PUAA 3KXOA 5INYA 1Z9HA 3GKMA 4K1FA 2EIRA 1A23A 5ECKB 4XTSA 3L4NA 3C1RA 5IPGA 1FOVA 3A2VA 3LYPA 2JZTA 4EUYA 4N10A 4F0BA 1O7UA 3ERFA 3LSZA 1U88A 3IK9A 4XRAA 1PA3A 4D73A 4GF0A 4WR4A 1YF0A 2GQMA 3LW9A 1JZOA 2RM6A 2L6DA 4TKYA 4HJMA 4YAVA 5HFKA 2XBIA 1YKCA 3UJ1A 1GTIA 1UA5A 4OCFA 1XWCA 2AV4A 20GSA 1FB0A 2KUCA 4MA9A 1XZOA 2B5YA 4OMVA 1G6WA 2H30A 4AJ6A 1G0TA 2E2GA 1T4ZA 1M3IA 2O7KA 4X0XA 2CVDA 3CSJA 4MK3A 3BBYA 4D73B 6GSTA 2OBKA 1VF4A 2O8VB 5CP1A 2YOIA 2H1GA 3KP8A 2OKAA 3IHQA 4YH2A 2C0GA 2JL4A 1F3BA 1X5EA 1SJ6A 3TKSE 1DUGA 3TKSC 4HU9A 6GSSA 4XS1A 1SKRB 3G9BA 3IE3A 2GDRA 4KCAA 4TR3A 1YDKA 4N30A 3VK9A 1YQ1A 2H8LA 4GWRA 2PN8A 3IC4A 4WBJA 1PQNA 4KH7A 2O89A 1A8YA 1EV4A 5C00A 4LMVA 1THXA 3VI5A 4IS0A 3UAPA 4L0WA 3M3MA 4JU5A 1XG8A 4L0UA 1BX9A 1SK2A 3NOFA 4HZ4A 1NHYA 4FYUA 3W8SA 4ML6A 2H0HA 2YANA 2VD1A 4X4JA 1EOHA 3APOA 1MDIA 5F0GA 1K0MA 5ELAA 1O81A 1ZYPA 4NWYA 4TR0A 3MSZA 1M3JA 1G6YA 2DMLA 2LV3A 1PD21 3FR6A 2FNOA 4EF0A 1QQ2A 3FZAA 3UMAA 2TRXA 1KNGA 1A0FA 2HZFA 3FR9A 1T3BA 1X5CA 2YJ7A 4ILFA 3US3A 1TI3A 2H71A 2L5OA 4OWYA 2R3XA 3VLNA 3FK8A 2QC7A 3DGQA 3FMWA 4MPFA 2OBIA 3LXTA 1AW9A 4MJBA 3N9JA 3RDWA 2N5FA 2VL2A 2FCHA 3L9VA 2X64A 1BJXA 6GSUA 4ICYA 1DBYA 4ZILA 2I9HA 1QXHA 2PVOC 2FD3A 5J5NA 1DE2A 3IA1A 4GQCA 5D73A 5JWOB 4Z7XA 1Z6NA 5DDLA 1SL1B 4HSCX 1M9BA 4EIQA 1GUHA 4KDXA 4YQMA 3Q18A 2JADA 3UIWA 1AQXA 2HRKA 3BD2A 3CBUA 3DVWA 1BG5A 4POMA 11GSA 3ZVJD 3FRCA 1B8XA 1NHOA 2FWGA 2FA8A 4EL1A 2K18A 3UL3A 4KCEA 1MDJA 3MYDA 4BPYA 3SWLA 1WE0A 2DKIA 3CRUA 4IJ3A 4V2NA 2P5QA 4E8HA 2LEGA 2KP2A 5ECSA 3GFKA 2YCDA 4J2FA 4LA1A 3LWAA 4TVEA 5HR2A 3GIXA 1Z3EA 1J0FA 1F3AA 3ZFLA 1R5PA 4NAXA 4EKZA 4F0CA 1ERWA 5DALA 2EC4A 5EPFA 1VF3A 1NW2A 4G10A 1R4WA 3M8NA 2VLUA 5IMZA 1IYHA 1C72A 4CDOA 3MIXA 1K0OA 2H0GA 1TOFA 3TDGA 1LJRA 4K0NA 3IPZA 3VWUA 3APQA 1U3AA 3IHGA 2PMTA 3RAZA 4LL4B 1GH2A 2AUVA 5DALB 1ZYNA 4IHUA 2ES7A 5JCWA 3TKRA 1OE8A 1XBSA 4J57E 1HYUA 1XW9A 1Z6MA 3QAGA 3ED3A 3H93A 4YKFA 3ZREA 3HA9A 2OADA 3G7YA 1EGRA 3R3EA 4XHMA 1GP1A 1O85A 4G0IA 2DJ0A 3ERWA 4CY8A 3GSTA 5DQSA 2RM5A 4EC0A 2E0QA 3GHAA 5HQPA 4YAPA 3QMXA 3KH9A 1M2AA 3KMOA 3TB2A 1SD9A 2OE0A 2LS5A 4LLRA 4KW6A 1QGVA 1QK8A 4ZXGA 3BCIA 5CRWA 3VWXA 4ZB8A 1ERTA 2KLXA 4OFTA 3ZL5A 4KSMA 1A2JA 4FYCA 3FZ9A 3SBCA 1RK4A 5F8BA 5IOXA 1X9WB 2ON7A 2IN3A 5CNWA 5KEJA 3PR8A 1V98A 4DVCA 2WFCA 1XWAA 4KGIA 5BMUA 1UC7A 1E2YA 3C8EA 4FH8A 3LJRA 5ECQB 4TRXA 1H4OA 1JZRA 1YKAA 2MMNA 2PERA 4YKGA 3K8NA 3PGTA 1A24A 4BL7A 3GKXA 3IOSA 1ZZYA 4NV5A 3WT1A 4MH3A 3VPTA 1OE7A 5IOWA 3LG6A 2NTOA 3TJGA 3HD5A 2DJ2A 4GXZA 5E59A 1GTBA 3F3QA 4GQFA 3HKRA 4MLYA 3HY2A 1KEBA 3QDNA 1GULA 4WBRD 1K0AA 4IN0A 16GSA 1V9WA 2L57A 2OJLA 5KOWA 3RBTA 5AIVA 1AIUA 2C0DA 5KOXA 1ML6A 1SD8A 2QA1A 3GH6A 3LQ7A 4MZWA 4QL9A 4KX4A 3BOAA 3ZIJA 1BAYA 1JHBA 4DSSA 5LD0A 2OACA 4ZB9A 4BL7B 3MAKA 1WPIA 4ISDA 3EINA 2YV7A 5CO3A 1T8EB 1HQOA 5G1KA 2V6KA 1GL8A 5BRTA 2LJKA 4ZL9A 3A3TA 2B7KA 3TOTA 2M80A 2CVKA 3W8JA 2V41A 3QD9A 1K0NA 5GSTA 3DMLA 5DJLA 1DE1A 2R0PA 1USBA 2VCVA 4I8BA 4DSSB 5J9CA 2B3SA 1TTZA 2VL2C 2MMAA 2GT6A 1XWBA 2VD0A 1SK0A 3UVHA 1K3LA 2XBQA 3HVNA 2V6OA 3P2AA 5J3RA 2JSZA 4MCUA 2DC5A 1GUMA 3HVSA 1A2LA 3EU4A 2A4VA 3I43A 2LJRA 4BVYA 4EXJA 3C7MA 4QL7A 3DKSA 4EDYA 4K2XA 2A2SA 3DYRA 4YQVA 4HQSA 1RQMA 5IPHA 4KB3A 1J9BA 3GX8A 2VLVA 4N0ZA 3J7Yb 2LKUA 1TRUA 2AB6A 2P0GA 1T00A 3F3RA 3KP9A 3IDVA 4MF5A 2C0FA 3UOMA 4K6XA 3BJ5A 4KF9A 4BVYB 1CQGA 1GNWA 3FZ5A 2YWIA 2LQOA 2REMA 4HDEA 2J23A 5DVBA 1F37A 1M2BA 3VPQA 4PXOA 1XPVA 3TKQA 2F8AA 4MJAA 2O85A 6GSVA 1EWXA 1VF1A 2M72A 2B5EA 5C04A 3EMXA 2LNSA 1K0BA 4ZBAA 2LQQA 2LRCA 2A4HA 4JR4A 3WGXA 3VI7A 5LCZA 1JZDA 3GRXA 1Q4JA 2BJXA 4K2DA 1W89A 1XFLA 3KJYA 3RPPA 2NPBA 3I6AA 1OVNA 3LXZA 1THOA 2DMMA 2FY6A 3VWVA 3TOUA 2IPAA 5IMFA 1PKZA 3HJPA 3LORA 2A2RA 3EURA 2VCWA 1PSQA 3A2XA 2E2MA 4IQAA 3NIVA 4LMWA 3GURA 2VO4A 4ZBBA 2FUG2 3ZMKA 2OA7A 5A4UA 3I9V2 4BIKA 3E3EA 3WT2A 5IMDA 2KHPA 2JZRA 1GTAA 1YJ6A 2LRNA 1IYIA 1BYEA 1R5AA 1AUCA 4RI7A 5G5FA 1QMVA 2H6ZA 5G31A 4KE3A 4RI6A 1G7OA 2ON5A 2AHEA 4I2TA 2JU5A 1ZYQB 3HVVA 4OFNA 3KEBA 5DCHA 3N5OA 5CRGA 3FW2A 1FB6A 2MBTA 2LTKA 2H1AA 2YP6A 1SKSB 2CZ2A 1TXXA 2IMDA 1OC3A 3EE2A 5B8BA 2IWTA 3KIJA 3TRPA 3OR5A 5D9XA 2WGRA 4BA7A 3GN3A 4K0GA 2IMKA 2C3QA 1PN9A 5H5QA 1SL2B 3QFBC 5B8AA 1F6MC 2EIQA 5CYYA 4F03A 4O7HA 4ZL8A 4FQUA 4TXOA 2X8GA 1AQVA 3CXGA 3UBKA 2MMZA 5GAPD 3QCPA 1WJKA 1BEDA 4WXTA 4ACSA 2Z9SA 4MDCA 3FYGA 3CTFA 1Z7PA 1TK5B 5IO0A 2HNLA 4AF2A 3F6FA 1ZCPA 5FHIA 1XXUA 4POLA 3RPNA 2BTOT 2H6XA 10GSA 4TR4A 1B9XC 2WB9A 5ID2A 3DEXA 2GLRA 4TXOB 5COHA 3CQFA 3F4SA 3IV4A 2YNXA 1OC8A 4HUAA 5J9BA 2YZUA 4F82A 3TKPA 4AJ8A 17GSA 1B4PA 1GRXA 3F4RA 1JLVA 4QQ7A 3IC8A 5IM9A 3RHCA 3WYWA 3LFLA 5D96A 2R0CA 2YPMA 5J4UA 1XIYA 3KTBA 2H70A 2QKEA 2X99A 3CTGA 4N11A 2DJJA 5A5KA 3KD0A 5ID2B 2HZEA 2YN1A 3FZ4A 2VUPA 2HRFA 2DKHA 2PPTA 2XHFA 4USSA 1O8XA 1TRVA 2WDUA 1AQWA 3HHVA 13GSA 5CRHA 3A5IA 4K8MA 4DEJA 3PH9A 1EEJA 4RUVA 3C71A 1U87A 2X4AA 3VWWA 4G2EA 3BCKA 3QAVA 3TJBA 2GGTA 3D4MA 4G19A 3IR4A 2ALBA 4Q5FA 3CMIA 4I5QA 1GSUA 2HZEB 1M99A 2C4JA 3EPTA 4KDUA 18GSA 4ECBA 3D5JA 4MJCA 4ECCA 1DSBA 2AAWA 1HNAA 2L4QA 4J56E 4BWQA 1GSDA 1T7PB 3WGEA 2OE1A 2CV4A 2ZUPA 2H72A 3J7Yk 2CQ9A 3GL5A 4MZBA 1VGLA 2KP1A 4MJEA 1XOBA 3KCMA 2VL9A 3GSSA 2P5RA 1ZL9A 1FO5A 1GSQA 3DVXA 2I81A 2V2GA 3R2QA 1OAZA 1K0DA 1URMA 1VF2A 4G0LA 3RHBA 2LUSA 2VM1A 1OC9A 2DJ3A 3GTUA 1ZYEA 4O32A 5IO2A 2M46A 2H66A 4EE0A 3E0UA 4V1Ag 4JZQA 3TJKA 2HSMA 1PKWA 2MYGA 6GSXA 2IMIA 5ECHB 4XS4A 2GQLA 1TJDA 3MWHA 3DXBA 3L78A 4HOJA 6GSWA 4TN8A 2MMOA 1JFUA 5ECPB 3U5RE 3EMPA 3HJOA 2WRTA 3AY8A 3L0HA 1JZWA 2V1MA 1HNCA 1OC9B 2FWHA 1PX7A 1A8LA 3GTUB 3WD6A 4JE1A 4KA0A 4K5SA 2R5GA 2DJ1A 4PQHA 3HJMA 1EGOA 1BQ7A 5JWRB 1HNBA 1O6JA 2HI7A 3G7JA 4XS4B 5DAKA 1O8WA 3P90A 1UVZA 1TRWA 3QAWA 4ULXA 2XC2A 3Q74A 5GAND 4HQZA 2AYTA 1K3YA 1TRSA 2DSAA 5LNKe 1TP9A 2F8FA 1EV9A 3FHKA 4NPBA 1GLPA 2YWNA 1T1VA 3LYKA 4I2UA 3KGKA 5HR0A 2R37A 1WRYA 2IMEA 4KDYA 5KN1A 3HZ4A 14GSA 4H86A 2L4CA 5JCUA 2X49A 2YWOA 5DAKB 3O6TA 5ECNB 2HSHA 1PGTA 1GWCA 1Y25A 2C3NA 4POBA 5F05A 2H1BA 1ST9A 3ZIVA 5D8IA 12GSA 2QA2A 5G2ZA 1FOHA 2X8CA 3F0IA 2H75A 4EO3A 2IMFA 2A2PA 3D6IA 5D9WA 1EOGA 1M2DA 2IJYA 1R7HA 4ZL7A 2F3MA 1F9MA 5G5EA 1SK1A 3S9FA 3UVTA 5F06A 1OYJA 3TRQA 5IMAA 1GLQA 5HR3A 4PQ1A 5FWGA 4MF6A 1S3DA 1SJIA 4MMMA 1K0CA 4WKWA 1ON4A 2F51A 2GTUA 4I97A 4FIWA 1NSWA 1V40A 2B1LA 4ML1A 4BWSA 2EIOA 1SL0B 5GZZB 3APSA 2R0GA 4NXIA 4NHWA 5DBQA 5JCGA 4ID0A 2YWMA 2MZCA 2PVQA 4KAEA 2FLSA 4K5RA 2XPDA 2G0FA 4WF5A 4CW9A 3ZZXA 4MPGA 1MDKA 3IRAA 1X9SB 2R4VA 3KH7A 5H5RA 1YY7A 3H4KA 4X43A 3A2WA 2C8UA 2N5BA 3GUSA 1SENA 1AAZA 3U6VA 2HXKA 1OKDA 4MP4A 1TDIA 1Z7RA 5ELGA 2K8SA 1LBKA 2H76A 1HD2A 4HZ2A 5B7CA 2V32A 2MBSA 3JCML 3FR3A 5JWQB 3GH9A 5DQYA 2VCZA 4PUFC 5A4WA 3A5WA 4ZBDA 1GTUA 1XVQA 5CREA 3F8UA 2PGTA 4TW5A 4V1Ap 4GCIA 4OO4A 3CYNA 1TI1A 5HR1A 1TK0B 4PURA 5DCGA 1JLWA 22GSA 1I9DA 2CX3A 2LNTA 2I1UA 4IELA 2HFDA 1WIKA 2NDOA 2GSRA 4IKHA 3GL3A 2RUFA 3FY7A 2HE3A 1PL2A 1ILOA 3M1GA 1FAAA 1EP7A 3QOUA 4Q5RA 5EL8A 1SJZA 2VM2A 2X8HA 1ERVA 4EIPA 1QFNA 1SKWB 2FWFA 5B6NA 1XWGA 2B7JA 4EDZA 2HRAA 3EC3A 1F2EA 1GNEA 2NBSA 2D2ZA 5KN0A 4HU7A 2K9FA 4L5OA 1O73A 2QSIA 4JBBA 1XCCA 2GVPA 3DRNA 7GSSA 3HZ8A 1AXDA 4OFMA 3GA4A 3TRXA 1N2AA 3GMFA 2L59A 2LSTA 4Z2UA 1MTCA 3M9JA 4P3YB 1XWKA 4JEDA 4WF4A 3QR6A 5AN1A 1XW6A 3C1SA 4LL1B 5D9VA 3GX0A 4O5UA 2FWEA 3FKFA 3MNGA 4PNGA 4DSQA 2H19A 4PTSA 2DIZA 2K6VA 4FYBA 1A2MA 3ZYWA 2C80A 2WJUA 1X5DA 1N8JA 4JR6A 2DLXA 3ZVJA 3GYKA 1ERUA 2WS2A 2HRNA 2GZPA 4PGTA 4IGJA 2H6YA 4HS1A 1QUWA 2NVLA 2I4AA 1B48A 1EZKA 4IQ1A 5KN2A 5H5SA 1V57A 4DSRA 1GUKA 1S3RA 1RW1A 5IIZA 1ABAA 1OKTA 5F07A 3EU3A 4ZB6A 3HXSA 2L5LA 5ECLB 4XS6A 5ECMB 2H0IA 2VAFA 1XW5A 1PL1A 19GSA 1ACVA 3ME8A 4GLTA 4K7NA 1CQHA 4G9HA 2FA4A 2VCQA 4MABA 5J41A 3HCZA 1WMJA 1AC1A 4IP6A 4K7IA 1PX6A 2GSQA 2GQKA 5B6MA 2VL3A 4O5RA 1LU4A 3PINA 3D4TA 2DJKA 2GSSA 2ZCTA 4CY6A 1WWJA 3CSHA 3Q19A 3EYTA 1PRXA 1MD3A 4XCSA 1WP0A 3ERGA 4O92A 1GSYA 3HVXA 2HLSA 2CAQA 1X0RA 