2MYGA

Solution structure of the dithiolic glutaredoxin 2-c-grx1 from the pathogen trypanosoma brucei brucei
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
GAMPSIASMIKGNKVVVFSWVTCPYCVRAEKLLHARTKDITVHYVDKMSEGEQLRGEIYQAYKHETVPAIFINGNFIGGCSDLEALDKEGKLDGLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dithiol glutaredoxin 1
publication title Solution structure of the dithiolic glutaredoxin 2-C-Grx1 from the pathogen Trypanosoma brucei brucei
rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 26
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mygA00
1EOGA 3TKRA 1AQVA 3APQA 3GKKA 2H0IA 2GQMA 4PNFA 2MMAA 5DALA 5IMFA 1SK0A 3GX8A 4POLA 5JCWA 1SL0B 3WGEA 2CVBA 4H86A 3C1RA 2V1MA 1XXUA 3CRUA 1GNEA 5HR2A 3FHKA 4ECBA 4PUFC 2PU9C 4MH2A 3IBHA 5ENUA 2MBSA 3P8WA 3VWVA 3HZ8A 4EXJA 4OFMA 1V40A 1SYXA 4ULXA 2XBQA 3A2XA 4HI7A 1TU8A 2H73A 4CDOA 1PN9A 2C4JA 2LSTA 4OCEA 4HS1A 1ERWA 4WR4A 1J0FA 5B6MA 1B4PA 1KNGA 3FZ4A 1UN2A 5ECHB 3IRAA 3ZITA 1TTZA 2AB6A 3KCMA 5E59A 5HR3A 4TKYA 3FY7A 3C8EA 4N11A 2YN1A 1TK5B 3FZ5A 16GSA 3NOFA 1SKRB 3VURA 1X5EA 3GTUB 3IA1A 2HRFA 3EMXA 4TN8A 3FW2A 2HI7A 1NM3A 2FWGA 1BEDA 1AQXA 1KEBA 1O7UA 3TKSA 3GKXA 3LXTA 4AGSA 3KMOA 4LMWA 4GF0A 4L5OA 1T1VA 4DSSA 3F9UA 1YKCA 1DE2A 4XRAA 2BJXA 3M9JA 3LYPA 4MJEA 4OMVA 5AIVA 2JL4A 2HZEA 1XWCA 3TKSC 3HD5A 1TRUA 4EDYA 4MZWA 2H71A 1E2YA 2GGTA 3QFAC 3NZNA 3LEFA 3W8JA 2C1YA 1M99A 1YF1A 3EURA 3F3RA 1GSEA 4RI6A 3G7YA 5C04A 2EIQA 2H66A 1XOAA 3VWXA 4ZB6A 2VCWA 2LRNA 3MWHA 4N10A 1OE8A 1FG4A 2VD0A 5LNKe 4WF5A 2HRNA 4K7IA 2YNXA 4K6XA 1QXHA 2L6DA 2XBIA 3ZRDA 3KD0A 1B48A 2CA8A 1ERTA 4E8HA 3RDWA 2IL3A 4EUYA 1YY7A 2V6KA 4P3YB 1HYUA 4PXOA 4EL1A 2BTOT 4ID0A 3UL3A 3VPTA 4FYBA 1A2JA 4IELA 4IP1A 4QL7A 1TXXA 1FAAA 2IFQA 5H5SA 3VWWA 2C0EA 3ERFA 4BVXA 2XPEA 1A8YA 1QGVA 1ZOFA 2NPBA 2FY6A 2JZSA 1GUMA 5DAKA 1AXDA 2WS2A 3EU3A 3VFIA 3TJFA 1XWAA 1ST9A 4OCFA 4OFNA 4WETA 1ERUA 3DGQA 3BBYA 4FO5A 2L6CA 2PGTA 4I2UA 3F4SA 1OC9B 2PERA 3RBTA 4IVFA 1G7EA 4MMMA 3P2AA 1UC7A 1BX9A 2H0GA 2O8VB 4O5RA 5LD0A 5CRHA 3LORA 3TRPA 2DJ1A 1ACVA 1OKDA 4GSNA 3TB2A 2VLUA 2K8VA 4RUVA 2OKAA 1FVKA 1HQOA 3FK8A 5HR1A 1X5CA 2YP6A 5IIZA 3ZFBA 5GSSA 4BWQA 1PD21 1GTIA 2N5FA 3CRTA 4TW5A 3ZTLA 3H4KA 4PURA 3VWUA 4ZL8A 3WT2A 3TGZA 4L0UA 18GSA 2WULA 2MZCA 3F4RA 5KN0A 1YF0A 2E2GA 4KA0A 4XS4B 2P5RA 2A2RA 4HJ2A 1GSQA 1YJ6A 1GL8A 1F3AA 1CQGA 3D4TA 5B6NA 1EP8A 1U3AA 2DBCA 2H6YA 2R6KA 1XOBA 4ILFA 4BVYA 5B8AA 1SD9A 4JBBA 2WGRA 1UVZA 3FYGA 2OE0A 3FR6A 4MCUA 3QFBC 4JR4A 1SK2A 5J41A 3EWLA 2AYTA 2C8UA 1TK0B 3GNJA 2VO4A 2VCXA 5DALB 4MZCA 1WRYA 4EO3A 3KZQA 2N5BA 5A4VA 1VF1A 1TRSA 1CQHA 1SJ6A 2VCVA 4POKA 3GMFA 2O89A 5CRWA 1TW9A 5IM9A 1XZOA 2YV9A 4NV2A 2LQQA 4OFTA 2VM2A 3TJBA 4Q5RA 5ECLB 3TOUA 4WBRD 5ECNB 3BCIA 2DJ3A 3DMLA 4YQMA 4IHUA 5FT3A 6GSYA 4HDEA 1JZDA 1TK8B 4MH3A 1FB0A 3WD6A 3CSIA 4EC0A 1HD2A 2DJ2A 2JACA 2ES7A 2MMOA 1T4YA 5F06A 1M2BA 1LU4A 3ERGA 5D96A 4CW9A 1BJXA 2TRXA 3HVXA 1BYEA 3EINA 1WPIA 3M9KA 17GSA 4KDUA 1GNWA 4EDZA 2AAWA 5ELGA 4POBA 2B5EA 3M0FA 4J56E 2HFDA 2GSSA 1XW9A 3RPPA 4ECIA 5ECMB 1O73A 2FNOA 1X9MB 5F8BA 3GIXA 4KCEA 1OC9A 3Q19A 2VL2A 3ZREA 1PGTA 3UEMA 3H93A 4HU7A 2WCIA 2DJJA 4TXVA 3UJ1A 2DIZA 4WKWA 3U5RE 2OBKA 2V2GA 4AJ7A 1PA3A 1NHOA 3GYKA 1O8XA 2AHEA 1Z6NA 2R2JA 1EV9A 4ZBDA 3D0ZA 4GLTA 2H76A 3F3QA 3FRCA 4ZB8A 4I5QA 4IKHA 4L5LA 5ECSA 5KEJA 2YWMA 1TKDB 3BD2A 3BJ5A 4XS1A 1PKWA 1IYHA 5G30A 2OJLA 2E2MA 1R5PA 2LKUA 3ZIVA 2YANA 4WBJA 1VF4A 1A24A 1A8LA 1G6YA 4NXIA 3EYTA 1T3BA 1EGRA 1R5AA 2DMLA 3TJKA 1QQ2A 2RIIA 6GSUA 2OE3A 2IFQB 2DMMA 4XIHA 4KSMA 5IOWA 4O92A 1QK8A 2PBJA 5G31A 2YZUA 5JWQB 5DQYA 5DAKB 3GL3A 1EOHA 1HNAA 2GTUA 1K3YA 2PVOC 3APOA 1WE0A 1YEXA 1Y25A 1Q98A 3US3A 1ML6A 1VGLA 4G19A 1GSUA 5HFGA 3A2VA 3BOAA 4V2MA 1XPVA 2DLXA 1FHEA 1GTUA 2H72A 2FUG2 1AQWA 3ERWA 4YAPA 2PWJA 2JZTA 1BG5A 2ALBA 4KUNA 2YOIA 3RPNA 4HQZA 1K0DA 2YV7A 1ON4A 1SU9A 3DVWA 3ZMKA 1XVWA 2K8SA 1X9SB 2H6XA 2CZ3A 3HVSA 3GKNA 1KBNA 3F63A 4X43A 2IIYA 1S3CA 4V2NA 2CVKA 4ZILA 2YCDA 3MDKA 1XIYA 2FHEA 5JCUA 2LRTA 4K7OA 4MF6A 2B3SA 11GSA 4POMA 3H1NA 5G5EA 1GUKA 4E8EA 4LA1A 2BMXA 1F2EA 4IQ1A 3GA4A 2KOKA 5E4WA 3D21A 2JADA 5LCZA 4IS0A 4IJIA 4KB3A 3UBLA 4GWRA 2Z9SA 2H1DA 1ILOA 3UIWA 1FB6A 2L4CA 5DBQA 2JSYA 2OBIA 1AIUA 1U88A 5AN1A 5J5NA 2AV4A 2R5GA 4PQHA 3TDGA 3GV1A 4GQFA 3HA9A 3PH9A 4HU9A 2I4AA 1BAYA 2ON5A 4X0XA 3DRNA 2MYGA 2X8GA 3LXZA 4XRDA 3TCOA 2EIRA 3CSJA 1A23A 4GQCA 2HXKA 4PQIA 3SBCA 4EE0A 4HEA2 1WOUA 4V1Ag 4AJ8A 1GLQA 5AIXA 4GTUA 2B7KA 3QOUA 3IE3A 1EEJA 14GSA 2F8AA 4KGIA 5EPFA 3TJJA 2L5LA 2K9FA 3KP9A 4EF0A 3GUSA 1U87A 4D73B 4JR6A 1TOFA 3VI5A 1OC8A 2QSIA 1DUGA 3DVXA 3A5WA 1XW6A 3PR8A 1SKWB 1G6WA 4ML6A 3K8NA 2MBTA 3NIVA 3IK7A 3D5JA 1TDIA 3G7IA 1ZMAA 1PX6A 2YJHA 1ZGNA 1O81A 4K2DA 5JWRB 1TU7A 4KCAA 3MSZA 1Z6MA 3M1GA 5H5QA 5IMZA 3L4NA 3UMAA 4ZIJA 4WR5A 2VCQA 2H01A 3TOTA 3V1WA 4F0CA 22GSA 1QUWA 3DWVA 4BPYA 4L8EA 2B1KA 19GSA 2H30A 2V32A 2GSRA 1TI3A 2IMKA 2H0HA 3HJPA 2C0FA 3H79A 3WYWA 1K0AA 3PINA 1SYRA 4KH7A 1GTAA 4HOJA 4OWYA 3IHQA 4JZQA 3CTGA 3EE2A 3QDNA 2A2SA 2FD3A 4GXZA 4RI7A 2ZCTA 4HQSA 5ELAA 3M3MA 3F0IA 2PPTA 3KJYA 4TR1A 3E9JB 2K18A 5J9CA 5A4WA 4FYCA 3UBKA 3VLNA 2JSZA 3QCPA 4I2TA 3LG6A 6GSVA 2QGVA 1T4ZA 3LGCA 20GSA 5A5KA 5JWOB 2H75A 5HR0A 2YWOA 5A4UA 3GL5A 4OO4A 1SL1B 4XS6A 4IBPA 3TUEA 3SWLA 3EC3A 3FR9A 4Z7XA 4YQUA 1M2DA 1Z9HA 3GFKA 4KAEA 2P5QA 3GH6A 1E6BA 4HUAA 2LNTA 9GSSA 2HZFA 3U6VA 1Q4JA 2O85A 3KTLA 4G10A 2CVDA 3QAVA 2D2ZA 1SD8A 3QPMA 2B7JA 3TJGA 3ZMLA 1F6MC 1GUHA 3WT1A 4ECJA 3A2WA 3F6FA 3AY8A 1J08A 2VAFA 1SKSB 2FGXA 4QL9A 4ECCA 4BA7A 3ZVJA 5FWGA 1X9WB 4KDYA 5DCGA 5H5RA 1FW1A 2GLRA 2WB9A 1GSDA 1HNCA 1TI1A 1T00A 3IAM2 1ERVA 5INYA 4MA9A 3WGXA 5CRGA 1O8WA 1M9AA 1ZL9A 5J9BA 3UVTA 3ISOA 4PQ1A 3FKFA 2CZ2A 5F0GA 4D73A 2HYXA 2X8HA 2IN3A 3E0UA 1VF2A 4K7NA 2E7PA 2LRCA 1G0TA 1N2AA 3C7MA 2AJQB 3HJOA 3DEXA 1SK1A 3HYPA 12GSA 5D73A 3E3EA 2YPMA 1NHYA 5IO0A 1VRSD 5D9TA 2PMTA 3UAPA 2GDRA 5COHA 5L71A 3LYKA 2K6VA 1URMA 3HXSA 5J4UA 2HNLA 3DXBA 3HHVA 2N5AA 1XWBA 2L5OA 4TOPA 2XHFA 4MF7A 2B5YA 1Z7PA 2IJYA 3MNGA 1EP7A 3F4TA 2VUPA 4MABA 4HZ4A 4ZBBA 2LV3A 1GSYA 1JZWA 5ECKB 3HKRA 4PNGA 4KW6A 1PMTA 3KXOA 4BL7A 1DE1A 5C00A 2GZYA 2H6ZA 2RM6A 4MF5A 4N30A 1NW2A 3F8UA 1PX7A 5HQPA 2X99A 1J9BA 1SENA 4TR0A 5IPHA 2VL3A 4V1Ap 4V2LA 2XPDA 2GZPA 1V2AA 3KMNA 3CTFA 2M72A 3KP8A 5DDLA 3R2QA 1PL1A 3D6IA 1DSBA 6GSXA 1JLWA 2FLSA 2G2QA 2JU5A 2VD1A 3VPQA 1M2AA 2B6MA 2IPAA 1O85A 2R37A 1HNBA 1JZOA 1Z7RA 2CQ9A 3VK9A 4NAXA 2H70A 3EMPA 4NHWA 3CXGA 3EU4A 4GCIA 1XWGA 2LS5A 5GSTA 5B7CA 3DIEA 2LJAA 1PL2A 2WJUA 4AF2A 2TRCP 3QMXA 5JCGA 2CV4A 1TRVA 2CAQA 3J7Yk 4ISDA 1K0OA 1K0BA 2CX3A 3CSHA 3L9VA 5CREA 1WMJA 2MMNA 4GRFA 4YH2A 1T8EB 2VCTA 3QAGA 5F07A 1JZRA 4GSSA 4MDCA 1FOVA 2TIRA 4ZL9A 5IMVA 1MD4A 4WXTA 7GSSA 2YJ7A 2C80A 2C3QA 2X8CA 1A0RP 1R4WA 3C1SA 1RW1A 4MZBA 1X5DA 4NV5A 3G9BA 4TR3A 1A2LA 1JHBA 3LQ7A 2NTOA 4I8BA 2H1AA 3L0HA 4TR1B 3GRXA 4YAVA 3ZL5A 2XC2A 1GH2A 2GVPA 1PRXA 4KSOA 2HE3A 4OD7A 1EGOA 2CX4A 2M46A 1USBA 3HJMA 1WJKA 2YWNA 5D9XA 2O7KA 5IQYA 1TRWA 2PUKC 4G9HA 1YZXA 1XWKA 4HZ2A 2C3TA 5G1LA 1QFNA 2O87A 3O3TA 3TRQA 3FEUA 3QD9A 5D8IA 4JEDA 3UOMA 2M80A 3IAS2 2ZNMA 4DSRA 2B5XA 3CYNA 4PUAA 2J9HA 2H1GA 1YEPA 2NVLA 1EV4A 2CAIA 1W4VA 2LNSA 5IO2A 2LEGA 5ID2B 1MEKA 2RLIA 1SJIA 5KN3A 4ACSA 2QC7A 4JRRA 4MPFA 3ZVJD 1V57A 5DJMA 4O7HA 3I6AA 4BWSA 5FHIA 5J3RA 5G5FA 1F37A 2YWIA 2FA4A 1M9BA 2IMDA 4XHMA 5ECRB 4NWYA 3KH9A 3GN3A 3KM6A 2L59A 1F9MA 3DKSA 1WWJA 2C0GA 1O6JA 4IN0A 2VLTA 4F82A 4K8MA 2ZUPA 1GP1A 3GHAA 2I3YA 2OADA 1GWCA 2DSAA 3TRXA 1M0UA 4JE1A 1GULA 3ZIJA 3KH7A 5KN2A 2FWFA 4ZXGA 2RM5A 2GZZA 4Q5QA 1MDKA 1ZYQB 1VF3A 4KE3A 4FH8A 1I9DA 2GT6A 2IMEA 2FWEA 3KGKA 2F3MA 1EEMA 2FCHA 5D93A 1ABAA 2IWTA 4G2EA 4IP6A 3QAWA 5IMDA 1AW9A 1B4QA 1MDJA 1NSWA 3PGTA 4EVMA 1FVJA 3TKPA 5B8BA 1GSSA 3ZLPA 2C3NA 2LJKA 5IOXA 1K0MA 1G7OA 4GSTA 2I1UA 3DYRA 4LL1B 3ZYWA 1I5GA 1WIKA 1Z3EA 5CRDA 1Z5YE 5IPGA 4YQVA 1Y6EA 4TR4A 4TXOA 2R4VA 2DIYA 2I81A 1AAZA 3GX0A 3N9JA 1XCCA 3A3TA 3LJRA 1X0RA 1YQ1A 4N0ZA 6GSSA 5IMCA 1R26A 1RK4A 4RQRA 2H8LA 3FZAA 3Q6OA 1H4OA 5G2ZA 1GRXA 2GQKA 4HJMA 1THOA 6GSWA 2A4VA 3H8QA 5ECPB 4F9ZA 1N8JA 2HLSA 3HDCA 2V41A 2VOCA 1DBYA 1SJZA 1MTCA 1W89A 2GSQA 3W6GA 2PVQA 5D9VA 5ECQB 2OE1A 3CMIA 1B8XA 1S3AA 5DQSA 2NDOA 4X1UA 4TVEA 2OA7A 2WRTA 2LQOA 3F6DA 3GSTA 2V6OA 2F51A 3OR5A 5GAND 1TJDA 3KTBA 3IDVA 1PKZA 4K1FA 4ZBAA 1TP9A 4K0NA 1RQMA 4QQ7A 3MAKA 1YKAA 3WGDA 3O76A 1BQ7A 2MMZA 1UA5A 1XW5A 5ID2A 2CT6A 2C0DA 4KNDA 2QKEA 1R7HA 4K0GA 4KX4A 2OACA 2FA8A 1XBSA 3GTUA 2R3XA 2JZRA 4IW9A 3L9UA 1YDKA 1U6TA 4Q5FA 2J23A 3M8NA 2H19A 3RHBA 3BCKA 13GSA 3RAZA 4RQXA 1F3BA 1OVNA 2KHPA 1ZYEA 3Q18A 4MJCA 3GSSA 2I9HA 2RUEA 4LLRA 2GS3A 3I69A 3LFLA 2G0FA 4MLYA 2VCZA 1H75A 5CYYA 4LMVA 3W8SA 2VLVA 3KEBA 4NHZA 3DD3A 3D22A 3EVIA 5KN1A 1MDIA 1LJRA 1LBKA 3C71A 3GH9A 1V98A 3JCML 2GQLA 2EIOA 3L78A 1JFUA 4J2FA 2HT9A 5HFIA 3ME8A 3GKMA 3APSA 4FYUA 5EVOA 5F05A 3FZ9A 2KP2A 2NBSA 3G7JA 2H1BA 1K0NA 2WDUA 1T7PB 3VI7A 4XTSA 1AC1A 1OAZA 3ZZXA 1B9XC 2L57A 4N0VA 4I97A 4FIWA 3P7XA 4CHSA 1XFLA 3C73A 1K3OA 2FWHA 1A0FA 2LJRA 1IYIA 1KTEA 5G1KA 3GURA 1SL2B 2B1LA 3TKQA 2KLXA 1S3DA 4IQAA 2P0GA 2ON7A 4JU5A 4ML1A 4TRXA 1ZZYA 3I9V2 8GSSA 1OC3A 10GSA 3ED3A 3IPZA 1B9YC 3O6TA 4DVCA 2WZ9A 2DJ0A 4MP4A 2GSTA 1THXA 1V58A 3UVHA 1GSFA 3RHCA 4MJBA 4MJAA 4LL4B 3HY2A 5IMAA 3HCZA 3P90A 5ABRA 1PSQA 5DJLA 3LWAA 1OE7A 2VM1A 1MD3A 3IR4A 4O32A 2HSYA 2GT5A 4DSSB 2LUSA 5AGYA 2RUFA 2HZEB 4DSQA 2HSHA 4EKZA 4KDXA 3QR6A 4NMUA 6GSTA 3ME7A 4F03A 5CP1A 2REMA 1JLVA 4WEYA 3I43A 1V9WA 4K9ZA 2WFCA 5CNWA 2VIMA 5D9WA 4AJ6A 5CAXA 2F8FA 2LTKA 2KUCA 5ECIB 4MPGA 3L9SA 3UARA 4I6XA 5HFKA 1EWXA 2VL2C 4WF4A 4PGTA 5GZZB 3KIJA 4NPBA 1WP0A 1M7TA 4XCSA 5CO3A 2P31A 4F2IA 5DVBA 3IV4A 4ZB9A 2IMFA 1QMVA 3N5OA 2H74A 4DEJA 3CBUA 3IK9A 2X64A 2EC4A 3ZFLA 5EL8A 1EZKA 4ZL7A 2DC5A 2YZHA 2VL9A 2L4QA 1GTBA 3LSZA 1K3LA 5GAPD 1C72A 5AISA 4TXOB 4L0WA 2E0QA 3IXRA 3IOSA 1K0CA 1U3IA 4MK3A 1A2MA 1XVQA 3S9FA 3HZ4A 4XS4A 3Q74A 3FR3A 2DJKA 4F0BA 2AUVA 1ZCPA 3J7Yb 2IMIA 1OYJA 1OKTA 1GLPA 1AUCA 4IJ3A 5EY6A 1PQNA 4IGJA 1FO5A 3HVVA 3D4MA 5DCHA 3TKSE 3IC4A 2KP1A 2PN8A 4OO5A 2F9SA 4PX1A 4J57E 5ECOB 4Q5NA
