1ERWA

Human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1erwA00
2A4VA 2YCDA 2YV7A 2LS5A 2IMIA 4JU5A 2PGTA 2FHEA 3QDNA 1OE8A 2HRNA 3FRCA 3O3TA 4JZQA 3RDWA 1BQ7A 3BD2A 3F3QA 2LQOA 5ECOB 4V2NA 2ES7A 2AAWA 1ABAA 1GSUA 4KW6A 3W8JA 2PU9C 4OWYA 1ST9A 1WIKA 4KDXA 2H74A 3TOUA 1XPVA 3RPPA 2PVOC 3P7XA 1O6JA 4G19A 5ID2B 1Q98A 2C3NA 3TKRA 2GZPA 1EV9A 4JR4A 3WYWA 3KGKA 5COHA 5ECNB 4ISDA 3G7YA 4MJBA 5D93A 3D6IA 4HDEA 2PWJA 2CX3A 1PMTA 2FWEA 2MYGA 4ID0A 1TRVA 3FZ5A 2C0GA 2DBCA 5ECSA 1FG4A 3GRXA 3A2XA 3VWUA 19GSA 2VLVA 2O85A 4MF7A 1SL1B 2P0GA 13GSA 4DEJA 1GSYA 2EIRA 4ZXGA 4ECCA 4MA9A 3OR5A 5DQSA 3EYTA 1W89A 2IPAA 5G5EA 2L6CA 2OE3A 1EV4A 4AJ7A 3IV4A 4EE0A 2G2QA 4MF5A 2GZZA 3N5OA 1H75A 5KN3A 5C04A 3IA1A 4HZ2A 1GSEA 3RPNA 3HHVA 1T8EB 4MP4A 2OADA 2VAFA 3HVXA 4Q5NA 1XW5A 1YEPA 1ZZYA 5DJLA 1XWKA 4KA0A 5IMFA 1TI3A 1FVJA 2L4QA 1SYXA 2GDRA 1AQVA 2TRCP 2JL4A 1Z7RA 2B6MA 4XRAA 2B7JA 4K2DA 3MWHA 4NMUA 2OE1A 2GT5A 2H1GA 4K1FA 1M2BA 2VL9A 5CP1A 3VPQA 3EU3A 3RHCA 22GSA 3NZNA 5D73A 4MLYA 1ZYQB 3LXTA 1B8XA 4OCEA 4I6XA 4N0ZA 3DVXA 3ME8A 4JE1A 4IGJA 1SKRB 2GQKA 3GYKA 2FA8A 1V58A 3UL3A 5D9VA 3RAZA 5IMZA 5HR1A 4WEYA 1SL0B 3GH6A 2CVDA 1YJ6A 4J57E 1PX6A 1R4WA 5J41A 5AISA 3GL5A 4LL1B 1B9YC 3WT2A 2IJYA 3TCOA 1AXDA 2FUG2 5CRWA 5D9WA 2IMKA 3UEMA 3HJMA 5AIVA 1WOUA 1PL1A 2H66A 5DAKB 14GSA 4TR3A 3CXGA 2VCQA 4DSSA 2H1DA 5HR3A 1SK2A 2LNTA 2LJRA 2CV4A 1LBKA 1NM3A 1NSWA 3Q74A 2FWGA 3EE2A 2GSRA 1JZDA 3ZTLA 4O5RA 1HNBA 3G7IA 4P3YB 2VD1A 4BVYA 2KLXA 5GSSA 3F63A 3UVHA 1ERWA 3CRTA 2O87A 4IQ1A 3UARA 2BMXA 4IS0A 1FB0A 3GKNA 4ZBAA 3D21A 4BA7A 1YF1A 5EPFA 1WE0A 2CZ2A 2GGTA 3LJRA 2H75A 2CAQA 2L57A 1K3LA 4N10A 4WF5A 4HU7A 5JCGA 1K3OA 1XBSA 1UC7A 1MDKA 2OBIA 5INYA 2VCWA 3A2VA 1PN9A 5KN2A 3KH9A 2FA4A 1GUMA 2LSTA 3KD0A 1GP1A 3IAS2 2KOKA 1SKWB 4KSOA 2BTOT 4RUVA 3DWVA 3KP9A 3BCIA 4KDUA 2E0QA 1X5CA 2B5YA 2R37A 1J0FA 1T4YA 3CRUA 2HE3A 5FHIA 1DE1A 2NTOA 4GSTA 4DSRA 2K18A 5J9CA 3KMNA 4GTUA 2HXKA 4K9ZA 2VCTA 3DVWA 2LNSA 2H70A 2KHPA 4X43A 2Z9SA 2VO4A 5LD0A 4K8MA 1VGLA 1HYUA 2MMAA 1LJRA 1TJDA 1TRSA 2CAIA 2VL2A 3VWVA 3PR8A 1BAYA 2DJ3A 1U6TA 3I9V2 1XWGA 4K7IA 5G30A 4IVFA 1FHEA 1M7TA 1M2DA 1KBNA 1B4PA 18GSA 1A2LA 1GL8A 2WGRA 4PQ1A 3F0IA 2F8AA 3O6TA 1T3BA 3LORA 5DDLA 4MPGA 2H01A 4EC0A 1V40A 2X8CA 4HEA2 3ZRDA 1I5GA 6GSUA 1EGRA 4MZBA 2IIYA 3FR6A 4H86A 1FO5A 3LG6A 1SD9A 4WBRD 4DSSB 1J9BA 1WWJA 2GLRA 3DGQA 4LA1A 4MK3A 1T00A 1VF4A 3E3EA 2YV9A 4ZB9A 1Y6EA 3PINA 4MZCA 1QUWA 2YJHA 4MZWA 1O85A 4IN0A 5DVBA 4XS1A 5ABRA 1SENA 1TK0B 5D9XA 1RQMA 1QMVA 3IXRA 5HR2A 2AB6A 2H76A 1TOFA 1M2AA 1EOHA 2JADA 1DE2A 3LWAA 5CRHA 4AF2A 2C0DA 2N5AA 2WULA 2R5GA 3L9VA 2E2GA 1GWCA 8GSSA 1SYRA 1EWXA 4JRRA 2F51A 1X5DA 3A3TA 3ZL5A 2YWIA 4OO4A 1T1VA 2IL3A 2LRNA 3ZIJA 2I1UA 2H6YA 3ISOA 3GH9A 1OKDA 3J7Yb 4MH2A 4IBPA 1A2MA 3HVVA 1X9MB 1OAZA 2J9HA 2YPMA 4I2UA 4LMVA 1E6BA 2H19A 3FR9A 1TK8B 1V98A 5G2ZA 3Q19A 3H8QA 3GSTA 3IOSA 2OA7A 3LXZA 2GVPA 3UVTA 3KCMA 4KB3A 4O92A 1DBYA 2R4VA 1OC8A 2F9SA 3TKQA 3F9UA 2WS2A 3ZLPA 2CX4A 2H1BA 3ZZXA 1PD21 2JZSA 3TDGA 3D4MA 1S3AA 4OCFA 2LQQA 3AY8A 3HJOA 4PQHA 2VIMA 4TR1B 3CSHA 2JACA 2GSTA 1GLQA 1QQ2A 1GTIA 1YEXA 2I81A 4N30A 5H5SA 1K0NA 3SBCA 2GT6A 4CW9A 4K7NA 4KX4A 4IJ3A 3P2AA 2FWFA 5F07A 4PGTA 2O7KA 1XW9A 2LTKA 2EIQA 2LEGA 3CYNA 1ZOFA 4BPYA 3C7MA 2KP2A 2G0FA 5G31A 5A4UA 3G7JA 4POBA 1A23A 3LQ7A 4MJEA 1EP7A 3KEBA 2JU5A 3WGDA 2FLSA 2ON7A 2F3MA 2AUVA 1NHOA 3KH7A 2B7KA 1ZL9A 3ZMLA 1WRYA 1GNEA 3KJYA 4KAEA 1KTEA 1AIUA 3W6GA 4TR0A 4HUAA 1ZYEA 1NHYA 2J23A 5DAKA 3TUEA 1GTUA 3FW2A 1GUKA 1GSSA 1GTAA 4I97A 2A2SA 2C0FA 3APOA 4EUYA 2DLXA 3W8SA 1PSQA 1OVNA 4KH7A 2YOIA 4EDZA 3FKFA 2YNXA 5ECPB 2MMNA 5A5KA 1U87A 11GSA 1TI1A 1ON4A 3IRAA 3QD9A 3EC3A 5EL8A 1TU8A 1Z6MA 2LKUA 3TRPA 2CA8A 4FYCA 5JWRB 1K0MA 4TN8A 4XCSA 3U5RE 1MDJA 4F03A 5CAXA 4I5QA 3ERWA 4PUFC 6GSVA 5KEJA 5IOWA 2H0GA 3APSA 2IN3A 2DJ2A 2RM6A 2H30A 2VD0A 3C73A 5LCZA 3BJ5A 3TJBA 5LNKe 1W4VA 1X9WB 1QXHA 1FB6A 2M80A 3F6DA 3UJ1A 2GQLA 4WKWA 2GTUA 5GSTA 1B9XC 3CSJA 5GAPD 1GH2A 2DJKA 6GSXA 1K0DA 1JZRA 1KNGA 1O81A 4GXZA 3HYPA 3RBTA 3SWLA 4F0BA 3DD3A 1AC1A 4XS4A 3QPMA 1T7PB 3GV1A 1O7UA 1ERUA 2VOCA 4J56E 2PMTA 3F4RA 3EURA 2AHEA 5B8AA 4HQSA 3P8WA 5CREA 5C00A 4ZB6A 1Z3EA 4QL9A 1BYEA 3IE3A 1UN2A 1VF2A 3EMPA 3TOTA 2L4CA 2FCHA 6GSYA 2DMLA 1EGOA 3TGZA 4ML6A 3IDVA 1TTZA 3GN3A 1XWAA 3GURA 2GZYA 4X1UA 3GHAA 3TJKA 2PBJA 5DCGA 2WRTA 5J9BA 3FR3A 3DKSA 4CHSA 1AQXA 2P5RA 3VI5A 4NHWA 3H1NA 4BWSA 4YQUA 1WP0A 5B7CA 3C1RA 3GKMA 5DQYA 2P31A 2WJUA 2MBTA 3M1GA 3PH9A 2LRTA 1JZOA 2B5XA 2I9HA 4V1Ag 1XOBA 4FIWA 1QGVA 4RQRA 3KZQA 5H5QA 4OMVA 4XRDA 5F0GA 2K9FA 4ZBDA 3KTLA 2LRCA 1JHBA 4IP1A 2ZUPA 4GWRA 3UBKA 3IHQA 1XIYA 2VCZA 4OFNA 2ON5A 1Q4JA 5HFIA 1B48A 1AAZA 2I3YA 1GUHA 4F0CA 4J2FA 2HRFA 3VWWA 1OKTA 2ZNMA 4TKYA 3IPZA 4OFMA 4IP6A 3VFIA 3N9JA 1SJZA 3Q18A 4E8EA 1Z7PA 5D96A 1XZOA 2QKEA 2ZCTA 4MPFA 3UAPA 2MMOA 4Q5QA 1QK8A 3GX8A 4HJMA 5JWQB 3DRNA 4IELA 5IMVA 1M99A 5A4WA 3JCML 3BOAA 2VCVA 3KTBA 4XS4B 5J5NA 1URMA 1XVQA 3HA9A 1RW1A 4KNDA 5IO2A 2QGVA 2REMA 1SU9A 5IM9A 1R26A 4HS1A 1V57A 2HFDA 2HNLA 2OKAA 4V1Ap 1OE7A 6GSWA 3FZ4A 2B1LA 2XHFA 3GSSA 4TR1A 4KE3A 2AV4A 3DIEA 1XWBA 2H1AA 1FOVA 1PL2A 2E2MA 1EEMA 3ZVJA 4ACSA 3A2WA 4ZL9A 2WB9A 1K0AA 4N11A 3HZ8A 1F6MC 2DJ1A 3ZYWA 3KM6A 2HI7A 3L9SA 4QL7A 2HT9A 5HFKA 2V41A 3UOMA 4ZBBA 4L0UA 4F2IA 5IO0A 1UA5A 4YQVA 3F4SA 1VF3A 2JSYA 5IMAA 1R5AA 3V1WA 3FHKA 3EU4A 3C8EA 2RUFA 1ERVA 3GL3A 5ECLB 3TKSE 5DCHA 5G1KA 4WXTA 5KN0A 7GSSA 4ZILA 1VF1A 4EF0A 4MH3A 5ELAA 2IMEA 1ML6A 1SK1A 2DC5A 4F82A 3LYKA 3C1SA 20GSA 3HCZA 4HJ2A 3TKSA 5IQYA 5EY6A 2FGXA 1IYIA 2HYXA 2YZUA 4JBBA 3IBHA 5HFGA 2PN8A 1A8YA 3ZIVA 5IMDA 2VL3A 4EKZA 4GSSA 3M0FA 5KN1A 1F3AA 5DALB 2C80A 1EZKA 1TDIA 1O8XA 3Q6OA 4GSNA 4YAPA 3FZ9A 3ZFLA 1GRXA 4K7OA 5B8BA 1FAAA 1V2AA 4N0VA 2WZ9A 3US3A 2N5BA 5GAND 4Q5RA 1TRUA 1A24A 3S9FA 1OC9A 2V6OA 4HI7A 4PXOA 3CMIA 3FEUA 3ERGA 4O7HA 4ULXA 2H6XA 1WPIA 1A2JA 4MDCA 4GF0A 2NPBA 4BWQA 1HNAA 1ZMAA 2V32A 1OYJA 1MEKA 1U88A 1SJ6A 2IFQB 3L4NA 4OD7A 2OJLA 4POMA 4TRXA 4WBJA 4TXVA 3WGXA 2L5OA 1M9BA 4WR4A 1XWCA 1X9SB 1ACVA 1CQGA 4PNFA 1HNCA 2FNOA 4WR5A 2PVQA 3KMOA 4LLRA 2C4JA 1YDKA 2XBQA 1PKZA 2OACA 5ENUA 1BX9A 1XW6A 4ZB8A 1M0UA 1A0RP 2QC7A 2RM5A 2VCXA 3EWLA 2RLIA 1GSQA 3E0UA 4AJ8A 1C72A 3UBLA 2MZCA 1R7HA 17GSA 2H0HA 4LMWA 4G10A 5ECKB 2DJJA 2C3TA 4G2EA 4BVXA 1MDIA 1PKWA 2N5FA 2FD3A 4XIHA 3M8NA 1ERTA 2VM1A 2X99A 1PX7A 4CDOA 4OFTA 5EVOA 2VM2A 3VK9A 3GX0A 1WJKA 1GULA 3FZAA 4IW9A 2LJKA 4NHZA 3U6VA 16GSA 4V2MA 2DIYA 4V2LA 3IC4A 4POLA 1F2EA 3BCKA 4XTSA 1IYHA 2K8SA 2D2ZA 3QAWA 4K0NA 2C1YA 3EVIA 2X8GA 1YKAA 2OE0A 2PUKC 4PURA 3LSZA 2M72A 2YANA 2L6DA 1X5EA 5E59A 2V6KA 2RUEA 4L8EA 2HSHA 1GSDA 1U3AA 2CQ9A 1XVWA 2P5QA 2AJQB 3HKRA 1BG5A 1Z6NA 2MMZA 2BJXA 2M46A 2H8LA 3PGTA 2V1MA 1AUCA 3D0ZA 3F4TA 1BEDA 1GNWA 2HSYA 2LUSA 4OO5A 1F9MA 2KP1A 1NW2A 4KCAA 3D5JA 5ECRB 1OC9B 1N2AA 4IJIA 1JLVA 1Y25A 1LU4A 5F05A 3HJPA 5F06A 2C0EA 3TJGA 5GZZB 1TKDB 1K0CA 1T4ZA 5IMCA 3G9BA 3FY7A 4GLTA 2GSQA 2IWTA 5ELGA 2K6VA 1B4QA 4QQ7A 1E2YA 4RI7A 4MJCA 1EOGA 1EP8A 3MDKA 1XXUA 3TJFA 3GIXA 1N8JA 3KIJA 4D73B 6GSSA 1SD8A 4GQFA 3MNGA 1ILOA 5DJMA 1Z5YE 4YH2A 2HZEA 3M9JA 4FYUA 5H5RA 2A2RA 2R6KA 1U3IA 4L5OA 2FWHA 3VURA 1G7EA 3A5WA 1XOAA 2H71A 1K0OA 4PX1A 2R3XA 4X0XA 4FH8A 1GSFA 4NPBA 2R2JA 4IKHA 5A4VA 5J4UA 3APQA 1THOA 5ECMB 2CVKA 4YAVA 4TOPA 4RI6A 4AGSA 5ECQB 5D8IA 4ILFA 3WT1A 3CSIA 5DBQA 3HY2A 4KDYA 5B6MA 3ZREA 2TRXA 3HVSA 3L9UA 3UIWA 4EDYA 4E8HA 4LL4B 4FO5A 2XPDA 3BBYA 5JWOB 3LEFA 2YJ7A 4TXOA 1ZCPA 4WETA 3HD5A 4GCIA 2LJAA 1CQHA 4WF4A 3GUSA 4TVEA 2NBSA 3ZVJD 2K8VA 2ALBA 2DJ0A 3KP8A 2JZTA 3VLNA 3M9KA 1AW9A 1PQNA 5J3RA 4MCUA 2YZHA 3DMLA 5CNWA 1UVZA 4PUAA 3GNJA 4Q5FA 2VL2C 2O89A 4F9ZA 3QCPA 2YWOA 3IR4A 1TXXA 5CO3A 2YWNA 1FVKA 3KXOA 3L0HA 4IHUA 4G9HA 1DUGA 1HQOA 4O32A 5DALA 2EIOA 2IMDA 4TR4A 1ZGNA 1S3DA 5E4WA 1XFLA 2H73A 5G1LA 4NV2A 4I8BA 5AGYA 1MD3A 10GSA 2NVLA 1XCCA 1SJIA 4PNGA 1MD4A 2E7PA 4KCEA 1K0BA 1JZWA 5JCWA 1AQWA 5IOXA 2H6ZA 4AJ6A 3VI7A 4YQMA 3UMAA 3HDCA 2PPTA 4DSQA 3RHBA 3IAM2 4MF6A 5G5FA 2XBIA 4NWYA 5B6NA 2F8FA 2IFQA 4MMMA 2XPEA 2WFCA 3M3MA 3TKSC 2HZEB 2B3SA 3NIVA 2VLUA 4MABA 1GTBA 3D22A 5JCUA 2X8HA 3VPTA 3DXBA 3TRXA 5CRDA 3GTUA 5HQPA 1K3YA 3DEXA 2CZ3A 5FT3A 3TKPA 1S3CA 1SL2B 2HZFA 3IK9A 1G7OA 4NV5A 2EC4A 4HU9A 3ZFBA 3GKKA 4KGIA 1SK0A 2QSIA 4IQAA 2OBKA 4Z7XA 3FK8A 4XS6A 2DMMA 2CT6A 1TU7A 3GFKA 4I2TA 3ED3A 4FYBA 1GLPA 4K0GA 2YP6A 2XC2A 3K8NA 4HOJA 4RQXA 4ML1A 3H93A 4ECIA 3HZ4A 3ME7A 2MBSA 4KSMA 4L0WA 3QFBC 2FY6A 3QAVA 4TXOB 2X64A 4TW5A 3GMFA 3O76A 2I4AA 1TK5B 1HD2A 1Z9HA 2GQMA 1F3BA 1TW9A 3H79A 2RIIA 4K6XA 4ZL8A 5IIZA 4ECBA 5FWGA 2HLSA 4NXIA 2C3QA 1V9WA 3GKXA 1EEJA 3HXSA 5HR0A 3CTFA 4ZIJA 2GSSA 1TRWA 3F3RA 4NAXA 1TP9A 4MJAA 1DSBA 4DVCA 1J08A 3GA4A 3FYGA 3I43A 3TJJA 3NOFA 2GS3A 3I6AA 1WMJA 3LFLA 12GSA 1USBA 3MAKA 2TIRA 2DIZA 2KUCA 3I69A 3C71A 1YY7A 4ECJA 5ID2A 5L71A 3QAGA 1MTCA 4HZ4A 4GRFA 1X0RA 1H4OA 3J7Yk 4KUNA 1O8WA 1OC3A 3R2QA 1PA3A 1JFUA 5CRGA 1G0TA 3E9JB 1I9DA 2C8UA 3LGCA 4EL1A 2YN1A 4XHMA 2B1KA 1YF0A 3MSZA 5ECIB 2H72A 2WDUA 3P90A 3ZMKA 1KEBA 2JSZA 1RK4A 1FW1A 9GSSA 2DSAA 4ZL7A 1F37A 1O73A 2O8VB 1JLWA 3EMXA 3LYPA 2AYTA 1YQ1A 3QMXA 5AN1A 1SKSB 4D73A 2CVBA 2V2GA 2WCIA 2VUPA 3CBUA 1M9AA 3GTUB 3TB2A 1YKCA 3QOUA 5ECHB 1A0FA 5D9TA 3VWXA 4EVMA 3L78A 2H0IA 3EINA 2NDOA 4JR6A 3H4KA 3ZITA 3TRQA 5CYYA 1QFNA 2B5EA 5IPGA 3D4TA 3WGEA 2LV3A 1R5PA 3WD6A 1G6YA 1THXA 3QR6A 3IK7A 5F8BA 4L5LA 6GSTA 2JZRA 4EXJA 4HQZA 1PGTA 4BL7A 2YWMA 5AIXA 1PRXA 1BJXA 4JEDA 1VRSD 4GQCA 3F8UA 4PQIA 1G6WA 3CTGA 4POKA 2L5LA 3DYRA 2IMFA 3F6FA 1YZXA 1A8LA 2L59A 2PERA 4EO3A 5IPHA 3QFAC 2VLTA 3ERFA
