2H72A

Crystal structure of thioredoxin mutant e85d in hexagonal (p61) space group
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGDVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin mutant E85D in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h72A00
5D73A 3TJKA 13GSA 3TRPA 4PNGA 3HVXA 11GSA 2TIRA 1LBKA 4OFMA 5J4UA 4KSMA 4ZL8A 2CVKA 2H0HA 2GSQA 1U88A 5LCZA 8GSSA 1PKZA 3TJFA 1KEBA 4G10A 4TR4A 2R2JA 4X43A 2X8GA 3ERGA 1A23A 3H4KA 4XS4A 2H75A 3V1WA 2IN3A 4IELA 1OC8A 5GAND 2IL3A 2KOKA 4KDUA 3TRQA 1MDKA 3P2AA 2I4AA 3RDWA 12GSA 4IJ3A 2M80A 1XVWA 3F0IA 2MYGA 3FEUA 1J9BA 3JCML 2WJUA 2RUEA 5ECLB 4BWQA 3LXTA 1SKRB 3GL3A 5G5FA 2REMA 4OWYA 3OR5A 3WGXA 2LRNA 5ECRB 1OC9A 3J7Yb 3EMXA 1OAZA 2FNOA 4ECIA 1TK0B 2AAWA 4FH8A 2MMNA 1FG4A 19GSA 1KTEA 1RK4A 2ES7A 2R6KA 2FY6A 5B6MA 2GDRA 1TI3A 2H0GA 3LSZA 2RLIA 2HXKA 1PMTA 1AXDA 4TR0A 4YAVA 1YY7A 2C0FA 5GSTA 1DE2A 1B48A 4HZ2A 3HVSA 4JEDA 2JZSA 2D2ZA 4LA1A 4BPYA 5CNWA 1IYIA 2OE3A 1DE1A 22GSA 3ZVJD 1LU4A 1I5GA 2H01A 2E2GA 2KP1A 2H1AA 2H6ZA 1O73A 3D22A 3BCKA 1SK0A 5J9BA 5HR1A 2VOCA 1WP0A 4EKZA 1Z7RA 1GUKA 3SBCA 3DVXA 3QMXA 1XZOA 1O6JA 3CTGA 4XS1A 3RHBA 4EC0A 1J0FA 2MBSA 5ECNB 1TRSA 4L8EA 4IGJA 3BOAA 1BYEA 1B9YC 1SKWB 1S3DA 3UBKA 2PN8A 2PBJA 3SWLA 1YF0A 3IE3A 4IJIA 3VK9A 1GLQA 3HHVA 5DQSA 2WULA 1W89A 1TK5B 1HQOA 3L9VA 1TJDA 4N11A 4F2IA 2JL4A 1U3AA 1ZL9A 2GSSA 5DJLA 2MMZA 4EXJA 4V1Ag 2DMLA 2JU5A 4XS6A 1O85A 3WGDA 4MPGA 2WB9A 2LKUA 1B8XA 5EL8A 3GN3A 5J3RA 3QOUA 4HOJA 3GHAA 2C80A 1B4PA 2MMAA 4XS4B 1AC1A 5J5NA 5HFGA 1T00A 3VPQA 5FT3A 1T7PB 5IM9A 3ERFA 1MD3A 4ML6A 3C1SA 1NHOA 1SU9A 2L57A 2YWOA 4ISDA 4G19A 1X9MB 3GSSA 1JFUA 1QK8A 5COHA 1VRSD 1HNAA 4KDXA 1YEPA 4ACSA 4POLA 1TRWA 5JWOB 1SK1A 4PQ1A 4K7IA 1OC9B 1YEXA 4HEA2 4AJ8A 1AQWA 4XHMA 2LSTA 4E8EA 3HZ4A 1TP9A 1XWCA 1BJXA 4Q5FA 4K6XA 2CQ9A 4XRAA 2JSZA 2GZYA 1V2AA 4KA0A 4MLYA 2GS3A 2H1DA 2DJ1A 4TR1A 4RI7A 2QC7A 2VL2A 4V2NA 3IPZA 5HR0A 3G7IA 1ML6A 4F0BA 4N0VA 1Z3EA 2JZTA 4TOPA 3EE2A 4X1UA 1M0UA 4FYUA 3ZMKA 5D9VA 3CRTA 1KBNA 4ILFA 2O8VB 2PWJA 3IK9A 1WRYA 3NIVA 4PQHA 4Z7XA 3PH9A 5B6NA 2C3NA 1A2JA 1A0RP 1GH2A 1JZDA 2AUVA 1G6YA 3ZFLA 4O32A 2FCHA 4GQCA 2FA4A 6GSVA 3GTUA 3L4NA 4ZBDA 3UARA 1X5CA 4LMVA 1ABAA 3ZIVA 1XWGA 1FVKA 1ACVA 3F3RA 4LMWA 3IHQA 2DLXA 3F3QA 1FO5A 1ZZYA 2VCVA 3RPNA 2DJ0A 4MABA 4MA9A 1THOA 4WXTA 2HZFA 3CBUA 5ECMB 1E2YA 4HDEA 1K0DA 1ERWA 1T3BA 4JE1A 2GGTA 1MDIA 1W4VA 3QAVA 4MF5A 1OKDA 4IHUA 2YCDA 1ZMAA 1YDKA 5CRGA 5ABRA 4BA7A 1SD8A 3Q74A 4POKA 2LRTA 16GSA 2I1UA 3F6FA 3FKFA 4WBJA 5DQYA 2DSAA 3GUSA 1F3AA 3HA9A 4L0WA 6GSYA 2LEGA 2IPAA 3GKKA 4NPBA 1TI1A 2F9SA 2I3YA 1DBYA 3ERWA 3NZNA 4KDYA 3KMOA 2HRNA 5CREA 3IAS2 1M2DA 3RAZA 3H1NA 5HFKA 4POMA 3EYTA 5DBQA 4CHSA 4NXIA 2CX4A 4H86A 2OADA 2LQOA 2A4VA 4EUYA 1AW9A 2X64A 5G5EA 4F9ZA 2QKEA 3M3MA 5A4WA 4CW9A 1GUHA 4GTUA 4TR1B 4RQXA 1XVQA 1GSEA 4RI6A 1K3YA 4O5RA 1MD4A 3KGKA 3I9V2 1SKSB 1THXA 2V6OA 5LNKe 2FHEA 3CSHA 3ZFBA 1PX7A 3DKSA 3GRXA 2OE1A 2H6XA 3EINA 3GKXA 2HRFA 1RW1A 1M7TA 1GL8A 3FYGA 2ZUPA 3P90A 3M8NA 4WEYA 1ZGNA 4YAPA 3CRUA 1OKTA 2H0IA 2VL9A 3GFKA 1YKAA 2YJHA 3GKMA 1DUGA 2KLXA 4TXOA 4WF4A 1V57A 2L5OA 4J56E 3M9JA 3C73A 4PURA 3FR9A 1M9AA 4HJ2A 4XCSA 1XOBA 2AHEA 1JLVA 3M9KA 3GTUB 2VL2C 5F8BA 2GSRA 2C3QA 2C0EA 2GQMA 4EF0A 3H93A 4KNDA 1QGVA 4GRFA 5ECSA 5EPFA 1JHBA 1V9WA 5J9CA 5DCHA 3KMNA 5IOWA 3GYKA 2LTKA 1XW5A 4XIHA 2C1YA 3DVWA 4HQZA 1X5EA 1BEDA 4TRXA 3VFIA 5EVOA 2YANA 1NW2A 2O87A 4MMMA 1GLPA 3LQ7A 5AN1A 3GH9A 2JSYA 3I43A 4KE3A 1QMVA 5B8BA 2AV4A 4HU9A 4ZL7A 2CZ3A 3US3A 1PL2A 2VM1A 4GXZA 1YKCA 3FZ5A 4GWRA 1GTIA 4MJBA 2DIZA 1SL2B 4DEJA 1R5PA 3VI5A 5ENUA 1URMA 2OBKA 3F4RA 3K8NA 1BX9A 3A2WA 3KD0A 3D21A 2RUFA 4MDCA 3FZ9A 3C7MA 3FW2A 2HI7A 2EIQA 4D73A 5G1KA 3EU4A 2DJKA 3P8WA 1EEJA 1SJZA 3ZYWA 1YF1A 2ZNMA 2C4JA 3ZZXA 4PX1A 4MH3A 4KGIA 2C8UA 1F3BA 2CZ2A 3GX8A 4L5OA 2A2RA 1WOUA 3EWLA 2K8SA 2HLSA 1K3LA 5F0GA 5ECKB 5A4UA 2IIYA 2O89A 5IOXA 5D93A 2MMOA 4RQRA 5JWRB 1AIUA 2EC4A 3TJJA 1JZRA 2ON7A 2P31A 2K18A 1BQ7A 4OCEA 4OD7A 4ZBBA 1XWAA 5GAPD 1GSUA 3EURA 4OMVA 4MZBA 4KX4A 3FR3A 4Q5RA 1K0MA 3VI7A 5CAXA 2K6VA 4TR3A 1S3CA 5IQYA 1X0RA 3UAPA 3EVIA 4TXOB 5DVBA 4ZBAA 5IMAA 3IV4A 4JU5A 6GSWA 3W8JA 2VD0A 1U87A 3MAKA 10GSA 3RHCA 2JZRA 3UEMA 3DRNA 1UA5A 2DMMA 2O7KA 1T1VA 3DIEA 2HSYA 2VLVA 2IMIA 1NM3A 4WETA 5HQPA 2EIOA 1K0NA 5ECQB 3IC4A 3E3EA 2FA8A 2XPDA 1XOAA 5KN2A 4AJ6A 3ZRDA 3LYPA 3TGZA 5LD0A 1QFNA 4N0ZA 3KEBA 3TJBA 2LJRA 4GSSA 1SD9A 2L4CA 3UVHA 1XXUA 1B4QA 3VPTA 3EU3A 2GT5A 2B3SA 1GWCA 1G7EA 2PMTA 3VWWA 5JCWA 1CQGA 2H6YA 4K1FA 1EGRA 4NMUA 1TOFA 3TOUA 3MDKA 1ERUA 1USBA 3KH9A 5HFIA 4MP4A 2PPTA 3HYPA 2VUPA 5E59A 3RPPA 1YZXA 3AY8A 1K0BA 2VCQA 4XTSA 3GIXA 3LEFA 3KP8A 5IO0A 4F82A 4KH7A 4PXOA 2LJKA 3UMAA 4D73B 1OVNA 3IRAA 4EE0A 3D0ZA 2L6DA 2MZCA 1HD2A 4QQ7A 2NPBA 2VM2A 1U3IA 2YV9A 3D6IA 1F2EA 1OYJA 2IWTA 4DSQA 1Z6NA 3HKRA 3TKSC 2CAQA 4CDOA 1Z5YE 1R5AA 1AUCA 3U5RE 4JRRA 3LFLA 1SYXA 1G0TA 3WT1A 3ZTLA 2NTOA 3HY2A 2I9HA 3IOSA 2DJ2A 2N5AA 1PKWA 4GCIA 4MJEA 2YP6A 1X5DA 1B9XC 1R4WA 1A8LA 4KAEA 4E8HA 2XBIA 5F07A 2K9FA 2XC2A 3DEXA 5KN1A 1TTZA 1G6WA 1R26A 3ZREA 2H66A 2VCWA 2FWGA 4ID0A 5JCUA 3GNJA 5E4WA 1TRUA 2FGXA 2PVOC 1S3AA 2F8FA 1GSYA 2YZUA 1E6BA 1O7UA 3QR6A 1TDIA 1T4ZA 2AB6A 5C04A 2WGRA 2HFDA 1ST9A 1YQ1A 2ON5A 5KN3A 3DXBA 2LV3A 2OKAA 4V1Ap 3ISOA 4LL4B 2H70A 2CAIA 2BTOT 2LQQA 2WRTA 1GULA 2LNSA 1GRXA 1FB6A 3D4MA 1PD21 2V41A 3PR8A 3C1RA 2FLSA 1MEKA 4DSSA 1T4YA 2GTUA 1PL1A 3KTLA 4ZL9A 5D9TA 5C00A 4G9HA 2QGVA 1GP1A 4Q5NA 2DJ3A 3E9JB 2GSTA 5HR2A 1Z6MA 2KUCA 3A5WA 1Y25A 2GVPA 4MF7A 1SENA 2IFQA 5AIVA 5JWQB 3ZLPA 4J57E 2VAFA 5CRDA 1TU7A 2NBSA 3D4TA 3PGTA 1CQHA 1VF2A 1WE0A 2B1KA 4K2DA 3IAM2 5GZZB 2B7KA 2PGTA 3DMLA 1X9WB 2TRXA 4MZCA 4KCAA 2HSHA 1SJ6A 4NHZA 2GQKA 3G7JA 3KIJA 14GSA 3HJMA 4NAXA 4JR4A 5IMCA 4YQUA 3ZVJA 1O8WA 2OJLA 3TKRA 4BVYA 1TXXA 4QL7A 5D96A 2E7PA 4I5QA 4NV2A 2PU9C 2FD3A 3U6VA 3EMPA 4GF0A 2OBIA 1HNBA 3HCZA 2B5XA 3QCPA 4IVFA 4EDYA 4ZB9A 2VO4A 2FUG2 2YPMA 3LXZA 5CP1A 1WPIA 1A2MA 3WGEA 3W6GA 2E2MA 2YOIA 1XCCA 4ECCA 4FYCA 1MDJA 2Z9SA 1G7OA 2PVQA 4PUAA 5J41A 3GX0A 6GSXA 3UJ1A 2C3TA 2YN1A 2O85A 1Q98A 3UIWA 3QDNA 2XPEA 1U6TA 4DVCA 3LWAA 4TKYA 1WWJA 2CVDA 3BBYA 2AJQB 7GSSA 1K0AA 1YJ6A 2YWIA 1SK2A 3IDVA 4EDZA 4PQIA 2YJ7A 1FOVA 2VD1A 4V2LA 3PINA 1J08A 4K9ZA 1ERTA 4ECBA 3ZITA 3GV1A 1GTBA 4KUNA 2P5RA 4WBRD 1H4OA 2WS2A 5DAKA 5H5SA 2J23A 5DJMA 4DSSB 2P0GA 5F05A 1PN9A 4PUFC 4J2FA 1OC3A 1EOGA 1ON4A 5EY6A 4IS0A 4TVEA 2WFCA 4ML1A 3WD6A 1AAZA 2OACA 5CRHA 1ZYEA 3O6TA 4MZWA 2IFQB 4IW9A 4WKWA 3KTBA 2BMXA 3P7XA 5CYYA 1K0OA 2JACA 4DSRA 3IR4A 2BJXA 4L5LA 4JZQA 1ZYQB 2X99A 1FVJA 4HZ4A 2FWFA 3BJ5A 1IYHA 2CA8A 2DIYA 5A5KA 3VWUA 3L9SA 4YQMA 5DCGA 3TKSA 4MK3A 1JZWA 4K0GA 1XBSA 4V2MA 2B6MA 4IP6A 4POBA 2TRCP 5ID2A 5DALA 4IKHA 3CXGA 2HT9A 2OA7A 1FW1A 2N5BA 3C8EA 1GSFA 2WCIA 3D5JA 2V2GA 4BVXA 5G31A 1M2AA 5IPHA 1WJKA 4AJ7A 5CRWA 3VLNA 2NVLA 1XFLA 2M46A 2IMEA 3BD2A 4FO5A 2B1LA 2IMDA 3A3TA 1WIKA 1V40A 4O7HA 3FK8A 4OFNA 3N9JA 3LYKA 1XPVA 3N5OA 3MNGA 4IQ1A 3FZAA 1XW9A 1EGOA 4WR5A 5JCGA 4HS1A 2L5LA 3BCIA 1GSDA 1EZKA 3RBTA 4IBPA 1QQ2A 1F37A 3HZ8A 3GMFA 3CMIA 2L4QA 4MCUA 3KM6A 9GSSA 4I6XA 2DC5A 3IXRA 5G2ZA 3VWVA 1EEMA 4QL9A 2CX3A 4TW5A 5AGYA 3KJYA 1BG5A 4KW6A 5FHIA 4TN8A 1UC7A 3EC3A 1OE7A 2VLUA 1PX6A 5IO2A 2R5GA 1N2AA 3I6AA 5DAKB 2IJYA 4F0CA 4EO3A 5G1LA 1F6MC 1VF3A 3HJPA 2YV7A 2H8LA 6GSTA 4JBBA 3F4TA 3F9UA 2X8HA 2X8CA 3ME7A 3L9UA 4ZXGA 5IMZA 1TRVA 2XBQA 4ZB6A 1VGLA 1LJRA 2CVBA 2CT6A 2HYXA 2L59A 1Z9HA 3A2XA 5ECIB 2H73A 3TUEA 3VURA 5D9XA 3DGQA 1H75A 1GUMA 3ED3A 2LUSA 2R3XA 3FHKA 2H19A 3O76A 5ECOB 3Q19A 2E0QA 2HE3A 1KNGA 1GTUA 3DWVA 1FB0A 1ZOFA 3QFAC 3FR6A 3GL5A 3IK7A 4NHWA 1M99A 3LJRA 1VF1A 1O8XA 3TJGA 4MJAA 3HJOA 1K3OA 4FYBA 1EOHA 1GNWA 2DBCA 4LL1B 5AISA 1UN2A 2P5QA 3LORA 2DJJA 2IMFA 1M9BA 4K7NA 5ID2B 1GNEA 5DALB 3GKNA 2H1BA 4GSTA 3MSZA 4G2EA 2PERA 4AGSA 2G0FA 1NHYA 5D9WA 2VCZA 3G9BA 2KHPA 2NDOA 4IQAA 4PNFA 3MWHA 3R2QA 4YQVA 5IMVA 3F6DA 5FWGA 1GTAA 3KP9A 20GSA 2GLRA 4TXVA 3TB2A 1Z7PA 1A0FA 2OE0A 1NSWA 2M72A 3QPMA 1PSQA 2LS5A 3QAWA 3I69A 3CTFA 5IMDA 17GSA 2GZPA 2C0GA 2MBTA 1EP7A 2KP2A 2QSIA 1QXHA 2G2QA 1F9MA 3WYWA 2GZZA 2F3MA 1GSSA 3CSIA 3HXSA 3TCOA 3M1GA 2LNTA 1OE8A 4KSOA 3FZ4A 1PA3A 2IMKA 2V6KA 2VCXA 3TOTA 2L6CA 2K8VA 1GSQA 3E0UA 4K0NA 5ELGA 1ZCPA 3G7YA 3FRCA 4ZIJA 3ZL5A 1V98A 4L0UA 1ILOA 4XRDA 18GSA 1EWXA 3TDGA 3ZIJA 2H1GA 1A24A 3GURA 3DYRA 1FAAA 3QAGA 5G30A 3F63A 4ZILA 3Q6OA 4WR4A 4ZB8A 1XWKA 5ELAA 1A8YA 3KCMA 1X9SB 3UBLA 2AYTA 5KEJA 1RQMA 4ECJA 4YH2A 4AF2A 4F03A 2H74A 4NV5A 4I2TA 3H79A 3S9FA 3ZMLA 5HR3A 1JZOA 2YZHA 1QUWA 3HDCA 1N8JA 1O81A 3UVTA 1A2LA 2H76A 1PGTA 1AQVA 1TK8B 1M2BA 2XHFA 2N5FA 2C0DA 1XWBA 5A4VA 1FHEA 3TKSE 1SJIA 4N30A 2ALBA 3ME8A 1XIYA 3TKPA 4EVMA 2RIIA 2FWHA 4MJCA 4GSNA 3DD3A 3HVVA 2WZ9A 1XW6A 4K7OA 5INYA 4O92A 2H71A 2YWNA 2CV4A 3F8UA 1SL1B 2J9HA 5AIXA 2HNLA 4HJMA 4I8BA 3APOA 2V32A 3F4SA 3KXOA 2F8AA 2HZEA 2H72A 2R4VA 4PGTA 3L0HA 1T8EB 2RM5A 4BL7A 3FY7A 3GH6A 1V58A 2VL3A 2YWMA 1TW9A 3M0FA 2RM6A 1UVZA 4GQFA 2VCTA 1SL0B 1HYUA 3IA1A 2H30A 2B5YA 1SYRA 4JR6A 5CO3A 1BAYA 4LLRA 5IMFA 4Q5QA 3WT2A 2EIRA 2B7JA 4N10A 2PUKC 1I9DA 4IP1A 5ECPB 4X0XA 3VWXA 3LGCA 1K0CA 2F51A 2V1MA 1MTCA 4GLTA 3QFBC 3A2VA 5L71A 3KH7A 3W8SA 4OCFA 3GSTA 3NOFA 1Y6EA 2VLTA 3KZQA 3LG6A 1TKDB 5KN0A 4ULXA 2ZCTA 5IPGA 1R7HA 2A2SA 2JADA 2LRCA 4HUAA 2GT6A 2VIMA 3HD5A 1AQXA 6GSSA 1ERVA 1JLWA 3J7Yk 4KB3A 4P3YB 4I2UA 1EV9A 3GA4A 5H5QA 4HI7A 1WMJA 1DSBA 3L78A 2YNXA 6GSUA 4IN0A 4WF5A 3APQA 4I97A 3APSA 1Q4JA 4FIWA 4RUVA 4MH2A 3UOMA 4HQSA 5D8IA 1HNCA 4HU7A 2FWEA 1TU8A 5F06A 3Q18A 4EL1A 4OO4A 1VF4A 1PQNA 4MPFA 4NWYA 2I81A 5ECHB 1EV4A 4KCEA 5IIZA 3TKQA 3CYNA 4OO5A 3TRXA 3O3TA 4MF6A 2HZEB 3IBHA 2R37A 5H5RA 2GQLA 2LJAA 5B8AA 3CSJA 3QD9A 5DDLA 4BWSA 1C72A 3C71A 2WDUA 5GSSA 4K8MA 3H8QA 5B7CA 4OFTA 3UL3A 1EP8A 1PRXA 2B5EA