chains in the Genus database with same CATH superfamily
1EOGA 3TKRA 1XG8A 1AQVA 3APQA 3GKKA 2H0IA 2GQMA 4PNFA 2MMAA 5DALA 5IMFA 1SK0A 3GX8A 4POLA 5JCWA 1SL0B 4MNNA 3WGEA 2CVBA 4H86A 3C1RA 2V1MA 1XXUA 3CRUA 1GNEA 5HR2A 4USSA 3FHKA 4ECBA 4PUFC 2PU9C 4MH2A 3IBHA 5ENUA 2MBSA 3P8WA 3VWVA 3HZ8A 1ZYNA 4EXJA 4OFMA 1V40A 1SYXA 4ULXA 2XBQA 3A2XA 4HI7A 1TU8A 2H73A 4CDOA 1PN9A 2C4JA 2LSTA 4OCEA 4HS1A 3MYDA 1ERWA 4WR4A 1J0FA 5B6MA 1B4PA 1KNGA 3FZ4A 1UN2A 5ECHB 3IRAA 3ZITA 1TTZA 2AB6A 3KCMA 5E59A 5HR3A 4TKYA 3FY7A 3C8EA 4N11A 2YN1A 1TK5B 3FZ5A 16GSA 3NOFA 1SKRB 3VURA 1X5EA 3GTUB 3IA1A 2HRFA 3EMXA 4TN8A 3FW2A 2HI7A 1NM3A 2FWGA 1BEDA 1AQXA 1KEBA 1O7UA 3TKSA 3GKXA 3LXTA 4AGSA 3KMOA 4LMWA 4GF0A 4L5OA 4Z2UA 1T1VA 4DSSA 3F9UA 1YKCA 1DE2A 4XRAA 2BJXA 3M9JA 3LYPA 4MJEA 4OMVA 4PTSA 5AIVA 2JL4A 2HZEA 1XWCA 3TKSC 3HD5A 1TRUA 4EDYA 4MZWA 2H71A 1E2YA 2GGTA 3QFAC 3NZNA 3LEFA 5BRTA 3W8JA 2C1YA 1M99A 1YF1A 3EURA 3F3RA 1GSEA 4RI6A 3G7YA 5C04A 2EIQA 2H66A 1XOAA 3VWXA 4ZB6A 2VCWA 2LRNA 3MWHA 4N10A 3IHGA 1OE8A 1M3JA 1FG4A 2VD0A 5LNKe 4WF5A 2HRNA 4K7IA 2YNXA 4K6XA 1QXHA 2L6DA 2XBIA 3ZRDA 3KD0A 1B48A 2CA8A 1ERTA 4E8HA 3RDWA 2IL3A 4EUYA 1YY7A 2V6KA 4P3YB 1HYUA 4PXOA 4EL1A 2BTOT 4ID0A 3UL3A 3VPTA 4FYBA 1A2JA 4IELA 4IP1A 4QL7A 1TXXA 1FAAA 2IFQA 4G0KA 5H5SA 3VWWA 2C0EA 3ERFA 4BVXA 2XPEA 1A8YA 1QGVA 1ZOFA 2NPBA 2FY6A 2JZSA 1GUMA 5DAKA 1AXDA 2WS2A 3EU3A 3VFIA 3TJFA 1XWAA 1ST9A 4OCFA 4OFNA 4WETA 1ERUA 3DGQA 3BBYA 4FO5A 2L6CA 2PGTA 4I2UA 2R0PA 3F4SA 1OC9B 2PERA 3RBTA 4IVFA 1G7EA 4MMMA 3P2AA 1UC7A 1BX9A 2H0GA 2O8VB 4O5RA 5LD0A 5CRHA 3LORA 3TRPA 2DJ1A 1ACVA 1OKDA 4GSNA 3TB2A 4CY8A 2VLUA 2K8VA 4RUVA 2OKAA 1FVKA 1HQOA 3FK8A 5HR1A 1X5CA 2YP6A 5IIZA 3ZFBA 5GSSA 4BWQA 1PD21 4K2XA 1GTIA 2N5FA 3CRTA 4TW5A 3ZTLA 3H4KA 4PURA 2X49A 3VWUA 4ZL8A 3WT2A 3TGZA 4L0UA 18GSA 2WULA 2MZCA 3F4RA 5KN0A 1YF0A 2E2GA 4KA0A 4XS4B 2P5RA 2A2RA 4HJ2A 1GSQA 1YJ6A 1GL8A 1F3AA 1CQGA 3D4TA 5B6NA 1EP8A 1U3AA 2DBCA 2H6YA 2R6KA 1XOBA 4ILFA 4BVYA 5B8AA 1SD9A 4JBBA 2WGRA 1UVZA 3FYGA 2OE0A 3FR6A 3QFBC 4MCUA 3EPTA 4JR4A 1SK2A 5J41A 3EWLA 2AYTA 4HSCX 2C8UA 1TK0B 1PFOA 3GNJA 2VO4A 2VCXA 5DALB 4MZCA 1WRYA 4EO3A 3KZQA 2N5BA 5A4VA 1S3RA 1VF1A 1TRSA 1CQHA 2A2PA 1SJ6A 2VCVA 4POKA 3GMFA 2O89A 5CRWA 1TW9A 5IM9A 1XZOA 2YV9A 4NV2A 2LQQA 4OFTA 2VM2A 3TJBA 4Q5RA 5ECLB 3TOUA 4WBRD 5ECNB 3BCIA 2DJ3A 3DMLA 4YQMA 4IHUA 5FT3A 6GSYA 4HDEA 1JZDA 1TK8B 4MH3A 1FB0A 3WD6A 3CSIA 4EC0A 1HD2A 2DJ2A 2JACA 2ES7A 2MMOA 1T4YA 5F06A 1M2BA 1LU4A 3ERGA 5D96A 4CW9A 1BJXA 2TRXA 3HVXA 1BYEA 3EINA 1WPIA 3M9KA 17GSA 4KDUA 1GNWA 4EDZA 2AAWA 5ELGA 4POBA 2B5EA 3M0FA 4J56E 2HFDA 4CY6A 2GSSA 1XW9A 2UZ8A 3RPPA 4ECIA 5ECMB 1O73A 2FNOA 1X9MB 5F8BA 3GIXA 4KCEA 1OC9A 3Q19A 2VL2A 3ZREA 1PGTA 3UEMA 3H93A 4HU7A 2WCIA 2DJJA 4TXVA 3UJ1A 2DIZA 4WKWA 3U5RE 2OBKA 2V2GA 4AJ7A 1PA3A 1NHOA 3GYKA 4YKFA 1O8XA 2AHEA 1Z6NA 2R2JA 1EV9A 4ZBDA 3D0ZA 4GLTA 2QA2A 2H76A 3F3QA 3FRCA 4ZB8A 4I5QA 4IKHA 4L5LA 5ECSA 5KEJA 2YWMA 1TKDB 3BD2A 3BJ5A 4XS1A 1PKWA 1IYHA 5G30A 2OJLA 2E2MA 1R5PA 2LKUA 3ZIVA 2YANA 4WBJA 1VF4A 1A24A 1A8LA 1G6YA 4NXIA 3EYTA 1T3BA 1EGRA 1R5AA 2DMLA 3TJKA 1QQ2A 2RIIA 6GSUA 2OE3A 2IFQB 2DMMA 4XIHA 4KSMA 5IOWA 4O92A 4BVXB 1QK8A 2PBJA 5G31A 2YZUA 5JWQB 5DQYA 5DAKB 3GL3A 1EOHA 1HNAA 2GTUA 1K3YA 2PVOC 3APOA 1WE0A 1YEXA 1Y25A 1Q98A 3US3A 1ML6A 1VGLA 4G19A 1GSUA 5HFGA 3A2VA 3BOAA 4V2MA 1XPVA 2DLXA 1FHEA 5KOWA 1GTUA 2H72A 2FUG2 1AQWA 3ERWA 4YAPA 2PWJA 2JZTA 1BG5A 2ALBA 4KUNA 2YOIA 3RPNA 4HQZA 1K0DA 2YV7A 1ON4A 1SU9A 3DVWA 4X4JA 3ZMKA 1XVWA 2K8SA 1X9SB 2H6XA 2CZ3A 3HVSA 3GKNA 1KBNA 3F63A 4X43A 2IIYA 1S3CA 4V2NA 2CVKA 4ZILA 2YCDA 3MDKA 1XIYA 2FHEA 5JCUA 2LRTA 4K7OA 4MF6A 2B3SA 11GSA 4POMA 3H1NA 5G5EA 1GUKA 4E8EA 4LA1A 2BMXA 1F2EA 4IQ1A 3GA4A 2KOKA 5E4WA 3D21A 2JADA 5LCZA 4IS0A 4IJIA 4KB3A 3UBLA 4GWRA 2Z9SA 2H1DA 1ILOA 3UIWA 1FB6A 2L4CA 5DBQA 2JSYA 2OBIA 1AIUA 1U88A 5AN1A 5J5NA 2AV4A 2R5GA 4PQHA 3TDGA 3GV1A 4GQFA 3HA9A 3PH9A 1M3IA 4HU9A 2I4AA 1BAYA 2ON5A 4BVYB 4X0XA 3DRNA 2MYGA 2X8GA 3LXZA 4XRDA 3TCOA 2EIRA 3CSJA 1A23A 4GQCA 2HXKA 4PQIA 3SBCA 4EE0A 4HEA2 1WOUA 4V1Ag 4AJ8A 1GLQA 5AIXA 4GTUA 2B7KA 3QOUA 3IE3A 1EEJA 14GSA 2F8AA 4KGIA 5EPFA 3TJJA 2L5LA 2K9FA 3KP9A 4EF0A 3GUSA 1U87A 3MIXA 4D73B 4K5RA 4JR6A 1TOFA 3VI5A 1OC8A 2QSIA 1DUGA 3DVXA 3A5WA 1XW6A 3PR8A 1SKWB 1G6WA 4ML6A 1PN0A 3K8NA 2MBTA 3NIVA 3IK7A 3D5JA 1TDIA 3G7IA 1ZMAA 1PX6A 2YJHA 1ZGNA 1O81A 4K2DA 5JWRB 1TU7A 4KCAA 3MSZA 1Z6MA 3M1GA 5H5QA 5IMZA 3L4NA 2QA1A 3UMAA 4ZIJA 4WR5A 2VCQA 2H01A 3TOTA 3V1WA 4F0CA 22GSA 1QUWA 3DWVA 4BPYA 4L8EA 2B1KA 19GSA 2H30A 2V32A 2GSRA 1TI3A 2IMKA 2H0HA 3HJPA 2C0FA 3H79A 3WYWA 1K0AA 3PINA 1SYRA 4KH7A 1GTAA 4HOJA 4OWYA 3IHQA 4JZQA 3CTGA 3EE2A 3QDNA 2A2SA 2FD3A 4GXZA 4RI7A 2ZCTA 4HQSA 5ELAA 3M3MA 3F0IA 2PPTA 3KJYA 4TR1A 3E9JB 2K18A 5J9CA 5A4WA 4FYCA 3UBKA 3VLNA 4YKGA 2JSZA 3QCPA 4I2TA 3LG6A 6GSVA 2QGVA 1T4ZA 3LGCA 20GSA 5A5KA 5JWOB 2H75A 5HR0A 2YWOA 5A4UA 3GL5A 4OO4A 1SL1B 4XS6A 4IBPA 3TUEA 3SWLA 3EC3A 3FR9A 4Z7XA 4YQUA 1M2DA 1Z9HA 3GFKA 4KAEA 2P5QA 3GH6A 1E6BA 4HUAA 2LNTA 9GSSA 2HZFA 3U6VA 1Q4JA 2O85A 3KTLA 4G10A 2CVDA 3QAVA 2D2ZA 1SD8A 3QPMA 2B7JA 3TJGA 3ZMLA 1F6MC 1GUHA 3WT1A 4ECJA 3A2WA 3F6FA 3AY8A 3IC8A 1J08A 2VAFA 1SKSB 2FGXA 4QL9A 4ECCA 4BA7A 3ZVJA 5FWGA 1X9WB 4KDYA 5DCGA 5H5RA 4EIQA 1FW1A 2GLRA 1ZYPA 1GSDA 2WB9A 1HNCA 1TI1A 1T00A 3IAM2 1ERVA 5INYA 4MA9A 3WGXA 5CRGA 4KF9A 1O8WA 1M9AA 1ZL9A 5J9BA 3UVTA 3ISOA 4PQ1A 3FKFA 2CZ2A 5F0GA 4D73A 2HYXA 2X8HA 2IN3A 3E0UA 1VF2A 4K7NA 2E7PA 2LRCA 1G0TA 1N2AA 2HRAA 3C7MA 2AJQB 3HJOA 3DEXA 1SK1A 3HYPA 12GSA 5D73A 3E3EA 2YPMA 1NHYA 5IO0A 1VRSD 5D9TA 2PMTA 3UAPA 2GDRA 5COHA 5L71A 3LYKA 2K6VA 1URMA 3HXSA 5J4UA 2HNLA 3DXBA 3HHVA 2N5AA 2X4AA 1XWBA 2L5OA 4TOPA 2XHFA 4MF7A 2B5YA 1Z7PA 2IJYA 3MNGA 1EP7A 3F4TA 2R0CA 2VUPA 4MABA 4HZ4A 4ZBBA 2LV3A 1GSYA 1JZWA 5ECKB 3HKRA 4PNGA 4KW6A 1PMTA 3KXOA 4BL7A 1DE1A 5C00A 2GZYA 2H6ZA 2RM6A 4MF5A 4N30A 1NW2A 3F8UA 1PX7A 5HQPA 2X99A 1J9BA 1SENA 4TR0A 5IPHA 2VL3A 4V1Ap 4V2LA 2XPDA 2GZPA 1V2AA 3KMNA 3CTFA 2M72A 3KP8A 5DDLA 3R2QA 4A5PA 1PL1A 3D6IA 1DSBA 6GSXA 1JLWA 2FLSA 2G2QA 3R3EA 2JU5A 2VD1A 3VPQA 1M2AA 2B6MA 2IPAA 1O85A 2R37A 1HNBA 1JZOA 4O5QA 1Z7RA 2CQ9A 3VK9A 4NAXA 2H70A 3EMPA 4NHWA 3CXGA 3CQFA 3EU4A 4GCIA 1XWGA 2LS5A 5GSTA 5B7CA 3DIEA 2LJAA 1PL2A 2WJUA 3HVNA 4AF2A 2TRCP 3QMXA 5JCGA 2CV4A 1TRVA 2CAQA 3J7Yk 4ISDA 4G0IA 1K0OA 1K0BA 2CX3A 3CSHA 3L9VA 5CREA 1WMJA 2MMNA 4GRFA 4YH2A 1T8EB 2VCTA 3QAGA 5F07A 1JZRA 4GSSA 4MDCA 1FOVA 2TIRA 4ZL9A 5IMVA 1MD4A 4WXTA 7GSSA 2YJ7A 2C80A 2C3QA 2X8CA 1A0RP 1R4WA 3C1SA 1RW1A 4MZBA 1X5DA 4NV5A 3G9BA 4TR3A 1A2LA 1JHBA 3LQ7A 2NTOA 4I8BA 2H1AA 3L0HA 4TR1B 3GRXA 4YAVA 3ZL5A 2XC2A 1GH2A 2GVPA 1PRXA 4KSOA 2HE3A 4OD7A 1EGOA 2CX4A 2M46A 1USBA 1FOHA 3HJMA 1WJKA 2YWNA 5D9XA 4G0LA 2O7KA 5IQYA 1TRWA 2PUKC 4G9HA 1YZXA 1XWKA 4HZ2A 2C3TA 5G1LA 1QFNA 2O87A 3O3TA 3TRQA 3FEUA 3QD9A 5D8IA 4JEDA 3UOMA 2M80A 3IAS2 2ZNMA 4DSRA 2B5XA 3CYNA 4PUAA 2J9HA 2H1GA 1YEPA 2NVLA 1EV4A 2CAIA 1W4VA 2LNSA 5IO2A 2LEGA 5ID2B 1MEKA 2RLIA 3PPUA 1SJIA 5KN3A 4ACSA 2QC7A 4JRRA 3A5IA 4MPFA 3ZVJD 1V57A 5DJMA 4O7HA 3I6AA 4BWSA 5FHIA 5J3RA 5G5FA 1F37A 2YWIA 2FA4A 1M9BA 2IMDA 4XHMA 5ECRB 4NWYA 3KH9A 3GN3A 3KM6A 2L59A 1F9MA 3DKSA 1WWJA 2HRKA 2C0GA 1O6JA 4IN0A 2VLTA 2R0GA 4F82A 4K8MA 2ZUPA 1GP1A 3GHAA 2I3YA 2OADA 1GWCA 2DSAA 3TRXA 1M0UA 4JE1A 1GULA 3ZIJA 3KH7A 5KN2A 2FWFA 4ZXGA 2RM5A 2GZZA 4Q5QA 1MDKA 1ZYQB 1VF3A 4Z2RA 4KE3A 4FH8A 1I9DA 2GT6A 2IMEA 2FWEA 3KGKA 2F3MA 1EEMA 2FCHA 5D93A 1ABAA 2IWTA 4G2EA 4IP6A 3QAWA 5IMDA 1AW9A 1B4QA 1MDJA 1NSWA 3PGTA 4EVMA 1FVJA 3TKPA 5B8BA 1GSSA 3ZLPA 2C3NA 2LJKA 5IOXA 1K0MA 1G7OA 4GSTA 2I1UA 3DYRA 4LL1B 3ZYWA 1I5GA 1WIKA 1Z3EA 5CRDA 1Z5YE 5IPGA 4YQVA 1Y6EA 4TR4A 4TXOA 2R4VA 2DIYA 2I81A 1AAZA 3GX0A 3N9JA 1XCCA 3A3TA 3LJRA 1X0RA 1YQ1A 4N0ZA 4BL7B 4Z2TA 6GSSA 5IMCA 1R26A 3LW9A 1RK4A 4RQRA 2H8LA 3FZAA 3Q6OA 1H4OA 5G2ZA 1GRXA 2GQKA 4HJMA 1THOA 6GSWA 2A4HA 2A4VA 3H8QA 5ECPB 4F9ZA 1N8JA 2HLSA 3HDCA 2V41A 2VOCA 1DBYA 1SJZA 1MTCA 1W89A 2GSQA 3W6GA 2PVQA 5D9VA 5ECQB 2OE1A 3CMIA 1B8XA 1S3AA 5DQSA 2NDOA 4X1UA 4TVEA 2OA7A 2WRTA 2LQOA 3F6DA 3GSTA 2V6OA 2F51A 3OR5A 5GAND 1TJDA 3KTBA 3IDVA 1PKZA 4K1FA 4ZBAA 1TP9A 4K0NA 1RQMA 4QQ7A 3MAKA 1YKAA 3WGDA 3O76A 1BQ7A 2MMZA 1UA5A 1XW5A 2DKHA 5ID2A 2CT6A 2C0DA 4KNDA 2QKEA 1R7HA 4K0GA 4KX4A 2OACA 2FA8A 1XBSA 3GTUA 2R3XA 2JZRA 4IW9A 3L9UA 1YDKA 1U6TA 4Q5FA 2J23A 3M8NA 2H19A 3RHBA 3BCKA 13GSA 3RAZA 4RQXA 1F3BA 1OVNA 2KHPA 1ZYEA 3Q18A 4MJCA 3GSSA 2I9HA 2RUEA 4LLRA 