chains in the Genus database with same CATH superfamily
2A4VA 2YCDA 4G0IA 2YV7A 2LS5A 2IMIA 4JU5A 2PGTA 2FHEA 3QDNA 1OE8A 2HRNA 3FRCA 3O3TA 4JZQA 3RDWA 1BQ7A 3BD2A 3F3QA 2LQOA 5ECOB 4V2NA 2ES7A 2AAWA 3EPTA 1ABAA 1GSUA 4KW6A 3W8JA 2PU9C 4OWYA 1ST9A 1WIKA 4KDXA 2H74A 3TOUA 1XPVA 3RPPA 2PVOC 3P7XA 1O6JA 4G19A 5ID2B 1Q98A 2C3NA 3TKRA 2GZPA 1EV9A 4JR4A 3WYWA 3KGKA 5COHA 5ECNB 4ISDA 3G7YA 4MJBA 5D93A 3D6IA 4HDEA 2PWJA 2CX3A 1PMTA 2FWEA 2MYGA 4ID0A 4KF9A 1TRVA 3FZ5A 2C0GA 2DBCA 5ECSA 1FG4A 3GRXA 3A2XA 3VWUA 19GSA 2VLVA 2O85A 4A5PA 5BMUA 4MF7A 1SL1B 2P0GA 13GSA 4DEJA 1GSYA 2EIRA 4ZXGA 4ECCA 4MA9A 3OR5A 5DQSA 3EYTA 1W89A 2IPAA 5G5EA 2L6CA 2OE3A 1EV4A 4AJ7A 3IV4A 4EE0A 2G2QA 4MF5A 2GZZA 3N5OA 1H75A 5KN3A 5C04A 2HSMA 3IA1A 4HZ2A 1GSEA 1ZYPA 3RPNA 3HHVA 1T8EB 4MP4A 2OADA 2VAFA 3HVXA 4Q5NA 1XW5A 1YEPA 1ZZYA 5DJLA 1XWKA 4KA0A 4O5QA 5IMFA 1TI3A 1FVJA 2L4QA 1SYXA 2GDRA 1AQVA 2TRCP 2JL4A 1Z7RA 2B6MA 4XRAA 2B7JA 4K2DA 3MWHA 4NMUA 2OE1A 2GT5A 2H1GA 4K1FA 1M2BA 4Z2UA 2VL9A 5CP1A 3VPQA 3EU3A 4BL7B 2QA1A 3RHCA 22GSA 3NZNA 5D73A 4MLYA 1ZYQB 3LXTA 1B8XA 4OCEA 4I6XA 4N0ZA 3DVXA 3ME8A 4JE1A 4IGJA 1SKRB 2GQKA 3GYKA 2FA8A 1V58A 3UL3A 5D9VA 3RAZA 5IMZA 5HR1A 4WEYA 1SL0B 3GH6A 2R0CA 2CVDA 1YJ6A 4J57E 1PX6A 1R4WA 5J41A 5AISA 3GL5A 4LL1B 1B9YC 3WT2A 3IC8A 2IJYA 3TCOA 1AXDA 2FUG2 5CRWA 5D9WA 2IMKA 3UEMA 3HJMA 5AIVA 1WOUA 1PL1A 2H66A 5DAKB 14GSA 4TR3A 3CXGA 2VCQA 4DSSA 2H1DA 5HR3A 1SK2A 2LNTA 2LJRA 2CV4A 4EIPA 1LBKA 1NM3A 1NSWA 3Q74A 2FWGA 3EE2A 2GSRA 1JZDA 3ZTLA 4O5RA 1HNBA 3G7IA 4P3YB 2VD1A 4BVYA 2KLXA 5GSSA 3F63A 3UVHA 1ERWA 3CRTA 4YKFA 2O87A 4IQ1A 3UARA 2BMXA 4IS0A 1FB0A 3GKNA 4ZBAA 3D21A 4BA7A 1YF1A 5EPFA 1WE0A 2CZ2A 2GGTA 3LJRA 2H75A 2CAQA 2L57A 1K3LA 4N10A 4WF5A 4HU7A 5JCGA 1K3OA 1XBSA 4ICYA 1UC7A 1MDKA 2OBIA 5INYA 2VCWA 3A2VA 1PN9A 5KN2A 3KH9A 2FA4A 4G0KA 1GUMA 2LSTA 3KD0A 1GP1A 3IAS2 2KOKA 1SKWB 1FOHA 4KSOA 2BTOT 4RUVA 3DWVA 3KP9A 3BCIA 4KDUA 2E0QA 1X5CA 2B5YA 2R37A 1J0FA 1T4YA 3CRUA 2HE3A 5FHIA 1DE1A 2NTOA 4GSTA 4DSRA 2K18A 5J9CA 3KMNA 4GTUA 2HXKA 4K9ZA 2VCTA 3DVWA 2LNSA 2H70A 2KHPA 4X43A 2Z9SA 2VO4A 5LD0A 4K8MA 1VGLA 1HYUA 2MMAA 1LJRA 1TJDA 1TRSA 2CAIA 2VL2A 3VWVA 3PR8A 1BAYA 2DJ3A 1U6TA 3I9V2 1XWGA 4K7IA 5G30A 4IVFA 1FHEA 1M7TA 1M2DA 1KBNA 1B4PA 18GSA 1A2LA 1GL8A 2WGRA 4PQ1A 3F0IA 2F8AA 3O6TA 1T3BA 3LORA 5DDLA 4MPGA 2H01A 4EC0A 1V40A 2X8CA 4HEA2 3ZRDA 1I5GA 6GSUA 1EGRA 4MZBA 2IIYA 3FR6A 4H86A 1FO5A 3LG6A 1SD9A 4WBRD 4DSSB 1J9BA 1WWJA 2GLRA 3DGQA 4LA1A 4MK3A 1T00A 1VF4A 3E3EA 2YV9A 4ZB9A 1Y6EA 3PINA 4MZCA 1QUWA 2YJHA 4MZWA 1O85A 4IN0A 4BIKA 5DVBA 4XS1A 5ABRA 1SENA 1TK0B 5D9XA 1RQMA 1QMVA 3IXRA 5HR2A 2AB6A 2H76A 1TOFA 1M2AA 1EOHA 2JADA 1DE2A 3LWAA 5CRHA 4AF2A 2C0DA 2N5AA 2WULA 2R5GA 3L9VA 2E2GA 1GWCA 8GSSA 1SYRA 1EWXA 4JRRA 2F51A 1X5DA 3A3TA 3ZL5A 2YWIA 4OO4A 1T1VA 1M3JA 2IL3A 2LRNA 3ZIJA 2I1UA 4K5RA 2H6YA 3ISOA 3GH9A 1OKDA 3J7Yb 4MH2A 4IBPA 1A2MA 3HVVA 1X9MB 1OAZA 2J9HA 2YPMA 4I2UA 4LMVA 1E6BA 2H19A 3FR9A 1TK8B 1V98A 5G2ZA 3Q19A 3H8QA 3GSTA 3IOSA 2OA7A 3LXZA 2GVPA 2A4HA 3KCMA 4KB3A 3UVTA 4O92A 1DBYA 2R4VA 1OC8A 2F9SA 3TKQA 3F9UA 3FMWA 2WS2A 3ZLPA 2CX4A 2H1BA 3ZZXA 1PD21 2JZSA 3TDGA 3D4MA 1S3AA 4OCFA 2LQQA 3AY8A 3HJOA 4PQHA 2VIMA 4TR1B 3CSHA 2JACA 2GSTA 1GLQA 1QQ2A 1GTIA 1YEXA 2I81A 4N30A 5H5SA 1K0NA 3SBCA 2GT6A 4CW9A 4K7NA 4KX4A 4IJ3A 3P2AA 2FWFA 5F07A 4PGTA 2O7KA 1XW9A 2LTKA 4X4JA 2EIQA 2LEGA 3CYNA 1ZOFA 4BPYA 3C7MA 2KP2A 2G0FA 5G31A 5A4UA 3G7JA 4HSCX 4POBA 1A23A 2HRKA 3LQ7A 4MJEA 1EP7A 3KEBA 2JU5A 3WGDA 1PN0A 2FLSA 2ON7A 2F3MA 2AUVA 1NHOA 3KH7A 2B7KA 1ZL9A 3ZMLA 1WRYA 1GNEA 3KJYA 4KAEA 1KTEA 1AIUA 3W6GA 4TR0A 4HUAA 1ZYEA 1NHYA 2J23A 5DAKA 3TUEA 1GTUA 3FW2A 1GUKA 1GSSA 1GTAA 4I97A 2A2SA 2C0FA 3APOA 4EUYA 2DLXA 3W8SA 1PSQA 1OVNA 4KH7A 2YOIA 4EDZA 3FKFA 2YNXA 5ECPB 2MMNA 5A5KA 1U87A 11GSA 1TI1A 1ON4A 3IRAA 3QD9A 3EC3A 5EL8A 1TU8A 1Z6MA 2LKUA 3TRPA 2CA8A 4FYCA 5JWRB 1K0MA 4TN8A 4XCSA 3U5RE 1MDJA 3MYDA 4F03A 5CAXA 4I5QA 3ERWA 4PUFC 6GSVA 5KEJA 4K5SA 5IOWA 2H0GA 3APSA 2IN3A 2DJ2A 2RM6A 2H30A 2VD0A 3C73A 5LCZA 3BJ5A 3TJBA 5LNKe 1W4VA 1X9WB 1QXHA 1FB6A 2M80A 3F6DA 3UJ1A 2GQLA 4WKWA 2GTUA 5GSTA 1B9XC 3CSJA 5GAPD 1GH2A 2DJKA 6GSXA 1K0DA 1JZRA 1KNGA 1O81A 4GXZA 3HYPA 3RBTA 3SWLA 3PPUA 4F0BA 3DD3A 1AC1A 4XS4A 3QPMA 1T7PB 3GV1A 1O7UA 1ERUA 2VOCA 4J56E 4USSA 2PMTA 3F4RA 3EURA 2AHEA 5B8AA 4HQSA 3P8WA 3CQFA 5CREA 5C00A 2DKIA 4ZB6A 1Z3EA 4QL9A 4EIQA 1BYEA 3IE3A 1UN2A 1VF2A 3EMPA 4BVXB 3TOTA 2L4CA 2FCHA 6GSYA 2DMLA 1EGOA 3TGZA 4ML6A 3IDVA 1TTZA 3GN3A 1XWAA 3GURA 2GZYA 4X1UA 3GHAA 3TJKA 2PBJA 5DCGA 2WRTA 5J9BA 3FR3A 4PTSA 3DKSA 4CHSA 1AQXA 2P5RA 3VI5A 4NHWA 1ZYNA 4MNNA 3H1NA 4FQUA 4BWSA 4YQUA 1WP0A 5B7CA 3C1RA 3GKMA 5DQYA 2P31A 2WJUA 2MBTA 3M1GA 3PH9A 2LRTA 1JZOA 2B5XA 2I9HA 4V1Ag 1XOBA 4FIWA 1QGVA 4RQRA 3KZQA 5H5QA 4OMVA 4XRDA 5F0GA 2K9FA 4ZBDA 3KTLA 2LRCA 1JHBA 4IP1A 2ZUPA 4GWRA 3UBKA 3IHQA 1XIYA 2VCZA 4OFNA 2ON5A 1Q4JA 5HFIA 1B48A 1AAZA 2I3YA 1GUHA 4F0CA 4J2FA 2HRFA 3VWWA 1OKTA 2ZNMA 4TKYA 3IPZA 4OFMA 4IP6A 3VFIA 3N9JA 1SJZA 5KOWA 3Q18A 4E8EA 1Z7PA 5D96A 1XZOA 2QKEA 2ZCTA 4MPFA 3UAPA 2MMOA 4Q5QA 1QK8A 3GX8A 4HJMA 5JWQB 3DRNA 4IELA 5IMVA 1M99A 5A4WA 4CY6A 3JCML 3BOAA 2VCVA 3KTBA 4XS4B 5J5NA 1URMA 1XVQA 3HA9A 1RW1A 4KNDA 5IO2A 2QGVA 2REMA 1SU9A 5IM9A 1R26A 4HS1A 1V57A 2HFDA 2HNLA 2OKAA 4V1Ap 1OE7A 6GSWA 3FZ4A 2B1LA 2XHFA 3GSSA 4TR1A 4KE3A 2AV4A 3DIEA 1XWBA 2A2PA 2H1AA 1FOVA 1PL2A 2E2MA 5BRTA 1EEMA 3ZVJA 4ACSA 3A2WA 4ZL9A 2WB9A 1K0AA 4N11A 3HZ8A 1F6MC 2DJ1A 3ZYWA 3KM6A 2HI7A 3L9SA 4QL7A 2HT9A 5HFKA 2V41A 3UOMA 4ZBBA 4L0UA 4F2IA 5IO0A 1UA5A 4YQVA 3F4SA 1VF3A 2JSYA 5IMAA 3R3EA 1R5AA 3V1WA 3FHKA 3EU4A 3C8EA 2RUFA 1ERVA 2R0PA 3GL3A 5ECLB 4G0LA 3TKSE 5DCHA 5G1KA 4WXTA 5KN0A 7GSSA 4ZILA 1VF1A 4EF0A 4MH3A 5ELAA 2IMEA 1ML6A 1SK1A 2DC5A 4F82A 3LYKA 3C1SA 20GSA 3HCZA 4HJ2A 3TKSA 5IQYA 5EY6A 2FGXA 4CY8A 1IYIA 2HYXA 2YZUA 4JBBA 3IBHA 5HFGA 2PN8A 1A8YA 3ZIVA 5IMDA 2VL3A 4EKZA 4GSSA 3M0FA 3MIXA 5KN1A 1F3AA 5DALB 2C80A 1EZKA 1TDIA 1O8XA 3Q6OA 4GSNA 4YAPA 3FZ9A 3ZFLA 1GRXA 4K7OA 5B8BA 1FAAA 1V2AA 4N0VA 2WZ9A 3US3A 2N5BA 5GAND 4Q5RA 1TRUA 1A24A 3S9FA 1OC9A 2V6OA 4HI7A 4PXOA 3CMIA 2UZ8A 3FEUA 3ERGA 4O7HA 4ULXA 2H6XA 1WPIA 1A2JA 4MDCA 4GF0A 2NPBA 4BWQA 1HNAA 1ZMAA 2V32A 1OYJA 1MEKA 1U88A 1SJ6A 2IFQB 3L4NA 4OD7A 2OJLA 4POMA 4TRXA 4WBJA 4TXVA 3WGXA 2L5OA 1M9BA 4WR4A 1XWCA 1X9SB 1ACVA 1CQGA 4PNFA 1HNCA 2FNOA 4WR5A 2PVQA 3KMOA 4LLRA 2C4JA 1YDKA 2XBQA 1PKZA 2OACA 5ENUA 1BX9A 1XW6A 4ZB8A 1M0UA 1A0RP 2QC7A 2RM5A 2VCXA 3EWLA 1S3RA 2RLIA 1GSQA 3E0UA 4AJ8A 1C72A 3UBLA 2MZCA 1R7HA 17GSA 2H0HA 4LMWA 4G10A 5ECKB 2DJJA 2C3TA 4G2EA 4BVXA 1MDIA 1PKWA 2N5FA 2FD3A 4XIHA 3M8NA 1ERTA 2VM1A 2X99A 1PX7A 4CDOA 4OFTA 5EVOA 2VM2A 3VK9A 3GX0A 1WJKA 1GULA 3FZAA 4IW9A 2LJKA 4NHZA 3U6VA 16GSA 4V2MA 2DIYA 4V2LA 3IC4A 4POLA 1F2EA 3BCKA 4XTSA 1IYHA 2K8SA 2D2ZA 3QAWA 4K0NA 2C1YA 3EVIA 2X8GA 1YKAA 2OE0A 2PUKC 4PURA 5KOXA 3LSZA 2M72A 2YANA 2L6DA 1X5EA 5E59A 2V6KA 2RUEA 4L8EA 2HSHA 1GSDA 1U3AA 2CQ9A 1XVWA 4YKGA 2P5QA 2AJQB 3HKRA 1BG5A 1Z6NA 2MMZA 2BJXA 2M46A 2H8LA 3PGTA 2V1MA 1AUCA 3D0ZA 3F4TA 1BEDA 1GNWA 2HSYA 2LUSA 4OO5A 1F9MA 2KP1A 1NW2A 4KCAA 3D5JA 5ECRB 1OC9B 1N2AA 3HVNA 4IJIA 1XG8A 1JLVA 1Y25A 1LU4A 5F05A 3HJPA 2C0EA 5F06A 3TJGA 5GZZB 1TKDB 1K0CA 1T4ZA 5IMCA 3G9BA 3FY7A 4GLTA 2GSQA 2IWTA 5ELGA 2K6VA 1B4QA 4QQ7A 1E2YA 4RI7A 4MJCA 1EOGA 1EP8A 3MDKA 1XXUA 3TJFA 3GIXA 1N8JA 3KIJA 4D73B 6GSSA 1SD8A 4GQFA 3MNGA 1ILOA 5DJMA 1Z5YE 4YH2A 2HZEA 2X4AA 3M9JA 4FYUA 5H5RA 2A2RA 2R6KA 1U3IA 4L5OA 2FWHA 3VURA 1G7EA 3A5WA 1XOAA 2H71A 1K0OA 4PX1A 2R3XA 4X0XA 4FH8A 1GSFA 4NPBA 2R2JA 4IKHA 5A4VA 5J4UA 3APQA 1THOA 5ECMB 2CVKA 4YAVA 4TOPA 4RI6A 4AGSA 5ECQB 5D8IA 4ILFA 3WT1A 3CSIA 5DBQA 3HY2A 4KDYA 5B6MA 3ZREA 2TRXA 3HVSA 3L9UA 3UIWA 4EDYA 4E8HA 4LL4B 4FO5A 2XPDA 3BBYA 5JWOB 3LEFA 2YJ7A 2QA2A 4TXOA 1ZCPA 4WETA 3HD5A 4GCIA 2LJAA 1CQHA 4WF4A 3GUSA 4TVEA 2NBSA 3ZVJD 2K8VA 2ALBA 2DJ0A 3KP8A 2JZTA 3VLNA 1PFOA 3M9KA 1AW9A 1PQNA 5J3RA 4MCUA 2YZHA 3DMLA 5CNWA 1UVZA 4PUAA 3GNJA 4Q5FA 2VL2C 2O89A 4F9ZA 3QCPA 2YWOA 4O5UA 3IR4A 1TXXA 5CO3A 2YWNA 1FVKA 3KXOA 3L0HA 4IHUA 4G9HA 1DUGA 1HQOA 4O32A 5DALA 2EIOA 2IMDA 4TR4A 1ZGNA 1S3DA 1XFLA 2H73A 5E4WA 5G1LA 4NV2A 4I8BA 5AGYA 1MD3A 3LW9A 10GSA 2NVLA 1XCCA 1SJIA 4PNGA 1MD4A 2E7PA 4KCEA 1K0BA 1JZWA 5JCWA 1AQWA 5IOXA 2H6ZA 4AJ6A 3VI7A 4YQMA 3UMAA 3HDCA 2PPTA 4DSQA 3RHBA 3IAM2 4MF6A 5G5FA 4K2XA 2XBIA 4NWYA 5B6NA 2F8FA 2IFQA 4MMMA 2XPEA 2WFCA 3M3MA 3TKSC 2HZEB 2B3SA 3NIVA 2VLUA 4MABA 1GTBA 3D22A 3A5IA 5JCUA 2X8HA 3VPTA 3DXBA 3TRXA 5CRDA 2DKHA 3GTUA 5HQPA 1K3YA 3DEXA 2CZ3A 5FT3A 3TKPA 1S3CA 1SL2B 2HZFA 3IK9A 1G7OA 4NV5A 2EC4A 4HU9A 3ZFBA 3GKKA 4KGIA 1SK0A 2QSIA 4IQAA 2OBKA 4Z7XA 3FK8A 4XS6A 2DMMA 2CT6A 1TU7A 3GFKA 4I2TA 3ED3A 4FYBA 1GLPA 4K0GA 2YP6A 2XC2A 3K8NA 4HOJA 4RQXA 4ML1A 3H93A 4ECIA 3HZ4A 3ME7A 2MBSA 4KSMA 4L0WA 3QFBC 2FY6A 3QAVA 4TXOB 2X64A 4TW5A 3GMFA 3O76A 2I4AA 1TK5B 1HD2A 1Z9HA 2GQMA 1F3BA 1TW9A 3H79A 2RIIA 4K6XA 4ZL8A 5IIZA 4ECBA 5FWGA 2HLSA 4NXIA 2C3QA 1V9WA 3GKXA 1EEJA 3HXSA 5HR0A 3CTFA 4ZIJA 2GSSA 1TRWA 3F3RA 4NAXA 1TP9A 4MJAA 1DSBA 4DVCA 1J08A 3GA4A 3FYGA 3I43A 3TJJA 3NOFA 2GS3A 3I6AA 1WMJA 3LFLA 12GSA 1USBA 3MAKA 2TIRA 2DIZA 2KUCA 3I69A 3C71A 1YY7A 4ECJA 4BVYB 5ID2A 5L71A 3QAGA 1MTCA 4HZ4A 4GRFA 1X0RA 1H4OA 3J7Yk 4KUNA 1O8WA 1OC3A 3R2QA 1PA3A 1JFUA 5CRGA 4Z2RA 1G0TA 3E9JB 1I9DA 2C8UA 3LGCA 4EL1A 2YN1A 4XHMA 2B1KA 1YF0A 3MSZA 3P90A 2H72A 2WDUA 5ECIB 3ZMKA 1KEBA 2JSZA 1RK4A 1FW1A 9GSSA 2DSAA 4ZL7A 1F37A 1O73A 2O8VB 1JLWA 3EMXA 3LYPA 2AYTA 1YQ1A 3QMXA 5AN1A 1SKSB 4D73A 2CVBA 2V2GA 2WCIA 2VUPA 3CBUA 1M9AA 3GTUB 3TB2A 2R0GA 1YKCA 3QOUA 5ECHB 1A0FA 5D9TA 1M3IA 3VWXA 4EVMA 3L78A 2H0IA 3EINA 2NDOA 4JR6A 3H4KA 3ZITA 3TRQA 3IHGA 5CYYA 1QFNA 2B5EA 5IPGA 3D4TA 3WGEA 2LV3A 2HRAA 1R5PA 3WD6A 1G6YA 1THXA 3QR6A 3IK7A 5F8BA 4L5LA 6GSTA 2JZRA 4EXJA 4HQZA 1PGTA 4BL7A 2YWMA 5AIXA 1PRXA 1BJXA 4JEDA 1VRSD 4GQCA 3F8UA 4PQIA 1G6WA 3CTGA 4POKA 2L5LA 3DYRA 2IMFA 3F6FA 2X49A 1YZXA 1A8LA 4Z2TA 2L59A 2PERA 4EO3A 5IPHA 3QFAC 2VLTA 3ERFA
