1ERWA

Human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
b'MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 36
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1erwA00
5A4WA 5EL8A 4DSSB 4H86A 1ERWA 2WGRA 5COHA 3VI5A 1TRVA 1ZYQB 3NZNA 2M80A 2CA8A 9GSSA 2TRXA 3QCPA 5B6MA 2DBCA 4RI6A 16GSA 4MH3A 3NOFA 4MJBA 1LU4A 5DDLA 2WULA 4N10A 3PINA 2MBTA 5HQPA 3FK8A 4XRDA 5G1LA 1XBSA 4EC0A 5ECSA 2KUCA 3A2VA 2MMOA 3VI7A 2I9HA 4JU5A 2JZSA 5J5NA 4O92A 2V2GA 3P2AA 2L57A 4OO4A 1LJRA 18GSA 3TJGA 2FD3A 5A4VA 4TW5A 1FB0A 3M9KA 1JZRA 3VWVA 2X64A 5B8BA 2LNTA 2LKUA 5EPFA 5GZZB 1TI3A 2OKAA 1ZCPA 1A0FA 2CX4A 3ZVJD 1SENA 3C73A 5J9BA 3TKRA 1DSBA 3FZ5A 1GNWA 3L4NA 4MJCA 2H8LA 1VRSD 4PQHA 4OO5A 1Y25A 2YV7A 1NSWA 5DALB 2O87A 4ID0A 4AGSA 2CAIA 3TKSE 4RQRA 2FNOA 4I8BA 3HKRA 3MNGA 4O5RA 5EY6A 4V2LA 1OKDA 3ISOA 1AC1A 3N9JA 1TDIA 1CQHA 3EVIA 2WDUA 2ZUPA 2WJUA 4FO5A 2QKEA 5D8IA 1XVQA 1DE2A 1PSQA 3HD5A 2YNXA 1Z6MA 2I4AA 4IELA 5G5FA 2DIZA 1GSYA 3APOA 4J57E 3TRQA 4IHUA 5D9TA 2EIOA 3EURA 5IMCA 2DJ3A 3KTBA 4LMVA 2Z9SA 5IMZA 4L5OA 2J9HA 1YKCA 1WWJA 4EE0A 2MZCA 4I97A 4YQVA 3IAM2 1U3AA 2VCZA 3O76A 2YWMA 3C8EA 4FYCA 3W6GA 2N5AA 1X5EA 4FIWA 3CSHA 1PD21 3GSTA 3A2WA 5DQSA 3GRXA 3LXTA 3L9SA 14GSA 3ZTLA 3LXZA 1QUWA 4MPFA 1G6WA 2HSHA 3TRPA 2IL3A 4GQFA 2DMLA 4Q5RA 1TOFA 1FOVA 2YPMA 3DRNA 2LRTA 2VAFA 2GT5A 4GCIA 1WE0A 1SJZA 4E8HA 1JLVA 4EVMA 4V1Ag 2H1DA 3M8NA 5C00A 1BEDA 3FZ4A 2E2MA 1QXHA 2OE1A 1LBKA 2FY6A 2GQKA 2H6XA 2H30A 2F8FA 2VM1A 1KEBA 4TR1A 4QL9A 4OD7A 3HCZA 2C0FA 3VPTA 5IOXA 1PKWA 3LYPA 1SL2B 5GSTA 5AIVA 1GRXA 1SK2A 2B7JA 2GVPA 5ELGA 3J7Yb 3KH7A 5F05A 1TRUA 2K9FA 2VL2C 1TJDA 3TJJA 4DVCA 1HNAA 1R4WA 1BG5A 2VCVA 1AQWA 4L8EA 5ECIB 5HR1A 5KEJA 3V1WA 2B5YA 11GSA 4AJ7A 5D9XA 2JADA 1PN9A 3A3TA 3CTGA 4F03A 1XW9A 2AV4A 2O85A 20GSA 3IPZA 3D4MA 5DALA 2CAQA 5KN1A 1M0UA 2LRNA 1T4YA 2H6ZA 2VLUA 4K7NA 3J7Yk 3HVVA 4MF6A 4D73B 3UARA 1ERVA 2HE3A 2BMXA 5ECNB 1SJIA 2A4VA 3A5WA 1UA5A 4YAPA 2F8AA 4NWYA 5JWOB 3UBLA 2LJRA 1K3LA 3HA9A 3ZMLA 3IHQA 5ECMB 5GAND 4ZBAA 5G30A 1DE1A 2O89A 2B7KA 1B9YC 3CTFA 2IMDA 1TK8B 5CRHA 1OC8A 2M72A 2WS2A 2NDOA 2CZ2A 4RUVA 4ZL9A 1Z7PA 3HJOA 2R6KA 3KH9A 3QAWA 3LJRA 1FW1A 5LD0A 5IMFA 3TDGA 3UBKA 2FLSA 2PVOC 4K0NA 5EVOA 5DJMA 4KSOA 2XPDA 3GURA 4QL7A 1GTAA 4X1UA 4QQ7A 2IMEA 3APSA 3KJYA 3EMXA 3IXRA 1T4ZA 2C80A 1WMJA 1BAYA 2C3TA 1O8XA 2C4JA 2REMA 4ML6A 1YQ1A 2CV4A 1JZWA 4EXJA 2C3QA 3BJ5A 2H0GA 1GSSA 2C0GA 4KSMA 3ZFLA 3TOTA 3DXBA 1GUKA 1GULA 5JCUA 2AAWA 3CRTA 4TXOA 5AN1A 2H71A 2X8HA 5CP1A 1YJ6A 4EUYA 2V1MA 2C0EA 3VPQA 3AY8A 4HZ2A 3KD0A 1H75A 4NMUA 3CSIA 1FO5A 1THXA 1B4PA 2VCXA 2FWEA 1ML6A 3Q6OA 1DUGA 3VK9A 3HHVA 2VUPA 4POKA 4PUAA 5CO3A 1A2LA 1AXDA 4I6XA 2E0QA 3KZQA 4KW6A 4ECCA 3ZIJA 2VD1A 4IN0A 2L6DA 1W89A 17GSA 3FR9A 2XBQA 4GLTA 1OE8A 4ECBA 2MMAA 1GSDA 2H74A 3WT1A 3F4TA 3LORA 3KTLA 4GSSA 4KA0A 4PQ1A 4FH8A 1VF4A 1F3BA 1UC7A 4MCUA 4WKWA 5A4UA 1DBYA 1K3YA 1EV4A 1YF1A 3D4TA 3TJKA 2EIQA 4ACSA 1HYUA 3W8SA 4TR0A 4G9HA 4ZXGA 4E8EA 2L4CA 3HJMA 4AF2A 3RPNA 2YOIA 6GSTA 1J9BA 1SKSB 3GKNA 3KGKA 3IK9A 5ECQB 5FWGA 2JL4A 2DJ2A 1B48A 1XPVA 5H5SA 2CVBA 1M7TA 2HLSA 2DJ1A 4D73A 2KLXA 5DBQA 2H75A 1ZZYA 3LGCA 3CSJA 1Q98A 2HFDA 3Q19A 2MBSA 1K0BA 5AISA 4TR4A 1XWCA 1EP8A 2PWJA 1J0FA 4WBJA 1SKRB 2H70A 1QMVA 2AHEA 4FYUA 3US3A 3TRXA 1TU8A 3RDWA 1HQOA 4CDOA 1ZL9A 4TN8A 3FY7A 2C8UA 1ABAA 1SU9A 1XZOA 2H6YA 4NXIA 3DVWA 3ED3A 1GUHA 3UL3A 2WFCA 3HYPA 4KNDA 1F6MC 3F4RA 5ECRB 4OFMA 4XS4A 2H1AA 1CQGA 1YF0A 3IK7A 1GSFA 4CW9A 2JSYA 1GSUA 3L0HA 3OR5A 1OVNA 1BX9A 2HZEA 3GKKA 2R3XA 4HU9A 2DJJA 2CVDA 3H4KA 4KDUA 2VD0A 3E3EA 4RI7A 3CMIA 3D5JA 3ZIVA 2L4QA 6GSWA 5ECHB 3KXOA 4OWYA 5DAKB 4GSTA 1TXXA 3WD6A 2DSAA 4EDZA 1MD3A 2E7PA 2HT9A 1TKDB 2JU5A 1GTUA 5IIZA 1GUMA 2VL9A 2IMIA 3ZRDA 5F8BA 2H73A 5CRWA 4KE3A 4KDXA 4MP4A 3H8QA 2NTOA 1E2YA 4POMA 3GX8A 1A24A 4O32A 1SKWB 1G0TA 1WIKA 3LFLA 1M2DA 2AJQB 3RHBA 3TUEA 2PMTA 3ZZXA 4J2FA 2RIIA 2OA7A 19GSA 3Q18A 2VM2A 2X99A 5CRDA 4IP1A 5C04A 3C1RA 4IW9A 3DGQA 2GLRA 3PGTA 1C72A 4WBRD 12GSA 4XS6A 4ZBBA 1RK4A 5F06A 2XBIA 3HZ4A 4HUAA 4MK3A 4LLRA 1JFUA 1EEJA 1BJXA 3WGEA 1FG4A 2FA8A 3P90A 3FKFA 2G0FA 2YN1A 1R5PA 5ID2A 1M2AA 3EINA 2XHFA 4LA1A 2HNLA 4KUNA 2K6VA 5KN2A 3QPMA 2OBKA 2WCIA 1PRXA 1QGVA 4XRAA 3F63A 4P3YB 4ZB6A 2H0HA 1X5CA 3BCKA 2RUFA 3GFKA 4HQSA 1AAZA 6GSUA 3F8UA 2X8CA 4TRXA 1YEPA 3IRAA 2LTKA 4NV5A 1WPIA 3FW2A 1NM3A 6GSSA 5G1KA 5KN3A 1Z6NA 5GAPD 5B7CA 3TB2A 2EC4A 1S3CA 2O7KA 3W8JA 6GSYA 5HR0A 1WOUA 5IO0A 4WR5A 3L9UA 4NV2A 5ECKB 1TRWA 2P5RA 3PR8A 4DSQA 1T3BA 4PNFA 4TKYA 2KHPA 1O6JA 3IA1A 1EGOA 2TRCP 2ON7A 1A2JA 1V57A 3WGXA 4ZIJA 2HI7A 3F6FA 1XOAA 3N5OA 3G9BA 2WB9A 1U88A 1PMTA 2B5XA 3ERFA 1WJKA 4DSSA 4Q5QA 2VL2A 4K1FA 1YKAA 4LL4B 2E2GA 2ES7A 1K3OA 1S3AA 2IWTA 3QOUA 3FR6A 1TU7A 2PGTA 3O6TA 4JRRA 5IMAA 1Z7RA 3H93A 4XTSA 3GUSA 7GSSA 4HEA2 2YV9A 1JZOA 1AQXA 1JZDA 2GZYA 1K0AA 3DYRA 4GWRA 1E6BA 1JHBA 2R37A 4OCEA 2JZRA 1OC9B 3WYWA 2I1UA 4WXTA 1XWBA 4HJMA 5F07A 2WZ9A 3LSZA 1R26A 5IMVA 1MDJA 1THOA 2AYTA 3WGDA 3M9JA 1I9DA 1XWAA 10GSA 4WEYA 3KCMA 3EE2A 2DLXA 1PL1A 4HU7A 4K7OA 3H79A 1ERTA 3D22A 1NHYA 1G7EA 4MLYA 1PL2A 1MDKA 1VF2A 1SYRA 3F4SA 3ZLPA 3DWVA 4BVYA 2K18A 2QC7A 3ERWA 3S9FA 4GQCA 4JR6A 3IBHA 1YDKA 3TOUA 2OADA 4N30A 4BWQA 2L59A 3TCOA 3E0UA 5JCWA 1TK0B 3DEXA 4TOPA 2FWGA 2R5GA 5DQYA 3O3TA 4KB3A 1PX6A 4GF0A 1JLWA 1V98A 4O7HA 3ZMKA 1GWCA 5INYA 1ZOFA 2PERA 1B8XA 4IKHA 1IYHA 1U3IA 4IS0A 3GN3A 2IFQB 4ECJA 2VO4A 1A23A 4I2UA 2H01A 4IQ1A 1XWKA 3VFIA 4N0ZA 1T00A 5G2ZA 4GTUA 2IPAA 1A0RP 2ZCTA 2N5BA 2LEGA 1X5DA 1GLQA 1SL0B 2KP1A 4MZBA 1OC3A 4Z7XA 4N11A 3R2QA 1XXUA 3BCIA 2I3YA 2DJ0A 2ZNMA 1Y6EA 4LL1B 1QQ2A 3GL3A 5J41A 1F3AA 5HR2A 2BJXA 2PU9C 3CRUA 1AIUA 3ZVJA 5HFKA 3UEMA 5KN0A 2FA4A 1EGRA 3GKMA 2B3SA 5JCGA 4DEJA 3NIVA 2BTOT 3TKSA 2R2JA 4HI7A 2AB6A 2YJ7A 3UAPA 3GV1A 3D21A 3IOSA 1YY7A 5L71A 2IN3A 5ENUA 1V58A 2L6CA 2EIRA 1URMA 4OFNA 5A5KA 4MJEA 1ZMAA 2LV3A 4LMWA 2V41A 1GSQA 2OJLA 4EDYA 5HR3A 2DIYA 5H5QA 3EU3A 4F2IA 1H4OA 4ILFA 2FGXA 2YZUA 2A2SA 22GSA 5D73A 5JWRB 2HZFA 5IM9A 3HY2A 5AGYA 5AIXA 3GKXA 3GH9A 3VWXA 3IV4A 3FZAA 2KOKA 3GTUB 2GGTA 1XW6A 1T1VA 1F2EA 2JZTA 5H5RA 3UIWA 2GSSA 2H66A 3I43A 4KX4A 5HFIA 5GSSA 3VWWA 2F9SA 4WF4A 1O8WA 3F6DA 4YAVA 3LEFA 3M1GA 6GSXA 3D6IA 5E4WA 3RHCA 4AJ6A 3MWHA 5IPGA 4K8MA 3VWUA 1K0CA 1SYXA 1KBNA 2I81A 3M0FA 1A8LA 1G7OA 1T8EB 3IAS2 3Q74A 2CZ3A 1TW9A 4GXZA 3LYKA 4V2MA 4POLA 2GDRA 1K0DA 5CRGA 4HQZA 4IP6A 1O85A 4PUFC 4I2TA 2LNSA 3FZ9A 3FEUA 5IMDA 3DIEA 4BPYA 5IO2A 1B4QA 2H1GA 4JR4A 5DCGA 1QFNA 2OBIA 5D9WA 5FT3A 4YH2A 3KIJA 6GSVA 1Z3EA 4YQUA 4PNGA 1V40A 1SK1A 3LQ7A 3QAGA 3DD3A 2DJKA 3IR4A 3FR3A 4V1Ap 1VF3A 3GH6A 1TK5B 1VF1A 3ZL5A 1EOHA 2PN8A 2GT6A 4ZILA 3C1SA 1T7PB 5J9CA 2RM5A 4TVEA 2OE0A 4KAEA 4MZWA 5CNWA 2YJHA 2NBSA 3FRCA 1GLPA 3EU4A 1EV9A 5D9VA 2V6KA 2YCDA 3GA4A 3U5RE 4IJ3A 3QR6A 3KMOA 3RBTA 1EZKA 1XFLA 2TIRA 4TR1B 2GZPA 4L0WA 3ME8A 5F0GA 5D93A 1HNCA 4K0GA 3KP9A 3MDKA 3MSZA 4KCEA 4DSRA 4GSNA 2A2RA 2H76A 2H19A 3GMFA 3G7IA 2GSTA 1M2BA 1Q4JA 1U6TA 1GTIA 2IMFA 2GTUA 1GSEA 1XWGA 3F0IA 2VLTA 2G2QA 4NHZA 4EO3A 4X43A 3RAZA 3EYTA 1BQ7A 1X9MB 1X9SB 1EP7A 2VLVA 2K8SA 3UOMA 2LUSA 3BBYA 4PX1A 3KMNA 3APQA 1TI1A 4MH2A 3HVSA 4KGIA 3GTUA 2YP6A 2VOCA 5B8AA 3L9VA 5ECPB 3M3MA 2B5EA 1XW5A 2LJAA 4G19A 2K8VA 1HD2A 5ELAA 3WT2A 4PGTA 3ZYWA 2P31A 3K8NA 2KP2A 1MD4A 1PX7A 4XHMA 4EL1A 3DVXA 1SJ6A 2QSIA 2FCHA 2QGVA 4GRFA 3QFBC 4ULXA 2C1YA 3SBCA 4NPBA 3TJFA 1MEKA 3GNJA 1G6YA 1WP0A 1ST9A 4EF0A 3QDNA 4F82A 3I69A 2PPTA 3EC3A 2V32A 1M9AA 2C3NA 4PXOA 2YWNA 1B9XC 2YANA 2IIYA 4F0BA 1PGTA 1J08A 4G2EA 3QMXA 3UJ1A 1MTCA 1M99A 4MF5A 2LS5A 3JCML 3HDCA 4WR4A 4OMVA 3HVXA 3GSSA 2GSRA 2IMKA 3F3RA 2P5QA 4Q5FA 2C0DA 3PH9A 4HOJA 3D0ZA 4JBBA 2JSZA 3VURA 1N2AA 4TXOB 3EWLA 3BOAA 4F0CA 2J23A 1FAAA 5ECOB 3FHKA 2N5FA 1GL8A 4AJ8A 3CYNA 4TXVA 1EWXA 4BL7A 4JEDA 1EEMA 2LSTA 2HRFA 5J3RA 5DAKA 2CQ9A 4KH7A 2JACA 3LG6A 1Z9HA 3QD9A 2MYGA 1K0OA 1ZYEA 4KDYA 1ACVA 4MA9A 1GP1A 1OAZA 1RW1A 4ZB8A 5DJLA 4ISDA 1OKTA 2VCTA 3QAVA 5LCZA 2VL3A 2WRTA 1XVWA 2R4VA 4MF7A 2GQLA 2B1LA 4MPGA 3P8WA 2LRCA 2H72A 4MDCA 5D96A 1GTBA 5JWQB 1TTZA 1U87A 4PQIA 2H0IA 1X0RA 4XS1A 2RM6A 1O81A 3ZITA 2P0GA 1M9BA 4L5LA 3E9JB 2D2ZA 1R5AA 4IBPA 4BVXA 2XPEA 2PVQA 2HSYA 3DMLA 1F9MA 1KTEA 3TGZA 2YZHA 3TKQA 4V2NA 5ABRA 2DMMA 3G7YA 1TP9A 4MMMA 3EMPA 1X9WB 1KNGA 1UN2A 1I5GA 1EOGA 5FHIA 3DKSA 2VCWA 1ON4A 3HXSA 5DVBA 2GZZA 4NHWA 1O7UA 1VGLA 2VCQA 3GL5A 5IOWA 4K9ZA 3ERGA 1Z5YE 2MMNA 2FWFA 2V6OA 3TJBA 4KCAA 3P7XA 4K7IA 2PBJA 5E59A 4ECIA 4RQXA 2B6MA 4XS4B 2HXKA 2OE3A 1V2AA 4IGJA 3GIXA 1A8YA 2PUKC 4MJAA 1O73A 5J4UA 4XCSA 3CXGA 2NVLA 1XIYA 3BD2A 2GSQA 1GH2A 5CAXA 5LNKe 2H1BA 3TKPA 4FYBA 4OFTA 1IYIA 1YZXA 2DC5A 2HZEB 3F9UA 3IC4A 4I5QA 4OCFA 3RPPA 2NPBA 1ERUA 1QK8A 2CT6A 1OYJA 1A2MA 1YEXA 4CHSA 4IQAA 4L0UA 1AUCA 3LWAA 3U6VA 4XIHA 4NAXA 3IDVA 3G7JA 4ZB9A 4HS1A 1K0MA 1AW9A 1K0NA 3CBUA 4POBA 4WETA 3IE3A 3F3QA 2YWIA 4ZL7A 2IJYA 1FB6A 1SD9A 2L5LA 2VIMA 3HZ8A 1SD8A 1WRYA 4ML1A 1NHOA 2O8VB 3GX0A 4WF5A 1GNEA 2GS3A 2GQMA 1PQNA 2B1KA 4BA7A 5CREA 1RQMA 3VLNA 1OC9A 4EKZA 2LJKA 2X8GA 4HJ2A 5DCHA 2ALBA 2MMZA 1USBA 1XOBA 3UVHA 2FHEA 4G10A 2FUG2 13GSA 3KM6A 2XC2A 3GHAA 2CX3A 3ME7A 2F51A 3TKSC 1FVJA 1W4VA 4HZ4A 2OACA 3L78A 1XCCA 4IJIA 8GSSA 3ZREA 5B6NA 5IPHA 1UVZA 3UMAA 1TRSA 4TR3A 3C71A 4PURA 4ZL8A 1N8JA 5ID2B 1V9WA 5G5EA 4Q5NA 3C7MA 3H1NA 3A2XA 2AUVA 2HYXA 1ILOA 5CYYA 3GYKA 2F3MA 2RUEA 3FYGA 4K2DA 3KEBA 4MABA 2CVKA 4J56E 3I9V2 2L5OA 3QFAC 1FVKA 4JE1A 4ZBDA 4JZQA 1PKZA 4YQMA 2HRNA 1S3DA 3MAKA 1FHEA 2YWOA 4K6XA 3UVTA 2FWHA 4N0VA 1NW2A 3KP8A 2RLIA 2IFQA 2ON5A 3I6AA 4BWSA 2LQQA 1F37A 5G31A 3SWLA 4MZCA 1HNBA 2M46A 4F9ZA 1ZGNA 2LQOA 1R7HA 4HDEA 4IVFA 1MDIA 1PA3A 5IQYA 1AQVA 4X0XA 1OE7A 5ECLB 5HFGA 1SL1B 3ZFBA 1SK0A 3HJPA 1BYEA