2GS3A 3I69A 3LFLA 2G0FA 4MLYA 2VCZA 1H75A 5CYYA 4LMVA 3W8SA 2VLVA 3KEBA 4NHZA 3DD3A 4O5UA 2HSMA 3D22A 3EVIA 5KN1A 1MDIA 1LJRA 5KOXA 1LBKA 3C71A 3GH9A 1V98A 3JCML 2GQLA 2EIOA 3L78A 1JFUA 4J2FA 2HT9A 5HFIA 3ME8A 3GKMA 3APSA 4FYUA 5EVOA 5F05A 3FZ9A 2KP2A 2NBSA 3G7JA 2H1BA 1K0NA 2WDUA 1T7PB 3VI7A 4XTSA 1AC1A 1OAZA 3ZZXA 1B9XC 2L57A 4N0VA 4I97A 4FIWA 3P7XA 4CHSA 1XFLA 3C73A 1K3OA 2FWHA 1A0FA 2LJRA 1IYIA 5BMUA 1KTEA 5G1KA 3GURA 2DKIA 1SL2B 2B1LA 4BIKA 3TKQA 2KLXA 1S3DA 4IQAA 2P0GA 2ON7A 4JU5A 4ML1A 4TRXA 1ZZYA 3I9V2 8GSSA 1OC3A 10GSA 3ED3A 3IPZA 1B9YC 3O6TA 4DVCA 2WZ9A 2DJ0A 4MP4A 2GSTA 1THXA 1V58A 3UVHA 1GSFA 3RHCA 4MJBA 4MJAA 4LL4B 3HY2A 5IMAA 3HCZA 3P90A 5ABRA 1PSQA 5DJLA 3LWAA 1OE7A 2VM1A 1MD3A 3IR4A 4O32A 2HSYA 2GT5A 4DSSB 2LUSA 5AGYA 2RUFA 2HZEB 4DSQA 2HSHA 4EKZA 4KDXA 3QR6A 4NMUA 6GSTA 3ME7A 4F03A 5CP1A 2REMA 1JLVA 4WEYA 3I43A 1V9WA 4K9ZA 2WFCA 5CNWA 2VIMA 5D9WA 4AJ6A 5CAXA 3FMWA 2F8FA 2LTKA 2KUCA 4K5SA 5ECIB 4MPGA 3L9SA 3UARA 4I6XA 5HFKA 1EWXA 4EIPA 2VL2C 4WF4A 4PGTA 5GZZB 3KIJA 4NPBA 1WP0A 1M7TA 4XCSA 5CO3A 2P31A 4F2IA 5DVBA 3IV4A 4ZB9A 2IMFA 1QMVA 3N5OA 4ICYA 2H74A 4DEJA 3CBUA 3IK9A 4FQUA 2X64A 2EC4A 3ZFLA 5EL8A 1EZKA 4ZL7A 2DC5A 2YZHA 2VL9A 2L4QA 1GTBA 3LSZA 1K3LA 5GAPD 1C72A 5AISA 4TXOB 4L0WA 2E0QA 3IXRA 3IOSA 1K0CA 1U3IA 4MK3A 1A2MA 1XVQA 3S9FA 3HZ4A 4XS4A 3Q74A 3FR3A 2DJKA 4F0BA 2AUVA 1ZCPA 3J7Yb 2IMIA 1OYJA 1OKTA 1GLPA 1AUCA 4IJ3A 5EY6A 1PQNA 4IGJA 1FO5A 3HVVA 3D4MA 5DCHA 3TKSE 3IC4A 2KP1A 2PN8A 4OO5A 2F9SA 4PX1A 4J57E 5ECOB 4Q5NA
chains in the Genus database with same CATH topology
1EOGA 3TKRA 1AQVA 3APQA 3GKKA 2H0IA 2GQMA 4PNFA 2MMAA 5DALA 5IMFA 1SK0A 3GX8A 4POLA 5JCWA 1SL0B 4MNNA 3WGEA 2CVBA 4H86A 3C1RA 2V1MA 1XXUA 3CRUA 1GNEA 5HR2A 4USSA 3FHKA 4ECBA 4PUFC 2PU9C 4MH2A 3IBHA 5ENUA 2MBSA 3P8WA 3VWVA 3HZ8A 1ZYNA 4EXJA 4OFMA 1V40A 1SYXA 4ULXA 2XBQA 3A2XA 4HI7A 1TU8A 2H73A 4CDOA 1PN9A 2C4JA 2LSTA 4OCEA 4HS1A 3MYDA 1ERWA 4WR4A 1J0FA 5B6MA 1B4PA 1KNGA 3FZ4A 1UN2A 5ECHB 3IRAA 3ZITA 1TTZA 2AB6A 3KCMA 5E59A 5HR3A 4TKYA 3FY7A 3C8EA 4N11A 2YN1A 1TK5B 3FZ5A 16GSA 3NOFA 1SKRB 3VURA 1X5EA 3GTUB 3IA1A 2HRFA 3EMXA 4TN8A 3FW2A 2HI7A 1NM3A 2FWGA 1BEDA 1AQXA 1KEBA 1O7UA 3TKSA 3GKXA 3LXTA 4AGSA 3KMOA 4LMWA 4GF0A 4L5OA 4Z2UA 1T1VA 4DSSA 3F9UA 1YKCA 1DE2A 4XRAA 2BJXA 3M9JA 3LYPA 4MJEA 4OMVA 4PTSA 5AIVA 2JL4A 2HZEA 1XWCA 3TKSC 3HD5A 1TRUA 4EDYA 4MZWA 2H71A 1E2YA 2GGTA 3QFAC 3NZNA 3LEFA 5BRTA 3W8JA 2C1YA 1M99A 1YF1A 3EURA 3F3RA 1GSEA 4RI6A 3G7YA 5C04A 2EIQA 2H66A 1XOAA 3VWXA 4ZB6A 2VCWA 2LRNA 3MWHA 4N10A 3IHGA 1OE8A 1FG4A 2VD0A 5LNKe 4WF5A 2HRNA 4K7IA 2YNXA 4K6XA 1QXHA 2L6DA 2XBIA 3ZRDA 3KD0A 1B48A 2CA8A 1ERTA 4E8HA 3RDWA 2IL3A 4EUYA 1YY7A 2V6KA 4P3YB 1HYUA 4PXOA 4EL1A 2BTOT 4ID0A 3UL3A 3VPTA 4FYBA 1A2JA 4IELA 4IP1A 4QL7A 1TXXA 1FAAA 2IFQA 4G0KA 5H5SA 3VWWA 2C0EA 3ERFA 4BVXA 2XPEA 1A8YA 1QGVA 1ZOFA 2NPBA 2FY6A 2JZSA 1GUMA 5DAKA 1AXDA 2WS2A 3EU3A 3VFIA 3TJFA 1XWAA 1ST9A 4OCFA 4OFNA 4WETA 1ERUA 3DGQA 3BBYA 4FO5A 2L6CA 2PGTA 4I2UA 2R0PA 3F4SA 1OC9B 2PERA 3RBTA 4IVFA 1G7EA 4MMMA 3P2AA 1UC7A 1BX9A 2H0GA 2O8VB 4O5RA 5LD0A 5CRHA 3LORA 3TRPA 2DJ1A 1ACVA 1OKDA 4GSNA 3TB2A 4CY8A 2VLUA 2K8VA 4RUVA 2OKAA 1FVKA 1HQOA 3FK8A 5HR1A 1X5CA 2YP6A 5IIZA 3ZFBA 5GSSA 4BWQA 1PD21 4K2XA 1GTIA 2N5FA 3CRTA 4TW5A 3ZTLA 3H4KA 4PURA 2X49A 3VWUA 4ZL8A 3WT2A 3TGZA 4L0UA 18GSA 2WULA 2MZCA 3F4RA 5KN0A 1YF0A 2E2GA 4KA0A 4XS4B 2P5RA 2A2RA 4HJ2A 1GSQA 1YJ6A 1GL8A 1F3AA 1CQGA 3D4TA 5B6NA 1EP8A 1U3AA 2DBCA 2H6YA 2R6KA 1XOBA 4ILFA 4BVYA 5B8AA 1SD9A 4JBBA 2WGRA 1UVZA 3FYGA 2OE0A 3FR6A 3QFBC 4MCUA 3EPTA 4JR4A 1SK2A 5J41A 3EWLA 2AYTA 2C8UA 1TK0B 3GNJA 2VO4A 2VCXA 5DALB 4MZCA 1WRYA 4EO3A 3KZQA 2N5BA 5A4VA 1VF1A 1TRSA 1CQHA 2A2PA 1SJ6A 2VCVA 4POKA 3GMFA 2O89A 5CRWA 1TW9A 5IM9A 1XZOA 2YV9A 4NV2A 2LQQA 4OFTA 2VM2A 3TJBA 4Q5RA 5ECLB 3TOUA 4WBRD 5ECNB 3BCIA 2DJ3A 3DMLA 4YQMA 4IHUA 5FT3A 6GSYA 4HDEA 1JZDA 1TK8B 4MH3A 1FB0A 3WD6A 3CSIA 4EC0A 1HD2A 2DJ2A 2JACA 2ES7A 2MMOA 1T4YA 5F06A 1M2BA 1LU4A 3ERGA 5D96A 4CW9A 1BJXA 2TRXA 3HVXA 1BYEA 3EINA 1WPIA 3M9KA 17GSA 4KDUA 1GNWA 4EDZA 2AAWA 5ELGA 4POBA 2B5EA 3M0FA 4J56E 2HFDA 4CY6A 2GSSA 1XW9A 2UZ8A 3RPPA 4ECIA 5ECMB 1O73A 2FNOA 1X9MB 5F8BA 3GIXA 4KCEA 1OC9A 3Q19A 2VL2A 3ZREA 1PGTA 3UEMA 3H93A 4HU7A 2WCIA 2DJJA 4TXVA 3UJ1A 2DIZA 4WKWA 3U5RE 2OBKA 2V2GA 4AJ7A 1PA3A 1NHOA 3GYKA 4YKFA 1O8XA 2AHEA 1Z6NA 2R2JA 1EV9A 4ZBDA 3D0ZA 4GLTA 2QA2A 2H76A 3F3QA 3FRCA 4ZB8A 4I5QA 4IKHA 4L5LA 5ECSA 5KEJA 2YWMA 1TKDB 3BD2A 3BJ5A 4XS1A 1PKWA 1IYHA 5G30A 2OJLA 2E2MA 1R5PA 2LKUA 3ZIVA 2YANA 4WBJA 1VF4A 1A24A 1A8LA 1G6YA 4NXIA 3EYTA 1T3BA 1EGRA 1R5AA 2DMLA 3TJKA 1QQ2A 2RIIA 6GSUA 2OE3A 2IFQB 2DMMA 4XIHA 4KSMA 5IOWA 4O92A 4BVXB 1QK8A 2PBJA 5G31A 2YZUA 5JWQB 5DQYA 5DAKB 3GL3A 1EOHA 1HNAA 2GTUA 1K3YA 2PVOC 3APOA 1WE0A 1YEXA 1Y25A 1Q98A 3US3A 1ML6A 1VGLA 4G19A 1GSUA 5HFGA 3A2VA 3BOAA 4V2MA 1XPVA 2DLXA 1FHEA 5KOWA 1GTUA 2H72A 2FUG2 1AQWA 3ERWA 4YAPA 2PWJA 2JZTA 1BG5A 2ALBA 4KUNA 2YOIA 3RPNA 4HQZA 1K0DA 2YV7A 1ON4A 1SU9A 3DVWA 4X4JA 3ZMKA 1XVWA 2K8SA 1X9SB 2H6XA 2CZ3A 3HVSA 3GKNA 1KBNA 3F63A 4X43A 2IIYA 1S3CA 4V2NA 2CVKA 4ZILA 2YCDA 3MDKA 1XIYA 2FHEA 5JCUA 2LRTA 4K7OA 4MF6A 2B3SA 11GSA 4POMA 3H1NA 5G5EA 1GUKA 4E8EA 4LA1A 2BMXA 1F2EA 4IQ1A 3GA4A 2KOKA 5E4WA 3D21A 2JADA 5LCZA 4IS0A 4IJIA 4KB3A 3UBLA 4GWRA 2Z9SA 2H1DA 1ILOA 3UIWA 1FB6A 2L4CA 5DBQA 2JSYA 2OBIA 1AIUA 1U88A 5AN1A 5J5NA 2AV4A 2R5GA 4PQHA 3TDGA 3GV1A 4GQFA 3HA9A 3PH9A 4HU9A 2I4AA 1BAYA 2ON5A 4BVYB 4X0XA 3DRNA 2MYGA 2X8GA 3LXZA 4XRDA 3TCOA 2EIRA 3CSJA 1A23A 4GQCA 2HXKA 4PQIA 3SBCA 4EE0A 4HEA2 1WOUA 4V1Ag 4AJ8A 1GLQA 5AIXA 4GTUA 2B7KA 3QOUA 3IE3A 1EEJA 14GSA 2F8AA 4KGIA 5EPFA 3TJJA 2L5LA 2K9FA 3KP9A 4EF0A 3GUSA 1U87A 3MIXA 4D73B 4K5RA 4JR6A 1TOFA 3VI5A 1OC8A 2QSIA 1DUGA 3DVXA 3A5WA 1XW6A 3PR8A 1SKWB 1G6WA 4ML6A 1PN0A 3K8NA 2MBTA 3NIVA 3IK7A 3D5JA 1TDIA 3G7IA 1ZMAA 1PX6A 2YJHA 1ZGNA 1O81A 4K2DA 5JWRB 1TU7A 4KCAA 3MSZA 1Z6MA 3M1GA 5H5QA 5IMZA 3L4NA 2QA1A 3UMAA 4ZIJA 4WR5A 2VCQA 2H01A 3TOTA 3V1WA 4F0CA 22GSA 1QUWA 3DWVA 4BPYA 4L8EA 2B1KA 19GSA 2H30A 2V32A 2GSRA 1TI3A 2IMKA 2H0HA 3HJPA 2C0FA 3H79A 3WYWA 1K0AA 3PINA 1SYRA 4KH7A 1GTAA 4HOJA 4OWYA 3IHQA 4JZQA 3CTGA 3EE2A 3QDNA 2A2SA 2FD3A 4GXZA 4RI7A 2ZCTA 4HQSA 5ELAA 3M3MA 3F0IA 2PPTA 3KJYA 4TR1A 3E9JB 2K18A 5J9CA 5A4WA 4FYCA 3UBKA 3VLNA 4YKGA 2JSZA 3QCPA 4I2TA 3LG6A 6GSVA 2QGVA 1T4ZA 3LGCA 20GSA 5A5KA 5JWOB 2H75A 5HR0A 2YWOA 5A4UA 3GL5A 4OO4A 1SL1B 4XS6A 4IBPA 3TUEA 3SWLA 3EC3A 3FR9A 4Z7XA 4YQUA 1M2DA 1Z9HA 3GFKA 4KAEA 2P5QA 3GH6A 1E6BA 4HUAA 2LNTA 9GSSA 2HZFA 3U6VA 1Q4JA 2O85A 3KTLA 4G10A 2CVDA 3QAVA 2D2ZA 1SD8A 3QPMA 2B7JA 3TJGA 3ZMLA 1F6MC 1GUHA 3WT1A 4ECJA 3A2WA 3F6FA 3AY8A 3IC8A 1J08A 2VAFA 1SKSB 2FGXA 4QL9A 4ECCA 4BA7A 3ZVJA 5FWGA 1X9WB 4KDYA 5DCGA 5H5RA 4EIQA 1FW1A 2GLRA 1ZYPA 1GSDA 2WB9A 1HNCA 1TI1A 1T00A 3IAM2 1ERVA 5INYA 4MA9A 3WGXA 5CRGA 4KF9A 1O8WA 1M9AA 1ZL9A 5J9BA 3UVTA 3ISOA 4PQ1A 3FKFA 2CZ2A 5F0GA 4D73A 2HYXA 2X8HA 2IN3A 3E0UA 1VF2A 4K7NA 2E7PA 2LRCA 1G0TA 1N2AA 2HRAA 3C7MA 2AJQB 3HJOA 3DEXA 1SK1A 3HYPA 12GSA 5D73A 3E3EA 2YPMA 1NHYA 5IO0A 1VRSD 5D9TA 2PMTA 3UAPA 2GDRA 5COHA 5L71A 3LYKA 2K6VA 1URMA 3HXSA 5J4UA 2HNLA 3DXBA 3HHVA 2N5AA 2X4AA 1XWBA 2L5OA 4TOPA 2XHFA 4MF7A 2B5YA 1Z7PA 2IJYA 3MNGA 1EP7A 3F4TA 2R0CA 2VUPA 4MABA 4HZ4A 4ZBBA 2LV3A 1GSYA 1JZWA 5ECKB 3HKRA 4PNGA 4KW6A 1PMTA 3KXOA 4BL7A 1DE1A 5C00A 2GZYA 2H6ZA 2RM6A 4MF5A 4N30A 1NW2A 3F8UA 1PX7A 5HQPA 2X99A 1J9BA 1SENA 4TR0A 5IPHA 2VL3A 4V1Ap 4V2LA 2XPDA 2GZPA 1V2AA 3KMNA 3CTFA 2M72A 3KP8A 5DDLA 3R2QA 4A5PA 1PL1A 3D6IA 1DSBA 6GSXA 1JLWA 2FLSA 2G2QA 3R3EA 2JU5A 2VD1A 3VPQA 1M2AA 2B6MA 2IPAA 1O85A 2R37A 1HNBA 1JZOA 4O5QA 1Z7RA 2CQ9A 3VK9A 4NAXA 2H70A 3EMPA 4NHWA 3CXGA 3EU4A 4GCIA 1XWGA 2LS5A 5GSTA 5B7CA 3DIEA 2LJAA 1PL2A 2WJUA 4AF2A 2TRCP 3QMXA 5JCGA 2CV4A 1TRVA 2CAQA 3J7Yk 4ISDA 4G0IA 1K0OA 1K0BA 2CX3A 3CSHA 3L9VA 5CREA 1WMJA 2MMNA 4GRFA 4YH2A 1T8EB 2VCTA 3QAGA 5F07A 1JZRA 4GSSA 4MDCA 1FOVA 2TIRA 4ZL9A 5IMVA 1MD4A 4WXTA 7GSSA 2YJ7A 2C80A 2C3QA 2X8CA 1A0RP 1R4WA 3C1SA 1RW1A 4MZBA 1X5DA 4NV5A 3G9BA 4TR3A 1A2LA 1JHBA 3LQ7A 2NTOA 4I8BA 2H1AA 3L0HA 4TR1B 3GRXA 4YAVA 3ZL5A 2XC2A 1GH2A 2GVPA 1PRXA 4KSOA 2HE3A 4OD7A 1EGOA 2CX4A 2M46A 1USBA 1FOHA 3HJMA 1WJKA 2YWNA 5D9XA 4G0LA 2O7KA 5IQYA 1TRWA 2PUKC 4G9HA 1YZXA 1XWKA 4HZ2A 2C3TA 5G1LA 1QFNA 2O87A 3O3TA 3TRQA 3FEUA 3QD9A 5D8IA 4JEDA 3UOMA 2M80A 3IAS2 2ZNMA 4DSRA 2B5XA 3CYNA 4PUAA 2J9HA 2H1GA 1YEPA 2NVLA 1EV4A 2CAIA 1W4VA 2LNSA 5IO2A 2LEGA 5ID2B 1MEKA 2RLIA 3PPUA 1SJIA 5KN3A 4ACSA 2QC7A 4JRRA 3A5IA 4MPFA 3ZVJD 1V57A 5DJMA 4O7HA 3I6AA 4BWSA 5FHIA 5J3RA 5G5FA 1F37A 2YWIA 2FA4A 1M9BA 2IMDA 4XHMA 5ECRB 4NWYA 3KH9A 3GN3A 3KM6A 2L59A 1F9MA 3DKSA 1WWJA 2HRKA 2C0GA 1O6JA 4IN0A 2VLTA 2R0GA 4F82A 4K8MA 2ZUPA 1GP1A 3GHAA 2I3YA 2OADA 1GWCA 2DSAA 3TRXA 1M0UA 4JE1A 1GULA 3ZIJA 3KH7A 5KN2A 2FWFA 4ZXGA 2RM5A 2GZZA 4Q5QA 1MDKA 1ZYQB 1VF3A 4Z2RA 4KE3A 4FH8A 1I9DA 2GT6A 2IMEA 2FWEA 3KGKA 2F3MA 1EEMA 2FCHA 5D93A 1ABAA 2IWTA 4G2EA 4IP6A 3QAWA 5IMDA 1AW9A 1B4QA 1MDJA 1NSWA 3PGTA 4EVMA 1FVJA 3TKPA 5B8BA 1GSSA 3ZLPA 2C3NA 2LJKA 5IOXA 1K0MA 1G7OA 4GSTA 2I1UA 3DYRA 4LL1B 3ZYWA 1I5GA 1WIKA 1Z3EA 5CRDA 1Z5YE 5IPGA 4YQVA 1Y6EA 4TR4A 4TXOA 2R4VA 2DIYA 2I81A 1AAZA 3GX0A 3N9JA 1XCCA 3A3TA 3LJRA 1X0RA 1YQ1A 4N0ZA 4BL7B 4Z2TA 6GSSA 5IMCA 