chains in the Genus database with same CATH topology
2A4VA 2YCDA 4G0IA 2YV7A 2LS5A 2IMIA 4JU5A 2PGTA 2FHEA 3QDNA 1OE8A 2HRNA 3FRCA 3O3TA 4JZQA 3RDWA 1BQ7A 3BD2A 3F3QA 2LQOA 5ECOB 4V2NA 2ES7A 2AAWA 3EPTA 1ABAA 1GSUA 4KW6A 3W8JA 2PU9C 4OWYA 1ST9A 1WIKA 4KDXA 2H74A 3TOUA 1XPVA 3RPPA 2PVOC 3P7XA 1O6JA 4G19A 5ID2B 1Q98A 2C3NA 3TKRA 2GZPA 1EV9A 4JR4A 3WYWA 3KGKA 5COHA 5ECNB 4ISDA 3G7YA 4MJBA 5D93A 3D6IA 4HDEA 2PWJA 2CX3A 1PMTA 2FWEA 2MYGA 4ID0A 4KF9A 1TRVA 3FZ5A 2C0GA 2DBCA 5ECSA 1FG4A 3GRXA 3A2XA 3VWUA 19GSA 2VLVA 2O85A 4A5PA 5BMUA 4MF7A 1SL1B 2P0GA 13GSA 4DEJA 1GSYA 2EIRA 4ZXGA 4ECCA 4MA9A 3OR5A 5DQSA 3EYTA 1W89A 2IPAA 5G5EA 2L6CA 2OE3A 1EV4A 4AJ7A 3IV4A 4EE0A 2G2QA 4MF5A 2GZZA 3N5OA 1H75A 5KN3A 5C04A 2HSMA 3IA1A 4HZ2A 1GSEA 1ZYPA 3RPNA 3HHVA 1T8EB 4MP4A 2OADA 2VAFA 3HVXA 4Q5NA 1XW5A 1YEPA 1ZZYA 5DJLA 1XWKA 4KA0A 4O5QA 5IMFA 1TI3A 1FVJA 2L4QA 1SYXA 2GDRA 1AQVA 2TRCP 2JL4A 1Z7RA 2B6MA 4XRAA 2B7JA 4K2DA 3MWHA 4NMUA 2OE1A 2GT5A 2H1GA 4K1FA 1M2BA 4Z2UA 2VL9A 5CP1A 3VPQA 3EU3A 4BL7B 2QA1A 3RHCA 22GSA 3NZNA 5D73A 4MLYA 1ZYQB 3LXTA 1B8XA 4OCEA 4I6XA 4N0ZA 3DVXA 3ME8A 4JE1A 4IGJA 1SKRB 2GQKA 3GYKA 2FA8A 1V58A 3UL3A 5D9VA 3RAZA 5IMZA 5HR1A 4WEYA 1SL0B 3GH6A 2R0CA 2CVDA 1YJ6A 4J57E 1PX6A 1R4WA 5J41A 5AISA 3GL5A 4LL1B 1B9YC 3WT2A 3IC8A 2IJYA 3TCOA 1AXDA 2FUG2 5CRWA 5D9WA 2IMKA 3UEMA 3HJMA 5AIVA 1WOUA 1PL1A 2H66A 5DAKB 14GSA 4TR3A 3CXGA 2VCQA 4DSSA 2H1DA 5HR3A 1SK2A 2LNTA 2LJRA 2CV4A 4EIPA 1LBKA 1NM3A 1NSWA 3Q74A 2FWGA 3EE2A 2GSRA 1JZDA 3ZTLA 4O5RA 1HNBA 3G7IA 4P3YB 2VD1A 4BVYA 2KLXA 5GSSA 3F63A 3UVHA 1ERWA 3CRTA 4YKFA 2O87A 4IQ1A 3UARA 2BMXA 4IS0A 1FB0A 3GKNA 4ZBAA 3D21A 4BA7A 1YF1A 5EPFA 1WE0A 2CZ2A 2GGTA 3LJRA 2H75A 2CAQA 2L57A 1K3LA 4N10A 4WF5A 4HU7A 5JCGA 1K3OA 1XBSA 4ICYA 1UC7A 1MDKA 2OBIA 5INYA 2VCWA 3A2VA 1PN9A 5KN2A 3KH9A 2FA4A 4G0KA 1GUMA 2LSTA 3KD0A 1GP1A 3IAS2 2KOKA 1SKWB 1FOHA 4KSOA 2BTOT 4RUVA 3DWVA 3KP9A 3BCIA 4KDUA 2E0QA 1X5CA 2B5YA 2R37A 1J0FA 1T4YA 3CRUA 2HE3A 5FHIA 1DE1A 2NTOA 4GSTA 4DSRA 2K18A 5J9CA 3KMNA 4GTUA 2HXKA 4K9ZA 2VCTA 3DVWA 2LNSA 2H70A 2KHPA 4X43A 2Z9SA 2VO4A 5LD0A 4K8MA 1VGLA 1HYUA 2MMAA 1LJRA 1TJDA 1TRSA 2CAIA 2VL2A 3VWVA 3PR8A 1BAYA 2DJ3A 1U6TA 3I9V2 1XWGA 4K7IA 5G30A 4IVFA 1FHEA 1M7TA 1M2DA 1KBNA 1B4PA 18GSA 1A2LA 1GL8A 2WGRA 4PQ1A 3F0IA 2F8AA 3O6TA 1T3BA 3LORA 5DDLA 4MPGA 2H01A 4EC0A 1V40A 2X8CA 4HEA2 3ZRDA 1I5GA 6GSUA 1EGRA 4MZBA 2IIYA 3FR6A 4H86A 1FO5A 3LG6A 1SD9A 4WBRD 4DSSB 1J9BA 1WWJA 2GLRA 3DGQA 4LA1A 4MK3A 1T00A 1VF4A 3E3EA 2YV9A 4ZB9A 1Y6EA 3PINA 4MZCA 1QUWA 2YJHA 4MZWA 1O85A 4IN0A 5DVBA 4XS1A 5ABRA 1SENA 1TK0B 5D9XA 1RQMA 1QMVA 3IXRA 5HR2A 2AB6A 2H76A 1TOFA 1M2AA 1EOHA 2JADA 1DE2A 3LWAA 5CRHA 4AF2A 2C0DA 2N5AA 2WULA 2R5GA 3L9VA 2E2GA 1GWCA 8GSSA 1SYRA 1EWXA 4JRRA 2F51A 1X5DA 3A3TA 3ZL5A 2YWIA 4OO4A 1T1VA 2IL3A 2LRNA 3ZIJA 2I1UA 4K5RA 2H6YA 3ISOA 3GH9A 1OKDA 3J7Yb 4MH2A 4IBPA 1A2MA 3HVVA 1X9MB 1OAZA 2J9HA 2YPMA 4I2UA 4LMVA 1E6BA 2H19A 3FR9A 1TK8B 1V98A 5G2ZA 3Q19A 3H8QA 3GSTA 3IOSA 2OA7A 3LXZA 2GVPA 2A4HA 3KCMA 4KB3A 3UVTA 4O92A 1DBYA 2R4VA 1OC8A 2F9SA 3TKQA 3F9UA 3FMWA 2WS2A 3ZLPA 2CX4A 2H1BA 3ZZXA 1PD21 2JZSA 3TDGA 3D4MA 1S3AA 4OCFA 2LQQA 3AY8A 3HJOA 4PQHA 2VIMA 4TR1B 3CSHA 2JACA 2GSTA 1GLQA 1QQ2A 1GTIA 1YEXA 2I81A 4N30A 5H5SA 1K0NA 3SBCA 2GT6A 4CW9A 4K7NA 4KX4A 4IJ3A 3P2AA 2FWFA 5F07A 4PGTA 2O7KA 1XW9A 2LTKA 4X4JA 2EIQA 2LEGA 3CYNA 1ZOFA 4BPYA 3C7MA 2KP2A 2G0FA 5G31A 5A4UA 3G7JA 4POBA 1A23A 2HRKA 3LQ7A 4MJEA 1EP7A 3KEBA 2JU5A 3WGDA 1PN0A 2FLSA 2ON7A 2F3MA 2AUVA 1NHOA 3KH7A 2B7KA 1ZL9A 3ZMLA 1WRYA 1GNEA 3KJYA 4KAEA 1KTEA 1AIUA 3W6GA 4TR0A 4HUAA 1ZYEA 1NHYA 2J23A 5DAKA 3TUEA 1GTUA 3FW2A 1GUKA 1GSSA 1GTAA 4I97A 2A2SA 2C0FA 3APOA 4EUYA 2DLXA 3W8SA 1PSQA 1OVNA 4KH7A 2YOIA 4EDZA 3FKFA 2YNXA 5ECPB 2MMNA 5A5KA 1U87A 11GSA 1TI1A 1ON4A 3IRAA 3QD9A 3EC3A 5EL8A 1TU8A 1Z6MA 2LKUA 3TRPA 2CA8A 4FYCA 5JWRB 1K0MA 4TN8A 4XCSA 3U5RE 1MDJA 3MYDA 4F03A 5CAXA 4I5QA 3ERWA 4PUFC 6GSVA 5KEJA 4K5SA 5IOWA 2H0GA 3APSA 2IN3A 2DJ2A 2RM6A 2H30A 2VD0A 3C73A 5LCZA 3BJ5A 3TJBA 5LNKe 1W4VA 1X9WB 1QXHA 1FB6A 2M80A 3F6DA 3UJ1A 2GQLA 4WKWA 2GTUA 5GSTA 1B9XC 3CSJA 5GAPD 1GH2A 2DJKA 6GSXA 1K0DA 1JZRA 1KNGA 1O81A 4GXZA 3HYPA 3RBTA 3SWLA 3PPUA 4F0BA 3DD3A 1AC1A 4XS4A 3QPMA 1T7PB 3GV1A 1O7UA 1ERUA 2VOCA 4J56E 4USSA 2PMTA 3F4RA 3EURA 2AHEA 5B8AA 4HQSA 3P8WA 5CREA 5C00A 2DKIA 4ZB6A 1Z3EA 4QL9A 4EIQA 1BYEA 3IE3A 1UN2A 1VF2A 3EMPA 4BVXB 3TOTA 2L4CA 2FCHA 6GSYA 2DMLA 1EGOA 3TGZA 4ML6A 3IDVA 1TTZA 3GN3A 1XWAA 3GURA 2GZYA 4X1UA 3GHAA 3TJKA 2PBJA 5DCGA 2WRTA 5J9BA 3FR3A 4PTSA 3DKSA 4CHSA 1AQXA 2P5RA 3VI5A 4NHWA 1ZYNA 4MNNA 3H1NA 4FQUA 4BWSA 4YQUA 1WP0A 5B7CA 3C1RA 3GKMA 5DQYA 2P31A 2WJUA 2MBTA 3M1GA 3PH9A 2LRTA 1JZOA 2B5XA 2I9HA 4V1Ag 1XOBA 4FIWA 1QGVA 4RQRA 3KZQA 5H5QA 4OMVA 4XRDA 5F0GA 2K9FA 4ZBDA 3KTLA 2LRCA 1JHBA 4IP1A 2ZUPA 4GWRA 3UBKA 3IHQA 1XIYA 2VCZA 4OFNA 2ON5A 1Q4JA 5HFIA 1B48A 1AAZA 2I3YA 1GUHA 4F0CA 4J2FA 2HRFA 3VWWA 1OKTA 2ZNMA 4TKYA 3IPZA 4OFMA 4IP6A 3VFIA 3N9JA 1SJZA 5KOWA 3Q18A 4E8EA 1Z7PA 5D96A 1XZOA 2QKEA 2ZCTA 4MPFA 3UAPA 2MMOA 4Q5QA 1QK8A 3GX8A 4HJMA 5JWQB 3DRNA 4IELA 5IMVA 1M99A 5A4WA 4CY6A 3JCML 3BOAA 2VCVA 3KTBA 4XS4B 5J5NA 1URMA 1XVQA 3HA9A 1RW1A 4KNDA 5IO2A 2QGVA 2REMA 1SU9A 5IM9A 1R26A 4HS1A 1V57A 2HFDA 2HNLA 2OKAA 4V1Ap 1OE7A 6GSWA 3FZ4A 2B1LA 2XHFA 3GSSA 4TR1A 4KE3A 2AV4A 3DIEA 1XWBA 2A2PA 2H1AA 1FOVA 1PL2A 2E2MA 5BRTA 1EEMA 3ZVJA 4ACSA 3A2WA 4ZL9A 2WB9A 1K0AA 4N11A 3HZ8A 1F6MC 2DJ1A 3ZYWA 3KM6A 2HI7A 3L9SA 4QL7A 2HT9A 5HFKA 2V41A 3UOMA 4ZBBA 4L0UA 4F2IA 5IO0A 1UA5A 4YQVA 3F4SA 1VF3A 2JSYA 5IMAA 3R3EA 1R5AA 3V1WA 3FHKA 3EU4A 3C8EA 2RUFA 1ERVA 2R0PA 3GL3A 5ECLB 4G0LA 3TKSE 5DCHA 5G1KA 4WXTA 5KN0A 7GSSA 4ZILA 1VF1A 4EF0A 4MH3A 5ELAA 2IMEA 1ML6A 1SK1A 2DC5A 4F82A 3LYKA 3C1SA 20GSA 3HCZA 4HJ2A 3TKSA 5IQYA 5EY6A 2FGXA 4CY8A 1IYIA 2HYXA 2YZUA 4JBBA 3IBHA 5HFGA 2PN8A 1A8YA 3ZIVA 5IMDA 2VL3A 4EKZA 4GSSA 3M0FA 3MIXA 5KN1A 1F3AA 5DALB 2C80A 1EZKA 1TDIA 1O8XA 3Q6OA 4GSNA 4YAPA 3FZ9A 3ZFLA 1GRXA 4K7OA 5B8BA 1FAAA 1V2AA 4N0VA 2WZ9A 3US3A 2N5BA 5GAND 4Q5RA 1TRUA 1A24A 3S9FA 1OC9A 2V6OA 4HI7A 4PXOA 3CMIA 2UZ8A 3FEUA 3ERGA 4O7HA 4ULXA 2H6XA 1WPIA 1A2JA 4MDCA 4GF0A 2NPBA 4BWQA 1HNAA 1ZMAA 2V32A 1OYJA 1MEKA 1U88A 1SJ6A 2IFQB 3L4NA 4OD7A 2OJLA 4POMA 4TRXA 4WBJA 4TXVA 3WGXA 2L5OA 1M9BA 4WR4A 1XWCA 1X9SB 1ACVA 1CQGA 4PNFA 1HNCA 2FNOA 4WR5A 2PVQA 3KMOA 4LLRA 2C4JA 1YDKA 2XBQA 1PKZA 2OACA 5ENUA 1BX9A 1XW6A 4ZB8A 1M0UA 1A0RP 2QC7A 2RM5A 2VCXA 3EWLA 2RLIA 1GSQA 3E0UA 4AJ8A 1C72A 3UBLA 2MZCA 1R7HA 17GSA 2H0HA 4LMWA 4G10A 5ECKB 2DJJA 2C3TA 4G2EA 4BVXA 1MDIA 1PKWA 2N5FA 2FD3A 4XIHA 3M8NA 1ERTA 2VM1A 2X99A 1PX7A 4CDOA 4OFTA 5EVOA 2VM2A 3VK9A 3GX0A 1WJKA 1GULA 3FZAA 4IW9A 2LJKA 4NHZA 3U6VA 16GSA 4V2MA 2DIYA 4V2LA 3IC4A 4POLA 1F2EA 3BCKA 4XTSA 1IYHA 2K8SA 2D2ZA 3QAWA 4K0NA 2C1YA 3EVIA 2X8GA 1YKAA 2OE0A 2PUKC 4PURA 5KOXA 3LSZA 2M72A 2YANA 2L6DA 1X5EA 5E59A 2V6KA 2RUEA 4L8EA 2HSHA 1GSDA 1U3AA 2CQ9A 1XVWA 4YKGA 2P5QA 2AJQB 3HKRA 1BG5A 1Z6NA 2MMZA 2BJXA 2M46A 2H8LA 3PGTA 2V1MA 1AUCA 3D0ZA 3F4TA 1BEDA 1GNWA 2HSYA 2LUSA 4OO5A 1F9MA 2KP1A 1NW2A 4KCAA 3D5JA 5ECRB 1OC9B 1N2AA 4IJIA 1JLVA 1Y25A 1LU4A 5F05A 3HJPA 2C0EA 5F06A 3TJGA 5GZZB 1TKDB 1K0CA 1T4ZA 5IMCA 3G9BA 3FY7A 4GLTA 2GSQA 2IWTA 5ELGA 2K6VA 1B4QA 4QQ7A 1E2YA 4RI7A 4MJCA 1EOGA 1EP8A 3MDKA 1XXUA 3TJFA 3GIXA 1N8JA 3KIJA 4D73B 6GSSA 1SD8A 4GQFA 3MNGA 1ILOA 5DJMA 1Z5YE 4YH2A 2HZEA 2X4AA 3M9JA 4FYUA 5H5RA 2A2RA 2R6KA 1U3IA 4L5OA 2FWHA 3VURA 1G7EA 3A5WA 1XOAA 2H71A 1K0OA 4PX1A 2R3XA 4X0XA 4FH8A 1GSFA 4NPBA 2R2JA 4IKHA 5A4VA 5J4UA 3APQA 1THOA 5ECMB 2CVKA 4YAVA 4TOPA 4RI6A 4AGSA 5ECQB 5D8IA 4ILFA 3WT1A 3CSIA 5DBQA 3HY2A 4KDYA 5B6MA 3ZREA 2TRXA 3HVSA 3L9UA 3UIWA 4EDYA 4E8HA 4LL4B 4FO5A 2XPDA 3BBYA 5JWOB 3LEFA 2YJ7A 2QA2A 4TXOA 1ZCPA 4WETA 3HD5A 4GCIA 2LJAA 1CQHA 4WF4A 3GUSA 4TVEA 2NBSA 3ZVJD 2K8VA 2ALBA 2DJ0A 3KP8A 2JZTA 3VLNA 3M9KA 1AW9A 1PQNA 5J3RA 4MCUA 2YZHA 3DMLA 5CNWA 1UVZA 4PUAA 3GNJA 4Q5FA 2VL2C 2O89A 4F9ZA 3QCPA 2YWOA 4O5UA 3IR4A 1TXXA 5CO3A 2YWNA 1FVKA 3KXOA 3L0HA 4IHUA 4G9HA 1DUGA 1HQOA 4O32A 5DALA 2EIOA 2IMDA 