chains in the Genus database with same CATH superfamily
5A4WA 5EL8A 4DSSB 4H86A 1ERWA 2WGRA 5COHA 3VI5A 1TRVA 1ZYQB 3NZNA 2M80A 2CA8A 9GSSA 2TRXA 3QCPA 5B6MA 2DBCA 4RI6A 16GSA 4MH3A 3NOFA 4MJBA 1PFOA 1LU4A 5DDLA 2WULA 4N10A 3PINA 2MBTA 5HQPA 3FK8A 4XRDA 5G1LA 1XBSA 4EC0A 2KUCA 5ECSA 3A2VA 2MMOA 3VI7A 2I9HA 4JU5A 2JZSA 4CY8A 5J5NA 4O92A 2V2GA 3P2AA 2L57A 4OO4A 1LJRA 2DKHA 18GSA 3TJGA 2FD3A 5A4VA 4TW5A 4G0LA 1FB0A 3M9KA 1JZRA 3VWVA 2X64A 5B8BA 2LNTA 2LKUA 5EPFA 5GZZB 1TI3A 2OKAA 1ZCPA 1A0FA 2CX4A 3ZVJD 1SENA 3C73A 5J9BA 3TKRA 1DSBA 3FZ5A 1GNWA 3L4NA 4MJCA 2H8LA 1VRSD 4PQHA 4OO5A 1Y25A 2YV7A 1NSWA 5DALB 2O87A 4ID0A 4AGSA 2CAIA 4BVYB 3TKSE 3PPUA 4RQRA 2FNOA 4I8BA 3HKRA 3MNGA 4KF9A 4O5RA 5EY6A 4V2LA 1OKDA 3ISOA 1AC1A 3N9JA 1TDIA 1CQHA 3IC8A 3EVIA 2WDUA 2ZUPA 2WJUA 4FO5A 2QKEA 5D8IA 1XVQA 1DE2A 1PSQA 3HD5A 2YNXA 1Z6MA 2I4AA 4IELA 5G5FA 2DIZA 1GSYA 3APOA 4J57E 3TRQA 4IHUA 5D9TA 2EIOA 3EURA 5IMCA 2DJ3A 3KTBA 4LMVA 2Z9SA 5IMZA 4L5OA 2J9HA 1YKCA 1WWJA 4EE0A 2MZCA 4I97A 4YQVA 3IAM2 1U3AA 2VCZA 3O76A 2YWMA 3C8EA 4FYCA 3W6GA 2N5AA 1X5EA 4FIWA 3CSHA 1PD21 3GSTA 3A2WA 5DQSA 3GRXA 3LXTA 3L9SA 14GSA 3ZTLA 3LXZA 1QUWA 4MPFA 1G6WA 1XG8A 2HSHA 3R3EA 3TRPA 2IL3A 4GQFA 2DMLA 4Q5RA 1TOFA 3LW9A 1FOVA 2YPMA 3DRNA 2LRTA 2VAFA 2GT5A 4GCIA 1WE0A 1SJZA 4E8HA 1JLVA 4EVMA 4V1Ag 4O5QA 2H1DA 3M8NA 5C00A 1BEDA 3FZ4A 2E2MA 1QXHA 2OE1A 1LBKA 2FY6A 2GQKA 2H6XA 2H30A 2F8FA 2VM1A 4HSCX 1KEBA 4TR1A 4QL9A 2HRAA 3HCZA 4OD7A 2C0FA 3VPTA 5IOXA 1PKWA 3LYPA 1SL2B 5GSTA 5AIVA 1GRXA 1SK2A 2B7JA 2GVPA 5ELGA 3J7Yb 3KH7A 1TRUA 2K9FA 2VL2C 5F05A 1TJDA 3TJJA 4DVCA 1HNAA 1R4WA 1BG5A 2VCVA 1AQWA 4L8EA 5ECIB 5HR1A 5KEJA 2UZ8A 3V1WA 2B5YA 11GSA 4PTSA 4AJ7A 5D9XA 2JADA 1PN9A 3A3TA 3CTGA 4F03A 1XW9A 2AV4A 2O85A 20GSA 3IPZA 3D4MA 5DALA 2CAQA 5KN1A 1M0UA 2LRNA 1T4YA 2H6ZA 2VLUA 4K7NA 3J7Yk 3HVVA 4MF6A 1FOHA 4D73B 3UARA 1ERVA 2HE3A 2BMXA 5ECNB 1SJIA 2A4VA 3A5WA 1UA5A 4YAPA 2F8AA 4NWYA 5JWOB 3UBLA 2LJRA 1K3LA 3HA9A 3ZMLA 3IHQA 5ECMB 5GAND 4ZBAA 5G30A 1DE1A 2O89A 2B7KA 1B9YC 3CTFA 2IMDA 1TK8B 5CRHA 1OC8A 2M72A 2WS2A 2NDOA 3MYDA 4RUVA 2CZ2A 4ZL9A 1Z7PA 3HJOA 2R6KA 3KH9A 3QAWA 3LJRA 1FW1A 5LD0A 5IMFA 3TDGA 3UBKA 2FLSA 2PVOC 4K0NA 5EVOA 5DJMA 4KSOA 2XPDA 3GURA 4QL7A 1GTAA 4X1UA 4QQ7A 2IMEA 3APSA 3KJYA 3EMXA 3IXRA 1T4ZA 2C80A 1WMJA 2R0CA 1BAYA 2C3TA 1O8XA 2C4JA 2REMA 4ML6A 1YQ1A 2CV4A 1JZWA 4EXJA 2C3QA 3BJ5A 2H0GA 1GSSA 2C0GA 4KSMA 3ZFLA 3TOTA 3DXBA 1GUKA 1GULA 5JCUA 2AAWA 1M3IA 3CRTA 4TXOA 5AN1A 2H71A 2X8HA 5CP1A 1YJ6A 4EUYA 2V1MA 2C0EA 3VPQA 3AY8A 4HZ2A 3KD0A 1H75A 4NMUA 3CSIA 1FO5A 1THXA 1B4PA 2VCXA 2FWEA 1ML6A 3Q6OA 1DUGA 3VK9A 3HHVA 2VUPA 4POKA 4PUAA 5CO3A 1A2LA 1AXDA 4I6XA 2E0QA 3A5IA 3KZQA 4KW6A 4ECCA 3ZIJA 2VD1A 4IN0A 2L6DA 2QA2A 1PN0A 1W89A 17GSA 3FR9A 2XBQA 4GLTA 1OE8A 4ECBA 2MMAA 1GSDA 2H74A 3WT1A 3F4TA 3LORA 3KTLA 4GSSA 4KA0A 4PQ1A 4FH8A 1VF4A 1F3BA 1UC7A 4MCUA 4Z2TA 4WKWA 5A4UA 1DBYA 1K3YA 1EV4A 1YF1A 3D4TA 3TJKA 2EIQA 4ACSA 1HYUA 3W8SA 4TR0A 4G9HA 4ZXGA 4E8EA 2L4CA 3HJMA 4AF2A 3RPNA 2YOIA 6GSTA 1J9BA 1SKSB 3GKNA 3KGKA 1ZYNA 3IK9A 5ECQB 5FWGA 2JL4A 2DJ2A 1B48A 1XPVA 5H5SA 2CVBA 1M7TA 2HLSA 2DJ1A 4D73A 2KLXA 5DBQA 2H75A 1ZZYA 3LGCA 3CSJA 1Q98A 2HFDA 3Q19A 2MBSA 1K0BA 5AISA 4TR4A 1XWCA 1EP8A 2PWJA 1J0FA 4WBJA 1SKRB 2H70A 1QMVA 2AHEA 4FYUA 3US3A 3TRXA 1TU8A 3RDWA 1HQOA 4CDOA 1ZL9A 4TN8A 3FY7A 2C8UA 1ABAA 1SU9A 1XZOA 2H6YA 4NXIA 3DVWA 3ED3A 1GUHA 3UL3A 4MNNA 2WFCA 3HYPA 4KNDA 1F6MC 3F4RA 5ECRB 4OFMA 4XS4A 2H1AA 1CQGA 1YF0A 3IK7A 1GSFA 4CW9A 2JSYA 1GSUA 3L0HA 3OR5A 1OVNA 1BX9A 2HZEA 3GKKA 2R3XA 4HU9A 2DJJA 4BL7B 2CVDA 3H4KA 4KDUA 2VD0A 3E3EA 4RI7A 3CMIA 3D5JA 3ZIVA 2L4QA 6GSWA 5ECHB 3KXOA 4OWYA 5DAKB 4GSTA 1TXXA 3WD6A 2DSAA 4EDZA 1MD3A 2E7PA 2HT9A 1TKDB 2JU5A 1GTUA 5IIZA 1GUMA 2VL9A 2IMIA 3ZRDA 5F8BA 2H73A 5CRWA 4KE3A 4KDXA 4MP4A 3H8QA 2NTOA 1E2YA 4POMA 3GX8A 1A24A 4O32A 1SKWB 1G0TA 1WIKA 3LFLA 1M2DA 2AJQB 3RHBA 3TUEA 2PMTA 3ZZXA 4J2FA 2RIIA 2OA7A 19GSA 3Q18A 2VM2A 2X99A 5CRDA 4IP1A 5C04A 3C1RA 4IW9A 3DGQA 2GLRA 3PGTA 1C72A 4WBRD 12GSA 4XS6A 4ZBBA 1RK4A 5F06A 2XBIA 3HZ4A 4HUAA 4MK3A 4LLRA 1JFUA 1EEJA 1BJXA 4BVXB 3WGEA 1FG4A 2FA8A 3P90A 3FKFA 2G0FA 4O5UA 2YN1A 1R5PA 5ID2A 1M2AA 3EINA 2XHFA 5BMUA 4LA1A 2HNLA 4KUNA 2K6VA 5KN2A 3QPMA 2OBKA 2WCIA 1PRXA 1QGVA 4XRAA 3F63A 4P3YB 4ZB6A 2H0HA 1X5CA 3BCKA 2RUFA 3GFKA 4HQSA 1AAZA 6GSUA 3F8UA 2X8CA 4TRXA 1YEPA 3IRAA 2LTKA 4NV5A 1WPIA 4Z2UA 3FW2A 1NM3A 3HVNA 6GSSA 5G1KA 5KN3A 1Z6NA 5GAPD 5B7CA 3TB2A 2EC4A 1S3CA 2O7KA 3W8JA 6GSYA 5HR0A 1WOUA 5IO0A 4WR5A 3L9UA 4NV2A 5ECKB 1TRWA 2P5RA 3PR8A 4DSQA 1T3BA 4PNFA 4TKYA 2KHPA 1O6JA 3IA1A 1EGOA 2TRCP 2ON7A 1A2JA 1V57A 3WGXA 4ZIJA 2HI7A 3F6FA 1XOAA 3N5OA 3G9BA 2WB9A 1U88A 1PMTA 2B5XA 3ERFA 1WJKA 4DSSA 4Q5QA 2VL2A 4K1FA 1YKAA 4LL4B 2E2GA 2ES7A 1K3OA 1S3AA 2IWTA 3QOUA 3FR6A 1TU7A 2PGTA 3O6TA 4JRRA 5IMAA 1Z7RA 3H93A 4XTSA 4A5PA 3GUSA 7GSSA 4HEA2 2YV9A 1JZOA 1AQXA 1JZDA 2GZYA 1K0AA 3DYRA 4GWRA 1E6BA 1JHBA 2R37A 4OCEA 2JZRA 1OC9B 3WYWA 2I1UA 4WXTA 2A2PA 1XWBA 4HJMA 5F07A 2WZ9A 3LSZA 1R26A 5IMVA 1MDJA 1THOA 2AYTA 3WGDA 3M9JA 3FMWA 1I9DA 1XWAA 10GSA 4WEYA 3KCMA 3EE2A 2DLXA 3CQFA 1PL1A 4HU7A 4K7OA 3H79A 1ERTA 3D22A 1NHYA 1G7EA 4MLYA 1PL2A 1MDKA 1VF2A 1SYRA 3F4SA 3ZLPA 3DWVA 4BVYA 2K18A 2QC7A 3ERWA 3S9FA 4GQCA 4JR6A 3IBHA 1YDKA 3TOUA 2OADA 4N30A 4BWQA 2L59A 3TCOA 3E0UA 5JCWA 1TK0B 3DEXA 4TOPA 2FWGA 2R5GA 5DQYA 3O3TA 4KB3A 1PX6A 4GF0A 1JLWA 1V98A 4O7HA 3ZMKA 1GWCA 5INYA 1ZOFA 2PERA 1B8XA 4IKHA 1IYHA 1U3IA 4IS0A 3GN3A 2IFQB 4ECJA 2VO4A 1A23A 4I2UA 2H01A 4IQ1A 1XWKA 3VFIA 4N0ZA 1T00A 5G2ZA 4GTUA 4K5RA 2IPAA 1A0RP 2ZCTA 2N5BA 2LEGA 1X5DA 1GLQA 1SL0B 2KP1A 4MZBA 1OC3A 4Z7XA 4G0IA 4N11A 3R2QA 1XXUA 3BCIA 2I3YA 2DJ0A 2ZNMA 1Y6EA 4LL1B 1QQ2A 3GL3A 5J41A 1F3AA 5HR2A 2BJXA 2PU9C 3CRUA 1AIUA 3ZVJA 5HFKA 3UEMA 5KN0A 2FA4A 1EGRA 3GKMA 2B3SA 5JCGA 4DEJA 3NIVA 2BTOT 3TKSA 2R2JA 4HI7A 2AB6A 2YJ7A 3UAPA 3GV1A 3D21A 3IOSA 1YY7A 5L71A 2IN3A 5ENUA 1V58A 2L6CA 2EIRA 1URMA 4OFNA 5A5KA 4MJEA 1ZMAA 2LV3A 4LMWA 2V41A 1GSQA 2OJLA 4EDYA 5HR3A 2DIYA 5H5QA 3EU3A 4F2IA 1H4OA 4ILFA 2FGXA 2YZUA 2A2SA 22GSA 5D73A 5JWRB 2HZFA 5IM9A 3HY2A 5AGYA 5AIXA 3GKXA 3GH9A 3VWXA 3IV4A 3FZAA 2KOKA 3GTUB 2GGTA 1XW6A 1T1VA 1F2EA 2JZTA 5H5RA 3UIWA 2GSSA 2H66A 3I43A 4KX4A 5HFIA 5GSSA 3VWWA 2F9SA 4WF4A 1O8WA 3F6DA 4YAVA 3LEFA 3M1GA 6GSXA 3D6IA 5E4WA 3RHCA 4AJ6A 3MWHA 5IPGA 4K8MA 3VWUA 1K0CA 1SYXA 1KBNA 5KOWA 2I81A 3M0FA 1A8LA 1G7OA 4K5SA 1T8EB 3IAS2 3Q74A 2CZ3A 1TW9A 4GXZA 3LYKA 4V2MA 4POLA 2GDRA 1K0DA 4BIKA 2X49A 5CRGA 4HQZA 4IP6A 1O85A 4PUFC 4I2TA 2LNSA 3FZ9A 3FEUA 5IMDA 3DIEA 4BPYA 5IO2A 1B4QA 2H1GA 4JR4A 5DCGA 1QFNA 2OBIA 5D9WA 5FT3A 4YH2A 3KIJA 6GSVA 1Z3EA 4YQUA 4PNGA 1V40A 1SK1A 3LQ7A 3QAGA 3DD3A 2DJKA 3IR4A 3FR3A 4V1Ap 1VF3A 3GH6A 1TK5B 1VF1A 3ZL5A 1EOHA 2PN8A 4YKFA 2GT6A 4ZILA 3C1SA 1T7PB 5J9CA 2RM5A 4TVEA 2OE0A 4KAEA 4MZWA 5CNWA 2YJHA 2NBSA 3FRCA 1GLPA 3EU4A 1EV9A 5D9VA 2V6KA 2YCDA 3GA4A 3U5RE 4IJ3A 3QR6A 3KMOA 3RBTA 1EZKA 1XFLA 2TIRA 2QA1A 4TR1B 2GZPA 4L0WA 3ME8A 5F0GA 5D93A 1HNCA 4K0GA 3KP9A 3MDKA 3MSZA 4FQUA 4KCEA 4DSRA 4GSNA 2A2RA 2H76A 2H19A 3GMFA 3G7IA 2GSTA 1M2BA 1Q4JA 1U6TA 3EPTA 1GTIA 2IMFA 2GTUA 1GSEA 1XWGA 3F0IA 2VLTA 2G2QA 4NHZA 4EO3A 4X43A 5KOXA 3RAZA 3EYTA 1BQ7A 1X9MB 1X9SB 1EP7A 2VLVA 2K8SA 3UOMA 2LUSA 3BBYA 4PX1A 3KMNA 3APQA 1TI1A 4MH2A 3HVSA 4KGIA 3GTUA 2YP6A 2VOCA 5B8AA 3L9VA 5ECPB 3M3MA 2B5EA 1XW5A 2LJAA 4G19A 2K8VA 1HD2A 5ELAA 3WT2A 4PGTA 3ZYWA 2P31A 3K8NA 2KP2A 1MD4A 1PX7A 4YKGA 4XHMA 4EL1A 3DVXA 1SJ6A 2QSIA 2FCHA 2QGVA 4GRFA 3QFBC 2X4AA 4ULXA 2C1YA 3SBCA 4NPBA 3TJFA 1MEKA 3GNJA 1G6YA 1WP0A 1ST9A 4EF0A 3QDNA 4F82A 3I69A 2PPTA 3EC3A 2V32A 1M9AA 2C3NA 4PXOA 2YWNA 1B9XC 2YANA 2IIYA 4F0BA 1PGTA 1J08A 4G2EA 3QMXA 3UJ1A 1MTCA 1M99A 4MF5A 2LS5A 3JCML 3HDCA 4WR4A 4OMVA 3HVXA 3GSSA 2GSRA 1S3RA 2IMKA 3F3RA 2P5QA 4Q5FA 2C0DA 3PH9A 4HOJA 3D0ZA 4JBBA 2JSZA 3VURA 1N2AA 4TXOB 3EWLA 3BOAA 4F0CA 2J23A 1FAAA 5ECOB 3FHKA 2N5FA 1GL8A 4AJ8A 3CYNA 4TXVA 1EWXA 4BL7A 4JEDA 1EEMA 2LSTA 2HRFA 5J3RA 5DAKA 2CQ9A 4KH7A 2JACA 4EIQA 3LG6A 1Z9HA 3QD9A 2MYGA 1K0OA 1ZYEA 4KDYA 1ACVA 4MA9A 1GP1A 1OAZA 1RW1A 3IHGA 4ZB8A 5DJLA 4G0KA 4ISDA 1OKTA 2VCTA 3QAVA 5LCZA 2VL3A 2WRTA 1XVWA 2R4VA 4MF7A 2GQLA 2B1LA 4K2XA 4MPGA 3P8WA 2LRCA 2H72A 4MDCA 5D96A 1GTBA 5JWQB 1TTZA 1U87A 4PQIA 2H0IA 1X0RA 4XS1A 2RM6A 1M3JA 1O81A 3ZITA 2P0GA 1M9BA 4L5LA 3E9JB 2D2ZA 1R5AA 4IBPA 4BVXA 2XPEA 2PVQA 2HSYA 3DMLA 1F9MA 1KTEA 3TGZA 2YZHA 3TKQA 4V2NA 5ABRA 2DMMA 3G7YA 4ICYA 2HSMA 1TP9A 4MMMA 3EMPA 1X9WB 1KNGA 1UN2A 1I5GA 1EOGA 5FHIA 3DKSA 2VCWA 1ON4A 3HXSA 5DVBA 2GZZA 4NHWA 1O7UA 1VGLA 2VCQA 3GL5A 5IOWA 4K9ZA 3ERGA 1Z5YE 2MMNA 2FWFA 2V6OA 3TJBA 4KCAA 3P7XA 4K7IA 2PBJA 5E59A 4ECIA 4RQXA 2B6MA 4XS4B 2HXKA 2OE3A 1V2AA 4IGJA 3GIXA 1A8YA 2PUKC 4MJAA 1O73A 5J4UA 4XCSA 3CXGA 2NVLA 1XIYA 3BD2A 2GSQA 1GH2A 5CAXA 5LNKe 2H1BA 3TKPA 4FYBA 4OFTA 1IYIA 1YZXA 2DC5A 4OCFA 2HZEB 3F9UA 3IC4A 4I5QA 3RPPA 2NPBA 4EIPA 1ERUA 1QK8A 2CT6A 1OYJA 1A2MA 1YEXA 4CHSA 4CY6A 4IQAA 4L0UA 4X4JA 1AUCA 3LWAA 3U6VA 4XIHA 4NAXA 3IDVA 3G7JA 4ZB9A 4HS1A 1K0MA 1AW9A 1K0NA 3CBUA 4POBA 4WETA 3IE3A 3F3QA 2YWIA 4ZL7A 2IJYA 1FB6A 1SD9A 2L5LA 2VIMA 3HZ8A 1SD8A 1WRYA 2A4HA 4ML1A 1NHOA 2O8VB 3GX0A 4WF5A 1GNEA 2GS3A 2GQMA 1PQNA 2B1KA 4BA7A 4Z2RA 5CREA 1RQMA 3VLNA 1OC9A 4EKZA 2LJKA 2X8GA 4HJ2A 5DCHA 2ALBA 2MMZA 1USBA 1XOBA 3UVHA 2FHEA 4G10A 2FUG2 13GSA 3KM6A 2XC2A 3GHAA 2CX3A 2HRKA 3ME7A 2F51A 3TKSC 1FVJA 1W4VA 4HZ4A 2OACA 3L78A 1XCCA 4IJIA 8GSSA 3ZREA 5B6NA 5IPHA 1UVZA 3UMAA 1TRSA 4TR3A 3C71A 4PURA 4ZL8A 1N8JA 5ID2B 1V9WA 5G5EA 4Q5NA 3C7MA 3H1NA 3A2XA 2AUVA 2HYXA 1ILOA 5CYYA 3GYKA 2F3MA 2RUEA 3FYGA 4K2DA 3KEBA 4MABA 2CVKA 4J56E 3I9V2 2L5OA 3QFAC 1FVKA 4JE1A 3MIXA 4ZBDA 4JZQA 2R0PA 1PKZA 4YQMA 2HRNA 1S3DA 3MAKA 2DKIA 1FHEA 2YWOA 4K6XA 3UVTA 2FWHA 4N0VA 1NW2A 3KP8A 2RLIA 2IFQA 5BRTA 2ON5A 3I6AA 4BWSA 2LQQA 1F37A 5G31A 3SWLA 4MZCA 1HNBA 2M46A 4F9ZA 1ZGNA 2LQOA 1R7HA 4HDEA 2R0GA 1MDIA 4IVFA 1PA3A 5IQYA 1AQVA 4X0XA 1ZYPA 1OE7A 4USSA 5ECLB 5HFGA 1SL1B 3ZFBA 1SK0A 3HJPA 1BYEA