2HYXA 1MEKA 3D0ZA 1VRSD 1V58A 3O3TA 4TOPA 2IFQA 2ZNMA 9GSSA 2H01A 3HYPA 2RIIA 1B9YC 3IBHA 1GSEA 2VCTA 3IK7A 5EY6A 4PX1A 1M7TA 1GSFA 2JSYA 2YV9A 2UZ8A 2VIMA 3VURA 4KSOA 1S3CA 1YF1A 5GSSA 3FEUA 4L8EA 4OD7A 6GSYA 4IBPA 3GKKA 2I3YA 4POKA 3P7XA 2CVBA 4MNNA 1Y6EA 1T4YA 1YEPA 2B1KA 3TGZA 2IFQB 4Q5NA 5D9TA 4ZIJA 2B5XA 1KBNA 5D93A 3KTLA 4Q5QA 3UBLA 2R2JA 1M9AA 1ZGNA 8GSSA 5HFIA 1J08A 4WETA 4BVXA 3ME7A 1TU8A 4IJIA 5EVOA 3TKSA 1A0RP 2HT9A 2IL3A 3LEFA 4HEA2 3GV1A 3I69A 1WOUA 2JACA 2CZ3A 2K8VA 1GSSA 1U6TA 2C1YA 2CT6A 2LRTA 5KN3A 1PFOA 2GZYA 1W4VA 3L9UA 3O76A 3M0FA 3VFIA 2YJHA 5CRDA 1E6BA 3P8WA 2TRCP 2PBJA 1FVKA 1PMTA 3UARA 1MD4A 5HFGA 1EEMA 4BVXB 4AJ7A 4Z2TA 5AISA 3KMNA 3TJFA 1K3OA 3WGDA 4MF7A 3W6GA 4JRRA 5L71A 1FW1A 1FHEA 3TUEA 4GSNA 4TR1A 4PNFA 2H1DA 1SYRA 2IIYA 4ECIA 1YEXA 1Q98A 4GSSA 2L6CA 3CRTA 4IP1A 5ECRB 4I6XA 4A5PA 4E8EA 2CAIA 2E7PA 3GKNA 2BMXA 2DBCA 4XRDA 4RQRA 2KOKA 1M0UA 2H74A 2DIYA 3ZLPA 3D22A 4WR5A 2FGXA 2VLTA 3QPMA 2O87A 3M9KA 1Z5YE 3G7IA 4KUNA 4Z2RA 2WZ9A 5G1LA 4HI7A 4V2MA 4CHSA 4TXVA 2P31A 3HDCA 4TR1B 4O5QA 1TU7A 3CSIA 2HSYA 3NZNA 2YZHA 1ZOFA 4NHZA 1YZXA 2WCIA 2C0EA 3Q6OA 5IQYA 1X9MB 2GZZA 4EVMA 3GNJA 2GSTA 2N5AA 2R6KA 3EWLA 3F6DA 2VCXA 1PN0A 4RQXA 1EP8A 5A4VA 4X1UA 2WULA 5IMCA 4F9ZA 4FO5A 1XVWA 4XIHA 2B6MA 1TK8B 1SU9A 2LJAA 5E4WA 3ZTLA 4HJ2A 3ZITA 2TIRA 4MZCA 3DWVA 4F2IA 1I5GA 2J9HA 4YQUA 4OO5A
chains in the Genus database with same CATH topology
3IAM2 3E9JB 1SYXA 4KNDA 4IW9A 5IMVA 2PUKC 3C73A 1B4QA 5AIXA 1FG4A 1FVJA 4NMUA 4G0KA 3UEMA 4V2LA 5ENUA 1S3AA 3H79A 1NM3A 4MH2A 3F9UA 3TCOA 2OE3A 3EVIA 4K7OA 5ECIB 3QFAC 2PWJA 2QGVA 1G7EA 4IVFA 3F4TA 3IXRA 1TW9A 3H1NA 3F63A 5DJMA 4GRFA 2FHEA 2RLIA 3V1WA 4K9ZA 1U3IA 3DD3A 3ZRDA 1R26A 3H8QA 4GSTA 3D21A 1H75A 2PU9C 5ABRA 2AJQB 3ZFBA 2CA8A 2H73A 4PQIA 2F9SA 3LGCA 5AGYA 3KZQA 2JZSA 1ZMAA 2G2QA 4L5LA 3KM6A 2XPEA 3IAS2 5G30A 1XOAA 4OCEA 3L9SA 2C3TA 3DIEA 1UN2A 4WEYA 3MDKA 5ECOB 4ECJA 2VOCA 5FT3A 4NV2A 2GS3A 2GT5A 2RUEA 1KTEA 3PPUA 3ZMLA 4AGSA 1V2AA 3TJJA 3ISOA 1TKDB 2CX4A 5CAXA 4N0VA 4GTUA 4PUAA 3KXOA 5INYA 1Z9HA 3GKMA 4K1FA 2EIRA 1A23A 5ECKB 4XTSA 3L4NA 3C1RA 5IPGA 1FOVA 3A2VA 3LYPA 2JZTA 4EUYA 4N10A 4F0BA 1O7UA 3ERFA 3LSZA 1U88A 3IK9A 4XRAA 1PA3A 4D73A 4GF0A 4WR4A 1YF0A 2GQMA 3LW9A 1JZOA 2RM6A 2L6DA 4TKYA 4HJMA 4YAVA 5HFKA 2XBIA 1YKCA 3UJ1A 1GTIA 1UA5A 4OCFA 1XWCA 2AV4A 20GSA 1FB0A 2KUCA 4MA9A 1XZOA 2B5YA 4OMVA 1G6WA 2H30A 4AJ6A 1G0TA 2E2GA 1T4ZA 2O7KA 4X0XA 2CVDA 3CSJA 4MK3A 3BBYA 4D73B 6GSTA 2OBKA 1VF4A 2O8VB 5CP1A 2YOIA 2H1GA 3KP8A 2OKAA 3IHQA 4YH2A 2C0GA 2JL4A 1F3BA 1X5EA 1SJ6A 3TKSE 1DUGA 3TKSC 4HU9A 6GSSA 4XS1A 1SKRB 3G9BA 3IE3A 2GDRA 4KCAA 4TR3A 1YDKA 4N30A 3VK9A 1YQ1A 2H8LA 4GWRA 2PN8A 3IC4A 4WBJA 1PQNA 4KH7A 2O89A 1A8YA 1EV4A 5C00A 4LMVA 1THXA 3VI5A 4IS0A 3UAPA 4L0WA 3M3MA 4JU5A 4L0UA 1BX9A 1SK2A 3NOFA 4HZ4A 1NHYA 4FYUA 3W8SA 4ML6A 2H0HA 2YANA 2VD1A 4X4JA 1EOHA 3APOA 1MDIA 5F0GA 1K0MA 5ELAA 1O81A 1ZYPA 4NWYA 4TR0A 3MSZA 1G6YA 2DMLA 2LV3A 1PD21 3FR6A 2FNOA 4EF0A 1QQ2A 3FZAA 3UMAA 2TRXA 1KNGA 1A0FA 2HZFA 3FR9A 1T3BA 1X5CA 2YJ7A 4ILFA 3US3A 1TI3A 2H71A 2L5OA 4OWYA 2R3XA 3VLNA 3FK8A 2QC7A 3DGQA 3FMWA 4MPFA 2OBIA 3LXTA 1AW9A 4MJBA 3N9JA 3RDWA 2N5FA 2VL2A 2FCHA 3L9VA 2X64A 1BJXA 6GSUA 4ICYA 1DBYA 4ZILA 2I9HA 1QXHA 2PVOC 2FD3A 5J5NA 1DE2A 3IA1A 4GQCA 5D73A 5JWOB 4Z7XA 1Z6NA 5DDLA 1SL1B 1M9BA 4EIQA 1GUHA 4KDXA 4YQMA 3Q18A 2JADA 3UIWA 1AQXA 2HRKA 3BD2A 3CBUA 3DVWA 1BG5A 4POMA 11GSA 3ZVJD 3FRCA 1B8XA 1NHOA 2FWGA 2FA8A 4EL1A 2K18A 3UL3A 4KCEA 1MDJA 3MYDA 4BPYA 3SWLA 1WE0A 2DKIA 3CRUA 4IJ3A 4V2NA 2P5QA 4E8HA 2LEGA 2KP2A 5ECSA 3GFKA 2YCDA 4J2FA 4LA1A 3LWAA 4TVEA 5HR2A 3GIXA 1Z3EA 1J0FA 1F3AA 3ZFLA 1R5PA 4NAXA 4EKZA 4F0CA 1ERWA 5DALA 2EC4A 5EPFA 1VF3A 1NW2A 4G10A 1R4WA 3M8NA 2VLUA 5IMZA 1IYHA 1C72A 4CDOA 3MIXA 1K0OA 2H0GA 1TOFA 3TDGA 1LJRA 4K0NA 3IPZA 3VWUA 3APQA 1U3AA 3IHGA 2PMTA 3RAZA 4LL4B 1GH2A 2AUVA 5DALB 1ZYNA 4IHUA 2ES7A 5JCWA 3TKRA 1OE8A 1XBSA 4J57E 1HYUA 1XW9A 1Z6MA 3QAGA 3ED3A 3H93A 4YKFA 3ZREA 3HA9A 2OADA 3G7YA 1EGRA 3R3EA 4XHMA 1GP1A 1O85A 4G0IA 2DJ0A 3ERWA 4CY8A 3GSTA 5DQSA 2RM5A 4EC0A 2E0QA 3GHAA 5HQPA 4YAPA 3QMXA 3KH9A 1M2AA 3KMOA 3TB2A 1SD9A 2OE0A 2LS5A 4LLRA 4KW6A 1QGVA 1QK8A 4ZXGA 3BCIA 5CRWA 3VWXA 4ZB8A 1ERTA 2KLXA 4OFTA 3ZL5A 4KSMA 1A2JA 4FYCA 3FZ9A 3SBCA 1RK4A 5F8BA 5IOXA 1X9WB 2ON7A 2IN3A 5CNWA 5KEJA 3PR8A 1V98A 4DVCA 2WFCA 1XWAA 4KGIA 5BMUA 1UC7A 1E2YA 3C8EA 4FH8A 3LJRA 5ECQB 4TRXA 1H4OA 1JZRA 1YKAA 2MMNA 2PERA 4YKGA 3K8NA 3PGTA 1A24A 4BL7A 3GKXA 3IOSA 1ZZYA 4NV5A 3WT1A 4MH3A 3VPTA 1OE7A 5IOWA 3LG6A 2NTOA 3TJGA 3HD5A 2DJ2A 4GXZA 5E59A 1GTBA 3F3QA 4GQFA 3HKRA 4MLYA 3HY2A 1KEBA 3QDNA 1GULA 4WBRD 1K0AA 4IN0A 16GSA 1V9WA 2L57A 2OJLA 5KOWA 3RBTA 5AIVA 1AIUA 2C0DA 5KOXA 1ML6A 1SD8A 2QA1A 3GH6A 3LQ7A 4MZWA 4QL9A 4KX4A 3BOAA 3ZIJA 1BAYA 1JHBA 4DSSA 5LD0A 2OACA 4ZB9A 4BL7B 3MAKA 1WPIA 4ISDA 3EINA 2YV7A 5CO3A 1T8EB 1HQOA 5G1KA 2V6KA 1GL8A 5BRTA 2LJKA 4ZL9A 3A3TA 2B7KA 3TOTA 2M80A 2CVKA 3W8JA 2V41A 3QD9A 1K0NA 5GSTA 3DMLA 5DJLA 1DE1A 2R0PA 1USBA 2VCVA 4I8BA 4DSSB 5J9CA 2B3SA 1TTZA 2VL2C 2MMAA 2GT6A 1XWBA 2VD0A 1SK0A 3UVHA 1K3LA 2XBQA 2V6OA 3P2AA 5J3RA 2JSZA 4MCUA 2DC5A 1GUMA 3HVSA 1A2LA 3EU4A 2A4VA 3I43A 2LJRA 4BVYA 4EXJA 3C7MA 4QL7A 3DKSA 4EDYA 4K2XA 2A2SA 3DYRA 4YQVA 4HQSA 1RQMA 5IPHA 4KB3A 1J9BA 3GX8A 2VLVA 4N0ZA 3J7Yb 2LKUA 1TRUA 2AB6A 2P0GA 1T00A 3F3RA 3KP9A 3IDVA 4MF5A 2C0FA 3UOMA 4K6XA 3BJ5A 4KF9A 4BVYB 1CQGA 1GNWA 3FZ5A 2YWIA 2LQOA 2REMA 4HDEA 2J23A 5DVBA 1F37A 1M2BA 3VPQA 4PXOA 1XPVA 3TKQA 2F8AA 4MJAA 2O85A 6GSVA 1EWXA 1VF1A 2M72A 2B5EA 5C04A 3EMXA 2LNSA 1K0BA 4ZBAA 2LQQA 2LRCA 2A4HA 4JR4A 3WGXA 3VI7A 5LCZA 1JZDA 3GRXA 1Q4JA 2BJXA 4K2DA 1W89A 1XFLA 3KJYA 3RPPA 2NPBA 3I6AA 1OVNA 3LXZA 1THOA 2DMMA 2FY6A 3VWVA 3TOUA 2IPAA 5IMFA 1PKZA 3HJPA 3LORA 2A2RA 3EURA 2VCWA 1PSQA 3A2XA 2E2MA 4IQAA 3NIVA 4LMWA 3GURA 2VO4A 4ZBBA 2FUG2 3ZMKA 2OA7A 5A4UA 3I9V2 3E3EA 3WT2A 5IMDA 2KHPA 2JZRA 1GTAA 1YJ6A 2LRNA 1IYIA 1BYEA 1R5AA 1AUCA 4RI7A 5G5FA 1QMVA 2H6ZA 5G31A 4KE3A 4RI6A 1G7OA 2ON5A 2AHEA 4I2TA 2JU5A 1ZYQB 3HVVA 4OFNA 3KEBA 5DCHA 3N5OA 5CRGA 3FW2A 1FB6A 2MBTA 2LTKA 2H1AA 2YP6A 1SKSB 2CZ2A 1TXXA 2IMDA 1OC3A 3EE2A 5B8BA 2IWTA 3KIJA 3TRPA 3OR5A 5D9XA 2WGRA 4BA7A 3GN3A 4K0GA 2IMKA 2C3QA 1PN9A 5H5QA 1SL2B 3QFBC 5B8AA 1F6MC 2EIQA 5CYYA 4F03A 4O7HA 4ZL8A 4FQUA 4TXOA 2X8GA 1AQVA 3CXGA 3UBKA 2MMZA 5GAPD 3QCPA 1WJKA 1BEDA 4WXTA 4ACSA 2Z9SA 4MDCA 3FYGA 3CTFA 1Z7PA 1TK5B 5IO0A 2HNLA 4AF2A 3F6FA 1ZCPA 5FHIA 1XXUA 4POLA 3RPNA 2BTOT 2H6XA 10GSA 4TR4A 1B9XC 2WB9A 5ID2A 3DEXA 2GLRA 4TXOB 5COHA 3F4SA 3IV4A 2YNXA 1OC8A 4HUAA 5J9BA 2YZUA 4F82A 3TKPA 4AJ8A 17GSA 1B4PA 1GRXA 3F4RA 1JLVA 4QQ7A 3IC8A 5IM9A 3RHCA 3WYWA 3LFLA 5D96A 2R0CA 2YPMA 5J4UA 1XIYA 3KTBA 2H70A 2QKEA 2X99A 3CTGA 4N11A 2DJJA 5A5KA 3KD0A 5ID2B 2HZEA 2YN1A 3FZ4A 2VUPA 2HRFA 2DKHA 2PPTA 2XHFA 4USSA 1O8XA 1TRVA 2WDUA 1AQWA 3HHVA 13GSA 5CRHA 3A5IA 4K8MA 4DEJA 3PH9A 1EEJA 4RUVA 3C71A 1U87A 2X4AA 3VWWA 4G2EA 3BCKA 3QAVA 3TJBA 2GGTA 3D4MA 4G19A 3IR4A 2ALBA 4Q5FA 3CMIA 4I5QA 1GSUA 2HZEB 1M99A 2C4JA 3EPTA 4KDUA 18GSA 4ECBA 3D5JA 4MJCA 4ECCA 1DSBA 2AAWA 1HNAA 2L4QA 4J56E 4BWQA 1GSDA 1T7PB 3WGEA 2OE1A 2CV4A 2ZUPA 2H72A 3J7Yk 2CQ9A 3GL5A 4MZBA 1VGLA 2KP1A 4MJEA 1XOBA 3KCMA 2VL9A 3GSSA 2P5RA 1ZL9A 1FO5A 1GSQA 3DVXA 2I81A 2V2GA 3R2QA 1OAZA 1K0DA 1URMA 1VF2A 4G0LA 3RHBA 2LUSA 2VM1A 1OC9A 2DJ3A 3GTUA 1ZYEA 4O32A 5IO2A 2M46A 2H66A 4EE0A 3E0UA 4V1Ag 4JZQA 3TJKA 2HSMA 1PKWA 2MYGA 6GSXA 2IMIA 5ECHB 4XS4A 2GQLA 1TJDA 3MWHA 3DXBA 3L78A 4HOJA 6GSWA 4TN8A 2MMOA 1JFUA 5ECPB 3U5RE 3EMPA 3HJOA 2WRTA 3AY8A 3L0HA 1JZWA 2V1MA 1HNCA 1OC9B 2FWHA 1PX7A 1A8LA 3GTUB 3WD6A 4JE1A 4KA0A 4K5SA 2R5GA 2DJ1A 4PQHA 3HJMA 1EGOA 1BQ7A 5JWRB 1HNBA 1O6JA 2HI7A 3G7JA 4XS4B 5DAKA 1O8WA 3P90A 1UVZA 1TRWA 3QAWA 4ULXA 2XC2A 3Q74A 5GAND 4HQZA 2AYTA 1K3YA 1TRSA 2DSAA 5LNKe 1TP9A 2F8FA 1EV9A 3FHKA 4NPBA 1GLPA 2YWNA 1T1VA 3LYKA 4I2UA 3KGKA 5HR0A 2R37A 1WRYA 2IMEA 4KDYA 5KN1A 3HZ4A 