4TR4A 1ZGNA 1S3DA 1XFLA 2H73A 5E4WA 5G1LA 4NV2A 4I8BA 5AGYA 1MD3A 3LW9A 10GSA 2NVLA 1XCCA 1SJIA 4PNGA 1MD4A 2E7PA 4KCEA 1K0BA 1JZWA 5JCWA 1AQWA 5IOXA 2H6ZA 4AJ6A 3VI7A 4YQMA 3UMAA 3HDCA 2PPTA 4DSQA 3RHBA 3IAM2 4MF6A 5G5FA 4K2XA 2XBIA 4NWYA 5B6NA 2F8FA 2IFQA 4MMMA 2XPEA 2WFCA 3M3MA 3TKSC 2HZEB 2B3SA 3NIVA 2VLUA 4MABA 1GTBA 3D22A 3A5IA 5JCUA 2X8HA 3VPTA 3DXBA 3TRXA 5CRDA 2DKHA 3GTUA 5HQPA 1K3YA 3DEXA 2CZ3A 5FT3A 3TKPA 1S3CA 1SL2B 2HZFA 3IK9A 1G7OA 4NV5A 2EC4A 4HU9A 3ZFBA 3GKKA 4KGIA 1SK0A 2QSIA 4IQAA 2OBKA 4Z7XA 3FK8A 4XS6A 2DMMA 2CT6A 1TU7A 3GFKA 4I2TA 3ED3A 4FYBA 1GLPA 4K0GA 2YP6A 2XC2A 3K8NA 4HOJA 4RQXA 4ML1A 3H93A 4ECIA 3HZ4A 3ME7A 2MBSA 4KSMA 4L0WA 3QFBC 2FY6A 3QAVA 4TXOB 2X64A 4TW5A 3GMFA 3O76A 2I4AA 1TK5B 1HD2A 1Z9HA 2GQMA 1F3BA 1TW9A 3H79A 2RIIA 4K6XA 4ZL8A 5IIZA 4ECBA 5FWGA 2HLSA 4NXIA 2C3QA 1V9WA 3GKXA 1EEJA 3HXSA 5HR0A 3CTFA 4ZIJA 2GSSA 1TRWA 3F3RA 4NAXA 1TP9A 4MJAA 1DSBA 4DVCA 1J08A 3GA4A 3FYGA 3I43A 3TJJA 3NOFA 2GS3A 3I6AA 1WMJA 3LFLA 12GSA 1USBA 3MAKA 2TIRA 2DIZA 2KUCA 3I69A 3C71A 1YY7A 4ECJA 4BVYB 5ID2A 5L71A 3QAGA 1MTCA 4HZ4A 4GRFA 1X0RA 1H4OA 3J7Yk 4KUNA 1O8WA 1OC3A 3R2QA 1PA3A 1JFUA 5CRGA 4Z2RA 1G0TA 3E9JB 1I9DA 2C8UA 3LGCA 4EL1A 2YN1A 4XHMA 2B1KA 1YF0A 3MSZA 3P90A 2H72A 2WDUA 5ECIB 3ZMKA 1KEBA 2JSZA 1RK4A 1FW1A 9GSSA 2DSAA 4ZL7A 1F37A 1O73A 2O8VB 1JLWA 3EMXA 3LYPA 2AYTA 1YQ1A 3QMXA 5AN1A 1SKSB 4D73A 2CVBA 2V2GA 2WCIA 2VUPA 3CBUA 1M9AA 3GTUB 3TB2A 2R0GA 1YKCA 3QOUA 5ECHB 1A0FA 5D9TA 3VWXA 4EVMA 3L78A 2H0IA 3EINA 2NDOA 4JR6A 3H4KA 3ZITA 3TRQA 3IHGA 5CYYA 1QFNA 2B5EA 5IPGA 3D4TA 3WGEA 2LV3A 2HRAA 1R5PA 3WD6A 1G6YA 1THXA 3QR6A 3IK7A 5F8BA 4L5LA 6GSTA 2JZRA 4EXJA 4HQZA 1PGTA 4BL7A 2YWMA 5AIXA 1PRXA 1BJXA 4JEDA 1VRSD 4GQCA 3F8UA 4PQIA 1G6WA 3CTGA 4POKA 2L5LA 3DYRA 2IMFA 3F6FA 2X49A 1YZXA 1A8LA 4Z2TA 2L59A 2PERA 4EO3A 5IPHA 3QFAC 2VLTA 3ERFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4V A;  2YCD A;  2YV7 A;  2LS5 A;  2IMI A;  4JU5 A;  2PGT A;  2FHE A;  3QDN A;  1OE8 A;  2HRN A;  3FRC A;  3O3T A;  4JZQ A;  3RDW A;  1BQ7 A;  3BD2 A;  3F3Q A;  2LQO A;  5ECO B;  4V2N A;  2ES7 A;  2AAW A;  1ABA A;  1GSU A;  4KW6 A;  3W8J A;  2PU9 C;  4OWY A;  1ST9 A;  1WIK A;  4KDX A;  2H74 A;  3TOU A;  1XPV A;  3RPP A;  2PVO C;  3P7X A;  1O6J A;  4G19 A;  5ID2 B;  1Q98 A;  2C3N A;  3TKR A;  2GZP A;  1EV9 A;  4JR4 A;  3WYW A;  3KGK A;  5COH A;  5ECN B;  4ISD A;  3G7Y A;  4MJB A;  5D93 A;  3D6I A;  4HDE A;  2PWJ A;  2CX3 A;  1PMT A;  2FWE A;  2MYG A;  4ID0 A;  1TRV A;  3FZ5 A;  2C0G A;  2DBC A;  5ECS A;  1FG4 A;  3GRX A;  3A2X A;  3VWU A;  19GS A;  2VLV A;  2O85 A;  4MF7 A;  1SL1 B;  2P0G A;  13GS A;  4DEJ A;  1GSY A;  2EIR A;  4ZXG A;  4ECC A;  4MA9 A;  3OR5 A;  5DQS A;  3EYT A;  1W89 A;  2IPA A;  5G5E A;  2L6C A;  2OE3 A;  1EV4 A;  4AJ7 A;  3IV4 A;  4EE0 A;  2G2Q A;  4MF5 A;  2GZZ A;  3N5O A;  1H75 A;  5KN3 A;  5C04 A;  3IA1 A;  4HZ2 A;  1GSE A;  3RPN A;  3HHV A;  1T8E B;  4MP4 A;  2OAD A;  2VAF A;  3HVX A;  4Q5N A;  1XW5 A;  1YEP A;  1ZZY A;  5DJL A;  1XWK A;  4KA0 A;  5IMF A;  1TI3 A;  1FVJ A;  2L4Q A;  1SYX A;  2GDR A;  1AQV A;  2TRC P;  2JL4 A;  1Z7R A;  2B6M A;  4XRA A;  2B7J A;  4K2D A;  3MWH A;  4NMU A;  2OE1 A;  2GT5 A;  2H1G A;  4K1F A;  1M2B A;  2VL9 A;  5CP1 A;  3VPQ A;  3EU3 A;  3RHC A;  22GS A;  3NZN A;  5D73 A;  4MLY A;  1ZYQ B;  3LXT A;  1B8X A;  4OCE A;  4I6X A;  4N0Z A;  3DVX A;  3ME8 A;  4JE1 A;  4IGJ A;  1SKR B;  2GQK A;  3GYK A;  2FA8 A;  1V58 A;  3UL3 A;  5D9V A;  3RAZ A;  5IMZ A;  5HR1 A;  4WEY A;  1SL0 B;  3GH6 A;  2CVD A;  1YJ6 A;  4J57 E;  1PX6 A;  1R4W A;  5J41 A;  5AIS A;  3GL5 A;  4LL1 B;  1B9Y C;  3WT2 A;  2IJY A;  3TCO A;  1AXD A;  2FUG 2;  5CRW A;  5D9W A;  2IMK A;  3UEM A;  3HJM A;  5AIV A;  1WOU A;  1PL1 A;  2H66 A;  5DAK B;  14GS A;  4TR3 A;  3CXG A;  2VCQ A;  4DSS A;  2H1D A;  5HR3 A;  1SK2 A;  2LNT A;  2LJR A;  2CV4 A;  1LBK A;  1NM3 A;  1NSW A;  3Q74 A;  2FWG A;  3EE2 A;  2GSR A;  1JZD A;  3ZTL A;  4O5R A;  1HNB A;  3G7I A;  4P3Y B;  2VD1 A;  4BVY A;  2KLX A;  5GSS A;  3F63 A;  3UVH A;  1ERW A;  3CRT A;  2O87 A;  4IQ1 A;  3UAR A;  2BMX A;  4IS0 A;  1FB0 A;  3GKN A;  4ZBA A;  3D21 A;  4BA7 A;  1YF1 A;  5EPF A;  1WE0 A;  2CZ2 A;  2GGT A;  3LJR A;  2H75 A;  2CAQ A;  2L57 A;  1K3L A;  4N10 A;  4WF5 A;  4HU7 A;  5JCG A;  1K3O A;  1XBS A;  1UC7 A;  1MDK A;  2OBI A;  5INY A;  2VCW A;  3A2V A;  1PN9 A;  5KN2 A;  3KH9 A;  2FA4 A;  1GUM A;  2LST A;  3KD0 A;  1GP1 A;  3IAS 2;  2KOK A;  1SKW B;  4KSO A;  2BTO T;  4RUV A;  3DWV A;  3KP9 A;  3BCI A;  4KDU A;  2E0Q A;  1X5C A;  2B5Y A;  2R37 A;  1J0F A;  1T4Y A;  3CRU A;  2HE3 A;  5FHI A;  1DE1 A;  2NTO A;  4GST A;  4DSR A;  2K18 A;  5J9C A;  3KMN A;  4GTU A;  2HXK A;  4K9Z A;  2VCT A;  3DVW A;  2LNS A;  2H70 A;  2KHP A;  4X43 A;  2Z9S A;  2VO4 A;  5LD0 A;  4K8M A;  1VGL A;  1HYU A;  2MMA A;  1LJR A;  1TJD A;  1TRS A;  2CAI A;  2VL2 A;  3VWV A;  3PR8 A;  1BAY A;  2DJ3 A;  1U6T A;  3I9V 2;  1XWG A;  4K7I A;  5G30 A;  4IVF A;  1FHE A;  1M7T A;  1M2D A;  1KBN A;  1B4P A;  18GS A;  1A2L A;  1GL8 A;  2WGR A;  4PQ1 A;  3F0I A;  2F8A A;  3O6T A;  1T3B A;  3LOR A;  5DDL A;  4MPG A;  2H01 A;  4EC0 A;  1V40 A;  2X8C A;  4HEA 2;  3ZRD A;  1I5G A;  6GSU A;  1EGR A;  4MZB A;  2IIY A;  3FR6 A;  4H86 A;  1FO5 A;  3LG6 A;  1SD9 A;  4WBR D;  4DSS B;  1J9B A;  1WWJ A;  2GLR A;  3DGQ A;  4LA1 A;  4MK3 A;  1T00 A;  1VF4 A;  3E3E A;  2YV9 A;  4ZB9 A;  1Y6E A;  3PIN A;  4MZC A;  1QUW A;  2YJH A;  4MZW A;  1O85 A;  4IN0 A;  5DVB A;  4XS1 A;  5ABR A;  1SEN A;  1TK0 B;  5D9X A;  1RQM A;  1QMV A;  3IXR A;  5HR2 A;  2AB6 A;  2H76 A;  1TOF A;  1M2A A;  1EOH A;  2JAD A;  1DE2 A;  3LWA A;  5CRH A;  4AF2 A;  2C0D A;  2N5A A;  2WUL A;  2R5G A;  3L9V A;  2E2G A;  1GWC A;  8GSS A;  1SYR A;  1EWX A;  4JRR A;  2F51 A;  1X5D A;  3A3T A;  3ZL5 A;  2YWI A;  4OO4 A;  1T1V A;  2IL3 A;  2LRN A;  3ZIJ A;  2I1U A;  2H6Y A;  3ISO A;  3GH9 A;  1OKD A;  3J7Y b;  4MH2 A;  4IBP A;  1A2M A;  3HVV A;  1X9M B;  1OAZ A;  2J9H A;  2YPM A;  4I2U A;  4LMV A;  1E6B A;  2H19 A;  3FR9 A;  1TK8 B;  1V98 A;  5G2Z A;  3Q19 A;  3H8Q A;  3GST A;  3IOS A;  2OA7 A;  3LXZ A;  2GVP A;  3UVT A;  3KCM A;  4KB3 A;  4O92 A;  1DBY A;  2R4V A;  1OC8 A;  2F9S A;  3TKQ A;  3F9U A;  2WS2 A;  3ZLP A;  2CX4 A;  2H1B A;  3ZZX A;  1PD2 1;  2JZS A;  3TDG A;  3D4M A;  1S3A A;  4OCF A;  2LQQ A;  3AY8 A;  3HJO A;  4PQH A;  2VIM A;  4TR1 B;  3CSH A;  2JAC A;  2GST A;  1GLQ A;  1QQ2 A;  1GTI A;  1YEX A;  2I81 A;  4N30 A;  5H5S A;  1K0N A;  3SBC A;  2GT6 A;  4CW9 A;  4K7N A;  4KX4 A;  4IJ3 A;  3P2A A;  2FWF A;  5F07 A;  4PGT A;  2O7K A;  1XW9 A;  2LTK A;  2EIQ A;  2LEG A;  3CYN A;  1ZOF A;  4BPY A;  3C7M A;  2KP2 A;  2G0F A;  5G31 A;  5A4U A;  3G7J A;  4POB A;  1A23 A;  3LQ7 A;  4MJE A;  1EP7 A;  3KEB A;  2JU5 A;  3WGD A;  2FLS A;  2ON7 A;  2F3M A;  2AUV A;  1NHO A;  3KH7 A;  2B7K A;  1ZL9 A;  3ZML A;  1WRY A;  1GNE A;  3KJY A;  4KAE A;  1KTE A;  1AIU A;  3W6G A;  4TR0 A;  4HUA A;  1ZYE A;  1NHY A;  2J23 A;  5DAK A;  3TUE A;  1GTU A;  3FW2 A;  1GUK A;  1GSS A;  1GTA A;  4I97 A;  2A2S A;  2C0F A;  3APO A;  4EUY A;  2DLX A;  3W8S A;  1PSQ A;  1OVN A;  4KH7 A;  2YOI A;  4EDZ A;  3FKF A;  2YNX A;  5ECP B;  2MMN A;  5A5K A;  1U87 A;  11GS A;  1TI1 A;  1ON4 A;  3IRA A;  3QD9 A;  3EC3 A;  5EL8 A;  1TU8 A;  1Z6M A;  2LKU A;  3TRP A;  2CA8 A;  4FYC A;  5JWR B;  1K0M A;  4TN8 A;  4XCS A;  3U5R E;  1MDJ A;  4F03 A;  5CAX A;  4I5Q A;  3ERW A;  4PUF C;  6GSV A;  5KEJ A;  5IOW A;  2H0G A;  3APS A;  2IN3 A;  2DJ2 A;  2RM6 A;  2H30 A;  2VD0 A;  3C73 A;  5LCZ A;  3BJ5 A;  3TJB A;  5LNK e;  1W4V A;  1X9W B;  1QXH A;  1FB6 A;  2M80 A;  3F6D A;  3UJ1 A;  2GQL A;  4WKW A;  2GTU A;  5GST A;  1B9X C;  3CSJ A;  5GAP D;  1GH2 A;  2DJK A;  6GSX A;  1K0D A;  1JZR A;  1KNG A;  1O81 A;  4GXZ A;  3HYP A;  3RBT A;  3SWL A;  4F0B A;  3DD3 A;  1AC1 A;  4XS4 A;  3QPM A;  1T7P B;  3GV1 A;  1O7U A;  1ERU A;  2VOC A;  4J56 E;  2PMT A;  3F4R A;  3EUR A;  2AHE A;  5B8A A;  4HQS A;  3P8W A;  5CRE A;  5C00 A;  4ZB6 A;  1Z3E A;  4QL9 A;  1BYE A;  3IE3 A;  1UN2 A;  1VF2 A;  3EMP A;  3TOT A;  2L4C A;  2FCH A;  6GSY A;  2DML A;  1EGO A;  3TGZ A;  4ML6 A;  3IDV A;  1TTZ A;  3GN3 A;  1XWA A;  3GUR A;  2GZY A;  4X1U A;  3GHA A;  3TJK A;  2PBJ A;  5DCG A;  2WRT A;  5J9B A;  3FR3 A;  3DKS A;  4CHS A;  1AQX A;  2P5R A;  3VI5 A;  4NHW A;  3H1N A;  4BWS A;  4YQU A;  1WP0 A;  5B7C A;  3C1R A;  3GKM A;  5DQY A;  2P31 A;  2WJU A;  2MBT A;  3M1G A;  3PH9 A;  2LRT A;  1JZO A;  2B5X A;  2I9H A;  4V1A g;  1XOB A;  4FIW A;  1QGV A;  4RQR A;  3KZQ A;  5H5Q A;  4OMV A;  4XRD A;  5F0G A;  2K9F A;  4ZBD A;  3KTL A;  2LRC A;  1JHB A;  4IP1 A;  2ZUP A;  4GWR A;  3UBK A;  3IHQ A;  1XIY A;  2VCZ A;  4OFN A;  2ON5 A;  1Q4J A;  5HFI A;  1B48 A;  1AAZ A;  2I3Y A;  1GUH A;  4F0C A;  4J2F A;  2HRF A;  3VWW A;  1OKT A;  2ZNM A;  4TKY A;  3IPZ A;  4OFM A;  4IP6 A;  3VFI A;  3N9J A;  1SJZ A;  3Q18 A;  4E8E A;  1Z7P A;  5D96 A;  1XZO A;  2QKE A;  2ZCT A;  4MPF A;  3UAP A;  2MMO A;  4Q5Q A;  1QK8 A;  3GX8 A;  4HJM A;  5JWQ B;  3DRN A;  4IEL A;  5IMV A;  1M99 A;  5A4W A;  3JCM L;  3BOA A;  2VCV A;  3KTB A;  