4MCUA

Crystal structure of disulfide oxidoreductase from klebsiella pneumoniae in reduced state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
188
Chain Sequence
NAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKTQTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein
publication title Comparative Sequence, Structure and Redox Analyses of Klebsiella pneumoniae DsbA Show That Anti-Virulence Target DsbA Enzymes Fall into Distinct Classes.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 58
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mcuA00
3U5RE 5G1KA 4GSTA 3GL3A 2B5EA 3QD9A 5B6MA 4EL1A 1I5GA 2DMLA 4HOJA 1TRWA 1PD21 3A3TA 2OBKA 3WYWA 1K3YA 3GX0A 3FK8A 6GSWA 4Q5RA 2PUKC 3IK9A 2L4QA 1BJXA 4HU7A 2E2MA 5A4WA 4GLTA 2LS5A 3ZMKA 3EU4A 5E4WA 1OC9A 4XRAA 4NHWA 2JL4A 3BOAA 3M9KA 1PRXA 5HFGA 5C04A 3F4TA 2AJQB 2J23A 4NV2A 2E7PA 3ZFBA 3RPPA 2YV9A 2YOIA 2I81A 2A2SA 4BWSA 3TJBA 3FR9A 5F07A 2BJXA 3LYKA 4MMMA 4IS0A 12GSA 3APOA 5IMDA 2GSTA 3ZTLA 2K6VA 2CAQA 1FVKA 3HJPA 3GH6A 4MDCA 2EIQA 3VI7A 4X43A 4KCEA 3ME8A 3PGTA 4YQMA 1FOVA 5J41A 3HHVA 2L4CA 3HD5A 4WETA 1GH2A 5AGYA 4ZB8A 4EUYA 3EE2A 3W8JA 5IIZA 4L0WA 4YQVA 4PQIA 3CSHA 3CSIA 3EU3A 3IR4A 1AAZA 1SKRB 2O87A 3ZREA 4DEJA 4POKA 1OC8A 3IHQA 5J9CA 2DC5A 4HQZA 2VD1A 3VI5A 3LXTA 4MJBA 1HNCA 3FW2A 1B4PA 2FA4A 4G19A 4N0ZA 3TGZA 2HI7A 3QR6A 4EXJA 3BBYA 1Y25A 3L9UA 3GTUA 4XS4A 4WR5A 1T8EB 1MDIA 1YZXA 3TJJA 2HE3A 3Q19A 2ZCTA 1M0UA 1SYXA 1YJ6A 4PXOA 1G7EA 3MWHA 4RUVA 1PL2A 3TJFA 2GQKA 5HFKA 3UVHA 4MJEA 1O8WA 4NWYA 1LJRA 5KN1A 3NIVA 5J3RA 3J7Yk 4YAPA 4BWQA 5ECMB 3M0FA 4PURA 1PX7A 5ECNB 3ZVJA 3TDGA 4ACSA 2QGVA 1PSQA 17GSA 4N0VA 5HR3A 4HZ2A 3TB2A 2XPEA 5DJLA 1THOA 4G2EA 5CYYA 3VK9A 2YWIA 2B5XA 2NPBA 3WT1A 3QFBC 2CZ2A 1XPVA 2DBCA 1AQWA 5JCWA 3SWLA 1XWBA 5HFIA 8GSSA 3KH9A 5JCGA 3HDCA 10GSA 2A4VA 5KN2A 2GTUA 2L5LA 4MP4A 1ERTA 2LKUA 3KJYA 3W6GA 3L9SA 3WD6A 1XCCA 3M3MA 2DJ0A 3P90A 1FO5A 1YKCA 5D9WA 4DSQA 2VCWA 1GL8A 3RDWA 3C71A 4V2LA 2GZZA 2NDOA 1A0FA 2H75A 4O7HA 4I8BA 1XWGA 3I69A 3KP9A 4ZL8A 2YN1A 3TOUA 2X8GA 2GSSA 1Q98A 3VWVA 3DXBA 5DAKB 1MEKA 3ZVJD 4HI7A 2CVBA 1N2AA 2VAFA 3GKXA 1NHOA 4H86A 4TR4A 3E0UA 2QC7A 2VCTA 4FYCA 4XHMA 5B8AA 2VIMA 3UVTA 5DQYA 2QSIA 4LL1B 4EDZA 3D0ZA 2CX4A 3F4RA 2H73A 5H5QA 1BQ7A 4TOPA 1GTIA 2LRNA 3IV4A 3F0IA 5B7CA 3IK7A 1B4QA 3GKKA 4XTSA 4BVYA 4ZBBA 4Z7XA 5ELGA 4V2NA 1K0NA 2M80A 1QK8A 1V58A 2VUPA 3IOSA 5DALA 1GNEA 1T3BA 2HZEA 3UMAA 4POMA 4Q5FA 1MTCA 3FHKA 2X8HA 3HVVA 4KA0A 4HDEA 1PN9A 3G7YA 1A8YA 2B5YA 5D8IA 5ABRA 4K0GA 3IXRA 2HSHA 2GT5A 2DJ3A 4NPBA 1LU4A 3ZITA 3FR6A 2HRNA 5CREA 3HY2A 5L71A 2XBIA 4KDYA 2IIYA 5IPHA 2H0GA 4NV5A 2IFQA 6GSUA 1PL1A 5CRHA 3SBCA 2D2ZA 3TKSE 2DJKA 4DSRA 1XWAA 3GA4A 4KAEA 1YKAA 4K7OA 2CVKA 3HVXA 1EGOA 13GSA 2H70A 3EWLA 3CMIA 4EF0A 1SD9A 3ZZXA 1JZDA 3VWWA 3TKSC 2OE1A 2LTKA 2L59A 4RI7A 2L6CA 2OADA 3D21A 1FB6A 4FYUA 4MF5A 1A2JA 2LQOA 3DWVA 4OCEA 3DVXA 4K7NA 1EZKA 3GRXA 4LLRA 2YJ7A 5F0GA 2P5RA 1X9SB 1HNAA 2FGXA 5ID2B 4XCSA 2CAIA 5IMVA 2N5BA 1E2YA 1ERUA 1T4ZA 3HJMA 5IMZA 1GSFA 5ELAA 5JWRB 3DIEA 2YZUA 3MNGA 5ECHB 2YPMA 3C7MA 1MD4A 3ZLPA 2R3XA 2IL3A 1Z5YE 2HSYA 1LBKA 2I4AA 2ES7A 1F37A 3IRAA 5GSTA 2WCIA 1SJIA 4DVCA 2HT9A 1SKSB 3QAVA 1M9BA 1ZYEA 2PBJA 1TXXA 1DBYA 2OKAA 4I2TA 1QFNA 3EMPA 4FH8A 3EYTA 4ZILA 3US3A 3L9VA 2O85A 1FVJA 2LQQA 3IA1A 1TU8A 3G7JA 5CRWA 1VF2A 2FWEA 4MA9A 4KX4A 2ON5A 2RLIA 4MPFA 1NSWA 4KSMA 2PWJA 3QOUA 4I97A 4IHUA 1X0RA 4J56E 2FHEA 4HS1A 2V32A 2DMMA 3HCZA 3GKNA 2FWGA 3EVIA 1F6MC 5AIXA 4G10A 18GSA 1H4OA 3EMXA 3QFAC 1K3LA 3VWUA 3TKQA 4Q5NA 5CP1A 4K8MA 3NZNA 4F82A 5G5FA 2HRFA 2OE0A 7GSSA 1F3AA 4OFTA 3H79A 2MYGA 3IE3A 1ZL9A 3P7XA 2GVPA 3KM6A 2RM5A 1GSYA 3KEBA 3FRCA 1EWXA 1THXA 4L5LA 3RHCA 1K0AA 1TW9A 1WRYA 4LA1A 1Z9HA 3ME7A 1OE7A 3H1NA 3HYPA 4IQ1A 5D9TA 3IAM2 3A2WA 4TXVA 2C0FA 4L8EA 2C0EA 1TOFA 3G9BA 3VFIA 3WGEA 2I3YA 4LL4B 1JFUA 2PGTA 5A5KA 5D9VA 1T7PB 1OC3A 20GSA 3AY8A 5IMCA 3OR5A 4JR6A 1E6BA 2GSQA 1H75A 2K8VA 2HFDA 3LYPA 2O8VB 2J9HA 4KW6A 4Q5QA 4MPGA 1ML6A 4JE1A 1EP8A 4X0XA 3GNJA 1DE1A 2H01A 1EGRA 3DD3A 5DDLA 3M9JA 2IMEA 1JZRA 3KXOA 3I43A 1TRSA 2HLSA 1OVNA 6GSYA 3TCOA 4P3YB 1ZMAA 4NAXA 2VD0A 1ZCPA 2LUSA 5CAXA 1G6WA 3GV1A 5FWGA 4PQ1A 3CYNA 2WRTA 3F4SA 4GCIA 1QXHA 1TK8B 4MF7A 5IQYA 4WR4A 3VPTA 1OKTA 1A0RP 3LFLA 1ST9A 3FKFA 1VF3A 1SJ6A 5DQSA 1TKDB 1R26A 3ED3A 5ECPB 1UC7A 1EP7A 1GUHA 4KH7A 1V2AA 3N9JA 1Z7PA 4HUAA 5KN0A 2QKEA 4V1Ag 1GULA 1EEMA 1TJDA 4K1FA 2AAWA 5F8BA 5HR0A 2CVDA 3F9UA 3LWAA 4TXOB 5J5NA 4J2FA 4ZIJA 3VWXA 2TIRA 1M9AA 4N30A 2IPAA 3RAZA 4RQRA 3LEFA 1SK2A 4FO5A 5AIVA 1YEXA 4QQ7A 2GT6A 3L4NA 2V41A 5G2ZA 2PVQA 3TUEA 5H5RA 4OFNA 4JEDA 3FZ4A 2FUG2 3MDKA 3UIWA 2EC4A 2PERA 4HZ4A 4RQXA 3HXSA 2ON7A 5G5EA 1WOUA 4IVFA 3HZ8A 5GAPD 3TRPA 3TKSA 4ECIA 4KNDA 1Q4JA 4GXZA 2CV4A 5G30A 2FNOA 4JBBA 3HA9A 1JHBA 4LMWA 2H76A 4NXIA 4ID0A 2VM2A 2MMOA 2YWNA 4PGTA 4KDXA 1SL0B 5DBQA 2P0GA 1A2MA 4X1UA 2C3NA 5DAKA 3KCMA 1K0MA 2VCQA 4AJ6A 1SK0A 2M46A 2V2GA 3LSZA 1FW1A 1S3AA 2C8UA 2REMA 2C80A 3BCKA 2G2QA 3ZIJA 3GL5A 3RPNA 4GQCA 3EINA 1SENA 2L5OA 1M2BA 5IM9A 1W89A 4F2IA 2GQMA 2H30A 2XHFA 3WGDA 3GSTA 1OAZA 4BL7A 1M2AA 3TOTA 3APSA 3Q6OA 1X9MB 3DEXA 4I2UA 3I9V2 3P2AA 4YAVA 2H71A 5CNWA 4WXTA 5JCUA 1EOHA 1ZOFA 1MD3A 2L57A 5D96A 2H1GA 1O85A 2LNSA 4POBA 5IOWA 1XOAA 3PINA 1SL2B 1DSBA 3JCML 4XRDA 5JWQB 1GSSA 4V2MA 1K0BA 2DLXA 1VF1A 1XIYA 4ZBAA 3D5JA 1YY7A 1XOBA 1O6JA 4OMVA 2IJYA 1EOGA 1A2LA 1TDIA 3PH9A 6GSTA 3TRXA 1BEDA 5HR2A 1J9BA 3CXGA 4HJMA 5DCHA 5FHIA 2H72A 3UAPA 1A23A 1NW2A 3VURA 4PUAA 1J08A 3L0HA 4CDOA 2JACA 3DKSA 5EY6A 1KBNA 1XW9A 1XVWA 6GSVA 2VL2C 2XC2A 4OO5A 4DSSB 1GLPA 1IYIA 1GTAA 4XIHA 5GZZB 2X64A 5ID2A 3UEMA 2CT6A 3WGXA 4GQFA 2OJLA 2VOCA 5J4UA 1USBA 1QQ2A 4MK3A 3HVSA 5GSSA 4QL9A 3GHAA 1NHYA 2E2GA 1KEBA 3KMNA 4ECBA 3C1RA 1YF1A 1K0OA 3ERGA 4KGIA 4JZQA 4E8EA 2AUVA 1M99A 2H0IA 2LNTA 3CTGA 1SKWB 1HYUA 1U3AA 1TK0B 1YQ1A 3ISOA 1GUKA 3LJRA 3BCIA 1I9DA 4EKZA 4IQAA 2AYTA 1WMJA 4GF0A 4CHSA 2MBSA 2V6KA 1TTZA 4IW9A 3V1WA 3LQ7A 5EVOA 1F3BA 2AB6A 3W8SA 3RBTA 1BX9A 2JSYA 3F3RA 1UVZA 4OWYA 1JZOA 1OE8A 3UOMA 3KIJA 3LXZA 3K8NA 4TRXA 1G6YA 1GSEA 2R4VA 9GSSA 1G7OA 6GSXA 2OACA 2KP2A 1NM3A 1WE0A 2B3SA 3GURA 1T4YA 2I1UA 3BJ5A 2GGTA 1SU9A 5DJMA 4NHZA 1GTBA 4AGSA 3KD0A 3L78A 2PPTA 1SD8A 2LJRA 2LRCA 2OA7A 5D9XA 3ZMLA 4MZWA 1XZOA 1Y6EA 1PQNA 1GUMA 1WP0A 2PU9C 1OYJA 2V6OA 4O5RA 2IMKA 5EPFA 1BYEA 2MMAA 2YZHA 3J7Yb 3GH9A 3M1GA 1T00A 1TK5B 3VLNA 1PX6A 1SYRA 4GSNA 3U6VA 4D73B 3WT2A 4L5OA 1XW6A 2H0HA 5LD0A 2ALBA 2KHPA 3ZIVA 5FT3A 2F9SA 1PKZA 1K3OA 1GTUA 4YH2A 2YCDA 3UJ1A 2P5QA 1IYHA 4PX1A 3D6IA 1GSUA 1AC1A 1V57A 4TR1B 4GRFA 1GLQA 2IWTA 2WDUA 3IDVA 4K0NA 1U3IA 1U6TA 4O92A 1CQGA 3HZ4A 4V1Ap 1ZZYA 16GSA 1QGVA 3GUSA 2HZFA 5C00A 3LG6A 1O81A 2CZ3A 5G31A 3A2VA 2PN8A 1JLWA 3QDNA 1YF0A 4PNFA 1SK1A 1K0CA 1AUCA 2YWMA 1R5PA 2JSZA 5HR1A 4OD7A 3LORA 1WPIA 3RHBA 3FZAA 1M2DA 3FZ5A 1WJKA 3C73A 1TI1A 2GS3A 3O3TA 1Z3EA 4FIWA 1B8XA 4HQSA 4WEYA 4G9HA 5D73A 5IO0A 1AXDA 2WZ9A 1MDJA 5IOXA 3HJOA 3GSSA 5CRGA 4YQUA 2WB9A 2F3MA 2YP6A 2OE3A 2ZNMA 4WF5A 4HJ2A 4ZL7A 1M7TA 2F8FA 2H66A 2GZYA 4IBPA 2O89A 2XPDA 1AW9A 5KN3A 2EIOA 3QPMA 4IP1A 3GN3A 1XXUA 6GSSA 5ECSA 4EO3A 2MZCA 4PNGA 1ZGNA 2MMZA 1PA3A 2B1KA 5ECIB 1A24A 4I6XA 4IJ3A 1SJZA 3BD2A 3MAKA 1R5AA 5B6NA 3F3QA 4TXOA 3KH7A 1DE2A 2PMTA 4NMUA 4MJAA 3QCPA 2VO4A 3R2QA 1TRUA 5GAND 1A8LA 4TW5A 4F9ZA 4MZBA 3KZQA 4TR3A 2O7KA 1XFLA 3Q74A 4XS6A 1AIUA 3GMFA 4JU5A 1ILOA 3CTFA 1T1VA 3KP8A 3LGCA 1UA5A 2LJAA 3PR8A 4IELA 1KTEA 4KSOA 2H6YA 3DGQA 5EL8A 1MDKA 4CW9A 3ZYWA 4E8HA 4K7IA 5ECRB 3ERFA 2MMNA 1S3CA 1WWJA 4GSSA 2YV7A 3F6FA 2K18A 2F51A 2WS2A 5G1LA 3TRQA 1HQOA 2VL2A 4WKWA 3VPQA 1B9XC 4OCFA 2KLXA 3P8WA 2VLUA 2H1BA 2DJ1A 2L6DA 4GTUA 4IJIA 1EEJA 3H4KA 2A2RA 4I5QA 2BTOT 3N5OA 3FYGA 3H93A 3I6AA 4TN8A 1XVQA 2FCHA 4AJ8A 2H1AA 2LSTA 3TJGA 5ENUA 1OC9B 4EC0A 1GNWA 2DJJA 4JR4A 3E9JB 1G0TA 2G0FA 1GSDA 4F0BA 1QMVA 2R5GA 1XW5A 3M8NA 1O8XA 4LMVA 3FEUA 1X9WB 2R37A 4L0UA 2PVOC 4MLYA 2V1MA 1HNBA 4PQHA 11GSA 1N8JA 1TU7A 2R2JA 3HKRA 1JZWA 5COHA 3ZL5A 2AHEA 3IAS2 4OFMA 1PGTA 14GSA 2I9HA 3DMLA 3GKMA 5E59A 4ILFA 2Z9SA 3C1SA 2ZUPA 4IKHA 2C0DA 4KDUA 4BPYA 2JZTA 2B7KA 4IGJA 1ZYQB 4F03A 4EVMA 3E3EA 2IN3A 2VCVA 2JZRA 4MJCA 1XWKA 2DIYA 3D4MA 3ERWA 2IMFA 1K0DA 5A4VA 4K9ZA 4RI6A 2TRXA 3KMOA 1ABAA 3ZRDA 2VL9A 4ISDA 1GWCA 1RQMA 5INYA 4WF4A 1Z6NA 2B6MA 1KNGA 2F8AA 2JU5A 4DSSA 3IBHA 3UBLA 1U87A 2B1LA 5ECKB 5A4UA 5LNKe 4JRRA 3GTUB 1VF4A 2JADA 2VLVA 4GWRA 4XS4B 1PKWA 3DYRA 2GLRA 4F0CA 4ML1A 1EV4A 4IP6A 3EC3A 3CSJA 4WBRD 5H5SA 4ECCA 4BVXA 1R7HA 1GP1A 1Z7RA 1C72A 3H8QA 1VGLA 4MH2A 1BG5A 1HD2A 2X99A 4IN0A 4EDYA 4ECJA 5CO3A 2E0QA 3TKRA 1TP9A 3CRUA 2TRCP 5IMFA 2VCXA 4N10A 5F06A 1OKDA 2JZSA 2RIIA 2VL3A 5IMAA 1XWCA 1UN2A 1RW1A 2FD3A 5J9BA 2WFCA 4ZL9A 2YANA 2WJUA 1QUWA 2VCZA 2N5AA 1ERWA 3IC4A 2HXKA 2RUEA 2H8LA 3A2XA 5ECOB 1S3DA 2H74A 1ON4A 5ECQB 4K6XA 1B48A 3D22A 2B7JA 5LCZA 3GX8A 4BA7A 4MF6A 3S9FA 3D4TA 3C8EA 1TRVA 4ZXGA 3F63A 1FAAA 2EIRA 2HYXA 3Q18A 2C0GA 2C1YA 2KOKA 3EURA 3DRNA 1O7UA 1VRSD 2CA8A 2CX3A 1F9MA 4ZB9A 4TR0A 2N5FA 3UARA 3DVWA 2M72A 3APQA 1PMTA 1Z6MA 2H6ZA 5AISA 2LEGA 2VLTA 19GSA 2GSRA 4ZB6A 4D73A 2IMIA 5F05A 5DVBA 5ECLB 1DUGA 2GDRA 2HNLA 1RK4A 3KTLA 4KB3A 1YDKA 4MABA 2MBTA 4HU9A 5IO2A 5DALB 3KGKA 2HZEB 1R4WA 1J0FA 3QMXA 2LV3A 4TR1A 2WULA 3TKPA 4KCAA 1GSQA 1AQVA 1YEPA 2XBQA 3FY7A 3O76A 4N11A 2C3QA 4KUNA 2R6KA 3FR3A 2GQLA 3FZ9A 1ERVA 4J57E 22GSA 2IFQB 1EV9A 4O32A 2C4JA 3QAGA 5B8BA 4POLA 2IMDA 3CRTA 5JWOB 1TI3A 4XS1A 5DCGA 2WGRA 3ZFLA 1B9YC 1SL1B 1V40A 2OBIA 2YJHA 2NVLA 3KTBA 2YWOA 5IPGA 1ACVA 4WBJA 2KP1A 2LJKA 3A5WA 5AN1A 2AV4A 4ULXA 4HEA2 2RM6A 2RUFA 3NOFA 4OO4A 2DSAA 3F6DA 3GYKA 4FYBA 3F8UA 3MSZA 5D93A 2BMXA 3G7IA 1FHEA 4MCUA 4K2DA 2NBSA 3TJKA 1CQHA 2FA8A 2NTOA 4TKYA 4ZBDA 2VM1A 2H19A 3UL3A 2CQ9A 2P31A 1X5EA 5CRDA 1URMA 1JLVA 1GRXA 4AF2A 4AJ7A 2FWFA 2X8CA 4ML6A 2FLSA 1V9WA 2YNXA 2FWHA 4TVEA 5KEJA 1WIKA 1U88A 2K9FA 3O6TA 2K8SA 2C3TA 1FB0A 2GZPA 2LRTA 5HQPA 2H1DA 1AQXA 4MH3A 1X5CA 1X5DA 1FG4A 3GIXA 1XBSA 3CBUA 1W4VA 1V98A 3UBKA 2FY6A 1F2EA 4EE0A 1BAYA 2DJ2A 2DIZA 2H6XA 3IPZA 4MZCA 4PUFC 4QL7A 3GFKA 1O73A 4KE3A 3QAWA 2KUCA