1R26A 3LW9A 1RK4A 4RQRA 2H8LA 3FZAA 3Q6OA 1H4OA 5G2ZA 1GRXA 2GQKA 4HJMA 1THOA 6GSWA 2A4HA 2A4VA 3H8QA 5ECPB 4F9ZA 1N8JA 2HLSA 3HDCA 2V41A 2VOCA 1DBYA 1SJZA 1MTCA 1W89A 2GSQA 3W6GA 2PVQA 5D9VA 5ECQB 2OE1A 3CMIA 1B8XA 1S3AA 5DQSA 2NDOA 4X1UA 4TVEA 2OA7A 2WRTA 2LQOA 3F6DA 3GSTA 2V6OA 2F51A 3OR5A 5GAND 1TJDA 3KTBA 3IDVA 1PKZA 4K1FA 4ZBAA 1TP9A 4K0NA 1RQMA 4QQ7A 3MAKA 1YKAA 3WGDA 3O76A 1BQ7A 2MMZA 1UA5A 1XW5A 2DKHA 5ID2A 2CT6A 2C0DA 4KNDA 2QKEA 1R7HA 4K0GA 4KX4A 2OACA 2FA8A 1XBSA 3GTUA 2R3XA 2JZRA 4IW9A 3L9UA 1YDKA 1U6TA 4Q5FA 2J23A 3M8NA 2H19A 3RHBA 3BCKA 13GSA 3RAZA 4RQXA 1F3BA 1OVNA 2KHPA 1ZYEA 3Q18A 4MJCA 3GSSA 2I9HA 2RUEA 4LLRA 2GS3A 3I69A 3LFLA 2G0FA 4MLYA 2VCZA 1H75A 5CYYA 4LMVA 3W8SA 2VLVA 3KEBA 4NHZA 3DD3A 4O5UA 2HSMA 3D22A 3EVIA 5KN1A 1MDIA 1LJRA 5KOXA 1LBKA 3C71A 3GH9A 1V98A 3JCML 2GQLA 2EIOA 3L78A 1JFUA 4J2FA 2HT9A 5HFIA 3ME8A 3GKMA 3APSA 4FYUA 5EVOA 5F05A 3FZ9A 2KP2A 2NBSA 3G7JA 2H1BA 1K0NA 2WDUA 1T7PB 3VI7A 4XTSA 1AC1A 1OAZA 3ZZXA 1B9XC 2L57A 4N0VA 4I97A 4FIWA 3P7XA 4CHSA 1XFLA 3C73A 1K3OA 2FWHA 1A0FA 2LJRA 1IYIA 5BMUA 1KTEA 5G1KA 3GURA 2DKIA 1SL2B 2B1LA 3TKQA 2KLXA 1S3DA 4IQAA 2P0GA 2ON7A 4JU5A 4ML1A 4TRXA 1ZZYA 3I9V2 8GSSA 1OC3A 10GSA 3ED3A 3IPZA 1B9YC 3O6TA 4DVCA 2WZ9A 2DJ0A 4MP4A 2GSTA 1THXA 1V58A 3UVHA 1GSFA 3RHCA 4MJBA 4MJAA 4LL4B 3HY2A 5IMAA 3HCZA 3P90A 5ABRA 1PSQA 5DJLA 3LWAA 1OE7A 2VM1A 1MD3A 3IR4A 4O32A 2HSYA 2GT5A 4DSSB 2LUSA 5AGYA 2RUFA 2HZEB 4DSQA 2HSHA 4EKZA 4KDXA 3QR6A 4NMUA 6GSTA 3ME7A 4F03A 5CP1A 2REMA 1JLVA 4WEYA 3I43A 1V9WA 4K9ZA 2WFCA 5CNWA 2VIMA 5D9WA 4AJ6A 5CAXA 3FMWA 2F8FA 2LTKA 2KUCA 4K5SA 5ECIB 4MPGA 3L9SA 3UARA 4I6XA 5HFKA 1EWXA 4EIPA 2VL2C 4WF4A 4PGTA 5GZZB 3KIJA 4NPBA 1WP0A 1M7TA 4XCSA 5CO3A 2P31A 4F2IA 5DVBA 3IV4A 4ZB9A 2IMFA 1QMVA 3N5OA 4ICYA 2H74A 4DEJA 3CBUA 3IK9A 4FQUA 2X64A 2EC4A 3ZFLA 5EL8A 1EZKA 4ZL7A 2DC5A 2YZHA 2VL9A 2L4QA 1GTBA 3LSZA 1K3LA 5GAPD 1C72A 5AISA 4TXOB 4L0WA 2E0QA 3IXRA 3IOSA 1K0CA 1U3IA 4MK3A 1A2MA 1XVQA 3S9FA 3HZ4A 4XS4A 3Q74A 3FR3A 2DJKA 4F0BA 2AUVA 1ZCPA 3J7Yb 2IMIA 1OYJA 1OKTA 1GLPA 1AUCA 4IJ3A 5EY6A 1PQNA 4IGJA 1FO5A 3HVVA 3D4MA 5DCHA 3TKSE 3IC4A 2KP1A 2PN8A 4OO5A 2F9SA 4PX1A 4J57E 5ECOB 4Q5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOG A;  3TKR A;  1AQV A;  3APQ A;  3GKK A;  2H0I A;  2GQM A;  4PNF A;  2MMA A;  5DAL A;  5IMF A;  1SK0 A;  3GX8 A;  4POL A;  5JCW A;  1SL0 B;  3WGE A;  2CVB A;  4H86 A;  3C1R A;  2V1M A;  1XXU A;  3CRU A;  1GNE A;  5HR2 A;  3FHK A;  4ECB A;  4PUF C;  2PU9 C;  4MH2 A;  3IBH A;  5ENU A;  2MBS A;  3P8W A;  3VWV A;  3HZ8 A;  4EXJ A;  4OFM A;  1V40 A;  1SYX A;  4ULX A;  2XBQ A;  3A2X A;  4HI7 A;  1TU8 A;  2H73 A;  4CDO A;  1PN9 A;  2C4J A;  2LST A;  4OCE A;  4HS1 A;  1ERW A;  4WR4 A;  1J0F A;  5B6M A;  1B4P A;  1KNG A;  3FZ4 A;  1UN2 A;  5ECH B;  3IRA A;  3ZIT A;  1TTZ A;  2AB6 A;  3KCM A;  5E59 A;  5HR3 A;  4TKY A;  3FY7 A;  3C8E A;  4N11 A;  2YN1 A;  1TK5 B;  3FZ5 A;  16GS A;  3NOF A;  1SKR B;  3VUR A;  1X5E A;  3GTU B;  3IA1 A;  2HRF A;  3EMX A;  4TN8 A;  3FW2 A;  2HI7 A;  1NM3 A;  2FWG A;  1BED A;  1AQX A;  1KEB A;  1O7U A;  3TKS A;  3GKX A;  3LXT A;  4AGS A;  3KMO A;  4LMW A;  4GF0 A;  4L5O A;  1T1V A;  4DSS A;  3F9U A;  1YKC A;  1DE2 A;  4XRA A;  2BJX A;  3M9J A;  3LYP A;  4MJE A;  4OMV A;  5AIV A;  2JL4 A;  2HZE A;  1XWC A;  3TKS C;  3HD5 A;  1TRU A;  4EDY A;  4MZW A;  2H71 A;  1E2Y A;  2GGT A;  3QFA C;  3NZN A;  3LEF A;  3W8J A;  2C1Y A;  1M99 A;  1YF1 A;  3EUR A;  3F3R A;  1GSE A;  4RI6 A;  3G7Y A;  5C04 A;  2EIQ A;  2H66 A;  1XOA A;  3VWX A;  4ZB6 A;  2VCW A;  2LRN A;  3MWH A;  4N10 A;  1OE8 A;  1FG4 A;  2VD0 A;  5LNK e;  4WF5 A;  2HRN A;  4K7I A;  2YNX A;  4K6X A;  1QXH A;  2L6D A;  2XBI A;  3ZRD A;  3KD0 A;  1B48 A;  2CA8 A;  1ERT A;  4E8H A;  3RDW A;  2IL3 A;  4EUY A;  1YY7 A;  2V6K A;  4P3Y B;  1HYU A;  4PXO A;  4EL1 A;  2BTO T;  4ID0 A;  3UL3 A;  3VPT A;  4FYB A;  1A2J A;  4IEL A;  4IP1 A;  4QL7 A;  1TXX A;  1FAA A;  2IFQ A;  5H5S A;  3VWW A;  2C0E A;  3ERF A;  4BVX A;  2XPE A;  1A8Y A;  1QGV A;  1ZOF A;  2NPB A;  2FY6 A;  2JZS A;  1GUM A;  5DAK A;  1AXD A;  2WS2 A;  3EU3 A;  3VFI A;  3TJF A;  1XWA A;  1ST9 A;  4OCF A;  4OFN A;  4WET A;  1ERU A;  3DGQ A;  3BBY A;  4FO5 A;  2L6C A;  2PGT A;  4I2U A;  3F4S A;  1OC9 B;  2PER A;  3RBT A;  4IVF A;  1G7E A;  4MMM A;  3P2A A;  1UC7 A;  1BX9 A;  2H0G A;  2O8V B;  4O5R A;  5LD0 A;  5CRH A;  3LOR A;  3TRP A;  2DJ1 A;  1ACV A;  1OKD A;  4GSN A;  3TB2 A;  2VLU A;  2K8V A;  4RUV A;  2OKA A;  1FVK A;  1HQO A;  3FK8 A;  5HR1 A;  1X5C A;  2YP6 A;  5IIZ A;  3ZFB A;  5GSS A;  4BWQ A;  1PD2 1;  1GTI A;  2N5F A;  3CRT A;  4TW5 A;  3ZTL A;  3H4K A;  4PUR A;  3VWU A;  4ZL8 A;  3WT2 A;  3TGZ A;  4L0U A;  18GS A;  2WUL A;  2MZC A;  3F4R A;  5KN0 A;  1YF0 A;  2E2G A;  4KA0 A;  4XS4 B;  2P5R A;  2A2R A;  4HJ2 A;  1GSQ A;  1YJ6 A;  1GL8 A;  1F3A A;  1CQG A;  3D4T A;  5B6N A;  1EP8 A;  1U3A A;  2DBC A;  2H6Y A;  2R6K A;  1XOB A;  4ILF A;  4BVY A;  5B8A A;  1SD9 A;  4JBB A;  2WGR A;  1UVZ A;  3FYG A;  2OE0 A;  3FR6 A;  4MCU A;  3QFB C;  4JR4 A;  1SK2 A;  5J41 A;  3EWL A;  2AYT A;  2C8U A;  1TK0 B;  3GNJ A;  2VO4 A;  2VCX A;  5DAL B;  4MZC A;  1WRY A;  4EO3 A;  3KZQ A;  2N5B A;  5A4V A;  1VF1 A;  1TRS A;  1CQH A;  1SJ6 A;  2VCV A;  4POK A;  3GMF A;  2O89 A;  5CRW A;  1TW9 A;  5IM9 A;  1XZO A;  2YV9 A;  4NV2 A;  2LQQ A;  4OFT A;  2VM2 A;  3TJB A;  4Q5R A;  5ECL B;  3TOU A;  4WBR D;  5ECN B;  3BCI A;  2DJ3 A;  3DML A;  4YQM A;  4IHU A;  5FT3 A;  6GSY A;  4HDE A;  1JZD A;  1TK8 B;  4MH3 A;  1FB0 A;  3WD6 A;  3CSI A;  4EC0 A;  1HD2 A;  2DJ2 A;  2JAC A;  2ES7 A;  2MMO A;  1T4Y A;  5F06 A;  1M2B A;  1LU4 A;  3ERG A;  5D96 A;  4CW9 A;  1BJX A;  2TRX A;  3HVX A;  1BYE A;  3EIN A;  1WPI A;  3M9K A;  17GS A;  4KDU A;  1GNW A;  4EDZ A;  2AAW A;  5ELG A;  4POB A;  2B5E A;  3M0F A;  4J56 E;  2HFD A;  2GSS A;  1XW9 A;  3RPP A;  4ECI A;  5ECM B;  1O73 A;  2FNO A;  1X9M B;  5F8B A;  3GIX A;  4KCE A;  1OC9 A;  3Q19 A;  2VL2 A;  3ZRE A;  1PGT A;  3UEM A;  3H93 A;  4HU7 A;  2WCI A;  2DJJ A;  4TXV A;  3UJ1 A;  2DIZ A;  4WKW A;  3U5R E;  2OBK A;  2V2G A;  4AJ7 A;  1PA3 A;  1NHO A;  3GYK A;  1O8X A;  2AHE A;  1Z6N A;  2R2J A;  1EV9 A;  4ZBD A;  3D0Z A;  4GLT A;  2H76 A;  3F3Q A;  3FRC A;  4ZB8 A;  4I5Q A;  4IKH A;  4L5L A;  5ECS A;  5KEJ A;  2YWM A;  1TKD B;  3BD2 A;  3BJ5 A;  4XS1 A;  1PKW A;  1IYH A;  5G30 A;  2OJL A;  2E2M A;  1R5P A;  2LKU A;  3ZIV A;  2YAN A;  4WBJ A;  1VF4 A;  1A24 A;  1A8L A;  1G6Y A;  4NXI A;  3EYT A;  1T3B A;  1EGR A;  1R5A A;  2DML A;  3TJK A;  1QQ2 A;  2RII A;  6GSU A;  2OE3 A;  2IFQ B;  2DMM A;  4XIH A;  4KSM A;  5IOW A;  4O92 A;  1QK8 A;  2PBJ A;  5G31 A;  2YZU A;  5JWQ B;  5DQY A;  5DAK B;  3GL3 A;  1EOH A;  1HNA A;  2GTU A;  1K3Y A;  2PVO C;  3APO A;  1WE0 A;  1YEX A;  1Y25 A;  1Q98 A;  3US3 A;  1ML6 A;  1VGL A;  4G19 A;  1GSU A;  5HFG A;  3A2V A;  3BOA A;  4V2M A;  1XPV A;  2DLX A;  1FHE A;  1GTU A;  2H72 A;  2FUG 2;  1AQW A;  3ERW A;  4YAP A;  2PWJ A;  2JZT A;  1BG5 A;  2ALB A;  4KUN A;  2YOI A;  3RPN A;  4HQZ A;  1K0D A;  2YV7 A;  1ON4 A;  1SU9 A;  3DVW A;  3ZMK A;  1XVW A;  2K8S A;  1X9S B;  2H6X A;  2CZ3 A;  3HVS A;  3GKN A;  1KBN A;  3F63 A;  4X43 A;  2IIY A;  1S3C A;  4V2N A;  2CVK A;  4ZIL A;  2YCD A;  3MDK A;  1XIY A;  2FHE A;  5JCU A;  2LRT A;  4K7O A;  4MF6 A;  2B3S A;  11GS A;  4POM A;  3H1N A;  5G5E A;  1GUK A;  4E8E A;  4LA1 A;  2BMX A;  1F2E A;  4IQ1 A;  3GA4 A;  2KOK A;  5E4W A;  3D21 A;  2JAD A;  5LCZ A;  4IS0 A;  4IJI A;  4KB3 A;  3UBL A;  4GWR A;  2Z9S A;  2H1D A;  1ILO A;  3UIW A;  1FB6 A;  2L4C A;  5DBQ A;  2JSY A;  2OBI A;  1AIU A;  1U88 A;  5AN1 A;  5J5N A;  2AV4 A;  2R5G A;  4PQH A;  3TDG A;  3GV1 A;  4GQF A;  3HA9 A;  3PH9 A;  4HU9 A;  2I4A A;  1BAY A;  2ON5 A;  4X0X A;  3DRN A;  2MYG A;  2X8G A;  3LXZ A;  4XRD A;  3TCO A;  2EIR A;  3CSJ A;  1A23 A;  4GQC A;  2HXK A;  4PQI A;  3SBC A;  4EE0 A;  4HEA 2;  1WOU A;  4V1A g;  4AJ8 A;  1GLQ A;  5AIX A;  4GTU A;  2B7K A;  3QOU A;  3IE3 A;  1EEJ A;  14GS A;  2F8A A;  4KGI A;  5EPF A;  3TJJ A;  2L5L A;  2K9F A;  3KP9 A;  4EF0 A;  3GUS A;  1U87 A;  4D73 B;  4JR6 A;  1TOF A;  3VI5 A;  1OC8 A;  2QSI A;  1DUG A;  3DVX A;  3A5W A;  1XW6 A;  3PR8 A;  1SKW B;  1G6W A;  4ML6 A;  3K8N A;  2MBT A;  3NIV A;  3IK7 A;  3D5J A;  1TDI A;  3G7I A;  1ZMA A;  1PX6 A;  2YJH A;  1ZGN A;  1O81 A;  4K2D A;  5JWR B;  1TU7 A;  4KCA A;  3MSZ A;  1Z6M A;  3M1G A;  5H5Q A;  5IMZ A;  3L4N A;  3UMA A;  4ZIJ A;  4WR5 A;  2VCQ A;  2H01 A;  3TOT A;  3V1W A;  4F0C A;  22GS A;  1QUW A;  3DWV A;  4BPY A;  4L8E A;  2B1K A;  19GS A;  2H30 A;  2V32 A;  2GSR A;  1TI3 A;  2IMK A;  2H0H A;  3HJP A;  2C0F A;  3H79 A;  3WYW A;  1K0A A;  3PIN A;  1SYR A;  4KH7 A;  1GTA A;  4HOJ A;  4OWY A;  3IHQ A;  4JZQ A;  3CTG A;  3EE2 A;  3QDN A;  2A2S A;  2FD3 A;  4GXZ A;  4RI7 A;  2ZCT A;  4HQS A;  5ELA A;  3M3M A;  3F0I A;  2PPT A;  3KJY A;  4TR1 A;  3E9J B;  2K18 A;  5J9C A;  5A4W A;  4FYC A;  3UBK A;  3VLN A;  2JSZ A;  3QCP A;  4I2T A;  3LG6 A;  6GSV A;  2QGV A;  1T4Z A;  3LGC A;  20GS A;  5A5K A;  5JWO B;  2H75 A;  5HR0 A;  2YWO A;  5A4U A;  3GL5 A;  4OO4 A;  1SL1 B;  4XS6 A;  4IBP A;  3TUE A;  3SWL A;  3EC3 A;  