2HSYA

Solution structure of thioredoxin 2 from saccharomyces cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin II
publication title NMR solution structure of the reduced form of thioredoxin 2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hsyA00
2JACA 5G2ZA 3D22A 2C3TA 2LUSA 2OKAA 5DQYA 5ABRA 3H1NA 2R4VA 5IPGA 4RQXA 5ECLB 1B4PA 4L5LA 2HYXA 4ZL9A 3FW2A 4Q5NA 3RHBA 4ISDA 1F37A 3GX0A 3N9JA 1EP7A 1SL0B 1JZDA 4KA0A 1URMA 2GS3A 1AUCA 2QGVA 2TRCP 4WBJA 1YEPA 3HD5A 1PGTA 1T4ZA 2RM5A 1O7UA 3GA4A 1Z9HA 1A0RP 1XBSA 2HNLA 4DVCA 3UBLA 2F51A 3CMIA 2A2SA 5ECHB 4O32A 2H8LA 4HJ2A 4KDUA 1HD2A 2V6OA 3QCPA 2HZEB 4MCUA 2GSTA 2VL3A 4XIHA 2F3MA 3WYWA 10GSA 4L5OA 5DDLA 1CQHA 2WRTA 1T00A 4GRFA 4PGTA 3GH9A 2LJRA 4GSTA 3ERGA 1U87A 2M72A 1ERVA 3ZVJD 4WBRD 5B8BA 1X9MB 3HA9A 2FWFA 2VL2C 3DIEA 1GLQA 2DLXA 4MPFA 3R2QA 2YWNA 1NW2A 3QAVA 2VCQA 4YQVA 4MJBA 3L78A 6GSXA 1OC3A 2G2QA 1AQVA 1GTUA 5CYYA 3EU3A 5IMCA 1M2BA 4MJCA 4QQ7A 1SJZA 4ACSA 2O8VB 5GAPD 4BL7A 4IP6A 3BBYA 4MPGA 2B7KA 2GQKA 4MK3A 4I5QA 1HYUA 2X8HA 4TVEA 4GXZA 3M8NA 2IWTA 2GSSA 4G10A 3DKSA 1DUGA 2H1AA 6GSVA 1Q98A 4OFTA 1TRSA 3G7YA 3GIXA 4KW6A 2FNOA 2VCWA 3TRPA 4KX4A 4ULXA 3IBHA 3D21A 2FA8A 1TRWA 2YV9A 3H8QA 5D8IA 2H6YA 1DE1A 2O7KA 11GSA 4YAPA 2RUFA 4LA1A 2VIMA 1SL1B 2VLTA 2LNSA 1R7HA 4AGSA 5DQSA 2FGXA 2FCHA 1XWBA 4HU7A 5J41A 2N5FA 2H0GA 5D73A 5F06A 4EC0A 2MBTA 3GKNA 2H1DA 3EC3A 1UA5A 3QD9A 4V2NA 1MTCA 2C0FA 5HR0A 5IMDA 5G5FA 2HRNA 3BOAA 2L6DA 1A23A 1EZKA 1VF4A 3VI5A 2B1LA 2R6KA 4HDEA 5CO3A 2GVPA 5AGYA 20GSA 3BCKA 3LQ7A 2B5YA 2PVQA 3FZAA 1GSFA 1GTAA 4HUAA 4MZWA 3G9BA 2VL2A 3S9FA 2XC2A 2CT6A 4WEYA 1K3LA 1BJXA 1YKCA 4HU9A 1T4YA 4PQHA 1GSQA 4WF5A 4MH2A 3RPPA 4MF6A 3ZITA 1S3CA 2BTOT 1EWXA 2GTUA 3GRXA 5IOWA 1R5AA 1OKDA 4J57E 5A5KA 3RDWA 1LJRA 3P8WA 3IV4A 4ECCA 2F9SA 3KIJA 1GWCA 1JZRA 1TRUA 