chains in the Genus database with same CATH superfamily
3U5RE 5G1KA 4GSTA 3GL3A 2B5EA 3QD9A 5B6MA 4EL1A 1I5GA 2DMLA 4HOJA 1TRWA 1PD21 3A3TA 2OBKA 3WYWA 1K3YA 3GX0A 3FK8A 6GSWA 4Q5RA 2PUKC 3IK9A 2L4QA 1BJXA 4HU7A 2E2MA 5A4WA 4GLTA 2LS5A 3ZMKA 3EU4A 5E4WA 1OC9A 4XRAA 4NHWA 2JL4A 3BOAA 3M9KA 1PRXA 5HFGA 5C04A 3F4TA 2AJQB 2HRKA 2HSMA 2J23A 4NV2A 2E7PA 3ZFBA 3RPPA 2YV9A 2YOIA 2I81A 2A2SA 4G0LA 4O5QA 4BWSA 3TJBA 4PTSA 3FR9A 5F07A 2BJXA 3LYKA 4MMMA 4IS0A 12GSA 3APOA 5IMDA 2GSTA 3ZTLA 2K6VA 4USSA 2CAQA 1FVKA 3HJPA 3GH6A 4MDCA 2EIQA 3VI7A 4X43A 4KCEA 3ME8A 3PGTA 4YQMA 1FOVA 5J41A 3HHVA 2L4CA 3HD5A 4WETA 1XG8A 1GH2A 5AGYA 4ZB8A 4EUYA 3EE2A 3W8JA 5IIZA 4L0WA 4YQVA 4PQIA 3CSHA 3CSIA 3EU3A 3IR4A 1AAZA 1SKRB 2O87A 3ZREA 3CQFA 4DEJA 4POKA 1OC8A 3IHQA 5J9CA 2DC5A 4HQZA 2VD1A 3VI5A 3LXTA 4MJBA 1HNCA 3FW2A 1B4PA 2FA4A 4G19A 4N0ZA 3TGZA 2HI7A 3QR6A 4EXJA 3BBYA 1Y25A 3L9UA 3GTUA 4XS4A 4WR5A 1T8EB 1MDIA 2QA2A 1YZXA 3TJJA 2HE3A 3Q19A 2ZCTA 1M0UA 1SYXA 1YJ6A 4PXOA 1G7EA 3MWHA 4RUVA 1PL2A 3TJFA 2GQKA 5BMUA 5HFKA 3UVHA 4MJEA 1O8WA 4NWYA 1LJRA 5KN1A 3NIVA 5J3RA 3J7Yk 4ICYA 4YAPA 4BWQA 5ECMB 3M0FA 3R3EA 4PURA 1PX7A 5ECNB 3ZVJA 3TDGA 4ACSA 2QGVA 1PSQA 17GSA 4N0VA 5HR3A 2X49A 4HZ2A 3TB2A 2XPEA 5DJLA 1THOA 4G2EA 5CYYA 3VK9A 2YWIA 2B5XA 2NPBA 3WT1A 3QFBC 2CZ2A 1XPVA 2DBCA 1AQWA 5JCWA 3SWLA 1XWBA 5HFIA 8GSSA 3KH9A 5JCGA 3HDCA 10GSA 2A4VA 5KN2A 2GTUA 2L5LA 4MP4A 1ERTA 2LKUA 3KJYA 3W6GA 3L9SA 3WD6A 1XCCA 3M3MA 2DJ0A 3P90A 5KOWA 1FO5A 1YKCA 5D9WA 4DSQA 2VCWA 1GL8A 3RDWA 3C71A 4V2LA 2GZZA 2NDOA 1A0FA 2H75A 4O7HA 4I8BA 1XWGA 3I69A 3KP9A 4ZL8A 2YN1A 3TOUA 2X8GA 2GSSA 1Q98A 3VWVA 3DXBA 5DAKB 1MEKA 3ZVJD 4HI7A 2CVBA 1N2AA 2VAFA 3GKXA 1NHOA 4H86A 4TR4A 4YKGA 3E0UA 5KOXA 2QC7A 2VCTA 4FYCA 4XHMA 5B8AA 2VIMA 3UVTA 5DQYA 2QSIA 4LL1B 4EDZA 3D0ZA 2CX4A 3F4RA 2H73A 5H5QA 1BQ7A 4TOPA 1GTIA 2LRNA 3IV4A 3F0IA 5B7CA 3IK7A 1B4QA 3GKKA 4XTSA 4BVYA 4ZBBA 4Z7XA 5ELGA 4V2NA 1K0NA 2M80A 1QK8A 1V58A 2VUPA 3IOSA 5DALA 1GNEA 1T3BA 2HZEA 3UMAA 4POMA 4BL7B 4Q5FA 1MTCA 3FHKA 2X8HA 3HVVA 4KA0A 1ZYPA 4HDEA 1PN9A 3G7YA 1A8YA 2B5YA 5D8IA 5ABRA 4K0GA 2A4HA 3IXRA 2HSHA 2GT5A 2DJ3A 4NPBA 1LU4A 3ZITA 3FR6A 2HRNA 5CREA 3HY2A 5L71A 2XBIA 2R0PA 4KDYA 2IIYA 5IPHA 2H0GA 4NV5A 2IFQA 6GSUA 1PL1A 5CRHA 3SBCA 2D2ZA 3TKSE 2DJKA 4DSRA 1XWAA 3GA4A 4KAEA 4Z2TA 1YKAA 4K7OA 2CVKA 3HVXA 1EGOA 13GSA 4BIKA 2H70A 3EWLA 3CMIA 4EF0A 1SD9A 3ZZXA 1JZDA 3VWWA 3TKSC 2OE1A 2LTKA 2L59A 4RI7A 2L6CA 2OADA 3D21A 1FB6A 4FYUA 4MF5A 1A2JA 2LQOA 3DWVA 4OCEA 3DVXA 4K7NA 1EZKA 3GRXA 4LLRA 2YJ7A 5F0GA 2P5RA 1X9SB 1HNAA 2FGXA 5ID2B 1FOHA 4XCSA 2CAIA 5IMVA 2N5BA 1E2YA 1ERUA 1T4ZA 3HJMA 5IMZA 1GSFA 5ELAA 5JWRB 3DIEA 2YZUA 3MNGA 5ECHB 2YPMA 3C7MA 1MD4A 3ZLPA 2R3XA 2IL3A 1Z5YE 2HSYA 1LBKA 2I4AA 2ES7A 1F37A 3IRAA 4K5SA 5GSTA 2WCIA 1SJIA 4DVCA 2HT9A 1SKSB 3QAVA 1M9BA 1ZYEA 2PBJA 1TXXA 1DBYA 2OKAA 4I2TA 1QFNA 3EMPA 4FH8A 3EYTA 4ZILA 3US3A 3L9VA 2O85A 1FVJA 2LQQA 3IA1A 1TU8A 3G7JA 5CRWA 1VF2A 2FWEA 4MA9A 4KX4A 2ON5A 4K2XA 2RLIA 4MPFA 1NSWA 4KSMA 2PWJA 3QOUA 4I97A 4IHUA 1X0RA 4J56E 2FHEA 4HS1A 2V32A 2DMMA 3MYDA 3HCZA 3GKNA 4FQUA 2FWGA 3EVIA 1F6MC 5AIXA 4G10A 18GSA 1H4OA 3EMXA 3QFAC 1K3LA 3VWUA 3TKQA 4Q5NA 5CP1A 4K8MA 3NZNA 4F82A 5G5FA 2HRFA 2OE0A 7GSSA 1F3AA 4OFTA 3H79A 2MYGA 3HVNA 3IE3A 1ZL9A 3P7XA 2GVPA 3KM6A 2RM5A 1GSYA 3KEBA 3FRCA 1EWXA 1THXA 4L5LA 3RHCA 2R0CA 1K0AA 1TW9A 1WRYA 4LA1A 3IHGA 1Z9HA 3ME7A 1OE7A 3H1NA 3HYPA 4IQ1A 5D9TA 3IAM2 3A2WA 4TXVA 2C0FA 4L8EA 2C0EA 1TOFA 3G9BA 3VFIA 3WGEA 1S3RA 2I3YA 4LL4B 1JFUA 2PGTA 5A5KA 5D9VA 1T7PB 1OC3A 20GSA 3AY8A 5IMCA 3OR5A 4JR6A 1E6BA 2GSQA 1H75A 2K8VA 2HFDA 3LYPA 2O8VB 2J9HA 4KW6A 4Q5QA 4MPGA 1ML6A 4JE1A 1EP8A 4X0XA 3GNJA 1DE1A 2H01A 1EGRA 3DD3A 5DDLA 3M9JA 2IMEA 1JZRA 4MNNA 3KXOA 3I43A 1TRSA 2HLSA 1OVNA 6GSYA 3TCOA 4P3YB 1ZMAA 4NAXA 2VD0A 1ZCPA 2LUSA 5CAXA 1G6WA 3GV1A 5FWGA 4PQ1A 3CYNA 2WRTA 3F4SA 4GCIA 1QXHA 1TK8B 4MF7A 5IQYA 4WR4A 3VPTA 1OKTA 1A0RP 3LFLA 1ST9A 3FKFA 1VF3A 1SJ6A 5DQSA 1TKDB 1R26A 3ED3A 5ECPB 1UC7A 1EP7A 1GUHA 4KH7A 1V2AA 3N9JA 1Z7PA 4HUAA 5KN0A 2DKHA 2A2PA 2QKEA 4V1Ag 1GULA 1EEMA 1TJDA 4K1FA 2AAWA 5F8BA 5HR0A 2CVDA 3F9UA 3LWAA 3EPTA 4TXOB 5J5NA 4J2FA 4ZIJA 3VWXA 2TIRA 1M9AA 4N30A 2IPAA 3RAZA 4RQRA 3LEFA 1SK2A 4FO5A 5AIVA 1YEXA 4QQ7A 2GT6A 3L4NA 2V41A 5G2ZA 2PVQA 3TUEA 5H5RA 4OFNA 4JEDA 3FZ4A 2FUG2 3MDKA 3UIWA 2EC4A 2PERA 4HZ4A 4RQXA 3HXSA 2ON7A 5G5EA 1WOUA 4IVFA 3HZ8A 5GAPD 3TRPA 3TKSA 4ECIA 4KNDA 1Q4JA 4GXZA 2CV4A 5G30A 2FNOA 4JBBA 3HA9A 1JHBA 4LMWA 2H76A 4NXIA 4KDXA 2VM2A 2MMOA 2YWNA 4PGTA 4ID0A 1SL0B 5DBQA 2P0GA 1A2MA 4X1UA 2C3NA 5DAKA 3KCMA 1K0MA 2VCQA 4AJ6A 1SK0A 2M46A 2V2GA 3LSZA 1FW1A 1S3AA 2C8UA 2REMA 2C80A 3BCKA 2G2QA 3ZIJA 3GL5A 3RPNA 4GQCA 3EINA 1SENA 2L5OA 1M2BA 5IM9A 1W89A 4F2IA 2GQMA 2H30A 2XHFA 3WGDA 3GSTA 1OAZA 4BL7A 1M2AA 3TOTA 3APSA 3Q6OA 1X9MB 3DEXA 4I2UA 3I9V2 3P2AA 4YAVA 2H71A 5CNWA 4WXTA 5JCUA 1EOHA 1ZOFA 1MD3A 2L57A 5D96A 2H1GA 1O85A 2LNSA 4POBA 5IOWA 1XOAA 3PINA 1SL2B 1DSBA 3JCML 4XRDA 5JWQB 1GSSA 4V2MA 1K0BA 2DLXA 1VF1A 1XIYA 4ZBAA 3D5JA 1YY7A 1XOBA 1O6JA 4OMVA 2IJYA 1EOGA 1A2LA 1TDIA 3PH9A 6GSTA 3TRXA 1BEDA 5HR2A 1J9BA 3CXGA 4HJMA 5DCHA 5FHIA 2H72A 3UAPA 1A23A 1NW2A 3VURA 4PUAA 1J08A 3L0HA 4CDOA 2JACA 3DKSA 5EY6A 1KBNA 1XW9A 1XVWA 6GSVA 2VL2C 2XC2A 4OO5A 4DSSB 1GLPA 1IYIA 1GTAA 4XIHA 5GZZB 2X64A 5ID2A 3UEMA 2CT6A 3WGXA 4GQFA 2OJLA 2VOCA 5J4UA 1USBA 1QQ2A 4MK3A 3HVSA 5GSSA 4QL9A 3GHAA 1NHYA 2E2GA 1KEBA 3KMNA 4ECBA 3C1RA 1YF1A 1K0OA 3ERGA 4KGIA 4BVXB 4JZQA 4E8EA 2AUVA 4G0KA 1M99A 2H0IA 2LNTA 3CTGA 1SKWB 1HYUA 1U3AA 1TK0B 1YQ1A 3ISOA 1GUKA 3LJRA 3BCIA 1I9DA 4EKZA 4IQAA 2AYTA 1WMJA 4GF0A 4CHSA 2MBSA 2V6KA 1TTZA 4IW9A 3V1WA 3LQ7A 5EVOA 1F3BA 2AB6A 3W8SA 3RBTA 1BX9A 2JSYA 3F3RA 1UVZA 4OWYA 1JZOA 1OE8A 3UOMA 3KIJA 3LXZA 3K8NA 4TRXA 1G6YA 1GSEA 2R4VA 9GSSA 1G7OA 6GSXA 2OACA 2KP2A 1NM3A 1WE0A 2B3SA 3GURA 1T4YA 2I1UA 3BJ5A 2GGTA 1SU9A 5DJMA 4NHZA 1GTBA 4AGSA 3KD0A 3L78A 2PPTA 1SD8A 2LJRA 2LRCA 2OA7A 3A5IA 5D9XA 3ZMLA 4MZWA 1XZOA 1Y6EA 1PQNA 1GUMA 1WP0A 2PU9C 1OYJA 2V6OA 4O5RA 2IMKA 5EPFA 1BYEA 2MMAA 2YZHA 3J7Yb 3GH9A 3M1GA 4A5PA 1T00A 1TK5B 3VLNA 1PX6A 1SYRA 4GSNA 3U6VA 4D73B 3WT2A 4L5OA 1XW6A 2H0HA 5LD0A 2ALBA 2KHPA 3ZIVA 5FT3A 2F9SA 1PKZA 1K3OA 1GTUA 4YH2A 2YCDA 3UJ1A 2P5QA 1IYHA 4PX1A 3D6IA 1GSUA 1AC1A 1V57A 4TR1B 4GRFA 1GLQA 2IWTA 2WDUA 3IDVA 4K0NA 1U3IA 1U6TA 4O92A 1CQGA 3HZ4A 4V1Ap 1ZZYA 16GSA 1QGVA 3GUSA 2HZFA 1M3IA 5C00A 3LG6A 1O81A 2CZ3A 5G31A 3A2VA 2PN8A 1JLWA 3QDNA 1YF0A 4PNFA 1SK1A 1K0CA 1AUCA 2YWMA 1R5PA 2JSZA 5HR1A 4OD7A 3LORA 1WPIA 3RHBA 3FZAA 1M2DA 3FZ5A 2X4AA 1WJKA 3LW9A 3C73A 1TI1A 2GS3A 3O3TA 1Z3EA 4FIWA 1B8XA 4HQSA 4WEYA 4G9HA 5D73A 5IO0A 1AXDA 2WZ9A 1MDJA 5IOXA 3HJOA 3GSSA 5CRGA 1M3JA 2QA1A 4YQUA 2WB9A 2F3MA 2YP6A 2OE3A 2ZNMA 4WF5A 4HJ2A 4ZL7A 1M7TA 2F8FA 2H66A 2GZYA 4IBPA 2O89A 2XPDA 1AW9A 5KN3A 2EIOA 3QPMA 4IP1A 3GN3A 1XXUA 6GSSA 5ECSA 4EO3A 2MZCA 4PNGA 1ZGNA 2MMZA 1PA3A 2B1KA 5ECIB 1A24A 4I6XA 4IJ3A 1SJZA 3BD2A 3MAKA 1R5AA 5B6NA 3F3QA 4TXOA 3KH7A 1DE2A 2PMTA 4NMUA 4MJAA 3QCPA 2VO4A 3R2QA 1TRUA 4X4JA 1A8LA 5GAND 4TW5A 4F9ZA 4MZBA 3KZQA 4TR3A 1PFOA 2O7KA 1XFLA 3Q74A 4XS6A 1AIUA 3GMFA 4JU5A 1ILOA 3CTFA 1T1VA 4EIQA 3KP8A 3LGCA 1UA5A 1ZYNA 2LJAA 3PR8A 4IELA 1KTEA 4KSOA 2H6YA 3DGQA 5EL8A 1MDKA 4CW9A 3ZYWA 4KF9A 4E8HA 4K7IA 5ECRB 3ERFA 2MMNA 1S3CA 1WWJA 4GSSA 2YV7A 3F6FA 2K18A 2F51A 2WS2A 5G1LA 3TRQA 1HQOA 2VL2A 4WKWA 3VPQA 1B9XC 4OCFA 2KLXA 3P8WA 2VLUA 2H1BA 2DJ1A 2L6DA 4GTUA 4IJIA 1EEJA 3H4KA 2A2RA 4I5QA 2DKIA 2BTOT 3N5OA 3FYGA 3H93A 3I6AA 4TN8A 1XVQA 2FCHA 4CY8A 4AJ8A 2H1AA 2LSTA 3TJGA 5ENUA 1OC9B 4EC0A 1GNWA 2DJJA 4JR4A 3E9JB 3FMWA 1G0TA 2G0FA 1GSDA 4F0BA 1QMVA 2R5GA 1XW5A 3M8NA 1O8XA 2HRAA 4LMVA 3FEUA 1X9WB 2R37A 4L0UA 2PVOC 4MLYA 2V1MA 1HNBA 4PQHA 11GSA 1PN0A 1N8JA 1TU7A 2R2JA 3HKRA 1JZWA 5COHA 3ZL5A 2AHEA 3IAS2 4OFMA 1PGTA 14GSA 2I9HA 3DMLA 3GKMA 5E59A 3IC8A 4ILFA 2Z9SA 3C1SA 2ZUPA 4IKHA 2C0DA 4KDUA 4BPYA 2JZTA 2B7KA 4IGJA 1ZYQB 4F03A 4EVMA 3E3EA 2IN3A 2VCVA 2JZRA 4MJCA 1XWKA 2DIYA 3D4MA 3ERWA 2IMFA 1K0DA 5A4VA 4K9ZA 4HSCX 4RI6A 2TRXA 3KMOA 1ABAA 3ZRDA 2VL9A 4ISDA 1GWCA 1RQMA 5INYA 4WF4A 1Z6NA 2B6MA 1KNGA 4YKFA 2F8AA 2JU5A 4DSSA 3IBHA 3UBLA 1U87A 2B1LA 5ECKB 5A4UA 5LNKe 4JRRA 3GTUB 1VF4A 2JADA 2VLVA 4GWRA 4XS4B 1PKWA 4G0IA 3DYRA 2GLRA 4F0CA 4ML1A 1EV4A 4IP6A 3EC3A 3CSJA 4WBRD 5H5SA 4ECCA 4BVXA 1R7HA 1GP1A 1Z7RA 1C72A 3H8QA 4Z2UA 1VGLA 4MH2A 1BG5A 1HD2A 2X99A 4O5UA 4IN0A 4EDYA 4ECJA 2R0GA 5CO3A 2E0QA 3TKRA 1TP9A 3CRUA 