chains in the Genus database with same CATH topology
5A4WA 5EL8A 4DSSB 4H86A 1ERWA 2WGRA 5COHA 3VI5A 1TRVA 1ZYQB 3NZNA 2M80A 2CA8A 9GSSA 2TRXA 3QCPA 5B6MA 2DBCA 4RI6A 16GSA 4MH3A 3NOFA 4MJBA 1LU4A 5DDLA 2WULA 4N10A 3PINA 2MBTA 5HQPA 3FK8A 4XRDA 5G1LA 1XBSA 4EC0A 2KUCA 5ECSA 3A2VA 2MMOA 3VI7A 2I9HA 4JU5A 2JZSA 4CY8A 5J5NA 4O92A 2V2GA 3P2AA 2L57A 4OO4A 1LJRA 2DKHA 18GSA 3TJGA 2FD3A 5A4VA 4TW5A 4G0LA 1FB0A 3M9KA 1JZRA 3VWVA 2X64A 5B8BA 2LNTA 2LKUA 5EPFA 5GZZB 1TI3A 2OKAA 1ZCPA 1A0FA 2CX4A 3ZVJD 1SENA 3C73A 5J9BA 3TKRA 1DSBA 3FZ5A 1GNWA 3L4NA 4MJCA 2H8LA 1VRSD 4PQHA 4OO5A 1Y25A 2YV7A 1NSWA 5DALB 2O87A 4ID0A 4AGSA 2CAIA 4BVYB 3TKSE 3PPUA 4RQRA 2FNOA 4I8BA 3HKRA 3MNGA 4KF9A 4O5RA 5EY6A 4V2LA 1OKDA 3ISOA 1AC1A 3N9JA 1TDIA 1CQHA 3IC8A 3EVIA 2WDUA 2ZUPA 2WJUA 4FO5A 2QKEA 5D8IA 1XVQA 1DE2A 1PSQA 3HD5A 2YNXA 1Z6MA 2I4AA 4IELA 5G5FA 2DIZA 1GSYA 3APOA 4J57E 3TRQA 4IHUA 5D9TA 2EIOA 3EURA 5IMCA 2DJ3A 3KTBA 4LMVA 2Z9SA 5IMZA 4L5OA 2J9HA 1YKCA 1WWJA 4EE0A 2MZCA 4I97A 4YQVA 3IAM2 1U3AA 2VCZA 3O76A 2YWMA 3C8EA 4FYCA 3W6GA 2N5AA 1X5EA 4FIWA 3CSHA 1PD21 3GSTA 3A2WA 5DQSA 3GRXA 3LXTA 3L9SA 14GSA 3ZTLA 3LXZA 1QUWA 4MPFA 1G6WA 2HSHA 3R3EA 3TRPA 2IL3A 4GQFA 2DMLA 4Q5RA 1TOFA 3LW9A 1FOVA 2YPMA 3DRNA 2LRTA 2VAFA 2GT5A 4GCIA 1WE0A 1SJZA 4E8HA 1JLVA 4EVMA 4V1Ag 4O5QA 2H1DA 3M8NA 5C00A 1BEDA 3FZ4A 2E2MA 1QXHA 2OE1A 1LBKA 2FY6A 2GQKA 2H6XA 2H30A 2F8FA 2VM1A 1KEBA 4TR1A 4QL9A 2HRAA 3HCZA 4OD7A 2C0FA 3VPTA 5IOXA 1PKWA 3LYPA 1SL2B 5GSTA 5AIVA 1GRXA 1SK2A 2B7JA 2GVPA 5ELGA 3J7Yb 3KH7A 1TRUA 2K9FA 2VL2C 5F05A 1TJDA 3TJJA 4DVCA 1HNAA 1R4WA 1BG5A 2VCVA 1AQWA 4L8EA 5ECIB 5HR1A 5KEJA 2UZ8A 3V1WA 2B5YA 11GSA 4PTSA 4AJ7A 5D9XA 2JADA 1PN9A 3A3TA 3CTGA 4F03A 1XW9A 2AV4A 2O85A 20GSA 3IPZA 3D4MA 5DALA 2CAQA 5KN1A 1M0UA 2LRNA 1T4YA 2H6ZA 2VLUA 4K7NA 3J7Yk 3HVVA 4MF6A 1FOHA 4D73B 3UARA 1ERVA 2HE3A 2BMXA 5ECNB 1SJIA 2A4VA 3A5WA 1UA5A 4YAPA 2F8AA 4NWYA 5JWOB 3UBLA 2LJRA 1K3LA 3HA9A 3ZMLA 3IHQA 5ECMB 5GAND 4ZBAA 5G30A 1DE1A 2O89A 2B7KA 1B9YC 3CTFA 2IMDA 1TK8B 5CRHA 1OC8A 2M72A 2WS2A 2NDOA 3MYDA 4RUVA 2CZ2A 4ZL9A 1Z7PA 3HJOA 2R6KA 3KH9A 3QAWA 3LJRA 1FW1A 5LD0A 5IMFA 3TDGA 3UBKA 2FLSA 2PVOC 4K0NA 5EVOA 5DJMA 4KSOA 2XPDA 3GURA 4QL7A 1GTAA 4X1UA 4QQ7A 2IMEA 3APSA 3KJYA 3EMXA 3IXRA 1T4ZA 2C80A 1WMJA 2R0CA 1BAYA 2C3TA 1O8XA 2C4JA 2REMA 4ML6A 1YQ1A 2CV4A 1JZWA 4EXJA 2C3QA 3BJ5A 2H0GA 1GSSA 2C0GA 4KSMA 3ZFLA 3TOTA 3DXBA 1GUKA 1GULA 5JCUA 2AAWA 3CRTA 4TXOA 5AN1A 2H71A 2X8HA 5CP1A 1YJ6A 4EUYA 2V1MA 2C0EA 3VPQA 3AY8A 4HZ2A 3KD0A 1H75A 4NMUA 3CSIA 1FO5A 1THXA 1B4PA 2VCXA 2FWEA 1ML6A 3Q6OA 1DUGA 3VK9A 3HHVA 2VUPA 4POKA 4PUAA 5CO3A 1A2LA 1AXDA 4I6XA 2E0QA 3A5IA 3KZQA 4KW6A 4ECCA 3ZIJA 2VD1A 4IN0A 2L6DA 2QA2A 1PN0A 1W89A 17GSA 3FR9A 2XBQA 4GLTA 1OE8A 4ECBA 2MMAA 1GSDA 2H74A 3WT1A 3F4TA 3LORA 3KTLA 4GSSA 4KA0A 4PQ1A 4FH8A 1VF4A 1F3BA 1UC7A 4MCUA 4Z2TA 4WKWA 5A4UA 1DBYA 1K3YA 1EV4A 1YF1A 3D4TA 3TJKA 2EIQA 4ACSA 1HYUA 3W8SA 4TR0A 4G9HA 4ZXGA 4E8EA 2L4CA 3HJMA 4AF2A 3RPNA 2YOIA 6GSTA 1J9BA 1SKSB 3GKNA 3KGKA 1ZYNA 3IK9A 5ECQB 5FWGA 2JL4A 2DJ2A 1B48A 1XPVA 5H5SA 2CVBA 1M7TA 2HLSA 2DJ1A 4D73A 2KLXA 5DBQA 2H75A 1ZZYA 3LGCA 3CSJA 1Q98A 2HFDA 3Q19A 2MBSA 1K0BA 5AISA 4TR4A 1XWCA 1EP8A 2PWJA 1J0FA 4WBJA 1SKRB 2H70A 1QMVA 2AHEA 4FYUA 3US3A 3TRXA 1TU8A 3RDWA 1HQOA 4CDOA 1ZL9A 4TN8A 3FY7A 2C8UA 1ABAA 1SU9A 1XZOA 2H6YA 4NXIA 3DVWA 3ED3A 1GUHA 3UL3A 4MNNA 2WFCA 3HYPA 4KNDA 1F6MC 3F4RA 5ECRB 4OFMA 4XS4A 2H1AA 1CQGA 1YF0A 3IK7A 1GSFA 4CW9A 2JSYA 1GSUA 3L0HA 3OR5A 1OVNA 1BX9A 2HZEA 3GKKA 2R3XA 4HU9A 2DJJA 4BL7B 2CVDA 3H4KA 4KDUA 2VD0A 3E3EA 4RI7A 3CMIA 3D5JA 3ZIVA 2L4QA 6GSWA 5ECHB 3KXOA 4OWYA 5DAKB 4GSTA 1TXXA 3WD6A 2DSAA 4EDZA 1MD3A 2E7PA 2HT9A 1TKDB 2JU5A 1GTUA 5IIZA 1GUMA 2VL9A 2IMIA 3ZRDA 5F8BA 2H73A 5CRWA 4KE3A 4KDXA 4MP4A 3H8QA 2NTOA 1E2YA 4POMA 3GX8A 1A24A 4O32A 1SKWB 1G0TA 1WIKA 3LFLA 1M2DA 2AJQB 3RHBA 3TUEA 2PMTA 3ZZXA 4J2FA 2RIIA 2OA7A 19GSA 3Q18A 2VM2A 2X99A 5CRDA 4IP1A 5C04A 3C1RA 4IW9A 3DGQA 2GLRA 3PGTA 1C72A 4WBRD 12GSA 4XS6A 4ZBBA 1RK4A 5F06A 2XBIA 3HZ4A 4HUAA 4MK3A 4LLRA 1JFUA 1EEJA 1BJXA 4BVXB 3WGEA 1FG4A 2FA8A 3P90A 3FKFA 2G0FA 4O5UA 2YN1A 1R5PA 5ID2A 1M2AA 3EINA 2XHFA 5BMUA 4LA1A 2HNLA 4KUNA 2K6VA 5KN2A 3QPMA 2OBKA 2WCIA 1PRXA 1QGVA 4XRAA 3F63A 4P3YB 4ZB6A 2H0HA 1X5CA 3BCKA 2RUFA 3GFKA 4HQSA 1AAZA 6GSUA 3F8UA 2X8CA 4TRXA 1YEPA 3IRAA 2LTKA 4NV5A 1WPIA 4Z2UA 3FW2A 1NM3A 6GSSA 5G1KA 5KN3A 1Z6NA 5GAPD 5B7CA 3TB2A 2EC4A 1S3CA 2O7KA 3W8JA 6GSYA 5HR0A 1WOUA 5IO0A 4WR5A 3L9UA 4NV2A 5ECKB 1TRWA 2P5RA 3PR8A 4DSQA 1T3BA 4PNFA 4TKYA 2KHPA 1O6JA 3IA1A 1EGOA 2TRCP 2ON7A 1A2JA 1V57A 3WGXA 4ZIJA 2HI7A 3F6FA 1XOAA 3N5OA 3G9BA 2WB9A 1U88A 1PMTA 2B5XA 3ERFA 1WJKA 4DSSA 4Q5QA 2VL2A 4K1FA 1YKAA 4LL4B 2E2GA 2ES7A 1K3OA 1S3AA 2IWTA 3QOUA 3FR6A 1TU7A 2PGTA 3O6TA 4JRRA 5IMAA 1Z7RA 3H93A 4XTSA 4A5PA 3GUSA 7GSSA 4HEA2 2YV9A 1JZOA 1AQXA 1JZDA 2GZYA 1K0AA 3DYRA 4GWRA 1E6BA 1JHBA 2R37A 4OCEA 2JZRA 1OC9B 3WYWA 2I1UA 4WXTA 2A2PA 1XWBA 4HJMA 5F07A 2WZ9A 3LSZA 1R26A 5IMVA 1MDJA 1THOA 2AYTA 3WGDA 3M9JA 3FMWA 1I9DA 1XWAA 10GSA 4WEYA 3KCMA 3EE2A 2DLXA 1PL1A 4HU7A 4K7OA 3H79A 1ERTA 3D22A 1NHYA 1G7EA 4MLYA 1PL2A 1MDKA 1VF2A 1SYRA 3F4SA 3ZLPA 3DWVA 4BVYA 2K18A 2QC7A 3ERWA 3S9FA 4GQCA 4JR6A 3IBHA 1YDKA 3TOUA 2OADA 4N30A 4BWQA 2L59A 3TCOA 3E0UA 5JCWA 1TK0B 3DEXA 4TOPA 2FWGA 2R5GA 5DQYA 3O3TA 4KB3A 1PX6A 4GF0A 1JLWA 1V98A 4O7HA 3ZMKA 1GWCA 5INYA 1ZOFA 2PERA 1B8XA 4IKHA 1IYHA 1U3IA 4IS0A 3GN3A 2IFQB 4ECJA 2VO4A 1A23A 4I2UA 2H01A 4IQ1A 1XWKA 3VFIA 4N0ZA 1T00A 5G2ZA 4GTUA 4K5RA 2IPAA 1A0RP 2ZCTA 2N5BA 2LEGA 1X5DA 1GLQA 1SL0B 2KP1A 4MZBA 1OC3A 4Z7XA 4G0IA 4N11A 3R2QA 1XXUA 3BCIA 2I3YA 2DJ0A 2ZNMA 1Y6EA 4LL1B 1QQ2A 3GL3A 5J41A 1F3AA 5HR2A 2BJXA 2PU9C 3CRUA 1AIUA 3ZVJA 5HFKA 3UEMA 5KN0A 2FA4A 1EGRA 3GKMA 2B3SA 5JCGA 4DEJA 3NIVA 2BTOT 3TKSA 2R2JA 4HI7A 2AB6A 2YJ7A 3UAPA 3GV1A 3D21A 3IOSA 1YY7A 5L71A 2IN3A 5ENUA 1V58A 2L6CA 2EIRA 1URMA 4OFNA 5A5KA 4MJEA 1ZMAA 2LV3A 4LMWA 2V41A 1GSQA 2OJLA 4EDYA 5HR3A 2DIYA 5H5QA 3EU3A 4F2IA 1H4OA 4ILFA 2FGXA 2YZUA 2A2SA 22GSA 5D73A 5JWRB 2HZFA 5IM9A 3HY2A 5AGYA 5AIXA 3GKXA 3GH9A 3VWXA 3IV4A 3FZAA 2KOKA 3GTUB 2GGTA 1XW6A 1T1VA 1F2EA 2JZTA 5H5RA 3UIWA 2GSSA 2H66A 3I43A 4KX4A 5HFIA 5GSSA 3VWWA 2F9SA 4WF4A 1O8WA 3F6DA 4YAVA 3LEFA 3M1GA 6GSXA 3D6IA 5E4WA 3RHCA 4AJ6A 3MWHA 5IPGA 4K8MA 3VWUA 1K0CA 1SYXA 1KBNA 5KOWA 2I81A 3M0FA 1A8LA 1G7OA 4K5SA 1T8EB 3IAS2 3Q74A 2CZ3A 1TW9A 4GXZA 3LYKA 4V2MA 4POLA 2GDRA 1K0DA 2X49A 5CRGA 4HQZA 4IP6A 1O85A 4PUFC 4I2TA 2LNSA 3FZ9A 3FEUA 5IMDA 3DIEA 4BPYA 5IO2A 1B4QA 2H1GA 4JR4A 5DCGA 1QFNA 2OBIA 5D9WA 5FT3A 4YH2A 3KIJA 6GSVA 1Z3EA 4YQUA 4PNGA 1V40A 1SK1A 3LQ7A 3QAGA 3DD3A 2DJKA 3IR4A 3FR3A 4V1Ap 1VF3A 3GH6A 1TK5B 1VF1A 3ZL5A 1EOHA 2PN8A 4YKFA 2GT6A 4ZILA 3C1SA 1T7PB 5J9CA 2RM5A 4TVEA 2OE0A 4KAEA 4MZWA 5CNWA 2YJHA 2NBSA 3FRCA 1GLPA 3EU4A 1EV9A 5D9VA 2V6KA 2YCDA 3GA4A 3U5RE 4IJ3A 3QR6A 3KMOA 3RBTA 1EZKA 1XFLA 2TIRA 2QA1A 4TR1B 2GZPA 4L0WA 3ME8A 5F0GA 5D93A 1HNCA 4K0GA 3KP9A 3MDKA 3MSZA 4FQUA 4KCEA 4DSRA 4GSNA 2A2RA 2H76A 2H19A 3GMFA 3G7IA 2GSTA 1M2BA 1Q4JA 1U6TA 3EPTA 1GTIA 2IMFA 2GTUA 1GSEA 1XWGA 3F0IA 2VLTA 2G2QA 4NHZA 4EO3A 4X43A 5KOXA 3RAZA 3EYTA 1BQ7A 1X9MB 1X9SB 1EP7A 2VLVA 2K8SA 3UOMA 2LUSA 3BBYA 4PX1A 3KMNA 3APQA 1TI1A 4MH2A 3HVSA 4KGIA 3GTUA 2YP6A 2VOCA 5B8AA 3L9VA 5ECPB 3M3MA 2B5EA 1XW5A 2LJAA 4G19A 2K8VA 1HD2A 5ELAA 3WT2A 4PGTA 3ZYWA 2P31A 3K8NA 2KP2A 1MD4A 1PX7A 4YKGA 4XHMA 4EL1A 3DVXA 1SJ6A 2QSIA 2FCHA 2QGVA 4GRFA 3QFBC 2X4AA 4ULXA 2C1YA 3SBCA 4NPBA 3TJFA 1MEKA 3GNJA 1G6YA 1WP0A 1ST9A 4EF0A 3QDNA 4F82A 3I69A 2PPTA 3EC3A 2V32A 1M9AA 2C3NA 4PXOA 2YWNA 1B9XC 2YANA 2IIYA 4F0BA 1PGTA 1J08A 4G2EA 3QMXA 3UJ1A 1MTCA 1M99A 4MF5A 2LS5A 3JCML 3HDCA 4WR4A 4OMVA 3HVXA 3GSSA 2GSRA 2IMKA 3F3RA 2P5QA 4Q5FA 2C0DA 3PH9A 4HOJA 3D0ZA 4JBBA 2JSZA 3VURA 1N2AA 4TXOB 3EWLA 3BOAA 4F0CA 2J23A 1FAAA 5ECOB 3FHKA 2N5FA 1GL8A 4AJ8A 3CYNA 4TXVA 1EWXA 4BL7A 4JEDA 1EEMA 2LSTA 2HRFA 5J3RA 5DAKA 2CQ9A 4KH7A 2JACA 4EIQA 3LG6A 1Z9HA 3QD9A 2MYGA 1K0OA 