4MCUA

Crystal structure of disulfide oxidoreductase from klebsiella pneumoniae in reduced state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
188
Chain Sequence
NAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKTQTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein
publication title Comparative Sequence, Structure and Redox Analyses of Klebsiella pneumoniae DsbA Show That Anti-Virulence Target DsbA Enzymes Fall into Distinct Classes.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 58
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mcuA00
3A3TA 4XRAA 2LEGA 3FZ4A 3QFAC 4L0UA 3ZRDA 2YWMA 2P31A 2DJJA 3F3QA 2ZUPA 1OYJA 5D8IA 4V2MA 4IP1A 3P8WA 2FUG2 4N11A 1GLPA 1A2LA 2KOKA 4X1UA 2FWGA 1VRSD 2R4VA 3DD3A 5H5SA 1AC1A 4EVMA 5DQYA 4KX4A 1NM3A 3IK9A 2IJYA 3KH9A 4YQVA 2H70A 2FGXA 1TXXA 3GX8A 2VM1A 1MDKA 2OE3A 3HJMA 3W8SA 4BPYA 4OO5A 1LBKA 2GZYA 2C0EA 1VF1A 5IIZA 4BVYA 1I5GA 4HS1A 1QGVA 2WJUA 3GA4A 1W89A 1WE0A 1YDKA 2OJLA 2DLXA 3P7XA 3H8QA 2RM5A 2YCDA 9GSSA 2VCQA 3IA1A 2HZEA 1N2AA 3BJ5A 4ILFA 3IDVA 2GT6A 2YWNA 13GSA 2H1AA 4XTSA 1FW1A 3TRQA 4XCSA 1ZYEA 1NHYA 1YKAA 1XPVA 2DJ2A 1PRXA 2AYTA 4TN8A 2HZFA 3TUEA 2C3QA 3CSIA 3F8UA 4X0XA 5J41A 4AGSA 4HOJA 4QL7A 5INYA 3DMLA 4NAXA 4V1Ap 5D9XA 2L4CA 1QUWA 5G5EA 1HNBA 1HQOA 3L9UA 1F3BA 4G9HA 3P90A 2B1KA 4OCFA 1YF0A 3QDNA 1J9BA 3TDGA 2MBSA 5DVBA 2WS2A 3TB2A 2HZEB 2CZ3A 4ID0A 3FR3A 4TOPA 5LD0A 3APOA 1TK0B 4I2UA 3ZVJA 3KMOA 1AQVA 5CRDA 3UJ1A 4PNGA 4KCAA 4MF6A 5FT3A 1BQ7A 3GL3A 4JRRA 3ZMLA 4HUAA 2B1LA 2F8FA 5HFKA 1Q4JA 1V58A 5JCWA 3TRPA 3ZFLA 1OAZA 2DMLA 4RQRA 3FY7A 5DBQA 14GSA 1ZZYA 1XWCA 3DWVA 2MMZA 2H1DA 1FOVA 2QKEA 5JWOB 2H76A 2IMEA 3VPQA 2VCTA 4GSSA 1AXDA 1A8LA 4OD7A 4TR3A 3OR5A 1K3OA 4IGJA 3WT1A 2YWOA 4IP6A 3EMPA 1I9DA 4IBPA 1F37A 3ISOA 1WMJA 1WJKA 2ON5A 3HHVA 2R37A 2LRNA 5DDLA 2EC4A 4IQAA 4XRDA 3LJRA 1RW1A 1GUHA 2OBIA 2P5QA 1C72A 3QOUA 2RUFA 4POLA 1OE8A 6GSUA 3CBUA 1V2AA 5ECSA 3QFBC 5ECQB 1H75A 1O8WA 2NPBA 1U3IA 5F05A 3ZTLA 4LLRA 3BD2A 2K9FA 2C80A 3KP9A 1B9YC 3V1WA 1TRVA 5D9TA 1K0AA 3VI5A 4MF5A 4ISDA 1DUGA 5D96A 3GHAA 2FHEA 2ES7A 4HDEA 3QR6A 2BMXA 3G7IA 2H01A 1YKCA 2MBTA 3NZNA 3SWLA 1PX7A 2JZSA 2IIYA 1TRUA 2DJ1A 1B48A 2M80A 3KTLA 4G19A 2H71A 1H4OA 2RLIA 4K0NA 3QCPA 2MZCA 1WIKA 2GQMA 3ZZXA 2WULA 1O85A 2NVLA 1AQWA 4K7IA 2JSYA 4RQXA 1MD3A 2IMKA 1TU8A 4PUAA 2JZRA 3G9BA 4POKA 2JU5A 2YP6A 3VPTA 1A0RP 2LJRA 1DSBA 3UEMA 2ALBA 4IJ3A 4RI6A 3F3RA 5F07A 2L4QA 1TKDB 1M9AA 1M0UA 4NMUA 5GAPD 4P3YB 3PR8A 3HVSA 2FA4A 4MJBA 5ENUA 4ZBBA 2A2RA 1O81A 3IRAA 1QFNA 4KDXA 1M9BA 3GKXA 20GSA 2ZNMA 4EL1A 2B7JA 2DIZA 2NDOA 5ELGA 2E0QA 5J9BA 1BJXA 3KGKA 3IHQA 2H1BA 4MJCA 4ULXA 1EGRA 4POMA 1Z6MA 1OKDA 4ML6A 4WF4A 2VLUA 3VI7A 1AUCA 3A2VA 3KD0A 4PGTA 5DALA 5CRHA 5AISA 2GLRA 1A24A 3G7YA 1HYUA 4MF7A 2O8VB 2D2ZA 2HT9A 3TKSC 1UC7A 3EU3A 5IMAA 3GV1A 1JLVA 2VL2A 3RHCA 3DGQA 3Q6OA 2G0FA 3DKSA 8GSSA 2O85A 3QAGA 4HZ2A 1O6JA 4Q5QA 1GNWA 4JU5A 4MJEA 4O32A 3DEXA 2IN3A 3RBTA 3A2WA 3GTUA 3GH6A 3VFIA 2ON7A 2H19A 4TRXA 1PL1A 2H30A 2OADA 3L78A 3C71A 1OC8A 2VAFA 3GUSA 1URMA 1G6YA 5DALB 1THOA 1R7HA 22GSA 1K0CA 4FIWA 4HEA2 1EOGA 1XOAA 2MYGA 2WDUA 3HYPA 3CMIA 5ID2A 2P5RA 3Q18A 1AIUA 4GCIA 4ZB8A 5IMDA 5B7CA 4GTUA 3GFKA 2K18A 2B5EA 5IPGA 1XW6A 1FVKA 3WGXA 3ZFBA 1B4PA 2JSZA 3CTGA 5CREA 1XW9A 2XPDA 4ECJA 5ECMB 4JR4A 5HR0A 3FZAA 3FK8A 2EIOA 4AF2A 4EF0A 2AJQB 1MD4A 3L9SA 1MEKA 1F3AA 1IYHA 4KH7A 4BL7A 5AIVA 2FLSA 3E3EA 2X8HA 1W4VA 4XHMA 3UIWA 2VLTA 3ZLPA 2H6YA 3KEBA 5DJLA 3F4RA 1BAYA 2J9HA 3LEFA 1T3BA 1WPIA 5IMFA 3ZL5A 4MH3A 4PX1A 4DSSB 3F4SA 3ZIJA 1GTAA 3GX0A 4I8BA 1TP9A 2TRCP 2PUKC 2KLXA 2WRTA 1FB6A 4XS1A 3L9VA 3LXTA 3O76A 4EKZA 4ZIJA 2JZTA 1X5EA 1VGLA 2LJKA 4NXIA 2LQOA 2GGTA 1Z7PA 5JWRB 3KMNA 4LMWA 4ZBAA 2YJ7A 3QD9A 2YJHA 3DXBA 4FYCA 10GSA 1EP7A 1R26A 2CVBA 1FG4A 2WGRA 3UVTA 4PQIA 3I6AA 5IO2A 3KIJA 4PUFC 2AUVA 5KN3A 4NV5A 1MDJA 3IPZA 4O5RA 2CQ9A 4AJ8A 3M8NA 3D21A 4K8MA 2YZHA 3O6TA 4GQFA 1JZDA 4FYUA 2N5FA 3U6VA 2CAIA 4FYBA 1V57A 2GZZA 2PMTA 2E2GA 1TDIA 5CO3A 3ERGA 1Z6NA 1G7OA 1PN9A 1Z7RA 1TRSA 2XBQA 4JR6A 2IPAA 3IR4A 1ACVA 1O73A 2PU9C 2H0GA 1GSFA 5JCGA 3TOUA 3ME8A 4TR0A 5J5NA 4IVFA 1TW9A 2IMFA 3F9UA 2MMAA 2VO4A 3F63A 4LMVA 1TOFA 1G7EA 1Z5YE 3HJPA 3M3MA 4HU9A 4GRFA 3MDKA 1ERUA 2FCHA 3HA9A 2EIRA 2FWHA 4KUNA 4F0BA 1BG5A 5JWQB 5C00A 2LJAA 5B6NA 2VCVA 3SBCA 2C1YA 1T7PB 4Q5FA 1F2EA 2MMNA 1ZCPA 3W8JA 1A2MA 1Z9HA 1TTZA 2L6CA 3UBLA 2HLSA 3US3A 1S3AA 1U88A 4J2FA 4N0VA 2HFDA 1R5AA 1OC3A 1Q98A 4G10A 4NHZA 5G2ZA 5IOXA 2K6VA 1THXA 4V2LA 2H66A 2H0HA 4HQSA 1WP0A 5HQPA 5ECOB 1ZOFA 4L8EA 2O89A 3VURA 1VF4A 5E4WA 1XOBA 1SENA 1ERTA 3CRUA 4IJIA 4OMVA 1XXUA 5H5RA 3I43A 1ZL9A 1VF3A 1SJIA 5B6MA 1IYIA 1EEMA 5CRWA 3GKNA 1KTEA 4NPBA 5A4WA 2L6DA 1SK1A 2NBSA 5F8BA 3H1NA 3M0FA 1JFUA 3BCIA 5IO0A 2R3XA 4WBJA 3FR9A 4POBA 2AHEA 2XC2A 2H8LA 2B5YA 3GMFA 5D9VA 3I9V2 4MH2A 2PERA 5DAKA 2PBJA 4ECBA 2F3MA 1OKTA 2V6KA 2H6ZA 2QGVA 2FA8A 3HVVA 3UAPA 3TKPA 5A4UA 2JADA 2GSSA 2RIIA 1ERVA 1EV9A 4BA7A 5IQYA 2H1GA 1BX9A 3VK9A 1M2DA 4F2IA 3D4TA 2K8SA 1CQGA 3IK7A 2CX4A 5G30A 1ABAA 3WYWA 2IWTA 2VLVA 4YQMA 3H93A 3BBYA 2XPEA 3FYGA 3MNGA 2A4VA 3UARA 3GRXA 2MMOA 5DAKB 2GQLA 4IKHA 2B6MA 3MWHA 4L0WA 2PWJA 2I81A 4WXTA 3D4MA 2VCZA 3FHKA 1NSWA 3ZYWA 2YPMA 3CSHA 5ECPB 4OCEA 5CP1A 4OFTA 3LGCA 3DVWA 4K6XA 1SKWB 1M2BA 3KJYA 3FZ5A 1TI3A 2OBKA 2AB6A 1PMTA 3VWXA 4GLTA 3P2AA 2RUEA 4QL9A 3DIEA 4K9ZA 2BJXA 4FH8A 4PURA 5G1KA 4F82A 3C8EA 1PKZA 1SK2A 2PGTA 4MZCA 1GULA 4V1Ag 3IOSA 3VWWA 3JCML 3DYRA 2H6XA 3KH7A 3A2XA 5ECLB 4JZQA 3RDWA 3IXRA 3KZQA 4O92A 6GSSA 5LNKe 2WFCA 4DSQA 2KHPA 1SYRA 1X5DA 3PH9A 4XS6A 4HJ2A 3KTBA 1YF1A 1FVJA 1A2JA 4WBRD 1O8XA 2C3NA 2OKAA 4WR5A 4ZXGA 3BOAA 5AGYA 2X8GA 4LL1B 5L71A 2LSTA 2VUPA 1BEDA 4D73B 1O7UA 3HJOA 1GUMA 4PQ1A 5IMVA 4O7HA 1RK4A 2V6OA 4TXOB 3UBKA 3LG6A 4KDUA 2CAQA 3F0IA 1GUKA 2VL3A 2J23A 2IMIA 3IE3A 5B8BA 2LRTA 5B8AA 2B5XA 2CA8A 4GSNA 5IMCA 4MMMA 1NHOA 4J57E 4K2DA 19GSA 2B3SA 5EL8A 5D9WA 1OVNA 4MCUA 2M46A 2R6KA 5A4VA 4K7NA 2I3YA 4I6XA 1GTIA 1B9XC 2C3TA 2NTOA 17GSA 1Z3EA 5FWGA 1A0FA 1DE2A 4YQUA 3KP8A 3F6DA 3EWLA 1UVZA 3GL5A 4LA1A 6GSTA 3N5OA 2HRNA 2JL4A 1USBA 4V2NA 3TJBA 1AQXA 2KP1A 4I2TA 5DCGA 1K0MA 3G7JA 3ZREA 5IOWA 5G31A 3N9JA 2I4AA 1T00A 5DJMA 4IQ1A 4ZL9A 2ZCTA 5KN1A 1B8XA 1K0NA 1T1VA 4BWQA 4DSSA 2VD1A 1SKRB 4BWSA 5IPHA 3VLNA 4EDYA 3EVIA 2YV7A 1G6WA 3GURA 1TJDA 2YWIA 1GP1A 2L59A 2VL2C 4TVEA 4EUYA 4ECIA 6GSYA 4MABA 3WGDA 1EV4A 1U3AA 1PQNA 4IHUA 4HU7A 5GSTA 5J4UA 5HFGA 2O87A 1HD2A 3EC3A 1T4YA 4Q5NA 3TJGA 6GSXA 3CSJA 2TRXA 5ELAA 3TKSE 3UL3A 4EDZA 1NW2A 2H73A 2TIRA 4MZWA 1BYEA 2F9SA 2C4JA 2H75A 1HNCA 1GSSA 5EPFA 2I9HA 3FZ9A 3ZVJD 3GN3A 3C73A 4OO4A 1X5CA 1SL1B 2JACA 1GNEA 3WT2A 5IMZA 1X9SB 4KB3A 4ZL8A 3HY2A 4K1FA 4E8EA 2R5GA 5LCZA 2P0GA 4F9ZA 2DJ0A 4MP4A 1XFLA 1GL8A 3LXZA 3EU4A 3NIVA 3NOFA 2GDRA 5DQSA 3TJKA 4N10A 1EGOA 4EO3A 2M72A 3RAZA 3CTFA 5GSSA 3MAKA 2AV4A 1M7TA 5ECRB 2FD3A 4TR1A 2Z9SA 3APQA 3UMAA 5CRGA 4MJAA 4MK3A 2HSYA 3GH9A 2V2GA 5DCHA 2GS3A 4GF0A 3IV4A 4JBBA 1A8YA 3HZ4A 4XIHA 1X0RA 1JZWA 4G2EA 1HNAA 4MPFA 3QPMA 1AAZA 3Q74A 4E8HA 1XVWA 2VIMA 3R2QA 3GSSA 3EE2A 4KAEA 1V40A 1YQ1A 1K0DA 3GNJA 4IELA 3ZITA 1M2AA 1PA3A 2H74A 1TRWA 2V41A 1QQ2A 1SJZA 1WWJA 4TR1B 2LKUA 2L5LA 3GIXA 2LV3A 5AN1A 11GSA 1PD21 2WZ9A 1R4WA 2GSRA 4I97A 1XWKA 3TGZA 4ZL7A 4NV2A 4WF5A 3TJJA 4GSTA 3EMXA 4XS4A 5ECNB 5ABRA 1PX6A 2L5OA 3LSZA 2KUCA 4IS0A 2IMDA 4GXZA 4TR4A 2IL3A 5CAXA 2PN8A 1SYXA 3QMXA 5COHA 2XBIA 2HNLA 4MLYA 5ECHB 1EOHA 3RHBA 4K7OA 1QMVA 2DJKA 1M99A 1JZOA 1S3DA 2YZUA 3HDCA 3DRNA 5AIXA 1OC9A 4EC0A 2N5AA 1UN2A 2GQKA 1GRXA 3D5JA 3I69A 4LL4B 3J7Yb 4GWRA 5ECIB 2HXKA 4XS4B 4PNFA 4IW9A 4YH2A 2VCWA 2B7KA 3ERWA 1TK8B 4Q5RA 2A2SA 2E2MA 4MDCA 3WGEA 2XHFA 3F4TA 5EVOA 1TK5B 3L4NA 1T4ZA 3DVXA 4PXOA 3EINA 3D0ZA 3C1RA 1OC9B 3KM6A 4DEJA 2YOIA 4ECCA 16GSA 4L5OA 3TRXA 2HYXA 2GSTA 1ML6A 4J56E 1XWAA 2QC7A 2VCXA 4HZ4A 1PL2A 1KNGA 1GH2A 3TOTA 1GTUA 2LTKA 2CZ2A 5G5FA 4KGIA 1Y6EA 5HR3A 2I1UA 3VWVA 2DC5A 3F6FA 3GYKA 5J9CA 4HI7A 3Q19A 4JE1A 4ML1A 3EURA 5HR2A 3AY8A 7GSSA 2C0FA 2G2QA 3WD6A 1K0BA 4KE3A 4KSOA 1XWBA 4TW5A 3E0UA 3LORA 3HVXA 3PINA 3HZ8A 3M1GA 4AJ6A 3FRCA 5A5KA 1EP8A 4YAVA 4NHWA 1SD9A 3M9KA 3LYPA 2CV4A 4BVXA 2EIQA 6GSWA 1JLWA 1XBSA 4X43A 1SL0B 2CVDA 3LFLA 4GQCA 4KDYA 3ME7A 3FKFA 1U87A 2C8UA 3HXSA 5CNWA 3UVHA 1YY7A 2WB9A 2YV9A 5KEJA 1WOUA 3W6GA 1E6BA 4KA0A 3PGTA 1SL2B 1ERWA 3M9JA 4WKWA 5HFIA 4ZB9A 2DBCA 1K3YA 2HRFA 4WR4A 1Y25A 1YEPA 3IC4A 3ED3A 4KNDA 5JCUA 4Z7XA 1A23A 4FO5A 2AAWA 1YZXA 2IFQA 4ZBDA 3TKSA 1F9MA 4OFNA 5ECKB 3C7MA 2RM6A 5IM9A 4D73A 3O3TA 3MSZA 2OA7A 4F03A 2GVPA 2GT5A 2V1MA 2KP2A 1EWXA 4TXOA 3H4KA 3D22A 1GSEA 2LRCA 2OE1A 1J08A 4AJ7A 2WCIA 1S3CA 5D73A 5FHIA 4H86A 1FO5A 5KN0A 1K0OA 1TI1A 1YJ6A 2LNTA 1PSQA 1FB0A 4EE0A 1YEXA 3HCZA 4PQHA 3RPNA 5F0GA 4N0ZA 4JEDA 1RQMA 1U6TA 2IFQB 4OFMA 2FNOA 2VL9A 3VWUA 2FY6A 2DJ3A 1TU7A 1GLQA 1T8EB 1XWGA 3IAM2 4CW9A 3ERFA 1X9MB 1MDIA 12GSA 3K8NA 5G1LA 2CT6A 3RPPA 1MTCA 2DIYA 1N8JA 4HQZA 4F0CA 2GSQA 2V32A 1EZKA 4TKYA 3D6IA 1KEBA 1SJ6A 3CYNA 2GTUA 2LQQA 4DVCA 4KSMA 2HSHA 3BCKA 1F6MC 1AW9A 3FEUA 4WETA 1G0TA 4IN0A 4YAPA 2X99A 4RI7A 1GSYA 1LU4A 1PGTA 1ST9A 1V98A 3IAS2 5EY6A 4L5LA 2YNXA 3HKRA 1DBYA 6GSVA 1EEJA 3KXOA 4ZILA 1UA5A 4MA9A 1XVQA 2X64A 1CQHA 1GSDA 2REMA 5HR1A 2FWEA 1LJRA 2PPTA 2LNSA 1ZMAA 2DMMA 2H72A 2F51A 3L0HA 1GSQA 1QXHA 1ZGNA 1ON4A 2LS5A 3LWAA 3FR6A 3QAWA 5GZZB 3A5WA 5C04A 2CVKA 1QK8A 1J0FA 1K3LA 4N30A 1B4QA 2VD0A 2L57A 3APSA 2PVOC 4DSRA 4ZB6A 1FHEA 3GKKA 1SK0A 2CX3A 3TKQA 4KW6A 1DE1A 3GTUB 3TKRA 3ZMKA 2X8CA 2K8VA 3GSTA 1GTBA 3QAVA 1FAAA 3GKMA 1X9WB 1ZYQB 2YANA 3E9JB 3CXGA 3U5RE 2N5BA 3TJFA 4MPGA 1XZOA 5KN2A 2HI7A 2R2JA 2LUSA 1PKWA 1XCCA 1ILOA 18GSA 1KBNA 1XIYA 3FW2A 4KCEA 1OE7A 3H79A 3IBHA 2FWFA 5ID2B 1WRYA 3HD5A 2DSAA 3KCMA 4RUVA 4OWYA 2PVQA 3C1SA 2HE3A 2H0IA 1V9WA 4WEYA 1VF2A 2QSIA 5CYYA 2E7PA 5GAND 1SKSB 5E59A 3LQ7A 3LYKA 2VOCA 3EYTA 2OE0A 1SD8A 2YN1A 4NWYA 2BTOT 2GZPA 3TCOA 4MZBA 2F8AA 4ACSA 4I5QA 2O7KA 4HJMA 3UOMA 1E2YA 4EXJA 2OACA 4CDOA 4TXVA 3CRTA 5D93A 1XW5A 5J3RA 4K0GA 2VM2A 4QQ7A 1GWCA 1JHBA 4CHSA 3ZIVA 3S9FA 1R5PA 1GSUA 2C0GA 3J7Yk 5F06A 1JZRA 1SU9A 5H5QA 2C0DA