2TRCP 5IMFA 2VCXA 4N10A 5F06A 1OKDA 2JZSA 2RIIA 2VL3A 5IMAA 1XWCA 1UN2A 1RW1A 2FD3A 5J9BA 2WFCA 4ZL9A 2YANA 2WJUA 1QUWA 2VCZA 2N5AA 1ERWA 3IC4A 2HXKA 2RUEA 2H8LA 3A2XA 5ECOB 1S3DA 2H74A 1ON4A 5ECQB 4K6XA 1B48A 3D22A 2B7JA 5LCZA 3GX8A 4BA7A 4MF6A 3S9FA 3D4TA 3C8EA 1TRVA 4ZXGA 3F63A 1FAAA 2EIRA 2HYXA 3Q18A 2C0GA 2C1YA 2KOKA 3EURA 3DRNA 1O7UA 1VRSD 2CA8A 2CX3A 1F9MA 4ZB9A 4TR0A 2N5FA 3UARA 3DVWA 2M72A 3APQA 1PMTA 1Z6MA 2H6ZA 5AISA 2LEGA 2VLTA 19GSA 2GSRA 4ZB6A 4D73A 2IMIA 5F05A 5DVBA 5ECLB 1DUGA 3PPUA 2GDRA 2HNLA 4BVYB 1RK4A 3KTLA 4KB3A 1YDKA 4MABA 2MBTA 4HU9A 5IO2A 5DALB 3KGKA 2HZEB 1R4WA 1J0FA 3QMXA 4K5RA 2LV3A 4TR1A 2WULA 3TKPA 4KCAA 1GSQA 1AQVA 1YEPA 2XBQA 3FY7A 3O76A 4N11A 2C3QA 4KUNA 2R6KA 3FR3A 2GQLA 3FZ9A 1ERVA 4J57E 22GSA 2IFQB 1EV9A 4O32A 2C4JA 3QAGA 5B8BA 5BRTA 4Z2RA 4POLA 2IMDA 3CRTA 5JWOB 1TI3A 4XS1A 5DCGA 2WGRA 3ZFLA 1B9YC 1SL1B 1V40A 2OBIA 2YJHA 2NVLA 3KTBA 2YWOA 5IPGA 1ACVA 4WBJA 2KP1A 2LJKA 3A5WA 2AV4A 5AN1A 4ULXA 4HEA2 2RM6A 2RUFA 3NOFA 4OO4A 2DSAA 3F6DA 3GYKA 4FYBA 3F8UA 3MSZA 5D93A 2BMXA 3G7IA 1FHEA 4MCUA 4K2DA 2NBSA 3TJKA 1CQHA 2FA8A 2NTOA 4TKYA 4ZBDA 2VM1A 2H19A 3UL3A 2CQ9A 2P31A 1X5EA 5CRDA 1URMA 1JLVA 1GRXA 4AF2A 4CY6A 4AJ7A 2FWFA 2X8CA 4ML6A 2FLSA 1V9WA 2YNXA 2FWHA 4TVEA 5KEJA 1WIKA 1U88A 2K9FA 3O6TA 2K8SA 2C3TA 1FB0A 2GZPA 2LRTA 5HQPA 2H1DA 1AQXA 4MH3A 1X5CA 1X5DA 1FG4A 3GIXA 1XBSA 3CBUA 1W4VA 1V98A 4EIPA 3UBKA 2FY6A 1F2EA 4EE0A 1BAYA 2DJ2A 2DIZA 2H6XA 3IPZA 4MZCA 4PUFC 4QL7A 3MIXA 3GFKA 1O73A 4KE3A 3QAWA 2KUCA 2UZ8A
chains in the Genus database with same CATH topology
3U5RE 5G1KA 4GSTA 3GL3A 2B5EA 3QD9A 5B6MA 4EL1A 1I5GA 2DMLA 4HOJA 1TRWA 1PD21 3A3TA 2OBKA 3WYWA 1K3YA 3GX0A 3FK8A 6GSWA 4Q5RA 2PUKC 3IK9A 2L4QA 1BJXA 4HU7A 2E2MA 5A4WA 4GLTA 2LS5A 3ZMKA 3EU4A 5E4WA 1OC9A 4XRAA 4NHWA 2JL4A 3BOAA 3M9KA 1PRXA 5HFGA 5C04A 3F4TA 2AJQB 2HRKA 2HSMA 2J23A 4NV2A 2E7PA 3ZFBA 3RPPA 2YV9A 2YOIA 2I81A 2A2SA 4G0LA 4O5QA 4BWSA 3TJBA 4PTSA 3FR9A 5F07A 2BJXA 3LYKA 4MMMA 4IS0A 12GSA 3APOA 5IMDA 2GSTA 3ZTLA 2K6VA 4USSA 2CAQA 1FVKA 3HJPA 3GH6A 4MDCA 2EIQA 3VI7A 4X43A 4KCEA 3ME8A 3PGTA 4YQMA 1FOVA 5J41A 3HHVA 2L4CA 3HD5A 4WETA 1GH2A 5AGYA 4ZB8A 4EUYA 3EE2A 3W8JA 5IIZA 4L0WA 4YQVA 4PQIA 3CSHA 3CSIA 3EU3A 3IR4A 1AAZA 1SKRB 2O87A 3ZREA 4DEJA 4POKA 1OC8A 3IHQA 5J9CA 2DC5A 4HQZA 2VD1A 3VI5A 3LXTA 4MJBA 1HNCA 3FW2A 1B4PA 2FA4A 4G19A 4N0ZA 3TGZA 2HI7A 3QR6A 4EXJA 3BBYA 1Y25A 3L9UA 3GTUA 4XS4A 4WR5A 1T8EB 1MDIA 2QA2A 1YZXA 3TJJA 2HE3A 3Q19A 2ZCTA 1M0UA 1SYXA 1YJ6A 4PXOA 1G7EA 3MWHA 4RUVA 1PL2A 3TJFA 2GQKA 5BMUA 5HFKA 3UVHA 4MJEA 1O8WA 4NWYA 1LJRA 5KN1A 3NIVA 5J3RA 3J7Yk 4ICYA 4YAPA 4BWQA 5ECMB 3M0FA 3R3EA 4PURA 1PX7A 5ECNB 3ZVJA 3TDGA 4ACSA 2QGVA 1PSQA 17GSA 4N0VA 5HR3A 2X49A 4HZ2A 3TB2A 2XPEA 5DJLA 1THOA 4G2EA 5CYYA 3VK9A 2YWIA 2B5XA 2NPBA 3WT1A 3QFBC 2CZ2A 1XPVA 2DBCA 1AQWA 5JCWA 3SWLA 1XWBA 5HFIA 8GSSA 3KH9A 5JCGA 3HDCA 10GSA 2A4VA 5KN2A 2GTUA 2L5LA 4MP4A 1ERTA 2LKUA 3KJYA 3W6GA 3L9SA 3WD6A 1XCCA 3M3MA 2DJ0A 3P90A 5KOWA 1FO5A 1YKCA 5D9WA 4DSQA 2VCWA 1GL8A 3RDWA 3C71A 4V2LA 2GZZA 2NDOA 1A0FA 2H75A 4O7HA 4I8BA 1XWGA 3I69A 3KP9A 4ZL8A 2YN1A 3TOUA 2X8GA 2GSSA 1Q98A 3VWVA 3DXBA 5DAKB 1MEKA 3ZVJD 4HI7A 2CVBA 1N2AA 2VAFA 3GKXA 1NHOA 4H86A 4TR4A 4YKGA 3E0UA 5KOXA 2QC7A 2VCTA 4FYCA 4XHMA 5B8AA 2VIMA 3UVTA 5DQYA 2QSIA 4LL1B 4EDZA 3D0ZA 2CX4A 3F4RA 2H73A 5H5QA 1BQ7A 4TOPA 1GTIA 2LRNA 3IV4A 3F0IA 5B7CA 3IK7A 1B4QA 3GKKA 4XTSA 4BVYA 4ZBBA 4Z7XA 5ELGA 4V2NA 1K0NA 2M80A 1QK8A 1V58A 2VUPA 3IOSA 5DALA 1GNEA 1T3BA 2HZEA 3UMAA 4POMA 4BL7B 4Q5FA 1MTCA 3FHKA 2X8HA 3HVVA 4KA0A 1ZYPA 4HDEA 1PN9A 3G7YA 1A8YA 2B5YA 5D8IA 5ABRA 4K0GA 2A4HA 3IXRA 2HSHA 2GT5A 2DJ3A 4NPBA 1LU4A 3ZITA 3FR6A 2HRNA 5CREA 3HY2A 5L71A 2XBIA 2R0PA 4KDYA 2IIYA 5IPHA 2H0GA 4NV5A 2IFQA 6GSUA 1PL1A 5CRHA 3SBCA 2D2ZA 3TKSE 2DJKA 4DSRA 1XWAA 3GA4A 4KAEA 4Z2TA 1YKAA 4K7OA 2CVKA 3HVXA 1EGOA 13GSA 2H70A 3EWLA 3CMIA 4EF0A 1SD9A 3ZZXA 1JZDA 3VWWA 3TKSC 2OE1A 2LTKA 2L59A 4RI7A 2L6CA 2OADA 3D21A 1FB6A 4FYUA 4MF5A 1A2JA 2LQOA 3DWVA 4OCEA 3DVXA 4K7NA 1EZKA 3GRXA 4LLRA 2YJ7A 5F0GA 2P5RA 1X9SB 1HNAA 2FGXA 5ID2B 1FOHA 4XCSA 2CAIA 5IMVA 2N5BA 1E2YA 1ERUA 1T4ZA 3HJMA 5IMZA 1GSFA 5ELAA 5JWRB 3DIEA 2YZUA 3MNGA 5ECHB 2YPMA 3C7MA 1MD4A 3ZLPA 2R3XA 2IL3A 1Z5YE 2HSYA 1LBKA 2I4AA 2ES7A 1F37A 3IRAA 4K5SA 5GSTA 2WCIA 1SJIA 4DVCA 2HT9A 1SKSB 3QAVA 1M9BA 1ZYEA 2PBJA 1TXXA 1DBYA 2OKAA 4I2TA 1QFNA 3EMPA 4FH8A 3EYTA 4ZILA 3US3A 3L9VA 2O85A 1FVJA 2LQQA 3IA1A 1TU8A 3G7JA 5CRWA 1VF2A 2FWEA 4MA9A 4KX4A 2ON5A 4K2XA 2RLIA 4MPFA 1NSWA 4KSMA 2PWJA 3QOUA 4I97A 4IHUA 1X0RA 4J56E 2FHEA 4HS1A 2V32A 2DMMA 3MYDA 3HCZA 3GKNA 4FQUA 2FWGA 3EVIA 1F6MC 5AIXA 4G10A 18GSA 1H4OA 3EMXA 3QFAC 1K3LA 3VWUA 3TKQA 4Q5NA 5CP1A 4K8MA 3NZNA 4F82A 5G5FA 2HRFA 2OE0A 7GSSA 1F3AA 4OFTA 3H79A 2MYGA 3IE3A 1ZL9A 3P7XA 2GVPA 3KM6A 2RM5A 1GSYA 3KEBA 3FRCA 1EWXA 1THXA 4L5LA 3RHCA 2R0CA 1K0AA 1TW9A 1WRYA 4LA1A 3IHGA 1Z9HA 3ME7A 1OE7A 3H1NA 3HYPA 4IQ1A 5D9TA 3IAM2 3A2WA 4TXVA 2C0FA 4L8EA 2C0EA 1TOFA 3G9BA 3VFIA 3WGEA 2I3YA 4LL4B 1JFUA 2PGTA 5A5KA 5D9VA 1T7PB 1OC3A 20GSA 3AY8A 5IMCA 3OR5A 4JR6A 1E6BA 2GSQA 1H75A 2K8VA 2HFDA 3LYPA 2O8VB 2J9HA 4KW6A 4Q5QA 4MPGA 1ML6A 4JE1A 1EP8A 4X0XA 3GNJA 1DE1A 2H01A 1EGRA 3DD3A 5DDLA 3M9JA 2IMEA 1JZRA 4MNNA 3KXOA 3I43A 1TRSA 2HLSA 1OVNA 6GSYA 3TCOA 4P3YB 1ZMAA 4NAXA 2VD0A 1ZCPA 2LUSA 5CAXA 1G6WA 3GV1A 5FWGA 4PQ1A 3CYNA 2WRTA 3F4SA 4GCIA 1QXHA 1TK8B 4MF7A 5IQYA 4WR4A 3VPTA 1OKTA 1A0RP 3LFLA 1ST9A 3FKFA 1VF3A 1SJ6A 5DQSA 1TKDB 1R26A 3ED3A 5ECPB 1UC7A 1EP7A 1GUHA 4KH7A 1V2AA 3N9JA 1Z7PA 4HUAA 5KN0A 2DKHA 2A2PA 2QKEA 4V1Ag 1GULA 1EEMA 1TJDA 4K1FA 2AAWA 5F8BA 5HR0A 2CVDA 3F9UA 3LWAA 3EPTA 4TXOB 5J5NA 4J2FA 4ZIJA 3VWXA 2TIRA 1M9AA 4N30A 2IPAA 3RAZA 4RQRA 3LEFA 1SK2A 4FO5A 5AIVA 1YEXA 4QQ7A 2GT6A 3L4NA 2V41A 5G2ZA 2PVQA 3TUEA 5H5RA 4OFNA 4JEDA 3FZ4A 2FUG2 3MDKA 3UIWA 2EC4A 2PERA 4HZ4A 4RQXA 3HXSA 2ON7A 5G5EA 1WOUA 4IVFA 3HZ8A 5GAPD 3TRPA 3TKSA 4ECIA 4KNDA 1Q4JA 4GXZA 2CV4A 5G30A 2FNOA 4JBBA 3HA9A 1JHBA 4LMWA 2H76A 4NXIA 4KDXA 2VM2A 2MMOA 2YWNA 4PGTA 4ID0A 1SL0B 5DBQA 2P0GA 1A2MA 4X1UA 2C3NA 5DAKA 3KCMA 1K0MA 2VCQA 4AJ6A 1SK0A 2M46A 2V2GA 3LSZA 1FW1A 1S3AA 2C8UA 2REMA 2C80A 3BCKA 2G2QA 3ZIJA 3GL5A 3RPNA 4GQCA 3EINA 1SENA 2L5OA 1M2BA 5IM9A 1W89A 4F2IA 2GQMA 2H30A 2XHFA 3WGDA 3GSTA 1OAZA 4BL7A 1M2AA 3TOTA 3APSA 3Q6OA 1X9MB 3DEXA 4I2UA 3I9V2 3P2AA 4YAVA 2H71A 5CNWA 4WXTA 5JCUA 1EOHA 1ZOFA 1MD3A 2L57A 5D96A 2H1GA 1O85A 2LNSA 4POBA 5IOWA 1XOAA 3PINA 1SL2B 1DSBA 3JCML 4XRDA 5JWQB 1GSSA 4V2MA 1K0BA 2DLXA 1VF1A 1XIYA 4ZBAA 3D5JA 1YY7A 1XOBA 1O6JA 4OMVA 2IJYA 1EOGA 1A2LA 1TDIA 3PH9A 6GSTA 3TRXA 1BEDA 5HR2A 1J9BA 3CXGA 4HJMA 5DCHA 5FHIA 2H72A 3UAPA 1A23A 1NW2A 3VURA 4PUAA 1J08A 3L0HA 4CDOA 2JACA 3DKSA 5EY6A 1KBNA 1XW9A 1XVWA 6GSVA 2VL2C 2XC2A 4OO5A 4DSSB 1GLPA 1IYIA 1GTAA 4XIHA 5GZZB 2X64A 5ID2A 3UEMA 2CT6A 3WGXA 4GQFA 2OJLA 2VOCA 5J4UA 1USBA 1QQ2A 4MK3A 3HVSA 5GSSA 4QL9A 3GHAA 1NHYA 2E2GA 1KEBA 3KMNA 4ECBA 3C1RA 1YF1A 1K0OA 3ERGA 4KGIA 4BVXB 4JZQA 4E8EA 2AUVA 4G0KA 1M99A 2H0IA 2LNTA 3CTGA 1SKWB 1HYUA 1U3AA 1TK0B 1YQ1A 3ISOA 1GUKA 3LJRA 3BCIA 1I9DA 4EKZA 4IQAA 2AYTA 1WMJA 4GF0A 4CHSA 2MBSA 2V6KA 1TTZA 4IW9A 3V1WA 3LQ7A 5EVOA 1F3BA 2AB6A 3W8SA 3RBTA 1BX9A 2JSYA 3F3RA 1UVZA 4OWYA 1JZOA 1OE8A 3UOMA 3KIJA 3LXZA 3K8NA 4TRXA 1G6YA 1GSEA 2R4VA 9GSSA 1G7OA 6GSXA 2OACA 2KP2A 1NM3A 1WE0A 2B3SA 3GURA 1T4YA 2I1UA 3BJ5A 2GGTA 1SU9A 5DJMA 4NHZA 1GTBA 4AGSA 3KD0A 3L78A 2PPTA 1SD8A 2LJRA 2LRCA 2OA7A 3A5IA 5D9XA 3ZMLA 4MZWA 1XZOA 1Y6EA 1PQNA 1GUMA 1WP0A 2PU9C 1OYJA 2V6OA 4O5RA 2IMKA 5EPFA 1BYEA 2MMAA 2YZHA 3J7Yb 3GH9A 3M1GA 4A5PA 1T00A 1TK5B 3VLNA 1PX6A 1SYRA 4GSNA 3U6VA 4D73B 3WT2A 4L5OA 1XW6A 2H0HA 5LD0A 2ALBA 2KHPA 3ZIVA 5FT3A 2F9SA 1PKZA 1K3OA 1GTUA 4YH2A 2YCDA 3UJ1A 2P5QA 1IYHA 4PX1A 3D6IA 1GSUA 1AC1A 1V57A 4TR1B 4GRFA 1GLQA 2IWTA 2WDUA 3IDVA 4K0NA 1U3IA 1U6TA 4O92A 1CQGA 3HZ4A 4V1Ap 1ZZYA 16GSA 1QGVA 3GUSA 2HZFA 5C00A 3LG6A 1O81A 2CZ3A 5G31A 3A2VA 2PN8A 1JLWA 3QDNA 1YF0A 4PNFA 1SK1A 1K0CA 1AUCA 2YWMA 1R5PA 2JSZA 5HR1A 4OD7A 3LORA 1WPIA 3RHBA 3FZAA 1M2DA 3FZ5A 2X4AA 1WJKA 3LW9A 3C73A 1TI1A 2GS3A 3O3TA 1Z3EA 4FIWA 1B8XA 4HQSA 4WEYA 4G9HA 5D73A 5IO0A 1AXDA 2WZ9A 1MDJA 5IOXA 3HJOA 3GSSA 5CRGA 2QA1A 4YQUA 2WB9A 2F3MA 2YP6A 2OE3A 2ZNMA 4WF5A 4HJ2A 4ZL7A 1M7TA 2F8FA 2H66A 2GZYA 4IBPA 2O89A 2XPDA 1AW9A 5KN3A 2EIOA 3QPMA 4IP1A 3GN3A 1XXUA 6GSSA 5ECSA 4EO3A 2MZCA 4PNGA 1ZGNA 2MMZA 1PA3A 2B1KA 5ECIB 1A24A 4I6XA 4IJ3A 1SJZA 3BD2A 3MAKA 1R5AA 5B6NA 3F3QA 4TXOA 3KH7A 1DE2A 2PMTA 4NMUA 4MJAA 3QCPA 2VO4A 3R2QA 1TRUA 4X4JA 1A8LA 5GAND 4TW5A 4F9ZA 4MZBA 3KZQA 4TR3A 2O7KA 1XFLA 3Q74A 4XS6A 1AIUA 3GMFA 4JU5A 1ILOA 3CTFA 1T1VA 4EIQA 3KP8A 3LGCA 1UA5A 1ZYNA 2LJAA 3PR8A 4IELA 1KTEA 4KSOA 2H6YA 3DGQA 5EL8A 1MDKA 4CW9A 3ZYWA 4KF9A 4E8HA 4K7IA 5ECRB 3ERFA 2MMNA 1S3CA 1WWJA 4GSSA 2YV7A 3F6FA 2K18A 2F51A 2WS2A 5G1LA 3TRQA 1HQOA 2VL2A 4WKWA 3VPQA 1B9XC 4OCFA 2KLXA 3P8WA 2VLUA 2H1BA 2DJ1A 2L6DA 4GTUA 4IJIA 1EEJA 3H4KA 2A2RA 4I5QA 2DKIA 2BTOT 3N5OA 3FYGA 3H93A 3I6AA 4TN8A 1XVQA 2FCHA 4CY8A 4AJ8A 2H1AA 2LSTA 3TJGA 5ENUA 1OC9B 4EC0A 1GNWA 2DJJA 4JR4A 3E9JB 3FMWA 1G0TA 2G0FA 1GSDA 4F0BA 1QMVA 2R5GA 1XW5A 3M8NA 1O8XA 2HRAA 4LMVA 3FEUA 1X9WB 2R37A 4L0UA 2PVOC 4MLYA 2V1MA 1HNBA 4PQHA 11GSA 1PN0A 1N8JA 1TU7A 2R2JA 3HKRA 1JZWA 5COHA 