1ZYEA 4KDYA 1ACVA 4MA9A 1GP1A 1OAZA 1RW1A 3IHGA 4ZB8A 5DJLA 4G0KA 4ISDA 1OKTA 2VCTA 3QAVA 5LCZA 2VL3A 2WRTA 1XVWA 2R4VA 4MF7A 2GQLA 2B1LA 4K2XA 4MPGA 3P8WA 2LRCA 2H72A 4MDCA 5D96A 1GTBA 5JWQB 1TTZA 1U87A 4PQIA 2H0IA 1X0RA 4XS1A 2RM6A 1O81A 3ZITA 2P0GA 1M9BA 4L5LA 3E9JB 2D2ZA 1R5AA 4IBPA 4BVXA 2XPEA 2PVQA 2HSYA 3DMLA 1F9MA 1KTEA 3TGZA 2YZHA 3TKQA 4V2NA 5ABRA 2DMMA 3G7YA 4ICYA 2HSMA 1TP9A 4MMMA 3EMPA 1X9WB 1KNGA 1UN2A 1I5GA 1EOGA 5FHIA 3DKSA 2VCWA 1ON4A 3HXSA 5DVBA 2GZZA 4NHWA 1O7UA 1VGLA 2VCQA 3GL5A 5IOWA 4K9ZA 3ERGA 1Z5YE 2MMNA 2FWFA 2V6OA 3TJBA 4KCAA 3P7XA 4K7IA 2PBJA 5E59A 4ECIA 4RQXA 2B6MA 4XS4B 2HXKA 2OE3A 1V2AA 4IGJA 3GIXA 1A8YA 2PUKC 4MJAA 1O73A 5J4UA 4XCSA 3CXGA 2NVLA 1XIYA 3BD2A 2GSQA 1GH2A 5CAXA 5LNKe 2H1BA 3TKPA 4FYBA 4OFTA 1IYIA 1YZXA 2DC5A 4OCFA 2HZEB 3F9UA 3IC4A 4I5QA 3RPPA 2NPBA 4EIPA 1ERUA 1QK8A 2CT6A 1OYJA 1A2MA 1YEXA 4CHSA 4CY6A 4IQAA 4L0UA 4X4JA 1AUCA 3LWAA 3U6VA 4XIHA 4NAXA 3IDVA 3G7JA 4ZB9A 4HS1A 1K0MA 1AW9A 1K0NA 3CBUA 4POBA 4WETA 3IE3A 3F3QA 2YWIA 4ZL7A 2IJYA 1FB6A 1SD9A 2L5LA 2VIMA 3HZ8A 1SD8A 1WRYA 2A4HA 4ML1A 1NHOA 2O8VB 3GX0A 4WF5A 1GNEA 2GS3A 2GQMA 1PQNA 2B1KA 4BA7A 4Z2RA 5CREA 1RQMA 3VLNA 1OC9A 4EKZA 2LJKA 2X8GA 4HJ2A 5DCHA 2ALBA 2MMZA 1USBA 1XOBA 3UVHA 2FHEA 4G10A 2FUG2 13GSA 3KM6A 2XC2A 3GHAA 2CX3A 2HRKA 3ME7A 2F51A 3TKSC 1FVJA 1W4VA 4HZ4A 2OACA 3L78A 1XCCA 4IJIA 8GSSA 3ZREA 5B6NA 5IPHA 1UVZA 3UMAA 1TRSA 4TR3A 3C71A 4PURA 4ZL8A 1N8JA 5ID2B 1V9WA 5G5EA 4Q5NA 3C7MA 3H1NA 3A2XA 2AUVA 2HYXA 1ILOA 5CYYA 3GYKA 2F3MA 2RUEA 3FYGA 4K2DA 3KEBA 4MABA 2CVKA 4J56E 3I9V2 2L5OA 3QFAC 1FVKA 4JE1A 3MIXA 4ZBDA 4JZQA 2R0PA 1PKZA 4YQMA 2HRNA 1S3DA 3MAKA 2DKIA 1FHEA 2YWOA 4K6XA 3UVTA 2FWHA 4N0VA 1NW2A 3KP8A 2RLIA 2IFQA 5BRTA 2ON5A 3I6AA 4BWSA 2LQQA 1F37A 5G31A 3SWLA 4MZCA 1HNBA 2M46A 4F9ZA 1ZGNA 2LQOA 1R7HA 4HDEA 2R0GA 1MDIA 4IVFA 1PA3A 5IQYA 1AQVA 4X0XA 1ZYPA 1OE7A 4USSA 5ECLB 5HFGA 1SL1B 3ZFBA 1SK0A 3HJPA 1BYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A4W A;  5EL8 A;  4DSS B;  4H86 A;  1ERW A;  2WGR A;  5COH A;  3VI5 A;  1TRV A;  1ZYQ B;  3NZN A;  2M80 A;  2CA8 A;  9GSS A;  2TRX A;  3QCP A;  5B6M A;  2DBC A;  4RI6 A;  16GS A;  4MH3 A;  3NOF A;  4MJB A;  1LU4 A;  5DDL A;  2WUL A;  4N10 A;  3PIN A;  2MBT A;  5HQP A;  3FK8 A;  4XRD A;  5G1L A;  1XBS A;  4EC0 A;  5ECS A;  2KUC A;  3A2V A;  2MMO A;  3VI7 A;  2I9H A;  4JU5 A;  2JZS A;  5J5N A;  4O92 A;  2V2G A;  3P2A A;  2L57 A;  4OO4 A;  1LJR A;  18GS A;  3TJG A;  2FD3 A;  5A4V A;  4TW5 A;  1FB0 A;  3M9K A;  1JZR A;  3VWV A;  2X64 A;  5B8B A;  2LNT A;  2LKU A;  5EPF A;  5GZZ B;  1TI3 A;  2OKA A;  1ZCP A;  1A0F A;  2CX4 A;  3ZVJ D;  1SEN A;  3C73 A;  5J9B A;  3TKR A;  1DSB A;  3FZ5 A;  1GNW A;  3L4N A;  4MJC A;  2H8L A;  1VRS D;  4PQH A;  4OO5 A;  1Y25 A;  2YV7 A;  1NSW A;  5DAL B;  2O87 A;  4ID0 A;  4AGS A;  2CAI A;  3TKS E;  4RQR A;  2FNO A;  4I8B A;  3HKR A;  3MNG A;  4O5R A;  5EY6 A;  4V2L A;  1OKD A;  3ISO A;  1AC1 A;  3N9J A;  1TDI A;  1CQH A;  3EVI A;  2WDU A;  2ZUP A;  2WJU A;  4FO5 A;  2QKE A;  5D8I A;  1XVQ A;  1DE2 A;  1PSQ A;  3HD5 A;  2YNX A;  1Z6M A;  2I4A A;  4IEL A;  5G5F A;  2DIZ A;  1GSY A;  3APO A;  4J57 E;  3TRQ A;  4IHU A;  5D9T A;  2EIO A;  3EUR A;  5IMC A;  2DJ3 A;  3KTB A;  4LMV A;  2Z9S A;  5IMZ A;  4L5O A;  2J9H A;  1YKC A;  1WWJ A;  4EE0 A;  2MZC A;  4I97 A;  4YQV A;  3IAM 2;  1U3A A;  2VCZ A;  3O76 A;  2YWM A;  3C8E A;  4FYC A;  3W6G A;  2N5A A;  1X5E A;  4FIW A;  3CSH A;  1PD2 1;  3GST A;  3A2W A;  5DQS A;  3GRX A;  3LXT A;  3L9S A;  14GS A;  3ZTL A;  3LXZ A;  1QUW A;  4MPF A;  1G6W A;  2HSH A;  3TRP A;  2IL3 A;  4GQF A;  2DML A;  4Q5R A;  1TOF A;  1FOV A;  2YPM A;  3DRN A;  2LRT A;  2VAF A;  2GT5 A;  4GCI A;  1WE0 A;  1SJZ A;  4E8H A;  1JLV A;  4EVM A;  4V1A g;  2H1D A;  3M8N A;  5C00 A;  1BED A;  3FZ4 A;  2E2M A;  1QXH A;  2OE1 A;  1LBK A;  2FY6 A;  2GQK A;  2H6X A;  2H30 A;  2F8F A;  2VM1 A;  1KEB A;  4TR1 A;  4QL9 A;  4OD7 A;  3HCZ A;  2C0F A;  3VPT A;  5IOX A;  1PKW A;  3LYP A;  1SL2 B;  5GST A;  5AIV A;  1GRX A;  1SK2 A;  2B7J A;  2GVP A;  5ELG A;  3J7Y b;  3KH7 A;  5F05 A;  1TRU A;  2K9F A;  2VL2 C;  1TJD A;  3TJJ A;  4DVC A;  1HNA A;  1R4W A;  1BG5 A;  2VCV A;  1AQW A;  4L8E A;  5ECI B;  5HR1 A;  5KEJ A;  3V1W A;  2B5Y A;  11GS A;  4AJ7 A;  5D9X A;  2JAD A;  1PN9 A;  3A3T A;  3CTG A;  4F03 A;  1XW9 A;  2AV4 A;  2O85 A;  20GS A;  3IPZ A;  3D4M A;  5DAL A;  2CAQ A;  5KN1 A;  1M0U A;  2LRN A;  1T4Y A;  2H6Z A;  2VLU A;  4K7N A;  3J7Y k;  3HVV A;  4MF6 A;  4D73 B;  3UAR A;  1ERV A;  2HE3 A;  2BMX A;  5ECN B;  1SJI A;  2A4V A;  3A5W A;  1UA5 A;  4YAP A;  2F8A A;  4NWY A;  5JWO B;  3UBL A;  2LJR A;  1K3L A;  3HA9 A;  3ZML A;  3IHQ A;  5ECM B;  5GAN D;  4ZBA A;  5G30 A;  1DE1 A;  2O89 A;  2B7K A;  1B9Y C;  3CTF A;  2IMD A;  1TK8 B;  5CRH A;  1OC8 A;  2M72 A;  2WS2 A;  2NDO A;  2CZ2 A;  4RUV A;  4ZL9 A;  1Z7P A;  3HJO A;  2R6K A;  3KH9 A;  3QAW A;  3LJR A;  1FW1 A;  5LD0 A;  5IMF A;  3TDG A;  3UBK A;  2FLS A;  2PVO C;  4K0N A;  5EVO A;  5DJM A;  4KSO A;  2XPD A;  3GUR A;  4QL7 A;  1GTA A;  4X1U A;  4QQ7 A;  2IME A;  3APS A;  3KJY A;  3EMX A;  3IXR A;  1T4Z A;  2C80 A;  1WMJ A;  1BAY A;  2C3T A;  1O8X A;  2C4J A;  2REM A;  4ML6 A;  1YQ1 A;  2CV4 A;  1JZW A;  4EXJ A;  2C3Q A;  3BJ5 A;  2H0G A;  1GSS A;  2C0G A;  4KSM A;  3ZFL A;  3TOT A;  3DXB A;  1GUK A;  1GUL A;  5JCU A;  2AAW A;  3CRT A;  4TXO A;  5AN1 A;  2H71 A;  2X8H A;  5CP1 A;  1YJ6 A;  4EUY A;  2V1M A;  2C0E A;  3VPQ A;  3AY8 A;  4HZ2 A;  3KD0 A;  1H75 A;  4NMU A;  3CSI A;  1FO5 A;  1THX A;  1B4P A;  2VCX A;  2FWE A;  1ML6 A;  3Q6O A;  1DUG A;  3VK9 A;  3HHV A;  2VUP A;  4POK A;  4PUA A;  5CO3 A;  1A2L A;  1AXD A;  4I6X A;  2E0Q A;  3KZQ A;  4KW6 A;  4ECC A;  3ZIJ A;  2VD1 A;  4IN0 A;  2L6D A;  1W89 A;  17GS A;  3FR9 A;  2XBQ A;  4GLT A;  1OE8 A;  4ECB A;  2MMA A;  1GSD A;  2H74 A;  3WT1 A;  3F4T A;  3LOR A;  3KTL A;  4GSS A;  4KA0 A;  4PQ1 A;  4FH8 A;  1VF4 A;  1F3B A;  1UC7 A;  4MCU A;  4WKW A;  5A4U A;  1DBY A;  1K3Y A;  1EV4 A;  1YF1 A;  3D4T A;  3TJK A;  2EIQ A;  4ACS A;  1HYU A;  3W8S A;  4TR0 A;  4G9H A;  4ZXG A;  4E8E A;  2L4C A;  3HJM A;  4AF2 A;  3RPN A;  2YOI A;  6GST A;  1J9B A;  1SKS B;  3GKN A;  3KGK A;  3IK9 A;  5ECQ B;  5FWG A;  2JL4 A;  2DJ2 A;  1B48 A;  1XPV A;  5H5S A;  2CVB A;  1M7T A;  2HLS A;  2DJ1 A;  4D73 A;  2KLX A;  5DBQ A;  2H75 A;  1ZZY A;  3LGC A;  3CSJ A;  1Q98 A;  2HFD A;  3Q19 A;  2MBS A;  1K0B A;  5AIS A;  4TR4 A;  1XWC A;  1EP8 A;  2PWJ A;  1J0F A;  4WBJ A;  1SKR B;  2H70 A;  1QMV A;  2AHE A;  4FYU A;  3US3 A;  3TRX A;  1TU8 A;  3RDW A;  1HQO A;  4CDO A;  1ZL9 A;  4TN8 A;  3FY7 A;  2C8U A;  1ABA A;  1SU9 A;  1XZO A;  2H6Y A;  4NXI A;  3DVW A;  3ED3 A;  1GUH A;  3UL3 A;  2WFC A;  3HYP A;  4KND A;  1F6M C;  3F4R A;  5ECR B;  4OFM A;  4XS4 A;  2H1A A;  1CQG A;  1YF0 A;  3IK7 A;  1GSF A;  4CW9 A;  2JSY A;  1GSU A;  3L0H A;  3OR5 A;  1OVN A;  1BX9 A;  2HZE A;  3GKK A;  2R3X A;  4HU9 A;  2DJJ A;  2CVD A;  3H4K A;  4KDU A;  2VD0 A;  3E3E A;  4RI7 A;  3CMI A;  3D5J A;  3ZIV A;  2L4Q A;  6GSW A;  5ECH B;  3KXO A;  4OWY A;  5DAK B;  4GST A;  1TXX A;  3WD6 A;  2DSA A;  4EDZ A;  1MD3 A;  2E7P A;  2HT9 A;  1TKD B;  2JU5 A;  1GTU A;  5IIZ A;  1GUM A;  2VL9 A;  2IMI A;  3ZRD A;  5F8B A;  2H73 A;  5CRW A;  4KE3 A;  4KDX A;  4MP4 A;  3H8Q A;  2NTO A;  1E2Y A;  4POM A;  3GX8 A;  1A24 A;  4O32 A;  1SKW B;  1G0T A;  1WIK A;  3LFL A;  1M2D A;  2AJQ B;  3RHB A;  3TUE A;  2PMT A;  3ZZX A;  4J2F A;  2RII A;  2OA7 A;  19GS A;  3Q18 A;  2VM2 A;  2X99 A;  5CRD A;  4IP1 A;  5C04 A;  3C1R A;  4IW9 A;  3DGQ A;  2GLR A;  3PGT A;  1C72 A;  4WBR D;  12GS A;  4XS6 A;  4ZBB A;  1RK4 A;  5F06 A;  2XBI A;  3HZ4 A;  4HUA A;  4MK3 A;  4LLR A;  1JFU A;  1EEJ A;  1BJX A;  3WGE A;  1FG4 A;  2FA8 A;  3P90 A;  3FKF A;  2G0F A;  2YN1 A;  1R5P A;  5ID2 A;  1M2A A;  3EIN A;  2XHF A;  4LA1 A;  2HNL A;  4KUN A;  2K6V A;  5KN2 A;  3QPM A;  2OBK A;  2WCI A;  1PRX A;  1QGV A;  4XRA A;  3F63 A;  4P3Y B;  4ZB6 A;  2H0H A;  1X5C A;  3BCK A;  2RUF A;  3GFK A;  4HQS A;  1AAZ A;  6GSU A;  3F8U A;  2X8C A;  4TRX A;  1YEP A;  3IRA A;  2LTK A;  4NV5 A;  1WPI A;  3FW2 A;  1NM3 A;  6GSS A;  5G1K A;  5KN3 A;  1Z6N A;  5GAP D;  5B7C A;  3TB2 A;  2EC4 A;  1S3C A;  2O7K A;  3W8J A;  6GSY A;  5HR0 A;  1WOU A;  5IO0 A;  4WR5 A;  3L9U A;  4NV2 A;  5ECK B;  1TRW A;  2P5R A;  3PR8 A;  4DSQ A;  1T3B A;  4PNF A;  4TKY A;  2KHP A;  1O6J A;  3IA1 A;  1EGO A;  2TRC P;  2ON7 A;  1A2J A;  1V57 A;  3WGX A;  4ZIJ A;  2HI7 A;  3F6F A;  1XOA A;  3N5O A;  3G9B A;  2WB9 A;  1U88 A;  1PMT A;  2B5X A;  3ERF A;  1WJK A;  4DSS A;  4Q5Q A;  2VL2 A;  4K1F A;  1YKA A;  4LL4 B;  2E2G A;  2ES7 A;  1K3O A;  1S3A A;  2IWT A;  3QOU A;  3FR6 A;  1TU7 A;  2PGT A;  3O6T A;  4JRR A;  5IMA A;  1Z7R A;  3H93 A;  4XTS A;  3GUS A;  7GSS A;  4HEA 2;  2YV9 A;  1JZO A;  1AQX A;  1JZD A;  2GZY A;  1K0A A;  3DYR A;  4GWR A;  1E6B A;  1JHB A;  2R37 A;  4OCE A;  2JZR A;  1OC9 B;  3WYW A;  2I1U A;  4WXT A;  1XWB A;  4HJM A;  5F07 A;  2WZ9 A;  3LSZ A;  1R26 A;  5IMV A;  1MDJ A;  1THO A;  2AYT A;  3WGD A;  3M9J A;  1I9D A;  1XWA A;  10GS A;  4WEY A;  3KCM