4XS4 B;  5J5N A;  1URM A;  1XVQ A;  3HA9 A;  1RW1 A;  4KND A;  5IO2 A;  2QGV A;  2REM A;  1SU9 A;  5IM9 A;  1R26 A;  4HS1 A;  1V57 A;  2HFD A;  2HNL A;  2OKA A;  4V1A p;  1OE7 A;  6GSW A;  3FZ4 A;  2B1L A;  2XHF A;  3GSS A;  4TR1 A;  4KE3 A;  2AV4 A;  3DIE A;  1XWB A;  2H1A A;  1FOV A;  1PL2 A;  2E2M A;  1EEM A;  3ZVJ A;  4ACS A;  3A2W A;  4ZL9 A;  2WB9 A;  1K0A A;  4N11 A;  3HZ8 A;  1F6M C;  2DJ1 A;  3ZYW A;  3KM6 A;  2HI7 A;  3L9S A;  4QL7 A;  2HT9 A;  5HFK A;  2V41 A;  3UOM A;  4ZBB A;  4L0U A;  4F2I A;  5IO0 A;  1UA5 A;  4YQV A;  3F4S A;  1VF3 A;  2JSY A;  5IMA A;  1R5A A;  3V1W A;  3FHK A;  3EU4 A;  3C8E A;  2RUF A;  1ERV A;  3GL3 A;  5ECL B;  3TKS E;  5DCH A;  5G1K A;  4WXT A;  5KN0 A;  7GSS A;  4ZIL A;  1VF1 A;  4EF0 A;  4MH3 A;  5ELA A;  2IME A;  1ML6 A;  1SK1 A;  2DC5 A;  4F82 A;  3LYK A;  3C1S A;  20GS A;  3HCZ A;  4HJ2 A;  3TKS A;  5IQY A;  5EY6 A;  2FGX A;  1IYI A;  2HYX A;  2YZU A;  4JBB A;  3IBH A;  5HFG A;  2PN8 A;  1A8Y A;  3ZIV A;  5IMD A;  2VL3 A;  4EKZ A;  4GSS A;  3M0F A;  5KN1 A;  1F3A A;  5DAL B;  2C80 A;  1EZK A;  1TDI A;  1O8X A;  3Q6O A;  4GSN A;  4YAP A;  3FZ9 A;  3ZFL A;  1GRX A;  4K7O A;  5B8B A;  1FAA A;  1V2A A;  4N0V A;  2WZ9 A;  3US3 A;  2N5B A;  5GAN D;  4Q5R A;  1TRU A;  1A24 A;  3S9F A;  1OC9 A;  2V6O A;  4HI7 A;  4PXO A;  3CMI A;  3FEU A;  3ERG A;  4O7H A;  4ULX A;  2H6X A;  1WPI A;  1A2J A;  4MDC A;  4GF0 A;  2NPB A;  4BWQ A;  1HNA A;  1ZMA A;  2V32 A;  1OYJ A;  1MEK A;  1U88 A;  1SJ6 A;  2IFQ B;  3L4N A;  4OD7 A;  2OJL A;  4POM A;  4TRX A;  4WBJ A;  4TXV A;  3WGX A;  2L5O A;  1M9B A;  4WR4 A;  1XWC A;  1X9S B;  1ACV A;  1CQG A;  4PNF A;  1HNC A;  2FNO A;  4WR5 A;  2PVQ A;  3KMO A;  4LLR A;  2C4J A;  1YDK A;  2XBQ A;  1PKZ A;  2OAC A;  5ENU A;  1BX9 A;  1XW6 A;  4ZB8 A;  1M0U A;  1A0R P;  2QC7 A;  2RM5 A;  2VCX A;  3EWL A;  2RLI A;  1GSQ A;  3E0U A;  4AJ8 A;  1C72 A;  3UBL A;  2MZC A;  1R7H A;  17GS A;  2H0H A;  4LMW A;  4G10 A;  5ECK B;  2DJJ A;  2C3T A;  4G2E A;  4BVX A;  1MDI A;  1PKW A;  2N5F A;  2FD3 A;  4XIH A;  3M8N A;  1ERT A;  2VM1 A;  2X99 A;  1PX7 A;  4CDO A;  4OFT A;  5EVO A;  2VM2 A;  3VK9 A;  3GX0 A;  1WJK A;  1GUL A;  3FZA A;  4IW9 A;  2LJK A;  4NHZ A;  3U6V A;  16GS A;  4V2M A;  2DIY A;  4V2L A;  3IC4 A;  4POL A;  1F2E A;  3BCK A;  4XTS A;  1IYH A;  2K8S A;  2D2Z A;  3QAW A;  4K0N A;  2C1Y A;  3EVI A;  2X8G A;  1YKA A;  2OE0 A;  2PUK C;  4PUR A;  3LSZ A;  2M72 A;  2YAN A;  2L6D A;  1X5E A;  5E59 A;  2V6K A;  2RUE A;  4L8E A;  2HSH A;  1GSD A;  1U3A A;  2CQ9 A;  1XVW A;  2P5Q A;  2AJQ B;  3HKR A;  1BG5 A;  1Z6N A;  2MMZ A;  2BJX A;  2M46 A;  2H8L A;  3PGT A;  2V1M A;  1AUC A;  3D0Z A;  3F4T A;  1BED A;  1GNW A;  2HSY A;  2LUS A;  4OO5 A;  1F9M A;  2KP1 A;  1NW2 A;  4KCA A;  3D5J A;  5ECR B;  1OC9 B;  1N2A A;  4IJI A;  1JLV A;  1Y25 A;  1LU4 A;  5F05 A;  3HJP A;  5F06 A;  2C0E A;  3TJG A;  5GZZ B;  1TKD B;  1K0C A;  1T4Z A;  5IMC A;  3G9B A;  3FY7 A;  4GLT A;  2GSQ A;  2IWT A;  5ELG A;  2K6V A;  1B4Q A;  4QQ7 A;  1E2Y A;  4RI7 A;  4MJC A;  1EOG A;  1EP8 A;  3MDK A;  1XXU A;  3TJF A;  3GIX A;  1N8J A;  3KIJ A;  4D73 B;  6GSS A;  1SD8 A;  4GQF A;  3MNG A;  1ILO A;  5DJM A;  1Z5Y E;  4YH2 A;  2HZE A;  3M9J A;  4FYU A;  5H5R A;  2A2R A;  2R6K A;  1U3I A;  4L5O A;  2FWH A;  3VUR A;  1G7E A;  3A5W A;  1XOA A;  2H71 A;  1K0O A;  4PX1 A;  2R3X A;  4X0X A;  4FH8 A;  1GSF A;  4NPB A;  2R2J A;  4IKH A;  5A4V A;  5J4U A;  3APQ A;  1THO A;  5ECM B;  2CVK A;  4YAV A;  4TOP A;  4RI6 A;  4AGS A;  5ECQ B;  5D8I A;  4ILF A;  3WT1 A;  3CSI A;  5DBQ A;  3HY2 A;  4KDY A;  5B6M A;  3ZRE A;  2TRX A;  3HVS A;  3L9U A;  3UIW A;  4EDY A;  4E8H A;  4LL4 B;  4FO5 A;  2XPD A;  3BBY A;  5JWO B;  3LEF A;  2YJ7 A;  4TXO A;  1ZCP A;  4WET A;  3HD5 A;  4GCI A;  2LJA A;  1CQH A;  4WF4 A;  3GUS A;  4TVE A;  2NBS A;  3ZVJ D;  2K8V A;  2ALB A;  2DJ0 A;  3KP8 A;  2JZT A;  3VLN A;  3M9K A;  1AW9 A;  1PQN A;  5J3R A;  4MCU A;  2YZH A;  3DML A;  5CNW A;  1UVZ A;  4PUA A;  3GNJ A;  4Q5F A;  2VL2 C;  2O89 A;  4F9Z A;  3QCP A;  2YWO A;  3IR4 A;  1TXX A;  5CO3 A;  2YWN A;  1FVK A;  3KXO A;  3L0H A;  4IHU A;  4G9H A;  1DUG A;  1HQO A;  4O32 A;  5DAL A;  2EIO A;  2IMD A;  4TR4 A;  1ZGN A;  1S3D A;  5E4W A;  1XFL A;  2H73 A;  5G1L A;  4NV2 A;  4I8B A;  5AGY A;  1MD3 A;  10GS A;  2NVL A;  1XCC A;  1SJI A;  4PNG A;  1MD4 A;  2E7P A;  4KCE A;  1K0B A;  1JZW A;  5JCW A;  1AQW A;  5IOX A;  2H6Z A;  4AJ6 A;  3VI7 A;  4YQM A;  3UMA A;  3HDC A;  2PPT A;  4DSQ A;  3RHB A;  3IAM 2;  4MF6 A;  5G5F A;  2XBI A;  4NWY A;  5B6N A;  2F8F A;  2IFQ A;  4MMM A;  2XPE A;  2WFC A;  3M3M A;  3TKS C;  2HZE B;  2B3S A;  3NIV A;  2VLU A;  4MAB A;  1GTB A;  3D22 A;  5JCU A;  2X8H A;  3VPT A;  3DXB A;  3TRX A;  5CRD A;  3GTU A;  5HQP A;  1K3Y A;  3DEX A;  2CZ3 A;  5FT3 A;  3TKP A;  1S3C A;  1SL2 B;  2HZF A;  3IK9 A;  1G7O A;  4NV5 A;  2EC4 A;  4HU9 A;  3ZFB A;  3GKK A;  4KGI A;  1SK0 A;  2QSI A;  4IQA A;  2OBK A;  4Z7X A;  3FK8 A;  4XS6 A;  2DMM A;  2CT6 A;  1TU7 A;  3GFK A;  4I2T A;  3ED3 A;  4FYB A;  1GLP A;  4K0G A;  2YP6 A;  2XC2 A;  3K8N A;  4HOJ A;  4RQX A;  4ML1 A;  3H93 A;  4ECI A;  3HZ4 A;  3ME7 A;  2MBS A;  4KSM A;  4L0W A;  3QFB C;  2FY6 A;  3QAV A;  4TXO B;  2X64 A;  4TW5 A;  3GMF A;  3O76 A;  2I4A A;  1TK5 B;  1HD2 A;  1Z9H A;  2GQM A;  1F3B A;  1TW9 A;  3H79 A;  2RII A;  4K6X A;  4ZL8 A;  5IIZ A;  4ECB A;  5FWG A;  2HLS A;  4NXI A;  2C3Q A;  1V9W A;  3GKX A;  1EEJ A;  3HXS A;  5HR0 A;  3CTF A;  4ZIJ A;  2GSS A;  1TRW A;  3F3R A;  4NAX A;  1TP9 A;  4MJA A;  1DSB A;  4DVC A;  1J08 A;  3GA4 A;  3FYG A;  3I43 A;  3TJJ A;  3NOF A;  2GS3 A;  3I6A A;  1WMJ A;  3LFL A;  12GS A;  1USB A;  3MAK A;  2TIR A;  2DIZ A;  2KUC A;  3I69 A;  3C71 A;  1YY7 A;  4ECJ A;  5ID2 A;  5L71 A;  3QAG A;  1MTC A;  4HZ4 A;  4GRF A;  1X0R A;  1H4O A;  3J7Y k;  4KUN A;  1O8W A;  1OC3 A;  3R2Q A;  1PA3 A;  1JFU A;  5CRG A;  1G0T A;  3E9J B;  1I9D A;  2C8U A;  3LGC A;  4EL1 A;  2YN1 A;  4XHM A;  2B1K A;  1YF0 A;  3MSZ A;  5ECI B;  2H72 A;  2WDU A;  3P90 A;  3ZMK A;  1KEB A;  2JSZ A;  1RK4 A;  1FW1 A;  9GSS A;  2DSA A;  4ZL7 A;  1F37 A;  1O73 A;  2O8V B;  1JLW A;  3EMX A;  3LYP A;  2AYT A;  1YQ1 A;  3QMX A;  5AN1 A;  1SKS B;  4D73 A;  2CVB A;  2V2G A;  2WCI A;  2VUP A;  3CBU A;  1M9A A;  3GTU B;  3TB2 A;  1YKC A;  3QOU A;  5ECH B;  1A0F A;  5D9T A;  3VWX A;  4EVM A;  3L78 A;  2H0I A;  3EIN A;  2NDO A;  4JR6 A;  3H4K A;  3ZIT A;  3TRQ A;  5CYY A;  1QFN A;  2B5E A;  5IPG A;  3D4T A;  3WGE A;  2LV3 A;  1R5P A;  3WD6 A;  1G6Y A;  1THX A;  3QR6 A;  3IK7 A;  5F8B A;  4L5L A;  6GST A;  2JZR A;  4EXJ A;  4HQZ A;  1PGT A;  4BL7 A;  2YWM A;  5AIX A;  1PRX A;  1BJX A;  4JED A;  1VRS D;  4GQC A;  3F8U A;  4PQI A;  1G6W A;  3CTG A;  4POK A;  2L5L A;  3DYR A;  2IMF A;  3F6F A;  1YZX A;  1A8L A;  2L59 A;  2PER A;  4EO3 A;  5IPH A;  3QFA C;  2VLT A;  3ERF A; 
#chains in the Genus database with same CATH topology
 2A4V A;  2YCD A;  4G0I A;  2YV7 A;  2LS5 A;  2IMI A;  4JU5 A;  2PGT A;  2FHE A;  3QDN A;  1OE8 A;  2HRN A;  3FRC A;  3O3T A;  4JZQ A;  3RDW A;  1BQ7 A;  3BD2 A;  3F3Q A;  2LQO A;  5ECO B;  4V2N A;  2ES7 A;  2AAW A;  3EPT A;  1ABA A;  1GSU A;  4KW6 A;  3W8J A;  2PU9 C;  4OWY A;  1ST9 A;  1WIK A;  4KDX A;  2H74 A;  3TOU A;  1XPV A;  3RPP A;  2PVO C;  3P7X A;  1O6J A;  4G19 A;  5ID2 B;  1Q98 A;  2C3N A;  3TKR A;  2GZP A;  1EV9 A;  4JR4 A;  3WYW A;  3KGK A;  5COH A;  5ECN B;  4ISD A;  3G7Y A;  4MJB A;  5D93 A;  3D6I A;  4HDE A;  2PWJ A;  2CX3 A;  1PMT A;  2FWE A;  2MYG A;  4ID0 A;  4KF9 A;  1TRV A;  3FZ5 A;  2C0G A;  2DBC A;  5ECS A;  1FG4 A;  3GRX A;  3A2X A;  3VWU A;  19GS A;  2VLV A;  2O85 A;  4A5P A;  5BMU A;  4MF7 A;  1SL1 B;  2P0G A;  13GS A;  4DEJ A;  1GSY A;  2EIR A;  4ZXG A;  4ECC A;  4MA9 A;  3OR5 A;  5DQS A;  3EYT A;  1W89 A;  2IPA A;  5G5E A;  2L6C A;  2OE3 A;  1EV4 A;  4AJ7 A;  3IV4 A;  4EE0 A;  2G2Q A;  4MF5 A;  2GZZ A;  3N5O A;  1H75 A;  5KN3 A;  5C04 A;  2HSM A;  3IA1 A;  4HZ2 A;  1GSE A;  1ZYP A;  3RPN A;  3HHV A;  1T8E B;  4MP4 A;  2OAD A;  2VAF A;  3HVX A;  4Q5N A;  1XW5 A;  1YEP A;  1ZZY A;  5DJL A;  1XWK A;  4KA0 A;  4O5Q A;  5IMF A;  1TI3 A;  1FVJ A;  2L4Q A;  1SYX A;  2GDR A;  1AQV A;  2TRC P;  2JL4 A;  1Z7R A;  2B6M A;  4XRA A;  2B7J A;  4K2D A;  3MWH A;  4NMU A;  2OE1 A;  2GT5 A;  2H1G A;  4K1F A;  1M2B A;  4Z2U A;  2VL9 A;  5CP1 A;  3VPQ A;  3EU3 A;  4BL7 B;  2QA1 A;  3RHC A;  22GS A;  3NZN A;  5D73 A;  4MLY A;  1ZYQ B;  3LXT A;  1B8X A;  4OCE A;  4I6X A;  4N0Z A;  3DVX A;  3ME8 A;  4JE1 A;  4IGJ A;  1SKR B;  2GQK A;  3GYK A;  2FA8 A;  1V58 A;  3UL3 A;  5D9V A;  3RAZ A;  5IMZ A;  5HR1 A;  4WEY A;  1SL0 B;  3GH6 A;  2R0C A;  2CVD A;  1YJ6 A;  4J57 E;  1PX6 A;  1R4W A;  5J41 A;  5AIS A;  3GL5 A;  4LL1 B;  1B9Y C;  3WT2 A;  3IC8 A;  2IJY A;  3TCO A;  1AXD A;  2FUG 2;  5CRW A;  5D9W A;  2IMK A;  3UEM A;  3HJM A;  5AIV A;  1WOU A;  1PL1 A;  2H66 A;  5DAK B;  14GS A;  4TR3 A;  3CXG A;  2VCQ A;  4DSS A;  2H1D A;  5HR3 A;  1SK2 A;  2LNT A;  2LJR A;  2CV4 A;  4EIP A;  1LBK A;  1NM3 A;  1NSW A;  3Q74 A;  2FWG A;  3EE2 A;  2GSR A;  1JZD A;  3ZTL A;  