3LGCA 4IP1A 3P90A 5B6NA 5FT3A 1XWAA 2LJAA 1SL2B 3CYNA 3KTBA 4F2IA 3F8UA 3UVTA 2I3YA 17GSA 1ZYQB 5JWRB 1SK1A 5AISA 1Z3EA 1IYHA 2YWIA 3UAPA 2L4QA 1GL8A 2GQMA 2MBSA 3FHKA 2H01A 1ERTA 3UL3A 2IN3A 4EUYA 5HR2A 2LS5A 3E3EA 4MDCA 1A2JA 4JZQA 5G5EA 1OE8A 2QSIA 3ZZXA 2DMMA 4PURA 1EV9A 5CREA 1A8YA 4BVXA 3RPNA 3QDNA 3IAS2 4CW9A 4XS4A 1G0TA 18GSA 2L5OA 3WD6A 5DALB 4EKZA 5DJLA 4JR6A 1M0UA 1XOBA 5LD0A 4AF2A 2C8UA 2F8FA 1PL1A 3HXSA 3ZYWA 1ZCPA 3G7IA 4IQ1A 2QKEA 2P5RA 2KP1A 3KXOA 4GLTA 1SK2A 2LEGA 4KNDA 2V32A 2NTOA 4XTSA 2PU9C 2K6VA 3H79A 1V57A 5ID2B 2I4AA 4BWSA 4ECJA 3FYGA 3TJFA 1KBNA 1ACVA 2R5GA 2GZZA 5J3RA 1PRXA 2ZUPA 2HXKA 1ZZYA 2XPDA 1QK8A 4D73B 1MEKA 1OE7A 2B1KA 3TJJA 1GSEA 2OJLA 3CTGA 5INYA 4XRAA 5D9XA 3QFBC 4CDOA 1SENA 3NZNA 1AIUA 4PUAA 2HSYA 4TR1A 1KEBA 3QMXA 1TXXA 1EGRA 4FH8A 1SJIA 1K0MA 3CRUA 2C80A 2LRCA 2H0IA 3KEBA 5J9CA 3IE3A 1GSUA 2B7JA 4E8EA 3F4RA 3ZFLA 1H4OA 3HZ4A 3L9UA 6GSSA 2AV4A 2CVDA 3HJMA 3LSZA 3KH7A 6GSTA 4IJIA 2L4CA 1HQOA 1TOFA 4WKWA 4POKA 4V1Ag 2YOIA 1PKWA 1G7OA 3QR6A 3NOFA 3E9JB 5G30A 4HZ4A 2H74A 1UC7A 3OR5A 1F9MA 3FZ4A 2CVBA 4Z7XA 5EL8A 1GTIA 5IQYA 2AAWA 3D6IA 3ZFBA 3IHQA 1YY7A 2IMEA 1A2MA 3GURA 5JWQB 4EVMA 4BVYA 2DJ0A 2NVLA 4TN8A 3MSZA 5GZZB 5HFIA 3O6TA 2J9HA 2WB9A 1NHOA 1GSDA 2O89A 5J9BA 3FKFA 3F6DA 1SK0A 5CP1A 2C3NA 1A2LA 1SJ6A 1ILOA 3G7JA 3GX8A 4WR4A 4NV5A 4WR5A 2HLSA 2HT9A 4LL1B 1TI1A 1LU4A 1J9BA 5AN1A 1K0NA 4NHZA 3KMNA 1F3AA 4LMWA 3ZIJA 2EIOA 1VF2A 4GSSA 2AYTA 1TK0B 3TCOA 2HSHA 4OWYA 2IFQA 1K0AA 4MABA 4IKHA 3GSTA 2KOKA 3GTUA 2GZPA 3QAWA 3LFLA 1N2AA 4I6XA 2KHPA 1Y25A 5H5RA 1TU8A 2VM2A 2E0QA 3ZMLA 1F2EA 2GGTA 3W8SA 2Z9SA 2N5AA 1T1VA 5IMAA 3VPQA 2PUKC 1GNEA 3K8NA 3GV1A 1MD4A 4AJ6A 3ZLPA 2P0GA 3UIWA 5CRWA 4HOJA 4KDXA 3APSA 2FUG2 2B3SA 3Q19A 2H30A 3KM6A 4ZBAA 5H5SA 2C0DA 1K0DA 1V9WA 1XW5A 4TXOA 3TKSA 1ABAA 1B48A 4NXIA 