3ZL5A 2AHEA 3IAS2 4OFMA 1PGTA 14GSA 2I9HA 3DMLA 3GKMA 5E59A 3IC8A 4ILFA 2Z9SA 3C1SA 2ZUPA 4IKHA 2C0DA 4KDUA 4BPYA 2JZTA 2B7KA 4IGJA 1ZYQB 4F03A 4EVMA 3E3EA 2IN3A 2VCVA 2JZRA 4MJCA 1XWKA 2DIYA 3D4MA 3ERWA 2IMFA 1K0DA 5A4VA 4K9ZA 4RI6A 2TRXA 3KMOA 1ABAA 3ZRDA 2VL9A 4ISDA 1GWCA 1RQMA 5INYA 4WF4A 1Z6NA 2B6MA 1KNGA 4YKFA 2F8AA 2JU5A 4DSSA 3IBHA 3UBLA 1U87A 2B1LA 5ECKB 5A4UA 5LNKe 4JRRA 3GTUB 1VF4A 2JADA 2VLVA 4GWRA 4XS4B 1PKWA 4G0IA 3DYRA 2GLRA 4F0CA 4ML1A 1EV4A 4IP6A 3EC3A 3CSJA 4WBRD 5H5SA 4ECCA 4BVXA 1R7HA 1GP1A 1Z7RA 1C72A 3H8QA 4Z2UA 1VGLA 4MH2A 1BG5A 1HD2A 2X99A 4O5UA 4IN0A 4EDYA 4ECJA 2R0GA 5CO3A 2E0QA 3TKRA 1TP9A 3CRUA 2TRCP 5IMFA 2VCXA 4N10A 5F06A 1OKDA 2JZSA 2RIIA 2VL3A 5IMAA 1XWCA 1UN2A 1RW1A 2FD3A 5J9BA 2WFCA 4ZL9A 2YANA 2WJUA 1QUWA 2VCZA 2N5AA 1ERWA 3IC4A 2HXKA 2RUEA 2H8LA 3A2XA 5ECOB 1S3DA 2H74A 1ON4A 5ECQB 4K6XA 1B48A 3D22A 2B7JA 5LCZA 3GX8A 4BA7A 4MF6A 3S9FA 3D4TA 3C8EA 1TRVA 4ZXGA 3F63A 1FAAA 2EIRA 2HYXA 3Q18A 2C0GA 2C1YA 2KOKA 3EURA 3DRNA 1O7UA 1VRSD 2CA8A 2CX3A 1F9MA 4ZB9A 4TR0A 2N5FA 3UARA 3DVWA 2M72A 3APQA 1PMTA 1Z6MA 2H6ZA 5AISA 2LEGA 2VLTA 19GSA 2GSRA 4ZB6A 4D73A 2IMIA 5F05A 5DVBA 5ECLB 1DUGA 3PPUA 2GDRA 2HNLA 4BVYB 1RK4A 3KTLA 4KB3A 1YDKA 4MABA 2MBTA 4HU9A 5IO2A 5DALB 3KGKA 2HZEB 1R4WA 1J0FA 3QMXA 4K5RA 2LV3A 4TR1A 2WULA 3TKPA 4KCAA 1GSQA 1AQVA 1YEPA 2XBQA 3FY7A 3O76A 4N11A 2C3QA 4KUNA 2R6KA 3FR3A 2GQLA 3FZ9A 1ERVA 4J57E 22GSA 2IFQB 1EV9A 4O32A 2C4JA 3QAGA 5B8BA 5BRTA 4Z2RA 4POLA 2IMDA 3CRTA 5JWOB 1TI3A 4XS1A 5DCGA 2WGRA 3ZFLA 1B9YC 1SL1B 1V40A 2OBIA 2YJHA 2NVLA 3KTBA 2YWOA 5IPGA 1ACVA 4WBJA 2KP1A 2LJKA 3A5WA 2AV4A 5AN1A 4ULXA 4HEA2 2RM6A 2RUFA 3NOFA 4OO4A 2DSAA 3F6DA 3GYKA 4FYBA 3F8UA 3MSZA 5D93A 2BMXA 3G7IA 1FHEA 4MCUA 4K2DA 2NBSA 3TJKA 1CQHA 2FA8A 2NTOA 4TKYA 4ZBDA 2VM1A 2H19A 3UL3A 2CQ9A 2P31A 1X5EA 5CRDA 1URMA 1JLVA 1GRXA 4AF2A 4CY6A 4AJ7A 2FWFA 2X8CA 4ML6A 2FLSA 1V9WA 2YNXA 2FWHA 4TVEA 5KEJA 1WIKA 1U88A 2K9FA 3O6TA 2K8SA 2C3TA 1FB0A 2GZPA 2LRTA 5HQPA 2H1DA 1AQXA 4MH3A 1X5CA 1X5DA 1FG4A 3GIXA 1XBSA 3CBUA 1W4VA 1V98A 4EIPA 3UBKA 2FY6A 1F2EA 4EE0A 1BAYA 2DJ2A 2DIZA 2H6XA 3IPZA 4MZCA 4PUFC 4QL7A 3MIXA 3GFKA 1O73A 4KE3A 3QAWA 2KUCA 2UZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5R E;  5G1K A;  4GST A;  3GL3 A;  2B5E A;  3QD9 A;  5B6M A;  4EL1 A;  1I5G A;  2DML A;  4HOJ A;  1TRW A;  1PD2 1;  3A3T A;  2OBK A;  3WYW A;  1K3Y A;  3GX0 A;  3FK8 A;  6GSW A;  4Q5R A;  2PUK C;  3IK9 A;  2L4Q A;  1BJX A;  4HU7 A;  2E2M A;  5A4W A;  4GLT A;  2LS5 A;  3ZMK A;  3EU4 A;  5E4W A;  1OC9 A;  4XRA A;  4NHW A;  2JL4 A;  3BOA A;  3M9K A;  1PRX A;  5HFG A;  5C04 A;  3F4T A;  2AJQ B;  2J23 A;  4NV2 A;  2E7P A;  3ZFB A;  3RPP A;  2YV9 A;  2YOI A;  2I81 A;  2A2S A;  4BWS A;  3TJB A;  3FR9 A;  5F07 A;  2BJX A;  3LYK A;  4MMM A;  4IS0 A;  12GS A;  3APO A;  5IMD A;  2GST A;  3ZTL A;  2K6V A;  2CAQ A;  1FVK A;  3HJP A;  3GH6 A;  4MDC A;  2EIQ A;  3VI7 A;  4X43 A;  4KCE A;  3ME8 A;  3PGT A;  4YQM A;  1FOV A;  5J41 A;  3HHV A;  2L4C A;  3HD5 A;  4WET A;  1GH2 A;  5AGY A;  4ZB8 A;  4EUY A;  3EE2 A;  3W8J A;  5IIZ A;  4L0W A;  4YQV A;  4PQI A;  3CSH A;  3CSI A;  3EU3 A;  3IR4 A;  1AAZ A;  1SKR B;  2O87 A;  3ZRE A;  4DEJ A;  4POK A;  1OC8 A;  3IHQ A;  5J9C A;  2DC5 A;  4HQZ A;  2VD1 A;  3VI5 A;  3LXT A;  4MJB A;  1HNC A;  3FW2 A;  1B4P A;  2FA4 A;  4G19 A;  4N0Z A;  3TGZ A;  2HI7 A;  3QR6 A;  4EXJ A;  3BBY A;  1Y25 A;  3L9U A;  3GTU A;  4XS4 A;  4WR5 A;  1T8E B;  1MDI A;  1YZX A;  3TJJ A;  2HE3 A;  3Q19 A;  2ZCT A;  1M0U A;  1SYX A;  1YJ6 A;  4PXO A;  1G7E A;  3MWH A;  4RUV A;  1PL2 A;  3TJF A;  2GQK A;  5HFK A;  3UVH A;  4MJE A;  1O8W A;  4NWY A;  1LJR A;  5KN1 A;  3NIV A;  5J3R A;  3J7Y k;  4YAP A;  4BWQ A;  5ECM B;  3M0F A;  4PUR A;  1PX7 A;  5ECN B;  3ZVJ A;  3TDG A;  4ACS A;  2QGV A;  1PSQ A;  17GS A;  4N0V A;  5HR3 A;  4HZ2 A;  3TB2 A;  2XPE A;  5DJL A;  1THO A;  4G2E A;  5CYY A;  3VK9 A;  2YWI A;  2B5X A;  2NPB A;  3WT1 A;  3QFB C;  2CZ2 A;  1XPV A;  2DBC A;  1AQW A;  5JCW A;  3SWL A;  1XWB A;  5HFI A;  8GSS A;  3KH9 A;  5JCG A;  3HDC A;  10GS A;  2A4V A;  5KN2 A;  2GTU A;  2L5L A;  4MP4 A;  1ERT A;  2LKU A;  3KJY A;  3W6G A;  3L9S A;  3WD6 A;  1XCC A;  3M3M A;  2DJ0 A;  3P90 A;  1FO5 A;  1YKC A;  5D9W A;  4DSQ A;  2VCW A;  1GL8 A;  3RDW A;  3C71 A;  4V2L A;  2GZZ A;  2NDO A;  1A0F A;  2H75 A;  4O7H A;  4I8B A;  1XWG A;  3I69 A;  3KP9 A;  4ZL8 A;  2YN1 A;  3TOU A;  2X8G A;  2GSS A;  1Q98 A;  3VWV A;  3DXB A;  5DAK B;  1MEK A;  3ZVJ D;  4HI7 A;  2CVB A;  1N2A A;  2VAF A;  3GKX A;  1NHO A;  4H86 A;  4TR4 A;  3E0U A;  2QC7 A;  2VCT A;  4FYC A;  4XHM A;  5B8A A;  2VIM A;  3UVT A;  5DQY A;  2QSI A;  4LL1 B;  4EDZ A;  3D0Z A;  2CX4 A;  3F4R A;  2H73 A;  5H5Q A;  1BQ7 A;  4TOP A;  1GTI A;  2LRN A;  3IV4 A;  3F0I A;  5B7C A;  3IK7 A;  1B4Q A;  3GKK A;  4XTS A;  4BVY A;  4ZBB A;  4Z7X A;  5ELG A;  4V2N A;  1K0N A;  2M80 A;  1QK8 A;  1V58 A;  2VUP A;  3IOS A;  5DAL A;  1GNE A;  1T3B A;  2HZE A;  3UMA A;  4POM A;  4Q5F A;  1MTC A;  3FHK A;  2X8H A;  3HVV A;  4KA0 A;  4HDE A;  1PN9 A;  3G7Y A;  1A8Y A;  2B5Y A;  5D8I A;  5ABR A;  4K0G A;  3IXR A;  2HSH A;  2GT5 A;  2DJ3 A;  4NPB A;  1LU4 A;  3ZIT A;  3FR6 A;  2HRN A;  5CRE A;  3HY2 A;  5L71 A;  2XBI A;  4KDY A;  2IIY A;  5IPH A;  2H0G A;  4NV5 A;  2IFQ A;  6GSU A;  1PL1 A;  5CRH A;  3SBC A;  2D2Z A;  3TKS E;  2DJK A;  4DSR A;  1XWA A;  3GA4 A;  4KAE A;  1YKA A;  4K7O A;  2CVK A;  3HVX A;  1EGO A;  13GS A;  2H70 A;  3EWL A;  3CMI A;  4EF0 A;  1SD9 A;  3ZZX A;  1JZD A;  3VWW A;  3TKS C;  2OE1 A;  2LTK A;  2L59 A;  4RI7 A;  2L6C A;  2OAD A;  3D21 A;  1FB6 A;  4FYU A;  4MF5 A;  1A2J A;  2LQO A;  3DWV A;  4OCE A;  3DVX A;  4K7N A;  1EZK A;  3GRX A;  4LLR A;  2YJ7 A;  5F0G A;  2P5R A;  1X9S B;  1HNA A;  2FGX A;  5ID2 B;  4XCS A;  2CAI A;  5IMV A;  2N5B A;  1E2Y A;  1ERU A;  1T4Z A;  3HJM A;  5IMZ A;  1GSF A;  5ELA A;  5JWR B;  3DIE A;  2YZU A;  3MNG A;  5ECH B;  2YPM A;  3C7M A;  1MD4 A;  3ZLP A;  2R3X A;  2IL3 A;  1Z5Y E;  2HSY A;  1LBK A;  2I4A A;  2ES7 A;  1F37 A;  3IRA A;  5GST A;  2WCI A;  1SJI A;  4DVC A;  2HT9 A;  1SKS B;  3QAV A;  1M9B A;  1ZYE A;  2PBJ A;  1TXX A;  1DBY A;  2OKA A;  4I2T A;  1QFN A;  3EMP A;  4FH8 A;  3EYT A;  4ZIL A;  3US3 A;  3L9V A;  2O85 A;  1FVJ A;  2LQQ A;  3IA1 A;  1TU8 A;  3G7J A;  5CRW A;  1VF2 A;  2FWE A;  4MA9 A;  4KX4 A;  2ON5 A;  2RLI A;  4MPF A;  1NSW A;  4KSM A;  2PWJ A;  3QOU A;  4I97 A;  4IHU A;  1X0R A;  4J56 E;  2FHE A;  4HS1 A;  2V32 A;  2DMM A;  3HCZ A;  3GKN A;  2FWG A;  3EVI A;  1F6M C;  5AIX A;  4G10 A;  18GS A;  1H4O A;  3EMX A;  3QFA C;  1K3L A;  3VWU A;  3TKQ A;  4Q5N A;  5CP1 A;  4K8M A;  3NZN A;  4F82 A;  5G5F A;  2HRF A;  2OE0 A;  7GSS A;  1F3A A;  4OFT A;  3H79 A;  2MYG A;  3IE3 A;  1ZL9 A;  3P7X A;  2GVP A;  3KM6 A;  2RM5 A;  1GSY A;  3KEB A;  3FRC A;  1EWX A;  1THX A;  4L5L A;  3RHC A;  1K0A A;  1TW9 A;  1WRY A;  4LA1 A;  1Z9H A;  3ME7 A;  1OE7 A;  3H1N A;  3HYP A;  4IQ1 A;  5D9T A;  3IAM 2;  3A2W A;  4TXV A;  2C0F A;  4L8E A;  2C0E A;  1TOF A;  3G9B A;  3VFI A;  3WGE A;  2I3Y A;  4LL4 B;  1JFU A;  2PGT A;  5A5K A;  5D9V A;  1T7P B;  1OC3 A;  20GS A;  3AY8 A;  5IMC A;  3OR5 A;  4JR6 A;  1E6B A;  2GSQ A;  1H75 A;  2K8V A;  2HFD A;  3LYP A;  2O8V B;  2J9H A;  4KW6 A;  4Q5Q A;  4MPG A;  1ML6 A;  4JE1 A;  1EP8 A;  4X0X A;  3GNJ A;  1DE1 A;  2H01 A;  1EGR A;  3DD3 A;  5DDL A;  3M9J A;  2IME A;  1JZR A;  3KXO A;  3I43 A;  1TRS A;  2HLS A;  1OVN A;  6GSY A;  3TCO A;  4P3Y B;  1ZMA A;  4NAX A;  2VD0 A;  1ZCP A;  2LUS A;  5CAX A;  1G6W A;  3GV1 A;  5FWG A;  4PQ1 A;  3CYN A;  2WRT A;  3F4S A;  4GCI A;  1QXH A;  1TK8 B;  4MF7 A;  5IQY A;  4WR4 A;  3VPT A;  1OKT A;  1A0R P;  3LFL A;  1ST9 A;  3FKF A;  1VF3 A;  1SJ6 A;  5DQS A;  1TKD B;  1R26 A;  3ED3 A;  5ECP B;  1UC7 A;  1EP7 A;  1GUH A;  4KH7 A;  1V2A A;  3N9J A;  1Z7P A;  4HUA A;  5KN0 A;  2QKE A;  4V1A g;  1GUL A;  1EEM A;  1TJD A;  4K1F A;  2AAW A;  5F8B A;  5HR0 A;  2CVD A;  3F9U A;  3LWA A;  4TXO B;  5J5N A;  4J2F A;  4ZIJ A;  3VWX A;  2TIR A;  1M9A A;  4N30 A;  2IPA A;  3RAZ A;  4RQR A;  3LEF A;  1SK2 A;  4FO5 A;  5AIV A;  1YEX A;  4QQ7 A;  2GT6 A;  3L4N A;  2V41 A;  5G2Z A;  2PVQ A;  3TUE A;  5H5R A;  4OFN A;  4JED A;  3FZ4 A;  2FUG 2;  3MDK A;  3UIW A;  2EC4 A;  2PER A;  4HZ4 A;  4RQX A;  3HXS A;  2ON7 A;  5G5E A;  1WOU A;  4IVF A;  3HZ8 A;  5GAP D;  3TRP A;  3TKS A;  4ECI A;  4KND A;  1Q4J A;  4GXZ A;  2CV4 A;  5G30 A;  2FNO A;  4JBB A;  3HA9 A;  1JHB A;  4LMW A;  2H76 A;  4NXI A;  4ID0 A;  2VM2 A;  2MMO A;  2YWN A;  4PGT A;  4KDX A;  1SL0 B;  5DBQ A;  2P0G A;  1A2M A;  4X1U A;  2C3N A;  5DAK A;  3KCM A;  1K0M A;  2VCQ A;  4AJ6 A;  1SK0 A;  2M46 A;  2V2G A;  3LSZ A;  1FW1 A;  1S3A A;  2C8U A;  2REM A;  2C80 A;  3BCK A;  2G2Q A;  3ZIJ A;  3GL5 A;  3RPN A;  4GQC A;  3EIN A;  1SEN A;  2L5O A;  1M2B A;  5IM9 A;  1W89 A;  4F2I A;  2GQM A;  2H30 A;  2XHF A;  3WGD A;  3GST A;  1OAZ A;  4BL7 A;  1M2A A;  3TOT A;  3APS A;  3Q6O A;  1X9M B;  3DEX A;  4I2U A;  3I9V 2;  3P2A A;  4YAV A;  2H71 A;  5CNW A;  4WXT A;  5JCU A;  1EOH A;  1ZOF A;  1MD3 A;  2L57 A;  5D96 A;  2H1G A;  1O85 A;  2LNS A;  4POB A;  5IOW A;  1XOA A;  3PIN A;  1SL2 B;  