3FR9 A;  4Z7X A;  4YQU A;  1M2D A;  1Z9H A;  3GFK A;  4KAE A;  2P5Q A;  3GH6 A;  1E6B A;  4HUA A;  2LNT A;  9GSS A;  2HZF A;  3U6V A;  1Q4J A;  2O85 A;  3KTL A;  4G10 A;  2CVD A;  3QAV A;  2D2Z A;  1SD8 A;  3QPM A;  2B7J A;  3TJG A;  3ZML A;  1F6M C;  1GUH A;  3WT1 A;  4ECJ A;  3A2W A;  3F6F A;  3AY8 A;  1J08 A;  2VAF A;  1SKS B;  2FGX A;  4QL9 A;  4ECC A;  4BA7 A;  3ZVJ A;  5FWG A;  1X9W B;  4KDY A;  5DCG A;  5H5R A;  1FW1 A;  2GLR A;  2WB9 A;  1GSD A;  1HNC A;  1TI1 A;  1T00 A;  3IAM 2;  1ERV A;  5INY A;  4MA9 A;  3WGX A;  5CRG A;  1O8W A;  1M9A A;  1ZL9 A;  5J9B A;  3UVT A;  3ISO A;  4PQ1 A;  3FKF A;  2CZ2 A;  5F0G A;  4D73 A;  2HYX A;  2X8H A;  2IN3 A;  3E0U A;  1VF2 A;  4K7N A;  2E7P A;  2LRC A;  1G0T A;  1N2A A;  3C7M A;  2AJQ B;  3HJO A;  3DEX A;  1SK1 A;  3HYP A;  12GS A;  5D73 A;  3E3E A;  2YPM A;  1NHY A;  5IO0 A;  1VRS D;  5D9T A;  2PMT A;  3UAP A;  2GDR A;  5COH A;  5L71 A;  3LYK A;  2K6V A;  1URM A;  3HXS A;  5J4U A;  2HNL A;  3DXB A;  3HHV A;  2N5A A;  1XWB A;  2L5O A;  4TOP A;  2XHF A;  4MF7 A;  2B5Y A;  1Z7P A;  2IJY A;  3MNG A;  1EP7 A;  3F4T A;  2VUP A;  4MAB A;  4HZ4 A;  4ZBB A;  2LV3 A;  1GSY A;  1JZW A;  5ECK B;  3HKR A;  4PNG A;  4KW6 A;  1PMT A;  3KXO A;  4BL7 A;  1DE1 A;  5C00 A;  2GZY A;  2H6Z A;  2RM6 A;  4MF5 A;  4N30 A;  1NW2 A;  3F8U A;  1PX7 A;  5HQP A;  2X99 A;  1J9B A;  1SEN A;  4TR0 A;  5IPH A;  2VL3 A;  4V1A p;  4V2L A;  2XPD A;  2GZP A;  1V2A A;  3KMN A;  3CTF A;  2M72 A;  3KP8 A;  5DDL A;  3R2Q A;  1PL1 A;  3D6I A;  1DSB A;  6GSX A;  1JLW A;  2FLS A;  2G2Q A;  2JU5 A;  2VD1 A;  3VPQ A;  1M2A A;  2B6M A;  2IPA A;  1O85 A;  2R37 A;  1HNB A;  1JZO A;  1Z7R A;  2CQ9 A;  3VK9 A;  4NAX A;  2H70 A;  3EMP A;  4NHW A;  3CXG A;  3EU4 A;  4GCI A;  1XWG A;  2LS5 A;  5GST A;  5B7C A;  3DIE A;  2LJA A;  1PL2 A;  2WJU A;  4AF2 A;  2TRC P;  3QMX A;  5JCG A;  2CV4 A;  1TRV A;  2CAQ A;  3J7Y k;  4ISD A;  1K0O A;  1K0B A;  2CX3 A;  3CSH A;  3L9V A;  5CRE A;  1WMJ A;  2MMN A;  4GRF A;  4YH2 A;  1T8E B;  2VCT A;  3QAG A;  5F07 A;  1JZR A;  4GSS A;  4MDC A;  1FOV A;  2TIR A;  4ZL9 A;  5IMV A;  1MD4 A;  4WXT A;  7GSS A;  2YJ7 A;  2C80 A;  2C3Q A;  2X8C A;  1A0R P;  1R4W A;  3C1S A;  1RW1 A;  4MZB A;  1X5D A;  4NV5 A;  3G9B A;  4TR3 A;  1A2L A;  1JHB A;  3LQ7 A;  2NTO A;  4I8B A;  2H1A A;  3L0H A;  4TR1 B;  3GRX A;  4YAV A;  3ZL5 A;  2XC2 A;  1GH2 A;  2GVP A;  1PRX A;  4KSO A;  2HE3 A;  4OD7 A;  1EGO A;  2CX4 A;  2M46 A;  1USB A;  3HJM A;  1WJK A;  2YWN A;  5D9X A;  2O7K A;  5IQY A;  1TRW A;  2PUK C;  4G9H A;  1YZX A;  1XWK A;  4HZ2 A;  2C3T A;  5G1L A;  1QFN A;  2O87 A;  3O3T A;  3TRQ A;  3FEU A;  3QD9 A;  5D8I A;  4JED A;  3UOM A;  2M80 A;  3IAS 2;  2ZNM A;  4DSR A;  2B5X A;  3CYN A;  4PUA A;  2J9H A;  2H1G A;  1YEP A;  2NVL A;  1EV4 A;  2CAI A;  1W4V A;  2LNS A;  5IO2 A;  2LEG A;  5ID2 B;  1MEK A;  2RLI A;  1SJI A;  5KN3 A;  4ACS A;  2QC7 A;  4JRR A;  4MPF A;  3ZVJ D;  1V57 A;  5DJM A;  4O7H A;  3I6A A;  4BWS A;  5FHI A;  5J3R A;  5G5F A;  1F37 A;  2YWI A;  2FA4 A;  1M9B A;  2IMD A;  4XHM A;  5ECR B;  4NWY A;  3KH9 A;  3GN3 A;  3KM6 A;  2L59 A;  1F9M A;  3DKS A;  1WWJ A;  2C0G A;  1O6J A;  4IN0 A;  2VLT A;  4F82 A;  4K8M A;  2ZUP A;  1GP1 A;  3GHA A;  2I3Y A;  2OAD A;  1GWC A;  2DSA A;  3TRX A;  1M0U A;  4JE1 A;  1GUL A;  3ZIJ A;  3KH7 A;  5KN2 A;  2FWF A;  4ZXG A;  2RM5 A;  2GZZ A;  4Q5Q A;  1MDK A;  1ZYQ B;  1VF3 A;  4KE3 A;  4FH8 A;  1I9D A;  2GT6 A;  2IME A;  2FWE A;  3KGK A;  2F3M A;  1EEM A;  2FCH A;  5D93 A;  1ABA A;  2IWT A;  4G2E A;  4IP6 A;  3QAW A;  5IMD A;  1AW9 A;  1B4Q A;  1MDJ A;  1NSW A;  3PGT A;  4EVM A;  1FVJ A;  3TKP A;  5B8B A;  1GSS A;  3ZLP A;  2C3N A;  2LJK A;  5IOX A;  1K0M A;  1G7O A;  4GST A;  2I1U A;  3DYR A;  4LL1 B;  3ZYW A;  1I5G A;  1WIK A;  1Z3E A;  5CRD A;  1Z5Y E;  5IPG A;  4YQV A;  1Y6E A;  4TR4 A;  4TXO A;  2R4V A;  2DIY A;  2I81 A;  1AAZ A;  3GX0 A;  3N9J A;  1XCC A;  3A3T A;  3LJR A;  1X0R A;  1YQ1 A;  4N0Z A;  6GSS A;  5IMC A;  1R26 A;  1RK4 A;  4RQR A;  2H8L A;  3FZA A;  3Q6O A;  1H4O A;  5G2Z A;  1GRX A;  2GQK A;  4HJM A;  1THO A;  6GSW A;  2A4V A;  3H8Q A;  5ECP B;  4F9Z A;  1N8J A;  2HLS A;  3HDC A;  2V41 A;  2VOC A;  1DBY A;  1SJZ A;  1MTC A;  1W89 A;  2GSQ A;  3W6G A;  2PVQ A;  5D9V A;  5ECQ B;  2OE1 A;  3CMI A;  1B8X A;  1S3A A;  5DQS A;  2NDO A;  4X1U A;  4TVE A;  2OA7 A;  2WRT A;  2LQO A;  3F6D A;  3GST A;  2V6O A;  2F51 A;  3OR5 A;  5GAN D;  1TJD A;  3KTB A;  3IDV A;  1PKZ A;  4K1F A;  4ZBA A;  1TP9 A;  4K0N A;  1RQM A;  4QQ7 A;  3MAK A;  1YKA A;  3WGD A;  3O76 A;  1BQ7 A;  2MMZ A;  1UA5 A;  1XW5 A;  5ID2 A;  2CT6 A;  2C0D A;  4KND A;  2QKE A;  1R7H A;  4K0G A;  4KX4 A;  2OAC A;  2FA8 A;  1XBS A;  3GTU A;  2R3X A;  2JZR A;  4IW9 A;  3L9U A;  1YDK A;  1U6T A;  4Q5F A;  2J23 A;  3M8N A;  2H19 A;  3RHB A;  3BCK A;  13GS A;  3RAZ A;  4RQX A;  1F3B A;  1OVN A;  2KHP A;  1ZYE A;  3Q18 A;  4MJC A;  3GSS A;  2I9H A;  2RUE A;  4LLR A;  2GS3 A;  3I69 A;  3LFL A;  2G0F A;  4MLY A;  2VCZ A;  1H75 A;  5CYY A;  4LMV A;  3W8S A;  2VLV A;  3KEB A;  4NHZ A;  3DD3 A;  3D22 A;  3EVI A;  5KN1 A;  1MDI A;  1LJR A;  1LBK A;  3C71 A;  3GH9 A;  1V98 A;  3JCM L;  2GQL A;  2EIO A;  3L78 A;  1JFU A;  4J2F A;  2HT9 A;  5HFI A;  3ME8 A;  3GKM A;  3APS A;  4FYU A;  5EVO A;  5F05 A;  3FZ9 A;  2KP2 A;  2NBS A;  3G7J A;  2H1B A;  1K0N A;  2WDU A;  1T7P B;  3VI7 A;  4XTS A;  1AC1 A;  1OAZ A;  3ZZX A;  1B9X C;  2L57 A;  4N0V A;  4I97 A;  4FIW A;  3P7X A;  4CHS A;  1XFL A;  3C73 A;  1K3O A;  2FWH A;  1A0F A;  2LJR A;  1IYI A;  1KTE A;  5G1K A;  3GUR A;  1SL2 B;  2B1L A;  3TKQ A;  2KLX A;  1S3D A;  4IQA A;  2P0G A;  2ON7 A;  4JU5 A;  4ML1 A;  4TRX A;  1ZZY A;  3I9V 2;  8GSS A;  1OC3 A;  10GS A;  3ED3 A;  3IPZ A;  1B9Y C;  3O6T A;  4DVC A;  2WZ9 A;  2DJ0 A;  4MP4 A;  2GST A;  1THX A;  1V58 A;  3UVH A;  1GSF A;  3RHC A;  4MJB A;  4MJA A;  4LL4 B;  3HY2 A;  5IMA A;  3HCZ A;  3P90 A;  5ABR A;  1PSQ A;  5DJL A;  3LWA A;  1OE7 A;  2VM1 A;  1MD3 A;  3IR4 A;  4O32 A;  2HSY A;  2GT5 A;  4DSS B;  2LUS A;  5AGY A;  2RUF A;  2HZE B;  4DSQ A;  2HSH A;  4EKZ A;  4KDX A;  3QR6 A;  4NMU A;  6GST A;  3ME7 A;  4F03 A;  5CP1 A;  2REM A;  1JLV A;  4WEY A;  3I43 A;  1V9W A;  4K9Z A;  2WFC A;  5CNW A;  2VIM A;  5D9W A;  4AJ6 A;  5CAX A;  2F8F A;  2LTK A;  2KUC A;  5ECI B;  4MPG A;  3L9S A;  3UAR A;  4I6X A;  5HFK A;  1EWX A;  2VL2 C;  4WF4 A;  4PGT A;  5GZZ B;  3KIJ A;  4NPB A;  1WP0 A;  1M7T A;  4XCS A;  5CO3 A;  2P31 A;  4F2I A;  5DVB A;  3IV4 A;  4ZB9 A;  2IMF A;  1QMV A;  3N5O A;  2H74 A;  4DEJ A;  3CBU A;  3IK9 A;  2X64 A;  2EC4 A;  3ZFL A;  5EL8 A;  1EZK A;  4ZL7 A;  2DC5 A;  2YZH A;  2VL9 A;  2L4Q A;  1GTB A;  3LSZ A;  1K3L A;  5GAP D;  1C72 A;  5AIS A;  4TXO B;  4L0W A;  2E0Q A;  3IXR A;  3IOS A;  1K0C A;  1U3I A;  4MK3 A;  1A2M A;  1XVQ A;  3S9F A;  3HZ4 A;  4XS4 A;  3Q74 A;  3FR3 A;  2DJK A;  4F0B A;  2AUV A;  1ZCP A;  3J7Y b;  2IMI A;  1OYJ A;  1OKT A;  1GLP A;  1AUC A;  4IJ3 A;  5EY6 A;  1PQN A;  4IGJ A;  1FO5 A;  3HVV A;  3D4M A;  5DCH A;  3TKS E;  3IC4 A;  2KP1 A;  2PN8 A;  4OO5 A;  2F9S A;  4PX1 A;  4J57 E;  5ECO B;  4Q5N A; 
#chains in the Genus database with same CATH topology
 1EOG A;  3TKR A;  1XG8 A;  1AQV A;  3APQ A;  3GKK A;  2H0I A;  2GQM A;  4PNF A;  2MMA A;  5DAL A;  5IMF A;  1SK0 A;  3GX8 A;  4POL A;  5JCW A;  1SL0 B;  4MNN A;  3WGE A;  2CVB A;  4H86 A;  3C1R A;  2V1M A;  1XXU A;  3CRU A;  1GNE A;  5HR2 A;  4USS A;  3FHK A;  4ECB A;  4PUF C;  2PU9 C;  4MH2 A;  3IBH A;  5ENU A;  2MBS A;  3P8W A;  3VWV A;  3HZ8 A;  1ZYN A;  4EXJ A;  4OFM A;  1V40 A;  1SYX A;  4ULX A;  2XBQ A;  3A2X A;  4HI7 A;  1TU8 A;  2H73 A;  4CDO A;  1PN9 A;  2C4J A;  2LST A;  4OCE A;  4HS1 A;  3MYD A;  1ERW A;  4WR4 A;  1J0F A;  5B6M A;  1B4P A;  1KNG A;  3FZ4 A;  1UN2 A;  5ECH B;  3IRA A;  3ZIT A;  1TTZ A;  2AB6 A;  3KCM A;  5E59 A;  5HR3 A;  4TKY A;  3FY7 A;  3C8E A;  4N11 A;  2YN1 A;  1TK5 B;  3FZ5 A;  16GS A;  3NOF A;  1SKR B;  3VUR A;  1X5E A;  3GTU B;  3IA1 A;  2HRF A;  3EMX A;  4TN8 A;  3FW2 A;  2HI7 A;  1NM3 A;  2FWG A;  1BED A;  1AQX A;  1KEB A;  1O7U A;  3TKS A;  3GKX A;  3LXT A;  4AGS A;  3KMO A;  4LMW A;  4GF0 A;  4L5O A;  4Z2U A;  1T1V A;  4DSS A;  3F9U A;  1YKC A;  1DE2 A;  4XRA A;  2BJX A;  3M9J A;  3LYP A;  4MJE A;  4OMV A;  4PTS A;  5AIV A;  2JL4 A;  2HZE A;  1XWC A;  3TKS C;  3HD5 A;  1TRU A;  4EDY A;  4MZW A;  2H71 A;  1E2Y A;  2GGT A;  3QFA C;  3NZN A;  3LEF A;  5BRT A;  3W8J A;  2C1Y A;  1M99 A;  1YF1 A;  3EUR A;  3F3R A;  1GSE A;  4RI6 A;  3G7Y A;  5C04 A;  2EIQ A;  2H66 A;  1XOA A;  3VWX A;  4ZB6 A;  2VCW A;  2LRN A;  3MWH A;  4N10 A;  3IHG A;  1OE8 A;  1M3J A;  1FG4 A;  2VD0 A;  5LNK e;  4WF5 A;  2HRN A;  4K7I A;  2YNX A;  4K6X A;  1QXH A;  2L6D A;  2XBI A;  3ZRD A;  3KD0 A;  1B48 A;  2CA8 A;  1ERT A;  4E8H A;  3RDW A;  2IL3 A;  4EUY A;  1YY7 A;  2V6K A;  4P3Y B;  1HYU A;  4PXO A;  4EL1 A;  2BTO T;  4ID0 A;  3UL3 A;  3VPT A;  4FYB A;  1A2J A;  4IEL A;  4IP1 A;  4QL7 A;  1TXX A;  1FAA A;  2IFQ A;  4G0K A;  5H5S A;  3VWW A;  2C0E A;  3ERF A;  4BVX A;  2XPE A;  1A8Y A;  1QGV A;  1ZOF A;  2NPB A;  2FY6 A;  2JZS A;  1GUM A;  5DAK A;  1AXD A;  2WS2 A;  