4O5R A;  1HNB A;  3G7I A;  4P3Y B;  2VD1 A;  4BVY A;  2KLX A;  5GSS A;  3F63 A;  3UVH A;  1ERW A;  3CRT A;  4YKF A;  2O87 A;  4IQ1 A;  3UAR A;  2BMX A;  4IS0 A;  1FB0 A;  3GKN A;  4ZBA A;  3D21 A;  4BA7 A;  1YF1 A;  5EPF A;  1WE0 A;  2CZ2 A;  2GGT A;  3LJR A;  2H75 A;  2CAQ A;  2L57 A;  1K3L A;  4N10 A;  4WF5 A;  4HU7 A;  5JCG A;  1K3O A;  1XBS A;  4ICY A;  1UC7 A;  1MDK A;  2OBI A;  5INY A;  2VCW A;  3A2V A;  1PN9 A;  5KN2 A;  3KH9 A;  2FA4 A;  4G0K A;  1GUM A;  2LST A;  3KD0 A;  1GP1 A;  3IAS 2;  2KOK A;  1SKW B;  1FOH A;  4KSO A;  2BTO T;  4RUV A;  3DWV A;  3KP9 A;  3BCI A;  4KDU A;  2E0Q A;  1X5C A;  2B5Y A;  2R37 A;  1J0F A;  1T4Y A;  3CRU A;  2HE3 A;  5FHI A;  1DE1 A;  2NTO A;  4GST A;  4DSR A;  2K18 A;  5J9C A;  3KMN A;  4GTU A;  2HXK A;  4K9Z A;  2VCT A;  3DVW A;  2LNS A;  2H70 A;  2KHP A;  4X43 A;  2Z9S A;  2VO4 A;  5LD0 A;  4K8M A;  1VGL A;  1HYU A;  2MMA A;  1LJR A;  1TJD A;  1TRS A;  2CAI A;  2VL2 A;  3VWV A;  3PR8 A;  1BAY A;  2DJ3 A;  1U6T A;  3I9V 2;  1XWG A;  4K7I A;  5G30 A;  4IVF A;  1FHE A;  1M7T A;  1M2D A;  1KBN A;  1B4P A;  18GS A;  1A2L A;  1GL8 A;  2WGR A;  4PQ1 A;  3F0I A;  2F8A A;  3O6T A;  1T3B A;  3LOR A;  5DDL A;  4MPG A;  2H01 A;  4EC0 A;  1V40 A;  2X8C A;  4HEA 2;  3ZRD A;  1I5G A;  6GSU A;  1EGR A;  4MZB A;  2IIY A;  3FR6 A;  4H86 A;  1FO5 A;  3LG6 A;  1SD9 A;  4WBR D;  4DSS B;  1J9B A;  1WWJ A;  2GLR A;  3DGQ A;  4LA1 A;  4MK3 A;  1T00 A;  1VF4 A;  3E3E A;  2YV9 A;  4ZB9 A;  1Y6E A;  3PIN A;  4MZC A;  1QUW A;  2YJH A;  4MZW A;  1O85 A;  4IN0 A;  4BIK A;  5DVB A;  4XS1 A;  5ABR A;  1SEN A;  1TK0 B;  5D9X A;  1RQM A;  1QMV A;  3IXR A;  5HR2 A;  2AB6 A;  2H76 A;  1TOF A;  1M2A A;  1EOH A;  2JAD A;  1DE2 A;  3LWA A;  5CRH A;  4AF2 A;  2C0D A;  2N5A A;  2WUL A;  2R5G A;  3L9V A;  2E2G A;  1GWC A;  8GSS A;  1SYR A;  1EWX A;  4JRR A;  2F51 A;  1X5D A;  3A3T A;  3ZL5 A;  2YWI A;  4OO4 A;  1T1V A;  1M3J A;  2IL3 A;  2LRN A;  3ZIJ A;  2I1U A;  4K5R A;  2H6Y A;  3ISO A;  3GH9 A;  1OKD A;  3J7Y b;  4MH2 A;  4IBP A;  1A2M A;  3HVV A;  1X9M B;  1OAZ A;  2J9H A;  2YPM A;  4I2U A;  4LMV A;  1E6B A;  2H19 A;  3FR9 A;  1TK8 B;  1V98 A;  5G2Z A;  3Q19 A;  3H8Q A;  3GST A;  3IOS A;  2OA7 A;  3LXZ A;  2GVP A;  2A4H A;  3KCM A;  4KB3 A;  3UVT A;  4O92 A;  1DBY A;  2R4V A;  1OC8 A;  2F9S A;  3TKQ A;  3F9U A;  3FMW A;  2WS2 A;  3ZLP A;  2CX4 A;  2H1B A;  3ZZX A;  1PD2 1;  2JZS A;  3TDG A;  3D4M A;  1S3A A;  4OCF A;  2LQQ A;  3AY8 A;  3HJO A;  4PQH A;  2VIM A;  4TR1 B;  3CSH A;  2JAC A;  2GST A;  1GLQ A;  1QQ2 A;  1GTI A;  1YEX A;  2I81 A;  4N30 A;  5H5S A;  1K0N A;  3SBC A;  2GT6 A;  4CW9 A;  4K7N A;  4KX4 A;  4IJ3 A;  3P2A A;  2FWF A;  5F07 A;  4PGT A;  2O7K A;  1XW9 A;  2LTK A;  4X4J A;  2EIQ A;  2LEG A;  3CYN A;  1ZOF A;  4BPY A;  3C7M A;  2KP2 A;  2G0F A;  5G31 A;  5A4U A;  3G7J A;  4HSC X;  4POB A;  1A23 A;  2HRK A;  3LQ7 A;  4MJE A;  1EP7 A;  3KEB A;  2JU5 A;  3WGD A;  1PN0 A;  2FLS A;  2ON7 A;  2F3M A;  2AUV A;  1NHO A;  3KH7 A;  2B7K A;  1ZL9 A;  3ZML A;  1WRY A;  1GNE A;  3KJY A;  4KAE A;  1KTE A;  1AIU A;  3W6G A;  4TR0 A;  4HUA A;  1ZYE A;  1NHY A;  2J23 A;  5DAK A;  3TUE A;  1GTU A;  3FW2 A;  1GUK A;  1GSS A;  1GTA A;  4I97 A;  2A2S A;  2C0F A;  3APO A;  4EUY A;  2DLX A;  3W8S A;  1PSQ A;  1OVN A;  4KH7 A;  2YOI A;  4EDZ A;  3FKF A;  2YNX A;  5ECP B;  2MMN A;  5A5K A;  1U87 A;  11GS A;  1TI1 A;  1ON4 A;  3IRA A;  3QD9 A;  3EC3 A;  5EL8 A;  1TU8 A;  1Z6M A;  2LKU A;  3TRP A;  2CA8 A;  4FYC A;  5JWR B;  1K0M A;  4TN8 A;  4XCS A;  3U5R E;  1MDJ A;  3MYD A;  4F03 A;  5CAX A;  4I5Q A;  3ERW A;  4PUF C;  6GSV A;  5KEJ A;  4K5S A;  5IOW A;  2H0G A;  3APS A;  2IN3 A;  2DJ2 A;  2RM6 A;  2H30 A;  2VD0 A;  3C73 A;  5LCZ A;  3BJ5 A;  3TJB A;  5LNK e;  1W4V A;  1X9W B;  1QXH A;  1FB6 A;  2M80 A;  3F6D A;  3UJ1 A;  2GQL A;  4WKW A;  2GTU A;  5GST A;  1B9X C;  3CSJ A;  5GAP D;  1GH2 A;  2DJK A;  6GSX A;  1K0D A;  1JZR A;  1KNG A;  1O81 A;  4GXZ A;  3HYP A;  3RBT A;  3SWL A;  3PPU A;  4F0B A;  3DD3 A;  1AC1 A;  4XS4 A;  3QPM A;  1T7P B;  3GV1 A;  1O7U A;  1ERU A;  2VOC A;  4J56 E;  4USS A;  2PMT A;  3F4R A;  3EUR A;  2AHE A;  5B8A A;  4HQS A;  3P8W A;  3CQF A;  5CRE A;  5C00 A;  2DKI A;  4ZB6 A;  1Z3E A;  4QL9 A;  4EIQ A;  1BYE A;  3IE3 A;  1UN2 A;  1VF2 A;  3EMP A;  4BVX B;  3TOT A;  2L4C A;  2FCH A;  6GSY A;  2DML A;  1EGO A;  3TGZ A;  4ML6 A;  3IDV A;  1TTZ A;  3GN3 A;  1XWA A;  3GUR A;  2GZY A;  4X1U A;  3GHA A;  3TJK A;  2PBJ A;  5DCG A;  2WRT A;  5J9B A;  3FR3 A;  4PTS A;  3DKS A;  4CHS A;  1AQX A;  2P5R A;  3VI5 A;  4NHW A;  1ZYN A;  4MNN A;  3H1N A;  4FQU A;  4BWS A;  4YQU A;  1WP0 A;  5B7C A;  3C1R A;  3GKM A;  5DQY A;  2P31 A;  2WJU A;  2MBT A;  3M1G A;  3PH9 A;  2LRT A;  1JZO A;  2B5X A;  2I9H A;  4V1A g;  1XOB A;  4FIW A;  1QGV A;  4RQR A;  3KZQ A;  5H5Q A;  4OMV A;  4XRD A;  5F0G A;  2K9F A;  4ZBD A;  3KTL A;  2LRC A;  1JHB A;  4IP1 A;  2ZUP A;  4GWR A;  3UBK A;  3IHQ A;  1XIY A;  2VCZ A;  4OFN A;  2ON5 A;  1Q4J A;  5HFI A;  1B48 A;  1AAZ A;  2I3Y A;  1GUH A;  4F0C A;  4J2F A;  2HRF A;  3VWW A;  1OKT A;  2ZNM A;  4TKY A;  3IPZ A;  4OFM A;  4IP6 A;  3VFI A;  3N9J A;  1SJZ A;  5KOW A;  3Q18 A;  4E8E A;  1Z7P A;  5D96 A;  1XZO A;  2QKE A;  2ZCT A;  4MPF A;  3UAP A;  2MMO A;  4Q5Q A;  1QK8 A;  3GX8 A;  4HJM A;  5JWQ B;  3DRN A;  4IEL A;  5IMV A;  1M99 A;  5A4W A;  4CY6 A;  3JCM L;  3BOA A;  2VCV A;  3KTB A;  4XS4 B;  5J5N A;  1URM A;  1XVQ A;  3HA9 A;  1RW1 A;  4KND A;  5IO2 A;  2QGV A;  2REM A;  1SU9 A;  5IM9 A;  1R26 A;  4HS1 A;  1V57 A;  2HFD A;  2HNL A;  2OKA A;  4V1A p;  1OE7 A;  6GSW A;  3FZ4 A;  2B1L A;  2XHF A;  3GSS A;  4TR1 A;  4KE3 A;  2AV4 A;  3DIE A;  1XWB A;  2A2P A;  2H1A A;  1FOV A;  1PL2 A;  2E2M A;  5BRT A;  1EEM A;  3ZVJ A;  4ACS A;  3A2W A;  4ZL9 A;  2WB9 A;  1K0A A;  4N11 A;  3HZ8 A;  1F6M C;  2DJ1 A;  3ZYW A;  3KM6 A;  2HI7 A;  3L9S A;  4QL7 A;  2HT9 A;  5HFK A;  2V41 A;  3UOM A;  4ZBB A;  4L0U A;  4F2I A;  5IO0 A;  1UA5 A;  4YQV A;  3F4S A;  1VF3 A;  2JSY A;  5IMA A;  3R3E A;  1R5A A;  3V1W A;  3FHK A;  3EU4 A;  3C8E A;  2RUF A;  1ERV A;  2R0P A;  3GL3 A;  5ECL B;  4G0L A;  3TKS E;  5DCH A;  5G1K A;  4WXT A;  5KN0 A;  7GSS A;  4ZIL A;  1VF1 A;  4EF0 A;  4MH3 A;  5ELA A;  2IME A;  1ML6 A;  1SK1 A;  2DC5 A;  4F82 A;  3LYK A;  3C1S A;  20GS A;  3HCZ A;  4HJ2 A;  3TKS A;  5IQY A;  5EY6 A;  2FGX A;  4CY8 A;  1IYI A;  2HYX A;  2YZU A;  4JBB A;  3IBH A;  5HFG A;  2PN8 A;  1A8Y A;  3ZIV A;  5IMD A;  2VL3 A;  4EKZ A;  4GSS A;  3M0F A;  3MIX A;  5KN1 A;  1F3A A;  5DAL B;  2C80 A;  1EZK A;  1TDI A;  1O8X A;  3Q6O A;  4GSN A;  4YAP A;  3FZ9 A;  3ZFL A;  1GRX A;  4K7O A;  5B8B A;  1FAA A;  1V2A A;  4N0V A;  2WZ9 A;  3US3 A;  2N5B A;  5GAN D;  4Q5R A;  1TRU A;  1A24 A;  3S9F A;  1OC9 A;  2V6O A;  4HI7 A;  4PXO A;  3CMI A;  2UZ8 A;  3FEU A;  3ERG A;  4O7H A;  4ULX A;  2H6X A;  1WPI A;  1A2J A;  4MDC A;  4GF0 A;  2NPB A;  4BWQ A;  1HNA A;  1ZMA A;  2V32 A;  1OYJ A;  1MEK A;  1U88 A;  1SJ6 A;  2IFQ B;  3L4N A;  4OD7 A;  2OJL A;  4POM A;  4TRX A;  4WBJ A;  4TXV A;  3WGX A;  2L5O A;  1M9B A;  4WR4 A;  1XWC A;  1X9S B;  1ACV A;  1CQG A;  4PNF A;  1HNC A;  2FNO A;  4WR5 A;  2PVQ A;  3KMO A;  4LLR A;  2C4J A;  1YDK A;  2XBQ A;  1PKZ A;  2OAC A;  5ENU A;  1BX9 A;  1XW6 A;  4ZB8 A;  1M0U A;  1A0R P;  2QC7 A;  2RM5 A;  2VCX A;  3EWL A;  1S3R A;  2RLI A;  1GSQ A;  3E0U A;  4AJ8 A;  1C72 A;  3UBL A;  2MZC A;  1R7H A;  17GS A;  2H0H A;  4LMW A;  4G10 A;  5ECK B;  2DJJ A;  2C3T A;  4G2E A;  4BVX A;  1MDI A;  1PKW A;  2N5F A;  2FD3 A;  4XIH A;  3M8N A;  1ERT A;  2VM1 A;  2X99 A;  1PX7 A;  4CDO A;  4OFT A;  5EVO A;  2VM2 A;  3VK9 A;  3GX0 A;  1WJK A;  1GUL A;  3FZA A;  4IW9 A;  2LJK A;  4NHZ A;  3U6V A;  16GS A;  4V2M A;  2DIY A;  4V2L A;  3IC4 A;  4POL A;  1F2E A;  3BCK A;  4XTS A;  1IYH A;  2K8S A;  2D2Z A;  3QAW A;  4K0N A;  2C1Y A;  3EVI A;  2X8G A;  1YKA A;  2OE0 A;  2PUK C;  4PUR A;  5KOX A;  3LSZ A;  2M72 A;  2YAN A;  2L6D A;  1X5E A;  5E59 A;  2V6K A;  2RUE A;  4L8E A;  2HSH A;  1GSD A;  1U3A A;  2CQ9 A;  1XVW A;  4YKG A;  2P5Q A;  2AJQ B;  3HKR A;  1BG5 A;  1Z6N A;  2MMZ A;  2BJX A;  2M46 A;  2H8L A;  3PGT A;  2V1M A;  1AUC A;  3D0Z A;  3F4T A;  1BED A;  1GNW A;  2HSY A;  2LUS A;  4OO5 A;  1F9M A;  2KP1 A;  1NW2 A;  4KCA A;  3D5J A;  5ECR B;  1OC9 B;  1N2A A;  3HVN A;  4IJI A;  1XG8 A;  1JLV A;  1Y25 A;  1LU4 A;  5F05 A;  3HJP A;  2C0E A;  5F06 A;  3TJG A;  5GZZ B;  1TKD B;  1K0C A;  1T4Z A;  5IMC A;  3G9B A;  3FY7 A;  4GLT A;  2GSQ A;  2IWT A;  5ELG A;  2K6V A;  1B4Q A;  4QQ7 A;  1E2Y A;  4RI7 A;  4MJC A;  1EOG A;  1EP8 A;  3MDK A;  1XXU A;  3TJF A;  3GIX A;  1N8J A;  3KIJ A;  4D73 B;  6GSS A;  1SD8 A;  4GQF A;  3MNG A;  1ILO A;  5DJM A;  1Z5Y E;  4YH2 A;  2HZE A;  2X4A A;  3M9J A;  4FYU A;  5H5R A;  2A2R A;  2R6K A;  1U3I A;  4L5O A;  2FWH A;  3VUR A;  1G7E A;  3A5W A;  1XOA A;  2H71 A;  1K0O A;  4PX1 A;  2R3X A;  4X0X A;  4FH8 A;  1GSF A;  4NPB A;  2R2J A;  4IKH A;  5A4V A;  5J4U A;  3APQ A;  1THO A;  5ECM B;  2CVK A;  4YAV A;  4TOP A;  4RI6 A;  4AGS A;  5ECQ B;  5D8I A;  4ILF A;  3WT1 A;  3CSI