1DSB A;  3JCM L;  4XRD A;  5JWQ B;  1GSS A;  4V2M A;  1K0B A;  2DLX A;  1VF1 A;  1XIY A;  4ZBA A;  3D5J A;  1YY7 A;  1XOB A;  1O6J A;  4OMV A;  2IJY A;  1EOG A;  1A2L A;  1TDI A;  3PH9 A;  6GST A;  3TRX A;  1BED A;  5HR2 A;  1J9B A;  3CXG A;  4HJM A;  5DCH A;  5FHI A;  2H72 A;  3UAP A;  1A23 A;  1NW2 A;  3VUR A;  4PUA A;  1J08 A;  3L0H A;  4CDO A;  2JAC A;  3DKS A;  5EY6 A;  1KBN A;  1XW9 A;  1XVW A;  6GSV A;  2VL2 C;  2XC2 A;  4OO5 A;  4DSS B;  1GLP A;  1IYI A;  1GTA A;  4XIH A;  5GZZ B;  2X64 A;  5ID2 A;  3UEM A;  2CT6 A;  3WGX A;  4GQF A;  2OJL A;  2VOC A;  5J4U A;  1USB A;  1QQ2 A;  4MK3 A;  3HVS A;  5GSS A;  4QL9 A;  3GHA A;  1NHY A;  2E2G A;  1KEB A;  3KMN A;  4ECB A;  3C1R A;  1YF1 A;  1K0O A;  3ERG A;  4KGI A;  4JZQ A;  4E8E A;  2AUV A;  1M99 A;  2H0I A;  2LNT A;  3CTG A;  1SKW B;  1HYU A;  1U3A A;  1TK0 B;  1YQ1 A;  3ISO A;  1GUK A;  3LJR A;  3BCI A;  1I9D A;  4EKZ A;  4IQA A;  2AYT A;  1WMJ A;  4GF0 A;  4CHS A;  2MBS A;  2V6K A;  1TTZ A;  4IW9 A;  3V1W A;  3LQ7 A;  5EVO A;  1F3B A;  2AB6 A;  3W8S A;  3RBT A;  1BX9 A;  2JSY A;  3F3R A;  1UVZ A;  4OWY A;  1JZO A;  1OE8 A;  3UOM A;  3KIJ A;  3LXZ A;  3K8N A;  4TRX A;  1G6Y A;  1GSE A;  2R4V A;  9GSS A;  1G7O A;  6GSX A;  2OAC A;  2KP2 A;  1NM3 A;  1WE0 A;  2B3S A;  3GUR A;  1T4Y A;  2I1U A;  3BJ5 A;  2GGT A;  1SU9 A;  5DJM A;  4NHZ A;  1GTB A;  4AGS A;  3KD0 A;  3L78 A;  2PPT A;  1SD8 A;  2LJR A;  2LRC A;  2OA7 A;  5D9X A;  3ZML A;  4MZW A;  1XZO A;  1Y6E A;  1PQN A;  1GUM A;  1WP0 A;  2PU9 C;  1OYJ A;  2V6O A;  4O5R A;  2IMK A;  5EPF A;  1BYE A;  2MMA A;  2YZH A;  3J7Y b;  3GH9 A;  3M1G A;  1T00 A;  1TK5 B;  3VLN A;  1PX6 A;  1SYR A;  4GSN A;  3U6V A;  4D73 B;  3WT2 A;  4L5O A;  1XW6 A;  2H0H A;  5LD0 A;  2ALB A;  2KHP A;  3ZIV A;  5FT3 A;  2F9S A;  1PKZ A;  1K3O A;  1GTU A;  4YH2 A;  2YCD A;  3UJ1 A;  2P5Q A;  1IYH A;  4PX1 A;  3D6I A;  1GSU A;  1AC1 A;  1V57 A;  4TR1 B;  4GRF A;  1GLQ A;  2IWT A;  2WDU A;  3IDV A;  4K0N A;  1U3I A;  1U6T A;  4O92 A;  1CQG A;  3HZ4 A;  4V1A p;  1ZZY A;  16GS A;  1QGV A;  3GUS A;  2HZF A;  5C00 A;  3LG6 A;  1O81 A;  2CZ3 A;  5G31 A;  3A2V A;  2PN8 A;  1JLW A;  3QDN A;  1YF0 A;  4PNF A;  1SK1 A;  1K0C A;  1AUC A;  2YWM A;  1R5P A;  2JSZ A;  5HR1 A;  4OD7 A;  3LOR A;  1WPI A;  3RHB A;  3FZA A;  1M2D A;  3FZ5 A;  1WJK A;  3C73 A;  1TI1 A;  2GS3 A;  3O3T A;  1Z3E A;  4FIW A;  1B8X A;  4HQS A;  4WEY A;  4G9H A;  5D73 A;  5IO0 A;  1AXD A;  2WZ9 A;  1MDJ A;  5IOX A;  3HJO A;  3GSS A;  5CRG A;  4YQU A;  2WB9 A;  2F3M A;  2YP6 A;  2OE3 A;  2ZNM A;  4WF5 A;  4HJ2 A;  4ZL7 A;  1M7T A;  2F8F A;  2H66 A;  2GZY A;  4IBP A;  2O89 A;  2XPD A;  1AW9 A;  5KN3 A;  2EIO A;  3QPM A;  4IP1 A;  3GN3 A;  1XXU A;  6GSS A;  5ECS A;  4EO3 A;  2MZC A;  4PNG A;  1ZGN A;  2MMZ A;  1PA3 A;  2B1K A;  5ECI B;  1A24 A;  4I6X A;  4IJ3 A;  1SJZ A;  3BD2 A;  3MAK A;  1R5A A;  5B6N A;  3F3Q A;  4TXO A;  3KH7 A;  1DE2 A;  2PMT A;  4NMU A;  4MJA A;  3QCP A;  2VO4 A;  3R2Q A;  1TRU A;  5GAN D;  1A8L A;  4TW5 A;  4F9Z A;  4MZB A;  3KZQ A;  4TR3 A;  2O7K A;  1XFL A;  3Q74 A;  4XS6 A;  1AIU A;  3GMF A;  4JU5 A;  1ILO A;  3CTF A;  1T1V A;  3KP8 A;  3LGC A;  1UA5 A;  2LJA A;  3PR8 A;  4IEL A;  1KTE A;  4KSO A;  2H6Y A;  3DGQ A;  5EL8 A;  1MDK A;  4CW9 A;  3ZYW A;  4E8H A;  4K7I A;  5ECR B;  3ERF A;  2MMN A;  1S3C A;  1WWJ A;  4GSS A;  2YV7 A;  3F6F A;  2K18 A;  2F51 A;  2WS2 A;  5G1L A;  3TRQ A;  1HQO A;  2VL2 A;  4WKW A;  3VPQ A;  1B9X C;  4OCF A;  2KLX A;  3P8W A;  2VLU A;  2H1B A;  2DJ1 A;  2L6D A;  4GTU A;  4IJI A;  1EEJ A;  3H4K A;  2A2R A;  4I5Q A;  2BTO T;  3N5O A;  3FYG A;  3H93 A;  3I6A A;  4TN8 A;  1XVQ A;  2FCH A;  4AJ8 A;  2H1A A;  2LST A;  3TJG A;  5ENU A;  1OC9 B;  4EC0 A;  1GNW A;  2DJJ A;  4JR4 A;  3E9J B;  1G0T A;  2G0F A;  1GSD A;  4F0B A;  1QMV A;  2R5G A;  1XW5 A;  3M8N A;  1O8X A;  4LMV A;  3FEU A;  1X9W B;  2R37 A;  4L0U A;  2PVO C;  4MLY A;  2V1M A;  1HNB A;  4PQH A;  11GS A;  1N8J A;  1TU7 A;  2R2J A;  3HKR A;  1JZW A;  5COH A;  3ZL5 A;  2AHE A;  3IAS 2;  4OFM A;  1PGT A;  14GS A;  2I9H A;  3DML A;  3GKM A;  5E59 A;  4ILF A;  2Z9S A;  3C1S A;  2ZUP A;  4IKH A;  2C0D A;  4KDU A;  4BPY A;  2JZT A;  2B7K A;  4IGJ A;  1ZYQ B;  4F03 A;  4EVM A;  3E3E A;  2IN3 A;  2VCV A;  2JZR A;  4MJC A;  1XWK A;  2DIY A;  3D4M A;  3ERW A;  2IMF A;  1K0D A;  5A4V A;  4K9Z A;  4RI6 A;  2TRX A;  3KMO A;  1ABA A;  3ZRD A;  2VL9 A;  4ISD A;  1GWC A;  1RQM A;  5INY A;  4WF4 A;  1Z6N A;  2B6M A;  1KNG A;  2F8A A;  2JU5 A;  4DSS A;  3IBH A;  3UBL A;  1U87 A;  2B1L A;  5ECK B;  5A4U A;  5LNK e;  4JRR A;  3GTU B;  1VF4 A;  2JAD A;  2VLV A;  4GWR A;  4XS4 B;  1PKW A;  3DYR A;  2GLR A;  4F0C A;  4ML1 A;  1EV4 A;  4IP6 A;  3EC3 A;  3CSJ A;  4WBR D;  5H5S A;  4ECC A;  4BVX A;  1R7H A;  1GP1 A;  1Z7R A;  1C72 A;  3H8Q A;  1VGL A;  4MH2 A;  1BG5 A;  1HD2 A;  2X99 A;  4IN0 A;  4EDY A;  4ECJ A;  5CO3 A;  2E0Q A;  3TKR A;  1TP9 A;  3CRU A;  2TRC P;  5IMF A;  2VCX A;  4N10 A;  5F06 A;  1OKD A;  2JZS A;  2RII A;  2VL3 A;  5IMA A;  1XWC A;  1UN2 A;  1RW1 A;  2FD3 A;  5J9B A;  2WFC A;  4ZL9 A;  2YAN A;  2WJU A;  1QUW A;  2VCZ A;  2N5A A;  1ERW A;  3IC4 A;  2HXK A;  2RUE A;  2H8L A;  3A2X A;  5ECO B;  1S3D A;  2H74 A;  1ON4 A;  5ECQ B;  4K6X A;  1B48 A;  3D22 A;  2B7J A;  5LCZ A;  3GX8 A;  4BA7 A;  4MF6 A;  3S9F A;  3D4T A;  3C8E A;  1TRV A;  4ZXG A;  3F63 A;  1FAA A;  2EIR A;  2HYX A;  3Q18 A;  2C0G A;  2C1Y A;  2KOK A;  3EUR A;  3DRN A;  1O7U A;  1VRS D;  2CA8 A;  2CX3 A;  1F9M A;  4ZB9 A;  4TR0 A;  2N5F A;  3UAR A;  3DVW A;  2M72 A;  3APQ A;  1PMT A;  1Z6M A;  2H6Z A;  5AIS A;  2LEG A;  2VLT A;  19GS A;  2GSR A;  4ZB6 A;  4D73 A;  2IMI A;  5F05 A;  5DVB A;  5ECL B;  1DUG A;  2GDR A;  2HNL A;  1RK4 A;  3KTL A;  4KB3 A;  1YDK A;  4MAB A;  2MBT A;  4HU9 A;  5IO2 A;  5DAL B;  3KGK A;  2HZE B;  1R4W A;  1J0F A;  3QMX A;  2LV3 A;  4TR1 A;  2WUL A;  3TKP A;  4KCA A;  1GSQ A;  1AQV A;  1YEP A;  2XBQ A;  3FY7 A;  3O76 A;  4N11 A;  2C3Q A;  4KUN A;  2R6K A;  3FR3 A;  2GQL A;  3FZ9 A;  1ERV A;  4J57 E;  22GS A;  2IFQ B;  1EV9 A;  4O32 A;  2C4J A;  3QAG A;  5B8B A;  4POL A;  2IMD A;  3CRT A;  5JWO B;  1TI3 A;  4XS1 A;  5DCG A;  2WGR A;  3ZFL A;  1B9Y C;  1SL1 B;  1V40 A;  2OBI A;  2YJH A;  2NVL A;  3KTB A;  2YWO A;  5IPG A;  1ACV A;  4WBJ A;  2KP1 A;  2LJK A;  3A5W A;  5AN1 A;  2AV4 A;  4ULX A;  4HEA 2;  2RM6 A;  2RUF A;  3NOF A;  4OO4 A;  2DSA A;  3F6D A;  3GYK A;  4FYB A;  3F8U A;  3MSZ A;  5D93 A;  2BMX A;  3G7I A;  1FHE A;  4MCU A;  4K2D A;  2NBS A;  3TJK A;  1CQH A;  2FA8 A;  2NTO A;  4TKY A;  4ZBD A;  2VM1 A;  2H19 A;  3UL3 A;  2CQ9 A;  2P31 A;  1X5E A;  5CRD A;  1URM A;  1JLV A;  1GRX A;  4AF2 A;  4AJ7 A;  2FWF A;  2X8C A;  4ML6 A;  2FLS A;  1V9W A;  2YNX A;  2FWH A;  4TVE A;  5KEJ A;  1WIK A;  1U88 A;  2K9F A;  3O6T A;  2K8S A;  2C3T A;  1FB0 A;  2GZP A;  2LRT A;  5HQP A;  2H1D A;  1AQX A;  4MH3 A;  1X5C A;  1X5D A;  1FG4 A;  3GIX A;  1XBS A;  3CBU A;  1W4V A;  1V98 A;  3UBK A;  2FY6 A;  1F2E A;  4EE0 A;  1BAY A;  2DJ2 A;  2DIZ A;  2H6X A;  3IPZ A;  4MZC A;  4PUF C;  4QL7 A;  3GFK A;  1O73 A;  4KE3 A;  3QAW A;  2KUC A; 
#chains in the Genus database with same CATH topology
 3U5R E;  5G1K A;  4GST A;  3GL3 A;  2B5E A;  3QD9 A;  5B6M A;  4EL1 A;  1I5G A;  2DML A;  4HOJ A;  1TRW A;  1PD2 1;  3A3T A;  2OBK A;  3WYW A;  1K3Y A;  3GX0 A;  3FK8 A;  6GSW A;  4Q5R A;  2PUK C;  3IK9 A;  2L4Q A;  1BJX A;  4HU7 A;  2E2M A;  5A4W A;  4GLT A;  2LS5 A;  3ZMK A;  3EU4 A;  5E4W A;  1OC9 A;  4XRA A;  4NHW A;  2JL4 A;  3BOA A;  3M9K A;  1PRX A;  5HFG A;  5C04 A;  3F4T A;  2AJQ B;  2HRK A;  2HSM A;  2J23 A;  4NV2 A;  2E7P A;  3ZFB A;  3RPP A;  2YV9 A;  2YOI A;  2I81 A;  2A2S A;  4G0L A;  4O5Q A;  4BWS A;  3TJB A;  4PTS A;  3FR9 A;  5F07 A;  2BJX A;  3LYK A;  4MMM A;  4IS0 A;  12GS A;  3APO A;  5IMD A;  2GST A;  3ZTL A;  2K6V A;  4USS A;  2CAQ A;  1FVK A;  3HJP A;  3GH6 A;  4MDC A;  2EIQ A;  3VI7 A;  4X43 A;  4KCE A;  3ME8 A;  3PGT A;  4YQM A;  1FOV A;  5J41 A;  3HHV A;  2L4C A;  3HD5 A;  4WET A;  1XG8 A;  1GH2 A;  5AGY A;  4ZB8 A;  4EUY A;  3EE2 A;  3W8J A;  5IIZ A;  4L0W A;  4YQV A;  4PQI A;  3CSH A;  3CSI A;  3EU3 A;  3IR4 A;  1AAZ A;  1SKR B;  2O87 A;  3ZRE A;  3CQF A;  4DEJ A;  4POK A;  1OC8 A;  3IHQ A;  5J9C A;  2DC5 A;  4HQZ A;  2VD1 A;  3VI5 A;  3LXT A;  4MJB A;  1HNC A;  3FW2 A;  1B4P A;  2FA4 A;  4G19 A;  4N0Z A;  3TGZ A;  2HI7 A;  3QR6 A;  4EXJ A;  3BBY A;  1Y25 A;  3L9U A;  3GTU A;  4XS4 A;  4WR5 A;  1T8E B;  1MDI A;  2QA2 A;  1YZX A;  3TJJ A;  2HE3 A;  3Q19 A;  2ZCT A;  1M0U A;  1SYX A;  1YJ6 A;  4PXO A;  1G7E A;  3MWH A;  4RUV A;  1PL2 A;  3TJF A;  2GQK A;  5BMU A;  5HFK A;  3UVH A;  4MJE A;  1O8W A;  4NWY A;  1LJR A;  5KN1 A;  3NIV A;  5J3R A;  3J7Y k;  4ICY A;  4YAP A;  4BWQ A;  5ECM B;  3M0F A;  3R3E A;  4PUR A;  1PX7 A;  5ECN B;  3ZVJ A;  3TDG A;  4ACS A;  2QGV A;  1PSQ A;  17GS A;  4N0V A;  5HR3 A;  2X49 A;  4HZ2 A;  3TB2 A;  2XPE A;  5DJL A;  1THO A;  4G2E A;  5CYY A;  3VK9 A;  2YWI A;  2B5X A;  2NPB A;  3WT1 A;  3QFB C;  2CZ2 A;  1XPV A;  2DBC A;  1AQW A;  5JCW A;  3SWL A;  1XWB A;  5HFI A;  8GSS A;  3KH9 A;  5JCG A;  3HDC A;  10GS A;  2A4V A;  