14GSA 4H86A 2L4CA 5JCUA 2X49A 2YWOA 5DAKB 3O6TA 5ECNB 2HSHA 1PGTA 1GWCA 1Y25A 2C3NA 4POBA 5F05A 2H1BA 1ST9A 3ZIVA 5D8IA 12GSA 2QA2A 5G2ZA 1FOHA 2X8CA 3F0IA 2H75A 4EO3A 2IMFA 2A2PA 3D6IA 5D9WA 1EOGA 1M2DA 2IJYA 1R7HA 4ZL7A 2F3MA 1F9MA 5G5EA 1SK1A 3S9FA 3UVTA 5F06A 1OYJA 3TRQA 5IMAA 1GLQA 5HR3A 4PQ1A 5FWGA 4MF6A 1S3DA 1SJIA 4MMMA 1K0CA 4WKWA 1ON4A 2F51A 2GTUA 4I97A 4FIWA 1NSWA 1V40A 2B1LA 4ML1A 4BWSA 2EIOA 1SL0B 5GZZB 3APSA 2R0GA 4NXIA 4NHWA 5DBQA 5JCGA 4ID0A 2YWMA 2MZCA 2PVQA 4KAEA 2FLSA 4K5RA 2XPDA 2G0FA 4WF5A 4CW9A 3ZZXA 4MPGA 1MDKA 3IRAA 1X9SB 2R4VA 3KH7A 5H5RA 1YY7A 3H4KA 4X43A 3A2WA 2C8UA 2N5BA 3GUSA 1SENA 1AAZA 3U6VA 2HXKA 1OKDA 4MP4A 1TDIA 1Z7RA 5ELGA 2K8SA 1LBKA 2H76A 1HD2A 4HZ2A 5B7CA 2V32A 2MBSA 3JCML 3FR3A 5JWQB 3GH9A 5DQYA 2VCZA 4PUFC 5A4WA 3A5WA 4ZBDA 1GTUA 1XVQA 5CREA 3F8UA 2PGTA 4TW5A 4V1Ap 4GCIA 4OO4A 3CYNA 1TI1A 5HR1A 1TK0B 4PURA 5DCGA 1JLWA 22GSA 1I9DA 2CX3A 2LNTA 2I1UA 4IELA 2HFDA 1WIKA 2NDOA 2GSRA 4IKHA 3GL3A 2RUFA 3FY7A 2HE3A 1PL2A 1ILOA 3M1GA 1FAAA 1EP7A 3QOUA 4Q5RA 5EL8A 1SJZA 2VM2A 2X8HA 1ERVA 4EIPA 1QFNA 1SKWB 2FWFA 5B6NA 1XWGA 2B7JA 4EDZA 2HRAA 3EC3A 1F2EA 1GNEA 2NBSA 2D2ZA 5KN0A 4HU7A 2K9FA 4L5OA 1O73A 2QSIA 4JBBA 1XCCA 2GVPA 3DRNA 7GSSA 3HZ8A 1AXDA 4OFMA 3GA4A 3TRXA 1N2AA 3GMFA 2L59A 2LSTA 4Z2UA 1MTCA 3M9JA 4P3YB 1XWKA 4JEDA 4WF4A 3QR6A 5AN1A 1XW6A 3C1SA 4LL1B 5D9VA 3GX0A 4O5UA 2FWEA 3FKFA 3MNGA 4PNGA 4DSQA 2H19A 4PTSA 2DIZA 2K6VA 4FYBA 1A2MA 3ZYWA 2C80A 2WJUA 1X5DA 1N8JA 4JR6A 2DLXA 3ZVJA 3GYKA 1ERUA 2WS2A 2HRNA 2GZPA 4PGTA 4IGJA 2H6YA 4HS1A 1QUWA 2NVLA 2I4AA 1B48A 1EZKA 4IQ1A 5KN2A 5H5SA 1V57A 4DSRA 1GUKA 1RW1A 5IIZA 1ABAA 1OKTA 5F07A 3EU3A 4ZB6A 3HXSA 2L5LA 5ECLB 4XS6A 5ECMB 2H0IA 2VAFA 1XW5A 1PL1A 19GSA 1ACVA 3ME8A 4GLTA 4K7NA 1CQHA 4G9HA 2FA4A 2VCQA 4MABA 5J41A 3HCZA 1WMJA 1AC1A 4IP6A 4K7IA 1PX6A 2GSQA 2GQKA 5B6MA 2VL3A 4O5RA 1LU4A 3PINA 3D4TA 2DJKA 2GSSA 2ZCTA 4CY6A 1WWJA 3CSHA 3Q19A 3EYTA 1PRXA 1MD3A 4XCSA 1WP0A 3ERGA 4O92A 1GSYA 3HVXA 2HLSA 2CAQA 1X0RA 2HYXA 1MEKA 3D0ZA 1VRSD 1V58A 3O3TA 4TOPA 2IFQA 2ZNMA 9GSSA 2H01A 3HYPA 2RIIA 1B9YC 3IBHA 1GSEA 2VCTA 3IK7A 5EY6A 4PX1A 1M7TA 1GSFA 2JSYA 2YV9A 2UZ8A 2VIMA 3VURA 4KSOA 1S3CA 1YF1A 5GSSA 3FEUA 4L8EA 4OD7A 6GSYA 4IBPA 3GKKA 2I3YA 4POKA 3P7XA 2CVBA 4MNNA 1Y6EA 1T4YA 1YEPA 2B1KA 3TGZA 2IFQB 4Q5NA 5D9TA 4ZIJA 2B5XA 1KBNA 5D93A 3KTLA 4Q5QA 3UBLA 2R2JA 1M9AA 1ZGNA 8GSSA 5HFIA 1J08A 4WETA 4BVXA 3ME7A 1TU8A 4IJIA 5EVOA 3TKSA 1A0RP 2HT9A 2IL3A 3LEFA 4HEA2 3GV1A 3I69A 1WOUA 2JACA 2CZ3A 2K8VA 1GSSA 1U6TA 2C1YA 2CT6A 2LRTA 5KN3A 2GZYA 1W4VA 3L9UA 3O76A 3M0FA 3VFIA 2YJHA 5CRDA 1E6BA 3P8WA 2TRCP 2PBJA 1FVKA 1PMTA 3UARA 1MD4A 5HFGA 1EEMA 4BVXB 4AJ7A 4Z2TA 5AISA 3KMNA 3TJFA 1K3OA 3WGDA 4MF7A 3W6GA 4JRRA 5L71A 1FW1A 1FHEA 3TUEA 4GSNA 4TR1A 4PNFA 2H1DA 1SYRA 2IIYA 4ECIA 1YEXA 1Q98A 4GSSA 2L6CA 3CRTA 4IP1A 5ECRB 4I6XA 4A5PA 4E8EA 2CAIA 2E7PA 3GKNA 2BMXA 2DBCA 4XRDA 4RQRA 2KOKA 1M0UA 2H74A 2DIYA 3ZLPA 3D22A 4WR5A 2FGXA 2VLTA 3QPMA 2O87A 3M9KA 1Z5YE 3G7IA 4KUNA 4Z2RA 2WZ9A 5G1LA 4HI7A 4V2MA 4CHSA 4TXVA 2P31A 3HDCA 4TR1B 4O5QA 1TU7A 3CSIA 2HSYA 3NZNA 2YZHA 1ZOFA 4NHZA 1YZXA 2WCIA 2C0EA 3Q6OA 5IQYA 1X9MB 2GZZA 4EVMA 3GNJA 2GSTA 2N5AA 2R6KA 3EWLA 3F6DA 2VCXA 1PN0A 4RQXA 1EP8A 5A4VA 4X1UA 2WULA 5IMCA 4F9ZA 4FO5A 1XVWA 4XIHA 2B6MA 1TK8B 1SU9A 2LJAA 5E4WA 3ZTLA 4HJ2A 3ZITA 2TIRA 4MZCA 3DWVA 4F2IA 1I5GA 2J9HA 4YQUA 4OO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAM 2;  3E9J B;  1SYX A;  4KND A;  4IW9 A;  5IMV A;  2PUK C;  3C73 A;  1B4Q A;  5AIX A;  1FG4 A;  1FVJ A;  4NMU A;  3UEM A;  4V2L A;  5ENU A;  1S3A A;  3H79 A;  1NM3 A;  4MH2 A;  3F9U A;  3TCO A;  2OE3 A;  3EVI A;  4K7O A;  5ECI B;  3QFA C;  2PWJ A;  2QGV A;  1G7E A;  4IVF A;  3F4T A;  3IXR A;  1TW9 A;  3H1N A;  3F63 A;  5DJM A;  4GRF A;  2FHE A;  2RLI A;  3V1W A;  4K9Z A;  1U3I A;  3DD3 A;  3ZRD A;  1R26 A;  3H8Q A;  4GST A;  3D21 A;  1H75 A;  2PU9 C;  5ABR A;  2AJQ B;  3ZFB A;  2CA8 A;  2H73 A;  4PQI A;  2F9S A;  3LGC A;  5AGY A;  3KZQ A;  2JZS A;  1ZMA A;  2G2Q A;  4L5L A;  3KM6 A;  2XPE A;  3IAS 2;  5G30 A;  1XOA A;  4OCE A;  3L9S A;  2C3T A;  3DIE A;  1UN2 A;  5ECO B;  3MDK A;  4WEY A;  4ECJ A;  2VOC A;  5FT3 A;  4NV2 A;  2GS3 A;  2GT5 A;  2RUE A;  1KTE A;  3ZML A;  4AGS A;  1V2A A;  3TJJ A;  3ISO A;  1TKD B;  2CX4 A;  5CAX A;  4GTU A;  4N0V A;  4PUA A;  3KXO A;  5INY A;  1Z9H A;  3GKM A;  4K1F A;  2EIR A;  1A23 A;  5ECK B;  4XTS A;  3L4N A;  3C1R A;  5IPG A;  1FOV A;  3A2V A;  3LYP A;  2JZT A;  4EUY A;  4N10 A;  4F0B A;  1O7U A;  3ERF A;  3LSZ A;  1U88 A;  3IK9 A;  4XRA A;  1PA3 A;  4D73 A;  4GF0 A;  4WR4 A;  1YF0 A;  2GQM A;  1JZO A;  2RM6 A;  2L6D A;  4TKY A;  4HJM A;  4YAV A;  5HFK A;  2XBI A;  1YKC A;  3UJ1 A;  1GTI A;  1UA5 A;  4OCF A;  1XWC A;  2AV4 A;  20GS A;  1FB0 A;  2KUC A;  4MA9 A;  1XZO A;  2B5Y A;  4OMV A;  1G6W A;  2H30 A;  4AJ6 A;  1G0T A;  2E2G A;  1T4Z A;  2O7K A;  4X0X A;  2CVD A;  3CSJ A;  4MK3 A;  3BBY A;  4D73 B;  6GST A;  2OBK A;  1VF4 A;  2O8V B;  5CP1 A;  2YOI A;  2H1G A;  3KP8 A;  2OKA A;  3IHQ A;  4YH2 A;  2C0G A;  2JL4 A;  1F3B A;  1X5E A;  1SJ6 A;  3TKS E;  1DUG A;  3TKS C;  4HU9 A;  6GSS A;  4XS1 A;  1SKR B;  3G9B A;  3IE3 A;  2GDR A;  4KCA A;  4TR3 A;  1YDK A;  4N30 A;  3VK9 A;  1YQ1 A;  2H8L A;  4GWR A;  2PN8 A;  3IC4 A;  4WBJ A;  1PQN A;  4KH7 A;  2O89 A;  1A8Y A;  1EV4 A;  5C00 A;  4LMV A;  1THX A;  3VI5 A;  4IS0 A;  3UAP A;  4L0W A;  3M3M A;  4JU5 A;  4L0U A;  1BX9 A;  1SK2 A;  3NOF A;  4HZ4 A;  1NHY A;  4FYU A;  3W8S A;  4ML6 A;  2H0H A;  2YAN A;  2VD1 A;  1EOH A;  3APO A;  1MDI A;  5F0G A;  1K0M A;  5ELA A;  1O81 A;  4NWY A;  4TR0 A;  3MSZ A;  1G6Y A;  2DML A;  2LV3 A;  1PD2 1;  3FR6 A;  2FNO A;  4EF0 A;  1QQ2 A;  3FZA A;  3UMA A;  2TRX A;  1KNG A;  1A0F A;  2HZF A;  3FR9 A;  1T3B A;  1X5C A;  2YJ7 A;  4ILF A;  3US3 A;  1TI3 A;  2H71 A;  2L5O A;  4OWY A;  2R3X A;  3VLN A;  3FK8 A;  2QC7 A;  3DGQ A;  4MPF A;  2OBI A;  3LXT A;  1AW9 A;  4MJB A;  3N9J A;  3RDW A;  2N5F A;  2VL2 A;  2FCH A;  3L9V A;  2X64 A;  1BJX A;  6GSU A;  1DBY A;  4ZIL A;  2I9H A;  1QXH A;  2PVO C;  2FD3 A;  5J5N A;  1DE2 A;  3IA1 A;  4GQC A;  5D73 A;  5JWO B;  4Z7X A;  1Z6N A;  5DDL A;  1SL1 B;  1M9B A;  1GUH A;  4KDX A;  4YQM A;  3Q18 A;  2JAD A;  3UIW A;  1AQX A;  3BD2 A;  3CBU A;  3DVW A;  1BG5 A;  4POM A;  11GS A;  3ZVJ D;  3FRC A;  1B8X A;  1NHO A;  2FWG A;  2FA8 A;  4EL1 A;  2K18 A;  3UL3 A;  4KCE A;  1MDJ A;  4BPY A;  3SWL A;  1WE0 A;  3CRU A;  4IJ3 A;  4V2N A;  2P5Q A;  4E8H A;  2LEG A;  2KP2 A;  5ECS A;  3GFK A;  2YCD A;  4J2F A;  4LA1 A;  3LWA A;  4TVE A;  5HR2 A;  3GIX A;  1Z3E A;  1J0F A;  1F3A A;  3ZFL A;  1R5P A;  4NAX A;  4EKZ A;  4F0C A;  1ERW A;  5DAL A;  2EC4 A;  5EPF A;  1VF3 A;  1NW2 A;  4G10 A;  1R4W A;  3M8N A;  2VLU A;  5IMZ A;  1IYH A;  1C72 A;  4CDO A;  1K0O A;  2H0G A;  1TOF A;  3TDG A;  1LJR A;  4K0N A;  3IPZ A;  3VWU A;  3APQ A;  1U3A A;  2PMT A;  3RAZ A;  4LL4 B;  1GH2 A;  2AUV A;  5DAL B;  4IHU A;  2ES7 A;  5JCW A;  3TKR A;  1OE8 A;  1XBS A;  4J57 E;  1HYU A;  1XW9 A;  1Z6M A;  3QAG A;  3ED3 A;  3H93 A;  3ZRE A;  3HA9 A;  2OAD A;  3G7Y A;  1EGR A;  4XHM A;  1GP1 A;  1O85 A;  2DJ0 A;  3ERW A;  3GST A;  5DQS A;  2RM5 A;  4EC0 A;  2E0Q A;  3GHA A;  5HQP A;  4YAP A;  3QMX A;  3KH9 A;  1M2A A;  3KMO A;  3TB2 A;  1SD9 A;  2OE0 A;  2LS5 A;  4LLR A;  4KW6 A;  1QGV A;  1QK8 A;  4ZXG A;  3BCI A;  5CRW A;  3VWX A;  4ZB8 A;  1ERT A;  2KLX A;  4OFT A;  3ZL5 A;  4KSM A;  1A2J A;  4FYC A;  3FZ9 A;  3SBC A;  1RK4 A;  5F8B A;  5IOX A;  1X9W B;  2ON7 A;  2IN3 A;  5CNW A;  5KEJ A;  3PR8 A;  1V98 A;  4DVC A;  2WFC A;  1XWA A;  4KGI A;  1UC7 A;  1E2Y A;  3C8E A;  4FH8 A;  3LJR A;  5ECQ B;  4TRX A;  1H4O A;  1JZR A;  1YKA A;  2MMN A;  2PER A;  3K8N A;  3PGT A;  1A24 A;  4BL7 A;  3GKX A;  3IOS A;  1ZZY A;  4NV5 A;  3WT1 A;  4MH3 A;  3VPT A;  1OE7 A;  5IOW A;  3LG6 A;  2NTO A;  