chains in the Genus database with same CATH superfamily
3A3TA 4XRAA 2LEGA 3FZ4A 3QFAC 4L0UA 3ZRDA 2YWMA 2P31A 2DJJA 3F3QA 2ZUPA 1OYJA 5D8IA 4V2MA 4IP1A 3P8WA 2FUG2 4N11A 1GLPA 1A2LA 2KOKA 4X1UA 2FWGA 1VRSD 2R4VA 3DD3A 5H5SA 1AC1A 4EVMA 5DQYA 4KX4A 1NM3A 3IK9A 2IJYA 1FOHA 3KH9A 4PTSA 4YQVA 2H70A 2HSMA 2FGXA 1TXXA 3GX8A 2VM1A 1MDKA 2OE3A 3HJMA 3W8SA 4BPYA 4OO5A 1LBKA 2GZYA 2C0EA 1VF1A 5IIZA 4BVYA 1I5GA 4HS1A 1QGVA 2WJUA 3GA4A 1W89A 1WE0A 1YDKA 2OJLA 2DLXA 3P7XA 3H8QA 2RM5A 2YCDA 9GSSA 2VCQA 3IA1A 2HZEA 3IC8A 1N2AA 3BJ5A 4ILFA 3IDVA 2GT6A 2YWNA 13GSA 2H1AA 4XTSA 1FW1A 3TRQA 4XCSA 1ZYEA 1NHYA 1YKAA 1XPVA 2DJ2A 1PRXA 2AYTA 4TN8A 2HZFA 3TUEA 2C3QA 3CSIA 3F8UA 4X0XA 5J41A 4AGSA 4HOJA 4QL7A 5INYA 3DMLA 4NAXA 4V1Ap 5D9XA 2L4CA 1QUWA 4BVYB 5G5EA 1HNBA 1HQOA 3L9UA 1F3BA 5BRTA 4G9HA 3P90A 2B1KA 4OCFA 1YF0A 3QDNA 1J9BA 3TDGA 2MBSA 5DVBA 2WS2A 3TB2A 2HZEB 2CZ3A 4ID0A 3FR3A 4TOPA 5LD0A 3APOA 1TK0B 3PPUA 4I2UA 3ZVJA 3KMOA 1AQVA 5CRDA 3UJ1A 4PNGA 4KCAA 2HRKA 3CQFA 4MF6A 5FT3A 1BQ7A 3GL3A 4JRRA 3ZMLA 4HUAA 2B1LA 2F8FA 5HFKA 1Q4JA 1V58A 5JCWA 3TRPA 3ZFLA 1OAZA 2DMLA 4RQRA 3FY7A 5DBQA 14GSA 1ZZYA 1XWCA 3DWVA 2MMZA 2H1DA 1FOVA 2QKEA 5JWOB 2H76A 2X49A 2IMEA 3VPQA 2VCTA 4GSSA 1AXDA 1A8LA 4OD7A 4TR3A 3OR5A 1K3OA 3EPTA 2R0PA 4IGJA 3WT1A 2YWOA 4IP6A 3EMPA 1I9DA 4IBPA 1F37A 3ISOA 1WMJA 1WJKA 2ON5A 3HHVA 2R37A 2LRNA 5DDLA 2EC4A 4IQAA 4XRDA 3LJRA 1RW1A 1GUHA 2OBIA 2P5QA 1C72A 4Z2TA 3QOUA 2RUFA 4POLA 1OE8A 6GSUA 3CBUA 1V2AA 5ECSA 3QFBC 5ECQB 1H75A 1O8WA 2NPBA 1U3IA 5F05A 3ZTLA 4LLRA 5KOXA 3BD2A 2K9FA 2C80A 3KP9A 1B9YC 3V1WA 1TRVA 5D9TA 1K0AA 3VI5A 3MYDA 4MF5A 4ISDA 1DUGA 5D96A 3GHAA 2FHEA 2ES7A 4HDEA 3QR6A 2BMXA 3G7IA 2H01A 1YKCA 2MBTA 3NZNA 3SWLA 1PX7A 2JZSA 2IIYA 1TRUA 2DJ1A 1B48A 2M80A 3KTLA 4G19A 2H71A 1H4OA 2RLIA 4K0NA 3QCPA 2MZCA 1WIKA 2GQMA 3ZZXA 2WULA 1O85A 2NVLA 1AQWA 4K7IA 2JSYA 4RQXA 1MD3A 2IMKA 1TU8A 4PUAA 2JZRA 3G9BA 4POKA 2JU5A 2YP6A 3VPTA 1A0RP 2LJRA 1DSBA 3UEMA 2ALBA 4IJ3A 4RI6A 3F3RA 5F07A 2L4QA 1TKDB 1M9AA 1M0UA 4NMUA 5GAPD 4P3YB 3PR8A 3HVSA 2FA4A 4MJBA 5ENUA 4ZBBA 2A2RA 1O81A 3IRAA 1QFNA 4KDXA 1M9BA 3GKXA 20GSA 2ZNMA 4EL1A 2B7JA 2DIZA 2NDOA 5ELGA 2E0QA 5J9BA 1BJXA 3KGKA 3IHQA 2H1BA 4MJCA 4ULXA 1EGRA 4POMA 1Z6MA 1OKDA 4ML6A 4WF4A 2VLUA 3VI7A 1AUCA 3A2VA 3KD0A 4PGTA 5DALA 5CRHA 5AISA 2GLRA 1A24A 3G7YA 1HYUA 4MF7A 2O8VB 2D2ZA 2HT9A 3TKSC 1UC7A 3EU3A 5IMAA 3GV1A 1JLVA 2VL2A 3RHCA 3DGQA 3Q6OA 2G0FA 3DKSA 8GSSA 2O85A 3QAGA 4HZ2A 1O6JA 4Q5QA 1GNWA 4JU5A 4MJEA 4O32A 3DEXA 2IN3A 3RBTA 3A2WA 3GTUA 3GH6A 3VFIA 2ON7A 2H19A 4TRXA 1PL1A 2H30A 2OADA 3L78A 3C71A 1OC8A 3A5IA 2VAFA 3GUSA 1URMA 1G6YA 5DALB 1THOA 1R7HA 22GSA 1K0CA 4FIWA 4HEA2 1EOGA 1XOAA 2MYGA 2WDUA 3HYPA 3CMIA 5ID2A 2P5RA 3Q18A 1AIUA 4GCIA 4ZB8A 5IMDA 5B7CA 4GTUA 3GFKA 2K18A 2B5EA 5IPGA 1XW6A 1FVKA 3WGXA 3ZFBA 1B4PA 2JSZA 3CTGA 5CREA 1XW9A 2XPDA 4ECJA 5ECMB 4JR4A 5HR0A 3FZAA 3FK8A 2EIOA 4AF2A 4EF0A 2AJQB 1MD4A 3L9SA 1MEKA 1F3AA 1IYHA 4KH7A 4BL7A 5AIVA 2FLSA 3E3EA 2X8HA 1W4VA 4XHMA 3UIWA 2VLTA 3ZLPA 2H6YA 3KEBA 5DJLA 3F4RA 1BAYA 2J9HA 3LEFA 1T3BA 1WPIA 5IMFA 3ZL5A 4MH3A 4PX1A 4DSSB 3F4SA 3ZIJA 1GTAA 3GX0A 4I8BA 1TP9A 2TRCP 2PUKC 2KLXA 2WRTA 1FB6A 4XS1A 3L9VA 3LXTA 3O76A 4EKZA 4ZIJA 2JZTA 1X5EA 1VGLA 2LJKA 2A4HA 2A2PA 4NXIA 4KF9A 2LQOA 2GGTA 1Z7PA 5JWRB 3KMNA 4LMWA 4ZBAA 2YJ7A 3QD9A 2YJHA 2UZ8A 3DXBA 4FYCA 10GSA 1EP7A 1R26A 2CVBA 1FG4A 2WGRA 3UVTA 4PQIA 3I6AA 5IO2A 3KIJA 4PUFC 2AUVA 5KN3A 4NV5A 1MDJA 3IPZA 4O5RA 2CQ9A 4AJ8A 3M8NA 3D21A 4K8MA 2YZHA 3O6TA 4GQFA 1JZDA 4FYUA 2N5FA 3U6VA 2CAIA 4FYBA 1V57A 2GZZA 2PMTA 2E2GA 1TDIA 5CO3A 3ERGA 1Z6NA 1G7OA 1PN9A 1Z7RA 1TRSA 2XBQA 4JR6A 2IPAA 3IR4A 1ACVA 1O73A 2PU9C 2H0GA 1GSFA 5JCGA 3TOUA 3ME8A 4TR0A 5J5NA 4IVFA 1TW9A 2IMFA 3F9UA 2MMAA 2VO4A 3F63A 4LMVA 1TOFA 1G7EA 1Z5YE 3HJPA 3M3MA 4HU9A 4GRFA 3MDKA 1ERUA 2FCHA 4EIPA 3HA9A 2EIRA 2FWHA 4KUNA 4F0BA 1BG5A 5JWQB 5C00A 2LJAA 5B6NA 2VCVA 3SBCA 2C1YA 1T7PB 4Q5FA 1F2EA 2MMNA 1ZCPA 3W8JA 1A2MA 1Z9HA 1TTZA 2L6CA 3UBLA 2HLSA 3US3A 1S3AA 1U88A 4J2FA 4N0VA 2HFDA 1R5AA 1OC3A 1Q98A 4G10A 4NHZA 5G2ZA 5IOXA 2K6VA 3R3EA 1THXA 4V2LA 2H66A 4HSCX 2H0HA 5KOWA 4HQSA 1WP0A 5HQPA 5ECOB 1ZOFA 4L8EA 4Z2RA 2O89A 3VURA 1VF4A 5E4WA 1XOBA 1SENA 1ERTA 3CRUA 4IJIA 4OMVA 1XXUA 5H5RA 3I43A 1ZL9A 1VF3A 1SJIA 5B6MA 1IYIA 1EEMA 5CRWA 3GKNA 1KTEA 4NPBA 5A4WA 2L6DA 1SK1A 2NBSA 5F8BA 3H1NA 3M0FA 1JFUA 3BCIA 5IO0A 2R3XA 4WBJA 3FR9A 4POBA 2AHEA 2XC2A 2H8LA 2B5YA 3GMFA 5D9VA 3I9V2 4MH2A 2QA1A 2PERA 5DAKA 2PBJA 4ECBA 2F3MA 4MNNA 1OKTA 2V6KA 2H6ZA 2QGVA 2FA8A 3HVVA 3UAPA 3TKPA 5A4UA 2JADA 2GSSA 2RIIA 1ERVA 1EV9A 4BA7A 5IQYA 2H1GA 1BX9A 3VK9A 1PFOA 1M2DA 4F2IA 3D4TA 2K8SA 1CQGA 3IK7A 2CX4A 5G30A 1ABAA 3WYWA 2IWTA 2VLVA 4YQMA 3H93A 3BBYA 2XPEA 3FYGA 3MNGA 2A4VA 3UARA 3GRXA 2MMOA 5DAKB 2GQLA 4IKHA 2B6MA 3MWHA 4L0WA 2PWJA 2I81A 4WXTA 3D4MA 2VCZA 3FHKA 1NSWA 3ZYWA 2YPMA 3CSHA 1PN0A 5ECPB 4OCEA 5CP1A 4OFTA 3LGCA 3DVWA 4K6XA 1SKWB 1M2BA 3KJYA 3FZ5A 1TI3A 4FQUA 2OBKA 2AB6A 1PMTA 3VWXA 4GLTA 3P2AA 4USSA 4CY8A 2RUEA 4QL9A 3DIEA 4K9ZA 2BJXA 4FH8A 4PURA 5G1KA 4F82A 3C8EA 1PKZA 1SK2A 2PGTA 4MZCA 1GULA 4V1Ag 3IOSA 3VWWA 3JCML 3DYRA 2H6XA 3KH7A 3A2XA 5ECLB 4JZQA 3RDWA 3IXRA 3KZQA 4O92A 6GSSA 5LNKe 2WFCA 4DSQA 2KHPA 1SYRA 1X5DA 3PH9A 4XS6A 4HJ2A 3KTBA 1YF1A 1FVJA 1A2JA 4WBRD 1O8XA 2C3NA 2OKAA 4WR5A 4ZXGA 3BOAA 5AGYA 2X8GA 4LL1B 5L71A 2LSTA 2VUPA 1BEDA 4D73B 1O7UA 3HJOA 1GUMA 4PQ1A 5IMVA 4O7HA 1RK4A 2V6OA 4TXOB 3UBKA 3LG6A 4KDUA 2CAQA 3F0IA 1GUKA 2VL3A 2J23A 2IMIA 3IE3A 5B8BA 4BIKA 2LRTA 5B8AA 2B5XA 2CA8A 4GSNA 5IMCA 4MMMA 1NHOA 4J57E 4K2DA 19GSA 2B3SA 5EL8A 5D9WA 1OVNA 4MCUA 2M46A 2R6KA 5A4VA 4K7NA 2I3YA 4I6XA 1GTIA 1B9XC 2C3TA 2NTOA 17GSA 1Z3EA 5FWGA 1A0FA 1DE2A 4YQUA 3KP8A 3F6DA 3EWLA 1UVZA 3GL5A 4LA1A 6GSTA 3N5OA 2HRNA 2JL4A 1USBA 4K5RA 4V2NA 3TJBA 4YKFA 1AQXA 2KP1A 4I2TA 5DCGA 1K0MA 3G7JA 3ZREA 5IOWA 5G31A 3N9JA 2I4AA 1T00A 5DJMA 4IQ1A 4ZL9A 2ZCTA 5KN1A 1B8XA 1K0NA 1T1VA 4G0IA 4BWQA 4DSSA 2VD1A 1SKRB 4BWSA 5IPHA 3VLNA 4EDYA 3EVIA 2YV7A 4EIQA 1G6WA 3GURA 1TJDA 1S3RA 2YWIA 1ZYPA 1GP1A 2L59A 2VL2C 4TVEA 4EUYA 4ECIA 6GSYA 2R0CA 4MABA 3WGDA 1EV4A 1U3AA 1PQNA 4IHUA 4HU7A 5GSTA 5J4UA 5HFGA 2O87A 1HD2A 3EC3A 1T4YA 4Q5NA 3TJGA 6GSXA 3CSJA 1M3IA 2TRXA 5ELAA 3TKSE 3UL3A 4EDZA 1NW2A 2H73A 2TIRA 4MZWA 1BYEA 2F9SA 2C4JA 2H75A 1HNCA 1GSSA 5EPFA 2I9HA 3FZ9A 3ZVJD 3GN3A 3C73A 4OO4A 1X5CA 1SL1B 2JACA 2DKHA 1GNEA 3WT2A 5IMZA 1X9SB 4KB3A 4ZL8A 3HY2A 4K1FA 4E8EA 2R5GA 5LCZA 2P0GA 4F9ZA 4X4JA 2DJ0A 4MP4A 1XFLA 1ZYNA 1GL8A 3LXZA 3EU4A 3NIVA 3NOFA 2GDRA 5DQSA 3TJKA 4N10A 1EGOA 4EO3A 2M72A 3RAZA 3CTFA 5GSSA 3MAKA 2AV4A 1M7TA 5ECRB 2FD3A 4TR1A 2Z9SA 3APQA 3UMAA 5CRGA 2QA2A 4MJAA 4MK3A 2HSYA 3GH9A 2V2GA 5DCHA 2GS3A 4GF0A 3IV4A 4JBBA 1A8YA 3HZ4A 4XIHA 1X0RA 1JZWA 4G2EA 1HNAA 4MPFA 3QPMA 1AAZA 3Q74A 4E8HA 1XVWA 2VIMA 3R2QA 3GSSA 3EE2A 4KAEA 1V40A 1YQ1A 1K0DA 3GNJA 4IELA 1XG8A 3ZITA 4O5QA 1M2AA 1PA3A 2H74A 1TRWA 2V41A 1QQ2A 1SJZA 1WWJA 4TR1B 2LKUA 2L5LA 3GIXA 2LV3A 5AN1A 11GSA 1PD21 2WZ9A 1R4WA 2GSRA 4I97A 1XWKA 3TGZA 4ZL7A 4NV2A 4WF5A 3TJJA 4GSTA 3EMXA 4XS4A 5ECNB 5ABRA 1PX6A 2L5OA 3LSZA 2KUCA 4IS0A 2IMDA 4GXZA 4TR4A 2IL3A 5CAXA 2PN8A 1SYXA 3QMXA 5COHA 2XBIA 2HNLA 4MLYA 5ECHB 1EOHA 3RHBA 4K7OA 1QMVA 2DJKA 1M99A 1JZOA 1S3DA 2YZUA 3HDCA 3DRNA 5AIXA 1OC9A 4EC0A 2N5AA 1UN2A 2GQKA 1GRXA 3D5JA 3I69A 4LL4B 3J7Yb 4GWRA 5ECIB 2HXKA 4XS4B 4PNFA 4IW9A 4YH2A 2VCWA 2B7KA 3ERWA 1TK8B 4Q5RA 2A2SA 2E2MA 4MDCA 3WGEA 2XHFA 3F4TA 5EVOA 1TK5B 3L4NA 1T4ZA 3DVXA 4PXOA 3EINA 3D0ZA 3C1RA 1OC9B 3KM6A 4DEJA 2YOIA 4ECCA 16GSA 4L5OA 3TRXA 2HYXA 2GSTA 1ML6A 4J56E 1XWAA 2QC7A 2VCXA 4HZ4A 1PL2A 1KNGA 1GH2A 3TOTA 1GTUA 2LTKA 2CZ2A 4Z2UA 5G5FA 4KGIA 1Y6EA 5HR3A 2I1UA 3VWVA 2DC5A 3F6FA 3GYKA 5J9CA 3FMWA 4HI7A 3Q19A 4JE1A 4ML1A 3EURA 5HR2A 3AY8A 7GSSA 2C0FA 2G2QA 3WD6A 1K0BA 4KE3A 4KSOA 1XWBA 4TW5A 3E0UA 3LORA 3HVXA 3PINA 3HZ8A 3M1GA 4AJ6A 3FRCA 5A5KA 1EP8A 4YAVA 4NHWA 1SD9A 3M9KA 3LYPA 2CV4A 4BVXA 2EIQA 6GSWA 1JLWA 1XBSA 4X43A 1SL0B 2CVDA 4K5SA 4O5UA 3LFLA 4GQCA 4KDYA 3ME7A 3FKFA 1U87A 4G0LA 2C8UA 3HXSA 5CNWA 3UVHA 1YY7A 2WB9A 4CY6A 2R0GA 2YV9A 5KEJA 1WOUA 3W6GA 1E6BA 4KA0A 3PGTA 1SL2B 1ERWA 3M9JA 4WKWA 5HFIA 4ZB9A 2DBCA 1K3YA 2HRFA 4WR4A 4BVXB 1Y25A 1YEPA 3IC4A 3ED3A 4KNDA 5JCUA 4Z7XA 1A23A 4FO5A 2AAWA 1YZXA 2IFQA 4ZBDA 4YKGA 3TKSA 1F9MA 4OFNA 5ECKB 3C7MA 2RM6A 5IM9A 4D73A 3O3TA 3MSZA 2OA7A 4F03A 2GVPA 2GT5A 2V1MA 2KP2A 1EWXA 4TXOA 3H4KA 3D22A 1GSEA 2LRCA 2OE1A 1J08A 4AJ7A 2WCIA 1S3CA 5D73A 5FHIA 