5KN2 A;  2GTU A;  2L5L A;  4MP4 A;  1ERT A;  2LKU A;  3KJY A;  3W6G A;  3L9S A;  3WD6 A;  1XCC A;  3M3M A;  2DJ0 A;  3P90 A;  5KOW A;  1FO5 A;  1YKC A;  5D9W A;  4DSQ A;  2VCW A;  1GL8 A;  3RDW A;  3C71 A;  4V2L A;  2GZZ A;  2NDO A;  1A0F A;  2H75 A;  4O7H A;  4I8B A;  1XWG A;  3I69 A;  3KP9 A;  4ZL8 A;  2YN1 A;  3TOU A;  2X8G A;  2GSS A;  1Q98 A;  3VWV A;  3DXB A;  5DAK B;  1MEK A;  3ZVJ D;  4HI7 A;  2CVB A;  1N2A A;  2VAF A;  3GKX A;  1NHO A;  4H86 A;  4TR4 A;  4YKG A;  3E0U A;  5KOX A;  2QC7 A;  2VCT A;  4FYC A;  4XHM A;  5B8A A;  2VIM A;  3UVT A;  5DQY A;  2QSI A;  4LL1 B;  4EDZ A;  3D0Z A;  2CX4 A;  3F4R A;  2H73 A;  5H5Q A;  1BQ7 A;  4TOP A;  1GTI A;  2LRN A;  3IV4 A;  3F0I A;  5B7C A;  3IK7 A;  1B4Q A;  3GKK A;  4XTS A;  4BVY A;  4ZBB A;  4Z7X A;  5ELG A;  4V2N A;  1K0N A;  2M80 A;  1QK8 A;  1V58 A;  2VUP A;  3IOS A;  5DAL A;  1GNE A;  1T3B A;  2HZE A;  3UMA A;  4POM A;  4BL7 B;  4Q5F A;  1MTC A;  3FHK A;  2X8H A;  3HVV A;  4KA0 A;  1ZYP A;  4HDE A;  1PN9 A;  3G7Y A;  1A8Y A;  2B5Y A;  5D8I A;  5ABR A;  4K0G A;  2A4H A;  3IXR A;  2HSH A;  2GT5 A;  2DJ3 A;  4NPB A;  1LU4 A;  3ZIT A;  3FR6 A;  2HRN A;  5CRE A;  3HY2 A;  5L71 A;  2XBI A;  2R0P A;  4KDY A;  2IIY A;  5IPH A;  2H0G A;  4NV5 A;  2IFQ A;  6GSU A;  1PL1 A;  5CRH A;  3SBC A;  2D2Z A;  3TKS E;  2DJK A;  4DSR A;  1XWA A;  3GA4 A;  4KAE A;  4Z2T A;  1YKA A;  4K7O A;  2CVK A;  3HVX A;  1EGO A;  13GS A;  4BIK A;  2H70 A;  3EWL A;  3CMI A;  4EF0 A;  1SD9 A;  3ZZX A;  1JZD A;  3VWW A;  3TKS C;  2OE1 A;  2LTK A;  2L59 A;  4RI7 A;  2L6C A;  2OAD A;  3D21 A;  1FB6 A;  4FYU A;  4MF5 A;  1A2J A;  2LQO A;  3DWV A;  4OCE A;  3DVX A;  4K7N A;  1EZK A;  3GRX A;  4LLR A;  2YJ7 A;  5F0G A;  2P5R A;  1X9S B;  1HNA A;  2FGX A;  5ID2 B;  1FOH A;  4XCS A;  2CAI A;  5IMV A;  2N5B A;  1E2Y A;  1ERU A;  1T4Z A;  3HJM A;  5IMZ A;  1GSF A;  5ELA A;  5JWR B;  3DIE A;  2YZU A;  3MNG A;  5ECH B;  2YPM A;  3C7M A;  1MD4 A;  3ZLP A;  2R3X A;  2IL3 A;  1Z5Y E;  2HSY A;  1LBK A;  2I4A A;  2ES7 A;  1F37 A;  3IRA A;  4K5S A;  5GST A;  2WCI A;  1SJI A;  4DVC A;  2HT9 A;  1SKS B;  3QAV A;  1M9B A;  1ZYE A;  2PBJ A;  1TXX A;  1DBY A;  2OKA A;  4I2T A;  1QFN A;  3EMP A;  4FH8 A;  3EYT A;  4ZIL A;  3US3 A;  3L9V A;  2O85 A;  1FVJ A;  2LQQ A;  3IA1 A;  1TU8 A;  3G7J A;  5CRW A;  1VF2 A;  2FWE A;  4MA9 A;  4KX4 A;  2ON5 A;  4K2X A;  2RLI A;  4MPF A;  1NSW A;  4KSM A;  2PWJ A;  3QOU A;  4I97 A;  4IHU A;  1X0R A;  4J56 E;  2FHE A;  4HS1 A;  2V32 A;  2DMM A;  3MYD A;  3HCZ A;  3GKN A;  4FQU A;  2FWG A;  3EVI A;  1F6M C;  5AIX A;  4G10 A;  18GS A;  1H4O A;  3EMX A;  3QFA C;  1K3L A;  3VWU A;  3TKQ A;  4Q5N A;  5CP1 A;  4K8M A;  3NZN A;  4F82 A;  5G5F A;  2HRF A;  2OE0 A;  7GSS A;  1F3A A;  4OFT A;  3H79 A;  2MYG A;  3HVN A;  3IE3 A;  1ZL9 A;  3P7X A;  2GVP A;  3KM6 A;  2RM5 A;  1GSY A;  3KEB A;  3FRC A;  1EWX A;  1THX A;  4L5L A;  3RHC A;  2R0C A;  1K0A A;  1TW9 A;  1WRY A;  4LA1 A;  3IHG A;  1Z9H A;  3ME7 A;  1OE7 A;  3H1N A;  3HYP A;  4IQ1 A;  5D9T A;  3IAM 2;  3A2W A;  4TXV A;  2C0F A;  4L8E A;  2C0E A;  1TOF A;  3G9B A;  3VFI A;  3WGE A;  1S3R A;  2I3Y A;  4LL4 B;  1JFU A;  2PGT A;  5A5K A;  5D9V A;  1T7P B;  1OC3 A;  20GS A;  3AY8 A;  5IMC A;  3OR5 A;  4JR6 A;  1E6B A;  2GSQ A;  1H75 A;  2K8V A;  2HFD A;  3LYP A;  2O8V B;  2J9H A;  4KW6 A;  4Q5Q A;  4MPG A;  1ML6 A;  4JE1 A;  1EP8 A;  4X0X A;  3GNJ A;  1DE1 A;  2H01 A;  1EGR A;  3DD3 A;  5DDL A;  3M9J A;  2IME A;  1JZR A;  4MNN A;  3KXO A;  3I43 A;  1TRS A;  2HLS A;  1OVN A;  6GSY A;  3TCO A;  4P3Y B;  1ZMA A;  4NAX A;  2VD0 A;  1ZCP A;  2LUS A;  5CAX A;  1G6W A;  3GV1 A;  5FWG A;  4PQ1 A;  3CYN A;  2WRT A;  3F4S A;  4GCI A;  1QXH A;  1TK8 B;  4MF7 A;  5IQY A;  4WR4 A;  3VPT A;  1OKT A;  1A0R P;  3LFL A;  1ST9 A;  3FKF A;  1VF3 A;  1SJ6 A;  5DQS A;  1TKD B;  1R26 A;  3ED3 A;  5ECP B;  1UC7 A;  1EP7 A;  1GUH A;  4KH7 A;  1V2A A;  3N9J A;  1Z7P A;  4HUA A;  5KN0 A;  2DKH A;  2A2P A;  2QKE A;  4V1A g;  1GUL A;  1EEM A;  1TJD A;  4K1F A;  2AAW A;  5F8B A;  5HR0 A;  2CVD A;  3F9U A;  3LWA A;  3EPT A;  4TXO B;  5J5N A;  4J2F A;  4ZIJ A;  3VWX A;  2TIR A;  1M9A A;  4N30 A;  2IPA A;  3RAZ A;  4RQR A;  3LEF A;  1SK2 A;  4FO5 A;  5AIV A;  1YEX A;  4QQ7 A;  2GT6 A;  3L4N A;  2V41 A;  5G2Z A;  2PVQ A;  3TUE A;  5H5R A;  4OFN A;  4JED A;  3FZ4 A;  2FUG 2;  3MDK A;  3UIW A;  2EC4 A;  2PER A;  4HZ4 A;  4RQX A;  3HXS A;  2ON7 A;  5G5E A;  1WOU A;  4IVF A;  3HZ8 A;  5GAP D;  3TRP A;  3TKS A;  4ECI A;  4KND A;  1Q4J A;  4GXZ A;  2CV4 A;  5G30 A;  2FNO A;  4JBB A;  3HA9 A;  1JHB A;  4LMW A;  2H76 A;  4NXI A;  4KDX A;  2VM2 A;  2MMO A;  2YWN A;  4PGT A;  4ID0 A;  1SL0 B;  5DBQ A;  2P0G A;  1A2M A;  4X1U A;  2C3N A;  5DAK A;  3KCM A;  1K0M A;  2VCQ A;  4AJ6 A;  1SK0 A;  2M46 A;  2V2G A;  3LSZ A;  1FW1 A;  1S3A A;  2C8U A;  2REM A;  2C80 A;  3BCK A;  2G2Q A;  3ZIJ A;  3GL5 A;  3RPN A;  4GQC A;  3EIN A;  1SEN A;  2L5O A;  1M2B A;  5IM9 A;  1W89 A;  4F2I A;  2GQM A;  2H30 A;  2XHF A;  3WGD A;  3GST A;  1OAZ A;  4BL7 A;  1M2A A;  3TOT A;  3APS A;  3Q6O A;  1X9M B;  3DEX A;  4I2U A;  3I9V 2;  3P2A A;  4YAV A;  2H71 A;  5CNW A;  4WXT A;  5JCU A;  1EOH A;  1ZOF A;  1MD3 A;  2L57 A;  5D96 A;  2H1G A;  1O85 A;  2LNS A;  4POB A;  5IOW A;  1XOA A;  3PIN A;  1SL2 B;  1DSB A;  3JCM L;  4XRD A;  5JWQ B;  1GSS A;  4V2M A;  1K0B A;  2DLX A;  1VF1 A;  1XIY A;  4ZBA A;  3D5J A;  1YY7 A;  1XOB A;  1O6J A;  4OMV A;  2IJY A;  1EOG A;  1A2L A;  1TDI A;  3PH9 A;  6GST A;  3TRX A;  1BED A;  5HR2 A;  1J9B A;  3CXG A;  4HJM A;  5DCH A;  5FHI A;  2H72 A;  3UAP A;  1A23 A;  1NW2 A;  3VUR A;  4PUA A;  1J08 A;  3L0H A;  4CDO A;  2JAC A;  3DKS A;  5EY6 A;  1KBN A;  1XW9 A;  1XVW A;  6GSV A;  2VL2 C;  2XC2 A;  4OO5 A;  4DSS B;  1GLP A;  1IYI A;  1GTA A;  4XIH A;  5GZZ B;  2X64 A;  5ID2 A;  3UEM A;  2CT6 A;  3WGX A;  4GQF A;  2OJL A;  2VOC A;  5J4U A;  1USB A;  1QQ2 A;  4MK3 A;  3HVS A;  5GSS A;  4QL9 A;  3GHA A;  1NHY A;  2E2G A;  1KEB A;  3KMN A;  4ECB A;  3C1R A;  1YF1 A;  1K0O A;  3ERG A;  4KGI A;  4BVX B;  4JZQ A;  4E8E A;  2AUV A;  4G0K A;  1M99 A;  2H0I A;  2LNT A;  3CTG A;  1SKW B;  1HYU A;  1U3A A;  1TK0 B;  1YQ1 A;  3ISO A;  1GUK A;  3LJR A;  3BCI A;  1I9D A;  4EKZ A;  4IQA A;  2AYT A;  1WMJ A;  4GF0 A;  4CHS A;  2MBS A;  2V6K A;  1TTZ A;  4IW9 A;  3V1W A;  3LQ7 A;  5EVO A;  1F3B A;  2AB6 A;  3W8S A;  3RBT A;  1BX9 A;  2JSY A;  3F3R A;  1UVZ A;  4OWY A;  1JZO A;  1OE8 A;  3UOM A;  3KIJ A;  3LXZ A;  3K8N A;  4TRX A;  1G6Y A;  1GSE A;  2R4V A;  9GSS A;  1G7O A;  6GSX A;  2OAC A;  2KP2 A;  1NM3 A;  1WE0 A;  2B3S A;  3GUR A;  1T4Y A;  2I1U A;  3BJ5 A;  2GGT A;  1SU9 A;  5DJM A;  4NHZ A;  1GTB A;  4AGS A;  3KD0 A;  3L78 A;  2PPT A;  1SD8 A;  2LJR A;  2LRC A;  2OA7 A;  3A5I A;  5D9X A;  3ZML A;  4MZW A;  1XZO A;  1Y6E A;  1PQN A;  1GUM A;  1WP0 A;  2PU9 C;  1OYJ A;  2V6O A;  4O5R A;  2IMK A;  5EPF A;  1BYE A;  2MMA A;  2YZH A;  3J7Y b;  3GH9 A;  3M1G A;  4A5P A;  1T00 A;  1TK5 B;  3VLN A;  1PX6 A;  1SYR A;  4GSN A;  3U6V A;  4D73 B;  3WT2 A;  4L5O A;  1XW6 A;  2H0H A;  5LD0 A;  2ALB A;  2KHP A;  3ZIV A;  5FT3 A;  2F9S A;  1PKZ A;  1K3O A;  1GTU A;  4YH2 A;  2YCD A;  3UJ1 A;  2P5Q A;  1IYH A;  4PX1 A;  3D6I A;  1GSU A;  1AC1 A;  1V57 A;  4TR1 B;  4GRF A;  1GLQ A;  2IWT A;  2WDU A;  3IDV A;  4K0N A;  1U3I A;  1U6T A;  4O92 A;  1CQG A;  3HZ4 A;  4V1A p;  1ZZY A;  16GS A;  1QGV A;  3GUS A;  2HZF A;  1M3I A;  5C00 A;  3LG6 A;  1O81 A;  2CZ3 A;  5G31 A;  3A2V A;  2PN8 A;  1JLW A;  3QDN A;  1YF0 A;  4PNF A;  1SK1 A;  1K0C A;  1AUC A;  2YWM A;  1R5P A;  2JSZ A;  5HR1 A;  4OD7 A;  3LOR A;  1WPI A;  3RHB A;  3FZA A;  1M2D A;  3FZ5 A;  2X4A A;  1WJK A;  3LW9 A;  3C73 A;  1TI1 A;  2GS3 A;  3O3T A;  1Z3E A;  4FIW A;  1B8X A;  4HQS A;  4WEY A;  4G9H A;  5D73 A;  5IO0 A;  1AXD A;  2WZ9 A;  1MDJ A;  5IOX A;  3HJO A;  3GSS A;  5CRG A;  1M3J A;  2QA1 A;  4YQU A;  2WB9 A;  2F3M A;  2YP6 A;  2OE3 A;  2ZNM A;  4WF5 A;  4HJ2 A;  4ZL7 A;  1M7T A;  2F8F A;  2H66 A;  2GZY A;  4IBP A;  2O89 A;  2XPD A;  1AW9 A;  5KN3 A;  2EIO A;  3QPM A;  4IP1 A;  3GN3 A;  1XXU A;  6GSS A;  5ECS A;  4EO3 A;  2MZC A;  4PNG A;  1ZGN A;  2MMZ A;  1PA3 A;  2B1K A;  5ECI B;  1A24 A;  4I6X A;  4IJ3 A;  1SJZ A;  3BD2 A;  3MAK A;  1R5A A;  5B6N A;  3F3Q A;  4TXO A;  3KH7 A;  1DE2 A;  2PMT A;  4NMU A;  4MJA A;  3QCP A;  2VO4 A;  3R2Q A;  1TRU A;  4X4J A;  1A8L A;  5GAN D;  4TW5 A;  4F9Z A;  4MZB A;  3KZQ A;  4TR3 A;  1PFO A;  2O7K A;  1XFL A;  3Q74 A;  4XS6 A;  1AIU A;  3GMF A;  4JU5 A;  1ILO A;  3CTF A;  1T1V A;  4EIQ A;  3KP8 A;  3LGC A;  1UA5 A;  1ZYN A;  2LJA A;  3PR8 A;  4IEL A;  1KTE A;  4KSO A;  2H6Y A;  3DGQ A;  5EL8 A;  1MDK A;  4CW9 A;  3ZYW A;  4KF9 A;  4E8H A;  4K7I A;  5ECR B;  3ERF A;  2MMN A;  1S3C A;  1WWJ A;  4GSS A;  2YV7 A;  3F6F A;  2K18 A;  2F51 A;  2WS2 A;  5G1L A;  3TRQ A;  1HQO A;  2VL2 A;  4WKW A;  3VPQ A;  1B9X C;  4OCF A;  2KLX A;  3P8W A;  2VLU A;  2H1B A;  2DJ1 A;  2L6D A;  4GTU A;  4IJI A;  1EEJ A;  3H4K A;  2A2R A;  4I5Q A;  2DKI A;  2BTO T;  3N5O A;  3FYG A;  3H93 A;  3I6A A;  4TN8 A;  1XVQ A;  2FCH A;  4CY8 A;  4AJ8 A;  2H1A A;  2LST A;  3TJG A;  5ENU A;  1OC9 B;  4EC0 