3TJKA 1JFUA 3VPTA 6GSUA 1KTEA 3VWVA 1PD21 2ES7A 4POMA 4GQCA 1EEJA 3DYRA 1XXUA 4WXTA 2WJUA 4KUNA 2AJQB 4JRRA 1UN2A 2B5XA 4FYCA 4K7OA 1Q4JA 4ZILA 3M9KA 1X0RA 4L8EA 2CA8A 3TJBA 3KJYA 3QPMA 3F3RA 5IPHA 3W8JA 2FWHA 3ZL5A 1AXDA 2I9HA 3UARA 2H0HA 2X8GA 3GSSA 1XW9A 3ZMKA 4F0BA 2YZUA 4KAEA 2CVKA 1U3AA 2RLIA 1UVZA 2VCVA 3US3A 1I9DA 2GT6A 3CTFA 1TRVA 2DBCA 3LG6A 3I43A 1VF1A 4NAXA 4DSSB 4ZIJA 2EIQA 2VUPA 3UMAA 5LNKe 2L6CA 1GULA 1VRSD 2FWGA 3TKRA 2GLRA 5DAKB 4YQUA 4IBPA 2VCTA 4DEJA 1GUKA 3CSIA 3ED3A 1V98A 5JCGA 4BWQA 1SD9A 3HCZA 2BJXA 2E7PA 4IELA 1EEMA 3NIVA 2MMOA 4MZCA 5HR3A 1Y6EA 3F63A 2O85A 1BEDA 1OC9B 2H66A 2YCDA 2IMFA 1FVKA 3TJGA 4YQMA 1XPVA 4MA9A 2VLVA 5ECOB 3RBTA 3HHVA 3KP9A 1T8EB 2R37A 1V2AA 1VF3A 2KUCA 2H1BA 3GH6A 1EV4A 2JADA 4N11A 3C73A 4XCSA 1B4QA 1XWKA 1PX7A 2HE3A 3C1SA 2NPBA 4IW9A 1Z7RA 1AC1A 2FWEA 4PQ1A 3MWHA 4L0UA 4JE1A 3D4TA 3ZVJA 1FVJA 1Z6MA 2DMLA 1TW9A 3TGZA 1FO5A 2DSAA 1A24A 5JCWA 1ZGNA 4E8HA 3Q18A 5KN3A 3L4NA 1MDIA 3A3TA 1QGVA 4OFMA 1ON4A 2K8SA 3DEXA 2MMAA 1EGOA 5F8BA 4TR4A 5F0GA 1I5GA 3QOUA 3IC4A 5DCGA 5HR1A 3W6GA 5AIXA 3CSHA 3SWLA 1DBYA 2FHEA 4HEA2 1EOGA 4F9ZA 5J4UA 2YWMA 4F03A 1WPIA 3RHCA 2MZCA 2WFCA 2HI7A 2EIRA 2LV3A 1SYRA 1Z7PA 1YKAA 2YWOA 4EF0A 3MDKA 3MNGA 3IK7A 4GF0A 3M0FA 4MF7A 2IPAA 3Q74A 2L5LA 3O3TA 5ECIB 1A8LA 5IO2A 14GSA 1GH2A 2PERA 2J23A 4LMVA 4FO5A 3DVWA 3DVXA 4HQZA 1BAYA 3GYKA 3ME7A 3F6FA 4LL4B 4HQSA 4AJ8A 5ECMB 2B6MA 1W4VA 1THOA 4KSMA 1FAAA 1Z6NA 2ZCTA 3L0HA 1S3AA 4OFNA 2VCXA 2OACA 1PQNA 3J7Yk 1SKRB 3APQA 1NHYA 2TIRA 5ECPB 2CAQA 4V1Ap 1J08A 4IS0A 4ZXGA 2V6KA 3DXBA 3DGQA 2X8CA 4FYUA 1YF0A 3FK8A 2VO4A 3KMOA 3C71A 2LTKA 4POLA 1ZL9A 2GSQA 2NDOA 1USBA 2YANA 3FR9A 1XZOA 2VAFA 5A4UA 5C04A 1RQMA 1TDIA 1O8WA 1GSYA 5EVOA 1YJ6A 1O73A 1RK4A 2CV4A 1J0FA 4N0ZA 2I81A 1B9YC 3DRNA 4N0VA 2PBJA 1OAZA 4YH2A 1NSWA 1G7EA 