chains in the Genus database with same CATH superfamily
5D73A 3TJKA 13GSA 3TRPA 4PNGA 3HVXA 11GSA 2TIRA 1LBKA 4OFMA 5J4UA 4KSMA 4ZL8A 2CVKA 2H0HA 2GSQA 1U88A 5LCZA 8GSSA 1PKZA 3TJFA 1KEBA 4G10A 4TR4A 2R2JA 4X43A 2X8GA 2QA2A 3ERGA 1A23A 3H4KA 4XS4A 2H75A 3V1WA 2IN3A 4IELA 1OC8A 5GAND 2IL3A 2KOKA 4KDUA 3TRQA 1MDKA 3P2AA 2I4AA 3RDWA 12GSA 4IJ3A 2M80A 1XVWA 3F0IA 2MYGA 3FEUA 1J9BA 3JCML 2WJUA 2RUEA 5ECLB 4BWQA 3LXTA 1SKRB 3GL3A 5G5FA 2REMA 3MIXA 4OWYA 3OR5A 3WGXA 2LRNA 5ECRB 1OC9A 3J7Yb 3EMXA 1OAZA 2FNOA 4ECIA 2X49A 1TK0B 2AAWA 4FH8A 2MMNA 1FG4A 19GSA 1KTEA 1RK4A 2ES7A 2R6KA 2FY6A 5B6MA 2GDRA 1TI3A 2H0GA 3LSZA 2RLIA 2HXKA 1PMTA 1AXDA 4TR0A 4YAVA 1YY7A 2C0FA 5GSTA 1DE2A 1B48A 4HZ2A 3HVSA 4JEDA 2JZSA 2D2ZA 4LA1A 4BPYA 5CNWA 1IYIA 2OE3A 1DE1A 22GSA 3ZVJD 1LU4A 1I5GA 2H01A 2E2GA 2KP1A 2H1AA 2H6ZA 1O73A 3D22A 3BCKA 1SK0A 5J9BA 5HR1A 2VOCA 1WP0A 4EKZA 1Z7RA 1GUKA 3IHGA 3SBCA 3CQFA 3DVXA 3QMXA 1XZOA 1O6JA 3CTGA 4XS1A 3RHBA 4EIQA 4EC0A 1J0FA 2MBSA 5ECNB 1TRSA 4L8EA 4BVXB 4IGJA 3BOAA 1BYEA 1B9YC 1SKWB 1S3DA 3UBKA 2PN8A 2PBJA 2R0GA 4Z2RA 3SWLA 1YF0A 3IE3A 4IJIA 3VK9A 1GLQA 3HHVA 5DQSA 2WULA 1W89A 1TK5B 1HQOA 3L9VA 1TJDA 4N11A 4F2IA 2JL4A 1U3AA 1ZL9A 2GSSA 5DJLA 2MMZA 4EXJA 4V1Ag 2DMLA 2JU5A 4XS6A 1O85A 3WGDA 4MPGA 2WB9A 2LKUA 1B8XA 5EL8A 3GN3A 5J3RA 3QOUA 4HOJA 3GHAA 2C80A 1B4PA 2MMAA 4XS4B 1AC1A 5J5NA 5HFGA 1T00A 3VPQA 5FT3A 1T7PB 5IM9A 3ERFA 1MD3A 4ML6A 3C1SA 4YKGA 1NHOA 1SU9A 2L57A 2YWOA 4ISDA 4G19A 1X9MB 3GSSA 1JFUA 1QK8A 5COHA 1VRSD 1HNAA 4KDXA 1YEPA 4ACSA 4POLA 1TRWA 5JWOB 1SK1A 4PQ1A 4K7IA 1OC9B 1YEXA 4HEA2 4AJ8A 1M3JA 1AQWA 4XHMA 2LSTA 4E8EA 3HZ4A 1TP9A 1XWCA 1BJXA 4Q5FA 4K6XA 2CQ9A 4XRAA 2JSZA 2GZYA 1V2AA 4KA0A 4MLYA 2GS3A 2H1DA 2DJ1A 4TR1A 4RI7A 2QC7A 2VL2A 4V2NA 3IPZA 5HR0A 3G7IA 1ML6A 4F0BA 4N0VA 1Z3EA 2JZTA 4TOPA 3EE2A 4X1UA 1M0UA 4FYUA 3ZMKA 5D9VA 3CRTA 1KBNA 4ILFA 2O8VB 2PWJA 3IK9A 1WRYA 3IC8A 3NIVA 4PQHA 4Z7XA 3PH9A 5B6NA 2C3NA 1A2JA 1A0RP 1GH2A 1JZDA 2AUVA 1G6YA 3ZFLA 4O32A 2FCHA 4GQCA 2FA4A 6GSVA 3A5IA 3GTUA 3L4NA 4ZBDA 3UARA 1X5CA 4LMVA 1ABAA 3ZIVA 4G0KA 1XWGA 1FVKA 1ACVA 3F3RA 4LMWA 3IHQA 2DLXA 3F3QA 1FO5A 1ZZYA 2VCVA 3RPNA 2DJ0A 4MABA 4MA9A 1THOA 4WXTA 2HZFA 3CBUA 5ECMB 1E2YA 4HDEA 1K0DA 1ERWA 1T3BA 4JE1A 2GGTA 1MDIA 1W4VA 3QAVA 4MF5A 1OKDA 4IHUA 2YCDA 1ZMAA 1YDKA 5CRGA 5ABRA 4BA7A 1SD8A 3Q74A 4POKA 2LRTA 16GSA 2I1UA 3F6FA 3FKFA 4WBJA 5DQYA 2DSAA 3GUSA 1F3AA 3HA9A 4L0WA 6GSYA 2LEGA 2IPAA 3GKKA 4NPBA 1TI1A 2F9SA 2I3YA 1DBYA 3ERWA 3NZNA 4KDYA 3KMOA 2HRNA 5CREA 3IAS2 4FQUA 1M2DA 3RAZA 3H1NA 5HFKA 4POMA 3EYTA 5DBQA 4CHSA 4NXIA 2CX4A 4H86A 2OADA 2LQOA 2A4VA 4EUYA 1AW9A 2X64A 5G5EA 4F9ZA 2QKEA 3M3MA 5A4WA 4CW9A 1GUHA 4GTUA 4TR1B 4RQXA 1XVQA 1GSEA 4RI6A 1K3YA 4O5RA 1MD4A 3KGKA 3I9V2 1SKSB 1THXA 2V6OA 5LNKe 2FHEA 3CSHA 3ZFBA 1PX7A 3DKSA 3GRXA 2OE1A 2H6XA 3EINA 3GKXA 2HRFA 1RW1A 1M7TA 1GL8A 3FYGA 2ZUPA 3P90A 3M8NA 4WEYA 1ZGNA 4YAPA 3CRUA 1OKTA 3LW9A 2H0IA 2VL9A 3GFKA 1YKAA 2YJHA 3GKMA 1DUGA 2KLXA 4YKFA 4TXOA 4WF4A 1V57A 2L5OA 4J56E 3M9JA 3C73A 4PURA 3FR9A 1M9AA 4HJ2A 4XCSA 1XOBA 2AHEA 1JLVA 3M9KA 3GTUB 2VL2C 5F8BA 2GSRA 2C3QA 2C0EA 4USSA 2GQMA 4EF0A 3H93A 4KNDA 1QGVA 4GRFA 5ECSA 5EPFA 1JHBA 1V9WA 5J9CA 5DCHA 3KMNA 5IOWA 3GYKA 2LTKA 1XW5A 4XIHA 2C1YA 3DVWA 4HQZA 1X5EA 1BEDA 4TRXA 3VFIA 5EVOA 2YANA 1NW2A 2O87A 4MMMA 1GLPA 3LQ7A 5AN1A 3GH9A 2JSYA 3I43A 4KE3A 1QMVA 5B8BA 2AV4A 4HU9A 4ZL7A 2CZ3A 3US3A 1PL2A 2VM1A 4GXZA 1YKCA 3FZ5A 4GWRA 1GTIA 4MJBA 2DIZA 1SL2B 4DEJA 2DKHA 1R5PA 3VI5A 5ENUA 1URMA 2OBKA 3F4RA 3K8NA 1BX9A 3A2WA 3KD0A 3D21A 4O5QA 2RUFA 4MDCA 3FZ9A 3C7MA 1XG8A 3FW2A 2HI7A 2EIQA 4D73A 5G1KA 3EU4A 4Z2TA 2DJKA 3P8WA 1EEJA 1SJZA 3ZYWA 1YF1A 2ZNMA 2C4JA 3ZZXA 4PX1A 4MH3A 4KGIA 2C8UA 1F3BA 2CZ2A 3GX8A 4L5OA 2A2RA 1WOUA 3EWLA 2K8SA 2HLSA 1K3LA 5F0GA 5ECKB 5A4UA 2IIYA 2O89A 5IOXA 5D93A 2MMOA 4RQRA 5JWRB 1AIUA 2EC4A 3TJJA 1JZRA 2ON7A 2P31A 2K18A 1BQ7A 4OCEA 4OD7A 4ZBBA 1XWAA 5GAPD 1GSUA 3EURA 4OMVA 4MZBA 4KX4A 3FR3A 4Q5RA 1K0MA 3VI7A 4MNNA 2K6VA 4TR3A 5CAXA 1S3CA 5IQYA 1X0RA 3UAPA 3EVIA 4TXOB 5DVBA 4ZBAA 5IMAA 3IV4A 4JU5A 6GSWA 3W8JA 2VD0A 1U87A 3MAKA 10GSA 3RHCA 2JZRA 3UEMA 3DRNA 1UA5A 2DMMA 2O7KA 1T1VA 3DIEA 2HSYA 2VLVA 2IMIA 1NM3A 4WETA 5HQPA 2EIOA 2QA1A 1K0NA 5ECQB 3IC4A 3E3EA 2FA8A 2XPDA 1XOAA 5KN2A 4AJ6A 3ZRDA 3LYPA 3TGZA 5LD0A 1QFNA 4N0ZA 3KEBA 3TJBA 2LJRA 4GSSA 1SD9A 2L4CA 3UVHA 1XXUA 1B4QA 3VPTA 3EU3A 2GT5A 2B3SA 1GWCA 1G7EA 2PMTA 3VWWA 5JCWA 1CQGA 2H6YA 4K1FA 1EGRA 4NMUA 1TOFA 3TOUA 3MDKA 1ERUA 1USBA 3KH9A 5HFIA 4MP4A 2PPTA 3HYPA 2VUPA 5E59A 3RPPA 1YZXA 3AY8A 1K0BA 2VCQA 4XTSA 3GIXA 3LEFA 3KP8A 5IO0A 4F82A 4KH7A 4PXOA 2LJKA 3UMAA 4D73B 1OVNA 3IRAA 4EE0A 3D0ZA 2L6DA 2MZCA 1HD2A 4QQ7A 2NPBA 2VM2A 1U3IA 2YV9A 3D6IA 1F2EA 1OYJA 2IWTA 4DSQA 1Z6NA 3HKRA 3TKSC 2CAQA 4CDOA 1Z5YE 1R5AA 1AUCA 3U5RE 5BRTA 4JRRA 3LFLA 1SYXA 1G0TA 3WT1A 3ZTLA 2NTOA 3HY2A 2I9HA 3IOSA 2DJ2A 2N5AA 1PKWA 4GCIA 4MJEA 2YP6A 1X5DA 1B9XC 1R4WA 1A8LA 4KAEA 4E8HA 2XBIA 5F07A 2K9FA 2XC2A 3R3EA 2UZ8A 3DEXA 1M3IA 5KN1A 1TTZA 1G6WA 1R26A 3ZREA 2H66A 2VCWA 2FWGA 4ID0A 5JCUA 3GNJA 5E4WA 1TRUA 2FGXA 2PVOC 1S3AA 2F8FA 1GSYA 2YZUA 1E6BA 1O7UA 3QR6A 1TDIA 1T4ZA 5KOXA 2AB6A 5C04A 2WGRA 2HFDA 1ST9A 1YQ1A 2ON5A 5KN3A 3DXBA 2LV3A 2OKAA 4V1Ap 3ISOA 4LL4B 2H70A 2CAIA 2BTOT 2LQQA 2WRTA 1GULA 2LNSA 1GRXA 1FB6A 3D4MA 1PD21 2V41A 3PR8A 3C1RA 2FLSA 1MEKA 4DSSA 1T4YA 2GTUA 1PL1A 1ZYNA 3KTLA 4ZL9A 5D9TA 5C00A 4G9HA 2QGVA 1GP1A 4Q5NA 2DJ3A 3E9JB 2GSTA 5HR2A 1Z6MA 2KUCA 3A5WA 1Y25A 2GVPA 4MF7A 1SENA 2IFQA 5AIVA 5JWQB 3ZLPA 4J57E 2VAFA 5CRDA 1TU7A 2NBSA 3D4TA 3PGTA 1CQHA 1VF2A 1WE0A 2B1KA 4K2DA 5KOWA 3IAM2 5GZZB 2B7KA 2PGTA 3DMLA 1X9WB 2TRXA 4MZCA 4KCAA 2HSHA 1SJ6A 4NHZA 4KF9A 2GQKA 3G7JA 3KIJA 14GSA 3HJMA 4NAXA 4JR4A 5IMCA 4YQUA 3ZVJA 1S3RA 1O8WA 2OJLA 3TKRA 4BVYA 1TXXA 4QL7A 5D96A 2E7PA 4I5QA 4NV2A 2PU9C 2FD3A 3U6VA 3EMPA 4GF0A 2OBIA 1HNBA 3HCZA 2B5XA 3QCPA 4IVFA 4EDYA 4ZB9A 2VO4A 2FUG2 2YPMA 3LXZA 5CP1A 1WPIA 1A2MA 3WGEA 3W6GA 2E2MA 2YOIA 1XCCA 4ECCA 4FYCA 1MDJA 2Z9SA 1G7OA 2PVQA 4PUAA 5J41A 3GX0A 6GSXA 3UJ1A 2C3TA 2YN1A 2O85A 1Q98A 3UIWA 3QDNA 2XPEA 4HSCX 1U6TA 4DVCA 3LWAA 4TKYA 1WWJA 2CVDA 3BBYA 2AJQB 7GSSA 1K0AA 1YJ6A 2YWIA 1SK2A 3IDVA 4EDZA 4PQIA 2YJ7A 1FOVA 2VD1A 4V2LA 3PINA 1J08A 4K9ZA 1ERTA 4ECBA 3ZITA 3GV1A 1GTBA 4KUNA 2P5RA 4WBRD 1H4OA 2WS2A 5DAKA 5H5SA 2J23A 5DJMA 4DSSB 2P0GA 5F05A 1PN9A 4PUFC 4J2FA 1OC3A 1EOGA 1ON4A 5EY6A 4IS0A 4TVEA 4EIPA 2WFCA 4ML1A 3EPTA 3WD6A 1AAZA 2OACA 5CRHA 1ZYEA 3O6TA 4MZWA 2IFQB 4IW9A 4WKWA 3KTBA 2BMXA 3P7XA 5CYYA 1K0OA 2JACA 4DSRA 3IR4A 2R0CA 2BJXA 4L5LA 4JZQA 1ZYQB 2X99A 4K2XA 1FVJA 4HZ4A 2FWFA 3BJ5A 1IYHA 2CA8A 2DIYA 4Z2UA 5A5KA 3VWUA 3L9SA 4YQMA 5DCGA 3TKSA 4MK3A 1JZWA 4K0GA 1XBSA 4V2MA 2B6MA 4IP6A 4POBA 2TRCP 5ID2A 5DALA 4IKHA 2HRAA 3CXGA 2HT9A 2OA7A 1FW1A 3FMWA 2N5BA 3C8EA 1GSFA 2WCIA 3D5JA 2V2GA 4BVXA 5G31A 1M2AA 5IPHA 1WJKA 4AJ7A 5CRWA 3MYDA 3VLNA 2NVLA 1XFLA 2M46A 2IMEA 4CY6A 3BD2A 4FO5A 2B1LA 2IMDA 3A3TA 1WIKA 1V40A 4O7HA 3FK8A 4G0IA 4OFNA 3N9JA 3LYKA 1XPVA 3N5OA 3MNGA 4IQ1A 3FZAA 1XW9A 1EGOA 4WR5A 5JCGA 4HS1A 2L5LA 3BCIA 1GSDA 1EZKA 3RBTA 4IBPA 1QQ2A 1F37A 1FOHA 3HZ8A 3GMFA 3CMIA 2L4QA 4MCUA 3KM6A 9GSSA 4I6XA 4K5RA 2DC5A 3IXRA 2X4AA 5G2ZA 3VWVA 1EEMA 4QL9A 2CX3A 4TW5A 5AGYA 3KJYA 1BG5A 4KW6A 5FHIA 4TN8A 1UC7A 3EC3A 1OE7A 2HRKA 2VLUA 1PX6A 5IO2A 2R5GA 1N2AA 3I6AA 5DAKB 2IJYA 4F0CA 4EO3A 5G1LA 1F6MC 1VF3A 3HJPA 2YV7A 2H8LA 6GSTA 4JBBA 3F4TA 4X4JA 3F9UA 1PN0A 2X8HA 2X8CA 3ME7A 3L9UA 4ZXGA 5IMZA 1TRVA 2XBQA 4ZB6A 1VGLA 1LJRA 2CVBA 2CT6A 2HYXA 2L59A 1Z9HA 3A2XA 5ECIB 5BMUA 2H73A 3TUEA 3VURA 2HSMA 5D9XA 3DGQA 1H75A 1GUMA 3ED3A 2LUSA 2R3XA 3FHKA 2H19A 3O76A 5ECOB 3Q19A 2E0QA 2HE3A 1KNGA 1GTUA 3DWVA 2R0PA 1FB0A 1ZOFA 3QFAC 3FR6A 3GL5A 3IK7A 4NHWA 1M99A 1ZYPA 3LJRA 1VF1A 1O8XA 3TJGA 4MJAA 3HJOA 1K3OA 4FYBA 1EOHA 1GNWA 2DBCA 4LL1B 5AISA 1UN2A 2P5QA 3LORA 2DJJA 2IMFA 1M9BA 4K7NA 5ID2B 1GNEA 5DALB 3GKNA 3HVNA 2H1BA 4GSTA 3MSZA 4G2EA 2PERA 4AGSA 2G0FA 1NHYA 5D9WA 2VCZA 3G9BA 2KHPA 2NDOA 4IQAA 4PNFA 3MWHA 3R2QA 4YQVA 5IMVA 3F6DA 5FWGA 1GTAA 3KP9A 20GSA 2GLRA 4TXVA 3TB2A 1Z7PA 1A0FA 2OE0A 1NSWA 2M72A 3QPMA 1PSQA 2LS5A 3QAWA 3I69A 4ICYA 3CTFA 5IMDA 17GSA 2GZPA 2C0GA 2MBTA 1EP7A 2KP2A 2QSIA 1QXHA 2G2QA 1F9MA 3WYWA 2GZZA 2F3MA 1GSSA 3CSIA 3HXSA 3TCOA 3M1GA 2LNTA 1OE8A 4KSOA 3FZ4A 1PA3A 2IMKA 2V6KA 2VCXA 3TOTA 2L6CA 4O5UA 2K8VA 1GSQA 3E0UA 4K0NA 5ELGA 1ZCPA 3G7YA 3FRCA 4ZIJA 3ZL5A 1V98A 4L0UA 1ILOA 4XRDA 18GSA 1EWXA 3TDGA 3ZIJA 2H1GA 1A24A 2A4HA 3GURA 3DYRA 1FAAA 3QAGA 5G30A 3F63A 4ZILA 3Q6OA 4WR4A 4ZB8A 1XWKA 5ELAA 1A8YA 3KCMA 1X9SB 3UBLA 2A2PA 2AYTA 5KEJA 1RQMA 4ECJA 4YH2A 4AF2A 4F03A 2H74A 4NV5A 4I2TA 3H79A 3S9FA 3ZMLA 5HR3A 1JZOA 4A5PA 2YZHA 1QUWA 3HDCA 1N8JA 1O81A 3UVTA 1A2LA 2H76A 1PGTA 1AQVA 1TK8B 1M2BA 2XHFA 2N5FA 2C0DA 1XWBA 5A4VA 1FHEA 4K5SA 3TKSE 1SJIA 4N30A 2ALBA 3ME8A 1XIYA 3TKPA 4EVMA 2RIIA 2FWHA 4MJCA 4GSNA 3DD3A 3HVVA 2WZ9A 1XW6A 4K7OA 5INYA 4O92A 2H71A 2YWNA 2CV4A 3F8UA 1SL1B 2J9HA 5AIXA 2HNLA 4HJMA 4I8BA 3APOA 2V32A 3F4SA 3KXOA 2F8AA 2HZEA 2H72A 2R4VA 4PGTA 3L0HA 1T8EB 2RM5A 4BL7A 3FY7A 3GH6A 1V58A 2VL3A 2YWMA 1TW9A 3M0FA 2RM6A 1UVZA 4GQFA 2VCTA 1SL0B 1HYUA 3IA1A 2H30A 2B5YA 1SYRA 4JR6A 5CO3A 1BAYA 4LLRA 5IMFA 4Q5QA 3WT2A 2EIRA 2B7JA 4N10A 2PUKC 1I9DA 4IP1A 5ECPB 4X0XA 3VWXA 3LGCA 1K0CA 2F51A 2V1MA 1MTCA 4GLTA 3QFBC 3A2VA 4G0LA 5L71A 3KH7A 3W8SA 4OCFA 3GSTA 3NOFA 1Y6EA 4CY8A 2VLTA 3KZQA 3LG6A 1TKDB 3PPUA 5KN0A 4ULXA 2ZCTA 5IPGA 1R7HA 2A2SA 2JADA 2LRCA 4HUAA 2GT6A 2VIMA 3HD5A 1AQXA 6GSSA 1ERVA 1PFOA 1JLWA 3J7Yk 4KB3A 4P3YB 4I2UA 1EV9A 3GA4A 5H5QA 4HI7A 1WMJA 1DSBA 3L78A 2YNXA 6GSUA 4IN0A 4WF5A 3APQA 4I97A 3APSA 1Q4JA 4FIWA 4RUVA 4MH2A 3UOMA 2DKIA 4HQSA 5D8IA 1HNCA 4BIKA 4HU7A 2FWEA 1TU8A 5F06A 3Q18A 4EL1A 4OO4A 1VF4A 1PQNA 4MPFA 4NWYA 2I81A 5ECHB 1EV4A 4KCEA 4PTSA 5IIZA 3TKQA 3CYNA 4OO5A 3TRXA 3O3TA 4MF6A 2HZEB 3IBHA 2R37A 5H5RA 2GQLA 2LJAA 4BVYB 5B8AA 3CSJA 3QD9A 5DDLA 4BL7B 4BWSA 1C72A 3C71A 2WDUA 5GSSA 4K8MA 3H8QA 5B7CA 4OFTA 3UL3A 1EP8A 1PRXA 2B5EA