3TJG A;  3HD5 A;  2DJ2 A;  4GXZ A;  5E59 A;  1GTB A;  3F3Q A;  4GQF A;  3HKR A;  4MLY A;  3HY2 A;  1KEB A;  3QDN A;  1GUL A;  4WBR D;  1K0A A;  4IN0 A;  16GS A;  1V9W A;  2L57 A;  2OJL A;  3RBT A;  5AIV A;  1AIU A;  2C0D A;  1ML6 A;  1SD8 A;  3GH6 A;  3LQ7 A;  4MZW A;  4QL9 A;  4KX4 A;  3BOA A;  3ZIJ A;  1BAY A;  1JHB A;  4DSS A;  5LD0 A;  2OAC A;  4ZB9 A;  3MAK A;  1WPI A;  4ISD A;  3EIN A;  2YV7 A;  5CO3 A;  1T8E B;  1HQO A;  5G1K A;  2V6K A;  1GL8 A;  2LJK A;  4ZL9 A;  3A3T A;  2B7K A;  3TOT A;  2M80 A;  2CVK A;  3W8J A;  2V41 A;  3QD9 A;  1K0N A;  5GST A;  3DML A;  5DJL A;  1DE1 A;  1USB A;  2VCV A;  4I8B A;  4DSS B;  5J9C A;  2B3S A;  1TTZ A;  2VL2 C;  2MMA A;  2GT6 A;  1XWB A;  2VD0 A;  1SK0 A;  3UVH A;  1K3L A;  2XBQ A;  2V6O A;  3P2A A;  5J3R A;  2JSZ A;  4MCU A;  2DC5 A;  1GUM A;  3HVS A;  1A2L A;  3EU4 A;  2A4V A;  3I43 A;  2LJR A;  4BVY A;  4EXJ A;  3C7M A;  4QL7 A;  3DKS A;  4EDY A;  2A2S A;  3DYR A;  4YQV A;  4HQS A;  1RQM A;  5IPH A;  4KB3 A;  1J9B A;  3GX8 A;  2VLV A;  4N0Z A;  3J7Y b;  2LKU A;  1TRU A;  2AB6 A;  2P0G A;  1T00 A;  3F3R A;  3KP9 A;  3IDV A;  4MF5 A;  2C0F A;  3UOM A;  4K6X A;  3BJ5 A;  1CQG A;  1GNW A;  3FZ5 A;  2YWI A;  2LQO A;  2REM A;  4HDE A;  5DVB A;  2J23 A;  1F37 A;  1M2B A;  3VPQ A;  4PXO A;  1XPV A;  3TKQ A;  2F8A A;  4MJA A;  2O85 A;  6GSV A;  1EWX A;  1VF1 A;  2M72 A;  2B5E A;  5C04 A;  3EMX A;  2LNS A;  1K0B A;  4ZBA A;  2LQQ A;  2LRC A;  4JR4 A;  3WGX A;  3VI7 A;  5LCZ A;  1JZD A;  3GRX A;  1Q4J A;  2BJX A;  4K2D A;  1W89 A;  1XFL A;  3KJY A;  3RPP A;  2NPB A;  3I6A A;  1OVN A;  3LXZ A;  1THO A;  2DMM A;  2FY6 A;  3VWV A;  3TOU A;  2IPA A;  5IMF A;  1PKZ A;  3HJP A;  3LOR A;  2A2R A;  3EUR A;  2VCW A;  1PSQ A;  3A2X A;  2E2M A;  4IQA A;  3NIV A;  4LMW A;  3GUR A;  2VO4 A;  4ZBB A;  2FUG 2;  3ZMK A;  2OA7 A;  5A4U A;  3I9V 2;  3E3E A;  3WT2 A;  5IMD A;  2KHP A;  2JZR A;  1GTA A;  1YJ6 A;  2LRN A;  1IYI A;  1BYE A;  1R5A A;  1AUC A;  4RI7 A;  5G5F A;  1QMV A;  2H6Z A;  5G31 A;  4KE3 A;  4RI6 A;  1G7O A;  2ON5 A;  2AHE A;  4I2T A;  2JU5 A;  1ZYQ B;  3HVV A;  4OFN A;  3KEB A;  5DCH A;  3N5O A;  5CRG A;  3FW2 A;  1FB6 A;  2MBT A;  2LTK A;  2H1A A;  2YP6 A;  1SKS B;  2CZ2 A;  1TXX A;  2IMD A;  1OC3 A;  3EE2 A;  5B8B A;  2IWT A;  3KIJ A;  3TRP A;  3OR5 A;  5D9X A;  2WGR A;  4BA7 A;  3GN3 A;  4K0G A;  2IMK A;  2C3Q A;  1PN9 A;  5H5Q A;  1SL2 B;  3QFB C;  5B8A A;  1F6M C;  2EIQ A;  5CYY A;  4F03 A;  4O7H A;  4ZL8 A;  4TXO A;  2X8G A;  1AQV A;  3CXG A;  3UBK A;  2MMZ A;  5GAP D;  3QCP A;  1WJK A;  1BED A;  4WXT A;  4ACS A;  2Z9S A;  4MDC A;  3FYG A;  3CTF A;  1Z7P A;  1TK5 B;  5IO0 A;  2HNL A;  4AF2 A;  3F6F A;  1ZCP A;  5FHI A;  1XXU A;  4POL A;  3RPN A;  2BTO T;  2H6X A;  10GS A;  4TR4 A;  1B9X C;  2WB9 A;  5ID2 A;  3DEX A;  2GLR A;  4TXO B;  5COH A;  3F4S A;  3IV4 A;  2YNX A;  1OC8 A;  4HUA A;  5J9B A;  2YZU A;  4F82 A;  3TKP A;  4AJ8 A;  17GS A;  1B4P A;  1GRX A;  3F4R A;  1JLV A;  4QQ7 A;  5IM9 A;  3RHC A;  3WYW A;  3LFL A;  5D96 A;  2YPM A;  5J4U A;  1XIY A;  3KTB A;  2H70 A;  2QKE A;  2X99 A;  3CTG A;  4N11 A;  2DJJ A;  5A5K A;  3KD0 A;  5ID2 B;  2HZE A;  2YN1 A;  3FZ4 A;  2VUP A;  2HRF A;  2PPT A;  2XHF A;  1O8X A;  1TRV A;  2WDU A;  1AQW A;  3HHV A;  13GS A;  5CRH A;  4K8M A;  4DEJ A;  3PH9 A;  1EEJ A;  4RUV A;  3C71 A;  1U87 A;  3VWW A;  4G2E A;  3BCK A;  3QAV A;  3TJB A;  2GGT A;  3D4M A;  4G19 A;  3IR4 A;  2ALB A;  4Q5F A;  3CMI A;  4I5Q A;  1GSU A;  2HZE B;  1M99 A;  2C4J A;  4KDU A;  18GS A;  4ECB A;  3D5J A;  4MJC A;  4ECC A;  1DSB A;  2AAW A;  1HNA A;  2L4Q A;  4J56 E;  4BWQ A;  1GSD A;  1T7P B;  3WGE A;  2OE1 A;  2CV4 A;  2ZUP A;  2H72 A;  3J7Y k;  2CQ9 A;  3GL5 A;  4MZB A;  1VGL A;  2KP1 A;  4MJE A;  1XOB A;  3KCM A;  2VL9 A;  3GSS A;  2P5R A;  1ZL9 A;  1FO5 A;  1GSQ A;  3DVX A;  2I81 A;  2V2G A;  3R2Q A;  1OAZ A;  1K0D A;  1URM A;  1VF2 A;  3RHB A;  2LUS A;  2VM1 A;  1OC9 A;  2DJ3 A;  3GTU A;  1ZYE A;  4O32 A;  5IO2 A;  2M46 A;  2H66 A;  4EE0 A;  3E0U A;  4V1A g;  4JZQ A;  3TJK A;  1PKW A;  2MYG A;  6GSX A;  2IMI A;  5ECH B;  4XS4 A;  2GQL A;  1TJD A;  3MWH A;  3DXB A;  3L78 A;  4HOJ A;  6GSW A;  4TN8 A;  2MMO A;  1JFU A;  5ECP B;  3U5R E;  3EMP A;  3HJO A;  2WRT A;  3AY8 A;  3L0H A;  1JZW A;  2V1M A;  1HNC A;  1OC9 B;  2FWH A;  1PX7 A;  1A8L A;  3GTU B;  3WD6 A;  4JE1 A;  4KA0 A;  2R5G A;  2DJ1 A;  4PQH A;  3HJM A;  1EGO A;  1BQ7 A;  5JWR B;  1HNB A;  1O6J A;  2HI7 A;  3G7J A;  4XS4 B;  5DAK A;  1O8W A;  3P90 A;  1UVZ A;  1TRW A;  3QAW A;  4ULX A;  2XC2 A;  3Q74 A;  5GAN D;  4HQZ A;  2AYT A;  1K3Y A;  1TRS A;  2DSA A;  5LNK e;  1TP9 A;  2F8F A;  1EV9 A;  3FHK A;  4NPB A;  1GLP A;  2YWN A;  1T1V A;  3LYK A;  4I2U A;  3KGK A;  5HR0 A;  2R37 A;  1WRY A;  2IME A;  4KDY A;  5KN1 A;  3HZ4 A;  14GS A;  4H86 A;  2L4C A;  5JCU A;  2YWO A;  5DAK B;  3O6T A;  5ECN B;  2HSH A;  1PGT A;  1GWC A;  1Y25 A;  2C3N A;  4POB A;  5F05 A;  2H1B A;  1ST9 A;  3ZIV A;  5D8I A;  12GS A;  5G2Z A;  2X8C A;  3F0I A;  2H75 A;  4EO3 A;  2IMF A;  3D6I A;  5D9W A;  1EOG A;  1M2D A;  2IJY A;  1R7H A;  4ZL7 A;  2F3M A;  1F9M A;  5G5E A;  1SK1 A;  3S9F A;  3UVT A;  5F06 A;  1OYJ A;  3TRQ A;  5IMA A;  1GLQ A;  5HR3 A;  4PQ1 A;  5FWG A;  4MF6 A;  1S3D A;  1SJI A;  4MMM A;  1K0C A;  4WKW A;  1ON4 A;  2F51 A;  2GTU A;  4I97 A;  4FIW A;  1NSW A;  1V40 A;  2B1L A;  4ML1 A;  4BWS A;  2EIO A;  1SL0 B;  5GZZ B;  3APS A;  4NXI A;  4NHW A;  5DBQ A;  5JCG A;  4ID0 A;  2YWM A;  2MZC A;  2PVQ A;  4KAE A;  2FLS A;  2XPD A;  2G0F A;  4WF5 A;  4CW9 A;  3ZZX A;  4MPG A;  1MDK A;  3IRA A;  1X9S B;  2R4V A;  3KH7 A;  5H5R A;  1YY7 A;  3H4K A;  4X43 A;  3A2W A;  2C8U A;  2N5B A;  3GUS A;  1SEN A;  1AAZ A;  3U6V A;  2HXK A;  1OKD A;  4MP4 A;  1TDI A;  1Z7R A;  5ELG A;  2K8S A;  1LBK A;  2H76 A;  1HD2 A;  4HZ2 A;  5B7C A;  2V32 A;  2MBS A;  3JCM L;  3FR3 A;  5JWQ B;  3GH9 A;  5DQY A;  2VCZ A;  4PUF C;  5A4W A;  3A5W A;  4ZBD A;  1GTU A;  1XVQ A;  5CRE A;  3F8U A;  2PGT A;  4TW5 A;  4V1A p;  4GCI A;  4OO4 A;  3CYN A;  1TI1 A;  5HR1 A;  1TK0 B;  4PUR A;  5DCG A;  1JLW A;  22GS A;  1I9D A;  2CX3 A;  2LNT A;  2I1U A;  4IEL A;  2HFD A;  1WIK A;  2NDO A;  2GSR A;  4IKH A;  3GL3 A;  2RUF A;  3FY7 A;  2HE3 A;  1PL2 A;  1ILO A;  3M1G A;  1FAA A;  1EP7 A;  3QOU A;  4Q5R A;  5EL8 A;  1SJZ A;  2VM2 A;  2X8H A;  1ERV A;  1QFN A;  1SKW B;  2FWF A;  5B6N A;  1XWG A;  2B7J A;  4EDZ A;  3EC3 A;  1F2E A;  1GNE A;  2NBS A;  2D2Z A;  5KN0 A;  4HU7 A;  2K9F A;  4L5O A;  1O73 A;  2QSI A;  4JBB A;  1XCC A;  2GVP A;  3DRN A;  7GSS A;  3HZ8 A;  1AXD A;  4OFM A;  3GA4 A;  3TRX A;  1N2A A;  3GMF A;  2L59 A;  2LST A;  1MTC A;  3M9J A;  4P3Y B;  1XWK A;  4JED A;  4WF4 A;  3QR6 A;  5AN1 A;  1XW6 A;  3C1S A;  4LL1 B;  5D9V A;  3GX0 A;  2FWE A;  3FKF A;  3MNG A;  4PNG A;  4DSQ A;  2H19 A;  2DIZ A;  2K6V A;  4FYB A;  1A2M A;  3ZYW A;  2C80 A;  2WJU A;  1X5D A;  1N8J A;  4JR6 A;  2DLX A;  3ZVJ A;  3GYK A;  1ERU A;  2WS2 A;  2HRN A;  2GZP A;  4IGJ A;  4PGT A;  2H6Y A;  4HS1 A;  1QUW A;  2NVL A;  2I4A A;  1B48 A;  1EZK A;  4IQ1 A;  5KN2 A;  5H5S A;  1V57 A;  4DSR A;  1GUK A;  1RW1 A;  5IIZ A;  1ABA A;  1OKT A;  5F07 A;  3EU3 A;  4ZB6 A;  3HXS A;  2L5L A;  5ECL B;  4XS6 A;  5ECM B;  2H0I A;  2VAF A;  1XW5 A;  1PL1 A;  19GS A;  1ACV A;  3ME8 A;  4GLT A;  4K7N A;  1CQH A;  4G9H A;  2FA4 A;  2VCQ A;  4MAB A;  5J41 A;  3HCZ A;  1WMJ A;  1AC1 A;  4IP6 A;  4K7I A;  1PX6 A;  2GSQ A;  2GQK A;  5B6M A;  2VL3 A;  4O5R A;  1LU4 A;  3PIN A;  3D4T A;  2DJK A;  2GSS A;  2ZCT A;  1WWJ A;  3CSH A;  3Q19 A;  3EYT A;  1PRX A;  1MD3 A;  4XCS A;  1WP0 A;  3ERG A;  4O92 A;  1GSY A;  3HVX A;  2HLS A;  2CAQ A;  1X0R A;  2HYX A;  1MEK A;  3D0Z A;  1VRS D;  1V58 A;  3O3T A;  4TOP A;  2IFQ A;  2ZNM A;  9GSS A;  2H01 A;  3HYP A;  2RII A;  1B9Y C;  3IBH A;  1GSE A;  2VCT A;  3IK7 