2HRAA 4H86A 1FO5A 5KN0A 1K0OA 1TI1A 1YJ6A 2LNTA 1PSQA 1FB0A 4EE0A 1YEXA 3HCZA 4PQHA 3RPNA 5F0GA 4N0ZA 4JEDA 1RQMA 1U6TA 2IFQB 4OFMA 2FNOA 2VL9A 3VWUA 2FY6A 2DJ3A 1TU7A 1GLQA 1T8EB 1XWGA 3IAM2 4CW9A 3ERFA 1X9MB 1MDIA 12GSA 3K8NA 5G1LA 2CT6A 3RPPA 1MTCA 2DIYA 1N8JA 4HQZA 4F0CA 2GSQA 2V32A 1EZKA 4TKYA 3D6IA 1KEBA 1SJ6A 3CYNA 2GTUA 2LQQA 4DVCA 4KSMA 2HSHA 3BCKA 1F6MC 1AW9A 3FEUA 4WETA 1G0TA 4IN0A 4YAPA 2X99A 4RI7A 1GSYA 1LU4A 1PGTA 1ST9A 1V98A 3IAS2 5EY6A 4L5LA 2YNXA 3HKRA 1DBYA 6GSVA 1EEJA 3KXOA 4ZILA 1UA5A 3MIXA 4MA9A 1XVQA 2X64A 1CQHA 1GSDA 2REMA 5HR1A 2FWEA 1LJRA 4K2XA 3HVNA 2PPTA 2LNSA 1ZMAA 5BMUA 2DMMA 2H72A 2F51A 3L0HA 1GSQA 1QXHA 1ZGNA 1ON4A 2LS5A 4A5PA 3LWAA 3FR6A 3QAWA 5GZZB 3IHGA 3A5WA 5C04A 2CVKA 1QK8A 1J0FA 1K3LA 4N30A 1B4QA 2VD0A 2L57A 3APSA 2PVOC 4DSRA 4ZB6A 1FHEA 2DKIA 3GKKA 1SK0A 2CX3A 3TKQA 4KW6A 1DE1A 3GTUB 3TKRA 3ZMKA 2X8CA 2K8VA 3GSTA 1GTBA 3QAVA 1FAAA 3GKMA 1X9WB 1ZYQB 2YANA 3E9JB 3CXGA 3U5RE 2N5BA 3TJFA 4MPGA 1XZOA 5KN2A 2HI7A 2R2JA 3LW9A 2LUSA 1PKWA 1XCCA 1ILOA 18GSA 1KBNA 1XIYA 3FW2A 4KCEA 1OE7A 3H79A 3IBHA 2FWFA 5ID2B 1WRYA 3HD5A 2DSAA 3KCMA 4RUVA 4OWYA 2PVQA 3C1SA 2HE3A 2H0IA 1V9WA 4WEYA 1VF2A 2QSIA 5CYYA 2E7PA 5GAND 1SKSB 3LQ7A 5E59A 3LYKA 2VOCA 3EYTA 2OE0A 1SD8A 2YN1A 4NWYA 2BTOT 2GZPA 3TCOA 4MZBA 2F8AA 4ACSA 4I5QA 2O7KA 4HJMA 3UOMA 1E2YA 1M3JA 4EXJA 2OACA 4G0KA 4CDOA 4TXVA 3CRTA 5D93A 1XW5A 4BL7B 5J3RA 4K0GA 2VM2A 4ICYA 4QQ7A 2X4AA 1GWCA 1JHBA 4CHSA 3ZIVA 3S9FA 1R5PA 1GSUA 2C0GA 3J7Yk 5F06A 1JZRA 1SU9A 5H5QA 2C0DA
chains in the Genus database with same CATH topology
3A3TA 4XRAA 2LEGA 3FZ4A 3QFAC 4L0UA 3ZRDA 2YWMA 2P31A 2DJJA 3F3QA 2ZUPA 1OYJA 5D8IA 4V2MA 4IP1A 3P8WA 2FUG2 4N11A 1GLPA 1A2LA 2KOKA 4X1UA 2FWGA 1VRSD 2R4VA 3DD3A 5H5SA 1AC1A 4EVMA 5DQYA 4KX4A 1NM3A 3IK9A 2IJYA 1FOHA 3KH9A 4PTSA 4YQVA 2H70A 2HSMA 2FGXA 1TXXA 3GX8A 2VM1A 1MDKA 2OE3A 3HJMA 3W8SA 4BPYA 4OO5A 1LBKA 2GZYA 2C0EA 1VF1A 5IIZA 4BVYA 1I5GA 4HS1A 1QGVA 2WJUA 3GA4A 1W89A 1WE0A 1YDKA 2OJLA 2DLXA 3P7XA 3H8QA 2RM5A 2YCDA 9GSSA 2VCQA 3IA1A 2HZEA 3IC8A 1N2AA 3BJ5A 4ILFA 3IDVA 2GT6A 2YWNA 13GSA 2H1AA 4XTSA 1FW1A 3TRQA 4XCSA 1ZYEA 1NHYA 1YKAA 1XPVA 2DJ2A 1PRXA 2AYTA 4TN8A 2HZFA 3TUEA 2C3QA 3CSIA 3F8UA 4X0XA 5J41A 4AGSA 4HOJA 4QL7A 5INYA 3DMLA 4NAXA 4V1Ap 5D9XA 2L4CA 1QUWA 4BVYB 5G5EA 1HNBA 1HQOA 3L9UA 1F3BA 5BRTA 4G9HA 3P90A 2B1KA 4OCFA 1YF0A 3QDNA 1J9BA 3TDGA 2MBSA 5DVBA 2WS2A 3TB2A 2HZEB 2CZ3A 4ID0A 3FR3A 4TOPA 5LD0A 3APOA 1TK0B 3PPUA 4I2UA 3ZVJA 3KMOA 1AQVA 5CRDA 3UJ1A 4PNGA 4KCAA 2HRKA 4MF6A 5FT3A 1BQ7A 3GL3A 4JRRA 3ZMLA 4HUAA 2B1LA 2F8FA 5HFKA 1Q4JA 1V58A 5JCWA 3TRPA 3ZFLA 1OAZA 2DMLA 4RQRA 3FY7A 5DBQA 14GSA 1ZZYA 1XWCA 3DWVA 2MMZA 2H1DA 1FOVA 2QKEA 5JWOB 2H76A 2X49A 2IMEA 3VPQA 2VCTA 4GSSA 1AXDA 1A8LA 4OD7A 4TR3A 3OR5A 1K3OA 3EPTA 2R0PA 4IGJA 3WT1A 2YWOA 4IP6A 3EMPA 1I9DA 4IBPA 1F37A 3ISOA 1WMJA 1WJKA 2ON5A 3HHVA 2R37A 2LRNA 5DDLA 2EC4A 4IQAA 4XRDA 3LJRA 1RW1A 1GUHA 2OBIA 2P5QA 1C72A 4Z2TA 3QOUA 2RUFA 4POLA 1OE8A 6GSUA 3CBUA 1V2AA 5ECSA 3QFBC 5ECQB 1H75A 1O8WA 2NPBA 1U3IA 5F05A 3ZTLA 4LLRA 5KOXA 3BD2A 2K9FA 2C80A 3KP9A 1B9YC 3V1WA 1TRVA 5D9TA 1K0AA 3VI5A 3MYDA 4MF5A 4ISDA 1DUGA 5D96A 3GHAA 2FHEA 2ES7A 4HDEA 3QR6A 2BMXA 3G7IA 2H01A 1YKCA 2MBTA 3NZNA 3SWLA 1PX7A 2JZSA 2IIYA 1TRUA 2DJ1A 1B48A 2M80A 3KTLA 4G19A 2H71A 1H4OA 2RLIA 4K0NA 3QCPA 2MZCA 1WIKA 2GQMA 3ZZXA 2WULA 1O85A 2NVLA 1AQWA 4K7IA 2JSYA 4RQXA 1MD3A 2IMKA 1TU8A 4PUAA 2JZRA 3G9BA 4POKA 2JU5A 2YP6A 3VPTA 1A0RP 2LJRA 1DSBA 3UEMA 2ALBA 4IJ3A 4RI6A 3F3RA 5F07A 2L4QA 1TKDB 1M9AA 1M0UA 4NMUA 5GAPD 4P3YB 3PR8A 3HVSA 2FA4A 4MJBA 5ENUA 4ZBBA 2A2RA 1O81A 3IRAA 1QFNA 4KDXA 1M9BA 3GKXA 20GSA 2ZNMA 4EL1A 2B7JA 2DIZA 2NDOA 5ELGA 2E0QA 5J9BA 1BJXA 3KGKA 3IHQA 2H1BA 4MJCA 4ULXA 1EGRA 4POMA 1Z6MA 1OKDA 4ML6A 4WF4A 2VLUA 3VI7A 1AUCA 3A2VA 3KD0A 4PGTA 5DALA 5CRHA 5AISA 2GLRA 1A24A 3G7YA 1HYUA 4MF7A 2O8VB 2D2ZA 2HT9A 3TKSC 1UC7A 3EU3A 5IMAA 3GV1A 1JLVA 2VL2A 3RHCA 3DGQA 3Q6OA 2G0FA 3DKSA 8GSSA 2O85A 3QAGA 4HZ2A 1O6JA 4Q5QA 1GNWA 4JU5A 4MJEA 4O32A 3DEXA 2IN3A 3RBTA 3A2WA 3GTUA 3GH6A 3VFIA 2ON7A 2H19A 4TRXA 1PL1A 2H30A 2OADA 3L78A 3C71A 1OC8A 3A5IA 2VAFA 3GUSA 1URMA 1G6YA 5DALB 1THOA 1R7HA 22GSA 1K0CA 4FIWA 4HEA2 1EOGA 1XOAA 2MYGA 2WDUA 3HYPA 3CMIA 5ID2A 2P5RA 3Q18A 1AIUA 4GCIA 4ZB8A 5IMDA 5B7CA 4GTUA 3GFKA 2K18A 2B5EA 5IPGA 1XW6A 1FVKA 3WGXA 3ZFBA 1B4PA 2JSZA 3CTGA 5CREA 1XW9A 2XPDA 4ECJA 5ECMB 4JR4A 5HR0A 3FZAA 3FK8A 2EIOA 4AF2A 4EF0A 2AJQB 1MD4A 3L9SA 1MEKA 1F3AA 1IYHA 4KH7A 4BL7A 5AIVA 2FLSA 3E3EA 2X8HA 1W4VA 4XHMA 3UIWA 2VLTA 3ZLPA 2H6YA 3KEBA 5DJLA 3F4RA 1BAYA 2J9HA 3LEFA 1T3BA 1WPIA 5IMFA 3ZL5A 4MH3A 4PX1A 4DSSB 3F4SA 3ZIJA 1GTAA 3GX0A 4I8BA 1TP9A 2TRCP 2PUKC 2KLXA 2WRTA 1FB6A 4XS1A 3L9VA 3LXTA 3O76A 4EKZA 4ZIJA 2JZTA 1X5EA 1VGLA 2LJKA 2A4HA 2A2PA 4NXIA 4KF9A 2LQOA 2GGTA 1Z7PA 5JWRB 3KMNA 4LMWA 4ZBAA 2YJ7A 3QD9A 2YJHA 2UZ8A 3DXBA 4FYCA 10GSA 1EP7A 1R26A 2CVBA 1FG4A 2WGRA 3UVTA 4PQIA 3I6AA 5IO2A 3KIJA 4PUFC 2AUVA 5KN3A 4NV5A 1MDJA 3IPZA 4O5RA 2CQ9A 4AJ8A 3M8NA 3D21A 4K8MA 2YZHA 3O6TA 4GQFA 1JZDA 4FYUA 2N5FA 3U6VA 2CAIA 4FYBA 1V57A 2GZZA 2PMTA 2E2GA 1TDIA 5CO3A 3ERGA 1Z6NA 1G7OA 1PN9A 1Z7RA 1TRSA 2XBQA 4JR6A 2IPAA 3IR4A 1ACVA 1O73A 2PU9C 2H0GA 1GSFA 5JCGA 3TOUA 3ME8A 4TR0A 5J5NA 4IVFA 1TW9A 2IMFA 3F9UA 2MMAA 2VO4A 3F63A 4LMVA 1TOFA 1G7EA 1Z5YE 3HJPA 3M3MA 4HU9A 4GRFA 3MDKA 1ERUA 2FCHA 4EIPA 3HA9A 2EIRA 2FWHA 4KUNA 4F0BA 1BG5A 5JWQB 5C00A 2LJAA 5B6NA 2VCVA 3SBCA 2C1YA 1T7PB 4Q5FA 1F2EA 2MMNA 1ZCPA 3W8JA 1A2MA 1Z9HA 1TTZA 2L6CA 3UBLA 2HLSA 3US3A 1S3AA 1U88A 4J2FA 4N0VA 2HFDA 1R5AA 1OC3A 1Q98A 4G10A 4NHZA 5G2ZA 5IOXA 2K6VA 3R3EA 1THXA 4V2LA 2H66A 2H0HA 5KOWA 4HQSA 1WP0A 5HQPA 5ECOB 1ZOFA 4L8EA 4Z2RA 2O89A 3VURA 1VF4A 5E4WA 1XOBA 1SENA 1ERTA 3CRUA 4IJIA 4OMVA 1XXUA 5H5RA 3I43A 1ZL9A 1VF3A 1SJIA 5B6MA 1IYIA 1EEMA 5CRWA 3GKNA 1KTEA 4NPBA 5A4WA 2L6DA 1SK1A 2NBSA 5F8BA 3H1NA 3M0FA 1JFUA 3BCIA 5IO0A 2R3XA 4WBJA 3FR9A 4POBA 2AHEA 2XC2A 2H8LA 2B5YA 3GMFA 5D9VA 3I9V2 4MH2A 2QA1A 2PERA 5DAKA 2PBJA 4ECBA 2F3MA 4MNNA 1OKTA 2V6KA 2H6ZA 2QGVA 2FA8A 3HVVA 3UAPA 3TKPA 5A4UA 2JADA 2GSSA 2RIIA 1ERVA 1EV9A 4BA7A 5IQYA 2H1GA 1BX9A 3VK9A 1M2DA 4F2IA 3D4TA 2K8SA 1CQGA 3IK7A 2CX4A 5G30A 1ABAA 3WYWA 2IWTA 2VLVA 4YQMA 3H93A 3BBYA 2XPEA 3FYGA 3MNGA 2A4VA 3UARA 3GRXA 2MMOA 5DAKB 2GQLA 4IKHA 2B6MA 3MWHA 4L0WA 2PWJA 2I81A 4WXTA 3D4MA 2VCZA 3FHKA 1NSWA 3ZYWA 2YPMA 3CSHA 1PN0A 5ECPB 4OCEA 5CP1A 4OFTA 3LGCA 3DVWA 4K6XA 1SKWB 1M2BA 3KJYA 3FZ5A 1TI3A 4FQUA 2OBKA 2AB6A 1PMTA 3VWXA 4GLTA 3P2AA 4USSA 4CY8A 2RUEA 4QL9A 3DIEA 4K9ZA 2BJXA 4FH8A 4PURA 5G1KA 4F82A 3C8EA 1PKZA 1SK2A 2PGTA 4MZCA 1GULA 4V1Ag 3IOSA 3VWWA 3JCML 3DYRA 2H6XA 3KH7A 3A2XA 5ECLB 4JZQA 3RDWA 3IXRA 3KZQA 4O92A 6GSSA 5LNKe 2WFCA 4DSQA 2KHPA 1SYRA 1X5DA 3PH9A 4XS6A 4HJ2A 3KTBA 1YF1A 1FVJA 1A2JA 4WBRD 1O8XA 2C3NA 2OKAA 4WR5A 4ZXGA 3BOAA 5AGYA 2X8GA 4LL1B 5L71A 2LSTA 2VUPA 1BEDA 4D73B 1O7UA 3HJOA 1GUMA 4PQ1A 5IMVA 4O7HA 1RK4A 2V6OA 4TXOB 3UBKA 3LG6A 4KDUA 2CAQA 3F0IA 1GUKA 2VL3A 2J23A 2IMIA 3IE3A 5B8BA 2LRTA 5B8AA 2B5XA 2CA8A 4GSNA 5IMCA 4MMMA 1NHOA 4J57E 4K2DA 19GSA 2B3SA 5EL8A 5D9WA 1OVNA 4MCUA 2M46A 2R6KA 5A4VA 4K7NA 2I3YA 4I6XA 1GTIA 1B9XC 2C3TA 2NTOA 17GSA 1Z3EA 5FWGA 1A0FA 1DE2A 4YQUA 3KP8A 3F6DA 3EWLA 1UVZA 3GL5A 4LA1A 6GSTA 3N5OA 2HRNA 2JL4A 1USBA 4K5RA 4V2NA 3TJBA 4YKFA 1AQXA 2KP1A 4I2TA 5DCGA 1K0MA 3G7JA 3ZREA 5IOWA 5G31A 3N9JA 2I4AA 1T00A 5DJMA 4IQ1A 4ZL9A 2ZCTA 5KN1A 1B8XA 1K0NA 1T1VA 4G0IA 4BWQA 4DSSA 2VD1A 1SKRB 4BWSA 5IPHA 3VLNA 4EDYA 3EVIA 2YV7A 4EIQA 1G6WA 3GURA 1TJDA 2YWIA 1ZYPA 1GP1A 2L59A 2VL2C 4TVEA 4EUYA 4ECIA 6GSYA 2R0CA 4MABA 3WGDA 1EV4A 1U3AA 1PQNA 4IHUA 4HU7A 5GSTA 5J4UA 5HFGA 2O87A 1HD2A 3EC3A 1T4YA 4Q5NA 3TJGA 6GSXA 3CSJA 2TRXA 5ELAA 3TKSE 3UL3A 4EDZA 1NW2A 2H73A 2TIRA 4MZWA 1BYEA 2F9SA 2C4JA 2H75A 1HNCA 1GSSA 5EPFA 2I9HA 3FZ9A 3ZVJD 3GN3A 3C73A 4OO4A 1X5CA 1SL1B 2JACA 2DKHA 1GNEA 3WT2A 5IMZA 1X9SB 4KB3A 4ZL8A 3HY2A 4K1FA 4E8EA 2R5GA 5LCZA 2P0GA 4F9ZA 4X4JA 2DJ0A 4MP4A 1XFLA 1ZYNA 1GL8A 3LXZA 3EU4A 3NIVA 3NOFA 2GDRA 5DQSA 3TJKA 4N10A 1EGOA 4EO3A 2M72A 3RAZA 3CTFA 5GSSA 3MAKA 2AV4A 1M7TA 5ECRB 2FD3A 4TR1A 2Z9SA 3APQA 3UMAA 5CRGA 2QA2A 4MJAA 4MK3A 2HSYA 3GH9A 2V2GA 5DCHA 2GS3A 4GF0A 3IV4A 4JBBA 1A8YA 3HZ4A 4XIHA 1X0RA 1JZWA 4G2EA 1HNAA 4MPFA 3QPMA 1AAZA 3Q74A 4E8HA 1XVWA 2VIMA 3R2QA 3GSSA 3EE2A 4KAEA 1V40A 1YQ1A 1K0DA 3GNJA 4IELA 3ZITA 4O5QA 1M2AA 1PA3A 2H74A 1TRWA 2V41A 1QQ2A 1SJZA 1WWJA 4TR1B 2LKUA 2L5LA 3GIXA 2LV3A 5AN1A 11GSA 1PD21 2WZ9A 1R4WA 2GSRA 4I97A 1XWKA 3TGZA 4ZL7A 4NV2A 4WF5A 3TJJA 4GSTA 3EMXA 4XS4A 5ECNB 5ABRA 1PX6A 2L5OA 3LSZA 2KUCA 4IS0A 2IMDA 4GXZA 4TR4A 2IL3A 5CAXA 2PN8A 1SYXA 3QMXA 5COHA 2XBIA 2HNLA 4MLYA 5ECHB 1EOHA 3RHBA 4K7OA 1QMVA 2DJKA 1M99A 1JZOA 1S3DA 2YZUA 3HDCA 3DRNA 5AIXA 1OC9A 4EC0A 2N5AA 1UN2A 2GQKA 1GRXA 3D5JA 3I69A 4LL4B 3J7Yb 4GWRA 5ECIB 2HXKA 4XS4B 4PNFA 4IW9A 4YH2A 2VCWA 2B7KA 3ERWA 1TK8B 4Q5RA 2A2SA 2E2MA 4MDCA 3WGEA 2XHFA 3F4TA 5EVOA 1TK5B 3L4NA 1T4ZA 3DVXA 4PXOA 3EINA 3D0ZA 3C1RA 1OC9B 3KM6A 4DEJA 2YOIA 4ECCA 16GSA 4L5OA 3TRXA 2HYXA 2GSTA 1ML6A 4J56E 1XWAA 2QC7A 2VCXA 4HZ4A 1PL2A 1KNGA 1GH2A 3TOTA 1GTUA 2LTKA 2CZ2A 4Z2UA 5G5FA 4KGIA 1Y6EA 5HR3A 2I1UA 3VWVA 2DC5A 3F6FA 3GYKA 5J9CA 3FMWA 4HI7A 3Q19A 4JE1A 4ML1A 3EURA 5HR2A 3AY8A 7GSSA 2C0FA 2G2QA 3WD6A 