chains in the Genus database with same CATH topology
5D73A 3TJKA 13GSA 3TRPA 4PNGA 3HVXA 11GSA 2TIRA 1LBKA 4OFMA 5J4UA 4KSMA 4ZL8A 2CVKA 2H0HA 2GSQA 1U88A 5LCZA 8GSSA 1PKZA 3TJFA 1KEBA 4G10A 4TR4A 2R2JA 4X43A 2X8GA 2QA2A 3ERGA 1A23A 3H4KA 4XS4A 2H75A 3V1WA 2IN3A 4IELA 1OC8A 5GAND 2IL3A 2KOKA 4KDUA 3TRQA 1MDKA 3P2AA 2I4AA 3RDWA 12GSA 4IJ3A 2M80A 1XVWA 3F0IA 2MYGA 3FEUA 1J9BA 3JCML 2WJUA 2RUEA 5ECLB 4BWQA 3LXTA 1SKRB 3GL3A 5G5FA 2REMA 3MIXA 4OWYA 3OR5A 3WGXA 2LRNA 5ECRB 1OC9A 3J7Yb 3EMXA 1OAZA 2FNOA 4ECIA 2X49A 1TK0B 2AAWA 4FH8A 2MMNA 1FG4A 19GSA 1KTEA 1RK4A 2ES7A 2R6KA 2FY6A 5B6MA 2GDRA 1TI3A 2H0GA 3LSZA 2RLIA 2HXKA 1PMTA 1AXDA 4TR0A 4YAVA 1YY7A 2C0FA 5GSTA 1DE2A 1B48A 4HZ2A 3HVSA 4JEDA 2JZSA 2D2ZA 4LA1A 4BPYA 5CNWA 1IYIA 2OE3A 1DE1A 22GSA 3ZVJD 1LU4A 1I5GA 2H01A 2E2GA 2KP1A 2H1AA 2H6ZA 1O73A 3D22A 3BCKA 1SK0A 5J9BA 5HR1A 2VOCA 1WP0A 4EKZA 1Z7RA 1GUKA 3IHGA 3SBCA 3DVXA 3QMXA 1XZOA 1O6JA 3CTGA 4XS1A 3RHBA 4EIQA 4EC0A 1J0FA 2MBSA 5ECNB 1TRSA 4L8EA 4BVXB 4IGJA 3BOAA 1BYEA 1B9YC 1SKWB 1S3DA 3UBKA 2PN8A 2PBJA 2R0GA 4Z2RA 3SWLA 1YF0A 3IE3A 4IJIA 3VK9A 1GLQA 3HHVA 5DQSA 2WULA 1W89A 1TK5B 1HQOA 3L9VA 1TJDA 4N11A 4F2IA 2JL4A 1U3AA 1ZL9A 2GSSA 5DJLA 2MMZA 4EXJA 4V1Ag 2DMLA 2JU5A 4XS6A 1O85A 3WGDA 4MPGA 2WB9A 2LKUA 1B8XA 5EL8A 3GN3A 5J3RA 3QOUA 4HOJA 3GHAA 2C80A 1B4PA 2MMAA 4XS4B 1AC1A 5J5NA 5HFGA 1T00A 3VPQA 5FT3A 1T7PB 5IM9A 3ERFA 1MD3A 4ML6A 3C1SA 4YKGA 1NHOA 1SU9A 2L57A 2YWOA 4ISDA 4G19A 1X9MB 3GSSA 1JFUA 1QK8A 5COHA 1VRSD 1HNAA 4KDXA 1YEPA 4ACSA 4POLA 1TRWA 5JWOB 1SK1A 4PQ1A 4K7IA 1OC9B 1YEXA 4HEA2 4AJ8A 1AQWA 4XHMA 2LSTA 4E8EA 3HZ4A 1TP9A 1XWCA 1BJXA 4Q5FA 4K6XA 2CQ9A 4XRAA 2JSZA 2GZYA 1V2AA 4KA0A 4MLYA 2GS3A 2H1DA 2DJ1A 4TR1A 4RI7A 2QC7A 2VL2A 4V2NA 3IPZA 5HR0A 3G7IA 1ML6A 4F0BA 4N0VA 1Z3EA 2JZTA 4TOPA 3EE2A 4X1UA 1M0UA 4FYUA 3ZMKA 5D9VA 3CRTA 1KBNA 4ILFA 2O8VB 2PWJA 3IK9A 1WRYA 3IC8A 3NIVA 4PQHA 4Z7XA 3PH9A 5B6NA 2C3NA 1A2JA 1A0RP 1GH2A 1JZDA 2AUVA 1G6YA 3ZFLA 4O32A 2FCHA 4GQCA 2FA4A 6GSVA 3A5IA 3GTUA 3L4NA 4ZBDA 3UARA 1X5CA 4LMVA 1ABAA 3ZIVA 4G0KA 1XWGA 1FVKA 1ACVA 3F3RA 4LMWA 3IHQA 2DLXA 3F3QA 1FO5A 1ZZYA 2VCVA 3RPNA 2DJ0A 4MABA 4MA9A 1THOA 4WXTA 2HZFA 3CBUA 5ECMB 1E2YA 4HDEA 1K0DA 1ERWA 1T3BA 4JE1A 2GGTA 1MDIA 1W4VA 3QAVA 4MF5A 1OKDA 4IHUA 2YCDA 1ZMAA 1YDKA 5CRGA 5ABRA 4BA7A 1SD8A 3Q74A 4POKA 2LRTA 16GSA 2I1UA 3F6FA 3FKFA 4WBJA 5DQYA 2DSAA 3GUSA 1F3AA 3HA9A 4L0WA 6GSYA 2LEGA 2IPAA 3GKKA 4NPBA 1TI1A 2F9SA 2I3YA 1DBYA 3ERWA 3NZNA 4KDYA 3KMOA 2HRNA 5CREA 3IAS2 4FQUA 1M2DA 3RAZA 3H1NA 5HFKA 4POMA 3EYTA 5DBQA 4CHSA 4NXIA 2CX4A 4H86A 2OADA 2LQOA 2A4VA 4EUYA 1AW9A 2X64A 5G5EA 4F9ZA 2QKEA 3M3MA 5A4WA 4CW9A 1GUHA 4GTUA 4TR1B 4RQXA 1XVQA 1GSEA 4RI6A 1K3YA 4O5RA 1MD4A 3KGKA 3I9V2 1SKSB 1THXA 2V6OA 5LNKe 2FHEA 3CSHA 3ZFBA 1PX7A 3DKSA 3GRXA 2OE1A 2H6XA 3EINA 3GKXA 2HRFA 1RW1A 1M7TA 1GL8A 3FYGA 2ZUPA 3P90A 3M8NA 4WEYA 1ZGNA 4YAPA 3CRUA 1OKTA 3LW9A 2H0IA 2VL9A 3GFKA 1YKAA 2YJHA 3GKMA 1DUGA 2KLXA 4YKFA 4TXOA 4WF4A 1V57A 2L5OA 4J56E 3M9JA 3C73A 4PURA 3FR9A 1M9AA 4HJ2A 4XCSA 1XOBA 2AHEA 1JLVA 3M9KA 3GTUB 2VL2C 5F8BA 2GSRA 2C3QA 2C0EA 4USSA 2GQMA 4EF0A 3H93A 4KNDA 1QGVA 4GRFA 5ECSA 5EPFA 1JHBA 1V9WA 5J9CA 5DCHA 3KMNA 5IOWA 3GYKA 2LTKA 1XW5A 4XIHA 2C1YA 3DVWA 4HQZA 1X5EA 1BEDA 4TRXA 3VFIA 5EVOA 2YANA 1NW2A 2O87A 4MMMA 1GLPA 3LQ7A 5AN1A 3GH9A 2JSYA 3I43A 4KE3A 1QMVA 5B8BA 2AV4A 4HU9A 4ZL7A 2CZ3A 3US3A 1PL2A 2VM1A 4GXZA 1YKCA 3FZ5A 4GWRA 1GTIA 4MJBA 2DIZA 1SL2B 4DEJA 2DKHA 1R5PA 3VI5A 5ENUA 1URMA 2OBKA 3F4RA 3K8NA 1BX9A 3A2WA 3KD0A 3D21A 4O5QA 2RUFA 4MDCA 3FZ9A 3C7MA 3FW2A 2HI7A 2EIQA 4D73A 5G1KA 3EU4A 4Z2TA 2DJKA 3P8WA 1EEJA 1SJZA 3ZYWA 1YF1A 2ZNMA 2C4JA 3ZZXA 4PX1A 4MH3A 4KGIA 2C8UA 1F3BA 2CZ2A 3GX8A 4L5OA 2A2RA 1WOUA 3EWLA 2K8SA 2HLSA 1K3LA 5F0GA 5ECKB 5A4UA 2IIYA 2O89A 5IOXA 5D93A 2MMOA 4RQRA 5JWRB 1AIUA 2EC4A 3TJJA 1JZRA 2ON7A 2P31A 2K18A 1BQ7A 4OCEA 4OD7A 4ZBBA 1XWAA 5GAPD 1GSUA 3EURA 4OMVA 4MZBA 4KX4A 3FR3A 4Q5RA 1K0MA 3VI7A 4MNNA 2K6VA 4TR3A 5CAXA 1S3CA 5IQYA 1X0RA 3UAPA 3EVIA 4TXOB 5DVBA 4ZBAA 5IMAA 3IV4A 4JU5A 6GSWA 3W8JA 2VD0A 1U87A 3MAKA 10GSA 3RHCA 2JZRA 3UEMA 3DRNA 1UA5A 2DMMA 2O7KA 1T1VA 3DIEA 2HSYA 2VLVA 2IMIA 1NM3A 4WETA 5HQPA 2EIOA 2QA1A 1K0NA 5ECQB 3IC4A 3E3EA 2FA8A 2XPDA 1XOAA 5KN2A 4AJ6A 3ZRDA 3LYPA 3TGZA 5LD0A 1QFNA 4N0ZA 3KEBA 3TJBA 2LJRA 4GSSA 1SD9A 2L4CA 3UVHA 1XXUA 1B4QA 3VPTA 3EU3A 2GT5A 2B3SA 1GWCA 1G7EA 2PMTA 3VWWA 5JCWA 1CQGA 2H6YA 4K1FA 1EGRA 4NMUA 1TOFA 3TOUA 3MDKA 1ERUA 1USBA 3KH9A 5HFIA 4MP4A 2PPTA 3HYPA 2VUPA 5E59A 3RPPA 1YZXA 3AY8A 1K0BA 2VCQA 4XTSA 3GIXA 3LEFA 3KP8A 5IO0A 4F82A 4KH7A 4PXOA 2LJKA 3UMAA 4D73B 1OVNA 3IRAA 4EE0A 3D0ZA 2L6DA 2MZCA 1HD2A 4QQ7A 2NPBA 2VM2A 1U3IA 2YV9A 3D6IA 1F2EA 1OYJA 2IWTA 4DSQA 1Z6NA 3HKRA 3TKSC 2CAQA 4CDOA 1Z5YE 1R5AA 1AUCA 3U5RE 5BRTA 4JRRA 3LFLA 1SYXA 1G0TA 3WT1A 3ZTLA 2NTOA 3HY2A 2I9HA 3IOSA 2DJ2A 2N5AA 1PKWA 4GCIA 4MJEA 2YP6A 1X5DA 1B9XC 1R4WA 1A8LA 4KAEA 4E8HA 2XBIA 5F07A 2K9FA 2XC2A 3R3EA 2UZ8A 3DEXA 5KN1A 1TTZA 1G6WA 1R26A 3ZREA 2H66A 2VCWA 2FWGA 4ID0A 5JCUA 3GNJA 5E4WA 1TRUA 2FGXA 2PVOC 1S3AA 2F8FA 1GSYA 2YZUA 1E6BA 1O7UA 3QR6A 1TDIA 1T4ZA 5KOXA 2AB6A 5C04A 2WGRA 2HFDA 1ST9A 1YQ1A 2ON5A 5KN3A 3DXBA 2LV3A 2OKAA 4V1Ap 3ISOA 4LL4B 2H70A 2CAIA 2BTOT 2LQQA 2WRTA 1GULA 2LNSA 1GRXA 1FB6A 3D4MA 1PD21 2V41A 3PR8A 3C1RA 2FLSA 1MEKA 4DSSA 1T4YA 2GTUA 1PL1A 1ZYNA 3KTLA 4ZL9A 5D9TA 5C00A 4G9HA 2QGVA 1GP1A 4Q5NA 2DJ3A 3E9JB 2GSTA 5HR2A 1Z6MA 2KUCA 3A5WA 1Y25A 2GVPA 4MF7A 1SENA 2IFQA 5AIVA 5JWQB 3ZLPA 4J57E 2VAFA 5CRDA 1TU7A 2NBSA 3D4TA 3PGTA 1CQHA 1VF2A 1WE0A 2B1KA 4K2DA 5KOWA 3IAM2 5GZZB 2B7KA 2PGTA 3DMLA 1X9WB 2TRXA 4MZCA 4KCAA 2HSHA 1SJ6A 4NHZA 4KF9A 2GQKA 3G7JA 3KIJA 14GSA 3HJMA 4NAXA 4JR4A 5IMCA 4YQUA 3ZVJA 1O8WA 2OJLA 3TKRA 4BVYA 1TXXA 4QL7A 5D96A 2E7PA 4I5QA 4NV2A 2PU9C 2FD3A 3U6VA 3EMPA 4GF0A 2OBIA 1HNBA 3HCZA 2B5XA 3QCPA 4IVFA 4EDYA 4ZB9A 2VO4A 2FUG2 2YPMA 3LXZA 5CP1A 1WPIA 1A2MA 3WGEA 3W6GA 2E2MA 2YOIA 1XCCA 4ECCA 4FYCA 1MDJA 2Z9SA 1G7OA 2PVQA 4PUAA 5J41A 3GX0A 6GSXA 3UJ1A 2C3TA 2YN1A 2O85A 1Q98A 3UIWA 3QDNA 2XPEA 1U6TA 4DVCA 3LWAA 4TKYA 1WWJA 2CVDA 3BBYA 2AJQB 7GSSA 1K0AA 1YJ6A 2YWIA 1SK2A 3IDVA 4EDZA 4PQIA 2YJ7A 1FOVA 2VD1A 4V2LA 3PINA 1J08A 4K9ZA 1ERTA 4ECBA 3ZITA 3GV1A 1GTBA 4KUNA 2P5RA 4WBRD 1H4OA 2WS2A 5DAKA 5H5SA 2J23A 5DJMA 4DSSB 2P0GA 5F05A 1PN9A 4PUFC 4J2FA 1OC3A 1EOGA 1ON4A 5EY6A 4IS0A 4TVEA 4EIPA 2WFCA 4ML1A 3EPTA 3WD6A 1AAZA 2OACA 5CRHA 1ZYEA 3O6TA 4MZWA 2IFQB 4IW9A 4WKWA 3KTBA 2BMXA 3P7XA 5CYYA 1K0OA 2JACA 4DSRA 3IR4A 2R0CA 2BJXA 4L5LA 4JZQA 1ZYQB 2X99A 4K2XA 1FVJA 4HZ4A 2FWFA 3BJ5A 1IYHA 2CA8A 2DIYA 4Z2UA 5A5KA 3VWUA 3L9SA 4YQMA 5DCGA 3TKSA 4MK3A 1JZWA 4K0GA 1XBSA 4V2MA 2B6MA 4IP6A 4POBA 2TRCP 5ID2A 5DALA 4IKHA 2HRAA 3CXGA 2HT9A 2OA7A 1FW1A 3FMWA 2N5BA 3C8EA 1GSFA 2WCIA 3D5JA 2V2GA 4BVXA 5G31A 1M2AA 5IPHA 1WJKA 4AJ7A 5CRWA 3MYDA 3VLNA 2NVLA 1XFLA 2M46A 2IMEA 4CY6A 3BD2A 4FO5A 2B1LA 2IMDA 3A3TA 1WIKA 1V40A 4O7HA 3FK8A 4G0IA 4OFNA 3N9JA 3LYKA 1XPVA 3N5OA 3MNGA 4IQ1A 3FZAA 1XW9A 1EGOA 4WR5A 5JCGA 4HS1A 2L5LA 3BCIA 1GSDA 1EZKA 3RBTA 4IBPA 1QQ2A 1F37A 1FOHA 3HZ8A 3GMFA 3CMIA 2L4QA 4MCUA 3KM6A 9GSSA 4I6XA 4K5RA 2DC5A 3IXRA 2X4AA 5G2ZA 3VWVA 1EEMA 4QL9A 2CX3A 4TW5A 5AGYA 3KJYA 1BG5A 4KW6A 5FHIA 4TN8A 1UC7A 3EC3A 1OE7A 2HRKA 2VLUA 1PX6A 5IO2A 2R5GA 1N2AA 3I6AA 5DAKB 2IJYA 4F0CA 4EO3A 5G1LA 1F6MC 1VF3A 3HJPA 2YV7A 2H8LA 6GSTA 4JBBA 3F4TA 4X4JA 3F9UA 1PN0A 2X8HA 2X8CA 3ME7A 3L9UA 4ZXGA 5IMZA 1TRVA 2XBQA 4ZB6A 1VGLA 1LJRA 2CVBA 2CT6A 2HYXA 2L59A 1Z9HA 3A2XA 5ECIB 5BMUA 2H73A 3TUEA 3VURA 2HSMA 5D9XA 3DGQA 1H75A 1GUMA 3ED3A 2LUSA 2R3XA 3FHKA 2H19A 3O76A 5ECOB 3Q19A 2E0QA 2HE3A 1KNGA 1GTUA 3DWVA 2R0PA 1FB0A 1ZOFA 3QFAC 3FR6A 3GL5A 3IK7A 4NHWA 1M99A 1ZYPA 3LJRA 1VF1A 1O8XA 3TJGA 4MJAA 3HJOA 1K3OA 4FYBA 1EOHA 1GNWA 2DBCA 4LL1B 5AISA 1UN2A 2P5QA 3LORA 2DJJA 2IMFA 1M9BA 4K7NA 5ID2B 1GNEA 5DALB 3GKNA 2H1BA 4GSTA 3MSZA 4G2EA 2PERA 4AGSA 2G0FA 1NHYA 5D9WA 2VCZA 3G9BA 2KHPA 2NDOA 