A;  5DBQ A;  3HY2 A;  4KDY A;  5B6M A;  3ZRE A;  2TRX A;  3HVS A;  3L9U A;  3UIW A;  4EDY A;  4E8H A;  4LL4 B;  4FO5 A;  2XPD A;  3BBY A;  5JWO B;  3LEF A;  2YJ7 A;  2QA2 A;  4TXO A;  1ZCP A;  4WET A;  3HD5 A;  4GCI A;  2LJA A;  1CQH A;  4WF4 A;  3GUS A;  4TVE A;  2NBS A;  3ZVJ D;  2K8V A;  2ALB A;  2DJ0 A;  3KP8 A;  2JZT A;  3VLN A;  1PFO A;  3M9K A;  1AW9 A;  1PQN A;  5J3R A;  4MCU A;  2YZH A;  3DML A;  5CNW A;  1UVZ A;  4PUA A;  3GNJ A;  4Q5F A;  2VL2 C;  2O89 A;  4F9Z A;  3QCP A;  2YWO A;  4O5U A;  3IR4 A;  1TXX A;  5CO3 A;  2YWN A;  1FVK A;  3KXO A;  3L0H A;  4IHU A;  4G9H A;  1DUG A;  1HQO A;  4O32 A;  5DAL A;  2EIO A;  2IMD A;  4TR4 A;  1ZGN A;  1S3D A;  1XFL A;  2H73 A;  5E4W A;  5G1L A;  4NV2 A;  4I8B A;  5AGY A;  1MD3 A;  3LW9 A;  10GS A;  2NVL A;  1XCC A;  1SJI A;  4PNG A;  1MD4 A;  2E7P A;  4KCE A;  1K0B A;  1JZW A;  5JCW A;  1AQW A;  5IOX A;  2H6Z A;  4AJ6 A;  3VI7 A;  4YQM A;  3UMA A;  3HDC A;  2PPT A;  4DSQ A;  3RHB A;  3IAM 2;  4MF6 A;  5G5F A;  4K2X A;  2XBI A;  4NWY A;  5B6N A;  2F8F A;  2IFQ A;  4MMM A;  2XPE A;  2WFC A;  3M3M A;  3TKS C;  2HZE B;  2B3S A;  3NIV A;  2VLU A;  4MAB A;  1GTB A;  3D22 A;  3A5I A;  5JCU A;  2X8H A;  3VPT A;  3DXB A;  3TRX A;  5CRD A;  2DKH A;  3GTU A;  5HQP A;  1K3Y A;  3DEX A;  2CZ3 A;  5FT3 A;  3TKP A;  1S3C A;  1SL2 B;  2HZF A;  3IK9 A;  1G7O A;  4NV5 A;  2EC4 A;  4HU9 A;  3ZFB A;  3GKK A;  4KGI A;  1SK0 A;  2QSI A;  4IQA A;  2OBK A;  4Z7X A;  3FK8 A;  4XS6 A;  2DMM A;  2CT6 A;  1TU7 A;  3GFK A;  4I2T A;  3ED3 A;  4FYB A;  1GLP A;  4K0G A;  2YP6 A;  2XC2 A;  3K8N A;  4HOJ A;  4RQX A;  4ML1 A;  3H93 A;  4ECI A;  3HZ4 A;  3ME7 A;  2MBS A;  4KSM A;  4L0W A;  3QFB C;  2FY6 A;  3QAV A;  4TXO B;  2X64 A;  4TW5 A;  3GMF A;  3O76 A;  2I4A A;  1TK5 B;  1HD2 A;  1Z9H A;  2GQM A;  1F3B A;  1TW9 A;  3H79 A;  2RII A;  4K6X A;  4ZL8 A;  5IIZ A;  4ECB A;  5FWG A;  2HLS A;  4NXI A;  2C3Q A;  1V9W A;  3GKX A;  1EEJ A;  3HXS A;  5HR0 A;  3CTF A;  4ZIJ A;  2GSS A;  1TRW A;  3F3R A;  4NAX A;  1TP9 A;  4MJA A;  1DSB A;  4DVC A;  1J08 A;  3GA4 A;  3FYG A;  3I43 A;  3TJJ A;  3NOF A;  2GS3 A;  3I6A A;  1WMJ A;  3LFL A;  12GS A;  1USB A;  3MAK A;  2TIR A;  2DIZ A;  2KUC A;  3I69 A;  3C71 A;  1YY7 A;  4ECJ A;  4BVY B;  5ID2 A;  5L71 A;  3QAG A;  1MTC A;  4HZ4 A;  4GRF A;  1X0R A;  1H4O A;  3J7Y k;  4KUN A;  1O8W A;  1OC3 A;  3R2Q A;  1PA3 A;  1JFU A;  5CRG A;  4Z2R A;  1G0T A;  3E9J B;  1I9D A;  2C8U A;  3LGC A;  4EL1 A;  2YN1 A;  4XHM A;  2B1K A;  1YF0 A;  3MSZ A;  3P90 A;  2H72 A;  2WDU A;  5ECI B;  3ZMK A;  1KEB A;  2JSZ A;  1RK4 A;  1FW1 A;  9GSS A;  2DSA A;  4ZL7 A;  1F37 A;  1O73 A;  2O8V B;  1JLW A;  3EMX A;  3LYP A;  2AYT A;  1YQ1 A;  3QMX A;  5AN1 A;  1SKS B;  4D73 A;  2CVB A;  2V2G A;  2WCI A;  2VUP A;  3CBU A;  1M9A A;  3GTU B;  3TB2 A;  2R0G A;  1YKC A;  3QOU A;  5ECH B;  1A0F A;  5D9T A;  1M3I A;  3VWX A;  4EVM A;  3L78 A;  2H0I A;  3EIN A;  2NDO A;  4JR6 A;  3H4K A;  3ZIT A;  3TRQ A;  3IHG A;  5CYY A;  1QFN A;  2B5E A;  5IPG A;  3D4T A;  3WGE A;  2LV3 A;  2HRA A;  1R5P A;  3WD6 A;  1G6Y A;  1THX A;  3QR6 A;  3IK7 A;  5F8B A;  4L5L A;  6GST A;  2JZR A;  4EXJ A;  4HQZ A;  1PGT A;  4BL7 A;  2YWM A;  5AIX A;  1PRX A;  1BJX A;  4JED A;  1VRS D;  4GQC A;  3F8U A;  4PQI A;  1G6W A;  3CTG A;  4POK A;  2L5L A;  3DYR A;  2IMF A;  3F6F A;  2X49 A;  1YZX A;  1A8L A;  4Z2T A;  2L59 A;  2PER A;  4EO3 A;  5IPH A;  3QFA C;  2VLT A;  3ERF A; 
#chains in the Genus database with same CATH homology
 2A4V A;  2YCD A;  4G0I A;  2YV7 A;  2LS5 A;  2IMI A;  4JU5 A;  2PGT A;  2FHE A;  3QDN A;  1OE8 A;  2HRN A;  3FRC A;  3O3T A;  4JZQ A;  3RDW A;  1BQ7 A;  3BD2 A;  3F3Q A;  2LQO A;  5ECO B;  4V2N A;  2ES7 A;  2AAW A;  3EPT A;  1ABA A;  1GSU A;  4KW6 A;  3W8J A;  2PU9 C;  4OWY A;  1ST9 A;  1WIK A;  4KDX A;  2H74 A;  3TOU A;  1XPV A;  3RPP A;  2PVO C;  3P7X A;  1O6J A;  4G19 A;  5ID2 B;  1Q98 A;  2C3N A;  3TKR A;  2GZP A;  1EV9 A;  4JR4 A;  3WYW A;  3KGK A;  5COH A;  5ECN B;  4ISD A;  3G7Y A;  4MJB A;  5D93 A;  3D6I A;  4HDE A;  2PWJ A;  2CX3 A;  1PMT A;  2FWE A;  2MYG A;  4ID0 A;  4KF9 A;  1TRV A;  3FZ5 A;  2C0G A;  2DBC A;  5ECS A;  1FG4 A;  3GRX A;  3A2X A;  3VWU A;  19GS A;  2VLV A;  2O85 A;  4A5P A;  5BMU A;  4MF7 A;  1SL1 B;  2P0G A;  13GS A;  4DEJ A;  1GSY A;  2EIR A;  4ZXG A;  4ECC A;  4MA9 A;  3OR5 A;  5DQS A;  3EYT A;  1W89 A;  2IPA A;  5G5E A;  2L6C A;  2OE3 A;  1EV4 A;  4AJ7 A;  3IV4 A;  4EE0 A;  2G2Q A;  4MF5 A;  2GZZ A;  3N5O A;  1H75 A;  5KN3 A;  5C04 A;  2HSM A;  3IA1 A;  4HZ2 A;  1GSE A;  1ZYP A;  3RPN A;  3HHV A;  1T8E B;  4MP4 A;  2OAD A;  2VAF A;  3HVX A;  4Q5N A;  1XW5 A;  1YEP A;  1ZZY A;  5DJL A;  1XWK A;  4KA0 A;  4O5Q A;  5IMF A;  1TI3 A;  1FVJ A;  2L4Q A;  1SYX A;  2GDR A;  1AQV A;  2TRC P;  2JL4 A;  1Z7R A;  2B6M A;  4XRA A;  2B7J A;  4K2D A;  3MWH A;  4NMU A;  2OE1 A;  2GT5 A;  2H1G A;  4K1F A;  1M2B A;  4Z2U A;  2VL9 A;  5CP1 A;  3VPQ A;  3EU3 A;  4BL7 B;  2QA1 A;  3RHC A;  22GS A;  3NZN A;  5D73 A;  4MLY A;  1ZYQ B;  3LXT A;  1B8X A;  4OCE A;  4I6X A;  4N0Z A;  3DVX A;  3ME8 A;  4JE1 A;  4IGJ A;  1SKR B;  2GQK A;  3GYK A;  2FA8 A;  1V58 A;  3UL3 A;  5D9V A;  3RAZ A;  5IMZ A;  5HR1 A;  4WEY A;  1SL0 B;  3GH6 A;  2R0C A;  2CVD A;  1YJ6 A;  4J57 E;  1PX6 A;  1R4W A;  5J41 A;  5AIS A;  3GL5 A;  4LL1 B;  1B9Y C;  3WT2 A;  3IC8 A;  2IJY A;  3TCO A;  1AXD A;  2FUG 2;  5CRW A;  5D9W A;  2IMK A;  3UEM A;  3HJM A;  5AIV A;  1WOU A;  1PL1 A;  2H66 A;  5DAK B;  14GS A;  4TR3 A;  3CXG A;  2VCQ A;  4DSS A;  2H1D A;  5HR3 A;  1SK2 A;  2LNT A;  2LJR A;  2CV4 A;  4EIP A;  1LBK A;  1NM3 A;  1NSW A;  3Q74 A;  2FWG A;  3EE2 A;  2GSR A;  1JZD A;  3ZTL A;  4O5R A;  1HNB A;  3G7I A;  4P3Y B;  2VD1 A;  4BVY A;  2KLX A;  5GSS A;  3F63 A;  3UVH A;  1ERW A;  3CRT A;  4YKF A;  2O87 A;  4IQ1 A;  3UAR A;  2BMX A;  4IS0 A;  1FB0 A;  3GKN A;  4ZBA A;  3D21 A;  4BA7 A;  1YF1 A;  5EPF A;  1WE0 A;  2CZ2 A;  2GGT A;  3LJR A;  2H75 A;  2CAQ A;  2L57 A;  1K3L A;  4N10 A;  4WF5 A;  4HU7 A;  5JCG A;  1K3O A;  1XBS A;  4ICY A;  1UC7 A;  1MDK A;  2OBI A;  5INY A;  2VCW A;  3A2V A;  1PN9 A;  5KN2 A;  3KH9 A;  2FA4 A;  4G0K A;  1GUM A;  2LST A;  3KD0 A;  1GP1 A;  3IAS 2;  2KOK A;  1SKW B;  1FOH A;  4KSO A;  2BTO T;  4RUV A;  3DWV A;  3KP9 A;  3BCI A;  4KDU A;  2E0Q A;  1X5C A;  2B5Y A;  2R37 A;  1J0F A;  1T4Y A;  3CRU A;  2HE3 A;  5FHI A;  1DE1 A;  2NTO A;  4GST A;  4DSR A;  2K18 A;  5J9C A;  3KMN A;  4GTU A;  2HXK A;  4K9Z A;  2VCT A;  3DVW A;  2LNS A;  2H70 A;  2KHP A;  4X43 A;  2Z9S A;  2VO4 A;  5LD0 A;  4K8M A;  1VGL A;  1HYU A;  2MMA A;  1LJR A;  1TJD A;  1TRS A;  2CAI A;  2VL2 A;  3VWV A;  3PR8 A;  1BAY A;  2DJ3 A;  1U6T A;  3I9V 2;  1XWG A;  4K7I A;  5G30 A;  4IVF A;  1FHE A;  1M7T A;  1M2D A;  1KBN A;  1B4P A;  18GS A;  1A2L A;  1GL8 A;  2WGR A;  4PQ1 A;  3F0I A;  2F8A A;  3O6T A;  1T3B A;  3LOR A;  5DDL A;  4MPG A;  2H01 A;  4EC0 A;  1V40 A;  2X8C A;  4HEA 2;  3ZRD A;  1I5G A;  6GSU A;  1EGR A;  4MZB A;  2IIY A;  3FR6 A;  4H86 A;  1FO5 A;  3LG6 A;  1SD9 A;  4WBR D;  4DSS B;  1J9B A;  1WWJ A;  2GLR A;  3DGQ A;  4LA1 A;  4MK3 A;  1T00 A;  1VF4 A;  3E3E A;  2YV9 A;  4ZB9 A;  1Y6E A;  3PIN A;  4MZC A;  1QUW A;  2YJH A;  4MZW A;  1O85 A;  4IN0 A;  5DVB A;  4XS1 A;  5ABR A;  1SEN A;  1TK0 B;  5D9X A;  1RQM A;  1QMV A;  3IXR A;  5HR2 A;  2AB6 A;  2H76 A;  1TOF A;  1M2A A;  1EOH A;  2JAD A;  1DE2 A;  3LWA A;  5CRH A;  4AF2 A;  2C0D A;  2N5A A;  2WUL A;  2R5G A;  3L9V A;  2E2G A;  1GWC A;  8GSS A;  1SYR A;  1EWX A;  4JRR A;  2F51 A;  1X5D A;  3A3T A;  3ZL5 A;  2YWI A;  4OO4 A;  1T1V A;  2IL3 A;  2LRN A;  3ZIJ A;  2I1U A;  4K5R A;  2H6Y A;  3ISO A;  3GH9 A;  1OKD A;  3J7Y b;  4MH2 A;  4IBP A;  1A2M A;  3HVV A;  1X9M B;  1OAZ A;  2J9H A;  2YPM A;  4I2U A;  4LMV A;  1E6B A;  2H19 A;  3FR9 A;  1TK8 B;  1V98 A;  5G2Z A;  3Q19 A;  3H8Q A;  3GST A;  3IOS A;  2OA7 A;  3LXZ A;  2GVP A;  2A4H A;  3KCM A;  4KB3 A;  3UVT A;  4O92 A;  1DBY A;  2R4V A;  1OC8 A;  2F9S A;  3TKQ A;  3F9U A;  3FMW A;  2WS2 A;  3ZLP A;  2CX4 A;  2H1B A;  3ZZX A;  1PD2 1;  2JZS A;  3TDG A;  3D4M A;  1S3A A;  4OCF A;  2LQQ A;  3AY8 A;  3HJO A;  4PQH A;  2VIM A;  4TR1 B;  3CSH A;  2JAC A;  2GST A;  1GLQ A;  1QQ2 A;  1GTI A;  1YEX A;  2I81 A;  4N30 A;  5H5S A;  1K0N A;  3SBC A;  2GT6 A;  4CW9 A;  4K7N A;  4KX4 A;  4IJ3 A;  3P2A A;  2FWF A;  5F07 A;  4PGT A;  2O7K A;  1XW9 A;  2LTK A;  4X4J A;  2EIQ A;  2LEG A;  3CYN A;  1ZOF A;  4BPY A;  3C7M A;  2KP2 A;  2G0F A;  5G31 A;  5A4U A;  3G7J A;  4POB A;  1A23 A;  2HRK A;  3LQ7 A;  4MJE A;  1EP7 A;  3KEB A;  2JU5 A;  3WGD A;  1PN0 A;  2FLS A;  2ON7 A;  2F3M A;  2AUV A;  1NHO A;  3KH7 A;  2B7K A;  1ZL9 A;  3ZML A;  1WRY A;  1GNE A;  3KJY A;  4KAE A;  1KTE A;  1AIU A;  3W6G A;  4TR0 A;  4HUA A;  1ZYE A;  1NHY A;  2J23 A;  5DAK A;  3TUE A;  1GTU A;  3FW2 A;  1GUK A;  1GSS A;  1GTA A;  4I97 A;  2A2S A;  2C0F A;  3APO A;  4EUY A;  2DLX A;  3W8S A;  1PSQ A;  1OVN A;  4KH7 A;  2YOI A;  4EDZ A;  3FKF A;  2YNX A;  5ECP B;  2MMN A;  5A5K A;  1U87 A;  11GS A;  1TI1 A;  1ON4 A;  3IRA A;  3QD9 A;  3EC3 A;  5EL8 A;  1TU8 