3EU3 A;  3VFI A;  3TJF A;  1XWA A;  1ST9 A;  4OCF A;  4OFN A;  4WET A;  1ERU A;  3DGQ A;  3BBY A;  4FO5 A;  2L6C A;  2PGT A;  4I2U A;  2R0P A;  3F4S A;  1OC9 B;  2PER A;  3RBT A;  4IVF A;  1G7E A;  4MMM A;  3P2A A;  1UC7 A;  1BX9 A;  2H0G A;  2O8V B;  4O5R A;  5LD0 A;  5CRH A;  3LOR A;  3TRP A;  2DJ1 A;  1ACV A;  1OKD A;  4GSN A;  3TB2 A;  4CY8 A;  2VLU A;  2K8V A;  4RUV A;  2OKA A;  1FVK A;  1HQO A;  3FK8 A;  5HR1 A;  1X5C A;  2YP6 A;  5IIZ A;  3ZFB A;  5GSS A;  4BWQ A;  1PD2 1;  4K2X A;  1GTI A;  2N5F A;  3CRT A;  4TW5 A;  3ZTL A;  3H4K A;  4PUR A;  2X49 A;  3VWU A;  4ZL8 A;  3WT2 A;  3TGZ A;  4L0U A;  18GS A;  2WUL A;  2MZC A;  3F4R A;  5KN0 A;  1YF0 A;  2E2G A;  4KA0 A;  4XS4 B;  2P5R A;  2A2R A;  4HJ2 A;  1GSQ A;  1YJ6 A;  1GL8 A;  1F3A A;  1CQG A;  3D4T A;  5B6N A;  1EP8 A;  1U3A A;  2DBC A;  2H6Y A;  2R6K A;  1XOB A;  4ILF A;  4BVY A;  5B8A A;  1SD9 A;  4JBB A;  2WGR A;  1UVZ A;  3FYG A;  2OE0 A;  3FR6 A;  3QFB C;  4MCU A;  3EPT A;  4JR4 A;  1SK2 A;  5J41 A;  3EWL A;  2AYT A;  4HSC X;  2C8U A;  1TK0 B;  1PFO A;  3GNJ A;  2VO4 A;  2VCX A;  5DAL B;  4MZC A;  1WRY A;  4EO3 A;  3KZQ A;  2N5B A;  5A4V A;  1S3R A;  1VF1 A;  1TRS A;  1CQH A;  2A2P A;  1SJ6 A;  2VCV A;  4POK A;  3GMF A;  2O89 A;  5CRW A;  1TW9 A;  5IM9 A;  1XZO A;  2YV9 A;  4NV2 A;  2LQQ A;  4OFT A;  2VM2 A;  3TJB A;  4Q5R A;  5ECL B;  3TOU A;  4WBR D;  5ECN B;  3BCI A;  2DJ3 A;  3DML A;  4YQM A;  4IHU A;  5FT3 A;  6GSY A;  4HDE A;  1JZD A;  1TK8 B;  4MH3 A;  1FB0 A;  3WD6 A;  3CSI A;  4EC0 A;  1HD2 A;  2DJ2 A;  2JAC A;  2ES7 A;  2MMO A;  1T4Y A;  5F06 A;  1M2B A;  1LU4 A;  3ERG A;  5D96 A;  4CW9 A;  1BJX A;  2TRX A;  3HVX A;  1BYE A;  3EIN A;  1WPI A;  3M9K A;  17GS A;  4KDU A;  1GNW A;  4EDZ A;  2AAW A;  5ELG A;  4POB A;  2B5E A;  3M0F A;  4J56 E;  2HFD A;  4CY6 A;  2GSS A;  1XW9 A;  2UZ8 A;  3RPP A;  4ECI A;  5ECM B;  1O73 A;  2FNO A;  1X9M B;  5F8B A;  3GIX A;  4KCE A;  1OC9 A;  3Q19 A;  2VL2 A;  3ZRE A;  1PGT A;  3UEM A;  3H93 A;  4HU7 A;  2WCI A;  2DJJ A;  4TXV A;  3UJ1 A;  2DIZ A;  4WKW A;  3U5R E;  2OBK A;  2V2G A;  4AJ7 A;  1PA3 A;  1NHO A;  3GYK A;  4YKF A;  1O8X A;  2AHE A;  1Z6N A;  2R2J A;  1EV9 A;  4ZBD A;  3D0Z A;  4GLT A;  2QA2 A;  2H76 A;  3F3Q A;  3FRC A;  4ZB8 A;  4I5Q A;  4IKH A;  4L5L A;  5ECS A;  5KEJ A;  2YWM A;  1TKD B;  3BD2 A;  3BJ5 A;  4XS1 A;  1PKW A;  1IYH A;  5G30 A;  2OJL A;  2E2M A;  1R5P A;  2LKU A;  3ZIV A;  2YAN A;  4WBJ A;  1VF4 A;  1A24 A;  1A8L A;  1G6Y A;  4NXI A;  3EYT A;  1T3B A;  1EGR A;  1R5A A;  2DML A;  3TJK A;  1QQ2 A;  2RII A;  6GSU A;  2OE3 A;  2IFQ B;  2DMM A;  4XIH A;  4KSM A;  5IOW A;  4O92 A;  4BVX B;  1QK8 A;  2PBJ A;  5G31 A;  2YZU A;  5JWQ B;  5DQY A;  5DAK B;  3GL3 A;  1EOH A;  1HNA A;  2GTU A;  1K3Y A;  2PVO C;  3APO A;  1WE0 A;  1YEX A;  1Y25 A;  1Q98 A;  3US3 A;  1ML6 A;  1VGL A;  4G19 A;  1GSU A;  5HFG A;  3A2V A;  3BOA A;  4V2M A;  1XPV A;  2DLX A;  1FHE A;  5KOW A;  1GTU A;  2H72 A;  2FUG 2;  1AQW A;  3ERW A;  4YAP A;  2PWJ A;  2JZT A;  1BG5 A;  2ALB A;  4KUN A;  2YOI A;  3RPN A;  4HQZ A;  1K0D A;  2YV7 A;  1ON4 A;  1SU9 A;  3DVW A;  4X4J A;  3ZMK A;  1XVW A;  2K8S A;  1X9S B;  2H6X A;  2CZ3 A;  3HVS A;  3GKN A;  1KBN A;  3F63 A;  4X43 A;  2IIY A;  1S3C A;  4V2N A;  2CVK A;  4ZIL A;  2YCD A;  3MDK A;  1XIY A;  2FHE A;  5JCU A;  2LRT A;  4K7O A;  4MF6 A;  2B3S A;  11GS A;  4POM A;  3H1N A;  5G5E A;  1GUK A;  4E8E A;  4LA1 A;  2BMX A;  1F2E A;  4IQ1 A;  3GA4 A;  2KOK A;  5E4W A;  3D21 A;  2JAD A;  5LCZ A;  4IS0 A;  4IJI A;  4KB3 A;  3UBL A;  4GWR A;  2Z9S A;  2H1D A;  1ILO A;  3UIW A;  1FB6 A;  2L4C A;  5DBQ A;  2JSY A;  2OBI A;  1AIU A;  1U88 A;  5AN1 A;  5J5N A;  2AV4 A;  2R5G A;  4PQH A;  3TDG A;  3GV1 A;  4GQF A;  3HA9 A;  3PH9 A;  1M3I A;  4HU9 A;  2I4A A;  1BAY A;  2ON5 A;  4BVY B;  4X0X A;  3DRN A;  2MYG A;  2X8G A;  3LXZ A;  4XRD A;  3TCO A;  2EIR A;  3CSJ A;  1A23 A;  4GQC A;  2HXK A;  4PQI A;  3SBC A;  4EE0 A;  4HEA 2;  1WOU A;  4V1A g;  4AJ8 A;  1GLQ A;  5AIX A;  4GTU A;  2B7K A;  3QOU A;  3IE3 A;  1EEJ A;  14GS A;  2F8A A;  4KGI A;  5EPF A;  3TJJ A;  2L5L A;  2K9F A;  3KP9 A;  4EF0 A;  3GUS A;  1U87 A;  3MIX A;  4D73 B;  4K5R A;  4JR6 A;  1TOF A;  3VI5 A;  1OC8 A;  2QSI A;  1DUG A;  3DVX A;  3A5W A;  1XW6 A;  3PR8 A;  1SKW B;  1G6W A;  4ML6 A;  1PN0 A;  3K8N A;  2MBT A;  3NIV A;  3IK7 A;  3D5J A;  1TDI A;  3G7I A;  1ZMA A;  1PX6 A;  2YJH A;  1ZGN A;  1O81 A;  4K2D A;  5JWR B;  1TU7 A;  4KCA A;  3MSZ A;  1Z6M A;  3M1G A;  5H5Q A;  5IMZ A;  3L4N A;  2QA1 A;  3UMA A;  4ZIJ A;  4WR5 A;  2VCQ A;  2H01 A;  3TOT A;  3V1W A;  4F0C A;  22GS A;  1QUW A;  3DWV A;  4BPY A;  4L8E A;  2B1K A;  19GS A;  2H30 A;  2V32 A;  2GSR A;  1TI3 A;  2IMK A;  2H0H A;  3HJP A;  2C0F A;  3H79 A;  3WYW A;  1K0A A;  3PIN A;  1SYR A;  4KH7 A;  1GTA A;  4HOJ A;  4OWY A;  3IHQ A;  4JZQ A;  3CTG A;  3EE2 A;  3QDN A;  2A2S A;  2FD3 A;  4GXZ A;  4RI7 A;  2ZCT A;  4HQS A;  5ELA A;  3M3M A;  3F0I A;  2PPT A;  3KJY A;  4TR1 A;  3E9J B;  2K18 A;  5J9C A;  5A4W A;  4FYC A;  3UBK A;  3VLN A;  4YKG A;  2JSZ A;  3QCP A;  4I2T A;  3LG6 A;  6GSV A;  2QGV A;  1T4Z A;  3LGC A;  20GS A;  5A5K A;  5JWO B;  2H75 A;  5HR0 A;  2YWO A;  5A4U A;  3GL5 A;  4OO4 A;  1SL1 B;  4XS6 A;  4IBP A;  3TUE A;  3SWL A;  3EC3 A;  3FR9 A;  4Z7X A;  4YQU A;  1M2D A;  1Z9H A;  3GFK A;  4KAE A;  2P5Q A;  3GH6 A;  1E6B A;  4HUA A;  2LNT A;  9GSS A;  2HZF A;  3U6V A;  1Q4J A;  2O85 A;  3KTL A;  4G10 A;  2CVD A;  3QAV A;  2D2Z A;  1SD8 A;  3QPM A;  2B7J A;  3TJG A;  3ZML A;  1F6M C;  1GUH A;  3WT1 A;  4ECJ A;  3A2W A;  3F6F A;  3AY8 A;  3IC8 A;  1J08 A;  2VAF A;  1SKS B;  2FGX A;  4QL9 A;  4ECC A;  4BA7 A;  3ZVJ A;  5FWG A;  1X9W B;  4KDY A;  5DCG A;  5H5R A;  4EIQ A;  1FW1 A;  2GLR A;  1ZYP A;  1GSD A;  2WB9 A;  1HNC A;  1TI1 A;  1T00 A;  3IAM 2;  1ERV A;  5INY A;  4MA9 A;  3WGX A;  5CRG A;  4KF9 A;  1O8W A;  1M9A A;  1ZL9 A;  5J9B A;  3UVT A;  3ISO A;  4PQ1 A;  3FKF A;  2CZ2 A;  5F0G A;  4D73 A;  2HYX A;  2X8H A;  2IN3 A;  3E0U A;  1VF2 A;  4K7N A;  2E7P A;  2LRC A;  1G0T A;  1N2A A;  2HRA A;  3C7M A;  2AJQ B;  3HJO A;  3DEX A;  1SK1 A;  3HYP A;  12GS A;  5D73 A;  3E3E A;  2YPM A;  1NHY A;  5IO0 A;  1VRS D;  5D9T A;  2PMT A;  3UAP A;  2GDR A;  5COH A;  5L71 A;  3LYK A;  2K6V A;  1URM A;  3HXS A;  5J4U A;  2HNL A;  3DXB A;  3HHV A;  2N5A A;  2X4A A;  1XWB A;  2L5O A;  4TOP A;  2XHF A;  4MF7 A;  2B5Y A;  1Z7P A;  2IJY A;  3MNG A;  1EP7 A;  3F4T A;  2R0C A;  2VUP A;  4MAB A;  4HZ4 A;  4ZBB A;  2LV3 A;  1GSY A;  1JZW A;  5ECK B;  3HKR A;  4PNG A;  4KW6 A;  1PMT A;  3KXO A;  4BL7 A;  1DE1 A;  5C00 A;  2GZY A;  2H6Z A;  2RM6 A;  4MF5 A;  4N30 A;  1NW2 A;  3F8U A;  1PX7 A;  5HQP A;  2X99 A;  1J9B A;  1SEN A;  4TR0 A;  5IPH A;  2VL3 A;  4V1A p;  4V2L A;  2XPD A;  2GZP A;  1V2A A;  3KMN A;  3CTF A;  2M72 A;  3KP8 A;  5DDL A;  3R2Q A;  4A5P A;  1PL1 A;  3D6I A;  1DSB A;  6GSX A;  1JLW A;  2FLS A;  2G2Q A;  3R3E A;  2JU5 A;  2VD1 A;  3VPQ A;  1M2A A;  2B6M A;  2IPA A;  1O85 A;  2R37 A;  1HNB A;  1JZO A;  4O5Q A;  1Z7R A;  2CQ9 A;  3VK9 A;  4NAX A;  2H70 A;  3EMP A;  4NHW A;  3CXG A;  3CQF A;  3EU4 A;  4GCI A;  1XWG A;  2LS5 A;  5GST A;  5B7C A;  3DIE A;  2LJA A;  1PL2 A;  2WJU A;  3HVN A;  4AF2 A;  2TRC P;  3QMX A;  5JCG A;  2CV4 A;  1TRV A;  2CAQ A;  3J7Y k;  4ISD A;  4G0I A;  1K0O A;  1K0B A;  2CX3 A;  3CSH A;  3L9V A;  5CRE A;  1WMJ A;  2MMN A;  4GRF A;  4YH2 A;  1T8E B;  2VCT A;  3QAG A;  5F07 A;  1JZR A;  4GSS A;  4MDC A;  1FOV A;  2TIR A;  4ZL9 A;  5IMV A;  1MD4 A;  4WXT A;  7GSS A;  2YJ7 A;  2C80 A;  2C3Q A;  2X8C A;  1A0R P;  1R4W A;  3C1S A;  1RW1 A;  4MZB A;  1X5D A;  4NV5 A;  3G9B A;  4TR3 A;  1A2L A;  1JHB A;  3LQ7 A;  2NTO A;  4I8B A;  2H1A A;  3L0H A;  4TR1 B;  3GRX A;  4YAV A;  3ZL5 A;  2XC2 A;  1GH2 A;  2GVP A;  1PRX A;  4KSO A;  2HE3 A;  4OD7 A;  1EGO A;  2CX4 A;  2M46 A;  1USB A;  1FOH A;  3HJM A;  1WJK A;  2YWN A;  5D9X A;  4G0L A;  2O7K A;  5IQY A;  1TRW A;  2PUK C;  4G9H A;  1YZX A;  1XWK A;  4HZ2 A;  2C3T A;  5G1L A;  1QFN A;  2O87 A;  3O3T A;  3TRQ A;  3FEU A;  3QD9 A;  5D8I A;  4JED A;  3UOM A;  2M80 A;  3IAS 2;  2ZNM A;  4DSR A;  2B5X A;  3CYN A;  4PUA A;  2J9H A;  2H1G A;  1YEP A;  2NVL A;  1EV4 A;  2CAI A;  1W4V A;  2LNS A;  5IO2 A;  2LEG A;  5ID2 B;  1MEK A;  2RLI A;  3PPU A;  1SJI A;  5KN3 A;  4ACS A;  2QC7 A;  4JRR A;  3A5I A;  4MPF A;  3ZVJ D;  1V57 A;  5DJM A;  4O7H A;  3I6A A;  4BWS A;  5FHI A;  5J3R A;  5G5F A;  1F37 A;  2YWI A;  2FA4 A;  1M9B A;  2IMD A;  4XHM A;  5ECR B;  4NWY A;  3KH9 A;  3GN3 A;  3KM6 A;  2L59 A;  1F9M A;  3DKS A;  1WWJ A;  2HRK A;  2C0G A;  1O6J A;  4IN0 A;  2VLT A;  2R0G A;  4F82 A;  4K8M A;  2ZUP A;  1GP1 A;  3GHA A;  2I3Y A;  2OAD A;  1GWC A;  2DSA A;  3TRX A;  1M0U A;  4JE1 A;  1GUL A;  3ZIJ A;  3KH7 A;  5KN2 A;  2FWF A;  4ZXG A;  2RM5 A;  2GZZ A;  4Q5Q A;  1MDK A;  1ZYQ B;  1VF3 A;  4Z2R A;  4KE3 A;  4FH8 A;  1I9D A;  2GT6 A;  2IME A;  2FWE A;  3KGK A;  2F3M A;  1EEM A;  2FCH A;  5D93 A;  1ABA A;  2IWT A;  4G2E A;  4IP6 A;  3QAW A;  5IMD A;  1AW9 A;  1B4Q A;  1MDJ A;  1NSW A;  3PGT A;  4EVM A;  1FVJ A;  3TKP A;  5B8B A;  1GSS A;  3ZLP A;  2C3N A;  2LJK A;  5IOX