4IQAA 4PNFA 3MWHA 3R2QA 4YQVA 5IMVA 3F6DA 5FWGA 1GTAA 3KP9A 20GSA 2GLRA 4TXVA 3TB2A 1Z7PA 1A0FA 2OE0A 1NSWA 2M72A 3QPMA 1PSQA 2LS5A 3QAWA 3I69A 4ICYA 3CTFA 5IMDA 17GSA 2GZPA 2C0GA 2MBTA 1EP7A 2KP2A 2QSIA 1QXHA 2G2QA 1F9MA 3WYWA 2GZZA 2F3MA 1GSSA 3CSIA 3HXSA 3TCOA 3M1GA 2LNTA 1OE8A 4KSOA 3FZ4A 1PA3A 2IMKA 2V6KA 2VCXA 3TOTA 2L6CA 4O5UA 2K8VA 1GSQA 3E0UA 4K0NA 5ELGA 1ZCPA 3G7YA 3FRCA 4ZIJA 3ZL5A 1V98A 4L0UA 1ILOA 4XRDA 18GSA 1EWXA 3TDGA 3ZIJA 2H1GA 1A24A 2A4HA 3GURA 3DYRA 1FAAA 3QAGA 5G30A 3F63A 4ZILA 3Q6OA 4WR4A 4ZB8A 1XWKA 5ELAA 1A8YA 3KCMA 1X9SB 3UBLA 2A2PA 2AYTA 5KEJA 1RQMA 4ECJA 4YH2A 4AF2A 4F03A 2H74A 4NV5A 4I2TA 3H79A 3S9FA 3ZMLA 5HR3A 1JZOA 4A5PA 2YZHA 1QUWA 3HDCA 1N8JA 1O81A 3UVTA 1A2LA 2H76A 1PGTA 1AQVA 1TK8B 1M2BA 2XHFA 2N5FA 2C0DA 1XWBA 5A4VA 1FHEA 4K5SA 3TKSE 1SJIA 4N30A 2ALBA 3ME8A 1XIYA 3TKPA 4EVMA 2RIIA 2FWHA 4MJCA 4GSNA 3DD3A 3HVVA 2WZ9A 1XW6A 4K7OA 5INYA 4O92A 2H71A 2YWNA 2CV4A 3F8UA 1SL1B 2J9HA 5AIXA 2HNLA 4HJMA 4I8BA 3APOA 2V32A 3F4SA 3KXOA 2F8AA 2HZEA 2H72A 2R4VA 4PGTA 3L0HA 1T8EB 2RM5A 4BL7A 3FY7A 3GH6A 1V58A 2VL3A 2YWMA 1TW9A 3M0FA 2RM6A 1UVZA 4GQFA 2VCTA 1SL0B 1HYUA 3IA1A 2H30A 2B5YA 1SYRA 4JR6A 5CO3A 1BAYA 4LLRA 5IMFA 4Q5QA 3WT2A 2EIRA 2B7JA 4N10A 2PUKC 1I9DA 4IP1A 5ECPB 4X0XA 3VWXA 3LGCA 1K0CA 2F51A 2V1MA 1MTCA 4GLTA 3QFBC 3A2VA 4G0LA 5L71A 3KH7A 3W8SA 4OCFA 3GSTA 3NOFA 1Y6EA 4CY8A 2VLTA 3KZQA 3LG6A 1TKDB 3PPUA 5KN0A 4ULXA 2ZCTA 5IPGA 1R7HA 2A2SA 2JADA 2LRCA 4HUAA 2GT6A 2VIMA 3HD5A 1AQXA 6GSSA 1ERVA 1JLWA 3J7Yk 4KB3A 4P3YB 4I2UA 1EV9A 3GA4A 5H5QA 4HI7A 1WMJA 1DSBA 3L78A 2YNXA 6GSUA 4IN0A 4WF5A 3APQA 4I97A 3APSA 1Q4JA 4FIWA 4RUVA 4MH2A 3UOMA 2DKIA 4HQSA 5D8IA 1HNCA 4HU7A 2FWEA 1TU8A 5F06A 3Q18A 4EL1A 4OO4A 1VF4A 1PQNA 4MPFA 4NWYA 2I81A 5ECHB 1EV4A 4KCEA 4PTSA 5IIZA 3TKQA 3CYNA 4OO5A 3TRXA 3O3TA 4MF6A 2HZEB 3IBHA 2R37A 5H5RA 2GQLA 2LJAA 4BVYB 5B8AA 3CSJA 3QD9A 5DDLA 4BL7B 4BWSA 1C72A 3C71A 2WDUA 5GSSA 4K8MA 3H8QA 5B7CA 4OFTA 3UL3A 1EP8A 1PRXA 2B5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D73 A;  3TJK A;  13GS A;  3TRP A;  4PNG A;  3HVX A;  11GS A;  2TIR A;  1LBK A;  4OFM A;  5J4U A;  4KSM A;  4ZL8 A;  2CVK A;  2H0H A;  2GSQ A;  1U88 A;  5LCZ A;  8GSS A;  1PKZ A;  3TJF A;  1KEB A;  4G10 A;  4TR4 A;  2R2J A;  4X43 A;  2X8G A;  3ERG A;  1A23 A;  3H4K A;  4XS4 A;  2H75 A;  3V1W A;  2IN3 A;  4IEL A;  1OC8 A;  5GAN D;  2IL3 A;  2KOK A;  4KDU A;  3TRQ A;  1MDK A;  3P2A A;  2I4A A;  3RDW A;  12GS A;  4IJ3 A;  2M80 A;  1XVW A;  3F0I A;  2MYG A;  3FEU A;  1J9B A;  3JCM L;  2WJU A;  2RUE A;  5ECL B;  4BWQ A;  3LXT A;  1SKR B;  3GL3 A;  5G5F A;  2REM A;  4OWY A;  3OR5 A;  3WGX A;  2LRN A;  5ECR B;  1OC9 A;  3J7Y b;  3EMX A;  1OAZ A;  2FNO A;  4ECI A;  1TK0 B;  2AAW A;  4FH8 A;  2MMN A;  1FG4 A;  19GS A;  1KTE A;  1RK4 A;  2ES7 A;  2R6K A;  2FY6 A;  5B6M A;  2GDR A;  1TI3 A;  2H0G A;  3LSZ A;  2RLI A;  2HXK A;  1PMT A;  1AXD A;  4TR0 A;  4YAV A;  1YY7 A;  2C0F A;  5GST A;  1DE2 A;  1B48 A;  4HZ2 A;  3HVS A;  4JED A;  2JZS A;  2D2Z A;  4LA1 A;  4BPY A;  5CNW A;  1IYI A;  2OE3 A;  1DE1 A;  22GS A;  3ZVJ D;  1LU4 A;  1I5G A;  2H01 A;  2E2G A;  2KP1 A;  2H1A A;  2H6Z A;  1O73 A;  3D22 A;  3BCK A;  1SK0 A;  5J9B A;  5HR1 A;  2VOC A;  1WP0 A;  4EKZ A;  1Z7R A;  1GUK A;  3SBC A;  3DVX A;  3QMX A;  1XZO A;  1O6J A;  3CTG A;  4XS1 A;  3RHB A;  4EC0 A;  1J0F A;  2MBS A;  5ECN B;  1TRS A;  4L8E A;  4IGJ A;  3BOA A;  1BYE A;  1B9Y C;  1SKW B;  1S3D A;  3UBK A;  2PN8 A;  2PBJ A;  3SWL A;  1YF0 A;  3IE3 A;  4IJI A;  3VK9 A;  1GLQ A;  3HHV A;  5DQS A;  2WUL A;  1W89 A;  1TK5 B;  1HQO A;  3L9V A;  1TJD A;  4N11 A;  4F2I A;  2JL4 A;  1U3A A;  1ZL9 A;  2GSS A;  5DJL A;  2MMZ A;  4EXJ A;  4V1A g;  2DML A;  2JU5 A;  4XS6 A;  1O85 A;  3WGD A;  4MPG A;  2WB9 A;  2LKU A;  1B8X A;  5EL8 A;  3GN3 A;  5J3R A;  3QOU A;  4HOJ A;  3GHA A;  2C80 A;  1B4P A;  2MMA A;  4XS4 B;  1AC1 A;  5J5N A;  5HFG A;  1T00 A;  3VPQ A;  5FT3 A;  1T7P B;  5IM9 A;  3ERF A;  1MD3 A;  4ML6 A;  3C1S A;  1NHO A;  1SU9 A;  2L57 A;  2YWO A;  4ISD A;  4G19 A;  1X9M B;  3GSS A;  1JFU A;  1QK8 A;  5COH A;  1VRS D;  1HNA A;  4KDX A;  1YEP A;  4ACS A;  4POL A;  1TRW A;  5JWO B;  1SK1 A;  4PQ1 A;  4K7I A;  1OC9 B;  1YEX A;  4HEA 2;  4AJ8 A;  1AQW A;  4XHM A;  2LST A;  4E8E A;  3HZ4 A;  1TP9 A;  1XWC A;  1BJX A;  4Q5F A;  4K6X A;  2CQ9 A;  4XRA A;  2JSZ A;  2GZY A;  1V2A A;  4KA0 A;  4MLY A;  2GS3 A;  2H1D A;  2DJ1 A;  4TR1 A;  4RI7 A;  2QC7 A;  2VL2 A;  4V2N A;  3IPZ A;  5HR0 A;  3G7I A;  1ML6 A;  4F0B A;  4N0V A;  1Z3E A;  2JZT A;  4TOP A;  3EE2 A;  4X1U A;  1M0U A;  4FYU A;  3ZMK A;  5D9V A;  3CRT A;  1KBN A;  4ILF A;  2O8V B;  2PWJ A;  3IK9 A;  1WRY A;  3NIV A;  4PQH A;  4Z7X A;  3PH9 A;  5B6N A;  2C3N A;  1A2J A;  1A0R P;  1GH2 A;  1JZD A;  2AUV A;  1G6Y A;  3ZFL A;  4O32 A;  2FCH A;  4GQC A;  2FA4 A;  6GSV A;  3GTU A;  3L4N A;  4ZBD A;  3UAR A;  1X5C A;  4LMV A;  1ABA A;  3ZIV A;  1XWG A;  1FVK A;  1ACV A;  3F3R A;  4LMW A;  3IHQ A;  2DLX A;  3F3Q A;  1FO5 A;  1ZZY A;  2VCV A;  3RPN A;  2DJ0 A;  4MAB A;  4MA9 A;  1THO A;  4WXT A;  2HZF A;  3CBU A;  5ECM B;  1E2Y A;  4HDE A;  1K0D A;  1ERW A;  1T3B A;  4JE1 A;  2GGT A;  1MDI A;  1W4V A;  3QAV A;  4MF5 A;  1OKD A;  4IHU A;  2YCD A;  1ZMA A;  1YDK A;  5CRG A;  5ABR A;  4BA7 A;  1SD8 A;  3Q74 A;  4POK A;  2LRT A;  16GS A;  2I1U A;  3F6F A;  3FKF A;  4WBJ A;  5DQY A;  2DSA A;  3GUS A;  1F3A A;  3HA9 A;  4L0W A;  6GSY A;  2LEG A;  2IPA A;  3GKK A;  4NPB A;  1TI1 A;  2F9S A;  2I3Y A;  1DBY A;  3ERW A;  3NZN A;  4KDY A;  3KMO A;  2HRN A;  5CRE A;  3IAS 2;  1M2D A;  3RAZ A;  3H1N A;  5HFK A;  4POM A;  3EYT A;  5DBQ A;  4CHS A;  4NXI A;  2CX4 A;  4H86 A;  2OAD A;  2LQO A;  2A4V A;  4EUY A;  1AW9 A;  2X64 A;  5G5E A;  4F9Z A;  2QKE A;  3M3M A;  5A4W A;  4CW9 A;  1GUH A;  4GTU A;  4TR1 B;  4RQX A;  1XVQ A;  1GSE A;  4RI6 A;  1K3Y A;  4O5R A;  1MD4 A;  3KGK A;  3I9V 2;  1SKS B;  1THX A;  2V6O A;  5LNK e;  2FHE A;  3CSH A;  3ZFB A;  1PX7 A;  3DKS A;  3GRX A;  2OE1 A;  2H6X A;  3EIN A;  3GKX A;  2HRF A;  1RW1 A;  1M7T A;  1GL8 A;  3FYG A;  2ZUP A;  3P90 A;  3M8N A;  4WEY A;  1ZGN A;  4YAP A;  3CRU A;  1OKT A;  2H0I A;  2VL9 A;  3GFK A;  1YKA A;  2YJH A;  3GKM A;  1DUG A;  2KLX A;  4TXO A;  4WF4 A;  1V57 A;  2L5O A;  4J56 E;  3M9J A;  3C73 A;  4PUR A;  3FR9 A;  1M9A A;  4HJ2 A;  4XCS A;  1XOB A;  2AHE A;  1JLV A;  3M9K A;  3GTU B;  2VL2 C;  5F8B A;  2GSR A;  2C3Q A;  2C0E A;  2GQM A;  4EF0 A;  3H93 A;  4KND A;  1QGV A;  4GRF A;  5ECS A;  5EPF A;  1JHB A;  1V9W A;  5J9C A;  5DCH A;  3KMN A;  5IOW A;  3GYK A;  2LTK A;  1XW5 A;  4XIH A;  2C1Y A;  3DVW A;  4HQZ A;  1X5E A;  1BED A;  4TRX A;  3VFI A;  5EVO A;  2YAN A;  1NW2 A;  2O87 A;  4MMM A;  1GLP A;  3LQ7 A;  5AN1 A;  3GH9 A;  2JSY A;  3I43 A;  4KE3 A;  1QMV A;  5B8B A;  2AV4 A;  4HU9 A;  4ZL7 A;  2CZ3 A;  3US3 A;  1PL2 A;  2VM1 A;  4GXZ A;  1YKC A;  3FZ5 A;  4GWR A;  1GTI A;  4MJB A;  2DIZ A;  1SL2 B;  4DEJ A;  1R5P A;  3VI5 A;  5ENU A;  1URM A;  2OBK A;  3F4R A;  3K8N A;  1BX9 A;  3A2W A;  3KD0 A;  3D21 A;  2RUF A;  4MDC A;  3FZ9 A;  3C7M A;  3FW2 A;  2HI7 A;  2EIQ A;  4D73 A;  5G1K A;  3EU4 A;  2DJK A;  3P8W A;  1EEJ A;  1SJZ A;  3ZYW A;  1YF1 A;  2ZNM A;  2C4J A;  3ZZX A;  4PX1 A;  4MH3 A;  4KGI A;  2C8U A;  1F3B A;  2CZ2 A;  3GX8 A;  4L5O A;  2A2R A;  1WOU A;  3EWL A;  2K8S A;  2HLS A;  1K3L A;  5F0G A;  5ECK B;  5A4U A;  2IIY A;  2O89 A;  5IOX A;  5D93 A;  2MMO A;  4RQR A;  5JWR B;  1AIU A;  2EC4 A;  3TJJ A;  1JZR A;  2ON7 A;  2P31 A;  2K18 A;  1BQ7 A;  4OCE A;  4OD7 A;  4ZBB A;  1XWA A;  5GAP D;  1GSU A;  3EUR A;  4OMV A;  4MZB A;  4KX4 A;  3FR3 A;  4Q5R A;  1K0M A;  3VI7 A;  5CAX A;  2K6V A;  4TR3 A;  1S3C A;  5IQY A;  1X0R A;  3UAP A;  3EVI A;  4TXO B;  5DVB A;  4ZBA A;  5IMA A;  3IV4 A;  4JU5 A;  6GSW A;  3W8J A;  2VD0 A;  1U87 A;  3MAK A;  10GS A;  3RHC A;  2JZR A;  3UEM A;  3DRN A;  1UA5 A;  2DMM A;  2O7K A;  1T1V A;  3DIE A;  2HSY A;  2VLV A;  2IMI A;  1NM3 A;  4WET A;  5HQP A;  2EIO A;  1K0N A;  5ECQ B;  3IC4 A;  3E3E A;  2FA8 A;  2XPD A;  1XOA A;  5KN2 A;  4AJ6 A;  3ZRD A;  3LYP A;  3TGZ A;  5LD0 A;  1QFN A;  4N0Z A;  3KEB A;  3TJB A;  2LJR A;  4GSS A;  1SD9 A;  2L4C A;  3UVH A;  1XXU A;  1B4Q A;  3VPT A;  3EU3 A;  2GT5 A;  2B3S A;  1GWC A;  1G7E A;  2PMT A;  3VWW A;  5JCW A;  1CQG A;  2H6Y A;  4K1F A;  1EGR A;  4NMU A;  1TOF A;  3TOU A;  3MDK A;  1ERU A;  1USB A;  3KH9 A;  5HFI A;  4MP4 A;  2PPT A;  3HYP A;  2VUP A;  5E59 A;  3RPP A;  1YZX A;  3AY8 A;  1K0B A;  2VCQ A;  4XTS A;  3GIX A;  3LEF A;  3KP8 A;  5IO0 A;  4F82 A;  4KH7 A;  4PXO A;  2LJK A;  3UMA A;  4D73 B;  1OVN A;  3IRA A;  4EE0 A;  3D0Z A;  2L6D A;  2MZC A;  1HD2 A;  4QQ7 A;  2NPB A;  2VM2 A;  1U3I A;  2YV9 A;  3D6I A;  1F2E A;  1OYJ A;  2IWT A;  4DSQ A;  1Z6N A;  3HKR A;  3TKS C;  2CAQ A;  4CDO A;  1Z5Y E;  1R5A A;  1AUC A;  3U5R E;  4JRR A;  3LFL A;  1SYX A;  1G0T A;  3WT1 A;  3ZTL A;  2NTO A;  3HY2 A;  2I9H A;  3IOS A;  2DJ2 A;  2N5A A;  1PKW A;  4GCI A;  4MJE A;  2YP6 A;  1X5D A;  1B9X C;  1R4W A;  1A8L A;  4KAE A;  4E8H A;  2XBI A;  5F07 A;  2K9F A;  2XC2 A;  3DEX A;  5KN1 A;  1TTZ A;  1G6W A;  1R26 A;  