1K0BA 4KE3A 4KSOA 1XWBA 4TW5A 3E0UA 3LORA 3HVXA 3PINA 3HZ8A 3M1GA 4AJ6A 3FRCA 5A5KA 1EP8A 4YAVA 4NHWA 1SD9A 3M9KA 3LYPA 2CV4A 4BVXA 2EIQA 6GSWA 1JLWA 1XBSA 4X43A 1SL0B 2CVDA 4K5SA 4O5UA 3LFLA 4GQCA 4KDYA 3ME7A 3FKFA 1U87A 4G0LA 2C8UA 3HXSA 5CNWA 3UVHA 1YY7A 2WB9A 4CY6A 2R0GA 2YV9A 5KEJA 1WOUA 3W6GA 1E6BA 4KA0A 3PGTA 1SL2B 1ERWA 3M9JA 4WKWA 5HFIA 4ZB9A 2DBCA 1K3YA 2HRFA 4WR4A 4BVXB 1Y25A 1YEPA 3IC4A 3ED3A 4KNDA 5JCUA 4Z7XA 1A23A 4FO5A 2AAWA 1YZXA 2IFQA 4ZBDA 4YKGA 3TKSA 1F9MA 4OFNA 5ECKB 3C7MA 2RM6A 5IM9A 4D73A 3O3TA 3MSZA 2OA7A 4F03A 2GVPA 2GT5A 2V1MA 2KP2A 1EWXA 4TXOA 3H4KA 3D22A 1GSEA 2LRCA 2OE1A 1J08A 4AJ7A 2WCIA 1S3CA 5D73A 5FHIA 2HRAA 4H86A 1FO5A 5KN0A 1K0OA 1TI1A 1YJ6A 2LNTA 1PSQA 1FB0A 4EE0A 1YEXA 3HCZA 4PQHA 3RPNA 5F0GA 4N0ZA 4JEDA 1RQMA 1U6TA 2IFQB 4OFMA 2FNOA 2VL9A 3VWUA 2FY6A 2DJ3A 1TU7A 1GLQA 1T8EB 1XWGA 3IAM2 4CW9A 3ERFA 1X9MB 1MDIA 12GSA 3K8NA 5G1LA 2CT6A 3RPPA 1MTCA 2DIYA 1N8JA 4HQZA 4F0CA 2GSQA 2V32A 1EZKA 4TKYA 3D6IA 1KEBA 1SJ6A 3CYNA 2GTUA 2LQQA 4DVCA 4KSMA 2HSHA 3BCKA 1F6MC 1AW9A 3FEUA 4WETA 1G0TA 4IN0A 4YAPA 2X99A 4RI7A 1GSYA 1LU4A 1PGTA 1ST9A 1V98A 3IAS2 5EY6A 4L5LA 2YNXA 3HKRA 1DBYA 6GSVA 1EEJA 3KXOA 4ZILA 1UA5A 3MIXA 4MA9A 1XVQA 2X64A 1CQHA 1GSDA 2REMA 5HR1A 2FWEA 1LJRA 4K2XA 2PPTA 2LNSA 1ZMAA 5BMUA 2DMMA 2H72A 2F51A 3L0HA 1GSQA 1QXHA 1ZGNA 1ON4A 2LS5A 4A5PA 3LWAA 3FR6A 3QAWA 5GZZB 3IHGA 3A5WA 5C04A 2CVKA 1QK8A 1J0FA 1K3LA 4N30A 1B4QA 2VD0A 2L57A 3APSA 2PVOC 4DSRA 4ZB6A 1FHEA 2DKIA 3GKKA 1SK0A 2CX3A 3TKQA 4KW6A 1DE1A 3GTUB 3TKRA 3ZMKA 2X8CA 2K8VA 3GSTA 1GTBA 3QAVA 1FAAA 3GKMA 1X9WB 1ZYQB 2YANA 3E9JB 3CXGA 3U5RE 2N5BA 3TJFA 4MPGA 1XZOA 5KN2A 2HI7A 2R2JA 3LW9A 2LUSA 1PKWA 1XCCA 1ILOA 18GSA 1KBNA 1XIYA 3FW2A 4KCEA 1OE7A 3H79A 3IBHA 2FWFA 5ID2B 1WRYA 3HD5A 2DSAA 3KCMA 4RUVA 4OWYA 2PVQA 3C1SA 2HE3A 2H0IA 1V9WA 4WEYA 1VF2A 2QSIA 5CYYA 2E7PA 5GAND 1SKSB 3LQ7A 5E59A 3LYKA 2VOCA 3EYTA 2OE0A 1SD8A 2YN1A 4NWYA 2BTOT 2GZPA 3TCOA 4MZBA 2F8AA 4ACSA 4I5QA 2O7KA 4HJMA 3UOMA 1E2YA 4EXJA 2OACA 4G0KA 4CDOA 4TXVA 3CRTA 5D93A 1XW5A 4BL7B 5J3RA 4K0GA 2VM2A 4ICYA 4QQ7A 2X4AA 1GWCA 1JHBA 4CHSA 3ZIVA 3S9FA 1R5PA 1GSUA 2C0GA 3J7Yk 5F06A 1JZRA 1SU9A 5H5QA 2C0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3T A;  4XRA A;  2LEG A;  3FZ4 A;  3QFA C;  4L0U A;  3ZRD A;  2YWM A;  2P31 A;  2DJJ A;  3F3Q A;  2ZUP A;  1OYJ A;  5D8I A;  4V2M A;  4IP1 A;  3P8W A;  2FUG 2;  4N11 A;  1GLP A;  1A2L A;  2KOK A;  4X1U A;  2FWG A;  1VRS D;  2R4V A;  3DD3 A;  5H5S A;  1AC1 A;  4EVM A;  5DQY A;  4KX4 A;  1NM3 A;  3IK9 A;  2IJY A;  3KH9 A;  4YQV A;  2H70 A;  2FGX A;  1TXX A;  3GX8 A;  2VM1 A;  1MDK A;  2OE3 A;  3HJM A;  3W8S A;  4BPY A;  4OO5 A;  1LBK A;  2GZY A;  2C0E A;  1VF1 A;  5IIZ A;  4BVY A;  1I5G A;  4HS1 A;  1QGV A;  2WJU A;  3GA4 A;  1W89 A;  1WE0 A;  1YDK A;  2OJL A;  2DLX A;  3P7X A;  3H8Q A;  2RM5 A;  2YCD A;  9GSS A;  2VCQ A;  3IA1 A;  2HZE A;  1N2A A;  3BJ5 A;  4ILF A;  3IDV A;  2GT6 A;  2YWN A;  13GS A;  2H1A A;  4XTS A;  1FW1 A;  3TRQ A;  4XCS A;  1ZYE A;  1NHY A;  1YKA A;  1XPV A;  2DJ2 A;  1PRX A;  2AYT A;  4TN8 A;  2HZF A;  3TUE A;  2C3Q A;  3CSI A;  3F8U A;  4X0X A;  5J41 A;  4AGS A;  4HOJ A;  4QL7 A;  5INY A;  3DML A;  4NAX A;  4V1A p;  5D9X A;  2L4C A;  1QUW A;  5G5E A;  1HNB A;  1HQO A;  3L9U A;  1F3B A;  4G9H A;  3P90 A;  2B1K A;  4OCF A;  1YF0 A;  3QDN A;  1J9B A;  3TDG A;  2MBS A;  5DVB A;  2WS2 A;  3TB2 A;  2HZE B;  2CZ3 A;  4ID0 A;  3FR3 A;  4TOP A;  5LD0 A;  3APO A;  1TK0 B;  4I2U A;  3ZVJ A;  3KMO A;  1AQV A;  5CRD A;  3UJ1 A;  4PNG A;  4KCA A;  4MF6 A;  5FT3 A;  1BQ7 A;  3GL3 A;  4JRR A;  3ZML A;  4HUA A;  2B1L A;  2F8F A;  5HFK A;  1Q4J A;  1V58 A;  5JCW A;  3TRP A;  3ZFL A;  1OAZ A;  2DML A;  4RQR A;  3FY7 A;  5DBQ A;  14GS A;  1ZZY A;  1XWC A;  3DWV A;  2MMZ A;  2H1D A;  1FOV A;  2QKE A;  5JWO B;  2H76 A;  2IME A;  3VPQ A;  2VCT A;  4GSS A;  1AXD A;  1A8L A;  4OD7 A;  4TR3 A;  3OR5 A;  1K3O A;  4IGJ A;  3WT1 A;  2YWO A;  4IP6 A;  3EMP A;  1I9D A;  4IBP A;  1F37 A;  3ISO A;  1WMJ A;  1WJK A;  2ON5 A;  3HHV A;  2R37 A;  2LRN A;  5DDL A;  2EC4 A;  4IQA A;  4XRD A;  3LJR A;  1RW1 A;  1GUH A;  2OBI A;  2P5Q A;  1C72 A;  3QOU A;  2RUF A;  4POL A;  1OE8 A;  6GSU A;  3CBU A;  1V2A A;  5ECS A;  3QFB C;  5ECQ B;  1H75 A;  1O8W A;  2NPB A;  1U3I A;  5F05 A;  3ZTL A;  4LLR A;  3BD2 A;  2K9F A;  2C80 A;  3KP9 A;  1B9Y C;  3V1W A;  1TRV A;  5D9T A;  1K0A A;  3VI5 A;  4MF5 A;  4ISD A;  1DUG A;  5D96 A;  3GHA A;  2FHE A;  2ES7 A;  4HDE A;  3QR6 A;  2BMX A;  3G7I A;  2H01 A;  1YKC A;  2MBT A;  3NZN A;  3SWL A;  1PX7 A;  2JZS A;  2IIY A;  1TRU A;  2DJ1 A;  1B48 A;  2M80 A;  3KTL A;  4G19 A;  2H71 A;  1H4O A;  2RLI A;  4K0N A;  3QCP A;  2MZC A;  1WIK A;  2GQM A;  3ZZX A;  2WUL A;  1O85 A;  2NVL A;  1AQW A;  4K7I A;  2JSY A;  4RQX A;  1MD3 A;  2IMK A;  1TU8 A;  4PUA A;  2JZR A;  3G9B A;  4POK A;  2JU5 A;  2YP6 A;  3VPT A;  1A0R P;  2LJR A;  1DSB A;  3UEM A;  2ALB A;  4IJ3 A;  4RI6 A;  3F3R A;  5F07 A;  2L4Q A;  1TKD B;  1M9A A;  1M0U A;  4NMU A;  5GAP D;  4P3Y B;  3PR8 A;  3HVS A;  2FA4 A;  4MJB A;  5ENU A;  4ZBB A;  2A2R A;  1O81 A;  3IRA A;  1QFN A;  4KDX A;  1M9B A;  3GKX A;  20GS A;  2ZNM A;  4EL1 A;  2B7J A;  2DIZ A;  2NDO A;  5ELG A;  2E0Q A;  5J9B A;  1BJX A;  3KGK A;  3IHQ A;  2H1B A;  4MJC A;  4ULX A;  1EGR A;  4POM A;  1Z6M A;  1OKD A;  4ML6 A;  4WF4 A;  2VLU A;  3VI7 A;  1AUC A;  3A2V A;  3KD0 A;  4PGT A;  5DAL A;  5CRH A;  5AIS A;  2GLR A;  1A24 A;  3G7Y A;  1HYU A;  4MF7 A;  2O8V B;  2D2Z A;  2HT9 A;  3TKS C;  1UC7 A;  3EU3 A;  5IMA A;  3GV1 A;  1JLV A;  2VL2 A;  3RHC A;  3DGQ A;  3Q6O A;  2G0F A;  3DKS A;  8GSS A;  2O85 A;  3QAG A;  4HZ2 A;  1O6J A;  4Q5Q A;  1GNW A;  4JU5 A;  4MJE A;  4O32 A;  3DEX A;  2IN3 A;  3RBT A;  3A2W A;  3GTU A;  3GH6 A;  3VFI A;  2ON7 A;  2H19 A;  4TRX A;  1PL1 A;  2H30 A;  2OAD A;  3L78 A;  3C71 A;  1OC8 A;  2VAF A;  3GUS A;  1URM A;  1G6Y A;  5DAL B;  1THO A;  1R7H A;  22GS A;  1K0C A;  4FIW A;  4HEA 2;  1EOG A;  1XOA A;  2MYG A;  2WDU A;  3HYP A;  3CMI A;  5ID2 A;  2P5R A;  3Q18 A;  1AIU A;  4GCI A;  4ZB8 A;  5IMD A;  5B7C A;  4GTU A;  3GFK A;  2K18 A;  2B5E A;  5IPG A;  1XW6 A;  1FVK A;  3WGX A;  3ZFB A;  1B4P A;  2JSZ A;  3CTG A;  5CRE A;  1XW9 A;  2XPD A;  4ECJ A;  5ECM B;  4JR4 A;  5HR0 A;  3FZA A;  3FK8 A;  2EIO A;  4AF2 A;  4EF0 A;  2AJQ B;  1MD4 A;  3L9S A;  1MEK A;  1F3A A;  1IYH A;  4KH7 A;  4BL7 A;  5AIV A;  2FLS A;  3E3E A;  2X8H A;  1W4V A;  4XHM A;  3UIW A;  2VLT A;  3ZLP A;  2H6Y A;  3KEB A;  5DJL A;  3F4R A;  1BAY A;  2J9H A;  3LEF A;  1T3B A;  1WPI A;  5IMF A;  3ZL5 A;  4MH3 A;  4PX1 A;  4DSS B;  3F4S A;  3ZIJ A;  1GTA A;  3GX0 A;  4I8B A;  1TP9 A;  2TRC P;  2PUK C;  2KLX A;  2WRT A;  1FB6 A;  4XS1 A;  3L9V A;  3LXT A;  3O76 A;  4EKZ A;  4ZIJ A;  2JZT A;  1X5E A;  1VGL A;  2LJK A;  4NXI A;  2LQO A;  2GGT A;  1Z7P A;  5JWR B;  3KMN A;  4LMW A;  4ZBA A;  2YJ7 A;  3QD9 A;  2YJH A;  3DXB A;  4FYC A;  10GS A;  1EP7 A;  1R26 A;  2CVB A;  1FG4 A;  2WGR A;  3UVT A;  4PQI A;  3I6A A;  5IO2 A;  3KIJ A;  4PUF C;  2AUV A;  5KN3 A;  4NV5 A;  1MDJ A;  3IPZ A;  4O5R A;  2CQ9 A;  4AJ8 A;  3M8N A;  3D21 A;  4K8M A;  2YZH A;  3O6T A;  4GQF A;  1JZD A;  4FYU A;  2N5F A;  3U6V A;  2CAI A;  4FYB A;  1V57 A;  2GZZ A;  2PMT A;  2E2G A;  1TDI A;  5CO3 A;  3ERG A;  1Z6N A;  1G7O A;  1PN9 A;  1Z7R A;  1TRS A;  2XBQ A;  4JR6 A;  2IPA A;  3IR4 A;  1ACV A;  1O73 A;  2PU9 C;  2H0G A;  1GSF A;  5JCG A;  3TOU A;  3ME8 A;  4TR0 A;  5J5N A;  4IVF A;  1TW9 A;  2IMF A;  3F9U A;  2MMA A;  2VO4 A;  3F63 A;  4LMV A;  1TOF A;  1G7E A;  1Z5Y E;  3HJP A;  3M3M A;  4HU9 A;  4GRF A;  3MDK A;  1ERU A;  2FCH A;  3HA9 A;  2EIR A;  2FWH A;  4KUN A;  4F0B A;  1BG5 A;  5JWQ B;  5C00 A;  2LJA A;  5B6N A;  2VCV A;  3SBC A;  2C1Y A;  1T7P B;  4Q5F A;  1F2E A;  2MMN A;  1ZCP A;  3W8J A;  1A2M A;  1Z9H A;  1TTZ A;  2L6C A;  3UBL A;  2HLS A;  3US3 A;  1S3A A;  1U88 A;  4J2F A;  4N0V A;  2HFD A;  1R5A A;  1OC3 A;  1Q98 A;  4G10 A;  4NHZ A;  5G2Z A;  5IOX A;  2K6V A;  1THX A;  4V2L A;  2H66 A;  2H0H A;  4HQS A;  1WP0 A;  5HQP A;  5ECO B;  1ZOF A;  4L8E A;  2O89 A;  3VUR A;  1VF4 A;  5E4W A;  1XOB A;  1SEN A;  1ERT A;  3CRU A;  4IJI A;  4OMV A;  1XXU A;  5H5R A;  3I43 A;  1ZL9 A;  1VF3 A;  1SJI A;  5B6M A;  1IYI A;  1EEM A;  5CRW A;  3GKN A;  1KTE A;  4NPB A;  5A4W A;  2L6D A;  1SK1 A;  2NBS A;  5F8B A;  3H1N A;  3M0F A;  1JFU A;  3BCI A;  5IO0 A;  2R3X A;  4WBJ A;  3FR9 A;  4POB A;  2AHE A;  2XC2 A;  2H8L A;  2B5Y A;  3GMF A;  5D9V A;  3I9V 2;  4MH2 A;  2PER A;  5DAK A;  2PBJ A;  4ECB A;  2F3M A;  1OKT A;  2V6K A;  2H6Z A;  2QGV A;  2FA8 A;  3HVV A;  3UAP A;  3TKP A;  5A4U A;  2JAD A;  2GSS A;  2RII A;  1ERV A;  1EV9 A;  4BA7 A;  5IQY A;  2H1G A;  1BX9 A;  3VK9 A;  1M2D A;  4F2I A;  3D4T A;  2K8S A;  1CQG A;  3IK7 A;  2CX4 A;  5G30 A;  1ABA A;  3WYW A;  2IWT A;  2VLV A;  4YQM A;  3H93 A;  3BBY A;  2XPE A;  3FYG A;  3MNG A;  2A4V A;  3UAR A;  3GRX A;  2MMO A;  5DAK B;  2GQL A;  4IKH A;  2B6M A;  3MWH A;  4L0W A;  2PWJ A;  2I81 A;  4WXT A;  3D4M A;  2VCZ A;  3FHK A;  1NSW A;  3ZYW A;  2YPM A;  3CSH A;  5ECP B;  4OCE A;  5CP1 A;  4OFT A;  3LGC A;  3DVW A;  4K6X A;  1SKW B;  