4G2EA 5AIVA 4F82A 3WT2A 1GRXA 1KNGA 2RUEA 5EPFA 3A2VA 5G31A 3C1RA 4O7HA 1XWCA 3WGDA 4ZBDA 3DMLA 2B5EA 4H86A 2O87A 1JLVA 3LWAA 1RW1A 1M99A 3IK9A 5CRHA 4MZBA 2LJKA 5JWOB 4BPYA 5LCZA 2VCZA 3VLNA 1E2YA 1A0FA 3LORA 2F8AA 4ID0A 2GQLA 2VOCA 4KDYA 4OMVA 4TR3A 9GSSA 1O81A 2C4JA 3SBCA 4V2LA 2DJKA 2VD1A 2DJ1A 1QFNA 1K0OA 1T7PB 3GKMA 2H72A 2CZ2A 4ZB6A 3FZ9A 4QL9A 4GWRA 4PNGA 2G0FA 5A4WA 5IIZA 1PL2A 4K7IA 1ZYEA 5DVBA 5HQPA 1G6YA 4ECIA 2H73A 2H19A 2XBIA 3DD3A 2HFDA 1K0CA 5GAND 4TOPA 4X1UA 2IMIA 1TJDA 5D93A 5L71A 4FYBA 2L57A 5D9TA 2C1YA 4MF5A 3TKPA 1ERUA 5D9WA 3HDCA 1YZXA 13GSA 1THXA 2WGRA 2AUVA 1XOAA 2ON5A 5FWGA 5KN2A 3I6AA 1VGLA 1PN9A 5E59A 1Z5YE 4IQAA 5F05A 2RIIA 2DJJA 3KZQA 3APOA 3V1WA 4Q5QA 5DALA 3C7MA 5IOXA 2TRXA 1PKZA 1K3OA 2FD3A 2A4VA 2OBKA 2CAIA 2YN1A 2R2JA 1SD8A 1WP0A 1TI3A 4MH3A 1YF1A 1HNBA 1FG4A 3DWVA 2R3XA 1F6MC 2WDUA 4P3YB 4BA7A 3ZIVA 2P31A 2YV7A 5ELGA 5ID2A 1WRYA 1GUMA 1OC8A 2PWJA 2FA4A 3KTLA 2MMZA 2OE3A 3EINA 1PMTA 1TKDB 2K9FA 2LRTA 3LJRA 4D73A 3IPZA 4K0GA 5H5QA 4K6XA 4HZ2A 1X5CA 1FW1A 2YPMA 5COHA 1B8XA 3CBUA 2EC4A 4OCEA 3EU4A 1NM3A 1X5DA 2VD0A 1O6JA 4V2MA 1O8XA 3D4MA 2YZHA 5KN0A 3E0UA 1SYXA 3A2WA 1M9AA 4CHSA 12GSA 3BCIA 3VK9A 2WCIA 1WMJA 3AY8A 1GUHA 2WS2A 3RAZA 1ZMAA 4YAVA 2OE1A 5GSTA 3FEUA 5KEJA 3M9JA 1R26A 5G1LA 2BMXA 3TKSE 2I1UA 3HVSA 22GSA 2DJ2A 3VI7A 4ZB8A 5EY6A 3IR4A 4PNFA 1V58A 2XPEA 4RQRA 3IA1A 4I8BA 3EE2A 3UOMA 4O5RA 5ECSA 2VL9A 4EE0A 3HVVA 4HJMA 2MMNA 3N5OA 1R5PA 3KCMA 5GSSA 3JCML 2H75A 1TK8B 1LBKA 2OA7A 4TKYA 4K7NA 8GSSA 4GQFA 2ON7A 3PGTA 1YDKA 2JZSA 2CX3A 1GSSA 1M7TA 1XCCA 1H75A 1TU7A 2GDRA 1F3BA 3BD2A 4JBBA 1SKWB 3IXRA 3FY7A 3A2XA 1YEXA 2WULA 4OD7A 2LSTA 1GLPA 3HJPA 4Q5RA 2K8VA 3EURA 4WF4A 1XIYA 3H93A 3IOSA 3U5RE 5J5NA 3LYPA 3CXGA 1QXHA 2LNTA 4MLYA 5B7CA 1M2AA 1OKTA 4IVFA 4PXOA 4K8MA 3FRCA 1QUWA 4XRDA 3F3QA 