A;  3EE2 A;  2DLX A;  1PL1 A;  4HU7 A;  4K7O A;  3H79 A;  1ERT A;  3D22 A;  1NHY A;  1G7E A;  4MLY A;  1PL2 A;  1MDK A;  1VF2 A;  1SYR A;  3F4S A;  3ZLP A;  3DWV A;  4BVY A;  2K18 A;  2QC7 A;  3ERW A;  3S9F A;  4GQC A;  4JR6 A;  3IBH A;  1YDK A;  3TOU A;  2OAD A;  4N30 A;  4BWQ A;  2L59 A;  3TCO A;  3E0U A;  5JCW A;  1TK0 B;  3DEX A;  4TOP A;  2FWG A;  2R5G A;  5DQY A;  3O3T A;  4KB3 A;  1PX6 A;  4GF0 A;  1JLW A;  1V98 A;  4O7H A;  3ZMK A;  1GWC A;  5INY A;  1ZOF A;  2PER A;  1B8X A;  4IKH A;  1IYH A;  1U3I A;  4IS0 A;  3GN3 A;  2IFQ B;  4ECJ A;  2VO4 A;  1A23 A;  4I2U A;  2H01 A;  4IQ1 A;  1XWK A;  3VFI A;  4N0Z A;  1T00 A;  5G2Z A;  4GTU A;  2IPA A;  1A0R P;  2ZCT A;  2N5B A;  2LEG A;  1X5D A;  1GLQ A;  1SL0 B;  2KP1 A;  4MZB A;  1OC3 A;  4Z7X A;  4N11 A;  3R2Q A;  1XXU A;  3BCI A;  2I3Y A;  2DJ0 A;  2ZNM A;  1Y6E A;  4LL1 B;  1QQ2 A;  3GL3 A;  5J41 A;  1F3A A;  5HR2 A;  2BJX A;  2PU9 C;  3CRU A;  1AIU A;  3ZVJ A;  5HFK A;  3UEM A;  5KN0 A;  2FA4 A;  1EGR A;  3GKM A;  2B3S A;  5JCG A;  4DEJ A;  3NIV A;  2BTO T;  3TKS A;  2R2J A;  4HI7 A;  2AB6 A;  2YJ7 A;  3UAP A;  3GV1 A;  3D21 A;  3IOS A;  1YY7 A;  5L71 A;  2IN3 A;  5ENU A;  1V58 A;  2L6C A;  2EIR A;  1URM A;  4OFN A;  5A5K A;  4MJE A;  1ZMA A;  2LV3 A;  4LMW A;  2V41 A;  1GSQ A;  2OJL A;  4EDY A;  5HR3 A;  2DIY A;  5H5Q A;  3EU3 A;  4F2I A;  1H4O A;  4ILF A;  2FGX A;  2YZU A;  2A2S A;  22GS A;  5D73 A;  5JWR B;  2HZF A;  5IM9 A;  3HY2 A;  5AGY A;  5AIX A;  3GKX A;  3GH9 A;  3VWX A;  3IV4 A;  3FZA A;  2KOK A;  3GTU B;  2GGT A;  1XW6 A;  1T1V A;  1F2E A;  2JZT A;  5H5R A;  3UIW A;  2GSS A;  2H66 A;  3I43 A;  4KX4 A;  5HFI A;  5GSS A;  3VWW A;  2F9S A;  4WF4 A;  1O8W A;  3F6D A;  4YAV A;  3LEF A;  3M1G A;  6GSX A;  3D6I A;  5E4W A;  3RHC A;  4AJ6 A;  3MWH A;  5IPG A;  4K8M A;  3VWU A;  1K0C A;  1SYX A;  1KBN A;  2I81 A;  3M0F A;  1A8L A;  1G7O A;  1T8E B;  3IAS 2;  3Q74 A;  2CZ3 A;  1TW9 A;  4GXZ A;  3LYK A;  4V2M A;  4POL A;  2GDR A;  1K0D A;  5CRG A;  4HQZ A;  4IP6 A;  1O85 A;  4PUF C;  4I2T A;  2LNS A;  3FZ9 A;  3FEU A;  5IMD A;  3DIE A;  4BPY A;  5IO2 A;  1B4Q A;  2H1G A;  4JR4 A;  5DCG A;  1QFN A;  2OBI A;  5D9W A;  5FT3 A;  4YH2 A;  3KIJ A;  6GSV A;  1Z3E A;  4YQU A;  4PNG A;  1V40 A;  1SK1 A;  3LQ7 A;  3QAG A;  3DD3 A;  2DJK A;  3IR4 A;  3FR3 A;  4V1A p;  1VF3 A;  3GH6 A;  1TK5 B;  1VF1 A;  3ZL5 A;  1EOH A;  2PN8 A;  2GT6 A;  4ZIL A;  3C1S A;  1T7P B;  5J9C A;  2RM5 A;  4TVE A;  2OE0 A;  4KAE A;  4MZW A;  5CNW A;  2YJH A;  2NBS A;  3FRC A;  1GLP A;  3EU4 A;  1EV9 A;  5D9V A;  2V6K A;  2YCD A;  3GA4 A;  3U5R E;  4IJ3 A;  3QR6 A;  3KMO A;  3RBT A;  1EZK A;  1XFL A;  2TIR A;  4TR1 B;  2GZP A;  4L0W A;  3ME8 A;  5F0G A;  5D93 A;  1HNC A;  4K0G A;  3KP9 A;  3MDK A;  3MSZ A;  4KCE A;  4DSR A;  4GSN A;  2A2R A;  2H76 A;  2H19 A;  3GMF A;  3G7I A;  2GST A;  1M2B A;  1Q4J A;  1U6T A;  1GTI A;  2IMF A;  2GTU A;  1GSE A;  1XWG A;  3F0I A;  2VLT A;  2G2Q A;  4NHZ A;  4EO3 A;  4X43 A;  3RAZ A;  3EYT A;  1BQ7 A;  1X9M B;  1X9S B;  1EP7 A;  2VLV A;  2K8S A;  3UOM A;  2LUS A;  3BBY A;  4PX1 A;  3KMN A;  3APQ A;  1TI1 A;  4MH2 A;  3HVS A;  4KGI A;  3GTU A;  2YP6 A;  2VOC A;  5B8A A;  3L9V A;  5ECP B;  3M3M A;  2B5E A;  1XW5 A;  2LJA A;  4G19 A;  2K8V A;  1HD2 A;  5ELA A;  3WT2 A;  4PGT A;  3ZYW A;  2P31 A;  3K8N A;  2KP2 A;  1MD4 A;  1PX7 A;  4XHM A;  4EL1 A;  3DVX A;  1SJ6 A;  2QSI A;  2FCH A;  2QGV A;  4GRF A;  3QFB C;  4ULX A;  2C1Y A;  3SBC A;  4NPB A;  3TJF A;  1MEK A;  3GNJ A;  1G6Y A;  1WP0 A;  1ST9 A;  4EF0 A;  3QDN A;  4F82 A;  3I69 A;  2PPT A;  3EC3 A;  2V32 A;  1M9A A;  2C3N A;  4PXO A;  2YWN A;  1B9X C;  2YAN A;  2IIY A;  4F0B A;  1PGT A;  1J08 A;  4G2E A;  3QMX A;  3UJ1 A;  1MTC A;  1M99 A;  4MF5 A;  2LS5 A;  3JCM L;  3HDC A;  4WR4 A;  4OMV A;  3HVX A;  3GSS A;  2GSR A;  2IMK A;  3F3R A;  2P5Q A;  4Q5F A;  2C0D A;  3PH9 A;  4HOJ A;  3D0Z A;  4JBB A;  2JSZ A;  3VUR A;  1N2A A;  4TXO B;  3EWL A;  3BOA A;  4F0C A;  2J23 A;  1FAA A;  5ECO B;  3FHK A;  2N5F A;  1GL8 A;  4AJ8 A;  3CYN A;  4TXV A;  1EWX A;  4BL7 A;  4JED A;  1EEM A;  2LST A;  2HRF A;  5J3R A;  5DAK A;  2CQ9 A;  4KH7 A;  2JAC A;  3LG6 A;  1Z9H A;  3QD9 A;  2MYG A;  1K0O A;  1ZYE A;  4KDY A;  1ACV A;  4MA9 A;  1GP1 A;  1OAZ A;  1RW1 A;  4ZB8 A;  5DJL A;  4ISD A;  1OKT A;  2VCT A;  3QAV A;  5LCZ A;  2VL3 A;  2WRT A;  1XVW A;  2R4V A;  4MF7 A;  2GQL A;  2B1L A;  4MPG A;  3P8W A;  2LRC A;  2H72 A;  4MDC A;  5D96 A;  1GTB A;  5JWQ B;  1TTZ A;  1U87 A;  4PQI A;  2H0I A;  1X0R A;  4XS1 A;  2RM6 A;  1O81 A;  3ZIT A;  2P0G A;  1M9B A;  4L5L A;  3E9J B;  2D2Z A;  1R5A A;  4IBP A;  4BVX A;  2XPE A;  2PVQ A;  2HSY A;  3DML A;  1F9M A;  1KTE A;  3TGZ A;  2YZH A;  3TKQ A;  4V2N A;  5ABR A;  2DMM A;  3G7Y A;  1TP9 A;  4MMM A;  3EMP A;  1X9W B;  1KNG A;  1UN2 A;  1I5G A;  1EOG A;  5FHI A;  3DKS A;  2VCW A;  1ON4 A;  3HXS A;  5DVB A;  2GZZ A;  4NHW A;  1O7U A;  1VGL A;  2VCQ A;  3GL5 A;  5IOW A;  4K9Z A;  3ERG A;  1Z5Y E;  2MMN A;  2FWF A;  2V6O A;  3TJB A;  4KCA A;  3P7X A;  4K7I A;  2PBJ A;  5E59 A;  4ECI A;  4RQX A;  2B6M A;  4XS4 B;  2HXK A;  2OE3 A;  1V2A A;  4IGJ A;  3GIX A;  1A8Y A;  2PUK C;  4MJA A;  1O73 A;  5J4U A;  4XCS A;  3CXG A;  2NVL A;  1XIY A;  3BD2 A;  2GSQ A;  1GH2 A;  5CAX A;  5LNK e;  2H1B A;  3TKP A;  4FYB A;  4OFT A;  1IYI A;  1YZX A;  2DC5 A;  2HZE B;  3F9U A;  3IC4 A;  4I5Q A;  4OCF A;  3RPP A;  2NPB A;  1ERU A;  1QK8 A;  2CT6 A;  1OYJ A;  1A2M A;  1YEX A;  4CHS A;  4IQA A;  4L0U A;  1AUC A;  3LWA A;  3U6V A;  4XIH A;  4NAX A;  3IDV A;  3G7J A;  4ZB9 A;  4HS1 A;  1K0M A;  1AW9 A;  1K0N A;  3CBU A;  4POB A;  4WET A;  3IE3 A;  3F3Q A;  2YWI A;  4ZL7 A;  2IJY A;  1FB6 A;  1SD9 A;  2L5L A;  2VIM A;  3HZ8 A;  1SD8 A;  1WRY A;  4ML1 A;  1NHO A;  2O8V B;  3GX0 A;  4WF5 A;  1GNE A;  2GS3 A;  2GQM A;  1PQN A;  2B1K A;  4BA7 A;  5CRE A;  1RQM A;  3VLN A;  1OC9 A;  4EKZ A;  2LJK A;  2X8G A;  4HJ2 A;  5DCH A;  2ALB A;  2MMZ A;  1USB A;  1XOB A;  3UVH A;  2FHE A;  4G10 A;  2FUG 2;  13GS A;  3KM6 A;  2XC2 A;  3GHA A;  2CX3 A;  3ME7 A;  2F51 A;  3TKS C;  1FVJ A;  1W4V A;  4HZ4 A;  2OAC A;  3L78 A;  1XCC A;  4IJI A;  8GSS A;  3ZRE A;  5B6N A;  5IPH A;  1UVZ A;  3UMA A;  1TRS A;  4TR3 A;  3C71 A;  4PUR A;  4ZL8 A;  1N8J A;  5ID2 B;  1V9W A;  5G5E A;  4Q5N A;  3C7M A;  3H1N A;  3A2X A;  2AUV A;  2HYX A;  1ILO A;  5CYY A;  3GYK A;  2F3M A;  2RUE A;  3FYG A;  4K2D A;  3KEB A;  4MAB A;  2CVK A;  4J56 E;  3I9V 2;  2L5O A;  3QFA C;  1FVK A;  4JE1 A;  4ZBD A;  4JZQ A;  1PKZ A;  4YQM A;  2HRN A;  1S3D A;  3MAK A;  1FHE A;  2YWO A;  4K6X A;  3UVT A;  2FWH A;  4N0V A;  1NW2 A;  3KP8 A;  2RLI A;  2IFQ A;  2ON5 A;  3I6A A;  4BWS A;  2LQQ A;  1F37 A;  5G31 A;  3SWL A;  4MZC A;  1HNB A;  2M46 A;  4F9Z A;  1ZGN A;  2LQO A;  1R7H A;  4HDE A;  4IVF A;  1MDI A;  1PA3 A;  5IQY A;  1AQV A;  4X0X A;  1OE7 A;  5ECL B;  5HFG A;  1SL1 B;  3ZFB A;  1SK0 A;  3HJP A;  1BYE A; 
#chains in the Genus database with same CATH topology
 5A4W A;  5EL8 A;  4DSS B;  4H86 A;  1ERW A;  2WGR A;  5COH A;  3VI5 A;  1TRV A;  1ZYQ B;  3NZN A;  2M80 A;  2CA8 A;  9GSS A;  2TRX A;  3QCP A;  5B6M A;  2DBC A;  4RI6 A;  16GS A;  4MH3 A;  3NOF A;  4MJB A;  1PFO A;  1LU4 A;  5DDL A;  2WUL A;  4N10 A;  3PIN A;  2MBT A;  5HQP A;  3FK8 A;  4XRD A;  5G1L A;  1XBS A;  4EC0 A;  2KUC A;  5ECS A;  3A2V A;  2MMO A;  3VI7 A;  2I9H A;  4JU5 A;  2JZS A;  4CY8 A;  5J5N A;  4O92 A;  2V2G A;  3P2A A;  2L57 A;  4OO4 A;  1LJR A;  2DKH A;  18GS A;  3TJG A;  2FD3 A;  5A4V A;  4TW5 A;  4G0L A;  1FB0 A;  3M9K A;  1JZR A;  3VWV A;  2X64 A;  5B8B A;  2LNT A;  2LKU A;  5EPF A;  5GZZ B;  1TI3 A;  2OKA A;  1ZCP A;  1A0F A;  2CX4 A;  3ZVJ D;  1SEN A;  3C73 A;  5J9B A;  3TKR A;  1DSB A;  3FZ5 A;  1GNW A;  3L4N A;  4MJC A;  2H8L A;  1VRS D;  4PQH A;  4OO5 A;  1Y25 A;  2YV7 A;  1NSW A;  5DAL B;  2O87 A;  4ID0 A;  4AGS A;  2CAI A;  4BVY B;  3TKS E;  3PPU A;  4RQR A;  2FNO A;  4I8B A;  3HKR A;  3MNG A;  4KF9 A;  4O5R A;  5EY6 A;  4V2L A;  1OKD A;  3ISO A;  1AC1 A;  3N9J A;  1TDI A;  1CQH A;  3IC8 A;  3EVI A;  2WDU A;  2ZUP A;  2WJU A;  4FO5 A;  2QKE A;  5D8I A;  1XVQ A;  1DE2 A;  1PSQ A;  3HD5 A;  2YNX A;  1Z6M A;  2I4A A;  4IEL A;  5G5F A;  2DIZ A;  1GSY A;  3APO A;  4J57 E;  3TRQ A;  4IHU A;  5D9T A;  2EIO A;  3EUR A;  5IMC A;  2DJ3 A;  3KTB A;  4LMV A;  2Z9S A;  5IMZ A;  4L5O A;  2J9H A;  1YKC A;  1WWJ A;  4EE0 A;  2MZC A;  4I97 A;  4YQV A;  3IAM 2;  1U3A A;  2VCZ A;  3O76 A;  2YWM A;  3C8E A;  4FYC A;  3W6G A;  2N5A A;  1X5E A;  4FIW A;  3CSH A;  1PD2 1;  3GST A;  3A2W A;  5DQS A;  3GRX A;  3LXT A;  3L9S A;  14GS A;  3ZTL A;  3LXZ A;  1QUW A;  4MPF A;  1G6W A;  1XG8 A;  2HSH A;  3R3E A;  3TRP A;  2IL3 A;  4GQF A;  2DML A;  4Q5R A;  1TOF A;  3LW9 A;  1FOV A;  2YPM A;  3DRN A;  2LRT A;  2VAF A;  2GT5 A;  4GCI A;  1WE0 A;  1SJZ A;  4E8H A;  1JLV A;  4EVM A;  4V1A g;  4O5Q A;  2H1D A;  3M8N A;  5C00 A;  1BED A;  3FZ4 A;  2E2M A;  1QXH A;  2OE1 A;  1LBK A;  2FY6 A;  2GQK A;  2H6X A;  2H30 A;  2F8F A;  2VM1 A;  4HSC X;  1KEB A;  4TR1 A;  4QL9 A;  2HRA A;  3HCZ A;  4OD7 A;  2C0F A;  3VPT A;  5IOX A;  