3ZRE A;  2H66 A;  2VCW A;  2FWG A;  4ID0 A;  5JCU A;  3GNJ A;  5E4W A;  1TRU A;  2FGX A;  2PVO C;  1S3A A;  2F8F A;  1GSY A;  2YZU A;  1E6B A;  1O7U A;  3QR6 A;  1TDI A;  1T4Z A;  2AB6 A;  5C04 A;  2WGR A;  2HFD A;  1ST9 A;  1YQ1 A;  2ON5 A;  5KN3 A;  3DXB A;  2LV3 A;  2OKA A;  4V1A p;  3ISO A;  4LL4 B;  2H70 A;  2CAI A;  2BTO T;  2LQQ A;  2WRT A;  1GUL A;  2LNS A;  1GRX A;  1FB6 A;  3D4M A;  1PD2 1;  2V41 A;  3PR8 A;  3C1R A;  2FLS A;  1MEK A;  4DSS A;  1T4Y A;  2GTU A;  1PL1 A;  3KTL A;  4ZL9 A;  5D9T A;  5C00 A;  4G9H A;  2QGV A;  1GP1 A;  4Q5N A;  2DJ3 A;  3E9J B;  2GST A;  5HR2 A;  1Z6M A;  2KUC A;  3A5W A;  1Y25 A;  2GVP A;  4MF7 A;  1SEN A;  2IFQ A;  5AIV A;  5JWQ B;  3ZLP A;  4J57 E;  2VAF A;  5CRD A;  1TU7 A;  2NBS A;  3D4T A;  3PGT A;  1CQH A;  1VF2 A;  1WE0 A;  2B1K A;  4K2D A;  3IAM 2;  5GZZ B;  2B7K A;  2PGT A;  3DML A;  1X9W B;  2TRX A;  4MZC A;  4KCA A;  2HSH A;  1SJ6 A;  4NHZ A;  2GQK A;  3G7J A;  3KIJ A;  14GS A;  3HJM A;  4NAX A;  4JR4 A;  5IMC A;  4YQU A;  3ZVJ A;  1O8W A;  2OJL A;  3TKR A;  4BVY A;  1TXX A;  4QL7 A;  5D96 A;  2E7P A;  4I5Q A;  4NV2 A;  2PU9 C;  2FD3 A;  3U6V A;  3EMP A;  4GF0 A;  2OBI A;  1HNB A;  3HCZ A;  2B5X A;  3QCP A;  4IVF A;  4EDY A;  4ZB9 A;  2VO4 A;  2FUG 2;  2YPM A;  3LXZ A;  5CP1 A;  1WPI A;  1A2M A;  3WGE A;  3W6G A;  2E2M A;  2YOI A;  1XCC A;  4ECC A;  4FYC A;  1MDJ A;  2Z9S A;  1G7O A;  2PVQ A;  4PUA A;  5J41 A;  3GX0 A;  6GSX A;  3UJ1 A;  2C3T A;  2YN1 A;  2O85 A;  1Q98 A;  3UIW A;  3QDN A;  2XPE A;  1U6T A;  4DVC A;  3LWA A;  4TKY A;  1WWJ A;  2CVD A;  3BBY A;  2AJQ B;  7GSS A;  1K0A A;  1YJ6 A;  2YWI A;  1SK2 A;  3IDV A;  4EDZ A;  4PQI A;  2YJ7 A;  1FOV A;  2VD1 A;  4V2L A;  3PIN A;  1J08 A;  4K9Z A;  1ERT A;  4ECB A;  3ZIT A;  3GV1 A;  1GTB A;  4KUN A;  2P5R A;  4WBR D;  1H4O A;  2WS2 A;  5DAK A;  5H5S A;  2J23 A;  5DJM A;  4DSS B;  2P0G A;  5F05 A;  1PN9 A;  4PUF C;  4J2F A;  1OC3 A;  1EOG A;  1ON4 A;  5EY6 A;  4IS0 A;  4TVE A;  2WFC A;  4ML1 A;  3WD6 A;  1AAZ A;  2OAC A;  5CRH A;  1ZYE A;  3O6T A;  4MZW A;  2IFQ B;  4IW9 A;  4WKW A;  3KTB A;  2BMX A;  3P7X A;  5CYY A;  1K0O A;  2JAC A;  4DSR A;  3IR4 A;  2BJX A;  4L5L A;  4JZQ A;  1ZYQ B;  2X99 A;  1FVJ A;  4HZ4 A;  2FWF A;  3BJ5 A;  1IYH A;  2CA8 A;  2DIY A;  5A5K A;  3VWU A;  3L9S A;  4YQM A;  5DCG A;  3TKS A;  4MK3 A;  1JZW A;  4K0G A;  1XBS A;  4V2M A;  2B6M A;  4IP6 A;  4POB A;  2TRC P;  5ID2 A;  5DAL A;  4IKH A;  3CXG A;  2HT9 A;  2OA7 A;  1FW1 A;  2N5B A;  3C8E A;  1GSF A;  2WCI A;  3D5J A;  2V2G A;  4BVX A;  5G31 A;  1M2A A;  5IPH A;  1WJK A;  4AJ7 A;  5CRW A;  3VLN A;  2NVL A;  1XFL A;  2M46 A;  2IME A;  3BD2 A;  4FO5 A;  2B1L A;  2IMD A;  3A3T A;  1WIK A;  1V40 A;  4O7H A;  3FK8 A;  4OFN A;  3N9J A;  3LYK A;  1XPV A;  3N5O A;  3MNG A;  4IQ1 A;  3FZA A;  1XW9 A;  1EGO A;  4WR5 A;  5JCG A;  4HS1 A;  2L5L A;  3BCI A;  1GSD A;  1EZK A;  3RBT A;  4IBP A;  1QQ2 A;  1F37 A;  3HZ8 A;  3GMF A;  3CMI A;  2L4Q A;  4MCU A;  3KM6 A;  9GSS A;  4I6X A;  2DC5 A;  3IXR A;  5G2Z A;  3VWV A;  1EEM A;  4QL9 A;  2CX3 A;  4TW5 A;  5AGY A;  3KJY A;  1BG5 A;  4KW6 A;  5FHI A;  4TN8 A;  1UC7 A;  3EC3 A;  1OE7 A;  2VLU A;  1PX6 A;  5IO2 A;  2R5G A;  1N2A A;  3I6A A;  5DAK B;  2IJY A;  4F0C A;  4EO3 A;  5G1L A;  1F6M C;  1VF3 A;  3HJP A;  2YV7 A;  2H8L A;  6GST A;  4JBB A;  3F4T A;  3F9U A;  2X8H A;  2X8C A;  3ME7 A;  3L9U A;  4ZXG A;  5IMZ A;  1TRV A;  2XBQ A;  4ZB6 A;  1VGL A;  1LJR A;  2CVB A;  2CT6 A;  2HYX A;  2L59 A;  1Z9H A;  3A2X A;  5ECI B;  2H73 A;  3TUE A;  3VUR A;  5D9X A;  3DGQ A;  1H75 A;  1GUM A;  3ED3 A;  2LUS A;  2R3X A;  3FHK A;  2H19 A;  3O76 A;  5ECO B;  3Q19 A;  2E0Q A;  2HE3 A;  1KNG A;  1GTU A;  3DWV A;  1FB0 A;  1ZOF A;  3QFA C;  3FR6 A;  3GL5 A;  3IK7 A;  4NHW A;  1M99 A;  3LJR A;  1VF1 A;  1O8X A;  3TJG A;  4MJA A;  3HJO A;  1K3O A;  4FYB A;  1EOH A;  1GNW A;  2DBC A;  4LL1 B;  5AIS A;  1UN2 A;  2P5Q A;  3LOR A;  2DJJ A;  2IMF A;  1M9B A;  4K7N A;  5ID2 B;  1GNE A;  5DAL B;  3GKN A;  2H1B A;  4GST A;  3MSZ A;  4G2E A;  2PER A;  4AGS A;  2G0F A;  1NHY A;  5D9W A;  2VCZ A;  3G9B A;  2KHP A;  2NDO A;  4IQA A;  4PNF A;  3MWH A;  3R2Q A;  4YQV A;  5IMV A;  3F6D A;  5FWG A;  1GTA A;  3KP9 A;  20GS A;  2GLR A;  4TXV A;  3TB2 A;  1Z7P A;  1A0F A;  2OE0 A;  1NSW A;  2M72 A;  3QPM A;  1PSQ A;  2LS5 A;  3QAW A;  3I69 A;  3CTF A;  5IMD A;  17GS A;  2GZP A;  2C0G A;  2MBT A;  1EP7 A;  2KP2 A;  2QSI A;  1QXH A;  2G2Q A;  1F9M A;  3WYW A;  2GZZ A;  2F3M A;  1GSS A;  3CSI A;  3HXS A;  3TCO A;  3M1G A;  2LNT A;  1OE8 A;  4KSO A;  3FZ4 A;  1PA3 A;  2IMK A;  2V6K A;  2VCX A;  3TOT A;  2L6C A;  2K8V A;  1GSQ A;  3E0U A;  4K0N A;  5ELG A;  1ZCP A;  3G7Y A;  3FRC A;  4ZIJ A;  3ZL5 A;  1V98 A;  4L0U A;  1ILO A;  4XRD A;  18GS A;  1EWX A;  3TDG A;  3ZIJ A;  2H1G A;  1A24 A;  3GUR A;  3DYR A;  1FAA A;  3QAG A;  5G30 A;  3F63 A;  4ZIL A;  3Q6O A;  4WR4 A;  4ZB8 A;  1XWK A;  5ELA A;  1A8Y A;  3KCM A;  1X9S B;  3UBL A;  2AYT A;  5KEJ A;  1RQM A;  4ECJ A;  4YH2 A;  4AF2 A;  4F03 A;  2H74 A;  4NV5 A;  4I2T A;  3H79 A;  3S9F A;  3ZML A;  5HR3 A;  1JZO A;  2YZH A;  1QUW A;  3HDC A;  1N8J A;  1O81 A;  3UVT A;  1A2L A;  2H76 A;  1PGT A;  1AQV A;  1TK8 B;  1M2B A;  2XHF A;  2N5F A;  2C0D A;  1XWB A;  5A4V A;  1FHE A;  3TKS E;  1SJI A;  4N30 A;  2ALB A;  3ME8 A;  1XIY A;  3TKP A;  4EVM A;  2RII A;  2FWH A;  4MJC A;  4GSN A;  3DD3 A;  3HVV A;  2WZ9 A;  1XW6 A;  4K7O A;  5INY A;  4O92 A;  2H71 A;  2YWN A;  2CV4 A;  3F8U A;  1SL1 B;  2J9H A;  5AIX A;  2HNL A;  4HJM A;  4I8B A;  3APO A;  2V32 A;  3F4S A;  3KXO A;  2F8A A;  2HZE A;  2H72 A;  2R4V A;  4PGT A;  3L0H A;  1T8E B;  2RM5 A;  4BL7 A;  3FY7 A;  3GH6 A;  1V58 A;  2VL3 A;  2YWM A;  1TW9 A;  3M0F A;  2RM6 A;  1UVZ A;  4GQF A;  2VCT A;  1SL0 B;  1HYU A;  3IA1 A;  2H30 A;  2B5Y A;  1SYR A;  4JR6 A;  5CO3 A;  1BAY A;  4LLR A;  5IMF A;  4Q5Q A;  3WT2 A;  2EIR A;  2B7J A;  4N10 A;  2PUK C;  1I9D A;  4IP1 A;  5ECP B;  4X0X A;  3VWX A;  3LGC A;  1K0C A;  2F51 A;  2V1M A;  1MTC A;  4GLT A;  3QFB C;  3A2V A;  5L71 A;  3KH7 A;  3W8S A;  4OCF A;  3GST A;  3NOF A;  1Y6E A;  2VLT A;  3KZQ A;  3LG6 A;  1TKD B;  5KN0 A;  4ULX A;  2ZCT A;  5IPG A;  1R7H A;  2A2S A;  2JAD A;  2LRC A;  4HUA A;  2GT6 A;  2VIM A;  3HD5 A;  1AQX A;  6GSS A;  1ERV A;  1JLW A;  3J7Y k;  4KB3 A;  4P3Y B;  4I2U A;  1EV9 A;  3GA4 A;  5H5Q A;  4HI7 A;  1WMJ A;  1DSB A;  3L78 A;  2YNX A;  6GSU A;  4IN0 A;  4WF5 A;  3APQ A;  4I97 A;  3APS A;  1Q4J A;  4FIW A;  4RUV A;  4MH2 A;  3UOM A;  4HQS A;  5D8I A;  1HNC A;  4HU7 A;  2FWE A;  1TU8 A;  5F06 A;  3Q18 A;  4EL1 A;  4OO4 A;  1VF4 A;  1PQN A;  4MPF A;  4NWY A;  2I81 A;  5ECH B;  1EV4 A;  4KCE A;  5IIZ A;  3TKQ A;  3CYN A;  4OO5 A;  3TRX A;  3O3T A;  4MF6 A;  2HZE B;  3IBH A;  2R37 A;  5H5R A;  2GQL A;  2LJA A;  5B8A A;  3CSJ A;  3QD9 A;  5DDL A;  4BWS A;  1C72 A;  3C71 A;  2WDU A;  5GSS A;  4K8M A;  3H8Q A;  5B7C A;  4OFT A;  3UL3 A;  1EP8 A;  1PRX A;  2B5E A; 
#chains in the Genus database with same CATH topology
 5D73 A;  3TJK A;  13GS A;  3TRP A;  4PNG A;  3HVX A;  11GS A;  2TIR A;  1LBK A;  4OFM A;  5J4U A;  4KSM A;  4ZL8 A;  2CVK A;  2H0H A;  2GSQ A;  1U88 A;  5LCZ A;  8GSS A;  1PKZ A;  3TJF A;  1KEB A;  4G10 A;  4TR4 A;  2R2J A;  4X43 A;  2X8G A;  2QA2 A;  3ERG A;  1A23 A;  3H4K A;  4XS4 A;  2H75 A;  3V1W A;  2IN3 A;  4IEL A;  1OC8 A;  5GAN D;  2IL3 A;  2KOK A;  4KDU A;  3TRQ A;  1MDK A;  3P2A A;  2I4A A;  3RDW A;  12GS A;  4IJ3 A;  2M80 A;  1XVW A;  3F0I A;  2MYG A;  3FEU A;  1J9B A;  3JCM L;  2WJU A;  2RUE A;  5ECL B;  4BWQ A;  3LXT A;  1SKR B;  3GL3 A;  5G5F A;  2REM A;  3MIX A;  4OWY A;  3OR5 A;  3WGX A;  2LRN A;  5ECR B;  1OC9 A;  3J7Y b;  3EMX A;  1OAZ A;  2FNO A;  4ECI A;  2X49 A;  1TK0 B;  2AAW A;  4FH8 A;  2MMN A;  1FG4 A;  19GS A;  1KTE A;  1RK4 A;  2ES7 A;  2R6K A;  2FY6 A;  5B6M A;  2GDR A;  1TI3 A;  2H0G A;  3LSZ A;  2RLI A;  2HXK A;  1PMT A;  1AXD A;  4TR0 A;  4YAV A;  1YY7 A;  2C0F A;  5GST A;  1DE2 A;  1B48 A;  4HZ2 A;  3HVS A;  4JED A;  2JZS A;  2D2Z A;  4LA1 A;  4BPY A;  5CNW A;  1IYI A;  2OE3 A;  1DE1 A;  22GS A;  3ZVJ D;  1LU4 A;  1I5G A;  2H01 A;  2E2G A;  2KP1 A;  2H1A A;  2H6Z A;  1O73 A;  3D22 A;  3BCK A;  1SK0 A;  5J9B A;  5HR1 A;  2VOC A;  1WP0 A;  4EKZ A;  1Z7R A;  1GUK A;  3IHG A;  3SBC A;  3CQF A;  3DVX A;  3QMX A;  1XZO A;  1O6J A;  3CTG A;  4XS1 A;  3RHB A;  4EIQ A;  4EC0 A;  1J0F A;  2MBS A;  5ECN B;  1TRS A;  4L8E A;  4BVX B;  4IGJ A;  3BOA A;  1BYE A;  1B9Y C;  1SKW B;  1S3D A;  3UBK A;  2PN8 A;  2PBJ A;  2R0G A;  4Z2R A;  3SWL A;  1YF0 A;  3IE3 A;  4IJI A;  3VK9 A;  1GLQ A;  3HHV A;  5DQS A;  2WUL A;  1W89 A;  1TK5 B;  1HQO A;  3L9V A;  1TJD A;  4N11 A;  4F2I A;  2JL4 A;  1U3A A;  1ZL9 A;  2GSS A;  5DJL A;  2MMZ A;  4EXJ A;  4V1A g;  2DML A;  2JU5 A;  4XS6 A;  1O85 A;  3WGD A;  4MPG A;  2WB9 A;  2LKU A;  1B8X A;  5EL8 A;  3GN3 A;  5J3R A;  3QOU A;  4HOJ A;  3GHA A;  2C80 A;  1B4P A;  2MMA A;  4XS4 B;  1AC1 A;  5J5N A;  5HFG A;  1T00 A;  3VPQ A;  5FT3 A;  1T7P B;  5IM9 A;  3ERF A;  1MD3 A;  4ML6 A;  3C1S A;  4YKG A;  1NHO A;  1SU9 A;  2L57 A;  2YWO A;  4ISD A;  