A;  1K0M A;  1G7O A;  4GST A;  2I1U A;  3DYR A;  4LL1 B;  3ZYW A;  1I5G A;  1WIK A;  1Z3E A;  5CRD A;  1Z5Y E;  5IPG A;  4YQV A;  1Y6E A;  4TR4 A;  4TXO A;  2R4V A;  2DIY A;  2I81 A;  1AAZ A;  3GX0 A;  3N9J A;  1XCC A;  3A3T A;  3LJR A;  1X0R A;  1YQ1 A;  4N0Z A;  4BL7 B;  4Z2T A;  6GSS A;  5IMC A;  1R26 A;  3LW9 A;  1RK4 A;  4RQR A;  2H8L A;  3FZA A;  3Q6O A;  1H4O A;  5G2Z A;  1GRX A;  2GQK A;  4HJM A;  1THO A;  6GSW A;  2A4H A;  2A4V A;  3H8Q A;  5ECP B;  4F9Z A;  1N8J A;  2HLS A;  3HDC A;  2V41 A;  2VOC A;  1DBY A;  1SJZ A;  1MTC A;  1W89 A;  2GSQ A;  3W6G A;  2PVQ A;  5D9V A;  5ECQ B;  2OE1 A;  3CMI A;  1B8X A;  1S3A A;  5DQS A;  2NDO A;  4X1U A;  4TVE A;  2OA7 A;  2WRT A;  2LQO A;  3F6D A;  3GST A;  2V6O A;  2F51 A;  3OR5 A;  5GAN D;  1TJD A;  3KTB A;  3IDV A;  1PKZ A;  4K1F A;  4ZBA A;  1TP9 A;  4K0N A;  1RQM A;  4QQ7 A;  3MAK A;  1YKA A;  3WGD A;  3O76 A;  1BQ7 A;  2MMZ A;  1UA5 A;  1XW5 A;  2DKH A;  5ID2 A;  2CT6 A;  2C0D A;  4KND A;  2QKE A;  1R7H A;  4K0G A;  4KX4 A;  2OAC A;  2FA8 A;  1XBS A;  3GTU A;  2R3X A;  2JZR A;  4IW9 A;  3L9U A;  1YDK A;  1U6T A;  4Q5F A;  2J23 A;  3M8N A;  2H19 A;  3RHB A;  3BCK A;  13GS A;  3RAZ A;  4RQX A;  1F3B A;  1OVN A;  2KHP A;  1ZYE A;  3Q18 A;  4MJC A;  3GSS A;  2I9H A;  2RUE A;  4LLR A;  2GS3 A;  3I69 A;  3LFL A;  2G0F A;  4MLY A;  2VCZ A;  1H75 A;  5CYY A;  4LMV A;  3W8S A;  2VLV A;  3KEB A;  4NHZ A;  3DD3 A;  4O5U A;  2HSM A;  3D22 A;  3EVI A;  5KN1 A;  1MDI A;  1LJR A;  5KOX A;  1LBK A;  3C71 A;  3GH9 A;  1V98 A;  3JCM L;  2GQL A;  2EIO A;  3L78 A;  1JFU A;  4J2F A;  2HT9 A;  5HFI A;  3ME8 A;  3GKM A;  3APS A;  4FYU A;  5EVO A;  5F05 A;  3FZ9 A;  2KP2 A;  2NBS A;  3G7J A;  2H1B A;  1K0N A;  2WDU A;  1T7P B;  3VI7 A;  4XTS A;  1AC1 A;  1OAZ A;  3ZZX A;  1B9X C;  2L57 A;  4N0V A;  4I97 A;  4FIW A;  3P7X A;  4CHS A;  1XFL A;  3C73 A;  1K3O A;  2FWH A;  1A0F A;  2LJR A;  1IYI A;  5BMU A;  1KTE A;  5G1K A;  3GUR A;  2DKI A;  1SL2 B;  2B1L A;  4BIK A;  3TKQ A;  2KLX A;  1S3D A;  4IQA A;  2P0G A;  2ON7 A;  4JU5 A;  4ML1 A;  4TRX A;  1ZZY A;  3I9V 2;  8GSS A;  1OC3 A;  10GS A;  3ED3 A;  3IPZ A;  1B9Y C;  3O6T A;  4DVC A;  2WZ9 A;  2DJ0 A;  4MP4 A;  2GST A;  1THX A;  1V58 A;  3UVH A;  1GSF A;  3RHC A;  4MJB A;  4MJA A;  4LL4 B;  3HY2 A;  5IMA A;  3HCZ A;  3P90 A;  5ABR A;  1PSQ A;  5DJL A;  3LWA A;  1OE7 A;  2VM1 A;  1MD3 A;  3IR4 A;  4O32 A;  2HSY A;  2GT5 A;  4DSS B;  2LUS A;  5AGY A;  2RUF A;  2HZE B;  4DSQ A;  2HSH A;  4EKZ A;  4KDX A;  3QR6 A;  4NMU A;  6GST A;  3ME7 A;  4F03 A;  5CP1 A;  2REM A;  1JLV A;  4WEY A;  3I43 A;  1V9W A;  4K9Z A;  2WFC A;  5CNW A;  2VIM A;  5D9W A;  4AJ6 A;  5CAX A;  3FMW A;  2F8F A;  2LTK A;  2KUC A;  4K5S A;  5ECI B;  4MPG A;  3L9S A;  3UAR A;  4I6X A;  5HFK A;  1EWX A;  4EIP A;  2VL2 C;  4WF4 A;  4PGT A;  5GZZ B;  3KIJ A;  4NPB A;  1WP0 A;  1M7T A;  4XCS A;  5CO3 A;  2P31 A;  4F2I A;  5DVB A;  3IV4 A;  4ZB9 A;  2IMF A;  1QMV A;  3N5O A;  4ICY A;  2H74 A;  4DEJ A;  3CBU A;  3IK9 A;  4FQU A;  2X64 A;  2EC4 A;  3ZFL A;  5EL8 A;  1EZK A;  4ZL7 A;  2DC5 A;  2YZH A;  2VL9 A;  2L4Q A;  1GTB A;  3LSZ A;  1K3L A;  5GAP D;  1C72 A;  5AIS A;  4TXO B;  4L0W A;  2E0Q A;  3IXR A;  3IOS A;  1K0C A;  1U3I A;  4MK3 A;  1A2M A;  1XVQ A;  3S9F A;  3HZ4 A;  4XS4 A;  3Q74 A;  3FR3 A;  2DJK A;  4F0B A;  2AUV A;  1ZCP A;  3J7Y b;  2IMI A;  1OYJ A;  1OKT A;  1GLP A;  1AUC A;  4IJ3 A;  5EY6 A;  1PQN A;  4IGJ A;  1FO5 A;  3HVV A;  3D4M A;  5DCH A;  3TKS E;  3IC4 A;  2KP1 A;  2PN8 A;  4OO5 A;  2F9S A;  4PX1 A;  4J57 E;  5ECO B;  4Q5N A; 
#chains in the Genus database with same CATH homology
 1EOG A;  3TKR A;  1AQV A;  3APQ A;  3GKK A;  2H0I A;  2GQM A;  4PNF A;  2MMA A;  5DAL A;  5IMF A;  1SK0 A;  3GX8 A;  4POL A;  5JCW A;  1SL0 B;  4MNN A;  3WGE A;  2CVB A;  4H86 A;  3C1R A;  2V1M A;  1XXU A;  3CRU A;  1GNE A;  5HR2 A;  4USS A;  3FHK A;  4ECB A;  4PUF C;  2PU9 C;  4MH2 A;  3IBH A;  5ENU A;  2MBS A;  3P8W A;  3VWV A;  3HZ8 A;  1ZYN A;  4EXJ A;  4OFM A;  1V40 A;  1SYX A;  4ULX A;  2XBQ A;  3A2X A;  4HI7 A;  1TU8 A;  2H73 A;  4CDO A;  1PN9 A;  2C4J A;  2LST A;  4OCE A;  4HS1 A;  3MYD A;  1ERW A;  4WR4 A;  1J0F A;  5B6M A;  1B4P A;  1KNG A;  3FZ4 A;  1UN2 A;  5ECH B;  3IRA A;  3ZIT A;  1TTZ A;  2AB6 A;  3KCM A;  5E59 A;  5HR3 A;  4TKY A;  3FY7 A;  3C8E A;  4N11 A;  2YN1 A;  1TK5 B;  3FZ5 A;  16GS A;  3NOF A;  1SKR B;  3VUR A;  1X5E A;  3GTU B;  3IA1 A;  2HRF A;  3EMX A;  4TN8 A;  3FW2 A;  2HI7 A;  1NM3 A;  2FWG A;  1BED A;  1AQX A;  1KEB A;  1O7U A;  3TKS A;  3GKX A;  3LXT A;  4AGS A;  3KMO A;  4LMW A;  4GF0 A;  4L5O A;  4Z2U A;  1T1V A;  4DSS A;  3F9U A;  1YKC A;  1DE2 A;  4XRA A;  2BJX A;  3M9J A;  3LYP A;  4MJE A;  4OMV A;  4PTS A;  5AIV A;  2JL4 A;  2HZE A;  1XWC A;  3TKS C;  3HD5 A;  1TRU A;  4EDY A;  4MZW A;  2H71 A;  1E2Y A;  2GGT A;  3QFA C;  3NZN A;  3LEF A;  5BRT A;  3W8J A;  2C1Y A;  1M99 A;  1YF1 A;  3EUR A;  3F3R A;  1GSE A;  4RI6 A;  3G7Y A;  5C04 A;  2EIQ A;  2H66 A;  1XOA A;  3VWX A;  4ZB6 A;  2VCW A;  2LRN A;  3MWH A;  4N10 A;  3IHG A;  1OE8 A;  1FG4 A;  2VD0 A;  5LNK e;  4WF5 A;  2HRN A;  4K7I A;  2YNX A;  4K6X A;  1QXH A;  2L6D A;  2XBI A;  3ZRD A;  3KD0 A;  1B48 A;  2CA8 A;  1ERT A;  4E8H A;  3RDW A;  2IL3 A;  4EUY A;  1YY7 A;  2V6K A;  4P3Y B;  1HYU A;  4PXO A;  4EL1 A;  2BTO T;  4ID0 A;  3UL3 A;  3VPT A;  4FYB A;  1A2J A;  4IEL A;  4IP1 A;  4QL7 A;  1TXX A;  1FAA A;  2IFQ A;  4G0K A;  5H5S A;  3VWW A;  2C0E A;  3ERF A;  4BVX A;  2XPE A;  1A8Y A;  1QGV A;  1ZOF A;  2NPB A;  2FY6 A;  2JZS A;  1GUM A;  5DAK A;  1AXD A;  2WS2 A;  3EU3 A;  3VFI A;  3TJF A;  1XWA A;  1ST9 A;  4OCF A;  4OFN A;  4WET A;  1ERU A;  3DGQ A;  3BBY A;  4FO5 A;  2L6C A;  2PGT A;  4I2U A;  2R0P A;  3F4S A;  1OC9 B;  2PER A;  3RBT A;  4IVF A;  1G7E A;  4MMM A;  3P2A A;  1UC7 A;  1BX9 A;  2H0G A;  2O8V B;  4O5R A;  5LD0 A;  5CRH A;  3LOR A;  3TRP A;  2DJ1 A;  1ACV A;  1OKD A;  4GSN A;  3TB2 A;  4CY8 A;  2VLU A;  2K8V A;  4RUV A;  2OKA A;  1FVK A;  1HQO A;  3FK8 A;  5HR1 A;  1X5C A;  2YP6 A;  5IIZ A;  3ZFB A;  5GSS A;  4BWQ A;  1PD2 1;  4K2X A;  1GTI A;  2N5F A;  3CRT A;  4TW5 A;  3ZTL A;  3H4K A;  4PUR A;  2X49 A;  3VWU A;  4ZL8 A;  3WT2 A;  3TGZ A;  4L0U A;  18GS A;  2WUL A;  2MZC A;  3F4R A;  5KN0 A;  1YF0 A;  2E2G A;  4KA0 A;  4XS4 B;  2P5R A;  2A2R A;  4HJ2 A;  1GSQ A;  1YJ6 A;  1GL8 A;  1F3A A;  1CQG A;  3D4T A;  5B6N A;  1EP8 A;  1U3A A;  2DBC A;  2H6Y A;  2R6K A;  1XOB A;  4ILF A;  4BVY A;  5B8A A;  1SD9 A;  4JBB A;  2WGR A;  1UVZ A;  3FYG A;  2OE0 A;  3FR6 A;  3QFB C;  4MCU A;  3EPT A;  4JR4 A;  1SK2 A;  5J41 A;  3EWL A;  2AYT A;  2C8U A;  1TK0 B;  3GNJ A;  2VO4 A;  2VCX A;  5DAL B;  4MZC A;  1WRY A;  4EO3 A;  3KZQ A;  2N5B A;  5A4V A;  1VF1 A;  1TRS A;  1CQH A;  2A2P A;  1SJ6 A;  2VCV A;  4POK A;  3GMF A;  2O89 A;  5CRW A;  1TW9 A;  5IM9 A;  1XZO A;  2YV9 A;  4NV2 A;  2LQQ A;  4OFT A;  2VM2 A;  3TJB A;  4Q5R A;  5ECL B;  3TOU A;  4WBR D;  5ECN B;  3BCI A;  2DJ3 A;  3DML A;  4YQM A;  4IHU A;  5FT3 A;  6GSY A;  4HDE A;  1JZD A;  1TK8 B;  4MH3 A;  1FB0 A;  3WD6 A;  3CSI A;  4EC0 A;  1HD2 A;  2DJ2 A;  2JAC A;  2ES7 A;  2MMO A;  1T4Y A;  5F06 A;  1M2B A;  1LU4 A;  3ERG A;  5D96 A;  4CW9 A;  1BJX A;  2TRX A;  3HVX A;  1BYE A;  3EIN A;  1WPI A;  3M9K A;  17GS A;  4KDU A;  1GNW A;  4EDZ A;  2AAW A;  5ELG A;  4POB A;  2B5E A;  3M0F A;  4J56 E;  2HFD A;  4CY6 A;  2GSS A;  1XW9 A;  2UZ8 A;  3RPP A;  4ECI A;  5ECM B;  1O73 A;  2FNO A;  1X9M B;  5F8B A;  3GIX A;  4KCE A;  1OC9 A;  3Q19 A;  2VL2 A;  3ZRE A;  1PGT A;  3UEM A;  3H93 A;  4HU7 A;  2WCI A;  2DJJ A;  4TXV A;  3UJ1 A;  2DIZ A;  4WKW A;  3U5R E;  2OBK A;  2V2G A;  4AJ7 A;  1PA3 A;  1NHO A;  3GYK A;  4YKF A;  1O8X A;  2AHE A;  1Z6N A;  2R2J A;  1EV9 A;  4ZBD A;  3D0Z A;  4GLT A;  2QA2 A;  2H76 A;  3F3Q A;  3FRC A;  4ZB8 A;  4I5Q A;  4IKH A;  4L5L A;  5ECS A;  5KEJ A;  2YWM A;  1TKD B;  3BD2 A;  3BJ5 A;  4XS1 A;  1PKW A;  1IYH A;  5G30 A;  2OJL A;  2E2M A;  1R5P A;  2LKU A;  3ZIV A;  2YAN A;  4WBJ A;  1VF4 A;  1A24 A;  1A8L A;  1G6Y A;  4NXI A;  3EYT A;  1T3B A;  1EGR A;  1R5A A;  2DML A;  3TJK A;  1QQ2 A;  2RII A;  6GSU A;  2OE3 A;  2IFQ B;  2DMM A;  4XIH A;  4KSM A;  5IOW A;  4O92 A;  4BVX B;  1QK8 A;  2PBJ A;  5G31 A;  2YZU A;  5JWQ B;  5DQY A;  5DAK B;  3GL3 A;  1EOH A;  1HNA A;  2GTU A;  1K3Y A;  2PVO C;  3APO A;  1WE0 A;  1YEX A;  1Y25 A;  1Q98 A;  3US3 A;  1ML6 A;  1VGL A;  4G19 A;  1GSU A;  5HFG A;  3A2V A;  3BOA A;  4V2M A;  1XPV A;  2DLX A;  1FHE A;  5KOW A;  1GTU A;  2H72 A;  2FUG 2;  1AQW A;  3ERW A;  4YAP A;  2PWJ A;  2JZT A;  1BG5 A;  2ALB A;  4KUN A;  2YOI A;  3RPN A;  4HQZ A;  1K0D A;  2YV7 A;  1ON4 A;  1SU9 A;  3DVW A;  4X4J A;  3ZMK A;  1XVW A;  2K8S A;  1X9S B;  2H6X A;  2CZ3 A;  3HVS A;  3GKN A;  1KBN A;  3F63 A;  4X43 A;  2IIY A;  1S3C A;  4V2N A;  2CVK A;  4ZIL A;  2YCD A;  3MDK A;  1XIY A;  2FHE A;  5JCU A;  2LRT A;  4K7O A;  4MF6 A;  2B3S A;  11GS A;  4POM A;  3H1N A;  5G5E A;  1GUK A;  4E8E A;  4LA1 A;  2BMX A;  1F2E A;  4IQ1 A;  3GA4 A;  2KOK A;  5E4W A;  3D21 A;  2JAD A;  5LCZ A;  4IS0 A;  4IJI A;  4KB3 A;  3UBL A;  4GWR A;  2Z9S A;  2H1D A;  1ILO A;  3UIW