1PKW A;  3LYP A;  1SL2 B;  5GST A;  5AIV A;  1GRX A;  1SK2 A;  2B7J A;  2GVP A;  5ELG A;  3J7Y b;  3KH7 A;  1TRU A;  2K9F A;  2VL2 C;  5F05 A;  1TJD A;  3TJJ A;  4DVC A;  1HNA A;  1R4W A;  1BG5 A;  2VCV A;  1AQW A;  4L8E A;  5ECI B;  5HR1 A;  5KEJ A;  2UZ8 A;  3V1W A;  2B5Y A;  11GS A;  4PTS A;  4AJ7 A;  5D9X A;  2JAD A;  1PN9 A;  3A3T A;  3CTG A;  4F03 A;  1XW9 A;  2AV4 A;  2O85 A;  20GS A;  3IPZ A;  3D4M A;  5DAL A;  2CAQ A;  5KN1 A;  1M0U A;  2LRN A;  1T4Y A;  2H6Z A;  2VLU A;  4K7N A;  3J7Y k;  3HVV A;  4MF6 A;  1FOH A;  4D73 B;  3UAR A;  1ERV A;  2HE3 A;  2BMX A;  5ECN B;  1SJI A;  2A4V A;  3A5W A;  1UA5 A;  4YAP A;  2F8A A;  4NWY A;  5JWO B;  3UBL A;  2LJR A;  1K3L A;  3HA9 A;  3ZML A;  3IHQ A;  5ECM B;  5GAN D;  4ZBA A;  5G30 A;  1DE1 A;  2O89 A;  2B7K A;  1B9Y C;  3CTF A;  2IMD A;  1TK8 B;  5CRH A;  1OC8 A;  2M72 A;  2WS2 A;  2NDO A;  3MYD A;  4RUV A;  2CZ2 A;  4ZL9 A;  1Z7P A;  3HJO A;  2R6K A;  3KH9 A;  3QAW A;  3LJR A;  1FW1 A;  5LD0 A;  5IMF A;  3TDG A;  3UBK A;  2FLS A;  2PVO C;  4K0N A;  5EVO A;  5DJM A;  4KSO A;  2XPD A;  3GUR A;  4QL7 A;  1GTA A;  4X1U A;  4QQ7 A;  2IME A;  3APS A;  3KJY A;  3EMX A;  3IXR A;  1T4Z A;  2C80 A;  1WMJ A;  2R0C A;  1BAY A;  2C3T A;  1O8X A;  2C4J A;  2REM A;  4ML6 A;  1YQ1 A;  2CV4 A;  1JZW A;  4EXJ A;  2C3Q A;  3BJ5 A;  2H0G A;  1GSS A;  2C0G A;  4KSM A;  3ZFL A;  3TOT A;  3DXB A;  1GUK A;  1GUL A;  5JCU A;  2AAW A;  1M3I A;  3CRT A;  4TXO A;  5AN1 A;  2H71 A;  2X8H A;  5CP1 A;  1YJ6 A;  4EUY A;  2V1M A;  2C0E A;  3VPQ A;  3AY8 A;  4HZ2 A;  3KD0 A;  1H75 A;  4NMU A;  3CSI A;  1FO5 A;  1THX A;  1B4P A;  2VCX A;  2FWE A;  1ML6 A;  3Q6O A;  1DUG A;  3VK9 A;  3HHV A;  2VUP A;  4POK A;  4PUA A;  5CO3 A;  1A2L A;  1AXD A;  4I6X A;  2E0Q A;  3A5I A;  3KZQ A;  4KW6 A;  4ECC A;  3ZIJ A;  2VD1 A;  4IN0 A;  2L6D A;  2QA2 A;  1PN0 A;  1W89 A;  17GS A;  3FR9 A;  2XBQ A;  4GLT A;  1OE8 A;  4ECB A;  2MMA A;  1GSD A;  2H74 A;  3WT1 A;  3F4T A;  3LOR A;  3KTL A;  4GSS A;  4KA0 A;  4PQ1 A;  4FH8 A;  1VF4 A;  1F3B A;  1UC7 A;  4MCU A;  4Z2T A;  4WKW A;  5A4U A;  1DBY A;  1K3Y A;  1EV4 A;  1YF1 A;  3D4T A;  3TJK A;  2EIQ A;  4ACS A;  1HYU A;  3W8S A;  4TR0 A;  4G9H A;  4ZXG A;  4E8E A;  2L4C A;  3HJM A;  4AF2 A;  3RPN A;  2YOI A;  6GST A;  1J9B A;  1SKS B;  3GKN A;  3KGK A;  1ZYN A;  3IK9 A;  5ECQ B;  5FWG A;  2JL4 A;  2DJ2 A;  1B48 A;  1XPV A;  5H5S A;  2CVB A;  1M7T A;  2HLS A;  2DJ1 A;  4D73 A;  2KLX A;  5DBQ A;  2H75 A;  1ZZY A;  3LGC A;  3CSJ A;  1Q98 A;  2HFD A;  3Q19 A;  2MBS A;  1K0B A;  5AIS A;  4TR4 A;  1XWC A;  1EP8 A;  2PWJ A;  1J0F A;  4WBJ A;  1SKR B;  2H70 A;  1QMV A;  2AHE A;  4FYU A;  3US3 A;  3TRX A;  1TU8 A;  3RDW A;  1HQO A;  4CDO A;  1ZL9 A;  4TN8 A;  3FY7 A;  2C8U A;  1ABA A;  1SU9 A;  1XZO A;  2H6Y A;  4NXI A;  3DVW A;  3ED3 A;  1GUH A;  3UL3 A;  4MNN A;  2WFC A;  3HYP A;  4KND A;  1F6M C;  3F4R A;  5ECR B;  4OFM A;  4XS4 A;  2H1A A;  1CQG A;  1YF0 A;  3IK7 A;  1GSF A;  4CW9 A;  2JSY A;  1GSU A;  3L0H A;  3OR5 A;  1OVN A;  1BX9 A;  2HZE A;  3GKK A;  2R3X A;  4HU9 A;  2DJJ A;  4BL7 B;  2CVD A;  3H4K A;  4KDU A;  2VD0 A;  3E3E A;  4RI7 A;  3CMI A;  3D5J A;  3ZIV A;  2L4Q A;  6GSW A;  5ECH B;  3KXO A;  4OWY A;  5DAK B;  4GST A;  1TXX A;  3WD6 A;  2DSA A;  4EDZ A;  1MD3 A;  2E7P A;  2HT9 A;  1TKD B;  2JU5 A;  1GTU A;  5IIZ A;  1GUM A;  2VL9 A;  2IMI A;  3ZRD A;  5F8B A;  2H73 A;  5CRW A;  4KE3 A;  4KDX A;  4MP4 A;  3H8Q A;  2NTO A;  1E2Y A;  4POM A;  3GX8 A;  1A24 A;  4O32 A;  1SKW B;  1G0T A;  1WIK A;  3LFL A;  1M2D A;  2AJQ B;  3RHB A;  3TUE A;  2PMT A;  3ZZX A;  4J2F A;  2RII A;  2OA7 A;  19GS A;  3Q18 A;  2VM2 A;  2X99 A;  5CRD A;  4IP1 A;  5C04 A;  3C1R A;  4IW9 A;  3DGQ A;  2GLR A;  3PGT A;  1C72 A;  4WBR D;  12GS A;  4XS6 A;  4ZBB A;  1RK4 A;  5F06 A;  2XBI A;  3HZ4 A;  4HUA A;  4MK3 A;  4LLR A;  1JFU A;  1EEJ A;  1BJX A;  4BVX B;  3WGE A;  1FG4 A;  2FA8 A;  3P90 A;  3FKF A;  2G0F A;  4O5U A;  2YN1 A;  1R5P A;  5ID2 A;  1M2A A;  3EIN A;  2XHF A;  5BMU A;  4LA1 A;  2HNL A;  4KUN A;  2K6V A;  5KN2 A;  3QPM A;  2OBK A;  2WCI A;  1PRX A;  1QGV A;  4XRA A;  3F63 A;  4P3Y B;  4ZB6 A;  2H0H A;  1X5C A;  3BCK A;  2RUF A;  3GFK A;  4HQS A;  1AAZ A;  6GSU A;  3F8U A;  2X8C A;  4TRX A;  1YEP A;  3IRA A;  2LTK A;  4NV5 A;  1WPI A;  4Z2U A;  3FW2 A;  1NM3 A;  3HVN A;  6GSS A;  5G1K A;  5KN3 A;  1Z6N A;  5GAP D;  5B7C A;  3TB2 A;  2EC4 A;  1S3C A;  2O7K A;  3W8J A;  6GSY A;  5HR0 A;  1WOU A;  5IO0 A;  4WR5 A;  3L9U A;  4NV2 A;  5ECK B;  1TRW A;  2P5R A;  3PR8 A;  4DSQ A;  1T3B A;  4PNF A;  4TKY A;  2KHP A;  1O6J A;  3IA1 A;  1EGO A;  2TRC P;  2ON7 A;  1A2J A;  1V57 A;  3WGX A;  4ZIJ A;  2HI7 A;  3F6F A;  1XOA A;  3N5O A;  3G9B A;  2WB9 A;  1U88 A;  1PMT A;  2B5X A;  3ERF A;  1WJK A;  4DSS A;  4Q5Q A;  2VL2 A;  4K1F A;  1YKA A;  4LL4 B;  2E2G A;  2ES7 A;  1K3O A;  1S3A A;  2IWT A;  3QOU A;  3FR6 A;  1TU7 A;  2PGT A;  3O6T A;  4JRR A;  5IMA A;  1Z7R A;  3H93 A;  4XTS A;  4A5P A;  3GUS A;  7GSS A;  4HEA 2;  2YV9 A;  1JZO A;  1AQX A;  1JZD A;  2GZY A;  1K0A A;  3DYR A;  4GWR A;  1E6B A;  1JHB A;  2R37 A;  4OCE A;  2JZR A;  1OC9 B;  3WYW A;  2I1U A;  4WXT A;  2A2P A;  1XWB A;  4HJM A;  5F07 A;  2WZ9 A;  3LSZ A;  1R26 A;  5IMV A;  1MDJ A;  1THO A;  2AYT A;  3WGD A;  3M9J A;  3FMW A;  1I9D A;  1XWA A;  10GS A;  4WEY A;  3KCM A;  3EE2 A;  2DLX A;  3CQF A;  1PL1 A;  4HU7 A;  4K7O A;  3H79 A;  1ERT A;  3D22 A;  1NHY A;  1G7E A;  4MLY A;  1PL2 A;  1MDK A;  1VF2 A;  1SYR A;  3F4S A;  3ZLP A;  3DWV A;  4BVY A;  2K18 A;  2QC7 A;  3ERW A;  3S9F A;  4GQC A;  4JR6 A;  3IBH A;  1YDK A;  3TOU A;  2OAD A;  4N30 A;  4BWQ A;  2L59 A;  3TCO A;  3E0U A;  5JCW A;  1TK0 B;  3DEX A;  4TOP A;  2FWG A;  2R5G A;  5DQY A;  3O3T A;  4KB3 A;  1PX6 A;  4GF0 A;  1JLW A;  1V98 A;  4O7H A;  3ZMK A;  1GWC A;  5INY A;  1ZOF A;  2PER A;  1B8X A;  4IKH A;  1IYH A;  1U3I A;  4IS0 A;  3GN3 A;  2IFQ B;  4ECJ A;  2VO4 A;  1A23 A;  4I2U A;  2H01 A;  4IQ1 A;  1XWK A;  3VFI A;  4N0Z A;  1T00 A;  5G2Z A;  4GTU A;  4K5R A;  2IPA A;  1A0R P;  2ZCT A;  2N5B A;  2LEG A;  1X5D A;  1GLQ A;  1SL0 B;  2KP1 A;  4MZB A;  1OC3 A;  4Z7X A;  4G0I A;  4N11 A;  3R2Q A;  1XXU A;  3BCI A;  2I3Y A;  2DJ0 A;  2ZNM A;  1Y6E A;  4LL1 B;  1QQ2 A;  3GL3 A;  5J41 A;  1F3A A;  5HR2 A;  2BJX A;  2PU9 C;  3CRU A;  1AIU A;  3ZVJ A;  5HFK A;  3UEM A;  5KN0 A;  2FA4 A;  1EGR A;  3GKM A;  2B3S A;  5JCG A;  4DEJ A;  3NIV A;  2BTO T;  3TKS A;  2R2J A;  4HI7 A;  2AB6 A;  2YJ7 A;  3UAP A;  3GV1 A;  3D21 A;  3IOS A;  1YY7 A;  5L71 A;  2IN3 A;  5ENU A;  1V58 A;  2L6C A;  2EIR A;  1URM A;  4OFN A;  5A5K A;  4MJE A;  1ZMA A;  2LV3 A;  4LMW A;  2V41 A;  1GSQ A;  2OJL A;  4EDY A;  5HR3 A;  2DIY A;  5H5Q A;  3EU3 A;  4F2I A;  1H4O A;  4ILF A;  2FGX A;  2YZU A;  2A2S A;  22GS A;  5D73 A;  5JWR B;  2HZF A;  5IM9 A;  3HY2 A;  5AGY A;  5AIX A;  3GKX A;  3GH9 A;  3VWX A;  3IV4 A;  3FZA A;  2KOK A;  3GTU B;  2GGT A;  1XW6 A;  1T1V A;  1F2E A;  2JZT A;  5H5R A;  3UIW A;  2GSS A;  2H66 A;  3I43 A;  4KX4 A;  5HFI A;  5GSS A;  3VWW A;  2F9S A;  4WF4 A;  1O8W A;  3F6D A;  4YAV A;  3LEF A;  3M1G A;  6GSX A;  3D6I A;  5E4W A;  3RHC A;  4AJ6 A;  3MWH A;  5IPG A;  4K8M A;  3VWU A;  1K0C A;  1SYX A;  1KBN A;  5KOW A;  2I81 A;  3M0F A;  1A8L A;  1G7O A;  4K5S A;  1T8E B;  3IAS 2;  3Q74 A;  2CZ3 A;  1TW9 A;  4GXZ A;  3LYK A;  4V2M A;  4POL A;  2GDR A;  1K0D A;  4BIK A;  2X49 A;  5CRG A;  4HQZ A;  4IP6 A;  1O85 A;  4PUF C;  4I2T A;  2LNS A;  3FZ9 A;  3FEU A;  5IMD A;  3DIE A;  4BPY A;  5IO2 A;  1B4Q A;  2H1G A;  4JR4 A;  5DCG A;  1QFN A;  2OBI A;  5D9W A;  5FT3 A;  4YH2 A;  3KIJ A;  6GSV A;  1Z3E A;  4YQU A;  4PNG A;  1V40 A;  1SK1 A;  3LQ7 A;  3QAG A;  3DD3 A;  2DJK A;  3IR4 A;  3FR3 A;  4V1A p;  1VF3 A;  3GH6 A;  1TK5 B;  1VF1 A;  3ZL5 A;  1EOH A;  2PN8 A;  4YKF A;  2GT6 A;  4ZIL A;  3C1S A;  1T7P B;  5J9C A;  2RM5 A;  4TVE A;  2OE0 A;  4KAE A;  4MZW A;  5CNW A;  2YJH A;  2NBS A;  3FRC A;  1GLP A;  3EU4 A;  1EV9 A;  5D9V A;  2V6K A;  2YCD A;  3GA4 A;  3U5R E;  4IJ3 A;  3QR6 A;  3KMO A;  3RBT A;  1EZK A;  1XFL A;  2TIR A;  2QA1 A;  4TR1 B;  2GZP A;  4L0W A;  3ME8 A;  5F0G A;  5D93 A;  1HNC A;  4K0G A;  3KP9 A;  3MDK A;  3MSZ A;  4FQU A;  4KCE A;  4DSR A;  4GSN A;  2A2R A;  2H76 A;  2H19 A;  3GMF A;  3G7I A;  2GST A;  1M2B A;  1Q4J A;  1U6T A;  3EPT A;  1GTI A;  2IMF A;  2GTU A;  1GSE A;  1XWG A;  3F0I A;  2VLT A;  2G2Q A;  4NHZ A;  4EO3 A;  4X43 A;  5KOX A;  3RAZ A;  3EYT A;  1BQ7 A;  1X9M B;  1X9S B;  1EP7 A;  2VLV A;  2K8S A;  3UOM A;  2LUS A;  3BBY A;  4PX1 A;  3KMN A;  3APQ A;  1TI1 A;  4MH2 A;  3HVS A;  4KGI A;  3GTU A;  2YP6 A;  2VOC A;  5B8A A;  3L9V A;  5ECP B;  3M3M A;  2B5E A;  1XW5 A;  2LJA A;  4G19 A;  2K8V A;  1HD2 A;  5ELA A;  3WT2 A;  4PGT A;  3ZYW A;  2P31 A;  3K8N A;  2KP2 A;  1MD4 A;  1PX7 A;  4YKG A;  4XHM A;  4EL1 A;  3DVX A;  1SJ6 A;  2QSI A;  2FCH A;  2QGV A;  4GRF A;  3QFB C;  2X4A A;  4ULX A;  2C1Y A;  3SBC A;  4NPB A;  3TJF A;  1MEK A;  3GNJ A;  1G6Y A;  1WP0 A;  1ST9 A;  4EF0 A;  3QDN A;  4F82 A;  3I69 A;  2PPT A;  3EC3 A;  2V32 A;  1M9A A;  2C3N A;  4PXO A;  2YWN A;  