A;  5EY6 A;  4PX1 A;  1M7T A;  1GSF A;  2JSY A;  2YV9 A;  2VIM A;  3VUR A;  4KSO A;  1S3C A;  1YF1 A;  5GSS A;  3FEU A;  4L8E A;  4OD7 A;  6GSY A;  4IBP A;  3GKK A;  2I3Y A;  4POK A;  3P7X A;  2CVB A;  1Y6E A;  1T4Y A;  1YEP A;  2B1K A;  3TGZ A;  2IFQ B;  4Q5N A;  5D9T A;  4ZIJ A;  2B5X A;  1KBN A;  5D93 A;  3KTL A;  4Q5Q A;  3UBL A;  2R2J A;  1M9A A;  1ZGN A;  8GSS A;  5HFI A;  1J08 A;  4WET A;  4BVX A;  3ME7 A;  1TU8 A;  4IJI A;  5EVO A;  3TKS A;  1A0R P;  2HT9 A;  2IL3 A;  3LEF A;  4HEA 2;  3GV1 A;  3I69 A;  1WOU A;  2JAC A;  2CZ3 A;  2K8V A;  1GSS A;  1U6T A;  2C1Y A;  2CT6 A;  2LRT A;  5KN3 A;  2GZY A;  1W4V A;  3L9U A;  3O76 A;  3M0F A;  3VFI A;  2YJH A;  5CRD A;  1E6B A;  3P8W A;  2TRC P;  2PBJ A;  1FVK A;  1PMT A;  3UAR A;  1MD4 A;  5HFG A;  1EEM A;  4AJ7 A;  5AIS A;  3KMN A;  3TJF A;  1K3O A;  3WGD A;  4MF7 A;  3W6G A;  4JRR A;  5L71 A;  1FW1 A;  1FHE A;  3TUE A;  4GSN A;  4TR1 A;  4PNF A;  2H1D A;  1SYR A;  2IIY A;  4ECI A;  1YEX A;  1Q98 A;  4GSS A;  2L6C A;  3CRT A;  4IP1 A;  5ECR B;  4I6X A;  4E8E A;  2CAI A;  2E7P A;  3GKN A;  2BMX A;  2DBC A;  4XRD A;  4RQR A;  2KOK A;  1M0U A;  2H74 A;  2DIY A;  3ZLP A;  3D22 A;  4WR5 A;  2FGX A;  2VLT A;  3QPM A;  2O87 A;  3M9K A;  1Z5Y E;  3G7I A;  4KUN A;  2WZ9 A;  5G1L A;  4HI7 A;  4V2M A;  4CHS A;  4TXV A;  2P31 A;  3HDC A;  4TR1 B;  1TU7 A;  3CSI A;  2HSY A;  3NZN A;  2YZH A;  1ZOF A;  4NHZ A;  1YZX A;  2WCI A;  2C0E A;  3Q6O A;  5IQY A;  1X9M B;  2GZZ A;  4EVM A;  3GNJ A;  2GST A;  2N5A A;  2R6K A;  3EWL A;  3F6D A;  2VCX A;  4RQX A;  1EP8 A;  5A4V A;  4X1U A;  2WUL A;  5IMC A;  4F9Z A;  4FO5 A;  1XVW A;  4XIH A;  2B6M A;  1TK8 B;  1SU9 A;  2LJA A;  5E4W A;  3ZTL A;  4HJ2 A;  3ZIT A;  2TIR A;  4MZC A;  3DWV A;  4F2I A;  1I5G A;  2J9H A;  4YQU A;  4OO5 A; 
#chains in the Genus database with same CATH topology
 3IAM 2;  3E9J B;  1SYX A;  4KND A;  4IW9 A;  5IMV A;  2PUK C;  3C73 A;  1B4Q A;  5AIX A;  1FG4 A;  1FVJ A;  4NMU A;  4G0K A;  3UEM A;  4V2L A;  5ENU A;  1S3A A;  3H79 A;  1NM3 A;  4MH2 A;  3F9U A;  3TCO A;  2OE3 A;  3EVI A;  4K7O A;  5ECI B;  3QFA C;  2PWJ A;  2QGV A;  1G7E A;  4IVF A;  3F4T A;  3IXR A;  1TW9 A;  3H1N A;  3F63 A;  5DJM A;  4GRF A;  2FHE A;  2RLI A;  3V1W A;  4K9Z A;  1U3I A;  3DD3 A;  3ZRD A;  1R26 A;  3H8Q A;  4GST A;  3D21 A;  1H75 A;  2PU9 C;  5ABR A;  2AJQ B;  3ZFB A;  2CA8 A;  2H73 A;  4PQI A;  2F9S A;  3LGC A;  5AGY A;  3KZQ A;  2JZS A;  1ZMA A;  2G2Q A;  4L5L A;  3KM6 A;  2XPE A;  3IAS 2;  5G30 A;  1XOA A;  4OCE A;  3L9S A;  2C3T A;  3DIE A;  1UN2 A;  4WEY A;  3MDK A;  5ECO B;  4ECJ A;  2VOC A;  5FT3 A;  4NV2 A;  2GS3 A;  2GT5 A;  2RUE A;  1KTE A;  3PPU A;  3ZML A;  4AGS A;  1V2A A;  3TJJ A;  3ISO A;  1TKD B;  2CX4 A;  5CAX A;  4N0V A;  4GTU A;  4PUA A;  3KXO A;  5INY A;  1Z9H A;  3GKM A;  4K1F A;  2EIR A;  1A23 A;  5ECK B;  4XTS A;  3L4N A;  3C1R A;  5IPG A;  1FOV A;  3A2V A;  3LYP A;  2JZT A;  4EUY A;  4N10 A;  4F0B A;  1O7U A;  3ERF A;  3LSZ A;  1U88 A;  3IK9 A;  4XRA A;  1PA3 A;  4D73 A;  4GF0 A;  4WR4 A;  1YF0 A;  2GQM A;  3LW9 A;  1JZO A;  2RM6 A;  2L6D A;  4TKY A;  4HJM A;  4YAV A;  5HFK A;  2XBI A;  1YKC A;  3UJ1 A;  1GTI A;  1UA5 A;  4OCF A;  1XWC A;  2AV4 A;  20GS A;  1FB0 A;  2KUC A;  4MA9 A;  1XZO A;  2B5Y A;  4OMV A;  1G6W A;  2H30 A;  4AJ6 A;  1G0T A;  2E2G A;  1T4Z A;  1M3I A;  2O7K A;  4X0X A;  2CVD A;  3CSJ A;  4MK3 A;  3BBY A;  4D73 B;  6GST A;  2OBK A;  1VF4 A;  2O8V B;  5CP1 A;  2YOI A;  2H1G A;  3KP8 A;  2OKA A;  3IHQ A;  4YH2 A;  2C0G A;  2JL4 A;  1F3B A;  1X5E A;  1SJ6 A;  3TKS E;  1DUG A;  3TKS C;  4HU9 A;  6GSS A;  4XS1 A;  1SKR B;  3G9B A;  3IE3 A;  2GDR A;  4KCA A;  4TR3 A;  1YDK A;  4N30 A;  3VK9 A;  1YQ1 A;  2H8L A;  4GWR A;  2PN8 A;  3IC4 A;  4WBJ A;  1PQN A;  4KH7 A;  2O89 A;  1A8Y A;  1EV4 A;  5C00 A;  4LMV A;  1THX A;  3VI5 A;  4IS0 A;  3UAP A;  4L0W A;  3M3M A;  4JU5 A;  1XG8 A;  4L0U A;  1BX9 A;  1SK2 A;  3NOF A;  4HZ4 A;  1NHY A;  4FYU A;  3W8S A;  4ML6 A;  2H0H A;  2YAN A;  2VD1 A;  4X4J A;  1EOH A;  3APO A;  1MDI A;  5F0G A;  1K0M A;  5ELA A;  1O81 A;  1ZYP A;  4NWY A;  4TR0 A;  3MSZ A;  1M3J A;  1G6Y A;  2DML A;  2LV3 A;  1PD2 1;  3FR6 A;  2FNO A;  4EF0 A;  1QQ2 A;  3FZA A;  3UMA A;  2TRX A;  1KNG A;  1A0F A;  2HZF A;  3FR9 A;  1T3B A;  1X5C A;  2YJ7 A;  4ILF A;  3US3 A;  1TI3 A;  2H71 A;  2L5O A;  4OWY A;  2R3X A;  3VLN A;  3FK8 A;  2QC7 A;  3DGQ A;  3FMW A;  4MPF A;  2OBI A;  3LXT A;  1AW9 A;  4MJB A;  3N9J A;  3RDW A;  2N5F A;  2VL2 A;  2FCH A;  3L9V A;  2X64 A;  1BJX A;  6GSU A;  4ICY A;  1DBY A;  4ZIL A;  2I9H A;  1QXH A;  2PVO C;  2FD3 A;  5J5N A;  1DE2 A;  3IA1 A;  4GQC A;  5D73 A;  5JWO B;  4Z7X A;  1Z6N A;  5DDL A;  1SL1 B;  4HSC X;  1M9B A;  4EIQ A;  1GUH A;  4KDX A;  4YQM A;  3Q18 A;  2JAD A;  3UIW A;  1AQX A;  2HRK A;  3BD2 A;  3CBU A;  3DVW A;  1BG5 A;  4POM A;  11GS A;  3ZVJ D;  3FRC A;  1B8X A;  1NHO A;  2FWG A;  2FA8 A;  4EL1 A;  2K18 A;  3UL3 A;  4KCE A;  1MDJ A;  3MYD A;  4BPY A;  3SWL A;  1WE0 A;  2DKI A;  3CRU A;  4IJ3 A;  4V2N A;  2P5Q A;  4E8H A;  2LEG A;  2KP2 A;  5ECS A;  3GFK A;  2YCD A;  4J2F A;  4LA1 A;  3LWA A;  4TVE A;  5HR2 A;  3GIX A;  1Z3E A;  1J0F A;  1F3A A;  3ZFL A;  1R5P A;  4NAX A;  4EKZ A;  4F0C A;  1ERW A;  5DAL A;  2EC4 A;  5EPF A;  1VF3 A;  1NW2 A;  4G10 A;  1R4W A;  3M8N A;  2VLU A;  5IMZ A;  1IYH A;  1C72 A;  4CDO A;  3MIX A;  1K0O A;  2H0G A;  1TOF A;  3TDG A;  1LJR A;  4K0N A;  3IPZ A;  3VWU A;  3APQ A;  1U3A A;  3IHG A;  2PMT A;  3RAZ A;  4LL4 B;  1GH2 A;  2AUV A;  5DAL B;  1ZYN A;  4IHU A;  2ES7 A;  5JCW A;  3TKR A;  1OE8 A;  1XBS A;  4J57 E;  1HYU A;  1XW9 A;  1Z6M A;  3QAG A;  3ED3 A;  3H93 A;  4YKF A;  3ZRE A;  3HA9 A;  2OAD A;  3G7Y A;  1EGR A;  3R3E A;  4XHM A;  1GP1 A;  1O85 A;  4G0I A;  2DJ0 A;  3ERW A;  4CY8 A;  3GST A;  5DQS A;  2RM5 A;  4EC0 A;  2E0Q A;  3GHA A;  5HQP A;  4YAP A;  3QMX A;  3KH9 A;  1M2A A;  3KMO A;  3TB2 A;  1SD9 A;  2OE0 A;  2LS5 A;  4LLR A;  4KW6 A;  1QGV A;  1QK8 A;  4ZXG A;  3BCI A;  5CRW A;  3VWX A;  4ZB8 A;  1ERT A;  2KLX A;  4OFT A;  3ZL5 A;  4KSM A;  1A2J A;  4FYC A;  3FZ9 A;  3SBC A;  1RK4 A;  5F8B A;  5IOX A;  1X9W B;  2ON7 A;  2IN3 A;  5CNW A;  5KEJ A;  3PR8 A;  1V98 A;  4DVC A;  2WFC A;  1XWA A;  4KGI A;  5BMU A;  1UC7 A;  1E2Y A;  3C8E A;  4FH8 A;  3LJR A;  5ECQ B;  4TRX A;  1H4O A;  1JZR A;  1YKA A;  2MMN A;  2PER A;  4YKG A;  3K8N A;  3PGT A;  1A24 A;  4BL7 A;  3GKX A;  3IOS A;  1ZZY A;  4NV5 A;  3WT1 A;  4MH3 A;  3VPT A;  1OE7 A;  5IOW A;  3LG6 A;  2NTO A;  3TJG A;  3HD5 A;  2DJ2 A;  4GXZ A;  5E59 A;  1GTB A;  3F3Q A;  4GQF A;  3HKR A;  4MLY A;  3HY2 A;  1KEB A;  3QDN A;  1GUL A;  4WBR D;  1K0A A;  4IN0 A;  16GS A;  1V9W A;  2L57 A;  2OJL A;  5KOW A;  3RBT A;  5AIV A;  1AIU A;  2C0D A;  5KOX A;  1ML6 A;  1SD8 A;  2QA1 A;  3GH6 A;  3LQ7 A;  4MZW A;  4QL9 A;  4KX4 A;  3BOA A;  3ZIJ A;  1BAY A;  1JHB A;  4DSS A;  5LD0 A;  2OAC A;  4ZB9 A;  4BL7 B;  3MAK A;  1WPI A;  4ISD A;  3EIN A;  2YV7 A;  5CO3 A;  1T8E B;  1HQO A;  5G1K A;  2V6K A;  1GL8 A;  5BRT A;  2LJK A;  4ZL9 A;  3A3T A;  2B7K A;  3TOT A;  2M80 A;  2CVK A;  3W8J A;  2V41 A;  3QD9 A;  1K0N A;  5GST A;  3DML A;  5DJL A;  1DE1 A;  2R0P A;  1USB A;  2VCV A;  4I8B A;  4DSS B;  5J9C A;  2B3S A;  1TTZ A;  2VL2 C;  2MMA A;  2GT6 A;  1XWB A;  2VD0 A;  1SK0 A;  3UVH A;  1K3L A;  2XBQ A;  3HVN A;  2V6O A;  3P2A A;  5J3R A;  2JSZ A;  4MCU A;  2DC5 A;  1GUM A;  3HVS A;  1A2L A;  3EU4 A;  2A4V A;  3I43 A;  2LJR A;  4BVY A;  4EXJ A;  3C7M A;  4QL7 A;  3DKS A;  4EDY A;  4K2X A;  2A2S A;  3DYR A;  4YQV A;  4HQS A;  1RQM A;  5IPH A;  4KB3 A;  1J9B A;  3GX8 A;  2VLV A;  4N0Z A;  3J7Y b;  2LKU A;  1TRU A;  2AB6 A;  2P0G A;  1T00 A;  3F3R A;  3KP9 A;  3IDV A;  4MF5 A;  2C0F A;  3UOM A;  4K6X A;  3BJ5 A;  4KF9 A;  4BVY B;  1CQG A;  1GNW A;  3FZ5 A;  2YWI A;  2LQO A;  