4G19 A;  1X9M B;  3GSS A;  1JFU A;  1QK8 A;  5COH A;  1VRS D;  1HNA A;  4KDX A;  1YEP A;  4ACS A;  4POL A;  1TRW A;  5JWO B;  1SK1 A;  4PQ1 A;  4K7I A;  1OC9 B;  1YEX A;  4HEA 2;  4AJ8 A;  1M3J A;  1AQW A;  4XHM A;  2LST A;  4E8E A;  3HZ4 A;  1TP9 A;  1XWC A;  1BJX A;  4Q5F A;  4K6X A;  2CQ9 A;  4XRA A;  2JSZ A;  2GZY A;  1V2A A;  4KA0 A;  4MLY A;  2GS3 A;  2H1D A;  2DJ1 A;  4TR1 A;  4RI7 A;  2QC7 A;  2VL2 A;  4V2N A;  3IPZ A;  5HR0 A;  3G7I A;  1ML6 A;  4F0B A;  4N0V A;  1Z3E A;  2JZT A;  4TOP A;  3EE2 A;  4X1U A;  1M0U A;  4FYU A;  3ZMK A;  5D9V A;  3CRT A;  1KBN A;  4ILF A;  2O8V B;  2PWJ A;  3IK9 A;  1WRY A;  3IC8 A;  3NIV A;  4PQH A;  4Z7X A;  3PH9 A;  5B6N A;  2C3N A;  1A2J A;  1A0R P;  1GH2 A;  1JZD A;  2AUV A;  1G6Y A;  3ZFL A;  4O32 A;  2FCH A;  4GQC A;  2FA4 A;  6GSV A;  3A5I A;  3GTU A;  3L4N A;  4ZBD A;  3UAR A;  1X5C A;  4LMV A;  1ABA A;  3ZIV A;  4G0K A;  1XWG A;  1FVK A;  1ACV A;  3F3R A;  4LMW A;  3IHQ A;  2DLX A;  3F3Q A;  1FO5 A;  1ZZY A;  2VCV A;  3RPN A;  2DJ0 A;  4MAB A;  4MA9 A;  1THO A;  4WXT A;  2HZF A;  3CBU A;  5ECM B;  1E2Y A;  4HDE A;  1K0D A;  1ERW A;  1T3B A;  4JE1 A;  2GGT A;  1MDI A;  1W4V A;  3QAV A;  4MF5 A;  1OKD A;  4IHU A;  2YCD A;  1ZMA A;  1YDK A;  5CRG A;  5ABR A;  4BA7 A;  1SD8 A;  3Q74 A;  4POK A;  2LRT A;  16GS A;  2I1U A;  3F6F A;  3FKF A;  4WBJ A;  5DQY A;  2DSA A;  3GUS A;  1F3A A;  3HA9 A;  4L0W A;  6GSY A;  2LEG A;  2IPA A;  3GKK A;  4NPB A;  1TI1 A;  2F9S A;  2I3Y A;  1DBY A;  3ERW A;  3NZN A;  4KDY A;  3KMO A;  2HRN A;  5CRE A;  3IAS 2;  4FQU A;  1M2D A;  3RAZ A;  3H1N A;  5HFK A;  4POM A;  3EYT A;  5DBQ A;  4CHS A;  4NXI A;  2CX4 A;  4H86 A;  2OAD A;  2LQO A;  2A4V A;  4EUY A;  1AW9 A;  2X64 A;  5G5E A;  4F9Z A;  2QKE A;  3M3M A;  5A4W A;  4CW9 A;  1GUH A;  4GTU A;  4TR1 B;  4RQX A;  1XVQ A;  1GSE A;  4RI6 A;  1K3Y A;  4O5R A;  1MD4 A;  3KGK A;  3I9V 2;  1SKS B;  1THX A;  2V6O A;  5LNK e;  2FHE A;  3CSH A;  3ZFB A;  1PX7 A;  3DKS A;  3GRX A;  2OE1 A;  2H6X A;  3EIN A;  3GKX A;  2HRF A;  1RW1 A;  1M7T A;  1GL8 A;  3FYG A;  2ZUP A;  3P90 A;  3M8N A;  4WEY A;  1ZGN A;  4YAP A;  3CRU A;  1OKT A;  3LW9 A;  2H0I A;  2VL9 A;  3GFK A;  1YKA A;  2YJH A;  3GKM A;  1DUG A;  2KLX A;  4YKF A;  4TXO A;  4WF4 A;  1V57 A;  2L5O A;  4J56 E;  3M9J A;  3C73 A;  4PUR A;  3FR9 A;  1M9A A;  4HJ2 A;  4XCS A;  1XOB A;  2AHE A;  1JLV A;  3M9K A;  3GTU B;  2VL2 C;  5F8B A;  2GSR A;  2C3Q A;  2C0E A;  4USS A;  2GQM A;  4EF0 A;  3H93 A;  4KND A;  1QGV A;  4GRF A;  5ECS A;  5EPF A;  1JHB A;  1V9W A;  5J9C A;  5DCH A;  3KMN A;  5IOW A;  3GYK A;  2LTK A;  1XW5 A;  4XIH A;  2C1Y A;  3DVW A;  4HQZ A;  1X5E A;  1BED A;  4TRX A;  3VFI A;  5EVO A;  2YAN A;  1NW2 A;  2O87 A;  4MMM A;  1GLP A;  3LQ7 A;  5AN1 A;  3GH9 A;  2JSY A;  3I43 A;  4KE3 A;  1QMV A;  5B8B A;  2AV4 A;  4HU9 A;  4ZL7 A;  2CZ3 A;  3US3 A;  1PL2 A;  2VM1 A;  4GXZ A;  1YKC A;  3FZ5 A;  4GWR A;  1GTI A;  4MJB A;  2DIZ A;  1SL2 B;  4DEJ A;  2DKH A;  1R5P A;  3VI5 A;  5ENU A;  1URM A;  2OBK A;  3F4R A;  3K8N A;  1BX9 A;  3A2W A;  3KD0 A;  3D21 A;  4O5Q A;  2RUF A;  4MDC A;  3FZ9 A;  3C7M A;  1XG8 A;  3FW2 A;  2HI7 A;  2EIQ A;  4D73 A;  5G1K A;  3EU4 A;  4Z2T A;  2DJK A;  3P8W A;  1EEJ A;  1SJZ A;  3ZYW A;  1YF1 A;  2ZNM A;  2C4J A;  3ZZX A;  4PX1 A;  4MH3 A;  4KGI A;  2C8U A;  1F3B A;  2CZ2 A;  3GX8 A;  4L5O A;  2A2R A;  1WOU A;  3EWL A;  2K8S A;  2HLS A;  1K3L A;  5F0G A;  5ECK B;  5A4U A;  2IIY A;  2O89 A;  5IOX A;  5D93 A;  2MMO A;  4RQR A;  5JWR B;  1AIU A;  2EC4 A;  3TJJ A;  1JZR A;  2ON7 A;  2P31 A;  2K18 A;  1BQ7 A;  4OCE A;  4OD7 A;  4ZBB A;  1XWA A;  5GAP D;  1GSU A;  3EUR A;  4OMV A;  4MZB A;  4KX4 A;  3FR3 A;  4Q5R A;  1K0M A;  3VI7 A;  4MNN A;  2K6V A;  4TR3 A;  5CAX A;  1S3C A;  5IQY A;  1X0R A;  3UAP A;  3EVI A;  4TXO B;  5DVB A;  4ZBA A;  5IMA A;  3IV4 A;  4JU5 A;  6GSW A;  3W8J A;  2VD0 A;  1U87 A;  3MAK A;  10GS A;  3RHC A;  2JZR A;  3UEM A;  3DRN A;  1UA5 A;  2DMM A;  2O7K A;  1T1V A;  3DIE A;  2HSY A;  2VLV A;  2IMI A;  1NM3 A;  4WET A;  5HQP A;  2EIO A;  2QA1 A;  1K0N A;  5ECQ B;  3IC4 A;  3E3E A;  2FA8 A;  2XPD A;  1XOA A;  5KN2 A;  4AJ6 A;  3ZRD A;  3LYP A;  3TGZ A;  5LD0 A;  1QFN A;  4N0Z A;  3KEB A;  3TJB A;  2LJR A;  4GSS A;  1SD9 A;  2L4C A;  3UVH A;  1XXU A;  1B4Q A;  3VPT A;  3EU3 A;  2GT5 A;  2B3S A;  1GWC A;  1G7E A;  2PMT A;  3VWW A;  5JCW A;  1CQG A;  2H6Y A;  4K1F A;  1EGR A;  4NMU A;  1TOF A;  3TOU A;  3MDK A;  1ERU A;  1USB A;  3KH9 A;  5HFI A;  4MP4 A;  2PPT A;  3HYP A;  2VUP A;  5E59 A;  3RPP A;  1YZX A;  3AY8 A;  1K0B A;  2VCQ A;  4XTS A;  3GIX A;  3LEF A;  3KP8 A;  5IO0 A;  4F82 A;  4KH7 A;  4PXO A;  2LJK A;  3UMA A;  4D73 B;  1OVN A;  3IRA A;  4EE0 A;  3D0Z A;  2L6D A;  2MZC A;  1HD2 A;  4QQ7 A;  2NPB A;  2VM2 A;  1U3I A;  2YV9 A;  3D6I A;  1F2E A;  1OYJ A;  2IWT A;  4DSQ A;  1Z6N A;  3HKR A;  3TKS C;  2CAQ A;  4CDO A;  1Z5Y E;  1R5A A;  1AUC A;  3U5R E;  5BRT A;  4JRR A;  3LFL A;  1SYX A;  1G0T A;  3WT1 A;  3ZTL A;  2NTO A;  3HY2 A;  2I9H A;  3IOS A;  2DJ2 A;  2N5A A;  1PKW A;  4GCI A;  4MJE A;  2YP6 A;  1X5D A;  1B9X C;  1R4W A;  1A8L A;  4KAE A;  4E8H A;  2XBI A;  5F07 A;  2K9F A;  2XC2 A;  3R3E A;  2UZ8 A;  3DEX A;  1M3I A;  5KN1 A;  1TTZ A;  1G6W A;  1R26 A;  3ZRE A;  2H66 A;  2VCW A;  2FWG A;  4ID0 A;  5JCU A;  3GNJ A;  5E4W A;  1TRU A;  2FGX A;  2PVO C;  1S3A A;  2F8F A;  1GSY A;  2YZU A;  1E6B A;  1O7U A;  3QR6 A;  1TDI A;  1T4Z A;  5KOX A;  2AB6 A;  5C04 A;  2WGR A;  2HFD A;  1ST9 A;  1YQ1 A;  2ON5 A;  5KN3 A;  3DXB A;  2LV3 A;  2OKA A;  4V1A p;  3ISO A;  4LL4 B;  2H70 A;  2CAI A;  2BTO T;  2LQQ A;  2WRT A;  1GUL A;  2LNS A;  1GRX A;  1FB6 A;  3D4M A;  1PD2 1;  2V41 A;  3PR8 A;  3C1R A;  2FLS A;  1MEK A;  4DSS A;  1T4Y A;  2GTU A;  1PL1 A;  1ZYN A;  3KTL A;  4ZL9 A;  5D9T A;  5C00 A;  4G9H A;  2QGV A;  1GP1 A;  4Q5N A;  2DJ3 A;  3E9J B;  2GST A;  5HR2 A;  1Z6M A;  2KUC A;  3A5W A;  1Y25 A;  2GVP A;  4MF7 A;  1SEN A;  2IFQ A;  5AIV A;  5JWQ B;  3ZLP A;  4J57 E;  2VAF A;  5CRD A;  1TU7 A;  2NBS A;  3D4T A;  3PGT A;  1CQH A;  1VF2 A;  1WE0 A;  2B1K A;  4K2D A;  5KOW A;  3IAM 2;  5GZZ B;  2B7K A;  2PGT A;  3DML A;  1X9W B;  2TRX A;  4MZC A;  4KCA A;  2HSH A;  1SJ6 A;  4NHZ A;  4KF9 A;  2GQK A;  3G7J A;  3KIJ A;  14GS A;  3HJM A;  4NAX A;  4JR4 A;  5IMC A;  4YQU A;  3ZVJ A;  1S3R A;  1O8W A;  2OJL A;  3TKR A;  4BVY A;  1TXX A;  4QL7 A;  5D96 A;  2E7P A;  4I5Q A;  4NV2 A;  2PU9 C;  2FD3 A;  3U6V A;  3EMP A;  4GF0 A;  2OBI A;  1HNB A;  3HCZ A;  2B5X A;  3QCP A;  4IVF A;  4EDY A;  4ZB9 A;  2VO4 A;  2FUG 2;  2YPM A;  3LXZ A;  5CP1 A;  1WPI A;  1A2M A;  3WGE A;  3W6G A;  2E2M A;  2YOI A;  1XCC A;  4ECC A;  4FYC A;  1MDJ A;  2Z9S A;  1G7O A;  2PVQ A;  4PUA A;  5J41 A;  3GX0 A;  6GSX A;  3UJ1 A;  2C3T A;  2YN1 A;  2O85 A;  1Q98 A;  3UIW A;  3QDN A;  2XPE A;  4HSC X;  1U6T A;  4DVC A;  3LWA A;  4TKY A;  1WWJ A;  2CVD A;  3BBY A;  2AJQ B;  7GSS A;  1K0A A;  1YJ6 A;  2YWI A;  1SK2 A;  3IDV A;  4EDZ A;  4PQI A;  2YJ7 A;  1FOV A;  2VD1 A;  4V2L A;  3PIN A;  1J08 A;  4K9Z A;  1ERT A;  4ECB A;  3ZIT A;  3GV1 A;  1GTB A;  4KUN A;  2P5R A;  4WBR D;  1H4O A;  2WS2 A;  5DAK A;  5H5S A;  2J23 A;  5DJM A;  4DSS B;  2P0G A;  5F05 A;  1PN9 A;  4PUF C;  4J2F A;  1OC3 A;  1EOG A;  1ON4 A;  5EY6 A;  4IS0 A;  4TVE A;  4EIP A;  2WFC A;  4ML1 A;  3EPT A;  3WD6 A;  1AAZ A;  2OAC A;  5CRH A;  1ZYE A;  3O6T A;  4MZW A;  2IFQ B;  4IW9 A;  4WKW A;  3KTB A;  2BMX A;  3P7X A;  5CYY A;  1K0O A;  2JAC A;  4DSR A;  3IR4 A;  2R0C A;  2BJX A;  4L5L A;  4JZQ A;  1ZYQ B;  2X99 A;  4K2X A;  1FVJ A;  4HZ4 A;  2FWF A;  3BJ5 A;  1IYH A;  2CA8 A;  2DIY A;  4Z2U A;  5A5K A;  3VWU A;  3L9S A;  4YQM A;  5DCG A;  3TKS A;  4MK3 A;  1JZW A;  4K0G A;  1XBS A;  4V2M A;  2B6M A;  4IP6 A;  4POB A;  2TRC P;  5ID2 A;  5DAL A;  4IKH A;  2HRA A;  3CXG A;  2HT9 A;  2OA7 A;  1FW1 A;  3FMW A;  2N5B A;  3C8E A;  1GSF A;  2WCI A;  3D5J A;  2V2G A;  4BVX A;  5G31 A;  1M2A A;  5IPH A;  1WJK A;  4AJ7 A;  5CRW A;  3MYD A;  3VLN A;  2NVL A;  1XFL A;  2M46 A;  2IME A;  4CY6 A;  3BD2 A;  4FO5 A;  2B1L A;  2IMD A;  3A3T A;  1WIK A;  1V40 A;  4O7H A;  3FK8 A;  4G0I A;  4OFN A;  3N9J A;  3LYK A;  1XPV A;  3N5O A;  3MNG A;  4IQ1 A;  3FZA A;  1XW9 A;  1EGO A;  4WR5 A;  5JCG A;  4HS1 A;  2L5L A;  3BCI A;  1GSD A;  1EZK A;  3RBT A;  4IBP A;  1QQ2 A;  1F37 A;  1FOH A;  3HZ8 A;  3GMF A;  3CMI A;  2L4Q A;  4MCU A;  3KM6 A;  9GSS A;  4I6X A;  4K5R A;  2DC5 A;  3IXR A;  2X4A A;  5G2Z A;  3VWV A;  1EEM A;  4QL9 A;  2CX3 A;  4TW5 A;  5AGY A;  3KJY A;  1BG5 A;  4KW6 A;  5FHI A;  4TN8 A;  1UC7 A;  3EC3 A;  1OE7 A;  2HRK A;  2VLU A;  1PX6 A;  5IO2 A;  2R5G A;  1N2A A;  3I6A A;  5DAK B;  2IJY A;  4F0C A;  4EO3 A;  5G1L A;  1F6M C;  1VF3 A;  3HJP A;  2YV7 A;  2H8L A;  6GST A;  4JBB A;  3F4T A;  4X4J A;  3F9U A;  1PN0 A;  2X8H A;  2X8C A;  3ME7 A;  3L9U A;  4ZXG A;  5IMZ A;  1TRV A;  2XBQ A;  4ZB6 A;  1VGL A;  1LJR A;  2CVB A;  2CT6 A;  2HYX A;  2L59 A;  1Z9H A;  3A2X A;  5ECI B;  5BMU A;  2H73 A;  3TUE A;  3VUR A;  2HSM A;  5D9X A;  3DGQ A;  1H75 A;  1GUM A;  3ED3 A;  2LUS A;  2R3X A;  3FHK A;  2H19 