A;  1GNW A;  2DJJ A;  4JR4 A;  3E9J B;  3FMW A;  1G0T A;  2G0F A;  1GSD A;  4F0B A;  1QMV A;  2R5G A;  1XW5 A;  3M8N A;  1O8X A;  2HRA A;  4LMV A;  3FEU A;  1X9W B;  2R37 A;  4L0U A;  2PVO C;  4MLY A;  2V1M A;  1HNB A;  4PQH A;  11GS A;  1PN0 A;  1N8J A;  1TU7 A;  2R2J A;  3HKR A;  1JZW A;  5COH A;  3ZL5 A;  2AHE A;  3IAS 2;  4OFM A;  1PGT A;  14GS A;  2I9H A;  3DML A;  3GKM A;  5E59 A;  3IC8 A;  4ILF A;  2Z9S A;  3C1S A;  2ZUP A;  4IKH A;  2C0D A;  4KDU A;  4BPY A;  2JZT A;  2B7K A;  4IGJ A;  1ZYQ B;  4F03 A;  4EVM A;  3E3E A;  2IN3 A;  2VCV A;  2JZR A;  4MJC A;  1XWK A;  2DIY A;  3D4M A;  3ERW A;  2IMF A;  1K0D A;  5A4V A;  4K9Z A;  4HSC X;  4RI6 A;  2TRX A;  3KMO A;  1ABA A;  3ZRD A;  2VL9 A;  4ISD A;  1GWC A;  1RQM A;  5INY A;  4WF4 A;  1Z6N A;  2B6M A;  1KNG A;  4YKF A;  2F8A A;  2JU5 A;  4DSS A;  3IBH A;  3UBL A;  1U87 A;  2B1L A;  5ECK B;  5A4U A;  5LNK e;  4JRR A;  3GTU B;  1VF4 A;  2JAD A;  2VLV A;  4GWR A;  4XS4 B;  1PKW A;  4G0I A;  3DYR A;  2GLR A;  4F0C A;  4ML1 A;  1EV4 A;  4IP6 A;  3EC3 A;  3CSJ A;  4WBR D;  5H5S A;  4ECC A;  4BVX A;  1R7H A;  1GP1 A;  1Z7R A;  1C72 A;  3H8Q A;  4Z2U A;  1VGL A;  4MH2 A;  1BG5 A;  1HD2 A;  2X99 A;  4O5U A;  4IN0 A;  4EDY A;  4ECJ A;  2R0G A;  5CO3 A;  2E0Q A;  3TKR A;  1TP9 A;  3CRU A;  2TRC P;  5IMF A;  2VCX A;  4N10 A;  5F06 A;  1OKD A;  2JZS A;  2RII A;  2VL3 A;  5IMA A;  1XWC A;  1UN2 A;  1RW1 A;  2FD3 A;  5J9B A;  2WFC A;  4ZL9 A;  2YAN A;  2WJU A;  1QUW A;  2VCZ A;  2N5A A;  1ERW A;  3IC4 A;  2HXK A;  2RUE A;  2H8L A;  3A2X A;  5ECO B;  1S3D A;  2H74 A;  1ON4 A;  5ECQ B;  4K6X A;  1B48 A;  3D22 A;  2B7J A;  5LCZ A;  3GX8 A;  4BA7 A;  4MF6 A;  3S9F A;  3D4T A;  3C8E A;  1TRV A;  4ZXG A;  3F63 A;  1FAA A;  2EIR A;  2HYX A;  3Q18 A;  2C0G A;  2C1Y A;  2KOK A;  3EUR A;  3DRN A;  1O7U A;  1VRS D;  2CA8 A;  2CX3 A;  1F9M A;  4ZB9 A;  4TR0 A;  2N5F A;  3UAR A;  3DVW A;  2M72 A;  3APQ A;  1PMT A;  1Z6M A;  2H6Z A;  5AIS A;  2LEG A;  2VLT A;  19GS A;  2GSR A;  4ZB6 A;  4D73 A;  2IMI A;  5F05 A;  5DVB A;  5ECL B;  1DUG A;  3PPU A;  2GDR A;  2HNL A;  4BVY B;  1RK4 A;  3KTL A;  4KB3 A;  1YDK A;  4MAB A;  2MBT A;  4HU9 A;  5IO2 A;  5DAL B;  3KGK A;  2HZE B;  1R4W A;  1J0F A;  3QMX A;  4K5R A;  2LV3 A;  4TR1 A;  2WUL A;  3TKP A;  4KCA A;  1GSQ A;  1AQV A;  1YEP A;  2XBQ A;  3FY7 A;  3O76 A;  4N11 A;  2C3Q A;  4KUN A;  2R6K A;  3FR3 A;  2GQL A;  3FZ9 A;  1ERV A;  4J57 E;  22GS A;  2IFQ B;  1EV9 A;  4O32 A;  2C4J A;  3QAG A;  5B8B A;  5BRT A;  4Z2R A;  4POL A;  2IMD A;  3CRT A;  5JWO B;  1TI3 A;  4XS1 A;  5DCG A;  2WGR A;  3ZFL A;  1B9Y C;  1SL1 B;  1V40 A;  2OBI A;  2YJH A;  2NVL A;  3KTB A;  2YWO A;  5IPG A;  1ACV A;  4WBJ A;  2KP1 A;  2LJK A;  3A5W A;  2AV4 A;  5AN1 A;  4ULX A;  4HEA 2;  2RM6 A;  2RUF A;  3NOF A;  4OO4 A;  2DSA A;  3F6D A;  3GYK A;  4FYB A;  3F8U A;  3MSZ A;  5D93 A;  2BMX A;  3G7I A;  1FHE A;  4MCU A;  4K2D A;  2NBS A;  3TJK A;  1CQH A;  2FA8 A;  2NTO A;  4TKY A;  4ZBD A;  2VM1 A;  2H19 A;  3UL3 A;  2CQ9 A;  2P31 A;  1X5E A;  5CRD A;  1URM A;  1JLV A;  1GRX A;  4AF2 A;  4CY6 A;  4AJ7 A;  2FWF A;  2X8C A;  4ML6 A;  2FLS A;  1V9W A;  2YNX A;  2FWH A;  4TVE A;  5KEJ A;  1WIK A;  1U88 A;  2K9F A;  3O6T A;  2K8S A;  2C3T A;  1FB0 A;  2GZP A;  2LRT A;  5HQP A;  2H1D A;  1AQX A;  4MH3 A;  1X5C A;  1X5D A;  1FG4 A;  3GIX A;  1XBS A;  3CBU A;  1W4V A;  1V98 A;  4EIP A;  3UBK A;  2FY6 A;  1F2E A;  4EE0 A;  1BAY A;  2DJ2 A;  2DIZ A;  2H6X A;  3IPZ A;  4MZC A;  4PUF C;  4QL7 A;  3MIX A;  3GFK A;  1O73 A;  4KE3 A;  3QAW A;  2KUC A;  2UZ8 A; 
#chains in the Genus database with same CATH homology
 3U5R E;  5G1K A;  4GST A;  3GL3 A;  2B5E A;  3QD9 A;  5B6M A;  4EL1 A;  1I5G A;  2DML A;  4HOJ A;  1TRW A;  1PD2 1;  3A3T A;  2OBK A;  3WYW A;  1K3Y A;  3GX0 A;  3FK8 A;  6GSW A;  4Q5R A;  2PUK C;  3IK9 A;  2L4Q A;  1BJX A;  4HU7 A;  2E2M A;  5A4W A;  4GLT A;  2LS5 A;  3ZMK A;  3EU4 A;  5E4W A;  1OC9 A;  4XRA A;  4NHW A;  2JL4 A;  3BOA A;  3M9K A;  1PRX A;  5HFG A;  5C04 A;  3F4T A;  2AJQ B;  2HRK A;  2HSM A;  2J23 A;  4NV2 A;  2E7P A;  3ZFB A;  3RPP A;  2YV9 A;  2YOI A;  2I81 A;  2A2S A;  4G0L A;  4O5Q A;  4BWS A;  3TJB A;  4PTS A;  3FR9 A;  5F07 A;  2BJX A;  3LYK A;  4MMM A;  4IS0 A;  12GS A;  3APO A;  5IMD A;  2GST A;  3ZTL A;  2K6V A;  4USS A;  2CAQ A;  1FVK A;  3HJP A;  3GH6 A;  4MDC A;  2EIQ A;  3VI7 A;  4X43 A;  4KCE A;  3ME8 A;  3PGT A;  4YQM A;  1FOV A;  5J41 A;  3HHV A;  2L4C A;  3HD5 A;  4WET A;  1GH2 A;  5AGY A;  4ZB8 A;  4EUY A;  3EE2 A;  3W8J A;  5IIZ A;  4L0W A;  4YQV A;  4PQI A;  3CSH A;  3CSI A;  3EU3 A;  3IR4 A;  1AAZ A;  1SKR B;  2O87 A;  3ZRE A;  4DEJ A;  4POK A;  1OC8 A;  3IHQ A;  5J9C A;  2DC5 A;  4HQZ A;  2VD1 A;  3VI5 A;  3LXT A;  4MJB A;  1HNC A;  3FW2 A;  1B4P A;  2FA4 A;  4G19 A;  4N0Z A;  3TGZ A;  2HI7 A;  3QR6 A;  4EXJ A;  3BBY A;  1Y25 A;  3L9U A;  3GTU A;  4XS4 A;  4WR5 A;  1T8E B;  1MDI A;  2QA2 A;  1YZX A;  3TJJ A;  2HE3 A;  3Q19 A;  2ZCT A;  1M0U A;  1SYX A;  1YJ6 A;  4PXO A;  1G7E A;  3MWH A;  4RUV A;  1PL2 A;  3TJF A;  2GQK A;  5BMU A;  5HFK A;  3UVH A;  4MJE A;  1O8W A;  4NWY A;  1LJR A;  5KN1 A;  3NIV A;  5J3R A;  3J7Y k;  4ICY A;  4YAP A;  4BWQ A;  5ECM B;  3M0F A;  3R3E A;  4PUR A;  1PX7 A;  5ECN B;  3ZVJ A;  3TDG A;  4ACS A;  2QGV A;  1PSQ A;  17GS A;  4N0V A;  5HR3 A;  2X49 A;  4HZ2 A;  3TB2 A;  2XPE A;  5DJL A;  1THO A;  4G2E A;  5CYY A;  3VK9 A;  2YWI A;  2B5X A;  2NPB A;  3WT1 A;  3QFB C;  2CZ2 A;  1XPV A;  2DBC A;  1AQW A;  5JCW A;  3SWL A;  1XWB A;  5HFI A;  8GSS A;  3KH9 A;  5JCG A;  3HDC A;  10GS A;  2A4V A;  5KN2 A;  2GTU A;  2L5L A;  4MP4 A;  1ERT A;  2LKU A;  3KJY A;  3W6G A;  3L9S A;  3WD6 A;  1XCC A;  3M3M A;  2DJ0 A;  3P90 A;  5KOW A;  1FO5 A;  1YKC A;  5D9W A;  4DSQ A;  2VCW A;  1GL8 A;  3RDW A;  3C71 A;  4V2L A;  2GZZ A;  2NDO A;  1A0F A;  2H75 A;  4O7H A;  4I8B A;  1XWG A;  3I69 A;  3KP9 A;  4ZL8 A;  2YN1 A;  3TOU A;  2X8G A;  2GSS A;  1Q98 A;  3VWV A;  3DXB A;  5DAK B;  1MEK A;  3ZVJ D;  4HI7 A;  2CVB A;  1N2A A;  2VAF A;  3GKX A;  1NHO A;  4H86 A;  4TR4 A;  4YKG A;  3E0U A;  5KOX A;  2QC7 A;  2VCT A;  4FYC A;  4XHM A;  5B8A A;  2VIM A;  3UVT A;  5DQY A;  2QSI A;  4LL1 B;  4EDZ A;  3D0Z A;  2CX4 A;  3F4R A;  2H73 A;  5H5Q A;  1BQ7 A;  4TOP A;  1GTI A;  2LRN A;  3IV4 A;  3F0I A;  5B7C A;  3IK7 A;  1B4Q A;  3GKK A;  4XTS A;  4BVY A;  4ZBB A;  4Z7X A;  5ELG A;  4V2N A;  1K0N A;  2M80 A;  1QK8 A;  1V58 A;  2VUP A;  3IOS A;  5DAL A;  1GNE A;  1T3B A;  2HZE A;  3UMA A;  4POM A;  4BL7 B;  4Q5F A;  1MTC A;  3FHK A;  2X8H A;  3HVV A;  4KA0 A;  1ZYP A;  4HDE A;  1PN9 A;  3G7Y A;  1A8Y A;  2B5Y A;  5D8I A;  5ABR A;  4K0G A;  2A4H A;  3IXR A;  2HSH A;  2GT5 A;  2DJ3 A;  4NPB A;  1LU4 A;  3ZIT A;  3FR6 A;  2HRN A;  5CRE A;  3HY2 A;  5L71 A;  2XBI A;  2R0P A;  4KDY A;  2IIY A;  5IPH A;  2H0G A;  4NV5 A;  2IFQ A;  6GSU A;  1PL1 A;  5CRH A;  3SBC A;  2D2Z A;  3TKS E;  2DJK A;  4DSR A;  1XWA A;  3GA4 A;  4KAE A;  4Z2T A;  1YKA A;  4K7O A;  2CVK A;  3HVX A;  1EGO A;  13GS A;  2H70 A;  3EWL A;  3CMI A;  4EF0 A;  1SD9 A;  3ZZX A;  1JZD A;  3VWW A;  3TKS C;  2OE1 A;  2LTK A;  2L59 A;  4RI7 A;  2L6C A;  2OAD A;  3D21 A;  1FB6 A;  4FYU A;  4MF5 A;  1A2J A;  2LQO A;  3DWV A;  4OCE A;  3DVX A;  4K7N A;  1EZK A;  3GRX A;  4LLR A;  2YJ7 A;  5F0G A;  2P5R A;  1X9S B;  1HNA A;  2FGX A;  5ID2 B;  1FOH A;  4XCS A;  2CAI A;  5IMV A;  2N5B A;  1E2Y A;  1ERU A;  1T4Z A;  3HJM A;  5IMZ A;  1GSF A;  5ELA A;  5JWR B;  3DIE A;  2YZU A;  3MNG A;  5ECH B;  2YPM A;  3C7M A;  1MD4 A;  3ZLP A;  2R3X A;  2IL3 A;  1Z5Y E;  2HSY A;  1LBK A;  2I4A A;  2ES7 A;  1F37 A;  3IRA A;  4K5S A;  5GST A;  2WCI A;  1SJI A;  4DVC A;  2HT9 A;  1SKS B;  3QAV A;  1M9B A;  1ZYE A;  2PBJ A;  1TXX A;  1DBY A;  2OKA A;  4I2T A;  1QFN A;  3EMP A;  4FH8 A;  3EYT A;  4ZIL A;  3US3 A;  3L9V A;  2O85 A;  1FVJ A;  2LQQ A;  3IA1 A;  1TU8 A;  3G7J A;  5CRW A;  1VF2 A;  2FWE A;  4MA9 A;  4KX4 A;  2ON5 A;  4K2X A;  2RLI A;  4MPF A;  1NSW A;  4KSM A;  2PWJ A;  3QOU A;  4I97 A;  4IHU A;  1X0R A;  4J56 E;  2FHE A;  4HS1 A;  2V32 A;  2DMM A;  3MYD A;  3HCZ A;  3GKN A;  4FQU A;  2FWG A;  3EVI A;  1F6M C;  5AIX A;  4G10 A;  18GS A;  1H4O A;  3EMX A;  3QFA C;  1K3L A;  3VWU A;  3TKQ A;  4Q5N A;  5CP1 A;  4K8M A;  3NZN A;  4F82 A;  5G5F A;  2HRF A;  2OE0 A;  7GSS A;  1F3A A;  4OFT A;  3H79 A;  2MYG A;  3IE3 A;  1ZL9 A;  3P7X A;  2GVP A;  3KM6 A;  2RM5 A;  1GSY A;  3KEB A;  3FRC A;  1EWX A;  1THX A;  4L5L A;  3RHC A;  2R0C A;  1K0A A;  1TW9 A;  1WRY A;  4LA1 A;  3IHG A;  1Z9H A;  3ME7 A;  1OE7 A;  3H1N A;  3HYP A;  4IQ1 A;  5D9T A;  3IAM 2;  3A2W A;  4TXV A;  2C0F A;  4L8E A;  2C0E A;  1TOF A;  3G9B A;  3VFI A;  3WGE A;  2I3Y A;  4LL4 B;  1JFU A;  2PGT A;  5A5K A;  5D9V A;  1T7P B;  1OC3 A;  20GS A;  3AY8 A;  5IMC A;  3OR5 A;  4JR6 A;  1E6B A;  2GSQ A;  1H75 A;  2K8V A;  2HFD A;  3LYP A;  2O8V B;  2J9H A;  4KW6 A;  4Q5Q A;  4MPG A;  1ML6 A;  4JE1 A;  1EP8 A;  4X0X A;  3GNJ A;  1DE1 A;  2H01 A;  1EGR A;  3DD3 A;  5DDL A;  3M9J A;  2IME A;  1JZR A;  4MNN A;  3KXO A;  3I43 A;  1TRS A;  2HLS A;  1OVN A;  6GSY A;  3TCO A;  4P3Y B;  1ZMA A;  4NAX A;  2VD0 A;  1ZCP