2REM A;  4HDE A;  2J23 A;  5DVB A;  1F37 A;  1M2B A;  3VPQ A;  4PXO A;  1XPV A;  3TKQ A;  2F8A A;  4MJA A;  2O85 A;  6GSV A;  1EWX A;  1VF1 A;  2M72 A;  2B5E A;  5C04 A;  3EMX A;  2LNS A;  1K0B A;  4ZBA A;  2LQQ A;  2LRC A;  2A4H A;  4JR4 A;  3WGX A;  3VI7 A;  5LCZ A;  1JZD A;  3GRX A;  1Q4J A;  2BJX A;  4K2D A;  1W89 A;  1XFL A;  3KJY A;  3RPP A;  2NPB A;  3I6A A;  1OVN A;  3LXZ A;  1THO A;  2DMM A;  2FY6 A;  3VWV A;  3TOU A;  2IPA A;  5IMF A;  1PKZ A;  3HJP A;  3LOR A;  2A2R A;  3EUR A;  2VCW A;  1PSQ A;  3A2X A;  2E2M A;  4IQA A;  3NIV A;  4LMW A;  3GUR A;  2VO4 A;  4ZBB A;  2FUG 2;  3ZMK A;  2OA7 A;  5A4U A;  3I9V 2;  4BIK A;  3E3E A;  3WT2 A;  5IMD A;  2KHP A;  2JZR A;  1GTA A;  1YJ6 A;  2LRN A;  1IYI A;  1BYE A;  1R5A A;  1AUC A;  4RI7 A;  5G5F A;  1QMV A;  2H6Z A;  5G31 A;  4KE3 A;  4RI6 A;  1G7O A;  2ON5 A;  2AHE A;  4I2T A;  2JU5 A;  1ZYQ B;  3HVV A;  4OFN A;  3KEB A;  5DCH A;  3N5O A;  5CRG A;  3FW2 A;  1FB6 A;  2MBT A;  2LTK A;  2H1A A;  2YP6 A;  1SKS B;  2CZ2 A;  1TXX A;  2IMD A;  1OC3 A;  3EE2 A;  5B8B A;  2IWT A;  3KIJ A;  3TRP A;  3OR5 A;  5D9X A;  2WGR A;  4BA7 A;  3GN3 A;  4K0G A;  2IMK A;  2C3Q A;  1PN9 A;  5H5Q A;  1SL2 B;  3QFB C;  5B8A A;  1F6M C;  2EIQ A;  5CYY A;  4F03 A;  4O7H A;  4ZL8 A;  4FQU A;  4TXO A;  2X8G A;  1AQV A;  3CXG A;  3UBK A;  2MMZ A;  5GAP D;  3QCP A;  1WJK A;  1BED A;  4WXT A;  4ACS A;  2Z9S A;  4MDC A;  3FYG A;  3CTF A;  1Z7P A;  1TK5 B;  5IO0 A;  2HNL A;  4AF2 A;  3F6F A;  1ZCP A;  5FHI A;  1XXU A;  4POL A;  3RPN A;  2BTO T;  2H6X A;  10GS A;  4TR4 A;  1B9X C;  2WB9 A;  5ID2 A;  3DEX A;  2GLR A;  4TXO B;  5COH A;  3CQF A;  3F4S A;  3IV4 A;  2YNX A;  1OC8 A;  4HUA A;  5J9B A;  2YZU A;  4F82 A;  3TKP A;  4AJ8 A;  17GS A;  1B4P A;  1GRX A;  3F4R A;  1JLV A;  4QQ7 A;  3IC8 A;  5IM9 A;  3RHC A;  3WYW A;  3LFL A;  5D96 A;  2R0C A;  2YPM A;  5J4U A;  1XIY A;  3KTB A;  2H70 A;  2QKE A;  2X99 A;  3CTG A;  4N11 A;  2DJJ A;  5A5K A;  3KD0 A;  5ID2 B;  2HZE A;  2YN1 A;  3FZ4 A;  2VUP A;  2HRF A;  2DKH A;  2PPT A;  2XHF A;  4USS A;  1O8X A;  1TRV A;  2WDU A;  1AQW A;  3HHV A;  13GS A;  5CRH A;  3A5I A;  4K8M A;  4DEJ A;  3PH9 A;  1EEJ A;  4RUV A;  3C71 A;  1U87 A;  2X4A A;  3VWW A;  4G2E A;  3BCK A;  3QAV A;  3TJB A;  2GGT A;  3D4M A;  4G19 A;  3IR4 A;  2ALB A;  4Q5F A;  3CMI A;  4I5Q A;  1GSU A;  2HZE B;  1M99 A;  2C4J A;  3EPT A;  4KDU A;  18GS A;  4ECB A;  3D5J A;  4MJC A;  4ECC A;  1DSB A;  2AAW A;  1HNA A;  2L4Q A;  4J56 E;  4BWQ A;  1GSD A;  1T7P B;  3WGE A;  2OE1 A;  2CV4 A;  2ZUP A;  2H72 A;  3J7Y k;  2CQ9 A;  3GL5 A;  4MZB A;  1VGL A;  2KP1 A;  4MJE A;  1XOB A;  3KCM A;  2VL9 A;  3GSS A;  2P5R A;  1ZL9 A;  1FO5 A;  1GSQ A;  3DVX A;  2I81 A;  2V2G A;  3R2Q A;  1OAZ A;  1K0D A;  1URM A;  1VF2 A;  4G0L A;  3RHB A;  2LUS A;  2VM1 A;  1OC9 A;  2DJ3 A;  3GTU A;  1ZYE A;  4O32 A;  5IO2 A;  2M46 A;  2H66 A;  4EE0 A;  3E0U A;  4V1A g;  4JZQ A;  3TJK A;  2HSM A;  1PKW A;  2MYG A;  6GSX A;  2IMI A;  5ECH B;  4XS4 A;  2GQL A;  1TJD A;  3MWH A;  3DXB A;  3L78 A;  4HOJ A;  6GSW A;  4TN8 A;  2MMO A;  1JFU A;  5ECP B;  3U5R E;  3EMP A;  3HJO A;  2WRT A;  3AY8 A;  3L0H A;  1JZW A;  2V1M A;  1HNC A;  1OC9 B;  2FWH A;  1PX7 A;  1A8L A;  3GTU B;  3WD6 A;  4JE1 A;  4KA0 A;  4K5S A;  2R5G A;  2DJ1 A;  4PQH A;  3HJM A;  1EGO A;  1BQ7 A;  5JWR B;  1HNB A;  1O6J A;  2HI7 A;  3G7J A;  4XS4 B;  5DAK A;  1O8W A;  3P90 A;  1UVZ A;  1TRW A;  3QAW A;  4ULX A;  2XC2 A;  3Q74 A;  5GAN D;  4HQZ A;  2AYT A;  1K3Y A;  1TRS A;  2DSA A;  5LNK e;  1TP9 A;  2F8F A;  1EV9 A;  3FHK A;  4NPB A;  1GLP A;  2YWN A;  1T1V A;  3LYK A;  4I2U A;  3KGK A;  5HR0 A;  2R37 A;  1WRY A;  2IME A;  4KDY A;  5KN1 A;  3HZ4 A;  14GS A;  4H86 A;  2L4C A;  5JCU A;  2X49 A;  2YWO A;  5DAK B;  3O6T A;  5ECN B;  2HSH A;  1PGT A;  1GWC A;  1Y25 A;  2C3N A;  4POB A;  5F05 A;  2H1B A;  1ST9 A;  3ZIV A;  5D8I A;  12GS A;  2QA2 A;  5G2Z A;  1FOH A;  2X8C A;  3F0I A;  2H75 A;  4EO3 A;  2IMF A;  2A2P A;  3D6I A;  5D9W A;  1EOG A;  1M2D A;  2IJY A;  1R7H A;  4ZL7 A;  2F3M A;  1F9M A;  5G5E A;  1SK1 A;  3S9F A;  3UVT A;  5F06 A;  1OYJ A;  3TRQ A;  5IMA A;  1GLQ A;  5HR3 A;  4PQ1 A;  5FWG A;  4MF6 A;  1S3D A;  1SJI A;  4MMM A;  1K0C A;  4WKW A;  1ON4 A;  2F51 A;  2GTU A;  4I97 A;  4FIW A;  1NSW A;  1V40 A;  2B1L A;  4ML1 A;  4BWS A;  2EIO A;  1SL0 B;  5GZZ B;  3APS A;  2R0G A;  4NXI A;  4NHW A;  5DBQ A;  5JCG A;  4ID0 A;  2YWM A;  2MZC A;  2PVQ A;  4KAE A;  2FLS A;  4K5R A;  2XPD A;  2G0F A;  4WF5 A;  4CW9 A;  3ZZX A;  4MPG A;  1MDK A;  3IRA A;  1X9S B;  2R4V A;  3KH7 A;  5H5R A;  1YY7 A;  3H4K A;  4X43 A;  3A2W A;  2C8U A;  2N5B A;  3GUS A;  1SEN A;  1AAZ A;  3U6V A;  2HXK A;  1OKD A;  4MP4 A;  1TDI A;  1Z7R A;  5ELG A;  2K8S A;  1LBK A;  2H76 A;  1HD2 A;  4HZ2 A;  5B7C A;  2V32 A;  2MBS A;  3JCM L;  3FR3 A;  5JWQ B;  3GH9 A;  5DQY A;  2VCZ A;  4PUF C;  5A4W A;  3A5W A;  4ZBD A;  1GTU A;  1XVQ A;  5CRE A;  3F8U A;  2PGT A;  4TW5 A;  4V1A p;  4GCI A;  4OO4 A;  3CYN A;  1TI1 A;  5HR1 A;  1TK0 B;  4PUR A;  5DCG A;  1JLW A;  22GS A;  1I9D A;  2CX3 A;  2LNT A;  2I1U A;  4IEL A;  2HFD A;  1WIK A;  2NDO A;  2GSR A;  4IKH A;  3GL3 A;  2RUF A;  3FY7 A;  2HE3 A;  1PL2 A;  1ILO A;  3M1G A;  1FAA A;  1EP7 A;  3QOU A;  4Q5R A;  5EL8 A;  1SJZ A;  2VM2 A;  2X8H A;  1ERV A;  4EIP A;  1QFN A;  1SKW B;  2FWF A;  5B6N A;  1XWG A;  2B7J A;  4EDZ A;  2HRA A;  3EC3 A;  1F2E A;  1GNE A;  2NBS A;  2D2Z A;  5KN0 A;  4HU7 A;  2K9F A;  4L5O A;  1O73 A;  2QSI A;  4JBB A;  1XCC A;  2GVP A;  3DRN A;  7GSS A;  3HZ8 A;  1AXD A;  4OFM A;  3GA4 A;  3TRX A;  1N2A A;  3GMF A;  2L59 A;  2LST A;  4Z2U A;  1MTC A;  3M9J A;  4P3Y B;  1XWK A;  4JED A;  4WF4 A;  3QR6 A;  5AN1 A;  1XW6 A;  3C1S A;  4LL1 B;  5D9V A;  3GX0 A;  4O5U A;  2FWE A;  3FKF A;  3MNG A;  4PNG A;  4DSQ A;  2H19 A;  4PTS A;  2DIZ A;  2K6V A;  4FYB A;  1A2M A;  3ZYW A;  2C80 A;  2WJU A;  1X5D A;  1N8J A;  4JR6 A;  2DLX A;  3ZVJ A;  3GYK A;  1ERU A;  2WS2 A;  2HRN A;  2GZP A;  4PGT A;  4IGJ A;  2H6Y A;  4HS1 A;  1QUW A;  2NVL A;  2I4A A;  1B48 A;  1EZK A;  4IQ1 A;  5KN2 A;  5H5S A;  1V57 A;  4DSR A;  1GUK A;  1S3R A;  1RW1 A;  5IIZ A;  1ABA A;  1OKT A;  5F07 A;  3EU3 A;  4ZB6 A;  3HXS A;  2L5L A;  5ECL B;  4XS6 A;  5ECM B;  2H0I A;  2VAF A;  1XW5 A;  1PL1 A;  19GS A;  1ACV A;  3ME8 A;  4GLT A;  4K7N A;  1CQH A;  4G9H A;  2FA4 A;  2VCQ A;  4MAB A;  5J41 A;  3HCZ A;  1WMJ A;  1AC1 A;  4IP6 A;  4K7I A;  1PX6 A;  2GSQ A;  2GQK A;  5B6M A;  2VL3 A;  4O5R A;  1LU4 A;  3PIN A;  3D4T A;  2DJK A;  2GSS A;  2ZCT A;  4CY6 A;  1WWJ A;  3CSH A;  3Q19 A;  3EYT A;  1PRX A;  1MD3 A;  4XCS A;  1WP0 A;  3ERG A;  4O92 A;  1GSY A;  3HVX A;  2HLS A;  2CAQ A;  1X0R A;  2HYX A;  1MEK A;  3D0Z A;  1VRS D;  1V58 A;  3O3T A;  4TOP A;  2IFQ A;  2ZNM A;  9GSS A;  2H01 A;  3HYP A;  2RII A;  1B9Y C;  3IBH A;  1GSE A;  2VCT A;  3IK7 A;  5EY6 A;  4PX1 A;  1M7T A;  1GSF A;  2JSY A;  2YV9 A;  2UZ8 A;  2VIM A;  3VUR A;  4KSO A;  1S3C A;  1YF1 A;  5GSS A;  3FEU A;  4L8E A;  4OD7 A;  6GSY A;  4IBP A;  3GKK A;  2I3Y A;  4POK A;  3P7X A;  2CVB A;  4MNN A;  1Y6E A;  1T4Y A;  1YEP A;  2B1K A;  3TGZ A;  2IFQ B;  4Q5N A;  5D9T A;  4ZIJ A;  2B5X A;  1KBN A;  5D93 A;  3KTL A;  4Q5Q A;  3UBL A;  2R2J A;  1M9A A;  1ZGN A;  8GSS A;  5HFI A;  1J08 A;  4WET A;  4BVX A;  3ME7 A;  1TU8 A;  4IJI A;  5EVO A;  3TKS A;  1A0R P;  2HT9 A;  2IL3 A;  3LEF A;  4HEA 2;  3GV1 A;  3I69 A;  1WOU A;  2JAC A;  2CZ3 A;  2K8V A;  1GSS A;  1U6T A;  2C1Y A;  2CT6 A;  2LRT A;  5KN3 A;  1PFO A;  2GZY A;  1W4V A;  3L9U A;  3O76 A;  3M0F A;  3VFI A;  2YJH A;  5CRD A;  1E6B A;  3P8W A;  2TRC P;  2PBJ A;  1FVK A;  1PMT A;  3UAR A;  1MD4 A;  5HFG A;  1EEM A;  4BVX B;  4AJ7 A;  4Z2T A;  5AIS A;  3KMN A;  3TJF A;  1K3O A;  3WGD A;  4MF7 A;  3W6G A;  4JRR A;  5L71 A;  1FW1 A;  1FHE A;  3TUE A;  4GSN A;  4TR1 A;  4PNF A;  2H1D A;  1SYR A;  2IIY A;  4ECI A;  1YEX A;  1Q98 A;  4GSS A;  2L6C A;  3CRT A;  4IP1 A;  5ECR B;  4I6X A;  4A5P A;  4E8E A;  2CAI A;  2E7P A;  3GKN A;  2BMX A;  2DBC A;  4XRD A;  4RQR A;  2KOK A;  1M0U A;  2H74 A;  2DIY A;  3ZLP A;  3D22 A;  4WR5 A;  2FGX A;  2VLT A;  3QPM A;  2O87 A;  3M9K A;  1Z5Y E;  3G7I A;  4KUN A;  4Z2R A;  2WZ9 A;  5G1L A;  4HI7 A;  4V2M A;  4CHS A;  4TXV A;  2P31 A;  3HDC A;  4TR1 B;  4O5Q A;  1TU7 A;  3CSI A;  2HSY A;  3NZN A;  2YZH A;  1ZOF A;  4NHZ A;  1YZX A;  2WCI A;  2C0E A;  3Q6O A;  5IQY A;  1X9M B;  2GZZ A;  4EVM A;  3GNJ A;  2GST A;  2N5A A;  2R6K A;  3EWL A;  3F6D A;  2VCX A;  1PN0 A;  4RQX A;  1EP8 A;  5A4V A;  4X1U A;  2WUL A;  5IMC A;  4F9Z A;  4FO5 A;  1XVW A;  4XIH A;  2B6M A;  1TK8 B;  1SU9 A;  2LJA A;  5E4W A;  3ZTL A;  4HJ2 A;  3ZIT A;  2TIR A;  4MZC A;  3DWV A;  4F2I A;  1I5G A;  2J9H A;  4YQU A;  4OO5 A; 