1M2B A;  3KJY A;  3FZ5 A;  1TI3 A;  2OBK A;  2AB6 A;  1PMT A;  3VWX A;  4GLT A;  3P2A A;  2RUE A;  4QL9 A;  3DIE A;  4K9Z A;  2BJX A;  4FH8 A;  4PUR A;  5G1K A;  4F82 A;  3C8E A;  1PKZ A;  1SK2 A;  2PGT A;  4MZC A;  1GUL A;  4V1A g;  3IOS A;  3VWW A;  3JCM L;  3DYR A;  2H6X A;  3KH7 A;  3A2X A;  5ECL B;  4JZQ A;  3RDW A;  3IXR A;  3KZQ A;  4O92 A;  6GSS A;  5LNK e;  2WFC A;  4DSQ A;  2KHP A;  1SYR A;  1X5D A;  3PH9 A;  4XS6 A;  4HJ2 A;  3KTB A;  1YF1 A;  1FVJ A;  1A2J A;  4WBR D;  1O8X A;  2C3N A;  2OKA A;  4WR5 A;  4ZXG A;  3BOA A;  5AGY A;  2X8G A;  4LL1 B;  5L71 A;  2LST A;  2VUP A;  1BED A;  4D73 B;  1O7U A;  3HJO A;  1GUM A;  4PQ1 A;  5IMV A;  4O7H A;  1RK4 A;  2V6O A;  4TXO B;  3UBK A;  3LG6 A;  4KDU A;  2CAQ A;  3F0I A;  1GUK A;  2VL3 A;  2J23 A;  2IMI A;  3IE3 A;  5B8B A;  2LRT A;  5B8A A;  2B5X A;  2CA8 A;  4GSN A;  5IMC A;  4MMM A;  1NHO A;  4J57 E;  4K2D A;  19GS A;  2B3S A;  5EL8 A;  5D9W A;  1OVN A;  4MCU A;  2M46 A;  2R6K A;  5A4V A;  4K7N A;  2I3Y A;  4I6X A;  1GTI A;  1B9X C;  2C3T A;  2NTO A;  17GS A;  1Z3E A;  5FWG A;  1A0F A;  1DE2 A;  4YQU A;  3KP8 A;  3F6D A;  3EWL A;  1UVZ A;  3GL5 A;  4LA1 A;  6GST A;  3N5O A;  2HRN A;  2JL4 A;  1USB A;  4V2N A;  3TJB A;  1AQX A;  2KP1 A;  4I2T A;  5DCG A;  1K0M A;  3G7J A;  3ZRE A;  5IOW A;  5G31 A;  3N9J A;  2I4A A;  1T00 A;  5DJM A;  4IQ1 A;  4ZL9 A;  2ZCT A;  5KN1 A;  1B8X A;  1K0N A;  1T1V A;  4BWQ A;  4DSS A;  2VD1 A;  1SKR B;  4BWS A;  5IPH A;  3VLN A;  4EDY A;  3EVI A;  2YV7 A;  1G6W A;  3GUR A;  1TJD A;  2YWI A;  1GP1 A;  2L59 A;  2VL2 C;  4TVE A;  4EUY A;  4ECI A;  6GSY A;  4MAB A;  3WGD A;  1EV4 A;  1U3A A;  1PQN A;  4IHU A;  4HU7 A;  5GST A;  5J4U A;  5HFG A;  2O87 A;  1HD2 A;  3EC3 A;  1T4Y A;  4Q5N A;  3TJG A;  6GSX A;  3CSJ A;  2TRX A;  5ELA A;  3TKS E;  3UL3 A;  4EDZ A;  1NW2 A;  2H73 A;  2TIR A;  4MZW A;  1BYE A;  2F9S A;  2C4J A;  2H75 A;  1HNC A;  1GSS A;  5EPF A;  2I9H A;  3FZ9 A;  3ZVJ D;  3GN3 A;  3C73 A;  4OO4 A;  1X5C A;  1SL1 B;  2JAC A;  1GNE A;  3WT2 A;  5IMZ A;  1X9S B;  4KB3 A;  4ZL8 A;  3HY2 A;  4K1F A;  4E8E A;  2R5G A;  5LCZ A;  2P0G A;  4F9Z A;  2DJ0 A;  4MP4 A;  1XFL A;  1GL8 A;  3LXZ A;  3EU4 A;  3NIV A;  3NOF A;  2GDR A;  5DQS A;  3TJK A;  4N10 A;  1EGO A;  4EO3 A;  2M72 A;  3RAZ A;  3CTF A;  5GSS A;  3MAK A;  2AV4 A;  1M7T A;  5ECR B;  2FD3 A;  4TR1 A;  2Z9S A;  3APQ A;  3UMA A;  5CRG A;  4MJA A;  4MK3 A;  2HSY A;  3GH9 A;  2V2G A;  5DCH A;  2GS3 A;  4GF0 A;  3IV4 A;  4JBB A;  1A8Y A;  3HZ4 A;  4XIH A;  1X0R A;  1JZW A;  4G2E A;  1HNA A;  4MPF A;  3QPM A;  1AAZ A;  3Q74 A;  4E8H A;  1XVW A;  2VIM A;  3R2Q A;  3GSS A;  3EE2 A;  4KAE A;  1V40 A;  1YQ1 A;  1K0D A;  3GNJ A;  4IEL A;  3ZIT A;  1M2A A;  1PA3 A;  2H74 A;  1TRW A;  2V41 A;  1QQ2 A;  1SJZ A;  1WWJ A;  4TR1 B;  2LKU A;  2L5L A;  3GIX A;  2LV3 A;  5AN1 A;  11GS A;  1PD2 1;  2WZ9 A;  1R4W A;  2GSR A;  4I97 A;  1XWK A;  3TGZ A;  4ZL7 A;  4NV2 A;  4WF5 A;  3TJJ A;  4GST A;  3EMX A;  4XS4 A;  5ECN B;  5ABR A;  1PX6 A;  2L5O A;  3LSZ A;  2KUC A;  4IS0 A;  2IMD A;  4GXZ A;  4TR4 A;  2IL3 A;  5CAX A;  2PN8 A;  1SYX A;  3QMX A;  5COH A;  2XBI A;  2HNL A;  4MLY A;  5ECH B;  1EOH A;  3RHB A;  4K7O A;  1QMV A;  2DJK A;  1M99 A;  1JZO A;  1S3D A;  2YZU A;  3HDC A;  3DRN A;  5AIX A;  1OC9 A;  4EC0 A;  2N5A A;  1UN2 A;  2GQK A;  1GRX A;  3D5J A;  3I69 A;  4LL4 B;  3J7Y b;  4GWR A;  5ECI B;  2HXK A;  4XS4 B;  4PNF A;  4IW9 A;  4YH2 A;  2VCW A;  2B7K A;  3ERW A;  1TK8 B;  4Q5R A;  2A2S A;  2E2M A;  4MDC A;  3WGE A;  2XHF A;  3F4T A;  5EVO A;  1TK5 B;  3L4N A;  1T4Z A;  3DVX A;  4PXO A;  3EIN A;  3D0Z A;  3C1R A;  1OC9 B;  3KM6 A;  4DEJ A;  2YOI A;  4ECC A;  16GS A;  4L5O A;  3TRX A;  2HYX A;  2GST A;  1ML6 A;  4J56 E;  1XWA A;  2QC7 A;  2VCX A;  4HZ4 A;  1PL2 A;  1KNG A;  1GH2 A;  3TOT A;  1GTU A;  2LTK A;  2CZ2 A;  5G5F A;  4KGI A;  1Y6E A;  5HR3 A;  2I1U A;  3VWV A;  2DC5 A;  3F6F A;  3GYK A;  5J9C A;  4HI7 A;  3Q19 A;  4JE1 A;  4ML1 A;  3EUR A;  5HR2 A;  3AY8 A;  7GSS A;  2C0F A;  2G2Q A;  3WD6 A;  1K0B A;  4KE3 A;  4KSO A;  1XWB A;  4TW5 A;  3E0U A;  3LOR A;  3HVX A;  3PIN A;  3HZ8 A;  3M1G A;  4AJ6 A;  3FRC A;  5A5K A;  1EP8 A;  4YAV A;  4NHW A;  1SD9 A;  3M9K A;  3LYP A;  2CV4 A;  4BVX A;  2EIQ A;  6GSW A;  1JLW A;  1XBS A;  4X43 A;  1SL0 B;  2CVD A;  3LFL A;  4GQC A;  4KDY A;  3ME7 A;  3FKF A;  1U87 A;  2C8U A;  3HXS A;  5CNW A;  3UVH A;  1YY7 A;  2WB9 A;  2YV9 A;  5KEJ A;  1WOU A;  3W6G A;  1E6B A;  4KA0 A;  3PGT A;  1SL2 B;  1ERW A;  3M9J A;  4WKW A;  5HFI A;  4ZB9 A;  2DBC A;  1K3Y A;  2HRF A;  4WR4 A;  1Y25 A;  1YEP A;  3IC4 A;  3ED3 A;  4KND A;  5JCU A;  4Z7X A;  1A23 A;  4FO5 A;  2AAW A;  1YZX A;  2IFQ A;  4ZBD A;  3TKS A;  1F9M A;  4OFN A;  5ECK B;  3C7M A;  2RM6 A;  5IM9 A;  4D73 A;  3O3T A;  3MSZ A;  2OA7 A;  4F03 A;  2GVP A;  2GT5 A;  2V1M A;  2KP2 A;  1EWX A;  4TXO A;  3H4K A;  3D22 A;  1GSE A;  2LRC A;  2OE1 A;  1J08 A;  4AJ7 A;  2WCI A;  1S3C A;  5D73 A;  5FHI A;  4H86 A;  1FO5 A;  5KN0 A;  1K0O A;  1TI1 A;  1YJ6 A;  2LNT A;  1PSQ A;  1FB0 A;  4EE0 A;  1YEX A;  3HCZ A;  4PQH A;  3RPN A;  5F0G A;  4N0Z A;  4JED A;  1RQM A;  1U6T A;  2IFQ B;  4OFM A;  2FNO A;  2VL9 A;  3VWU A;  2FY6 A;  2DJ3 A;  1TU7 A;  1GLQ A;  1T8E B;  1XWG A;  3IAM 2;  4CW9 A;  3ERF A;  1X9M B;  1MDI A;  12GS A;  3K8N A;  5G1L A;  2CT6 A;  3RPP A;  1MTC A;  2DIY A;  1N8J A;  4HQZ A;  4F0C A;  2GSQ A;  2V32 A;  1EZK A;  4TKY A;  3D6I A;  1KEB A;  1SJ6 A;  3CYN A;  2GTU A;  2LQQ A;  4DVC A;  4KSM A;  2HSH A;  3BCK A;  1F6M C;  1AW9 A;  3FEU A;  4WET A;  1G0T A;  4IN0 A;  4YAP A;  2X99 A;  4RI7 A;  1GSY A;  1LU4 A;  1PGT A;  1ST9 A;  1V98 A;  3IAS 2;  5EY6 A;  4L5L A;  2YNX A;  3HKR A;  1DBY A;  6GSV A;  1EEJ A;  3KXO A;  4ZIL A;  1UA5 A;  4MA9 A;  1XVQ A;  2X64 A;  1CQH A;  1GSD A;  2REM A;  5HR1 A;  2FWE A;  1LJR A;  2PPT A;  2LNS A;  1ZMA A;  2DMM A;  2H72 A;  2F51 A;  3L0H A;  1GSQ A;  1QXH A;  1ZGN A;  1ON4 A;  2LS5 A;  3LWA A;  3FR6 A;  3QAW A;  5GZZ B;  3A5W A;  5C04 A;  2CVK A;  1QK8 A;  1J0F A;  1K3L A;  4N30 A;  1B4Q A;  2VD0 A;  2L57 A;  3APS A;  2PVO C;  4DSR A;  4ZB6 A;  1FHE A;  3GKK A;  1SK0 A;  2CX3 A;  3TKQ A;  4KW6 A;  1DE1 A;  3GTU B;  3TKR A;  3ZMK A;  2X8C A;  2K8V A;  3GST A;  1GTB A;  3QAV A;  1FAA A;  3GKM A;  1X9W B;  1ZYQ B;  2YAN A;  3E9J B;  3CXG A;  3U5R E;  2N5B A;  3TJF A;  4MPG A;  1XZO A;  5KN2 A;  2HI7 A;  2R2J A;  2LUS A;  1PKW A;  1XCC A;  1ILO A;  18GS A;  1KBN A;  1XIY A;  3FW2 A;  4KCE A;  1OE7 A;  3H79 A;  3IBH A;  2FWF A;  5ID2 B;  1WRY A;  3HD5 A;  2DSA A;  3KCM A;  4RUV A;  4OWY A;  2PVQ A;  3C1S A;  2HE3 A;  2H0I A;  1V9W A;  4WEY A;  1VF2 A;  2QSI A;  5CYY A;  2E7P A;  5GAN D;  1SKS B;  5E59 A;  3LQ7 A;  3LYK A;  2VOC A;  3EYT A;  2OE0 A;  1SD8 A;  2YN1 A;  4NWY A;  2BTO T;  2GZP A;  3TCO A;  4MZB A;  2F8A A;  4ACS A;  4I5Q A;  2O7K A;  4HJM A;  3UOM A;  1E2Y A;  4EXJ A;  2OAC A;  4CDO A;  4TXV A;  3CRT A;  5D93 A;  1XW5 A;  5J3R A;  4K0G A;  2VM2 A;  4QQ7 A;  1GWC A;  1JHB A;  4CHS A;  3ZIV A;  3S9F A;  1R5P A;  1GSU A;  2C0G A;  3J7Y k;  5F06 A;  1JZR A;  1SU9 A;  5H5Q A;  2C0D A; 
#chains in the Genus database with same CATH topology
 3A3T A;  4XRA A;  2LEG A;  3FZ4 A;  3QFA C;  4L0U A;  3ZRD A;  2YWM A;  2P31 A;  2DJJ A;  3F3Q A;  2ZUP A;  1OYJ A;  5D8I A;  4V2M A;  4IP1 A;  3P8W A;  2FUG 2;  4N11 A;  1GLP A;  1A2L A;  2KOK A;  4X1U A;  2FWG A;  1VRS D;  2R4V A;  3DD3 A;  5H5S A;  1AC1 A;  4EVM A;  5DQY A;  4KX4 A;  1NM3 A;  3IK9 A;  2IJY A;  1FOH A;  3KH9 A;  4PTS A;  4YQV A;  2H70 A;  2HSM A;  2FGX A;  1TXX A;  3GX8 A;  2VM1 A;  1MDK A;  2OE3 A;  3HJM A;  3W8S A;  4BPY A;  4OO5 A;  1LBK A;  2GZY A;  2C0E A;  1VF1 A;  5IIZ A;  4BVY A;  1I5G A;  4HS1 A;  1QGV A;  2WJU A;  3GA4 A;  1W89 A;  1WE0 A;  1YDK A;  2OJL A;  2DLX A;  3P7X A;  3H8Q A;  2RM5 A;  2YCD A;  9GSS A;  2VCQ A;  3IA1 A;  2HZE A;  3IC8 A;  1N2A A;  3BJ5 A;  4ILF A;  3IDV A;  2GT6 A;  2YWN A;  13GS A;  2H1A A;  4XTS A;  1FW1 A;  3TRQ A;  4XCS A;  1ZYE A;  1NHY A;  1YKA A;  1XPV A;  2DJ2 A;  1PRX A;  2AYT A;  4TN8 A;  2HZF A;  3TUE A;  2C3Q A;  3CSI A;  3F8U A;  4X0X A;  5J41 A;  4AGS A;  4HOJ A;  4QL7 A;  5INY A;  3DML A;  4NAX A;  4V1A p;  5D9X A;  2L4C A;  1QUW A;  4BVY B;  5G5E A;  1HNB A;  1HQO A;  3L9U A;  1F3B A;  5BRT A;  4G9H A;  3P90 A;  2B1K A;  4OCF A;  1YF0 A;  3QDN A;  1J9B A;  3TDG A;  2MBS A;  5DVB A;  2WS2 A;  3TB2 A;  2HZE B;  2CZ3 A;  4ID0 A;  3FR3 A;  4TOP A;  5LD0 A;  3APO A;  1TK0 B;  3PPU A;  4I2U A;  3ZVJ A;  3KMO A;  1AQV A;  5CRD A;  3UJ1 A;  4PNG A;  4KCA A;  2HRK A;  3CQF A;  4MF6 A;  5FT3 A;  1BQ7 A;  3GL3 A;  4JRR A;  3ZML A;  4HUA A;  2B1L A;  2F8F A;  5HFK A;  1Q4J A;  1V58 A;  5JCW A;  3TRP A;  3ZFL A;  1OAZ A;  2DML A;  4RQR A;  3FY7 A;  5DBQ A;  14GS A;  1ZZY A;  1XWC A;  3DWV A;  2MMZ A;  2H1D A;  1FOV A;  2QKE A;  5JWO B;  2H76 A;  2X49 A;  2IME A;  3VPQ A;  2VCT A;  4GSS A;  1AXD A;  1A8L A;  4OD7 A;  4TR3 A;  3OR5 A;  1K3O A;  3EPT A;  2R0P A;  4IGJ A;  3WT1 A;  2YWO A;  4IP6 A;  3EMP A;  1I9D A;  4IBP A;  1F37 A;  3ISO A;  1WMJ A;  1WJK A;  2ON5 A;  3HHV A;  2R37 A;  2LRN A;  5DDL A;  2EC4 A;  4IQA A;  