1B9X C;  2YAN A;  2IIY A;  4F0B A;  1PGT A;  1J08 A;  4G2E A;  3QMX A;  3UJ1 A;  1MTC A;  1M99 A;  4MF5 A;  2LS5 A;  3JCM L;  3HDC A;  4WR4 A;  4OMV A;  3HVX A;  3GSS A;  2GSR A;  1S3R A;  2IMK A;  3F3R A;  2P5Q A;  4Q5F A;  2C0D A;  3PH9 A;  4HOJ A;  3D0Z A;  4JBB A;  2JSZ A;  3VUR A;  1N2A A;  4TXO B;  3EWL A;  3BOA A;  4F0C A;  2J23 A;  1FAA A;  5ECO B;  3FHK A;  2N5F A;  1GL8 A;  4AJ8 A;  3CYN A;  4TXV A;  1EWX A;  4BL7 A;  4JED A;  1EEM A;  2LST A;  2HRF A;  5J3R A;  5DAK A;  2CQ9 A;  4KH7 A;  2JAC A;  4EIQ A;  3LG6 A;  1Z9H A;  3QD9 A;  2MYG A;  1K0O A;  1ZYE A;  4KDY A;  1ACV A;  4MA9 A;  1GP1 A;  1OAZ A;  1RW1 A;  3IHG A;  4ZB8 A;  5DJL A;  4G0K A;  4ISD A;  1OKT A;  2VCT A;  3QAV A;  5LCZ A;  2VL3 A;  2WRT A;  1XVW A;  2R4V A;  4MF7 A;  2GQL A;  2B1L A;  4K2X A;  4MPG A;  3P8W A;  2LRC A;  2H72 A;  4MDC A;  5D96 A;  1GTB A;  5JWQ B;  1TTZ A;  1U87 A;  4PQI A;  2H0I A;  1X0R A;  4XS1 A;  2RM6 A;  1M3J A;  1O81 A;  3ZIT A;  2P0G A;  1M9B A;  4L5L A;  3E9J B;  2D2Z A;  1R5A A;  4IBP A;  4BVX A;  2XPE A;  2PVQ A;  2HSY A;  3DML A;  1F9M A;  1KTE A;  3TGZ A;  2YZH A;  3TKQ A;  4V2N A;  5ABR A;  2DMM A;  3G7Y A;  4ICY A;  2HSM A;  1TP9 A;  4MMM A;  3EMP A;  1X9W B;  1KNG A;  1UN2 A;  1I5G A;  1EOG A;  5FHI A;  3DKS A;  2VCW A;  1ON4 A;  3HXS A;  5DVB A;  2GZZ A;  4NHW A;  1O7U A;  1VGL A;  2VCQ A;  3GL5 A;  5IOW A;  4K9Z A;  3ERG A;  1Z5Y E;  2MMN A;  2FWF A;  2V6O A;  3TJB A;  4KCA A;  3P7X A;  4K7I A;  2PBJ A;  5E59 A;  4ECI A;  4RQX A;  2B6M A;  4XS4 B;  2HXK A;  2OE3 A;  1V2A A;  4IGJ A;  3GIX A;  1A8Y A;  2PUK C;  4MJA A;  1O73 A;  5J4U A;  4XCS A;  3CXG A;  2NVL A;  1XIY A;  3BD2 A;  2GSQ A;  1GH2 A;  5CAX A;  5LNK e;  2H1B A;  3TKP A;  4FYB A;  4OFT A;  1IYI A;  1YZX A;  2DC5 A;  4OCF A;  2HZE B;  3F9U A;  3IC4 A;  4I5Q A;  3RPP A;  2NPB A;  4EIP A;  1ERU A;  1QK8 A;  2CT6 A;  1OYJ A;  1A2M A;  1YEX A;  4CHS A;  4CY6 A;  4IQA A;  4L0U A;  4X4J A;  1AUC A;  3LWA A;  3U6V A;  4XIH A;  4NAX A;  3IDV A;  3G7J A;  4ZB9 A;  4HS1 A;  1K0M A;  1AW9 A;  1K0N A;  3CBU A;  4POB A;  4WET A;  3IE3 A;  3F3Q A;  2YWI A;  4ZL7 A;  2IJY A;  1FB6 A;  1SD9 A;  2L5L A;  2VIM A;  3HZ8 A;  1SD8 A;  1WRY A;  2A4H A;  4ML1 A;  1NHO A;  2O8V B;  3GX0 A;  4WF5 A;  1GNE A;  2GS3 A;  2GQM A;  1PQN A;  2B1K A;  4BA7 A;  4Z2R A;  5CRE A;  1RQM A;  3VLN A;  1OC9 A;  4EKZ A;  2LJK A;  2X8G A;  4HJ2 A;  5DCH A;  2ALB A;  2MMZ A;  1USB A;  1XOB A;  3UVH A;  2FHE A;  4G10 A;  2FUG 2;  13GS A;  3KM6 A;  2XC2 A;  3GHA A;  2CX3 A;  2HRK A;  3ME7 A;  2F51 A;  3TKS C;  1FVJ A;  1W4V A;  4HZ4 A;  2OAC A;  3L78 A;  1XCC A;  4IJI A;  8GSS A;  3ZRE A;  5B6N A;  5IPH A;  1UVZ A;  3UMA A;  1TRS A;  4TR3 A;  3C71 A;  4PUR A;  4ZL8 A;  1N8J A;  5ID2 B;  1V9W A;  5G5E A;  4Q5N A;  3C7M A;  3H1N A;  3A2X A;  2AUV A;  2HYX A;  1ILO A;  5CYY A;  3GYK A;  2F3M A;  2RUE A;  3FYG A;  4K2D A;  3KEB A;  4MAB A;  2CVK A;  4J56 E;  3I9V 2;  2L5O A;  3QFA C;  1FVK A;  4JE1 A;  3MIX A;  4ZBD A;  4JZQ A;  2R0P A;  1PKZ A;  4YQM A;  2HRN A;  1S3D A;  3MAK A;  2DKI A;  1FHE A;  2YWO A;  4K6X A;  3UVT A;  2FWH A;  4N0V A;  1NW2 A;  3KP8 A;  2RLI A;  2IFQ A;  5BRT A;  2ON5 A;  3I6A A;  4BWS A;  2LQQ A;  1F37 A;  5G31 A;  3SWL A;  4MZC A;  1HNB A;  2M46 A;  4F9Z A;  1ZGN A;  2LQO A;  1R7H A;  4HDE A;  2R0G A;  1MDI A;  4IVF A;  1PA3 A;  5IQY A;  1AQV A;  4X0X A;  1ZYP A;  1OE7 A;  4USS A;  5ECL B;  5HFG A;  1SL1 B;  3ZFB A;  1SK0 A;  3HJP A;  1BYE A; 
#chains in the Genus database with same CATH homology
 5A4W A;  5EL8 A;  4DSS B;  4H86 A;  1ERW A;  2WGR A;  5COH A;  3VI5 A;  1TRV A;  1ZYQ B;  3NZN A;  2M80 A;  2CA8 A;  9GSS A;  2TRX A;  3QCP A;  5B6M A;  2DBC A;  4RI6 A;  16GS A;  4MH3 A;  3NOF A;  4MJB A;  1LU4 A;  5DDL A;  2WUL A;  4N10 A;  3PIN A;  2MBT A;  5HQP A;  3FK8 A;  4XRD A;  5G1L A;  1XBS A;  4EC0 A;  2KUC A;  5ECS A;  3A2V A;  2MMO A;  3VI7 A;  2I9H A;  4JU5 A;  2JZS A;  4CY8 A;  5J5N A;  4O92 A;  2V2G A;  3P2A A;  2L57 A;  4OO4 A;  1LJR A;  2DKH A;  18GS A;  3TJG A;  2FD3 A;  5A4V A;  4TW5 A;  4G0L A;  1FB0 A;  3M9K A;  1JZR A;  3VWV A;  2X64 A;  5B8B A;  2LNT A;  2LKU A;  5EPF A;  5GZZ B;  1TI3 A;  2OKA A;  1ZCP A;  1A0F A;  2CX4 A;  3ZVJ D;  1SEN A;  3C73 A;  5J9B A;  3TKR A;  1DSB A;  3FZ5 A;  1GNW A;  3L4N A;  4MJC A;  2H8L A;  1VRS D;  4PQH A;  4OO5 A;  1Y25 A;  2YV7 A;  1NSW A;  5DAL B;  2O87 A;  4ID0 A;  4AGS A;  2CAI A;  4BVY B;  3TKS E;  3PPU A;  4RQR A;  2FNO A;  4I8B A;  3HKR A;  3MNG A;  4KF9 A;  4O5R A;  5EY6 A;  4V2L A;  1OKD A;  3ISO A;  1AC1 A;  3N9J A;  1TDI A;  1CQH A;  3IC8 A;  3EVI A;  2WDU A;  2ZUP A;  2WJU A;  4FO5 A;  2QKE A;  5D8I A;  1XVQ A;  1DE2 A;  1PSQ A;  3HD5 A;  2YNX A;  1Z6M A;  2I4A A;  4IEL A;  5G5F A;  2DIZ A;  1GSY A;  3APO A;  4J57 E;  3TRQ A;  4IHU A;  5D9T A;  2EIO A;  3EUR A;  5IMC A;  2DJ3 A;  3KTB A;  4LMV A;  2Z9S A;  5IMZ A;  4L5O A;  2J9H A;  1YKC A;  1WWJ A;  4EE0 A;  2MZC A;  4I97 A;  4YQV A;  3IAM 2;  1U3A A;  2VCZ A;  3O76 A;  2YWM A;  3C8E A;  4FYC A;  3W6G A;  2N5A A;  1X5E A;  4FIW A;  3CSH A;  1PD2 1;  3GST A;  3A2W A;  5DQS A;  3GRX A;  3LXT A;  3L9S A;  14GS A;  3ZTL A;  3LXZ A;  1QUW A;  4MPF A;  1G6W A;  2HSH A;  3R3E A;  3TRP A;  2IL3 A;  4GQF A;  2DML A;  4Q5R A;  1TOF A;  3LW9 A;  1FOV A;  2YPM A;  3DRN A;  2LRT A;  2VAF A;  2GT5 A;  4GCI A;  1WE0 A;  1SJZ A;  4E8H A;  1JLV A;  4EVM A;  4V1A g;  4O5Q A;  2H1D A;  3M8N A;  5C00 A;  1BED A;  3FZ4 A;  2E2M A;  1QXH A;  2OE1 A;  1LBK A;  2FY6 A;  2GQK A;  2H6X A;  2H30 A;  2F8F A;  2VM1 A;  1KEB A;  4TR1 A;  4QL9 A;  2HRA A;  3HCZ A;  4OD7 A;  2C0F A;  3VPT A;  5IOX A;  1PKW A;  3LYP A;  1SL2 B;  5GST A;  5AIV A;  1GRX A;  1SK2 A;  2B7J A;  2GVP A;  5ELG A;  3J7Y b;  3KH7 A;  1TRU A;  2K9F A;  2VL2 C;  5F05 A;  1TJD A;  3TJJ A;  4DVC A;  1HNA A;  1R4W A;  1BG5 A;  2VCV A;  1AQW A;  4L8E A;  5ECI B;  5HR1 A;  5KEJ A;  2UZ8 A;  3V1W A;  2B5Y A;  11GS A;  4PTS A;  4AJ7 A;  5D9X A;  2JAD A;  1PN9 A;  3A3T A;  3CTG A;  4F03 A;  1XW9 A;  2AV4 A;  2O85 A;  20GS A;  3IPZ A;  3D4M A;  5DAL A;  2CAQ A;  5KN1 A;  1M0U A;  2LRN A;  1T4Y A;  2H6Z A;  2VLU A;  4K7N A;  3J7Y k;  3HVV A;  4MF6 A;  1FOH A;  4D73 B;  3UAR A;  1ERV A;  2HE3 A;  2BMX A;  5ECN B;  1SJI A;  2A4V A;  3A5W A;  1UA5 A;  4YAP A;  2F8A A;  4NWY A;  5JWO B;  3UBL A;  2LJR A;  1K3L A;  3HA9 A;  3ZML A;  3IHQ A;  5ECM B;  5GAN D;  4ZBA A;  5G30 A;  1DE1 A;  2O89 A;  2B7K A;  1B9Y C;  3CTF A;  2IMD A;  1TK8 B;  5CRH A;  1OC8 A;  2M72 A;  2WS2 A;  2NDO A;  3MYD A;  4RUV A;  2CZ2 A;  4ZL9 A;  1Z7P A;  3HJO A;  2R6K A;  3KH9 A;  3QAW A;  3LJR A;  1FW1 A;  5LD0 A;  5IMF A;  3TDG A;  3UBK A;  2FLS A;  2PVO C;  4K0N A;  5EVO A;  5DJM A;  4KSO A;  2XPD A;  3GUR A;  4QL7 A;  1GTA A;  4X1U A;  4QQ7 A;  2IME A;  3APS A;  3KJY A;  3EMX A;  3IXR A;  1T4Z A;  2C80 A;  1WMJ A;  2R0C A;  1BAY A;  2C3T A;  1O8X A;  2C4J A;  2REM A;  4ML6 A;  1YQ1 A;  2CV4 A;  1JZW A;  4EXJ A;  2C3Q A;  3BJ5 A;  2H0G A;  1GSS A;  2C0G A;  4KSM A;  3ZFL A;  3TOT A;  3DXB A;  1GUK A;  1GUL A;  5JCU A;  2AAW A;  3CRT A;  4TXO A;  5AN1 A;  2H71 A;  2X8H A;  5CP1 A;  1YJ6 A;  4EUY A;  2V1M A;  2C0E A;  3VPQ A;  3AY8 A;  4HZ2 A;  3KD0 A;  1H75 A;  4NMU A;  3CSI A;  1FO5 A;  1THX A;  1B4P A;  2VCX A;  2FWE A;  1ML6 A;  3Q6O A;  1DUG A;  3VK9 A;  3HHV A;  2VUP A;  4POK A;  4PUA A;  5CO3 A;  1A2L A;  1AXD A;  4I6X A;  2E0Q A;  3A5I A;  3KZQ A;  4KW6 A;  4ECC A;  3ZIJ A;  2VD1 A;  4IN0 A;  2L6D A;  2QA2 A;  1PN0 A;  1W89 A;  17GS A;  3FR9 A;  2XBQ A;  4GLT A;  1OE8 A;  4ECB A;  2MMA A;  1GSD A;  2H74 A;  3WT1 A;  3F4T A;  3LOR A;  3KTL A;  4GSS A;  4KA0 A;  4PQ1 A;  4FH8 A;  1VF4 A;  1F3B A;  1UC7 A;  4MCU A;  4Z2T A;  4WKW A;  5A4U A;  1DBY A;  1K3Y A;  1EV4 A;  1YF1 A;  3D4T A;  3TJK A;  2EIQ A;  4ACS A;  1HYU A;  3W8S A;  4TR0 A;  4G9H A;  4ZXG A;  4E8E A;  2L4C A;  3HJM A;  4AF2 A;  3RPN A;  2YOI A;  6GST A;  1J9B A;  1SKS B;  3GKN A;  3KGK A;  1ZYN A;  3IK9 A;  5ECQ B;  5FWG A;  2JL4 A;  2DJ2 A;  1B48 A;  1XPV A;  5H5S A;  2CVB A;  1M7T A;  2HLS A;  2DJ1 A;  4D73 A;  2KLX A;  5DBQ A;  2H75 A;  1ZZY A;  3LGC A;  3CSJ A;  1Q98 A;  2HFD A;  3Q19 A;  2MBS A;  1K0B A;  5AIS A;  4TR4 A;  1XWC A;  1EP8 A;  2PWJ A;  1J0F A;  4WBJ A;  1SKR B;  2H70 A;  1QMV A;  2AHE A;  4FYU A;  3US3 A;  3TRX A;  1TU8 A;  3RDW A;  1HQO A;  4CDO A;  1ZL9 A;  4TN8 A;  3FY7 A;  2C8U A;  1ABA A;  1SU9 A;  1XZO A;  2H6Y A;  4NXI A;  3DVW A;  3ED3 A;  1GUH A;  3UL3 A;  4MNN A;  2WFC A;  3HYP A;  4KND A;  1F6M C;  3F4R A;  5ECR B;  4OFM A;  4XS4 A;  2H1A A;  1CQG A;  1YF0 A;  3IK7 A;  1GSF A;  4CW9 A;  2JSY A;  1GSU A;  3L0H A;  3OR5 A;  1OVN A;  1BX9 A;  2HZE A;  3GKK A;  2R3X A;  4HU9 A;  2DJJ A;  4BL7 B;  2CVD A;  3H4K A;  4KDU A;  2VD0 A;  3E3E A;  4RI7 A;  3CMI A;  3D5J A;  3ZIV A;  2L4Q A;  6GSW A;  5ECH B;  3KXO A;  4OWY A;  5DAK B;  4GST A;  1TXX A;  3WD6 A;  2DSA A;  4EDZ A;  1MD3 A;  2E7P A;  2HT9 A;  1TKD B;  2JU5 A;  1GTU A;  5IIZ A;  1GUM A;  2VL9 A;  2IMI A;  3ZRD A;  5F8B A;  2H73 A;  5CRW A;  4KE3 A;  4KDX A;  4MP4 A;  3H8Q A;  2NTO A;  1E2Y A;  4POM A;  3GX8 