A;  1FB6 A;  2L4C A;  5DBQ A;  2JSY A;  2OBI A;  1AIU A;  1U88 A;  5AN1 A;  5J5N A;  2AV4 A;  2R5G A;  4PQH A;  3TDG A;  3GV1 A;  4GQF A;  3HA9 A;  3PH9 A;  4HU9 A;  2I4A A;  1BAY A;  2ON5 A;  4BVY B;  4X0X A;  3DRN A;  2MYG A;  2X8G A;  3LXZ A;  4XRD A;  3TCO A;  2EIR A;  3CSJ A;  1A23 A;  4GQC A;  2HXK A;  4PQI A;  3SBC A;  4EE0 A;  4HEA 2;  1WOU A;  4V1A g;  4AJ8 A;  1GLQ A;  5AIX A;  4GTU A;  2B7K A;  3QOU A;  3IE3 A;  1EEJ A;  14GS A;  2F8A A;  4KGI A;  5EPF A;  3TJJ A;  2L5L A;  2K9F A;  3KP9 A;  4EF0 A;  3GUS A;  1U87 A;  3MIX A;  4D73 B;  4K5R A;  4JR6 A;  1TOF A;  3VI5 A;  1OC8 A;  2QSI A;  1DUG A;  3DVX A;  3A5W A;  1XW6 A;  3PR8 A;  1SKW B;  1G6W A;  4ML6 A;  1PN0 A;  3K8N A;  2MBT A;  3NIV A;  3IK7 A;  3D5J A;  1TDI A;  3G7I A;  1ZMA A;  1PX6 A;  2YJH A;  1ZGN A;  1O81 A;  4K2D A;  5JWR B;  1TU7 A;  4KCA A;  3MSZ A;  1Z6M A;  3M1G A;  5H5Q A;  5IMZ A;  3L4N A;  2QA1 A;  3UMA A;  4ZIJ A;  4WR5 A;  2VCQ A;  2H01 A;  3TOT A;  3V1W A;  4F0C A;  22GS A;  1QUW A;  3DWV A;  4BPY A;  4L8E A;  2B1K A;  19GS A;  2H30 A;  2V32 A;  2GSR A;  1TI3 A;  2IMK A;  2H0H A;  3HJP A;  2C0F A;  3H79 A;  3WYW A;  1K0A A;  3PIN A;  1SYR A;  4KH7 A;  1GTA A;  4HOJ A;  4OWY A;  3IHQ A;  4JZQ A;  3CTG A;  3EE2 A;  3QDN A;  2A2S A;  2FD3 A;  4GXZ A;  4RI7 A;  2ZCT A;  4HQS A;  5ELA A;  3M3M A;  3F0I A;  2PPT A;  3KJY A;  4TR1 A;  3E9J B;  2K18 A;  5J9C A;  5A4W A;  4FYC A;  3UBK A;  3VLN A;  4YKG A;  2JSZ A;  3QCP A;  4I2T A;  3LG6 A;  6GSV A;  2QGV A;  1T4Z A;  3LGC A;  20GS A;  5A5K A;  5JWO B;  2H75 A;  5HR0 A;  2YWO A;  5A4U A;  3GL5 A;  4OO4 A;  1SL1 B;  4XS6 A;  4IBP A;  3TUE A;  3SWL A;  3EC3 A;  3FR9 A;  4Z7X A;  4YQU A;  1M2D A;  1Z9H A;  3GFK A;  4KAE A;  2P5Q A;  3GH6 A;  1E6B A;  4HUA A;  2LNT A;  9GSS A;  2HZF A;  3U6V A;  1Q4J A;  2O85 A;  3KTL A;  4G10 A;  2CVD A;  3QAV A;  2D2Z A;  1SD8 A;  3QPM A;  2B7J A;  3TJG A;  3ZML A;  1F6M C;  1GUH A;  3WT1 A;  4ECJ A;  3A2W A;  3F6F A;  3AY8 A;  3IC8 A;  1J08 A;  2VAF A;  1SKS B;  2FGX A;  4QL9 A;  4ECC A;  4BA7 A;  3ZVJ A;  5FWG A;  1X9W B;  4KDY A;  5DCG A;  5H5R A;  4EIQ A;  1FW1 A;  2GLR A;  1ZYP A;  1GSD A;  2WB9 A;  1HNC A;  1TI1 A;  1T00 A;  3IAM 2;  1ERV A;  5INY A;  4MA9 A;  3WGX A;  5CRG A;  4KF9 A;  1O8W A;  1M9A A;  1ZL9 A;  5J9B A;  3UVT A;  3ISO A;  4PQ1 A;  3FKF A;  2CZ2 A;  5F0G A;  4D73 A;  2HYX A;  2X8H A;  2IN3 A;  3E0U A;  1VF2 A;  4K7N A;  2E7P A;  2LRC A;  1G0T A;  1N2A A;  2HRA A;  3C7M A;  2AJQ B;  3HJO A;  3DEX A;  1SK1 A;  3HYP A;  12GS A;  5D73 A;  3E3E A;  2YPM A;  1NHY A;  5IO0 A;  1VRS D;  5D9T A;  2PMT A;  3UAP A;  2GDR A;  5COH A;  5L71 A;  3LYK A;  2K6V A;  1URM A;  3HXS A;  5J4U A;  2HNL A;  3DXB A;  3HHV A;  2N5A A;  2X4A A;  1XWB A;  2L5O A;  4TOP A;  2XHF A;  4MF7 A;  2B5Y A;  1Z7P A;  2IJY A;  3MNG A;  1EP7 A;  3F4T A;  2R0C A;  2VUP A;  4MAB A;  4HZ4 A;  4ZBB A;  2LV3 A;  1GSY A;  1JZW A;  5ECK B;  3HKR A;  4PNG A;  4KW6 A;  1PMT A;  3KXO A;  4BL7 A;  1DE1 A;  5C00 A;  2GZY A;  2H6Z A;  2RM6 A;  4MF5 A;  4N30 A;  1NW2 A;  3F8U A;  1PX7 A;  5HQP A;  2X99 A;  1J9B A;  1SEN A;  4TR0 A;  5IPH A;  2VL3 A;  4V1A p;  4V2L A;  2XPD A;  2GZP A;  1V2A A;  3KMN A;  3CTF A;  2M72 A;  3KP8 A;  5DDL A;  3R2Q A;  4A5P A;  1PL1 A;  3D6I A;  1DSB A;  6GSX A;  1JLW A;  2FLS A;  2G2Q A;  3R3E A;  2JU5 A;  2VD1 A;  3VPQ A;  1M2A A;  2B6M A;  2IPA A;  1O85 A;  2R37 A;  1HNB A;  1JZO A;  4O5Q A;  1Z7R A;  2CQ9 A;  3VK9 A;  4NAX A;  2H70 A;  3EMP A;  4NHW A;  3CXG A;  3EU4 A;  4GCI A;  1XWG A;  2LS5 A;  5GST A;  5B7C A;  3DIE A;  2LJA A;  1PL2 A;  2WJU A;  4AF2 A;  2TRC P;  3QMX A;  5JCG A;  2CV4 A;  1TRV A;  2CAQ A;  3J7Y k;  4ISD A;  4G0I A;  1K0O A;  1K0B A;  2CX3 A;  3CSH A;  3L9V A;  5CRE A;  1WMJ A;  2MMN A;  4GRF A;  4YH2 A;  1T8E B;  2VCT A;  3QAG A;  5F07 A;  1JZR A;  4GSS A;  4MDC A;  1FOV A;  2TIR A;  4ZL9 A;  5IMV A;  1MD4 A;  4WXT A;  7GSS A;  2YJ7 A;  2C80 A;  2C3Q A;  2X8C A;  1A0R P;  1R4W A;  3C1S A;  1RW1 A;  4MZB A;  1X5D A;  4NV5 A;  3G9B A;  4TR3 A;  1A2L A;  1JHB A;  3LQ7 A;  2NTO A;  4I8B A;  2H1A A;  3L0H A;  4TR1 B;  3GRX A;  4YAV A;  3ZL5 A;  2XC2 A;  1GH2 A;  2GVP A;  1PRX A;  4KSO A;  2HE3 A;  4OD7 A;  1EGO A;  2CX4 A;  2M46 A;  1USB A;  1FOH A;  3HJM A;  1WJK A;  2YWN A;  5D9X A;  4G0L A;  2O7K A;  5IQY A;  1TRW A;  2PUK C;  4G9H A;  1YZX A;  1XWK A;  4HZ2 A;  2C3T A;  5G1L A;  1QFN A;  2O87 A;  3O3T A;  3TRQ A;  3FEU A;  3QD9 A;  5D8I A;  4JED A;  3UOM A;  2M80 A;  3IAS 2;  2ZNM A;  4DSR A;  2B5X A;  3CYN A;  4PUA A;  2J9H A;  2H1G A;  1YEP A;  2NVL A;  1EV4 A;  2CAI A;  1W4V A;  2LNS A;  5IO2 A;  2LEG A;  5ID2 B;  1MEK A;  2RLI A;  3PPU A;  1SJI A;  5KN3 A;  4ACS A;  2QC7 A;  4JRR A;  3A5I A;  4MPF A;  3ZVJ D;  1V57 A;  5DJM A;  4O7H A;  3I6A A;  4BWS A;  5FHI A;  5J3R A;  5G5F A;  1F37 A;  2YWI A;  2FA4 A;  1M9B A;  2IMD A;  4XHM A;  5ECR B;  4NWY A;  3KH9 A;  3GN3 A;  3KM6 A;  2L59 A;  1F9M A;  3DKS A;  1WWJ A;  2HRK A;  2C0G A;  1O6J A;  4IN0 A;  2VLT A;  2R0G A;  4F82 A;  4K8M A;  2ZUP A;  1GP1 A;  3GHA A;  2I3Y A;  2OAD A;  1GWC A;  2DSA A;  3TRX A;  1M0U A;  4JE1 A;  1GUL A;  3ZIJ A;  3KH7 A;  5KN2 A;  2FWF A;  4ZXG A;  2RM5 A;  2GZZ A;  4Q5Q A;  1MDK A;  1ZYQ B;  1VF3 A;  4Z2R A;  4KE3 A;  4FH8 A;  1I9D A;  2GT6 A;  2IME A;  2FWE A;  3KGK A;  2F3M A;  1EEM A;  2FCH A;  5D93 A;  1ABA A;  2IWT A;  4G2E A;  4IP6 A;  3QAW A;  5IMD A;  1AW9 A;  1B4Q A;  1MDJ A;  1NSW A;  3PGT A;  4EVM A;  1FVJ A;  3TKP A;  5B8B A;  1GSS A;  3ZLP A;  2C3N A;  2LJK A;  5IOX A;  1K0M A;  1G7O A;  4GST A;  2I1U A;  3DYR A;  4LL1 B;  3ZYW A;  1I5G A;  1WIK A;  1Z3E A;  5CRD A;  1Z5Y E;  5IPG A;  4YQV A;  1Y6E A;  4TR4 A;  4TXO A;  2R4V A;  2DIY A;  2I81 A;  1AAZ A;  3GX0 A;  3N9J A;  1XCC A;  3A3T A;  3LJR A;  1X0R A;  1YQ1 A;  4N0Z A;  4BL7 B;  4Z2T A;  6GSS A;  5IMC A;  1R26 A;  3LW9 A;  1RK4 A;  4RQR A;  2H8L A;  3FZA A;  3Q6O A;  1H4O A;  5G2Z A;  1GRX A;  2GQK A;  4HJM A;  1THO A;  6GSW A;  2A4H A;  2A4V A;  3H8Q A;  5ECP B;  4F9Z A;  1N8J A;  2HLS A;  3HDC A;  2V41 A;  2VOC A;  1DBY A;  1SJZ A;  1MTC A;  1W89 A;  2GSQ A;  3W6G A;  2PVQ A;  5D9V A;  5ECQ B;  2OE1 A;  3CMI A;  1B8X A;  1S3A A;  5DQS A;  2NDO A;  4X1U A;  4TVE A;  2OA7 A;  2WRT A;  2LQO A;  3F6D A;  3GST A;  2V6O A;  2F51 A;  3OR5 A;  5GAN D;  1TJD A;  3KTB A;  3IDV A;  1PKZ A;  4K1F A;  4ZBA A;  1TP9 A;  4K0N A;  1RQM A;  4QQ7 A;  3MAK A;  1YKA A;  3WGD A;  3O76 A;  1BQ7 A;  2MMZ A;  1UA5 A;  1XW5 A;  2DKH A;  5ID2 A;  2CT6 A;  2C0D A;  4KND A;  2QKE A;  1R7H A;  4K0G A;  4KX4 A;  2OAC A;  2FA8 A;  1XBS A;  3GTU A;  2R3X A;  2JZR A;  4IW9 A;  3L9U A;  1YDK A;  1U6T A;  4Q5F A;  2J23 A;  3M8N A;  2H19 A;  3RHB A;  3BCK A;  13GS A;  3RAZ A;  4RQX A;  1F3B A;  1OVN A;  2KHP A;  1ZYE A;  3Q18 A;  4MJC A;  3GSS A;  2I9H A;  2RUE A;  4LLR A;  2GS3 A;  3I69 A;  3LFL A;  2G0F A;  4MLY A;  2VCZ A;  1H75 A;  5CYY A;  4LMV A;  3W8S A;  2VLV A;  3KEB A;  4NHZ A;  3DD3 A;  4O5U A;  2HSM A;  3D22 A;  3EVI A;  5KN1 A;  1MDI A;  1LJR A;  5KOX A;  1LBK A;  3C71 A;  3GH9 A;  1V98 A;  3JCM L;  2GQL A;  2EIO A;  3L78 A;  1JFU A;  4J2F A;  2HT9 A;  5HFI A;  3ME8 A;  3GKM A;  3APS A;  4FYU A;  5EVO A;  5F05 A;  3FZ9 A;  2KP2 A;  2NBS A;  3G7J A;  2H1B A;  1K0N A;  2WDU A;  1T7P B;  3VI7 A;  4XTS A;  1AC1 A;  1OAZ A;  3ZZX A;  1B9X C;  2L57 A;  4N0V A;  4I97 A;  4FIW A;  3P7X A;  4CHS A;  1XFL A;  3C73 A;  1K3O A;  2FWH A;  1A0F A;  2LJR A;  1IYI A;  5BMU A;  1KTE A;  5G1K A;  3GUR A;  2DKI A;  1SL2 B;  2B1L A;  3TKQ A;  2KLX A;  1S3D A;  4IQA A;  2P0G A;  2ON7 A;  4JU5 A;  4ML1 A;  4TRX A;  1ZZY A;  3I9V 2;  8GSS A;  1OC3 A;  10GS A;  3ED3 A;  3IPZ A;  1B9Y C;  3O6T A;  4DVC A;  2WZ9 A;  2DJ0 A;  4MP4 A;  2GST A;  1THX A;  1V58 A;  3UVH A;  1GSF A;  3RHC A;  4MJB A;  4MJA A;  4LL4 B;  3HY2 A;  5IMA A;  3HCZ A;  3P90 A;  5ABR A;  1PSQ A;  5DJL A;  3LWA A;  1OE7 A;  2VM1 A;  1MD3 A;  3IR4 A;  4O32 A;  2HSY A;  2GT5 A;  4DSS B;  2LUS A;  5AGY A;  2RUF A;  2HZE B;  4DSQ A;  2HSH A;  4EKZ A;  4KDX A;  3QR6 A;  4NMU A;  6GST A;  3ME7 A;  4F03 A;  5CP1 A;  2REM A;  1JLV A;  4WEY A;  3I43 A;  1V9W A;  4K9Z A;  2WFC A;  5CNW A;  2VIM A;  5D9W A;  4AJ6 A;  5CAX A;  3FMW A;  2F8F A;  2LTK A;  2KUC A;  4K5S A;  5ECI B;  4MPG A;  3L9S A;  3UAR A;  4I6X A;  5HFK A;  1EWX A;  4EIP A;  2VL2 C;  4WF4 A;  4PGT A;  5GZZ B;  3KIJ A;  4NPB A;  1WP0 A;  1M7T A;  4XCS A;  5CO3 A;  2P31 A;  4F2I A;  5DVB A;  3IV4 A;  4ZB9 A;  2IMF A;  1QMV A;  3N5O A;  4ICY A;  2H74 A;  4DEJ A;  3CBU A;  3IK9 A;  4FQU A;  2X64 A;  2EC4 A;  3ZFL A;  5EL8 A;  1EZK A;  4ZL7 A;  2DC5 A;  2YZH A;  2VL9 A;  2L4Q A;  1GTB A;  3LSZ A;  1K3L A;  5GAP D;  1C72 A;  5AIS A;  4TXO B;  4L0W A;  2E0Q A;  3IXR A;  3IOS A;  1K0C A;  1U3I A;  4MK3 A;  1A2M A;  1XVQ A;  3S9F A;  3HZ4 A;  4XS4 A;  3Q74 A;  3FR3 A;  2DJK A;  4F0B A;  2AUV A;  1ZCP A;  3J7Y b;  2IMI A;  1OYJ A;  1OKT A;  1GLP A;  1AUC A;  4IJ3 A;  5EY6 A;  1PQN A;  4IGJ A;  1FO5 A;  3HVV A;  3D4M A;  5DCH A;  3TKS E;  3IC4 A;  2KP1 A;  2PN8 A;  4OO5 A;  2F9S A;  4PX1 A;  4J57 E;  5ECO B;  4Q5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...