#chains in the Genus database with same CATH homology
 3IAM 2;  3E9J B;  1SYX A;  4KND A;  4IW9 A;  5IMV A;  2PUK C;  3C73 A;  1B4Q A;  5AIX A;  1FG4 A;  1FVJ A;  4NMU A;  4G0K A;  3UEM A;  4V2L A;  5ENU A;  1S3A A;  3H79 A;  1NM3 A;  4MH2 A;  3F9U A;  3TCO A;  2OE3 A;  3EVI A;  4K7O A;  5ECI B;  3QFA C;  2PWJ A;  2QGV A;  1G7E A;  4IVF A;  3F4T A;  3IXR A;  1TW9 A;  3H1N A;  3F63 A;  5DJM A;  4GRF A;  2FHE A;  2RLI A;  3V1W A;  4K9Z A;  1U3I A;  3DD3 A;  3ZRD A;  1R26 A;  3H8Q A;  4GST A;  3D21 A;  1H75 A;  2PU9 C;  5ABR A;  2AJQ B;  3ZFB A;  2CA8 A;  2H73 A;  4PQI A;  2F9S A;  3LGC A;  5AGY A;  3KZQ A;  2JZS A;  1ZMA A;  2G2Q A;  4L5L A;  3KM6 A;  2XPE A;  3IAS 2;  5G30 A;  1XOA A;  4OCE A;  3L9S A;  2C3T A;  3DIE A;  1UN2 A;  4WEY A;  3MDK A;  5ECO B;  4ECJ A;  2VOC A;  5FT3 A;  4NV2 A;  2GS3 A;  2GT5 A;  2RUE A;  1KTE A;  3PPU A;  3ZML A;  4AGS A;  1V2A A;  3TJJ A;  3ISO A;  1TKD B;  2CX4 A;  5CAX A;  4N0V A;  4GTU A;  4PUA A;  3KXO A;  5INY A;  1Z9H A;  3GKM A;  4K1F A;  2EIR A;  1A23 A;  5ECK B;  4XTS A;  3L4N A;  3C1R A;  5IPG A;  1FOV A;  3A2V A;  3LYP A;  2JZT A;  4EUY A;  4N10 A;  4F0B A;  1O7U A;  3ERF A;  3LSZ A;  1U88 A;  3IK9 A;  4XRA A;  1PA3 A;  4D73 A;  4GF0 A;  4WR4 A;  1YF0 A;  2GQM A;  3LW9 A;  1JZO A;  2RM6 A;  2L6D A;  4TKY A;  4HJM A;  4YAV A;  5HFK A;  2XBI A;  1YKC A;  3UJ1 A;  1GTI A;  1UA5 A;  4OCF A;  1XWC A;  2AV4 A;  20GS A;  1FB0 A;  2KUC A;  4MA9 A;  1XZO A;  2B5Y A;  4OMV A;  1G6W A;  2H30 A;  4AJ6 A;  1G0T A;  2E2G A;  1T4Z A;  2O7K A;  4X0X A;  2CVD A;  3CSJ A;  4MK3 A;  3BBY A;  4D73 B;  6GST A;  2OBK A;  1VF4 A;  2O8V B;  5CP1 A;  2YOI A;  2H1G A;  3KP8 A;  2OKA A;  3IHQ A;  4YH2 A;  2C0G A;  2JL4 A;  1F3B A;  1X5E A;  1SJ6 A;  3TKS E;  1DUG A;  3TKS C;  4HU9 A;  6GSS A;  4XS1 A;  1SKR B;  3G9B A;  3IE3 A;  2GDR A;  4KCA A;  4TR3 A;  1YDK A;  4N30 A;  3VK9 A;  1YQ1 A;  2H8L A;  4GWR A;  2PN8 A;  3IC4 A;  4WBJ A;  1PQN A;  4KH7 A;  2O89 A;  1A8Y A;  1EV4 A;  5C00 A;  4LMV A;  1THX A;  3VI5 A;  4IS0 A;  3UAP A;  4L0W A;  3M3M A;  4JU5 A;  4L0U A;  1BX9 A;  1SK2 A;  3NOF A;  4HZ4 A;  1NHY A;  4FYU A;  3W8S A;  4ML6 A;  2H0H A;  2YAN A;  2VD1 A;  4X4J A;  1EOH A;  3APO A;  1MDI A;  5F0G A;  1K0M A;  5ELA A;  1O81 A;  1ZYP A;  4NWY A;  4TR0 A;  3MSZ A;  1G6Y A;  2DML A;  2LV3 A;  1PD2 1;  3FR6 A;  2FNO A;  4EF0 A;  1QQ2 A;  3FZA A;  3UMA A;  2TRX A;  1KNG A;  1A0F A;  2HZF A;  3FR9 A;  1T3B A;  1X5C A;  2YJ7 A;  4ILF A;  3US3 A;  1TI3 A;  2H71 A;  2L5O A;  4OWY A;  2R3X A;  3VLN A;  3FK8 A;  2QC7 A;  3DGQ A;  3FMW A;  4MPF A;  2OBI A;  3LXT A;  1AW9 A;  4MJB A;  3N9J A;  3RDW A;  2N5F A;  2VL2 A;  2FCH A;  3L9V A;  2X64 A;  1BJX A;  6GSU A;  4ICY A;  1DBY A;  4ZIL A;  2I9H A;  1QXH A;  2PVO C;  2FD3 A;  5J5N A;  1DE2 A;  3IA1 A;  4GQC A;  5D73 A;  5JWO B;  4Z7X A;  1Z6N A;  5DDL A;  1SL1 B;  1M9B A;  4EIQ A;  1GUH A;  4KDX A;  4YQM A;  3Q18 A;  2JAD A;  3UIW A;  1AQX A;  2HRK A;  3BD2 A;  3CBU A;  3DVW A;  1BG5 A;  4POM A;  11GS A;  3ZVJ D;  3FRC A;  1B8X A;  1NHO A;  2FWG A;  2FA8 A;  4EL1 A;  2K18 A;  3UL3 A;  4KCE A;  1MDJ A;  3MYD A;  4BPY A;  3SWL A;  1WE0 A;  2DKI A;  3CRU A;  4IJ3 A;  4V2N A;  2P5Q A;  4E8H A;  2LEG A;  2KP2 A;  5ECS A;  3GFK A;  2YCD A;  4J2F A;  4LA1 A;  3LWA A;  4TVE A;  5HR2 A;  3GIX A;  1Z3E A;  1J0F A;  1F3A A;  3ZFL A;  1R5P A;  4NAX A;  4EKZ A;  4F0C A;  1ERW A;  5DAL A;  2EC4 A;  5EPF A;  1VF3 A;  1NW2 A;  4G10 A;  1R4W A;  3M8N A;  2VLU A;  5IMZ A;  1IYH A;  1C72 A;  4CDO A;  3MIX A;  1K0O A;  2H0G A;  1TOF A;  3TDG A;  1LJR A;  4K0N A;  3IPZ A;  3VWU A;  3APQ A;  1U3A A;  3IHG A;  2PMT A;  3RAZ A;  4LL4 B;  1GH2 A;  2AUV A;  5DAL B;  1ZYN A;  4IHU A;  2ES7 A;  5JCW A;  3TKR A;  1OE8 A;  1XBS A;  4J57 E;  1HYU A;  1XW9 A;  1Z6M A;  3QAG A;  3ED3 A;  3H93 A;  4YKF A;  3ZRE A;  3HA9 A;  2OAD A;  3G7Y A;  1EGR A;  3R3E A;  4XHM A;  1GP1 A;  1O85 A;  4G0I A;  2DJ0 A;  3ERW A;  4CY8 A;  3GST A;  5DQS A;  2RM5 A;  4EC0 A;  2E0Q A;  3GHA A;  5HQP A;  4YAP A;  3QMX A;  3KH9 A;  1M2A A;  3KMO A;  3TB2 A;  1SD9 A;  2OE0 A;  2LS5 A;  4LLR A;  4KW6 A;  1QGV A;  1QK8 A;  4ZXG A;  3BCI A;  5CRW A;  3VWX A;  4ZB8 A;  1ERT A;  2KLX A;  4OFT A;  3ZL5 A;  4KSM A;  1A2J A;  4FYC A;  3FZ9 A;  3SBC A;  1RK4 A;  5F8B A;  5IOX A;  1X9W B;  2ON7 A;  2IN3 A;  5CNW A;  5KEJ A;  3PR8 A;  1V98 A;  4DVC A;  2WFC A;  1XWA A;  4KGI A;  5BMU A;  1UC7 A;  1E2Y A;  3C8E A;  4FH8 A;  3LJR A;  5ECQ B;  4TRX A;  1H4O A;  1JZR A;  1YKA A;  2MMN A;  2PER A;  4YKG A;  3K8N A;  3PGT A;  1A24 A;  4BL7 A;  3GKX A;  3IOS A;  1ZZY A;  4NV5 A;  3WT1 A;  4MH3 A;  3VPT A;  1OE7 A;  5IOW A;  3LG6 A;  2NTO A;  3TJG A;  3HD5 A;  2DJ2 A;  4GXZ A;  5E59 A;  1GTB A;  3F3Q A;  4GQF A;  3HKR A;  4MLY A;  3HY2 A;  1KEB A;  3QDN A;  1GUL A;  4WBR D;  1K0A A;  4IN0 A;  16GS A;  1V9W A;  2L57 A;  2OJL A;  5KOW A;  3RBT A;  5AIV A;  1AIU A;  2C0D A;  5KOX A;  1ML6 A;  1SD8 A;  2QA1 A;  3GH6 A;  3LQ7 A;  4MZW A;  4QL9 A;  4KX4 A;  3BOA A;  3ZIJ A;  1BAY A;  1JHB A;  4DSS A;  5LD0 A;  2OAC A;  4ZB9 A;  4BL7 B;  3MAK A;  1WPI A;  4ISD A;  3EIN A;  2YV7 A;  5CO3 A;  1T8E B;  1HQO A;  5G1K A;  2V6K A;  1GL8 A;  5BRT A;  2LJK A;  4ZL9 A;  3A3T A;  2B7K A;  3TOT A;  2M80 A;  2CVK A;  3W8J A;  2V41 A;  3QD9 A;  1K0N A;  5GST A;  3DML A;  5DJL A;  1DE1 A;  2R0P A;  1USB A;  2VCV A;  4I8B A;  4DSS B;  5J9C A;  2B3S A;  1TTZ A;  2VL2 C;  2MMA A;  2GT6 A;  1XWB A;  2VD0 A;  1SK0 A;  3UVH A;  1K3L A;  2XBQ A;  2V6O A;  3P2A A;  5J3R A;  2JSZ A;  4MCU A;  2DC5 A;  1GUM A;  3HVS A;  1A2L A;  3EU4 A;  2A4V A;  3I43 A;  2LJR A;  4BVY A;  4EXJ A;  3C7M A;  4QL7 A;  3DKS A;  4EDY A;  4K2X A;  2A2S A;  3DYR A;  4YQV A;  4HQS A;  1RQM A;  5IPH A;  4KB3 A;  1J9B A;  3GX8 A;  2VLV A;  4N0Z A;  3J7Y b;  2LKU A;  1TRU A;  2AB6 A;  2P0G A;  1T00 A;  3F3R A;  3KP9 A;  3IDV A;  4MF5 A;  2C0F A;  3UOM A;  4K6X A;  3BJ5 A;  4KF9 A;  4BVY B;  1CQG A;  1GNW A;  3FZ5 A;  2YWI A;  2LQO A;  2REM A;  4HDE A;  2J23 A;  5DVB A;  1F37 A;  1M2B A;  3VPQ A;  4PXO A;  1XPV A;  3TKQ A;  2F8A A;  4MJA A;  2O85 A;  6GSV A;  1EWX A;  1VF1 A;  2M72 A;  2B5E A;  5C04 A;  3EMX A;  2LNS A;  1K0B A;  4ZBA A;  2LQQ A;  2LRC A;  2A4H A;  4JR4 A;  3WGX A;  3VI7 A;  5LCZ A;  1JZD A;  3GRX A;  1Q4J A;  2BJX A;  4K2D A;  1W89 A;  1XFL A;  3KJY A;  3RPP A;  2NPB A;  3I6A A;  1OVN A;  3LXZ A;  1THO A;  2DMM A;  2FY6 A;  3VWV A;  3TOU A;  2IPA A;  5IMF A;  1PKZ A;  3HJP A;  3LOR A;  2A2R A;  3EUR A;  2VCW A;  1PSQ A;  3A2X A;  2E2M A;  4IQA A;  3NIV A;  4LMW A;  3GUR A;  2VO4 A;  4ZBB A;  2FUG 2;  3ZMK A;  2OA7 A;  5A4U A;  3I9V 2;  3E3E A;  3WT2 A;  5IMD A;  2KHP A;  2JZR A;  1GTA A;  1YJ6 A;  2LRN A;  1IYI A;  1BYE A;  1R5A A;  1AUC A;  4RI7 A;  5G5F A;  1QMV A;  2H6Z A;  5G31 A;  4KE3 A;  4RI6 A;  1G7O A;  2ON5 A;  2AHE A;  4I2T A;  2JU5 A;  1ZYQ B;  3HVV A;  4OFN A;  3KEB A;  5DCH A;  3N5O A;  