A;  2LUS A;  5CAX A;  1G6W A;  3GV1 A;  5FWG A;  4PQ1 A;  3CYN A;  2WRT A;  3F4S A;  4GCI A;  1QXH A;  1TK8 B;  4MF7 A;  5IQY A;  4WR4 A;  3VPT A;  1OKT A;  1A0R P;  3LFL A;  1ST9 A;  3FKF A;  1VF3 A;  1SJ6 A;  5DQS A;  1TKD B;  1R26 A;  3ED3 A;  5ECP B;  1UC7 A;  1EP7 A;  1GUH A;  4KH7 A;  1V2A A;  3N9J A;  1Z7P A;  4HUA A;  5KN0 A;  2DKH A;  2A2P A;  2QKE A;  4V1A g;  1GUL A;  1EEM A;  1TJD A;  4K1F A;  2AAW A;  5F8B A;  5HR0 A;  2CVD A;  3F9U A;  3LWA A;  3EPT A;  4TXO B;  5J5N A;  4J2F A;  4ZIJ A;  3VWX A;  2TIR A;  1M9A A;  4N30 A;  2IPA A;  3RAZ A;  4RQR A;  3LEF A;  1SK2 A;  4FO5 A;  5AIV A;  1YEX A;  4QQ7 A;  2GT6 A;  3L4N A;  2V41 A;  5G2Z A;  2PVQ A;  3TUE A;  5H5R A;  4OFN A;  4JED A;  3FZ4 A;  2FUG 2;  3MDK A;  3UIW A;  2EC4 A;  2PER A;  4HZ4 A;  4RQX A;  3HXS A;  2ON7 A;  5G5E A;  1WOU A;  4IVF A;  3HZ8 A;  5GAP D;  3TRP A;  3TKS A;  4ECI A;  4KND A;  1Q4J A;  4GXZ A;  2CV4 A;  5G30 A;  2FNO A;  4JBB A;  3HA9 A;  1JHB A;  4LMW A;  2H76 A;  4NXI A;  4KDX A;  2VM2 A;  2MMO A;  2YWN A;  4PGT A;  4ID0 A;  1SL0 B;  5DBQ A;  2P0G A;  1A2M A;  4X1U A;  2C3N A;  5DAK A;  3KCM A;  1K0M A;  2VCQ A;  4AJ6 A;  1SK0 A;  2M46 A;  2V2G A;  3LSZ A;  1FW1 A;  1S3A A;  2C8U A;  2REM A;  2C80 A;  3BCK A;  2G2Q A;  3ZIJ A;  3GL5 A;  3RPN A;  4GQC A;  3EIN A;  1SEN A;  2L5O A;  1M2B A;  5IM9 A;  1W89 A;  4F2I A;  2GQM A;  2H30 A;  2XHF A;  3WGD A;  3GST A;  1OAZ A;  4BL7 A;  1M2A A;  3TOT A;  3APS A;  3Q6O A;  1X9M B;  3DEX A;  4I2U A;  3I9V 2;  3P2A A;  4YAV A;  2H71 A;  5CNW A;  4WXT A;  5JCU A;  1EOH A;  1ZOF A;  1MD3 A;  2L57 A;  5D96 A;  2H1G A;  1O85 A;  2LNS A;  4POB A;  5IOW A;  1XOA A;  3PIN A;  1SL2 B;  1DSB A;  3JCM L;  4XRD A;  5JWQ B;  1GSS A;  4V2M A;  1K0B A;  2DLX A;  1VF1 A;  1XIY A;  4ZBA A;  3D5J A;  1YY7 A;  1XOB A;  1O6J A;  4OMV A;  2IJY A;  1EOG A;  1A2L A;  1TDI A;  3PH9 A;  6GST A;  3TRX A;  1BED A;  5HR2 A;  1J9B A;  3CXG A;  4HJM A;  5DCH A;  5FHI A;  2H72 A;  3UAP A;  1A23 A;  1NW2 A;  3VUR A;  4PUA A;  1J08 A;  3L0H A;  4CDO A;  2JAC A;  3DKS A;  5EY6 A;  1KBN A;  1XW9 A;  1XVW A;  6GSV A;  2VL2 C;  2XC2 A;  4OO5 A;  4DSS B;  1GLP A;  1IYI A;  1GTA A;  4XIH A;  5GZZ B;  2X64 A;  5ID2 A;  3UEM A;  2CT6 A;  3WGX A;  4GQF A;  2OJL A;  2VOC A;  5J4U A;  1USB A;  1QQ2 A;  4MK3 A;  3HVS A;  5GSS A;  4QL9 A;  3GHA A;  1NHY A;  2E2G A;  1KEB A;  3KMN A;  4ECB A;  3C1R A;  1YF1 A;  1K0O A;  3ERG A;  4KGI A;  4BVX B;  4JZQ A;  4E8E A;  2AUV A;  4G0K A;  1M99 A;  2H0I A;  2LNT A;  3CTG A;  1SKW B;  1HYU A;  1U3A A;  1TK0 B;  1YQ1 A;  3ISO A;  1GUK A;  3LJR A;  3BCI A;  1I9D A;  4EKZ A;  4IQA A;  2AYT A;  1WMJ A;  4GF0 A;  4CHS A;  2MBS A;  2V6K A;  1TTZ A;  4IW9 A;  3V1W A;  3LQ7 A;  5EVO A;  1F3B A;  2AB6 A;  3W8S A;  3RBT A;  1BX9 A;  2JSY A;  3F3R A;  1UVZ A;  4OWY A;  1JZO A;  1OE8 A;  3UOM A;  3KIJ A;  3LXZ A;  3K8N A;  4TRX A;  1G6Y A;  1GSE A;  2R4V A;  9GSS A;  1G7O A;  6GSX A;  2OAC A;  2KP2 A;  1NM3 A;  1WE0 A;  2B3S A;  3GUR A;  1T4Y A;  2I1U A;  3BJ5 A;  2GGT A;  1SU9 A;  5DJM A;  4NHZ A;  1GTB A;  4AGS A;  3KD0 A;  3L78 A;  2PPT A;  1SD8 A;  2LJR A;  2LRC A;  2OA7 A;  3A5I A;  5D9X A;  3ZML A;  4MZW A;  1XZO A;  1Y6E A;  1PQN A;  1GUM A;  1WP0 A;  2PU9 C;  1OYJ A;  2V6O A;  4O5R A;  2IMK A;  5EPF A;  1BYE A;  2MMA A;  2YZH A;  3J7Y b;  3GH9 A;  3M1G A;  4A5P A;  1T00 A;  1TK5 B;  3VLN A;  1PX6 A;  1SYR A;  4GSN A;  3U6V A;  4D73 B;  3WT2 A;  4L5O A;  1XW6 A;  2H0H A;  5LD0 A;  2ALB A;  2KHP A;  3ZIV A;  5FT3 A;  2F9S A;  1PKZ A;  1K3O A;  1GTU A;  4YH2 A;  2YCD A;  3UJ1 A;  2P5Q A;  1IYH A;  4PX1 A;  3D6I A;  1GSU A;  1AC1 A;  1V57 A;  4TR1 B;  4GRF A;  1GLQ A;  2IWT A;  2WDU A;  3IDV A;  4K0N A;  1U3I A;  1U6T A;  4O92 A;  1CQG A;  3HZ4 A;  4V1A p;  1ZZY A;  16GS A;  1QGV A;  3GUS A;  2HZF A;  5C00 A;  3LG6 A;  1O81 A;  2CZ3 A;  5G31 A;  3A2V A;  2PN8 A;  1JLW A;  3QDN A;  1YF0 A;  4PNF A;  1SK1 A;  1K0C A;  1AUC A;  2YWM A;  1R5P A;  2JSZ A;  5HR1 A;  4OD7 A;  3LOR A;  1WPI A;  3RHB A;  3FZA A;  1M2D A;  3FZ5 A;  2X4A A;  1WJK A;  3LW9 A;  3C73 A;  1TI1 A;  2GS3 A;  3O3T A;  1Z3E A;  4FIW A;  1B8X A;  4HQS A;  4WEY A;  4G9H A;  5D73 A;  5IO0 A;  1AXD A;  2WZ9 A;  1MDJ A;  5IOX A;  3HJO A;  3GSS A;  5CRG A;  2QA1 A;  4YQU A;  2WB9 A;  2F3M A;  2YP6 A;  2OE3 A;  2ZNM A;  4WF5 A;  4HJ2 A;  4ZL7 A;  1M7T A;  2F8F A;  2H66 A;  2GZY A;  4IBP A;  2O89 A;  2XPD A;  1AW9 A;  5KN3 A;  2EIO A;  3QPM A;  4IP1 A;  3GN3 A;  1XXU A;  6GSS A;  5ECS A;  4EO3 A;  2MZC A;  4PNG A;  1ZGN A;  2MMZ A;  1PA3 A;  2B1K A;  5ECI B;  1A24 A;  4I6X A;  4IJ3 A;  1SJZ A;  3BD2 A;  3MAK A;  1R5A A;  5B6N A;  3F3Q A;  4TXO A;  3KH7 A;  1DE2 A;  2PMT A;  4NMU A;  4MJA A;  3QCP A;  2VO4 A;  3R2Q A;  1TRU A;  4X4J A;  1A8L A;  5GAN D;  4TW5 A;  4F9Z A;  4MZB A;  3KZQ A;  4TR3 A;  2O7K A;  1XFL A;  3Q74 A;  4XS6 A;  1AIU A;  3GMF A;  4JU5 A;  1ILO A;  3CTF A;  1T1V A;  4EIQ A;  3KP8 A;  3LGC A;  1UA5 A;  1ZYN A;  2LJA A;  3PR8 A;  4IEL A;  1KTE A;  4KSO A;  2H6Y A;  3DGQ A;  5EL8 A;  1MDK A;  4CW9 A;  3ZYW A;  4KF9 A;  4E8H A;  4K7I A;  5ECR B;  3ERF A;  2MMN A;  1S3C A;  1WWJ A;  4GSS A;  2YV7 A;  3F6F A;  2K18 A;  2F51 A;  2WS2 A;  5G1L A;  3TRQ A;  1HQO A;  2VL2 A;  4WKW A;  3VPQ A;  1B9X C;  4OCF A;  2KLX A;  3P8W A;  2VLU A;  2H1B A;  2DJ1 A;  2L6D A;  4GTU A;  4IJI A;  1EEJ A;  3H4K A;  2A2R A;  4I5Q A;  2DKI A;  2BTO T;  3N5O A;  3FYG A;  3H93 A;  3I6A A;  4TN8 A;  1XVQ A;  2FCH A;  4CY8 A;  4AJ8 A;  2H1A A;  2LST A;  3TJG A;  5ENU A;  1OC9 B;  4EC0 A;  1GNW A;  2DJJ A;  4JR4 A;  3E9J B;  3FMW A;  1G0T A;  2G0F A;  1GSD A;  4F0B A;  1QMV A;  2R5G A;  1XW5 A;  3M8N A;  1O8X A;  2HRA A;  4LMV A;  3FEU A;  1X9W B;  2R37 A;  4L0U A;  2PVO C;  4MLY A;  2V1M A;  1HNB A;  4PQH A;  11GS A;  1PN0 A;  1N8J A;  1TU7 A;  2R2J A;  3HKR A;  1JZW A;  5COH A;  3ZL5 A;  2AHE A;  3IAS 2;  4OFM A;  1PGT A;  14GS A;  2I9H A;  3DML A;  3GKM A;  5E59 A;  3IC8 A;  4ILF A;  2Z9S A;  3C1S A;  2ZUP A;  4IKH A;  2C0D A;  4KDU A;  4BPY A;  2JZT A;  2B7K A;  4IGJ A;  1ZYQ B;  4F03 A;  4EVM A;  3E3E A;  2IN3 A;  2VCV A;  2JZR A;  4MJC A;  1XWK A;  2DIY A;  3D4M A;  3ERW A;  2IMF A;  1K0D A;  5A4V A;  4K9Z A;  4RI6 A;  2TRX A;  3KMO A;  1ABA A;  3ZRD A;  2VL9 A;  4ISD A;  1GWC A;  1RQM A;  5INY A;  4WF4 A;  1Z6N A;  2B6M A;  1KNG A;  4YKF A;  2F8A A;  2JU5 A;  4DSS A;  3IBH A;  3UBL A;  1U87 A;  2B1L A;  5ECK B;  5A4U A;  5LNK e;  4JRR A;  3GTU B;  1VF4 A;  2JAD A;  2VLV A;  4GWR A;  4XS4 B;  1PKW A;  4G0I A;  3DYR A;  2GLR A;  4F0C A;  4ML1 A;  1EV4 A;  4IP6 A;  3EC3 A;  3CSJ A;  4WBR D;  5H5S A;  4ECC A;  4BVX A;  1R7H A;  1GP1 A;  1Z7R A;  1C72 A;  3H8Q A;  4Z2U A;  1VGL A;  4MH2 A;  1BG5 A;  1HD2 A;  2X99 A;  4O5U A;  4IN0 A;  4EDY A;  4ECJ A;  2R0G A;  5CO3 A;  2E0Q A;  3TKR A;  1TP9 A;  3CRU A;  2TRC P;  5IMF A;  2VCX A;  4N10 A;  5F06 A;  1OKD A;  2JZS A;  2RII A;  2VL3 A;  5IMA A;  1XWC A;  1UN2 A;  1RW1 A;  2FD3 A;  5J9B A;  2WFC A;  4ZL9 A;  2YAN A;  2WJU A;  1QUW A;  2VCZ A;  2N5A A;  1ERW A;  3IC4 A;  2HXK A;  2RUE A;  2H8L A;  3A2X A;  5ECO B;  1S3D A;  2H74 A;  1ON4 A;  5ECQ B;  4K6X A;  1B48 A;  3D22 A;  2B7J A;  5LCZ A;  3GX8 A;  4BA7 A;  4MF6 A;  3S9F A;  3D4T A;  3C8E A;  1TRV A;  4ZXG A;  3F63 A;  1FAA A;  2EIR A;  2HYX A;  3Q18 A;  2C0G A;  2C1Y A;  2KOK A;  3EUR A;  3DRN A;  1O7U A;  1VRS D;  2CA8 A;  2CX3 A;  1F9M A;  4ZB9 A;  4TR0 A;  2N5F A;  3UAR A;  3DVW A;  2M72 A;  3APQ A;  1PMT A;  1Z6M A;  2H6Z A;  5AIS A;  2LEG A;  2VLT A;  19GS A;  2GSR A;  4ZB6 A;  4D73 A;  2IMI A;  5F05 A;  5DVB A;  5ECL B;  1DUG A;  3PPU A;  2GDR A;  2HNL A;  4BVY B;  1RK4 A;  3KTL A;  4KB3 A;  1YDK A;  4MAB A;  2MBT A;  4HU9 A;  5IO2 A;  5DAL B;  3KGK A;  2HZE B;  1R4W A;  1J0F A;  3QMX A;  4K5R A;  2LV3 A;  4TR1 A;  2WUL A;  3TKP A;  4KCA A;  1GSQ A;  1AQV A;  1YEP A;  2XBQ A;  3FY7 A;  3O76 A;  4N11 A;  2C3Q A;  4KUN A;  2R6K A;  3FR3 A;  2GQL A;  3FZ9 A;  1ERV A;  4J57 E;  22GS A;  2IFQ B;  1EV9 A;  4O32 A;  2C4J A;  3QAG A;  5B8B A;  5BRT A;  4Z2R A;  4POL A;  2IMD A;  3CRT A;  5JWO B;  1TI3 A;  4XS1 A;  5DCG A;  2WGR A;  3ZFL A;  1B9Y C;  1SL1 B;  1V40 A;  2OBI A;  2YJH A;  2NVL A;  3KTB A;  2YWO A;  5IPG A;  1ACV A;  4WBJ A;  2KP1 A;  2LJK A;  3A5W A;  2AV4 A;  5AN1 A;  4ULX A;  4HEA 2;  2RM6 A;  2RUF A;  3NOF A;  4OO4 A;  2DSA A;  3F6D A;  3GYK A;  4FYB A;  3F8U A;  3MSZ A;  5D93 A;  2BMX A;  3G7I A;  1FHE A;  4MCU A;  4K2D A;  2NBS A;  3TJK A;  1CQH A;  2FA8 A;  2NTO A;  4TKY A;  4ZBD A;  2VM1 A;  2H19 A;  3UL3 A;  2CQ9 A;  2P31 A;  1X5E A;  5CRD A;  1URM A;  1JLV A;  1GRX A;  4AF2 A;  4CY6 A;  4AJ7 A;  2FWF A;  2X8C A;  4ML6 A;  2FLS A;  1V9W A;  2YNX A;  2FWH A;  4TVE A;  5KEJ A;  1WIK A;  1U88 A;  2K9F A;  3O6T A;  2K8S A;  2C3T A;  1FB0 A;  2GZP A;  2LRT A;  5HQP A;  2H1D A;  1AQX A;  4MH3 A;  1X5C A;  1X5D A;  1FG4 A;  3GIX A;  1XBS A;  3CBU A;  1W4V A;  1V98 A;  4EIP A;  3UBK A;  2FY6 A;  1F2E A;  4EE0 A;  1BAY A;  2DJ2 A;  2DIZ A;  2H6X A;  3IPZ A;  4MZC A;  4PUF C;  4QL7 A;  3MIX A;  3GFK A;  1O73 A;  4KE3 A;  3QAW A;  2KUC A;  2UZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...