A;  3O76 A;  5ECO B;  3Q19 A;  2E0Q A;  2HE3 A;  1KNG A;  1GTU A;  3DWV A;  2R0P A;  1FB0 A;  1ZOF A;  3QFA C;  3FR6 A;  3GL5 A;  3IK7 A;  4NHW A;  1M99 A;  1ZYP A;  3LJR A;  1VF1 A;  1O8X A;  3TJG A;  4MJA A;  3HJO A;  1K3O A;  4FYB A;  1EOH A;  1GNW A;  2DBC A;  4LL1 B;  5AIS A;  1UN2 A;  2P5Q A;  3LOR A;  2DJJ A;  2IMF A;  1M9B A;  4K7N A;  5ID2 B;  1GNE A;  5DAL B;  3GKN A;  3HVN A;  2H1B A;  4GST A;  3MSZ A;  4G2E A;  2PER A;  4AGS A;  2G0F A;  1NHY A;  5D9W A;  2VCZ A;  3G9B A;  2KHP A;  2NDO A;  4IQA A;  4PNF A;  3MWH A;  3R2Q A;  4YQV A;  5IMV A;  3F6D A;  5FWG A;  1GTA A;  3KP9 A;  20GS A;  2GLR A;  4TXV A;  3TB2 A;  1Z7P A;  1A0F A;  2OE0 A;  1NSW A;  2M72 A;  3QPM A;  1PSQ A;  2LS5 A;  3QAW A;  3I69 A;  4ICY A;  3CTF A;  5IMD A;  17GS A;  2GZP A;  2C0G A;  2MBT A;  1EP7 A;  2KP2 A;  2QSI A;  1QXH A;  2G2Q A;  1F9M A;  3WYW A;  2GZZ A;  2F3M A;  1GSS A;  3CSI A;  3HXS A;  3TCO A;  3M1G A;  2LNT A;  1OE8 A;  4KSO A;  3FZ4 A;  1PA3 A;  2IMK A;  2V6K A;  2VCX A;  3TOT A;  2L6C A;  4O5U A;  2K8V A;  1GSQ A;  3E0U A;  4K0N A;  5ELG A;  1ZCP A;  3G7Y A;  3FRC A;  4ZIJ A;  3ZL5 A;  1V98 A;  4L0U A;  1ILO A;  4XRD A;  18GS A;  1EWX A;  3TDG A;  3ZIJ A;  2H1G A;  1A24 A;  2A4H A;  3GUR A;  3DYR A;  1FAA A;  3QAG A;  5G30 A;  3F63 A;  4ZIL A;  3Q6O A;  4WR4 A;  4ZB8 A;  1XWK A;  5ELA A;  1A8Y A;  3KCM A;  1X9S B;  3UBL A;  2A2P A;  2AYT A;  5KEJ A;  1RQM A;  4ECJ A;  4YH2 A;  4AF2 A;  4F03 A;  2H74 A;  4NV5 A;  4I2T A;  3H79 A;  3S9F A;  3ZML A;  5HR3 A;  1JZO A;  4A5P A;  2YZH A;  1QUW A;  3HDC A;  1N8J A;  1O81 A;  3UVT A;  1A2L A;  2H76 A;  1PGT A;  1AQV A;  1TK8 B;  1M2B A;  2XHF A;  2N5F A;  2C0D A;  1XWB A;  5A4V A;  1FHE A;  4K5S A;  3TKS E;  1SJI A;  4N30 A;  2ALB A;  3ME8 A;  1XIY A;  3TKP A;  4EVM A;  2RII A;  2FWH A;  4MJC A;  4GSN A;  3DD3 A;  3HVV A;  2WZ9 A;  1XW6 A;  4K7O A;  5INY A;  4O92 A;  2H71 A;  2YWN A;  2CV4 A;  3F8U A;  1SL1 B;  2J9H A;  5AIX A;  2HNL A;  4HJM A;  4I8B A;  3APO A;  2V32 A;  3F4S A;  3KXO A;  2F8A A;  2HZE A;  2H72 A;  2R4V A;  4PGT A;  3L0H A;  1T8E B;  2RM5 A;  4BL7 A;  3FY7 A;  3GH6 A;  1V58 A;  2VL3 A;  2YWM A;  1TW9 A;  3M0F A;  2RM6 A;  1UVZ A;  4GQF A;  2VCT A;  1SL0 B;  1HYU A;  3IA1 A;  2H30 A;  2B5Y A;  1SYR A;  4JR6 A;  5CO3 A;  1BAY A;  4LLR A;  5IMF A;  4Q5Q A;  3WT2 A;  2EIR A;  2B7J A;  4N10 A;  2PUK C;  1I9D A;  4IP1 A;  5ECP B;  4X0X A;  3VWX A;  3LGC A;  1K0C A;  2F51 A;  2V1M A;  1MTC A;  4GLT A;  3QFB C;  3A2V A;  4G0L A;  5L71 A;  3KH7 A;  3W8S A;  4OCF A;  3GST A;  3NOF A;  1Y6E A;  4CY8 A;  2VLT A;  3KZQ A;  3LG6 A;  1TKD B;  3PPU A;  5KN0 A;  4ULX A;  2ZCT A;  5IPG A;  1R7H A;  2A2S A;  2JAD A;  2LRC A;  4HUA A;  2GT6 A;  2VIM A;  3HD5 A;  1AQX A;  6GSS A;  1ERV A;  1PFO A;  1JLW A;  3J7Y k;  4KB3 A;  4P3Y B;  4I2U A;  1EV9 A;  3GA4 A;  5H5Q A;  4HI7 A;  1WMJ A;  1DSB A;  3L78 A;  2YNX A;  6GSU A;  4IN0 A;  4WF5 A;  3APQ A;  4I97 A;  3APS A;  1Q4J A;  4FIW A;  4RUV A;  4MH2 A;  3UOM A;  2DKI A;  4HQS A;  5D8I A;  1HNC A;  4BIK A;  4HU7 A;  2FWE A;  1TU8 A;  5F06 A;  3Q18 A;  4EL1 A;  4OO4 A;  1VF4 A;  1PQN A;  4MPF A;  4NWY A;  2I81 A;  5ECH B;  1EV4 A;  4KCE A;  4PTS A;  5IIZ A;  3TKQ A;  3CYN A;  4OO5 A;  3TRX A;  3O3T A;  4MF6 A;  2HZE B;  3IBH A;  2R37 A;  5H5R A;  2GQL A;  2LJA A;  4BVY B;  5B8A A;  3CSJ A;  3QD9 A;  5DDL A;  4BL7 B;  4BWS A;  1C72 A;  3C71 A;  2WDU A;  5GSS A;  4K8M A;  3H8Q A;  5B7C A;  4OFT A;  3UL3 A;  1EP8 A;  1PRX A;  2B5E A; 
#chains in the Genus database with same CATH homology
 5D73 A;  3TJK A;  13GS A;  3TRP A;  4PNG A;  3HVX A;  11GS A;  2TIR A;  1LBK A;  4OFM A;  5J4U A;  4KSM A;  4ZL8 A;  2CVK A;  2H0H A;  2GSQ A;  1U88 A;  5LCZ A;  8GSS A;  1PKZ A;  3TJF A;  1KEB A;  4G10 A;  4TR4 A;  2R2J A;  4X43 A;  2X8G A;  2QA2 A;  3ERG A;  1A23 A;  3H4K A;  4XS4 A;  2H75 A;  3V1W A;  2IN3 A;  4IEL A;  1OC8 A;  5GAN D;  2IL3 A;  2KOK A;  4KDU A;  3TRQ A;  1MDK A;  3P2A A;  2I4A A;  3RDW A;  12GS A;  4IJ3 A;  2M80 A;  1XVW A;  3F0I A;  2MYG A;  3FEU A;  1J9B A;  3JCM L;  2WJU A;  2RUE A;  5ECL B;  4BWQ A;  3LXT A;  1SKR B;  3GL3 A;  5G5F A;  2REM A;  3MIX A;  4OWY A;  3OR5 A;  3WGX A;  2LRN A;  5ECR B;  1OC9 A;  3J7Y b;  3EMX A;  1OAZ A;  2FNO A;  4ECI A;  2X49 A;  1TK0 B;  2AAW A;  4FH8 A;  2MMN A;  1FG4 A;  19GS A;  1KTE A;  1RK4 A;  2ES7 A;  2R6K A;  2FY6 A;  5B6M A;  2GDR A;  1TI3 A;  2H0G A;  3LSZ A;  2RLI A;  2HXK A;  1PMT A;  1AXD A;  4TR0 A;  4YAV A;  1YY7 A;  2C0F A;  5GST A;  1DE2 A;  1B48 A;  4HZ2 A;  3HVS A;  4JED A;  2JZS A;  2D2Z A;  4LA1 A;  4BPY A;  5CNW A;  1IYI A;  2OE3 A;  1DE1 A;  22GS A;  3ZVJ D;  1LU4 A;  1I5G A;  2H01 A;  2E2G A;  2KP1 A;  2H1A A;  2H6Z A;  1O73 A;  3D22 A;  3BCK A;  1SK0 A;  5J9B A;  5HR1 A;  2VOC A;  1WP0 A;  4EKZ A;  1Z7R A;  1GUK A;  3IHG A;  3SBC A;  3DVX A;  3QMX A;  1XZO A;  1O6J A;  3CTG A;  4XS1 A;  3RHB A;  4EIQ A;  4EC0 A;  1J0F A;  2MBS A;  5ECN B;  1TRS A;  4L8E A;  4BVX B;  4IGJ A;  3BOA A;  1BYE A;  1B9Y C;  1SKW B;  1S3D A;  3UBK A;  2PN8 A;  2PBJ A;  2R0G A;  4Z2R A;  3SWL A;  1YF0 A;  3IE3 A;  4IJI A;  3VK9 A;  1GLQ A;  3HHV A;  5DQS A;  2WUL A;  1W89 A;  1TK5 B;  1HQO A;  3L9V A;  1TJD A;  4N11 A;  4F2I A;  2JL4 A;  1U3A A;  1ZL9 A;  2GSS A;  5DJL A;  2MMZ A;  4EXJ A;  4V1A g;  2DML A;  2JU5 A;  4XS6 A;  1O85 A;  3WGD A;  4MPG A;  2WB9 A;  2LKU A;  1B8X A;  5EL8 A;  3GN3 A;  5J3R A;  3QOU A;  4HOJ A;  3GHA A;  2C80 A;  1B4P A;  2MMA A;  4XS4 B;  1AC1 A;  5J5N A;  5HFG A;  1T00 A;  3VPQ A;  5FT3 A;  1T7P B;  5IM9 A;  3ERF A;  1MD3 A;  4ML6 A;  3C1S A;  4YKG A;  1NHO A;  1SU9 A;  2L57 A;  2YWO A;  4ISD A;  4G19 A;  1X9M B;  3GSS A;  1JFU A;  1QK8 A;  5COH A;  1VRS D;  1HNA A;  4KDX A;  1YEP A;  4ACS A;  4POL A;  1TRW A;  5JWO B;  1SK1 A;  4PQ1 A;  4K7I A;  1OC9 B;  1YEX A;  4HEA 2;  4AJ8 A;  1AQW A;  4XHM A;  2LST A;  4E8E A;  3HZ4 A;  1TP9 A;  1XWC A;  1BJX A;  4Q5F A;  4K6X A;  2CQ9 A;  4XRA A;  2JSZ A;  2GZY A;  1V2A A;  4KA0 A;  4MLY A;  2GS3 A;  2H1D A;  2DJ1 A;  4TR1 A;  4RI7 A;  2QC7 A;  2VL2 A;  4V2N A;  3IPZ A;  5HR0 A;  3G7I A;  1ML6 A;  4F0B A;  4N0V A;  1Z3E A;  2JZT A;  4TOP A;  3EE2 A;  4X1U A;  1M0U A;  4FYU A;  3ZMK A;  5D9V A;  3CRT A;  1KBN A;  4ILF A;  2O8V B;  2PWJ A;  3IK9 A;  1WRY A;  3IC8 A;  3NIV A;  4PQH A;  4Z7X A;  3PH9 A;  5B6N A;  2C3N A;  1A2J A;  1A0R P;  1GH2 A;  1JZD A;  2AUV A;  1G6Y A;  3ZFL A;  4O32 A;  2FCH A;  4GQC A;  2FA4 A;  6GSV A;  3A5I A;  3GTU A;  3L4N A;  4ZBD A;  3UAR A;  1X5C A;  4LMV A;  1ABA A;  3ZIV A;  4G0K A;  1XWG A;  1FVK A;  1ACV A;  3F3R A;  4LMW A;  3IHQ A;  2DLX A;  3F3Q A;  1FO5 A;  1ZZY A;  2VCV A;  3RPN A;  2DJ0 A;  4MAB A;  4MA9 A;  1THO A;  4WXT A;  2HZF A;  3CBU A;  5ECM B;  1E2Y A;  4HDE A;  1K0D A;  1ERW A;  1T3B A;  4JE1 A;  2GGT A;  1MDI A;  1W4V A;  3QAV A;  4MF5 A;  1OKD A;  4IHU A;  2YCD A;  1ZMA A;  1YDK A;  5CRG A;  5ABR A;  4BA7 A;  1SD8 A;  3Q74 A;  4POK A;  2LRT A;  16GS A;  2I1U A;  3F6F A;  3FKF A;  4WBJ A;  5DQY A;  2DSA A;  3GUS A;  1F3A A;  3HA9 A;  4L0W A;  6GSY A;  2LEG A;  2IPA A;  3GKK A;  4NPB A;  1TI1 A;  2F9S A;  2I3Y A;  1DBY A;  3ERW A;  3NZN A;  4KDY A;  3KMO A;  2HRN A;  5CRE A;  3IAS 2;  4FQU A;  1M2D A;  3RAZ A;  3H1N A;  5HFK A;  4POM A;  3EYT A;  5DBQ A;  4CHS A;  4NXI A;  2CX4 A;  4H86 A;  2OAD A;  2LQO A;  2A4V A;  4EUY A;  1AW9 A;  2X64 A;  5G5E A;  4F9Z A;  2QKE A;  3M3M A;  5A4W A;  4CW9 A;  1GUH A;  4GTU A;  4TR1 B;  4RQX A;  1XVQ A;  1GSE A;  4RI6 A;  1K3Y A;  4O5R A;  1MD4 A;  3KGK A;  3I9V 2;  1SKS B;  1THX A;  2V6O A;  5LNK e;  2FHE A;  3CSH A;  3ZFB A;  1PX7 A;  3DKS A;  3GRX A;  2OE1 A;  2H6X A;  3EIN A;  3GKX A;  2HRF A;  1RW1 A;  1M7T A;  1GL8 A;  3FYG A;  2ZUP A;  3P90 A;  3M8N A;  4WEY A;  1ZGN A;  4YAP A;  3CRU A;  1OKT A;  3LW9 A;  2H0I A;  2VL9 A;  3GFK A;  1YKA A;  2YJH A;  3GKM A;  1DUG A;  2KLX A;  4YKF A;  4TXO A;  4WF4 A;  1V57 A;  2L5O A;  4J56 E;  3M9J A;  3C73 A;  4PUR A;  3FR9 A;  1M9A A;  4HJ2 A;  4XCS A;  1XOB A;  2AHE A;  1JLV A;  3M9K A;  3GTU B;  2VL2 C;  5F8B A;  2GSR A;  2C3Q A;  2C0E A;  4USS A;  2GQM A;  4EF0 A;  3H93 A;  4KND A;  1QGV A;  4GRF A;  5ECS A;  5EPF A;  1JHB A;  1V9W A;  5J9C A;  5DCH A;  3KMN A;  5IOW A;  3GYK A;  2LTK A;  1XW5 A;  4XIH A;  2C1Y A;  3DVW A;  4HQZ A;  1X5E A;  1BED A;  4TRX A;  3VFI A;  5EVO A;  2YAN A;  1NW2 A;  2O87 A;  4MMM A;  1GLP A;  3LQ7 A;  5AN1 A;  3GH9 A;  2JSY A;  3I43 A;  4KE3 A;  1QMV A;  5B8B A;  2AV4 A;  4HU9 A;  4ZL7 A;  2CZ3 A;  3US3 A;  1PL2 A;  2VM1 A;  4GXZ A;  1YKC A;  3FZ5 A;  4GWR A;  1GTI A;  4MJB A;  2DIZ A;  1SL2 B;  4DEJ A;  2DKH A;  1R5P A;  3VI5 A;  5ENU A;  1URM A;  2OBK A;  3F4R A;  3K8N A;  1BX9 A;  3A2W A;  3KD0 A;  3D21 A;  4O5Q A;  2RUF A;  4MDC A;  3FZ9 A;  3C7M A;  3FW2 A;  2HI7 A;  2EIQ A;  4D73 A;  5G1K A;  3EU4 A;  4Z2T A;  2DJK A;  3P8W A;  1EEJ A;  1SJZ A;  3ZYW A;  1YF1 A;  2ZNM A;  2C4J A;  3ZZX A;  4PX1 A;  4MH3 A;  4KGI A;  2C8U A;  1F3B A;  2CZ2 A;  3GX8 A;  4L5O A;  2A2R A;  1WOU A;  3EWL A;  2K8S A;  2HLS A;  1K3L A;  5F0G A;  5ECK B;  5A4U A;  2IIY A;  2O89 A;  5IOX A;  5D93 A;  2MMO