A;  1Z6M A;  2LKU A;  3TRP A;  2CA8 A;  4FYC A;  5JWR B;  1K0M A;  4TN8 A;  4XCS A;  3U5R E;  1MDJ A;  3MYD A;  4F03 A;  5CAX A;  4I5Q A;  3ERW A;  4PUF C;  6GSV A;  5KEJ A;  4K5S A;  5IOW A;  2H0G A;  3APS A;  2IN3 A;  2DJ2 A;  2RM6 A;  2H30 A;  2VD0 A;  3C73 A;  5LCZ A;  3BJ5 A;  3TJB A;  5LNK e;  1W4V A;  1X9W B;  1QXH A;  1FB6 A;  2M80 A;  3F6D A;  3UJ1 A;  2GQL A;  4WKW A;  2GTU A;  5GST A;  1B9X C;  3CSJ A;  5GAP D;  1GH2 A;  2DJK A;  6GSX A;  1K0D A;  1JZR A;  1KNG A;  1O81 A;  4GXZ A;  3HYP A;  3RBT A;  3SWL A;  3PPU A;  4F0B A;  3DD3 A;  1AC1 A;  4XS4 A;  3QPM A;  1T7P B;  3GV1 A;  1O7U A;  1ERU A;  2VOC A;  4J56 E;  4USS A;  2PMT A;  3F4R A;  3EUR A;  2AHE A;  5B8A A;  4HQS A;  3P8W A;  5CRE A;  5C00 A;  2DKI A;  4ZB6 A;  1Z3E A;  4QL9 A;  4EIQ A;  1BYE A;  3IE3 A;  1UN2 A;  1VF2 A;  3EMP A;  4BVX B;  3TOT A;  2L4C A;  2FCH A;  6GSY A;  2DML A;  1EGO A;  3TGZ A;  4ML6 A;  3IDV A;  1TTZ A;  3GN3 A;  1XWA A;  3GUR A;  2GZY A;  4X1U A;  3GHA A;  3TJK A;  2PBJ A;  5DCG A;  2WRT A;  5J9B A;  3FR3 A;  4PTS A;  3DKS A;  4CHS A;  1AQX A;  2P5R A;  3VI5 A;  4NHW A;  1ZYN A;  4MNN A;  3H1N A;  4FQU A;  4BWS A;  4YQU A;  1WP0 A;  5B7C A;  3C1R A;  3GKM A;  5DQY A;  2P31 A;  2WJU A;  2MBT A;  3M1G A;  3PH9 A;  2LRT A;  1JZO A;  2B5X A;  2I9H A;  4V1A g;  1XOB A;  4FIW A;  1QGV A;  4RQR A;  3KZQ A;  5H5Q A;  4OMV A;  4XRD A;  5F0G A;  2K9F A;  4ZBD A;  3KTL A;  2LRC A;  1JHB A;  4IP1 A;  2ZUP A;  4GWR A;  3UBK A;  3IHQ A;  1XIY A;  2VCZ A;  4OFN A;  2ON5 A;  1Q4J A;  5HFI A;  1B48 A;  1AAZ A;  2I3Y A;  1GUH A;  4F0C A;  4J2F A;  2HRF A;  3VWW A;  1OKT A;  2ZNM A;  4TKY A;  3IPZ A;  4OFM A;  4IP6 A;  3VFI A;  3N9J A;  1SJZ A;  5KOW A;  3Q18 A;  4E8E A;  1Z7P A;  5D96 A;  1XZO A;  2QKE A;  2ZCT A;  4MPF A;  3UAP A;  2MMO A;  4Q5Q A;  1QK8 A;  3GX8 A;  4HJM A;  5JWQ B;  3DRN A;  4IEL A;  5IMV A;  1M99 A;  5A4W A;  4CY6 A;  3JCM L;  3BOA A;  2VCV A;  3KTB A;  4XS4 B;  5J5N A;  1URM A;  1XVQ A;  3HA9 A;  1RW1 A;  4KND A;  5IO2 A;  2QGV A;  2REM A;  1SU9 A;  5IM9 A;  1R26 A;  4HS1 A;  1V57 A;  2HFD A;  2HNL A;  2OKA A;  4V1A p;  1OE7 A;  6GSW A;  3FZ4 A;  2B1L A;  2XHF A;  3GSS A;  4TR1 A;  4KE3 A;  2AV4 A;  3DIE A;  1XWB A;  2A2P A;  2H1A A;  1FOV A;  1PL2 A;  2E2M A;  5BRT A;  1EEM A;  3ZVJ A;  4ACS A;  3A2W A;  4ZL9 A;  2WB9 A;  1K0A A;  4N11 A;  3HZ8 A;  1F6M C;  2DJ1 A;  3ZYW A;  3KM6 A;  2HI7 A;  3L9S A;  4QL7 A;  2HT9 A;  5HFK A;  2V41 A;  3UOM A;  4ZBB A;  4L0U A;  4F2I A;  5IO0 A;  1UA5 A;  4YQV A;  3F4S A;  1VF3 A;  2JSY A;  5IMA A;  3R3E A;  1R5A A;  3V1W A;  3FHK A;  3EU4 A;  3C8E A;  2RUF A;  1ERV A;  2R0P A;  3GL3 A;  5ECL B;  4G0L A;  3TKS E;  5DCH A;  5G1K A;  4WXT A;  5KN0 A;  7GSS A;  4ZIL A;  1VF1 A;  4EF0 A;  4MH3 A;  5ELA A;  2IME A;  1ML6 A;  1SK1 A;  2DC5 A;  4F82 A;  3LYK A;  3C1S A;  20GS A;  3HCZ A;  4HJ2 A;  3TKS A;  5IQY A;  5EY6 A;  2FGX A;  4CY8 A;  1IYI A;  2HYX A;  2YZU A;  4JBB A;  3IBH A;  5HFG A;  2PN8 A;  1A8Y A;  3ZIV A;  5IMD A;  2VL3 A;  4EKZ A;  4GSS A;  3M0F A;  3MIX A;  5KN1 A;  1F3A A;  5DAL B;  2C80 A;  1EZK A;  1TDI A;  1O8X A;  3Q6O A;  4GSN A;  4YAP A;  3FZ9 A;  3ZFL A;  1GRX A;  4K7O A;  5B8B A;  1FAA A;  1V2A A;  4N0V A;  2WZ9 A;  3US3 A;  2N5B A;  5GAN D;  4Q5R A;  1TRU A;  1A24 A;  3S9F A;  1OC9 A;  2V6O A;  4HI7 A;  4PXO A;  3CMI A;  2UZ8 A;  3FEU A;  3ERG A;  4O7H A;  4ULX A;  2H6X A;  1WPI A;  1A2J A;  4MDC A;  4GF0 A;  2NPB A;  4BWQ A;  1HNA A;  1ZMA A;  2V32 A;  1OYJ A;  1MEK A;  1U88 A;  1SJ6 A;  2IFQ B;  3L4N A;  4OD7 A;  2OJL A;  4POM A;  4TRX A;  4WBJ A;  4TXV A;  3WGX A;  2L5O A;  1M9B A;  4WR4 A;  1XWC A;  1X9S B;  1ACV A;  1CQG A;  4PNF A;  1HNC A;  2FNO A;  4WR5 A;  2PVQ A;  3KMO A;  4LLR A;  2C4J A;  1YDK A;  2XBQ A;  1PKZ A;  2OAC A;  5ENU A;  1BX9 A;  1XW6 A;  4ZB8 A;  1M0U A;  1A0R P;  2QC7 A;  2RM5 A;  2VCX A;  3EWL A;  2RLI A;  1GSQ A;  3E0U A;  4AJ8 A;  1C72 A;  3UBL A;  2MZC A;  1R7H A;  17GS A;  2H0H A;  4LMW A;  4G10 A;  5ECK B;  2DJJ A;  2C3T A;  4G2E A;  4BVX A;  1MDI A;  1PKW A;  2N5F A;  2FD3 A;  4XIH A;  3M8N A;  1ERT A;  2VM1 A;  2X99 A;  1PX7 A;  4CDO A;  4OFT A;  5EVO A;  2VM2 A;  3VK9 A;  3GX0 A;  1WJK A;  1GUL A;  3FZA A;  4IW9 A;  2LJK A;  4NHZ A;  3U6V A;  16GS A;  4V2M A;  2DIY A;  4V2L A;  3IC4 A;  4POL A;  1F2E A;  3BCK A;  4XTS A;  1IYH A;  2K8S A;  2D2Z A;  3QAW A;  4K0N A;  2C1Y A;  3EVI A;  2X8G A;  1YKA A;  2OE0 A;  2PUK C;  4PUR A;  5KOX A;  3LSZ A;  2M72 A;  2YAN A;  2L6D A;  1X5E A;  5E59 A;  2V6K A;  2RUE A;  4L8E A;  2HSH A;  1GSD A;  1U3A A;  2CQ9 A;  1XVW A;  4YKG A;  2P5Q A;  2AJQ B;  3HKR A;  1BG5 A;  1Z6N A;  2MMZ A;  2BJX A;  2M46 A;  2H8L A;  3PGT A;  2V1M A;  1AUC A;  3D0Z A;  3F4T A;  1BED A;  1GNW A;  2HSY A;  2LUS A;  4OO5 A;  1F9M A;  2KP1 A;  1NW2 A;  4KCA A;  3D5J A;  5ECR B;  1OC9 B;  1N2A A;  4IJI A;  1JLV A;  1Y25 A;  1LU4 A;  5F05 A;  3HJP A;  2C0E A;  5F06 A;  3TJG A;  5GZZ B;  1TKD B;  1K0C A;  1T4Z A;  5IMC A;  3G9B A;  3FY7 A;  4GLT A;  2GSQ A;  2IWT A;  5ELG A;  2K6V A;  1B4Q A;  4QQ7 A;  1E2Y A;  4RI7 A;  4MJC A;  1EOG A;  1EP8 A;  3MDK A;  1XXU A;  3TJF A;  3GIX A;  1N8J A;  3KIJ A;  4D73 B;  6GSS A;  1SD8 A;  4GQF A;  3MNG A;  1ILO A;  5DJM A;  1Z5Y E;  4YH2 A;  2HZE A;  2X4A A;  3M9J A;  4FYU A;  5H5R A;  2A2R A;  2R6K A;  1U3I A;  4L5O A;  2FWH A;  3VUR A;  1G7E A;  3A5W A;  1XOA A;  2H71 A;  1K0O A;  4PX1 A;  2R3X A;  4X0X A;  4FH8 A;  1GSF A;  4NPB A;  2R2J A;  4IKH A;  5A4V A;  5J4U A;  3APQ A;  1THO A;  5ECM B;  2CVK A;  4YAV A;  4TOP A;  4RI6 A;  4AGS A;  5ECQ B;  5D8I A;  4ILF A;  3WT1 A;  3CSI A;  5DBQ A;  3HY2 A;  4KDY A;  5B6M A;  3ZRE A;  2TRX A;  3HVS A;  3L9U A;  3UIW A;  4EDY A;  4E8H A;  4LL4 B;  4FO5 A;  2XPD A;  3BBY A;  5JWO B;  3LEF A;  2YJ7 A;  2QA2 A;  4TXO A;  1ZCP A;  4WET A;  3HD5 A;  4GCI A;  2LJA A;  1CQH A;  4WF4 A;  3GUS A;  4TVE A;  2NBS A;  3ZVJ D;  2K8V A;  2ALB A;  2DJ0 A;  3KP8 A;  2JZT A;  3VLN A;  3M9K A;  1AW9 A;  1PQN A;  5J3R A;  4MCU A;  2YZH A;  3DML A;  5CNW A;  1UVZ A;  4PUA A;  3GNJ A;  4Q5F A;  2VL2 C;  2O89 A;  4F9Z A;  3QCP A;  2YWO A;  4O5U A;  3IR4 A;  1TXX A;  5CO3 A;  2YWN A;  1FVK A;  3KXO A;  3L0H A;  4IHU A;  4G9H A;  1DUG A;  1HQO A;  4O32 A;  5DAL A;  2EIO A;  2IMD A;  4TR4 A;  1ZGN A;  1S3D A;  1XFL A;  2H73 A;  5E4W A;  5G1L A;  4NV2 A;  4I8B A;  5AGY A;  1MD3 A;  3LW9 A;  10GS A;  2NVL A;  1XCC A;  1SJI A;  4PNG A;  1MD4 A;  2E7P A;  4KCE A;  1K0B A;  1JZW A;  5JCW A;  1AQW A;  5IOX A;  2H6Z A;  4AJ6 A;  3VI7 A;  4YQM A;  3UMA A;  3HDC A;  2PPT A;  4DSQ A;  3RHB A;  3IAM 2;  4MF6 A;  5G5F A;  4K2X A;  2XBI A;  4NWY A;  5B6N A;  2F8F A;  2IFQ A;  4MMM A;  2XPE A;  2WFC A;  3M3M A;  3TKS C;  2HZE B;  2B3S A;  3NIV A;  2VLU A;  4MAB A;  1GTB A;  3D22 A;  3A5I A;  5JCU A;  2X8H A;  3VPT A;  3DXB A;  3TRX A;  5CRD A;  2DKH A;  3GTU A;  5HQP A;  1K3Y A;  3DEX A;  2CZ3 A;  5FT3 A;  3TKP A;  1S3C A;  1SL2 B;  2HZF A;  3IK9 A;  1G7O A;  4NV5 A;  2EC4 A;  4HU9 A;  3ZFB A;  3GKK A;  4KGI A;  1SK0 A;  2QSI A;  4IQA A;  2OBK A;  4Z7X A;  3FK8 A;  4XS6 A;  2DMM A;  2CT6 A;  1TU7 A;  3GFK A;  4I2T A;  3ED3 A;  4FYB A;  1GLP A;  4K0G A;  2YP6 A;  2XC2 A;  3K8N A;  4HOJ A;  4RQX A;  4ML1 A;  3H93 A;  4ECI A;  3HZ4 A;  3ME7 A;  2MBS A;  4KSM A;  4L0W A;  3QFB C;  2FY6 A;  3QAV A;  4TXO B;  2X64 A;  4TW5 A;  3GMF A;  3O76 A;  2I4A A;  1TK5 B;  1HD2 A;  1Z9H A;  2GQM A;  1F3B A;  1TW9 A;  3H79 A;  2RII A;  4K6X A;  4ZL8 A;  5IIZ A;  4ECB A;  5FWG A;  2HLS A;  4NXI A;  2C3Q A;  1V9W A;  3GKX A;  1EEJ A;  3HXS A;  5HR0 A;  3CTF A;  4ZIJ A;  2GSS A;  1TRW A;  3F3R A;  4NAX A;  1TP9 A;  4MJA A;  1DSB A;  4DVC A;  1J08 A;  3GA4 A;  3FYG A;  3I43 A;  3TJJ A;  3NOF A;  2GS3 A;  3I6A A;  1WMJ A;  3LFL A;  12GS A;  1USB A;  3MAK A;  2TIR A;  2DIZ A;  2KUC A;  3I69 A;  3C71 A;  1YY7 A;  4ECJ A;  4BVY B;  5ID2 A;  5L71 A;  3QAG A;  1MTC A;  4HZ4 A;  4GRF A;  1X0R A;  1H4O A;  3J7Y k;  4KUN A;  1O8W A;  1OC3 A;  3R2Q A;  1PA3 A;  1JFU A;  5CRG A;  4Z2R A;  1G0T A;  3E9J B;  1I9D A;  2C8U A;  3LGC A;  4EL1 A;  2YN1 A;  4XHM A;  2B1K A;  1YF0 A;  3MSZ A;  3P90 A;  2H72 A;  2WDU A;  5ECI B;  3ZMK A;  1KEB A;  2JSZ A;  1RK4 A;  1FW1 A;  9GSS A;  2DSA A;  4ZL7 A;  1F37 A;  1O73 A;  2O8V B;  1JLW A;  3EMX A;  3LYP A;  2AYT A;  1YQ1 A;  3QMX A;  5AN1 A;  1SKS B;  4D73 A;  2CVB A;  2V2G A;  2WCI A;  2VUP A;  3CBU A;  1M9A A;  3GTU B;  3TB2 A;  2R0G A;  1YKC A;  3QOU A;  5ECH B;  1A0F A;  5D9T A;  3VWX A;  4EVM A;  3L78 A;  2H0I A;  3EIN A;  2NDO A;  4JR6 A;  3H4K A;  3ZIT A;  3TRQ A;  3IHG A;  5CYY A;  1QFN A;  2B5E A;  5IPG A;  3D4T A;  3WGE A;  2LV3 A;  2HRA A;  1R5P A;  3WD6 A;  1G6Y A;  1THX A;  3QR6 A;  3IK7 A;  5F8B A;  4L5L A;  6GST A;  2JZR A;  4EXJ A;  4HQZ A;  1PGT A;  4BL7 A;  2YWM A;  5AIX A;  1PRX A;  1BJX A;  4JED A;  1VRS D;  4GQC A;  3F8U A;  4PQI A;  1G6W A;  3CTG A;  4POK A;  2L5L A;  3DYR A;  2IMF A;  3F6F A;  2X49 A;  1YZX A;  1A8L A;  4Z2T A;  2L59 A;  2PER A;  4EO3 A;  5IPH A;  3QFA C;  2VLT A;  3ERF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...