4ML6A 3ERWA 1X9WB 3TB2A 5A4VA 1SKSB 1K3YA 2H71A 3FR3A 1EP8A 4PUFC 4DSQA 4F0CA 2JZRA 4HI7A 3VFIA 1U88A 4N10A 2JU5A 2GSRA 1MDJA 3MAKA 3UEMA 1GP1A 1C72A 3J7Yb 3I9V2 3ZREA 2C0EA 4K9ZA 5DJMA 2V41A 4XS4B 5CNWA 2AHEA 1XVWA 2CQ9A 1JHBA 1PSQA 3GMFA 3LEFA 2E2MA 5CRGA 4KH7A 2P5QA 4IHUA 1WJKA 5E4WA 4G9HA 5HFKA 1TP9A 4NPBA 1WIKA 3LXZA 3F4TA 2WZ9A 2YJ7A 3GKKA 4OO5A 4ZBBA 1OYJA 5ECRB 4NV2A 3VWUA 2ALBA 1FOVA 3P2AA 1QMVA 1JLWA 3A5WA 5KN1A 2DC5A 4I2TA 2HZEA 4OCFA 1GTBA 2C3QA 4RI7A 4I97A 5IMFA 3I69A 5G1KA 4ZL8A 3FZ5A 4RUVA 4XS6A 2YNXA 4PQIA 2LRNA 3F9UA 5F07A 3IDVA 1M2DA 3WGXA 1TTZA 4Q5FA 4JR4A 3M1GA 1S3DA 2OE0A 3TRQA 3CSJA 3D0ZA 1WWJA 3F0IA 3FR6A 1HNAA 2JSZA 4KGIA 4TR1B 3HYPA 3IAM2 4N30A 1OVNA 2C0GA 2RM6A 1BX9A 1CQGA 2PN8A 4HS1A 2YJHA 4XHMA 2IMKA 4JEDA 4RI6A 1ZOFA 4L0WA 3GN3A 5FHIA 3WT1A 2CZ3A 3GKXA 4DSSA 2JL4A 1SU9A 1E6BA 2FLSA 2CX4A 3EWLA 4J2FA 1IYIA 2IL3A 3ISOA 2QC7A 1XWGA 3QAGA 5DAKA 4NWYA 1EOHA 3PINA 2IMDA 3KP8A 3D5JA 3L9SA 3VURA 3ZTLA 4KSOA 2PMTA 1BQ7A 3F4SA 19GSA 2M46A 2LQOA 3H4KA 2A2RA 3GHAA 4EDZA 5D96A 4X43A 1OC9A 3LYKA 4X0XA 3HVXA 3TOUA 5ENUA 4GTUA 5CAXA 1R4WA 3ERFA 5CRDA 1XFLA 2PVOC 5IM9A 3PH9A 2V1MA 1WOUA 4LLRA 4GSNA 4ZL7A 4O92A 2PPTA 3Q6OA 2MYGA 3HY2A 7GSSA 2XHFA 4ECBA 5IMVA 3TKQA 5ELAA 2H1GA 4EL1A 3HKRA 1AQWA 1G6WA 3TDGA 2YP6A 3HZ8A 4ZB9A 1M9BA 3EMPA 1TK5B 4TR0A 3CRTA 2DIZA 1MD3A 2VM1A 4KB3A 4EO3A 4MJAA 2L59A 1N8JA 2N5BA 3GUSA 2X99A 1X9SB 2IFQB 5ECNB 3GTUB 4QL7A 1BYEA 4FIWA 3L9VA 1FHEA 1O85A 1ML6A 3LXTA 1AAZA 5B8AA 1WE0A 3BJ5A 2E2GA 2IJYA 4TW5A 2XBQA 4KE3A 2M80A 1HNCA 4IJ3A 4IGJA 2REMA 1ST9A 2DIYA 3EVIA 1FB0A 2OBIA 4ML1A 3C8EA 5ECKB 2H76A 4WETA 2V2GA 1ERWA 1X5EA 3O76A 4EXJA 2HZFA 3UVHA 3TUEA 1FB6A 3PR8A 4TXOB 2DJ3A 1U3IA 4NHWA 2VLUA 16GSA 4XS1A 2KLXA 5D9VA 3HJOA 1W89A 3GFKA 4EDYA 4OO4A 1DSBA 4K1FA 1V40A 2AB6A 1JZOA 4MMMA 2LQQA 1AW9A 