4XRD A;  3LJR A;  1RW1 A;  1GUH A;  2OBI A;  2P5Q A;  1C72 A;  4Z2T A;  3QOU A;  2RUF A;  4POL A;  1OE8 A;  6GSU A;  3CBU A;  1V2A A;  5ECS A;  3QFB C;  5ECQ B;  1H75 A;  1O8W A;  2NPB A;  1U3I A;  5F05 A;  3ZTL A;  4LLR A;  5KOX A;  3BD2 A;  2K9F A;  2C80 A;  3KP9 A;  1B9Y C;  3V1W A;  1TRV A;  5D9T A;  1K0A A;  3VI5 A;  3MYD A;  4MF5 A;  4ISD A;  1DUG A;  5D96 A;  3GHA A;  2FHE A;  2ES7 A;  4HDE A;  3QR6 A;  2BMX A;  3G7I A;  2H01 A;  1YKC A;  2MBT A;  3NZN A;  3SWL A;  1PX7 A;  2JZS A;  2IIY A;  1TRU A;  2DJ1 A;  1B48 A;  2M80 A;  3KTL A;  4G19 A;  2H71 A;  1H4O A;  2RLI A;  4K0N A;  3QCP A;  2MZC A;  1WIK A;  2GQM A;  3ZZX A;  2WUL A;  1O85 A;  2NVL A;  1AQW A;  4K7I A;  2JSY A;  4RQX A;  1MD3 A;  2IMK A;  1TU8 A;  4PUA A;  2JZR A;  3G9B A;  4POK A;  2JU5 A;  2YP6 A;  3VPT A;  1A0R P;  2LJR A;  1DSB A;  3UEM A;  2ALB A;  4IJ3 A;  4RI6 A;  3F3R A;  5F07 A;  2L4Q A;  1TKD B;  1M9A A;  1M0U A;  4NMU A;  5GAP D;  4P3Y B;  3PR8 A;  3HVS A;  2FA4 A;  4MJB A;  5ENU A;  4ZBB A;  2A2R A;  1O81 A;  3IRA A;  1QFN A;  4KDX A;  1M9B A;  3GKX A;  20GS A;  2ZNM A;  4EL1 A;  2B7J A;  2DIZ A;  2NDO A;  5ELG A;  2E0Q A;  5J9B A;  1BJX A;  3KGK A;  3IHQ A;  2H1B A;  4MJC A;  4ULX A;  1EGR A;  4POM A;  1Z6M A;  1OKD A;  4ML6 A;  4WF4 A;  2VLU A;  3VI7 A;  1AUC A;  3A2V A;  3KD0 A;  4PGT A;  5DAL A;  5CRH A;  5AIS A;  2GLR A;  1A24 A;  3G7Y A;  1HYU A;  4MF7 A;  2O8V B;  2D2Z A;  2HT9 A;  3TKS C;  1UC7 A;  3EU3 A;  5IMA A;  3GV1 A;  1JLV A;  2VL2 A;  3RHC A;  3DGQ A;  3Q6O A;  2G0F A;  3DKS A;  8GSS A;  2O85 A;  3QAG A;  4HZ2 A;  1O6J A;  4Q5Q A;  1GNW A;  4JU5 A;  4MJE A;  4O32 A;  3DEX A;  2IN3 A;  3RBT A;  3A2W A;  3GTU A;  3GH6 A;  3VFI A;  2ON7 A;  2H19 A;  4TRX A;  1PL1 A;  2H30 A;  2OAD A;  3L78 A;  3C71 A;  1OC8 A;  3A5I A;  2VAF A;  3GUS A;  1URM A;  1G6Y A;  5DAL B;  1THO A;  1R7H A;  22GS A;  1K0C A;  4FIW A;  4HEA 2;  1EOG A;  1XOA A;  2MYG A;  2WDU A;  3HYP A;  3CMI A;  5ID2 A;  2P5R A;  3Q18 A;  1AIU A;  4GCI A;  4ZB8 A;  5IMD A;  5B7C A;  4GTU A;  3GFK A;  2K18 A;  2B5E A;  5IPG A;  1XW6 A;  1FVK A;  3WGX A;  3ZFB A;  1B4P A;  2JSZ A;  3CTG A;  5CRE A;  1XW9 A;  2XPD A;  4ECJ A;  5ECM B;  4JR4 A;  5HR0 A;  3FZA A;  3FK8 A;  2EIO A;  4AF2 A;  4EF0 A;  2AJQ B;  1MD4 A;  3L9S A;  1MEK A;  1F3A A;  1IYH A;  4KH7 A;  4BL7 A;  5AIV A;  2FLS A;  3E3E A;  2X8H A;  1W4V A;  4XHM A;  3UIW A;  2VLT A;  3ZLP A;  2H6Y A;  3KEB A;  5DJL A;  3F4R A;  1BAY A;  2J9H A;  3LEF A;  1T3B A;  1WPI A;  5IMF A;  3ZL5 A;  4MH3 A;  4PX1 A;  4DSS B;  3F4S A;  3ZIJ A;  1GTA A;  3GX0 A;  4I8B A;  1TP9 A;  2TRC P;  2PUK C;  2KLX A;  2WRT A;  1FB6 A;  4XS1 A;  3L9V A;  3LXT A;  3O76 A;  4EKZ A;  4ZIJ A;  2JZT A;  1X5E A;  1VGL A;  2LJK A;  2A4H A;  2A2P A;  4NXI A;  4KF9 A;  2LQO A;  2GGT A;  1Z7P A;  5JWR B;  3KMN A;  4LMW A;  4ZBA A;  2YJ7 A;  3QD9 A;  2YJH A;  2UZ8 A;  3DXB A;  4FYC A;  10GS A;  1EP7 A;  1R26 A;  2CVB A;  1FG4 A;  2WGR A;  3UVT A;  4PQI A;  3I6A A;  5IO2 A;  3KIJ A;  4PUF C;  2AUV A;  5KN3 A;  4NV5 A;  1MDJ A;  3IPZ A;  4O5R A;  2CQ9 A;  4AJ8 A;  3M8N A;  3D21 A;  4K8M A;  2YZH A;  3O6T A;  4GQF A;  1JZD A;  4FYU A;  2N5F A;  3U6V A;  2CAI A;  4FYB A;  1V57 A;  2GZZ A;  2PMT A;  2E2G A;  1TDI A;  5CO3 A;  3ERG A;  1Z6N A;  1G7O A;  1PN9 A;  1Z7R A;  1TRS A;  2XBQ A;  4JR6 A;  2IPA A;  3IR4 A;  1ACV A;  1O73 A;  2PU9 C;  2H0G A;  1GSF A;  5JCG A;  3TOU A;  3ME8 A;  4TR0 A;  5J5N A;  4IVF A;  1TW9 A;  2IMF A;  3F9U A;  2MMA A;  2VO4 A;  3F63 A;  4LMV A;  1TOF A;  1G7E A;  1Z5Y E;  3HJP A;  3M3M A;  4HU9 A;  4GRF A;  3MDK A;  1ERU A;  2FCH A;  4EIP A;  3HA9 A;  2EIR A;  2FWH A;  4KUN A;  4F0B A;  1BG5 A;  5JWQ B;  5C00 A;  2LJA A;  5B6N A;  2VCV A;  3SBC A;  2C1Y A;  1T7P B;  4Q5F A;  1F2E A;  2MMN A;  1ZCP A;  3W8J A;  1A2M A;  1Z9H A;  1TTZ A;  2L6C A;  3UBL A;  2HLS A;  3US3 A;  1S3A A;  1U88 A;  4J2F A;  4N0V A;  2HFD A;  1R5A A;  1OC3 A;  1Q98 A;  4G10 A;  4NHZ A;  5G2Z A;  5IOX A;  2K6V A;  3R3E A;  1THX A;  4V2L A;  2H66 A;  4HSC X;  2H0H A;  5KOW A;  4HQS A;  1WP0 A;  5HQP A;  5ECO B;  1ZOF A;  4L8E A;  4Z2R A;  2O89 A;  3VUR A;  1VF4 A;  5E4W A;  1XOB A;  1SEN A;  1ERT A;  3CRU A;  4IJI A;  4OMV A;  1XXU A;  5H5R A;  3I43 A;  1ZL9 A;  1VF3 A;  1SJI A;  5B6M A;  1IYI A;  1EEM A;  5CRW A;  3GKN A;  1KTE A;  4NPB A;  5A4W A;  2L6D A;  1SK1 A;  2NBS A;  5F8B A;  3H1N A;  3M0F A;  1JFU A;  3BCI A;  5IO0 A;  2R3X A;  4WBJ A;  3FR9 A;  4POB A;  2AHE A;  2XC2 A;  2H8L A;  2B5Y A;  3GMF A;  5D9V A;  3I9V 2;  4MH2 A;  2QA1 A;  2PER A;  5DAK A;  2PBJ A;  4ECB A;  2F3M A;  4MNN A;  1OKT A;  2V6K A;  2H6Z A;  2QGV A;  2FA8 A;  3HVV A;  3UAP A;  3TKP A;  5A4U A;  2JAD A;  2GSS A;  2RII A;  1ERV A;  1EV9 A;  4BA7 A;  5IQY A;  2H1G A;  1BX9 A;  3VK9 A;  1PFO A;  1M2D A;  4F2I A;  3D4T A;  2K8S A;  1CQG A;  3IK7 A;  2CX4 A;  5G30 A;  1ABA A;  3WYW A;  2IWT A;  2VLV A;  4YQM A;  3H93 A;  3BBY A;  2XPE A;  3FYG A;  3MNG A;  2A4V A;  3UAR A;  3GRX A;  2MMO A;  5DAK B;  2GQL A;  4IKH A;  2B6M A;  3MWH A;  4L0W A;  2PWJ A;  2I81 A;  4WXT A;  3D4M A;  2VCZ A;  3FHK A;  1NSW A;  3ZYW A;  2YPM A;  3CSH A;  1PN0 A;  5ECP B;  4OCE A;  5CP1 A;  4OFT A;  3LGC A;  3DVW A;  4K6X A;  1SKW B;  1M2B A;  3KJY A;  3FZ5 A;  1TI3 A;  4FQU A;  2OBK A;  2AB6 A;  1PMT A;  3VWX A;  4GLT A;  3P2A A;  4USS A;  4CY8 A;  2RUE A;  4QL9 A;  3DIE A;  4K9Z A;  2BJX A;  4FH8 A;  4PUR A;  5G1K A;  4F82 A;  3C8E A;  1PKZ A;  1SK2 A;  2PGT A;  4MZC A;  1GUL A;  4V1A g;  3IOS A;  3VWW A;  3JCM L;  3DYR A;  2H6X A;  3KH7 A;  3A2X A;  5ECL B;  4JZQ A;  3RDW A;  3IXR A;  3KZQ A;  4O92 A;  6GSS A;  5LNK e;  2WFC A;  4DSQ A;  2KHP A;  1SYR A;  1X5D A;  3PH9 A;  4XS6 A;  4HJ2 A;  3KTB A;  1YF1 A;  1FVJ A;  1A2J A;  4WBR D;  1O8X A;  2C3N A;  2OKA A;  4WR5 A;  4ZXG A;  3BOA A;  5AGY A;  2X8G A;  4LL1 B;  5L71 A;  2LST A;  2VUP A;  1BED A;  4D73 B;  1O7U A;  3HJO A;  1GUM A;  4PQ1 A;  5IMV A;  4O7H A;  1RK4 A;  2V6O A;  4TXO B;  3UBK A;  3LG6 A;  4KDU A;  2CAQ A;  3F0I A;  1GUK A;  2VL3 A;  2J23 A;  2IMI A;  3IE3 A;  5B8B A;  4BIK A;  2LRT A;  5B8A A;  2B5X A;  2CA8 A;  4GSN A;  5IMC A;  4MMM A;  1NHO A;  4J57 E;  4K2D A;  19GS A;  2B3S A;  5EL8 A;  5D9W A;  1OVN A;  4MCU A;  2M46 A;  2R6K A;  5A4V A;  4K7N A;  2I3Y A;  4I6X A;  1GTI A;  1B9X C;  2C3T A;  2NTO A;  17GS A;  1Z3E A;  5FWG A;  1A0F A;  1DE2 A;  4YQU A;  3KP8 A;  3F6D A;  3EWL A;  1UVZ A;  3GL5 A;  4LA1 A;  6GST A;  3N5O A;  2HRN A;  2JL4 A;  1USB A;  4K5R A;  4V2N A;  3TJB A;  4YKF A;  1AQX A;  2KP1 A;  4I2T A;  5DCG A;  1K0M A;  3G7J A;  3ZRE A;  5IOW A;  5G31 A;  3N9J A;  2I4A A;  1T00 A;  5DJM A;  4IQ1 A;  4ZL9 A;  2ZCT A;  5KN1 A;  1B8X A;  1K0N A;  1T1V A;  4G0I A;  4BWQ A;  4DSS A;  2VD1 A;  1SKR B;  4BWS A;  5IPH A;  3VLN A;  4EDY A;  3EVI A;  2YV7 A;  4EIQ A;  1G6W A;  3GUR A;  1TJD A;  1S3R A;  2YWI A;  1ZYP A;  1GP1 A;  2L59 A;  2VL2 C;  4TVE A;  4EUY A;  4ECI A;  6GSY A;  2R0C A;  4MAB A;  3WGD A;  1EV4 A;  1U3A A;  1PQN A;  4IHU A;  4HU7 A;  5GST A;  5J4U A;  5HFG A;  2O87 A;  1HD2 A;  3EC3 A;  1T4Y A;  4Q5N A;  3TJG A;  6GSX A;  3CSJ A;  1M3I A;  2TRX A;  5ELA A;  3TKS E;  3UL3 A;  4EDZ A;  1NW2 A;  2H73 A;  2TIR A;  4MZW A;  1BYE A;  2F9S A;  2C4J A;  2H75 A;  1HNC A;  1GSS A;  5EPF A;  2I9H A;  3FZ9 A;  3ZVJ D;  3GN3 A;  3C73 A;  4OO4 A;  1X5C A;  1SL1 B;  2JAC A;  2DKH A;  1GNE A;  3WT2 A;  5IMZ A;  1X9S B;  4KB3 A;  4ZL8 A;  3HY2 A;  4K1F A;  4E8E A;  2R5G A;  5LCZ A;  2P0G A;  4F9Z A;  4X4J A;  2DJ0 A;  4MP4 A;  1XFL A;  1ZYN A;  1GL8 A;  3LXZ A;  3EU4 A;  3NIV A;  3NOF A;  2GDR A;  5DQS A;  3TJK A;  4N10 A;  1EGO A;  4EO3 A;  2M72 A;  3RAZ A;  3CTF A;  5GSS A;  3MAK A;  2AV4 A;  1M7T A;  5ECR B;  2FD3 A;  4TR1 A;  2Z9S A;  3APQ A;  3UMA A;  5CRG A;  2QA2 A;  4MJA A;  4MK3 A;  2HSY A;  3GH9 A;  2V2G A;  5DCH A;  2GS3 A;  4GF0 A;  3IV4 A;  4JBB A;  1A8Y A;  3HZ4 A;  4XIH A;  1X0R A;  1JZW A;  4G2E A;  1HNA A;  4MPF A;  3QPM A;  1AAZ A;  3Q74 A;  4E8H A;  1XVW A;  2VIM A;  3R2Q A;  3GSS A;  3EE2 A;  4KAE A;  1V40 A;  1YQ1 A;  1K0D A;  3GNJ A;  4IEL A;  1XG8 A;  3ZIT A;  4O5Q A;  1M2A A;  1PA3 A;  2H74 A;  1TRW A;  2V41 A;  1QQ2 A;  1SJZ A;  1WWJ A;  4TR1 B;  2LKU A;  2L5L A;  3GIX A;  2LV3 A;  5AN1 A;  11GS A;  1PD2 1;  2WZ9 A;  1R4W A;  2GSR A;  4I97 A;  1XWK A;  3TGZ A;  4ZL7 A;  4NV2 A;  4WF5 A;  3TJJ A;  4GST A;  3EMX A;  4XS4 A;  5ECN B;  5ABR A;  1PX6 A;  2L5O A;  3LSZ A;  2KUC A;  4IS0 A;  2IMD A;  4GXZ A;  4TR4 A;  2IL3 A;  5CAX A;  2PN8 A;  1SYX A;  3QMX A;  5COH A;  2XBI A;  2HNL A;  4MLY A;  5ECH B;  1EOH A;  3RHB A;  4K7O A;  1QMV A;  2DJK A;  1M99 A;  1JZO A;  1S3D A;  2YZU A;  3HDC A;  3DRN A;  5AIX A;  1OC9 A;  4EC0 A;  2N5A A;  1UN2 A;  2GQK A;  1GRX A;  3D5J A;  3I69 A;  4LL4 B;  3J7Y b;  4GWR A;  5ECI B;  2HXK A;  4XS4 B;  4PNF A;  4IW9 A;  4YH2 A;  2VCW A;  2B7K A;  3ERW A;  1TK8 B;  4Q5R A;  2A2S A;  2E2M A;  4MDC A;  3WGE A;  2XHF A;  3F4T A;  5EVO A;  1TK5 B;  3L4N A;  1T4Z A;  3DVX A;  4PXO A;  3EIN A;  3D0Z A;  3C1R A;  1OC9 B;  3KM6 A;  4DEJ A;  2YOI A;  4ECC A;  16GS A;  4L5O A;  3TRX A;  2HYX A;  2GST A;  1ML6 A;  4J56 E;  1XWA A;  2QC7 