A;  4RQR A;  5JWR B;  1AIU A;  2EC4 A;  3TJJ A;  1JZR A;  2ON7 A;  2P31 A;  2K18 A;  1BQ7 A;  4OCE A;  4OD7 A;  4ZBB A;  1XWA A;  5GAP D;  1GSU A;  3EUR A;  4OMV A;  4MZB A;  4KX4 A;  3FR3 A;  4Q5R A;  1K0M A;  3VI7 A;  4MNN A;  2K6V A;  4TR3 A;  5CAX A;  1S3C A;  5IQY A;  1X0R A;  3UAP A;  3EVI A;  4TXO B;  5DVB A;  4ZBA A;  5IMA A;  3IV4 A;  4JU5 A;  6GSW A;  3W8J A;  2VD0 A;  1U87 A;  3MAK A;  10GS A;  3RHC A;  2JZR A;  3UEM A;  3DRN A;  1UA5 A;  2DMM A;  2O7K A;  1T1V A;  3DIE A;  2HSY A;  2VLV A;  2IMI A;  1NM3 A;  4WET A;  5HQP A;  2EIO A;  2QA1 A;  1K0N A;  5ECQ B;  3IC4 A;  3E3E A;  2FA8 A;  2XPD A;  1XOA A;  5KN2 A;  4AJ6 A;  3ZRD A;  3LYP A;  3TGZ A;  5LD0 A;  1QFN A;  4N0Z A;  3KEB A;  3TJB A;  2LJR A;  4GSS A;  1SD9 A;  2L4C A;  3UVH A;  1XXU A;  1B4Q A;  3VPT A;  3EU3 A;  2GT5 A;  2B3S A;  1GWC A;  1G7E A;  2PMT A;  3VWW A;  5JCW A;  1CQG A;  2H6Y A;  4K1F A;  1EGR A;  4NMU A;  1TOF A;  3TOU A;  3MDK A;  1ERU A;  1USB A;  3KH9 A;  5HFI A;  4MP4 A;  2PPT A;  3HYP A;  2VUP A;  5E59 A;  3RPP A;  1YZX A;  3AY8 A;  1K0B A;  2VCQ A;  4XTS A;  3GIX A;  3LEF A;  3KP8 A;  5IO0 A;  4F82 A;  4KH7 A;  4PXO A;  2LJK A;  3UMA A;  4D73 B;  1OVN A;  3IRA A;  4EE0 A;  3D0Z A;  2L6D A;  2MZC A;  1HD2 A;  4QQ7 A;  2NPB A;  2VM2 A;  1U3I A;  2YV9 A;  3D6I A;  1F2E A;  1OYJ A;  2IWT A;  4DSQ A;  1Z6N A;  3HKR A;  3TKS C;  2CAQ A;  4CDO A;  1Z5Y E;  1R5A A;  1AUC A;  3U5R E;  5BRT A;  4JRR A;  3LFL A;  1SYX A;  1G0T A;  3WT1 A;  3ZTL A;  2NTO A;  3HY2 A;  2I9H A;  3IOS A;  2DJ2 A;  2N5A A;  1PKW A;  4GCI A;  4MJE A;  2YP6 A;  1X5D A;  1B9X C;  1R4W A;  1A8L A;  4KAE A;  4E8H A;  2XBI A;  5F07 A;  2K9F A;  2XC2 A;  3R3E A;  2UZ8 A;  3DEX A;  5KN1 A;  1TTZ A;  1G6W A;  1R26 A;  3ZRE A;  2H66 A;  2VCW A;  2FWG A;  4ID0 A;  5JCU A;  3GNJ A;  5E4W A;  1TRU A;  2FGX A;  2PVO C;  1S3A A;  2F8F A;  1GSY A;  2YZU A;  1E6B A;  1O7U A;  3QR6 A;  1TDI A;  1T4Z A;  5KOX A;  2AB6 A;  5C04 A;  2WGR A;  2HFD A;  1ST9 A;  1YQ1 A;  2ON5 A;  5KN3 A;  3DXB A;  2LV3 A;  2OKA A;  4V1A p;  3ISO A;  4LL4 B;  2H70 A;  2CAI A;  2BTO T;  2LQQ A;  2WRT A;  1GUL A;  2LNS A;  1GRX A;  1FB6 A;  3D4M A;  1PD2 1;  2V41 A;  3PR8 A;  3C1R A;  2FLS A;  1MEK A;  4DSS A;  1T4Y A;  2GTU A;  1PL1 A;  1ZYN A;  3KTL A;  4ZL9 A;  5D9T A;  5C00 A;  4G9H A;  2QGV A;  1GP1 A;  4Q5N A;  2DJ3 A;  3E9J B;  2GST A;  5HR2 A;  1Z6M A;  2KUC A;  3A5W A;  1Y25 A;  2GVP A;  4MF7 A;  1SEN A;  2IFQ A;  5AIV A;  5JWQ B;  3ZLP A;  4J57 E;  2VAF A;  5CRD A;  1TU7 A;  2NBS A;  3D4T A;  3PGT A;  1CQH A;  1VF2 A;  1WE0 A;  2B1K A;  4K2D A;  5KOW A;  3IAM 2;  5GZZ B;  2B7K A;  2PGT A;  3DML A;  1X9W B;  2TRX A;  4MZC A;  4KCA A;  2HSH A;  1SJ6 A;  4NHZ A;  4KF9 A;  2GQK A;  3G7J A;  3KIJ A;  14GS A;  3HJM A;  4NAX A;  4JR4 A;  5IMC A;  4YQU A;  3ZVJ A;  1O8W A;  2OJL A;  3TKR A;  4BVY A;  1TXX A;  4QL7 A;  5D96 A;  2E7P A;  4I5Q A;  4NV2 A;  2PU9 C;  2FD3 A;  3U6V A;  3EMP A;  4GF0 A;  2OBI A;  1HNB A;  3HCZ A;  2B5X A;  3QCP A;  4IVF A;  4EDY A;  4ZB9 A;  2VO4 A;  2FUG 2;  2YPM A;  3LXZ A;  5CP1 A;  1WPI A;  1A2M A;  3WGE A;  3W6G A;  2E2M A;  2YOI A;  1XCC A;  4ECC A;  4FYC A;  1MDJ A;  2Z9S A;  1G7O A;  2PVQ A;  4PUA A;  5J41 A;  3GX0 A;  6GSX A;  3UJ1 A;  2C3T A;  2YN1 A;  2O85 A;  1Q98 A;  3UIW A;  3QDN A;  2XPE A;  1U6T A;  4DVC A;  3LWA A;  4TKY A;  1WWJ A;  2CVD A;  3BBY A;  2AJQ B;  7GSS A;  1K0A A;  1YJ6 A;  2YWI A;  1SK2 A;  3IDV A;  4EDZ A;  4PQI A;  2YJ7 A;  1FOV A;  2VD1 A;  4V2L A;  3PIN A;  1J08 A;  4K9Z A;  1ERT A;  4ECB A;  3ZIT A;  3GV1 A;  1GTB A;  4KUN A;  2P5R A;  4WBR D;  1H4O A;  2WS2 A;  5DAK A;  5H5S A;  2J23 A;  5DJM A;  4DSS B;  2P0G A;  5F05 A;  1PN9 A;  4PUF C;  4J2F A;  1OC3 A;  1EOG A;  1ON4 A;  5EY6 A;  4IS0 A;  4TVE A;  4EIP A;  2WFC A;  4ML1 A;  3EPT A;  3WD6 A;  1AAZ A;  2OAC A;  5CRH A;  1ZYE A;  3O6T A;  4MZW A;  2IFQ B;  4IW9 A;  4WKW A;  3KTB A;  2BMX A;  3P7X A;  5CYY A;  1K0O A;  2JAC A;  4DSR A;  3IR4 A;  2R0C A;  2BJX A;  4L5L A;  4JZQ A;  1ZYQ B;  2X99 A;  4K2X A;  1FVJ A;  4HZ4 A;  2FWF A;  3BJ5 A;  1IYH A;  2CA8 A;  2DIY A;  4Z2U A;  5A5K A;  3VWU A;  3L9S A;  4YQM A;  5DCG A;  3TKS A;  4MK3 A;  1JZW A;  4K0G A;  1XBS A;  4V2M A;  2B6M A;  4IP6 A;  4POB A;  2TRC P;  5ID2 A;  5DAL A;  4IKH A;  2HRA A;  3CXG A;  2HT9 A;  2OA7 A;  1FW1 A;  3FMW A;  2N5B A;  3C8E A;  1GSF A;  2WCI A;  3D5J A;  2V2G A;  4BVX A;  5G31 A;  1M2A A;  5IPH A;  1WJK A;  4AJ7 A;  5CRW A;  3MYD A;  3VLN A;  2NVL A;  1XFL A;  2M46 A;  2IME A;  4CY6 A;  3BD2 A;  4FO5 A;  2B1L A;  2IMD A;  3A3T A;  1WIK A;  1V40 A;  4O7H A;  3FK8 A;  4G0I A;  4OFN A;  3N9J A;  3LYK A;  1XPV A;  3N5O A;  3MNG A;  4IQ1 A;  3FZA A;  1XW9 A;  1EGO A;  4WR5 A;  5JCG A;  4HS1 A;  2L5L A;  3BCI A;  1GSD A;  1EZK A;  3RBT A;  4IBP A;  1QQ2 A;  1F37 A;  1FOH A;  3HZ8 A;  3GMF A;  3CMI A;  2L4Q A;  4MCU A;  3KM6 A;  9GSS A;  4I6X A;  4K5R A;  2DC5 A;  3IXR A;  2X4A A;  5G2Z A;  3VWV A;  1EEM A;  4QL9 A;  2CX3 A;  4TW5 A;  5AGY A;  3KJY A;  1BG5 A;  4KW6 A;  5FHI A;  4TN8 A;  1UC7 A;  3EC3 A;  1OE7 A;  2HRK A;  2VLU A;  1PX6 A;  5IO2 A;  2R5G A;  1N2A A;  3I6A A;  5DAK B;  2IJY A;  4F0C A;  4EO3 A;  5G1L A;  1F6M C;  1VF3 A;  3HJP A;  2YV7 A;  2H8L A;  6GST A;  4JBB A;  3F4T A;  4X4J A;  3F9U A;  1PN0 A;  2X8H A;  2X8C A;  3ME7 A;  3L9U A;  4ZXG A;  5IMZ A;  1TRV A;  2XBQ A;  4ZB6 A;  1VGL A;  1LJR A;  2CVB A;  2CT6 A;  2HYX A;  2L59 A;  1Z9H A;  3A2X A;  5ECI B;  5BMU A;  2H73 A;  3TUE A;  3VUR A;  2HSM A;  5D9X A;  3DGQ A;  1H75 A;  1GUM A;  3ED3 A;  2LUS A;  2R3X A;  3FHK A;  2H19 A;  3O76 A;  5ECO B;  3Q19 A;  2E0Q A;  2HE3 A;  1KNG A;  1GTU A;  3DWV A;  2R0P A;  1FB0 A;  1ZOF A;  3QFA C;  3FR6 A;  3GL5 A;  3IK7 A;  4NHW A;  1M99 A;  1ZYP A;  3LJR A;  1VF1 A;  1O8X A;  3TJG A;  4MJA A;  3HJO A;  1K3O A;  4FYB A;  1EOH A;  1GNW A;  2DBC A;  4LL1 B;  5AIS A;  1UN2 A;  2P5Q A;  3LOR A;  2DJJ A;  2IMF A;  1M9B A;  4K7N A;  5ID2 B;  1GNE A;  5DAL B;  3GKN A;  2H1B A;  4GST A;  3MSZ A;  4G2E A;  2PER A;  4AGS A;  2G0F A;  1NHY A;  5D9W A;  2VCZ A;  3G9B A;  2KHP A;  2NDO A;  4IQA A;  4PNF A;  3MWH A;  3R2Q A;  4YQV A;  5IMV A;  3F6D A;  5FWG A;  1GTA A;  3KP9 A;  20GS A;  2GLR A;  4TXV A;  3TB2 A;  1Z7P A;  1A0F A;  2OE0 A;  1NSW A;  2M72 A;  3QPM A;  1PSQ A;  2LS5 A;  3QAW A;  3I69 A;  4ICY A;  3CTF A;  5IMD A;  17GS A;  2GZP A;  2C0G A;  2MBT A;  1EP7 A;  2KP2 A;  2QSI A;  1QXH A;  2G2Q A;  1F9M A;  3WYW A;  2GZZ A;  2F3M A;  1GSS A;  3CSI A;  3HXS A;  3TCO A;  3M1G A;  2LNT A;  1OE8 A;  4KSO A;  3FZ4 A;  1PA3 A;  2IMK A;  2V6K A;  2VCX A;  3TOT A;  2L6C A;  4O5U A;  2K8V A;  1GSQ A;  3E0U A;  4K0N A;  5ELG A;  1ZCP A;  3G7Y A;  3FRC A;  4ZIJ A;  3ZL5 A;  1V98 A;  4L0U A;  1ILO A;  4XRD A;  18GS A;  1EWX A;  3TDG A;  3ZIJ A;  2H1G A;  1A24 A;  2A4H A;  3GUR A;  3DYR A;  1FAA A;  3QAG A;  5G30 A;  3F63 A;  4ZIL A;  3Q6O A;  4WR4 A;  4ZB8 A;  1XWK A;  5ELA A;  1A8Y A;  3KCM A;  1X9S B;  3UBL A;  2A2P A;  2AYT A;  5KEJ A;  1RQM A;  4ECJ A;  4YH2 A;  4AF2 A;  4F03 A;  2H74 A;  4NV5 A;  4I2T A;  3H79 A;  3S9F A;  3ZML A;  5HR3 A;  1JZO A;  4A5P A;  2YZH A;  1QUW A;  3HDC A;  1N8J A;  1O81 A;  3UVT A;  1A2L A;  2H76 A;  1PGT A;  1AQV A;  1TK8 B;  1M2B A;  2XHF A;  2N5F A;  2C0D A;  1XWB A;  5A4V A;  1FHE A;  4K5S A;  3TKS E;  1SJI A;  4N30 A;  2ALB A;  3ME8 A;  1XIY A;  3TKP A;  4EVM A;  2RII A;  2FWH A;  4MJC A;  4GSN A;  3DD3 A;  3HVV A;  2WZ9 A;  1XW6 A;  4K7O A;  5INY A;  4O92 A;  2H71 A;  2YWN A;  2CV4 A;  3F8U A;  1SL1 B;  2J9H A;  5AIX A;  2HNL A;  4HJM A;  4I8B A;  3APO A;  2V32 A;  3F4S A;  3KXO A;  2F8A A;  2HZE A;  2H72 A;  2R4V A;  4PGT A;  3L0H A;  1T8E B;  2RM5 A;  4BL7 A;  3FY7 A;  3GH6 A;  1V58 A;  2VL3 A;  2YWM A;  1TW9 A;  3M0F A;  2RM6 A;  1UVZ A;  4GQF A;  2VCT A;  1SL0 B;  1HYU A;  3IA1 A;  2H30 A;  2B5Y A;  1SYR A;  4JR6 A;  5CO3 A;  1BAY A;  4LLR A;  5IMF A;  4Q5Q A;  3WT2 A;  2EIR A;  2B7J A;  4N10 A;  2PUK C;  1I9D A;  4IP1 A;  5ECP B;  4X0X A;  3VWX A;  3LGC A;  1K0C A;  2F51 A;  2V1M A;  1MTC A;  4GLT A;  3QFB C;  3A2V A;  4G0L A;  5L71 A;  3KH7 A;  3W8S A;  4OCF A;  3GST A;  3NOF A;  1Y6E A;  4CY8 A;  2VLT A;  3KZQ A;  3LG6 A;  1TKD B;  3PPU A;  5KN0 A;  4ULX A;  2ZCT A;  5IPG A;  1R7H A;  2A2S A;  2JAD A;  2LRC A;  4HUA A;  2GT6 A;  2VIM A;  3HD5 A;  1AQX A;  6GSS A;  1ERV A;  1JLW A;  3J7Y k;  4KB3 A;  4P3Y B;  4I2U A;  1EV9 A;  3GA4 A;  5H5Q A;  4HI7 A;  1WMJ A;  1DSB A;  3L78 A;  2YNX A;  6GSU A;  4IN0 A;  4WF5 A;  3APQ A;  4I97 A;  3APS A;  1Q4J A;  4FIW A;  4RUV A;  4MH2 A;  3UOM A;  2DKI A;  4HQS A;  5D8I A;  1HNC A;  4HU7 A;  2FWE A;  1TU8 A;  5F06 A;  3Q18 A;  4EL1 A;  4OO4 A;  1VF4 A;  1PQN A;  4MPF A;  4NWY A;  2I81 A;  5ECH B;  1EV4 A;  4KCE A;  4PTS A;  5IIZ A;  3TKQ A;  3CYN A;  4OO5 A;  3TRX A;  3O3T A;  4MF6 A;  2HZE B;  3IBH A;  2R37 A;  5H5R A;  2GQL A;  2LJA A;  4BVY B;  5B8A A;  3CSJ A;  3QD9 A;  5DDL A;  4BL7 B;  4BWS A;  1C72 A;  3C71 A;  2WDU A;  5GSS A;  4K8M A;  3H8Q A;  5B7C A;  4OFT A;  3UL3 A;  1EP8 A;  1PRX A;  2B5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...