A;  1A24 A;  4O32 A;  1SKW B;  1G0T A;  1WIK A;  3LFL A;  1M2D A;  2AJQ B;  3RHB A;  3TUE A;  2PMT A;  3ZZX A;  4J2F A;  2RII A;  2OA7 A;  19GS A;  3Q18 A;  2VM2 A;  2X99 A;  5CRD A;  4IP1 A;  5C04 A;  3C1R A;  4IW9 A;  3DGQ A;  2GLR A;  3PGT A;  1C72 A;  4WBR D;  12GS A;  4XS6 A;  4ZBB A;  1RK4 A;  5F06 A;  2XBI A;  3HZ4 A;  4HUA A;  4MK3 A;  4LLR A;  1JFU A;  1EEJ A;  1BJX A;  4BVX B;  3WGE A;  1FG4 A;  2FA8 A;  3P90 A;  3FKF A;  2G0F A;  4O5U A;  2YN1 A;  1R5P A;  5ID2 A;  1M2A A;  3EIN A;  2XHF A;  5BMU A;  4LA1 A;  2HNL A;  4KUN A;  2K6V A;  5KN2 A;  3QPM A;  2OBK A;  2WCI A;  1PRX A;  1QGV A;  4XRA A;  3F63 A;  4P3Y B;  4ZB6 A;  2H0H A;  1X5C A;  3BCK A;  2RUF A;  3GFK A;  4HQS A;  1AAZ A;  6GSU A;  3F8U A;  2X8C A;  4TRX A;  1YEP A;  3IRA A;  2LTK A;  4NV5 A;  1WPI A;  4Z2U A;  3FW2 A;  1NM3 A;  6GSS A;  5G1K A;  5KN3 A;  1Z6N A;  5GAP D;  5B7C A;  3TB2 A;  2EC4 A;  1S3C A;  2O7K A;  3W8J A;  6GSY A;  5HR0 A;  1WOU A;  5IO0 A;  4WR5 A;  3L9U A;  4NV2 A;  5ECK B;  1TRW A;  2P5R A;  3PR8 A;  4DSQ A;  1T3B A;  4PNF A;  4TKY A;  2KHP A;  1O6J A;  3IA1 A;  1EGO A;  2TRC P;  2ON7 A;  1A2J A;  1V57 A;  3WGX A;  4ZIJ A;  2HI7 A;  3F6F A;  1XOA A;  3N5O A;  3G9B A;  2WB9 A;  1U88 A;  1PMT A;  2B5X A;  3ERF A;  1WJK A;  4DSS A;  4Q5Q A;  2VL2 A;  4K1F A;  1YKA A;  4LL4 B;  2E2G A;  2ES7 A;  1K3O A;  1S3A A;  2IWT A;  3QOU A;  3FR6 A;  1TU7 A;  2PGT A;  3O6T A;  4JRR A;  5IMA A;  1Z7R A;  3H93 A;  4XTS A;  4A5P A;  3GUS A;  7GSS A;  4HEA 2;  2YV9 A;  1JZO A;  1AQX A;  1JZD A;  2GZY A;  1K0A A;  3DYR A;  4GWR A;  1E6B A;  1JHB A;  2R37 A;  4OCE A;  2JZR A;  1OC9 B;  3WYW A;  2I1U A;  4WXT A;  2A2P A;  1XWB A;  4HJM A;  5F07 A;  2WZ9 A;  3LSZ A;  1R26 A;  5IMV A;  1MDJ A;  1THO A;  2AYT A;  3WGD A;  3M9J A;  3FMW A;  1I9D A;  1XWA A;  10GS A;  4WEY A;  3KCM A;  3EE2 A;  2DLX A;  1PL1 A;  4HU7 A;  4K7O A;  3H79 A;  1ERT A;  3D22 A;  1NHY A;  1G7E A;  4MLY A;  1PL2 A;  1MDK A;  1VF2 A;  1SYR A;  3F4S A;  3ZLP A;  3DWV A;  4BVY A;  2K18 A;  2QC7 A;  3ERW A;  3S9F A;  4GQC A;  4JR6 A;  3IBH A;  1YDK A;  3TOU A;  2OAD A;  4N30 A;  4BWQ A;  2L59 A;  3TCO A;  3E0U A;  5JCW A;  1TK0 B;  3DEX A;  4TOP A;  2FWG A;  2R5G A;  5DQY A;  3O3T A;  4KB3 A;  1PX6 A;  4GF0 A;  1JLW A;  1V98 A;  4O7H A;  3ZMK A;  1GWC A;  5INY A;  1ZOF A;  2PER A;  1B8X A;  4IKH A;  1IYH A;  1U3I A;  4IS0 A;  3GN3 A;  2IFQ B;  4ECJ A;  2VO4 A;  1A23 A;  4I2U A;  2H01 A;  4IQ1 A;  1XWK A;  3VFI A;  4N0Z A;  1T00 A;  5G2Z A;  4GTU A;  4K5R A;  2IPA A;  1A0R P;  2ZCT A;  2N5B A;  2LEG A;  1X5D A;  1GLQ A;  1SL0 B;  2KP1 A;  4MZB A;  1OC3 A;  4Z7X A;  4G0I A;  4N11 A;  3R2Q A;  1XXU A;  3BCI A;  2I3Y A;  2DJ0 A;  2ZNM A;  1Y6E A;  4LL1 B;  1QQ2 A;  3GL3 A;  5J41 A;  1F3A A;  5HR2 A;  2BJX A;  2PU9 C;  3CRU A;  1AIU A;  3ZVJ A;  5HFK A;  3UEM A;  5KN0 A;  2FA4 A;  1EGR A;  3GKM A;  2B3S A;  5JCG A;  4DEJ A;  3NIV A;  2BTO T;  3TKS A;  2R2J A;  4HI7 A;  2AB6 A;  2YJ7 A;  3UAP A;  3GV1 A;  3D21 A;  3IOS A;  1YY7 A;  5L71 A;  2IN3 A;  5ENU A;  1V58 A;  2L6C A;  2EIR A;  1URM A;  4OFN A;  5A5K A;  4MJE A;  1ZMA A;  2LV3 A;  4LMW A;  2V41 A;  1GSQ A;  2OJL A;  4EDY A;  5HR3 A;  2DIY A;  5H5Q A;  3EU3 A;  4F2I A;  1H4O A;  4ILF A;  2FGX A;  2YZU A;  2A2S A;  22GS A;  5D73 A;  5JWR B;  2HZF A;  5IM9 A;  3HY2 A;  5AGY A;  5AIX A;  3GKX A;  3GH9 A;  3VWX A;  3IV4 A;  3FZA A;  2KOK A;  3GTU B;  2GGT A;  1XW6 A;  1T1V A;  1F2E A;  2JZT A;  5H5R A;  3UIW A;  2GSS A;  2H66 A;  3I43 A;  4KX4 A;  5HFI A;  5GSS A;  3VWW A;  2F9S A;  4WF4 A;  1O8W A;  3F6D A;  4YAV A;  3LEF A;  3M1G A;  6GSX A;  3D6I A;  5E4W A;  3RHC A;  4AJ6 A;  3MWH A;  5IPG A;  4K8M A;  3VWU A;  1K0C A;  1SYX A;  1KBN A;  5KOW A;  2I81 A;  3M0F A;  1A8L A;  1G7O A;  4K5S A;  1T8E B;  3IAS 2;  3Q74 A;  2CZ3 A;  1TW9 A;  4GXZ A;  3LYK A;  4V2M A;  4POL A;  2GDR A;  1K0D A;  2X49 A;  5CRG A;  4HQZ A;  4IP6 A;  1O85 A;  4PUF C;  4I2T A;  2LNS A;  3FZ9 A;  3FEU A;  5IMD A;  3DIE A;  4BPY A;  5IO2 A;  1B4Q A;  2H1G A;  4JR4 A;  5DCG A;  1QFN A;  2OBI A;  5D9W A;  5FT3 A;  4YH2 A;  3KIJ A;  6GSV A;  1Z3E A;  4YQU A;  4PNG A;  1V40 A;  1SK1 A;  3LQ7 A;  3QAG A;  3DD3 A;  2DJK A;  3IR4 A;  3FR3 A;  4V1A p;  1VF3 A;  3GH6 A;  1TK5 B;  1VF1 A;  3ZL5 A;  1EOH A;  2PN8 A;  4YKF A;  2GT6 A;  4ZIL A;  3C1S A;  1T7P B;  5J9C A;  2RM5 A;  4TVE A;  2OE0 A;  4KAE A;  4MZW A;  5CNW A;  2YJH A;  2NBS A;  3FRC A;  1GLP A;  3EU4 A;  1EV9 A;  5D9V A;  2V6K A;  2YCD A;  3GA4 A;  3U5R E;  4IJ3 A;  3QR6 A;  3KMO A;  3RBT A;  1EZK A;  1XFL A;  2TIR A;  2QA1 A;  4TR1 B;  2GZP A;  4L0W A;  3ME8 A;  5F0G A;  5D93 A;  1HNC A;  4K0G A;  3KP9 A;  3MDK A;  3MSZ A;  4FQU A;  4KCE A;  4DSR A;  4GSN A;  2A2R A;  2H76 A;  2H19 A;  3GMF A;  3G7I A;  2GST A;  1M2B A;  1Q4J A;  1U6T A;  3EPT A;  1GTI A;  2IMF A;  2GTU A;  1GSE A;  1XWG A;  3F0I A;  2VLT A;  2G2Q A;  4NHZ A;  4EO3 A;  4X43 A;  5KOX A;  3RAZ A;  3EYT A;  1BQ7 A;  1X9M B;  1X9S B;  1EP7 A;  2VLV A;  2K8S A;  3UOM A;  2LUS A;  3BBY A;  4PX1 A;  3KMN A;  3APQ A;  1TI1 A;  4MH2 A;  3HVS A;  4KGI A;  3GTU A;  2YP6 A;  2VOC A;  5B8A A;  3L9V A;  5ECP B;  3M3M A;  2B5E A;  1XW5 A;  2LJA A;  4G19 A;  2K8V A;  1HD2 A;  5ELA A;  3WT2 A;  4PGT A;  3ZYW A;  2P31 A;  3K8N A;  2KP2 A;  1MD4 A;  1PX7 A;  4YKG A;  4XHM A;  4EL1 A;  3DVX A;  1SJ6 A;  2QSI A;  2FCH A;  2QGV A;  4GRF A;  3QFB C;  2X4A A;  4ULX A;  2C1Y A;  3SBC A;  4NPB A;  3TJF A;  1MEK A;  3GNJ A;  1G6Y A;  1WP0 A;  1ST9 A;  4EF0 A;  3QDN A;  4F82 A;  3I69 A;  2PPT A;  3EC3 A;  2V32 A;  1M9A A;  2C3N A;  4PXO A;  2YWN A;  1B9X C;  2YAN A;  2IIY A;  4F0B A;  1PGT A;  1J08 A;  4G2E A;  3QMX A;  3UJ1 A;  1MTC A;  1M99 A;  4MF5 A;  2LS5 A;  3JCM L;  3HDC A;  4WR4 A;  4OMV A;  3HVX A;  3GSS A;  2GSR A;  2IMK A;  3F3R A;  2P5Q A;  4Q5F A;  2C0D A;  3PH9 A;  4HOJ A;  3D0Z A;  4JBB A;  2JSZ A;  3VUR A;  1N2A A;  4TXO B;  3EWL A;  3BOA A;  4F0C A;  2J23 A;  1FAA A;  5ECO B;  3FHK A;  2N5F A;  1GL8 A;  4AJ8 A;  3CYN A;  4TXV A;  1EWX A;  4BL7 A;  4JED A;  1EEM A;  2LST A;  2HRF A;  5J3R A;  5DAK A;  2CQ9 A;  4KH7 A;  2JAC A;  4EIQ A;  3LG6 A;  1Z9H A;  3QD9 A;  2MYG A;  1K0O A;  1ZYE A;  4KDY A;  1ACV A;  4MA9 A;  1GP1 A;  1OAZ A;  1RW1 A;  3IHG A;  4ZB8 A;  5DJL A;  4G0K A;  4ISD A;  1OKT A;  2VCT A;  3QAV A;  5LCZ A;  2VL3 A;  2WRT A;  1XVW A;  2R4V A;  4MF7 A;  2GQL A;  2B1L A;  4K2X A;  4MPG A;  3P8W A;  2LRC A;  2H72 A;  4MDC A;  5D96 A;  1GTB A;  5JWQ B;  1TTZ A;  1U87 A;  4PQI A;  2H0I A;  1X0R A;  4XS1 A;  2RM6 A;  1O81 A;  3ZIT A;  2P0G A;  1M9B A;  4L5L A;  3E9J B;  2D2Z A;  1R5A A;  4IBP A;  4BVX A;  2XPE A;  2PVQ A;  2HSY A;  3DML A;  1F9M A;  1KTE A;  3TGZ A;  2YZH A;  3TKQ A;  4V2N A;  5ABR A;  2DMM A;  3G7Y A;  4ICY A;  2HSM A;  1TP9 A;  4MMM A;  3EMP A;  1X9W B;  1KNG A;  1UN2 A;  1I5G A;  1EOG A;  5FHI A;  3DKS A;  2VCW A;  1ON4 A;  3HXS A;  5DVB A;  2GZZ A;  4NHW A;  1O7U A;  1VGL A;  2VCQ A;  3GL5 A;  5IOW A;  4K9Z A;  3ERG A;  1Z5Y E;  2MMN A;  2FWF A;  2V6O A;  3TJB A;  4KCA A;  3P7X A;  4K7I A;  2PBJ A;  5E59 A;  4ECI A;  4RQX A;  2B6M A;  4XS4 B;  2HXK A;  2OE3 A;  1V2A A;  4IGJ A;  3GIX A;  1A8Y A;  2PUK C;  4MJA A;  1O73 A;  5J4U A;  4XCS A;  3CXG A;  2NVL A;  1XIY A;  3BD2 A;  2GSQ A;  1GH2 A;  5CAX A;  5LNK e;  2H1B A;  3TKP A;  4FYB A;  4OFT A;  1IYI A;  1YZX A;  2DC5 A;  4OCF A;  2HZE B;  3F9U A;  3IC4 A;  4I5Q A;  3RPP A;  2NPB A;  4EIP A;  1ERU A;  1QK8 A;  2CT6 A;  1OYJ A;  1A2M A;  1YEX A;  4CHS A;  4CY6 A;  4IQA A;  4L0U A;  4X4J A;  1AUC A;  3LWA A;  3U6V A;  4XIH A;  4NAX A;  3IDV A;  3G7J A;  4ZB9 A;  4HS1 A;  1K0M A;  1AW9 A;  1K0N A;  3CBU A;  4POB A;  4WET A;  3IE3 A;  3F3Q A;  2YWI A;  4ZL7 A;  2IJY A;  1FB6 A;  1SD9 A;  2L5L A;  2VIM A;  3HZ8 A;  1SD8 A;  1WRY A;  2A4H A;  4ML1 A;  1NHO A;  2O8V B;  3GX0 A;  4WF5 A;  1GNE A;  2GS3 A;  2GQM A;  1PQN A;  2B1K A;  4BA7 A;  4Z2R A;  5CRE A;  1RQM A;  3VLN A;  1OC9 A;  4EKZ A;  2LJK A;  2X8G A;  4HJ2 A;  5DCH A;  2ALB A;  2MMZ A;  1USB A;  1XOB A;  3UVH A;  2FHE A;  4G10 A;  2FUG 2;  13GS A;  3KM6 A;  2XC2 A;  3GHA A;  2CX3 A;  2HRK A;  3ME7 A;  2F51 A;  3TKS C;  1FVJ A;  1W4V A;  4HZ4 A;  2OAC A;  3L78 A;  1XCC A;  4IJI A;  8GSS A;  3ZRE A;  5B6N A;  5IPH A;  1UVZ A;  3UMA A;  1TRS A;  4TR3 A;  3C71 A;  4PUR A;  4ZL8 A;  1N8J A;  5ID2 B;  1V9W A;  5G5E A;  4Q5N A;  3C7M A;  3H1N A;  3A2X A;  2AUV A;  2HYX A;  1ILO A;  5CYY A;  3GYK A;  2F3M A;  2RUE A;  3FYG A;  4K2D A;  3KEB A;  4MAB A;  2CVK A;  4J56 E;  3I9V 2;  2L5O A;  3QFA C;  1FVK A;  4JE1 A;  3MIX A;  4ZBD A;  4JZQ A;  2R0P A;  1PKZ A;  4YQM A;  2HRN A;  1S3D A;  3MAK A;  2DKI A;  1FHE A;  2YWO A;  4K6X A;  3UVT A;  2FWH A;  4N0V A;  1NW2 A;  3KP8 A;  2RLI A;  2IFQ A;  5BRT A;  2ON5 A;  3I6A A;  4BWS A;  2LQQ A;  1F37 A;  5G31 A;  3SWL A;  4MZC A;  1HNB A;  2M46 A;  4F9Z A;  1ZGN A;  2LQO A;  1R7H A;  4HDE A;  2R0G A;  1MDI A;  4IVF A;  1PA3 A;  5IQY A;  1AQV A;  4X0X A;  1ZYP A;  1OE7 A;  4USS A;  5ECL B;  5HFG A;  1SL1 B;  3ZFB A;  1SK0 A;  3HJP A;  1BYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...