A;  2VCX A;  4HZ4 A;  1PL2 A;  1KNG A;  1GH2 A;  3TOT A;  1GTU A;  2LTK A;  2CZ2 A;  4Z2U A;  5G5F A;  4KGI A;  1Y6E A;  5HR3 A;  2I1U A;  3VWV A;  2DC5 A;  3F6F A;  3GYK A;  5J9C A;  3FMW A;  4HI7 A;  3Q19 A;  4JE1 A;  4ML1 A;  3EUR A;  5HR2 A;  3AY8 A;  7GSS A;  2C0F A;  2G2Q A;  3WD6 A;  1K0B A;  4KE3 A;  4KSO A;  1XWB A;  4TW5 A;  3E0U A;  3LOR A;  3HVX A;  3PIN A;  3HZ8 A;  3M1G A;  4AJ6 A;  3FRC A;  5A5K A;  1EP8 A;  4YAV A;  4NHW A;  1SD9 A;  3M9K A;  3LYP A;  2CV4 A;  4BVX A;  2EIQ A;  6GSW A;  1JLW A;  1XBS A;  4X43 A;  1SL0 B;  2CVD A;  4K5S A;  4O5U A;  3LFL A;  4GQC A;  4KDY A;  3ME7 A;  3FKF A;  1U87 A;  4G0L A;  2C8U A;  3HXS A;  5CNW A;  3UVH A;  1YY7 A;  2WB9 A;  4CY6 A;  2R0G A;  2YV9 A;  5KEJ A;  1WOU A;  3W6G A;  1E6B A;  4KA0 A;  3PGT A;  1SL2 B;  1ERW A;  3M9J A;  4WKW A;  5HFI A;  4ZB9 A;  2DBC A;  1K3Y A;  2HRF A;  4WR4 A;  4BVX B;  1Y25 A;  1YEP A;  3IC4 A;  3ED3 A;  4KND A;  5JCU A;  4Z7X A;  1A23 A;  4FO5 A;  2AAW A;  1YZX A;  2IFQ A;  4ZBD A;  4YKG A;  3TKS A;  1F9M A;  4OFN A;  5ECK B;  3C7M A;  2RM6 A;  5IM9 A;  4D73 A;  3O3T A;  3MSZ A;  2OA7 A;  4F03 A;  2GVP A;  2GT5 A;  2V1M A;  2KP2 A;  1EWX A;  4TXO A;  3H4K A;  3D22 A;  1GSE A;  2LRC A;  2OE1 A;  1J08 A;  4AJ7 A;  2WCI A;  1S3C A;  5D73 A;  5FHI A;  2HRA A;  4H86 A;  1FO5 A;  5KN0 A;  1K0O A;  1TI1 A;  1YJ6 A;  2LNT A;  1PSQ A;  1FB0 A;  4EE0 A;  1YEX A;  3HCZ A;  4PQH A;  3RPN A;  5F0G A;  4N0Z A;  4JED A;  1RQM A;  1U6T A;  2IFQ B;  4OFM A;  2FNO A;  2VL9 A;  3VWU A;  2FY6 A;  2DJ3 A;  1TU7 A;  1GLQ A;  1T8E B;  1XWG A;  3IAM 2;  4CW9 A;  3ERF A;  1X9M B;  1MDI A;  12GS A;  3K8N A;  5G1L A;  2CT6 A;  3RPP A;  1MTC A;  2DIY A;  1N8J A;  4HQZ A;  4F0C A;  2GSQ A;  2V32 A;  1EZK A;  4TKY A;  3D6I A;  1KEB A;  1SJ6 A;  3CYN A;  2GTU A;  2LQQ A;  4DVC A;  4KSM A;  2HSH A;  3BCK A;  1F6M C;  1AW9 A;  3FEU A;  4WET A;  1G0T A;  4IN0 A;  4YAP A;  2X99 A;  4RI7 A;  1GSY A;  1LU4 A;  1PGT A;  1ST9 A;  1V98 A;  3IAS 2;  5EY6 A;  4L5L A;  2YNX A;  3HKR A;  1DBY A;  6GSV A;  1EEJ A;  3KXO A;  4ZIL A;  1UA5 A;  3MIX A;  4MA9 A;  1XVQ A;  2X64 A;  1CQH A;  1GSD A;  2REM A;  5HR1 A;  2FWE A;  1LJR A;  4K2X A;  3HVN A;  2PPT A;  2LNS A;  1ZMA A;  5BMU A;  2DMM A;  2H72 A;  2F51 A;  3L0H A;  1GSQ A;  1QXH A;  1ZGN A;  1ON4 A;  2LS5 A;  4A5P A;  3LWA A;  3FR6 A;  3QAW A;  5GZZ B;  3IHG A;  3A5W A;  5C04 A;  2CVK A;  1QK8 A;  1J0F A;  1K3L A;  4N30 A;  1B4Q A;  2VD0 A;  2L57 A;  3APS A;  2PVO C;  4DSR A;  4ZB6 A;  1FHE A;  2DKI A;  3GKK A;  1SK0 A;  2CX3 A;  3TKQ A;  4KW6 A;  1DE1 A;  3GTU B;  3TKR A;  3ZMK A;  2X8C A;  2K8V A;  3GST A;  1GTB A;  3QAV A;  1FAA A;  3GKM A;  1X9W B;  1ZYQ B;  2YAN A;  3E9J B;  3CXG A;  3U5R E;  2N5B A;  3TJF A;  4MPG A;  1XZO A;  5KN2 A;  2HI7 A;  2R2J A;  3LW9 A;  2LUS A;  1PKW A;  1XCC A;  1ILO A;  18GS A;  1KBN A;  1XIY A;  3FW2 A;  4KCE A;  1OE7 A;  3H79 A;  3IBH A;  2FWF A;  5ID2 B;  1WRY A;  3HD5 A;  2DSA A;  3KCM A;  4RUV A;  4OWY A;  2PVQ A;  3C1S A;  2HE3 A;  2H0I A;  1V9W A;  4WEY A;  1VF2 A;  2QSI A;  5CYY A;  2E7P A;  5GAN D;  1SKS B;  3LQ7 A;  5E59 A;  3LYK A;  2VOC A;  3EYT A;  2OE0 A;  1SD8 A;  2YN1 A;  4NWY A;  2BTO T;  2GZP A;  3TCO A;  4MZB A;  2F8A A;  4ACS A;  4I5Q A;  2O7K A;  4HJM A;  3UOM A;  1E2Y A;  1M3J A;  4EXJ A;  2OAC A;  4G0K A;  4CDO A;  4TXV A;  3CRT A;  5D93 A;  1XW5 A;  4BL7 B;  5J3R A;  4K0G A;  2VM2 A;  4ICY A;  4QQ7 A;  2X4A A;  1GWC A;  1JHB A;  4CHS A;  3ZIV A;  3S9F A;  1R5P A;  1GSU A;  2C0G A;  3J7Y k;  5F06 A;  1JZR A;  1SU9 A;  5H5Q A;  2C0D A; 
#chains in the Genus database with same CATH homology
 3A3T A;  4XRA A;  2LEG A;  3FZ4 A;  3QFA C;  4L0U A;  3ZRD A;  2YWM A;  2P31 A;  2DJJ A;  3F3Q A;  2ZUP A;  1OYJ A;  5D8I A;  4V2M A;  4IP1 A;  3P8W A;  2FUG 2;  4N11 A;  1GLP A;  1A2L A;  2KOK A;  4X1U A;  2FWG A;  1VRS D;  2R4V A;  3DD3 A;  5H5S A;  1AC1 A;  4EVM A;  5DQY A;  4KX4 A;  1NM3 A;  3IK9 A;  2IJY A;  1FOH A;  3KH9 A;  4PTS A;  4YQV A;  2H70 A;  2HSM A;  2FGX A;  1TXX A;  3GX8 A;  2VM1 A;  1MDK A;  2OE3 A;  3HJM A;  3W8S A;  4BPY A;  4OO5 A;  1LBK A;  2GZY A;  2C0E A;  1VF1 A;  5IIZ A;  4BVY A;  1I5G A;  4HS1 A;  1QGV A;  2WJU A;  3GA4 A;  1W89 A;  1WE0 A;  1YDK A;  2OJL A;  2DLX A;  3P7X A;  3H8Q A;  2RM5 A;  2YCD A;  9GSS A;  2VCQ A;  3IA1 A;  2HZE A;  3IC8 A;  1N2A A;  3BJ5 A;  4ILF A;  3IDV A;  2GT6 A;  2YWN A;  13GS A;  2H1A A;  4XTS A;  1FW1 A;  3TRQ A;  4XCS A;  1ZYE A;  1NHY A;  1YKA A;  1XPV A;  2DJ2 A;  1PRX A;  2AYT A;  4TN8 A;  2HZF A;  3TUE A;  2C3Q A;  3CSI A;  3F8U A;  4X0X A;  5J41 A;  4AGS A;  4HOJ A;  4QL7 A;  5INY A;  3DML A;  4NAX A;  4V1A p;  5D9X A;  2L4C A;  1QUW A;  4BVY B;  5G5E A;  1HNB A;  1HQO A;  3L9U A;  1F3B A;  5BRT A;  4G9H A;  3P90 A;  2B1K A;  4OCF A;  1YF0 A;  3QDN A;  1J9B A;  3TDG A;  2MBS A;  5DVB A;  2WS2 A;  3TB2 A;  2HZE B;  2CZ3 A;  4ID0 A;  3FR3 A;  4TOP A;  5LD0 A;  3APO A;  1TK0 B;  3PPU A;  4I2U A;  3ZVJ A;  3KMO A;  1AQV A;  5CRD A;  3UJ1 A;  4PNG A;  4KCA A;  2HRK A;  4MF6 A;  5FT3 A;  1BQ7 A;  3GL3 A;  4JRR A;  3ZML A;  4HUA A;  2B1L A;  2F8F A;  5HFK A;  1Q4J A;  1V58 A;  5JCW A;  3TRP A;  3ZFL A;  1OAZ A;  2DML A;  4RQR A;  3FY7 A;  5DBQ A;  14GS A;  1ZZY A;  1XWC A;  3DWV A;  2MMZ A;  2H1D A;  1FOV A;  2QKE A;  5JWO B;  2H76 A;  2X49 A;  2IME A;  3VPQ A;  2VCT A;  4GSS A;  1AXD A;  1A8L A;  4OD7 A;  4TR3 A;  3OR5 A;  1K3O A;  3EPT A;  2R0P A;  4IGJ A;  3WT1 A;  2YWO A;  4IP6 A;  3EMP A;  1I9D A;  4IBP A;  1F37 A;  3ISO A;  1WMJ A;  1WJK A;  2ON5 A;  3HHV A;  2R37 A;  2LRN A;  5DDL A;  2EC4 A;  4IQA A;  4XRD A;  3LJR A;  1RW1 A;  1GUH A;  2OBI A;  2P5Q A;  1C72 A;  4Z2T A;  3QOU A;  2RUF A;  4POL A;  1OE8 A;  6GSU A;  3CBU A;  1V2A A;  5ECS A;  3QFB C;  5ECQ B;  1H75 A;  1O8W A;  2NPB A;  1U3I A;  5F05 A;  3ZTL A;  4LLR A;  5KOX A;  3BD2 A;  2K9F A;  2C80 A;  3KP9 A;  1B9Y C;  3V1W A;  1TRV A;  5D9T A;  1K0A A;  3VI5 A;  3MYD A;  4MF5 A;  4ISD A;  1DUG A;  5D96 A;  3GHA A;  2FHE A;  2ES7 A;  4HDE A;  3QR6 A;  2BMX A;  3G7I A;  2H01 A;  1YKC A;  2MBT A;  3NZN A;  3SWL A;  1PX7 A;  2JZS A;  2IIY A;  1TRU A;  2DJ1 A;  1B48 A;  2M80 A;  3KTL A;  4G19 A;  2H71 A;  1H4O A;  2RLI A;  4K0N A;  3QCP A;  2MZC A;  1WIK A;  2GQM A;  3ZZX A;  2WUL A;  1O85 A;  2NVL A;  1AQW A;  4K7I A;  2JSY A;  4RQX A;  1MD3 A;  2IMK A;  1TU8 A;  4PUA A;  2JZR A;  3G9B A;  4POK A;  2JU5 A;  2YP6 A;  3VPT A;  1A0R P;  2LJR A;  1DSB A;  3UEM A;  2ALB A;  4IJ3 A;  4RI6 A;  3F3R A;  5F07 A;  2L4Q A;  1TKD B;  1M9A A;  1M0U A;  4NMU A;  5GAP D;  4P3Y B;  3PR8 A;  3HVS A;  2FA4 A;  4MJB A;  5ENU A;  4ZBB A;  2A2R A;  1O81 A;  3IRA A;  1QFN A;  4KDX A;  1M9B A;  3GKX A;  20GS A;  2ZNM A;  4EL1 A;  2B7J A;  2DIZ A;  2NDO A;  5ELG A;  2E0Q A;  5J9B A;  1BJX A;  3KGK A;  3IHQ A;  2H1B A;  4MJC A;  4ULX A;  1EGR A;  4POM A;  1Z6M A;  1OKD A;  4ML6 A;  4WF4 A;  2VLU A;  3VI7 A;  1AUC A;  3A2V A;  3KD0 A;  4PGT A;  5DAL A;  5CRH A;  5AIS A;  2GLR A;  1A24 A;  3G7Y A;  1HYU A;  4MF7 A;  2O8V B;  2D2Z A;  2HT9 A;  3TKS C;  1UC7 A;  3EU3 A;  5IMA A;  3GV1 A;  1JLV A;  2VL2 A;  3RHC A;  3DGQ A;  3Q6O A;  2G0F A;  3DKS A;  8GSS A;  2O85 A;  3QAG A;  4HZ2 A;  1O6J A;  4Q5Q A;  1GNW A;  4JU5 A;  4MJE A;  4O32 A;  3DEX A;  2IN3 A;  3RBT A;  3A2W A;  3GTU A;  3GH6 A;  3VFI A;  2ON7 A;  2H19 A;  4TRX A;  1PL1 A;  2H30 A;  2OAD A;  3L78 A;  3C71 A;  1OC8 A;  3A5I A;  2VAF A;  3GUS A;  1URM A;  1G6Y A;  5DAL B;  1THO A;  1R7H A;  22GS A;  1K0C A;  4FIW A;  4HEA 2;  1EOG A;  1XOA A;  2MYG A;  2WDU A;  3HYP A;  3CMI A;  5ID2 A;  2P5R A;  3Q18 A;  1AIU A;  4GCI A;  4ZB8 A;  5IMD A;  5B7C A;  4GTU A;  3GFK A;  2K18 A;  2B5E A;  5IPG A;  1XW6 A;  1FVK A;  3WGX A;  3ZFB A;  1B4P A;  2JSZ A;  3CTG A;  5CRE A;  1XW9 A;  2XPD A;  4ECJ A;  5ECM B;  4JR4 A;  5HR0 A;  3FZA A;  3FK8 A;  2EIO A;  4AF2 A;  4EF0 A;  2AJQ B;  1MD4 A;  3L9S A;  1MEK A;  1F3A A;  1IYH A;  4KH7 A;  4BL7 A;  5AIV A;  2FLS A;  3E3E A;  2X8H A;  1W4V A;  4XHM A;  3UIW A;  2VLT A;  3ZLP A;  2H6Y A;  3KEB A;  5DJL A;  3F4R A;  1BAY A;  2J9H A;  3LEF A;  1T3B A;  1WPI A;  5IMF A;  3ZL5 A;  4MH3 A;  4PX1 A;  4DSS B;  3F4S A;  3ZIJ A;  1GTA A;  3GX0 A;  4I8B A;  1TP9 A;  2TRC P;  2PUK C;  2KLX A;  2WRT A;  1FB6 A;  4XS1 A;  3L9V A;  3LXT A;  3O76 A;  4EKZ A;  4ZIJ A;  2JZT A;  1X5E A;  1VGL A;  2LJK A;  2A4H A;  2A2P A;  4NXI A;  4KF9 A;  2LQO A;  2GGT A;  1Z7P A;  5JWR B;  3KMN A;  4LMW A;  4ZBA A;  2YJ7 A;  3QD9 A;  2YJH A;  2UZ8 A;  3DXB A;  4FYC A;  10GS A;  1EP7 A;  1R26 A;  2CVB A;  1FG4 A;  2WGR A;  3UVT A;  4PQI A;  3I6A A;  5IO2 A;  3KIJ A;  4PUF C;  2AUV A;  5KN3 A;  4NV5 A;  1MDJ A;  3IPZ A;  4O5R A;  2CQ9 A;  4AJ8 A;  3M8N A;  3D21 A;  4K8M A;  2YZH A;  3O6T A;  4GQF A;  1JZD A;  4FYU A;  2N5F A;  3U6V A;  2CAI A;  4FYB A;  1V57 A;  2GZZ A;  2PMT A;  2E2G A;  1TDI A;  5CO3 A;  3ERG A;  1Z6N A;  1G7O A;  1PN9 A;  1Z7R A;  1TRS A;  2XBQ A;  4JR6 A;  2IPA A;  3IR4 A;  1ACV A;  1O73 A;  2PU9 C;  2H0G A;  1GSF A;  5JCG A;  3TOU A;  3ME8 A;  4TR0 A;  5J5N A;  4IVF A;  1TW9 A;  2IMF A;  3F9U A;  2MMA A;  2VO4 A;  3F63 A;  4LMV A;  1TOF A;  1G7E A;  1Z5Y E;  3HJP