5CRG A;  3FW2 A;  1FB6 A;  2MBT A;  2LTK A;  2H1A A;  2YP6 A;  1SKS B;  2CZ2 A;  1TXX A;  2IMD A;  1OC3 A;  3EE2 A;  5B8B A;  2IWT A;  3KIJ A;  3TRP A;  3OR5 A;  5D9X A;  2WGR A;  4BA7 A;  3GN3 A;  4K0G A;  2IMK A;  2C3Q A;  1PN9 A;  5H5Q A;  1SL2 B;  3QFB C;  5B8A A;  1F6M C;  2EIQ A;  5CYY A;  4F03 A;  4O7H A;  4ZL8 A;  4FQU A;  4TXO A;  2X8G A;  1AQV A;  3CXG A;  3UBK A;  2MMZ A;  5GAP D;  3QCP A;  1WJK A;  1BED A;  4WXT A;  4ACS A;  2Z9S A;  4MDC A;  3FYG A;  3CTF A;  1Z7P A;  1TK5 B;  5IO0 A;  2HNL A;  4AF2 A;  3F6F A;  1ZCP A;  5FHI A;  1XXU A;  4POL A;  3RPN A;  2BTO T;  2H6X A;  10GS A;  4TR4 A;  1B9X C;  2WB9 A;  5ID2 A;  3DEX A;  2GLR A;  4TXO B;  5COH A;  3F4S A;  3IV4 A;  2YNX A;  1OC8 A;  4HUA A;  5J9B A;  2YZU A;  4F82 A;  3TKP A;  4AJ8 A;  17GS A;  1B4P A;  1GRX A;  3F4R A;  1JLV A;  4QQ7 A;  3IC8 A;  5IM9 A;  3RHC A;  3WYW A;  3LFL A;  5D96 A;  2R0C A;  2YPM A;  5J4U A;  1XIY A;  3KTB A;  2H70 A;  2QKE A;  2X99 A;  3CTG A;  4N11 A;  2DJJ A;  5A5K A;  3KD0 A;  5ID2 B;  2HZE A;  2YN1 A;  3FZ4 A;  2VUP A;  2HRF A;  2DKH A;  2PPT A;  2XHF A;  4USS A;  1O8X A;  1TRV A;  2WDU A;  1AQW A;  3HHV A;  13GS A;  5CRH A;  3A5I A;  4K8M A;  4DEJ A;  3PH9 A;  1EEJ A;  4RUV A;  3C71 A;  1U87 A;  2X4A A;  3VWW A;  4G2E A;  3BCK A;  3QAV A;  3TJB A;  2GGT A;  3D4M A;  4G19 A;  3IR4 A;  2ALB A;  4Q5F A;  3CMI A;  4I5Q A;  1GSU A;  2HZE B;  1M99 A;  2C4J A;  3EPT A;  4KDU A;  18GS A;  4ECB A;  3D5J A;  4MJC A;  4ECC A;  1DSB A;  2AAW A;  1HNA A;  2L4Q A;  4J56 E;  4BWQ A;  1GSD A;  1T7P B;  3WGE A;  2OE1 A;  2CV4 A;  2ZUP A;  2H72 A;  3J7Y k;  2CQ9 A;  3GL5 A;  4MZB A;  1VGL A;  2KP1 A;  4MJE A;  1XOB A;  3KCM A;  2VL9 A;  3GSS A;  2P5R A;  1ZL9 A;  1FO5 A;  1GSQ A;  3DVX A;  2I81 A;  2V2G A;  3R2Q A;  1OAZ A;  1K0D A;  1URM A;  1VF2 A;  4G0L A;  3RHB A;  2LUS A;  2VM1 A;  1OC9 A;  2DJ3 A;  3GTU A;  1ZYE A;  4O32 A;  5IO2 A;  2M46 A;  2H66 A;  4EE0 A;  3E0U A;  4V1A g;  4JZQ A;  3TJK A;  2HSM A;  1PKW A;  2MYG A;  6GSX A;  2IMI A;  5ECH B;  4XS4 A;  2GQL A;  1TJD A;  3MWH A;  3DXB A;  3L78 A;  4HOJ A;  6GSW A;  4TN8 A;  2MMO A;  1JFU A;  5ECP B;  3U5R E;  3EMP A;  3HJO A;  2WRT A;  3AY8 A;  3L0H A;  1JZW A;  2V1M A;  1HNC A;  1OC9 B;  2FWH A;  1PX7 A;  1A8L A;  3GTU B;  3WD6 A;  4JE1 A;  4KA0 A;  4K5S A;  2R5G A;  2DJ1 A;  4PQH A;  3HJM A;  1EGO A;  1BQ7 A;  5JWR B;  1HNB A;  1O6J A;  2HI7 A;  3G7J A;  4XS4 B;  5DAK A;  1O8W A;  3P90 A;  1UVZ A;  1TRW A;  3QAW A;  4ULX A;  2XC2 A;  3Q74 A;  5GAN D;  4HQZ A;  2AYT A;  1K3Y A;  1TRS A;  2DSA A;  5LNK e;  1TP9 A;  2F8F A;  1EV9 A;  3FHK A;  4NPB A;  1GLP A;  2YWN A;  1T1V A;  3LYK A;  4I2U A;  3KGK A;  5HR0 A;  2R37 A;  1WRY A;  2IME A;  4KDY A;  5KN1 A;  3HZ4 A;  14GS A;  4H86 A;  2L4C A;  5JCU A;  2X49 A;  2YWO A;  5DAK B;  3O6T A;  5ECN B;  2HSH A;  1PGT A;  1GWC A;  1Y25 A;  2C3N A;  4POB A;  5F05 A;  2H1B A;  1ST9 A;  3ZIV A;  5D8I A;  12GS A;  2QA2 A;  5G2Z A;  1FOH A;  2X8C A;  3F0I A;  2H75 A;  4EO3 A;  2IMF A;  2A2P A;  3D6I A;  5D9W A;  1EOG A;  1M2D A;  2IJY A;  1R7H A;  4ZL7 A;  2F3M A;  1F9M A;  5G5E A;  1SK1 A;  3S9F A;  3UVT A;  5F06 A;  1OYJ A;  3TRQ A;  5IMA A;  1GLQ A;  5HR3 A;  4PQ1 A;  5FWG A;  4MF6 A;  1S3D A;  1SJI A;  4MMM A;  1K0C A;  4WKW A;  1ON4 A;  2F51 A;  2GTU A;  4I97 A;  4FIW A;  1NSW A;  1V40 A;  2B1L A;  4ML1 A;  4BWS A;  2EIO A;  1SL0 B;  5GZZ B;  3APS A;  2R0G A;  4NXI A;  4NHW A;  5DBQ A;  5JCG A;  4ID0 A;  2YWM A;  2MZC A;  2PVQ A;  4KAE A;  2FLS A;  4K5R A;  2XPD A;  2G0F A;  4WF5 A;  4CW9 A;  3ZZX A;  4MPG A;  1MDK A;  3IRA A;  1X9S B;  2R4V A;  3KH7 A;  5H5R A;  1YY7 A;  3H4K A;  4X43 A;  3A2W A;  2C8U A;  2N5B A;  3GUS A;  1SEN A;  1AAZ A;  3U6V A;  2HXK A;  1OKD A;  4MP4 A;  1TDI A;  1Z7R A;  5ELG A;  2K8S A;  1LBK A;  2H76 A;  1HD2 A;  4HZ2 A;  5B7C A;  2V32 A;  2MBS A;  3JCM L;  3FR3 A;  5JWQ B;  3GH9 A;  5DQY A;  2VCZ A;  4PUF C;  5A4W A;  3A5W A;  4ZBD A;  1GTU A;  1XVQ A;  5CRE A;  3F8U A;  2PGT A;  4TW5 A;  4V1A p;  4GCI A;  4OO4 A;  3CYN A;  1TI1 A;  5HR1 A;  1TK0 B;  4PUR A;  5DCG A;  1JLW A;  22GS A;  1I9D A;  2CX3 A;  2LNT A;  2I1U A;  4IEL A;  2HFD A;  1WIK A;  2NDO A;  2GSR A;  4IKH A;  3GL3 A;  2RUF A;  3FY7 A;  2HE3 A;  1PL2 A;  1ILO A;  3M1G A;  1FAA A;  1EP7 A;  3QOU A;  4Q5R A;  5EL8 A;  1SJZ A;  2VM2 A;  2X8H A;  1ERV A;  4EIP A;  1QFN A;  1SKW B;  2FWF A;  5B6N A;  1XWG A;  2B7J A;  4EDZ A;  2HRA A;  3EC3 A;  1F2E A;  1GNE A;  2NBS A;  2D2Z A;  5KN0 A;  4HU7 A;  2K9F A;  4L5O A;  1O73 A;  2QSI A;  4JBB A;  1XCC A;  2GVP A;  3DRN A;  7GSS A;  3HZ8 A;  1AXD A;  4OFM A;  3GA4 A;  3TRX A;  1N2A A;  3GMF A;  2L59 A;  2LST A;  4Z2U A;  1MTC A;  3M9J A;  4P3Y B;  1XWK A;  4JED A;  4WF4 A;  3QR6 A;  5AN1 A;  1XW6 A;  3C1S A;  4LL1 B;  5D9V A;  3GX0 A;  4O5U A;  2FWE A;  3FKF A;  3MNG A;  4PNG A;  4DSQ A;  2H19 A;  4PTS A;  2DIZ A;  2K6V A;  4FYB A;  1A2M A;  3ZYW A;  2C80 A;  2WJU A;  1X5D A;  1N8J A;  4JR6 A;  2DLX A;  3ZVJ A;  3GYK A;  1ERU A;  2WS2 A;  2HRN A;  2GZP A;  4PGT A;  4IGJ A;  2H6Y A;  4HS1 A;  1QUW A;  2NVL A;  2I4A A;  1B48 A;  1EZK A;  4IQ1 A;  5KN2 A;  5H5S A;  1V57 A;  4DSR A;  1GUK A;  1RW1 A;  5IIZ A;  1ABA A;  1OKT A;  5F07 A;  3EU3 A;  4ZB6 A;  3HXS A;  2L5L A;  5ECL B;  4XS6 A;  5ECM B;  2H0I A;  2VAF A;  1XW5 A;  1PL1 A;  19GS A;  1ACV A;  3ME8 A;  4GLT A;  4K7N A;  1CQH A;  4G9H A;  2FA4 A;  2VCQ A;  4MAB A;  5J41 A;  3HCZ A;  1WMJ A;  1AC1 A;  4IP6 A;  4K7I A;  1PX6 A;  2GSQ A;  2GQK A;  5B6M A;  2VL3 A;  4O5R A;  1LU4 A;  3PIN A;  3D4T A;  2DJK A;  2GSS A;  2ZCT A;  4CY6 A;  1WWJ A;  3CSH A;  3Q19 A;  3EYT A;  1PRX A;  1MD3 A;  4XCS A;  1WP0 A;  3ERG A;  4O92 A;  1GSY A;  3HVX A;  2HLS A;  2CAQ A;  1X0R A;  2HYX A;  1MEK A;  3D0Z A;  1VRS D;  1V58 A;  3O3T A;  4TOP A;  2IFQ A;  2ZNM A;  9GSS A;  2H01 A;  3HYP A;  2RII A;  1B9Y C;  3IBH A;  1GSE A;  2VCT A;  3IK7 A;  5EY6 A;  4PX1 A;  1M7T A;  1GSF A;  2JSY A;  2YV9 A;  2UZ8 A;  2VIM A;  3VUR A;  4KSO A;  1S3C A;  1YF1 A;  5GSS A;  3FEU A;  4L8E A;  4OD7 A;  6GSY A;  4IBP A;  3GKK A;  2I3Y A;  4POK A;  3P7X A;  2CVB A;  4MNN A;  1Y6E A;  1T4Y A;  1YEP A;  2B1K A;  3TGZ A;  2IFQ B;  4Q5N A;  5D9T A;  4ZIJ A;  2B5X A;  1KBN A;  5D93 A;  3KTL A;  4Q5Q A;  3UBL A;  2R2J A;  1M9A A;  1ZGN A;  8GSS A;  5HFI A;  1J08 A;  4WET A;  4BVX A;  3ME7 A;  1TU8 A;  4IJI A;  5EVO A;  3TKS A;  1A0R P;  2HT9 A;  2IL3 A;  3LEF A;  4HEA 2;  3GV1 A;  3I69 A;  1WOU A;  2JAC A;  2CZ3 A;  2K8V A;  1GSS A;  1U6T A;  2C1Y A;  2CT6 A;  2LRT A;  5KN3 A;  2GZY A;  1W4V A;  3L9U A;  3O76 A;  3M0F A;  3VFI A;  2YJH A;  5CRD A;  1E6B A;  3P8W A;  2TRC P;  2PBJ A;  1FVK A;  1PMT A;  3UAR A;  1MD4 A;  5HFG A;  1EEM A;  4BVX B;  4AJ7 A;  4Z2T A;  5AIS A;  3KMN A;  3TJF A;  1K3O A;  3WGD A;  4MF7 A;  3W6G A;  4JRR A;  5L71 A;  1FW1 A;  1FHE A;  3TUE A;  4GSN A;  4TR1 A;  4PNF A;  2H1D A;  1SYR A;  2IIY A;  4ECI A;  1YEX A;  1Q98 A;  4GSS A;  2L6C A;  3CRT A;  4IP1 A;  5ECR B;  4I6X A;  4A5P A;  4E8E A;  2CAI A;  2E7P A;  3GKN A;  2BMX A;  2DBC A;  4XRD A;  4RQR A;  2KOK A;  1M0U A;  2H74 A;  2DIY A;  3ZLP A;  3D22 A;  4WR5 A;  2FGX A;  2VLT A;  3QPM A;  2O87 A;  3M9K A;  1Z5Y E;  3G7I A;  4KUN A;  4Z2R A;  2WZ9 A;  5G1L A;  4HI7 A;  4V2M A;  4CHS A;  4TXV A;  2P31 A;  3HDC A;  4TR1 B;  4O5Q A;  1TU7 A;  3CSI A;  2HSY A;  3NZN A;  2YZH A;  1ZOF A;  4NHZ A;  1YZX A;  2WCI A;  2C0E A;  3Q6O A;  5IQY A;  1X9M B;  2GZZ A;  4EVM A;  3GNJ A;  2GST A;  2N5A A;  2R6K A;  3EWL A;  3F6D A;  2VCX A;  1PN0 A;  4RQX A;  1EP8 A;  5A4V A;  4X1U A;  2WUL A;  5IMC A;  4F9Z A;  4FO5 A;  1XVW A;  4XIH A;  2B6M A;  1TK8 B;  1SU9 A;  2LJA A;  5E4W A;  3ZTL A;  4HJ2 A;  3ZIT A;  2TIR A;  4MZC A;  3DWV A;  4F2I A;  1I5G A;  2J9H A;  4YQU A;  4OO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...