A;  3M3M A;  4HU9 A;  4GRF A;  3MDK A;  1ERU A;  2FCH A;  4EIP A;  3HA9 A;  2EIR A;  2FWH A;  4KUN A;  4F0B A;  1BG5 A;  5JWQ B;  5C00 A;  2LJA A;  5B6N A;  2VCV A;  3SBC A;  2C1Y A;  1T7P B;  4Q5F A;  1F2E A;  2MMN A;  1ZCP A;  3W8J A;  1A2M A;  1Z9H A;  1TTZ A;  2L6C A;  3UBL A;  2HLS A;  3US3 A;  1S3A A;  1U88 A;  4J2F A;  4N0V A;  2HFD A;  1R5A A;  1OC3 A;  1Q98 A;  4G10 A;  4NHZ A;  5G2Z A;  5IOX A;  2K6V A;  3R3E A;  1THX A;  4V2L A;  2H66 A;  2H0H A;  5KOW A;  4HQS A;  1WP0 A;  5HQP A;  5ECO B;  1ZOF A;  4L8E A;  4Z2R A;  2O89 A;  3VUR A;  1VF4 A;  5E4W A;  1XOB A;  1SEN A;  1ERT A;  3CRU A;  4IJI A;  4OMV A;  1XXU A;  5H5R A;  3I43 A;  1ZL9 A;  1VF3 A;  1SJI A;  5B6M A;  1IYI A;  1EEM A;  5CRW A;  3GKN A;  1KTE A;  4NPB A;  5A4W A;  2L6D A;  1SK1 A;  2NBS A;  5F8B A;  3H1N A;  3M0F A;  1JFU A;  3BCI A;  5IO0 A;  2R3X A;  4WBJ A;  3FR9 A;  4POB A;  2AHE A;  2XC2 A;  2H8L A;  2B5Y A;  3GMF A;  5D9V A;  3I9V 2;  4MH2 A;  2QA1 A;  2PER A;  5DAK A;  2PBJ A;  4ECB A;  2F3M A;  4MNN A;  1OKT A;  2V6K A;  2H6Z A;  2QGV A;  2FA8 A;  3HVV A;  3UAP A;  3TKP A;  5A4U A;  2JAD A;  2GSS A;  2RII A;  1ERV A;  1EV9 A;  4BA7 A;  5IQY A;  2H1G A;  1BX9 A;  3VK9 A;  1M2D A;  4F2I A;  3D4T A;  2K8S A;  1CQG A;  3IK7 A;  2CX4 A;  5G30 A;  1ABA A;  3WYW A;  2IWT A;  2VLV A;  4YQM A;  3H93 A;  3BBY A;  2XPE A;  3FYG A;  3MNG A;  2A4V A;  3UAR A;  3GRX A;  2MMO A;  5DAK B;  2GQL A;  4IKH A;  2B6M A;  3MWH A;  4L0W A;  2PWJ A;  2I81 A;  4WXT A;  3D4M A;  2VCZ A;  3FHK A;  1NSW A;  3ZYW A;  2YPM A;  3CSH A;  1PN0 A;  5ECP B;  4OCE A;  5CP1 A;  4OFT A;  3LGC A;  3DVW A;  4K6X A;  1SKW B;  1M2B A;  3KJY A;  3FZ5 A;  1TI3 A;  4FQU A;  2OBK A;  2AB6 A;  1PMT A;  3VWX A;  4GLT A;  3P2A A;  4USS A;  4CY8 A;  2RUE A;  4QL9 A;  3DIE A;  4K9Z A;  2BJX A;  4FH8 A;  4PUR A;  5G1K A;  4F82 A;  3C8E A;  1PKZ A;  1SK2 A;  2PGT A;  4MZC A;  1GUL A;  4V1A g;  3IOS A;  3VWW A;  3JCM L;  3DYR A;  2H6X A;  3KH7 A;  3A2X A;  5ECL B;  4JZQ A;  3RDW A;  3IXR A;  3KZQ A;  4O92 A;  6GSS A;  5LNK e;  2WFC A;  4DSQ A;  2KHP A;  1SYR A;  1X5D A;  3PH9 A;  4XS6 A;  4HJ2 A;  3KTB A;  1YF1 A;  1FVJ A;  1A2J A;  4WBR D;  1O8X A;  2C3N A;  2OKA A;  4WR5 A;  4ZXG A;  3BOA A;  5AGY A;  2X8G A;  4LL1 B;  5L71 A;  2LST A;  2VUP A;  1BED A;  4D73 B;  1O7U A;  3HJO A;  1GUM A;  4PQ1 A;  5IMV A;  4O7H A;  1RK4 A;  2V6O A;  4TXO B;  3UBK A;  3LG6 A;  4KDU A;  2CAQ A;  3F0I A;  1GUK A;  2VL3 A;  2J23 A;  2IMI A;  3IE3 A;  5B8B A;  2LRT A;  5B8A A;  2B5X A;  2CA8 A;  4GSN A;  5IMC A;  4MMM A;  1NHO A;  4J57 E;  4K2D A;  19GS A;  2B3S A;  5EL8 A;  5D9W A;  1OVN A;  4MCU A;  2M46 A;  2R6K A;  5A4V A;  4K7N A;  2I3Y A;  4I6X A;  1GTI A;  1B9X C;  2C3T A;  2NTO A;  17GS A;  1Z3E A;  5FWG A;  1A0F A;  1DE2 A;  4YQU A;  3KP8 A;  3F6D A;  3EWL A;  1UVZ A;  3GL5 A;  4LA1 A;  6GST A;  3N5O A;  2HRN A;  2JL4 A;  1USB A;  4K5R A;  4V2N A;  3TJB A;  4YKF A;  1AQX A;  2KP1 A;  4I2T A;  5DCG A;  1K0M A;  3G7J A;  3ZRE A;  5IOW A;  5G31 A;  3N9J A;  2I4A A;  1T00 A;  5DJM A;  4IQ1 A;  4ZL9 A;  2ZCT A;  5KN1 A;  1B8X A;  1K0N A;  1T1V A;  4G0I A;  4BWQ A;  4DSS A;  2VD1 A;  1SKR B;  4BWS A;  5IPH A;  3VLN A;  4EDY A;  3EVI A;  2YV7 A;  4EIQ A;  1G6W A;  3GUR A;  1TJD A;  2YWI A;  1ZYP A;  1GP1 A;  2L59 A;  2VL2 C;  4TVE A;  4EUY A;  4ECI A;  6GSY A;  2R0C A;  4MAB A;  3WGD A;  1EV4 A;  1U3A A;  1PQN A;  4IHU A;  4HU7 A;  5GST A;  5J4U A;  5HFG A;  2O87 A;  1HD2 A;  3EC3 A;  1T4Y A;  4Q5N A;  3TJG A;  6GSX A;  3CSJ A;  2TRX A;  5ELA A;  3TKS E;  3UL3 A;  4EDZ A;  1NW2 A;  2H73 A;  2TIR A;  4MZW A;  1BYE A;  2F9S A;  2C4J A;  2H75 A;  1HNC A;  1GSS A;  5EPF A;  2I9H A;  3FZ9 A;  3ZVJ D;  3GN3 A;  3C73 A;  4OO4 A;  1X5C A;  1SL1 B;  2JAC A;  2DKH A;  1GNE A;  3WT2 A;  5IMZ A;  1X9S B;  4KB3 A;  4ZL8 A;  3HY2 A;  4K1F A;  4E8E A;  2R5G A;  5LCZ A;  2P0G A;  4F9Z A;  4X4J A;  2DJ0 A;  4MP4 A;  1XFL A;  1ZYN A;  1GL8 A;  3LXZ A;  3EU4 A;  3NIV A;  3NOF A;  2GDR A;  5DQS A;  3TJK A;  4N10 A;  1EGO A;  4EO3 A;  2M72 A;  3RAZ A;  3CTF A;  5GSS A;  3MAK A;  2AV4 A;  1M7T A;  5ECR B;  2FD3 A;  4TR1 A;  2Z9S A;  3APQ A;  3UMA A;  5CRG A;  2QA2 A;  4MJA A;  4MK3 A;  2HSY A;  3GH9 A;  2V2G A;  5DCH A;  2GS3 A;  4GF0 A;  3IV4 A;  4JBB A;  1A8Y A;  3HZ4 A;  4XIH A;  1X0R A;  1JZW A;  4G2E A;  1HNA A;  4MPF A;  3QPM A;  1AAZ A;  3Q74 A;  4E8H A;  1XVW A;  2VIM A;  3R2Q A;  3GSS A;  3EE2 A;  4KAE A;  1V40 A;  1YQ1 A;  1K0D A;  3GNJ A;  4IEL A;  3ZIT A;  4O5Q A;  1M2A A;  1PA3 A;  2H74 A;  1TRW A;  2V41 A;  1QQ2 A;  1SJZ A;  1WWJ A;  4TR1 B;  2LKU A;  2L5L A;  3GIX A;  2LV3 A;  5AN1 A;  11GS A;  1PD2 1;  2WZ9 A;  1R4W A;  2GSR A;  4I97 A;  1XWK A;  3TGZ A;  4ZL7 A;  4NV2 A;  4WF5 A;  3TJJ A;  4GST A;  3EMX A;  4XS4 A;  5ECN B;  5ABR A;  1PX6 A;  2L5O A;  3LSZ A;  2KUC A;  4IS0 A;  2IMD A;  4GXZ A;  4TR4 A;  2IL3 A;  5CAX A;  2PN8 A;  1SYX A;  3QMX A;  5COH A;  2XBI A;  2HNL A;  4MLY A;  5ECH B;  1EOH A;  3RHB A;  4K7O A;  1QMV A;  2DJK A;  1M99 A;  1JZO A;  1S3D A;  2YZU A;  3HDC A;  3DRN A;  5AIX A;  1OC9 A;  4EC0 A;  2N5A A;  1UN2 A;  2GQK A;  1GRX A;  3D5J A;  3I69 A;  4LL4 B;  3J7Y b;  4GWR A;  5ECI B;  2HXK A;  4XS4 B;  4PNF A;  4IW9 A;  4YH2 A;  2VCW A;  2B7K A;  3ERW A;  1TK8 B;  4Q5R A;  2A2S A;  2E2M A;  4MDC A;  3WGE A;  2XHF A;  3F4T A;  5EVO A;  1TK5 B;  3L4N A;  1T4Z A;  3DVX A;  4PXO A;  3EIN A;  3D0Z A;  3C1R A;  1OC9 B;  3KM6 A;  4DEJ A;  2YOI A;  4ECC A;  16GS A;  4L5O A;  3TRX A;  2HYX A;  2GST A;  1ML6 A;  4J56 E;  1XWA A;  2QC7 A;  2VCX A;  4HZ4 A;  1PL2 A;  1KNG A;  1GH2 A;  3TOT A;  1GTU A;  2LTK A;  2CZ2 A;  4Z2U A;  5G5F A;  4KGI A;  1Y6E A;  5HR3 A;  2I1U A;  3VWV A;  2DC5 A;  3F6F A;  3GYK A;  5J9C A;  3FMW A;  4HI7 A;  3Q19 A;  4JE1 A;  4ML1 A;  3EUR A;  5HR2 A;  3AY8 A;  7GSS A;  2C0F A;  2G2Q A;  3WD6 A;  1K0B A;  4KE3 A;  4KSO A;  1XWB A;  4TW5 A;  3E0U A;  3LOR A;  3HVX A;  3PIN A;  3HZ8 A;  3M1G A;  4AJ6 A;  3FRC A;  5A5K A;  1EP8 A;  4YAV A;  4NHW A;  1SD9 A;  3M9K A;  3LYP A;  2CV4 A;  4BVX A;  2EIQ A;  6GSW A;  1JLW A;  1XBS A;  4X43 A;  1SL0 B;  2CVD A;  4K5S A;  4O5U A;  3LFL A;  4GQC A;  4KDY A;  3ME7 A;  3FKF A;  1U87 A;  4G0L A;  2C8U A;  3HXS A;  5CNW A;  3UVH A;  1YY7 A;  2WB9 A;  4CY6 A;  2R0G A;  2YV9 A;  5KEJ A;  1WOU A;  3W6G A;  1E6B A;  4KA0 A;  3PGT A;  1SL2 B;  1ERW A;  3M9J A;  4WKW A;  5HFI A;  4ZB9 A;  2DBC A;  1K3Y A;  2HRF A;  4WR4 A;  4BVX B;  1Y25 A;  1YEP A;  3IC4 A;  3ED3 A;  4KND A;  5JCU A;  4Z7X A;  1A23 A;  4FO5 A;  2AAW A;  1YZX A;  2IFQ A;  4ZBD A;  4YKG A;  3TKS A;  1F9M A;  4OFN A;  5ECK B;  3C7M A;  2RM6 A;  5IM9 A;  4D73 A;  3O3T A;  3MSZ A;  2OA7 A;  4F03 A;  2GVP A;  2GT5 A;  2V1M A;  2KP2 A;  1EWX A;  4TXO A;  3H4K A;  3D22 A;  1GSE A;  2LRC A;  2OE1 A;  1J08 A;  4AJ7 A;  2WCI A;  1S3C A;  5D73 A;  5FHI A;  2HRA A;  4H86 A;  1FO5 A;  5KN0 A;  1K0O A;  1TI1 A;  1YJ6 A;  2LNT A;  1PSQ A;  1FB0 A;  4EE0 A;  1YEX A;  3HCZ A;  4PQH A;  3RPN A;  5F0G A;  4N0Z A;  4JED A;  1RQM A;  1U6T A;  2IFQ B;  4OFM A;  2FNO A;  2VL9 A;  3VWU A;  2FY6 A;  2DJ3 A;  1TU7 A;  1GLQ A;  1T8E B;  1XWG A;  3IAM 2;  4CW9 A;  3ERF A;  1X9M B;  1MDI A;  12GS A;  3K8N A;  5G1L A;  2CT6 A;  3RPP A;  1MTC A;  2DIY A;  1N8J A;  4HQZ A;  4F0C A;  2GSQ A;  2V32 A;  1EZK A;  4TKY A;  3D6I A;  1KEB A;  1SJ6 A;  3CYN A;  2GTU A;  2LQQ A;  4DVC A;  4KSM A;  2HSH A;  3BCK A;  1F6M C;  1AW9 A;  3FEU A;  4WET A;  1G0T A;  4IN0 A;  4YAP A;  2X99 A;  4RI7 A;  1GSY A;  1LU4 A;  1PGT A;  1ST9 A;  1V98 A;  3IAS 2;  5EY6 A;  4L5L A;  2YNX A;  3HKR A;  1DBY A;  6GSV A;  1EEJ A;  3KXO A;  4ZIL A;  1UA5 A;  3MIX A;  4MA9 A;  1XVQ A;  2X64 A;  1CQH A;  1GSD A;  2REM A;  5HR1 A;  2FWE A;  1LJR A;  4K2X A;  2PPT A;  2LNS A;  1ZMA A;  5BMU A;  2DMM A;  2H72 A;  2F51 A;  3L0H A;  1GSQ A;  1QXH A;  1ZGN A;  1ON4 A;  2LS5 A;  4A5P A;  3LWA A;  3FR6 A;  3QAW A;  5GZZ B;  3IHG A;  3A5W A;  5C04 A;  2CVK A;  1QK8 A;  1J0F A;  1K3L A;  4N30 A;  1B4Q A;  2VD0 A;  2L57 A;  3APS A;  2PVO C;  4DSR A;  4ZB6 A;  1FHE A;  2DKI A;  3GKK A;  1SK0 A;  2CX3 A;  3TKQ A;  4KW6 A;  1DE1 A;  3GTU B;  3TKR A;  3ZMK A;  2X8C A;  2K8V A;  3GST A;  1GTB A;  3QAV A;  1FAA A;  3GKM A;  1X9W B;  1ZYQ B;  2YAN A;  3E9J B;  3CXG A;  3U5R E;  2N5B A;  3TJF A;  4MPG A;  1XZO A;  5KN2 A;  2HI7 A;  2R2J A;  3LW9 A;  2LUS A;  1PKW A;  1XCC A;  1ILO A;  18GS A;  1KBN A;  1XIY A;  3FW2 A;  4KCE A;  1OE7 A;  3H79 A;  3IBH A;  2FWF A;  5ID2 B;  1WRY A;  3HD5 A;  2DSA A;  3KCM A;  4RUV A;  4OWY A;  2PVQ A;  3C1S A;  2HE3 A;  2H0I A;  1V9W A;  4WEY A;  1VF2 A;  2QSI A;  5CYY A;  2E7P A;  5GAN D;  1SKS B;  3LQ7 A;  5E59 A;  3LYK A;  2VOC A;  3EYT A;  2OE0 A;  1SD8 A;  2YN1 A;  4NWY A;  2BTO T;  2GZP A;  3TCO A;  4MZB A;  2F8A A;  4ACS A;  4I5Q A;  2O7K A;  4HJM A;  3UOM A;  1E2Y A;  4EXJ A;  2OAC A;  4G0K A;  4CDO A;  4TXV A;  3CRT A;  5D93 A;  1XW5 A;  4BL7 B;  5J3R A;  4K0G A;  2VM2 A;  4ICY A;  4QQ7 A;  2X4A A;  1GWC A;  1JHB A;  4CHS A;  3ZIV A;  3S9F A;  1R5P A;  1GSU A;  2C0G A;  3J7Y k;  5F06 A;  1JZR A;  1SU9 A;  5H5Q A;  2C0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...