3EYTA 1PX6A 3U6VA 5B6MA 4AJ7A 1XW6A 1PA3A 1U6TA 3TKSC 4TRXA 2JSYA 2GT5A 2NBSA 4K2DA 4MP4A 3M3MA 4DSRA 3TOTA 4KCEA 4IN0A 2H70A 4GCIA 3KD0A 3VWWA 3ZRDA 3EMXA 1T3BA 2JZTA 2GZYA 3UJ1A 4POBA 1AQXA 5ECQB 2KP2A 2ZNMA 3IRAA 5IMZA 4NMUA 1K0BA 3GNJA 2HRFA 1JZWA 2K18A 1XVQA 5IO0A 4TXVA 3GL5A 1B9XC 3UBKA 3WGEA 3TRXA 5DCHA 2LKUA 2PGTA 1MDKA 4JU5A 1QQ2A 4I2UA 5HFGA 5JCUA 1GNWA 5C00A 4MJEA 3KH9A 6GSYA 3KGKA 4KCAA 2IIYA 3ME8A 4PX1A 1YQ1A 3VWXA 4G19A 4J56E 1BG5A 4K0NA 2X64A 2H6XA 3P7XA 2OADA 2D2ZA 3GL3A 5DBQA 6GSWA 2H6ZA 2FY6A 1DE2A 3QFAC 4ILFA
chains in the Genus database with same CATH superfamily
2JACA 5G2ZA 3D22A 2C3TA 2LUSA 2OKAA 5DQYA 5ABRA 3H1NA 2R4VA 5IPGA 4RQXA 4O5QA 5ECLB 1B4PA 4L5LA 2HYXA 4ZL9A 3FW2A 4Q5NA 3RHBA 4ISDA 1F37A 3GX0A 3N9JA 1EP7A 1SL0B 1JZDA 4KA0A 1URMA 2GS3A 1AUCA 2QGVA 2TRCP 4WBJA 1YEPA 3HD5A 1PGTA 1T4ZA 2RM5A 1O7UA 3GA4A 1Z9HA 1A0RP 1XBSA 2HNLA 4DVCA 3UBLA 2F51A 3CMIA 2A2SA 5ECHB 4O32A 2H8LA 4HJ2A 4KDUA 1HD2A 2V6OA 3QCPA 2HZEB 4MCUA 2GSTA 2VL3A 4XIHA 2F3MA 3WYWA 10GSA 4L5OA 5DDLA 1CQHA 2WRTA 1T00A 4GRFA 4PGTA 3GH9A 2LJRA 4FQUA 4GSTA 3ERGA 1U87A 2M72A 1ERVA 3ZVJD 4WBRD 5B8BA 1X9MB 3HA9A 2FWFA 2VL2C 3DIEA 1GLQA 2DLXA 4MPFA 3R2QA 3PPUA 2YWNA 1NW2A 3QAVA 2VCQA 4YQVA 4MJBA 3L78A 6GSXA 1OC3A 2X4AA 2G2QA 1AQVA 4Z2RA 1GTUA 5CYYA 3EU3A 5IMCA 1M2BA 4MJCA 4QQ7A 1SJZA 4ACSA 2O8VB 5GAPD 4BL7A 4IP6A 3BBYA 4MPGA 2B7KA 2GQKA 4MK3A 1XG8A 4I5QA 1HYUA 2X8HA 4TVEA 4GXZA 5KOWA 3M8NA 2IWTA 2GSSA 4G10A 3DKSA 1DUGA 2H1AA 6GSVA 1Q98A 4OFTA 1TRSA 3G7YA 3GIXA 4KW6A 2FNOA 2VCWA 3TRPA 4KX4A 4ULXA 3IBHA 3D21A 4KF9A 2FA8A 1TRWA 2YV9A 3H8QA 5D8IA 2H6YA 1DE1A 2O7KA 11GSA 4YAPA 2RUFA 4LA1A 2VIMA 1SL1B 2VLTA 2LNSA 1R7HA 4AGSA 5DQSA 2FGXA 2FCHA 1XWBA 4HU7A 5J41A 2N5FA 2H0GA 5D73A 5F06A 4O5UA 4EC0A 2MBTA 3GKNA 2H1DA 3EC3A 1UA5A 3QD9A 4V2NA 1MTCA 2C0FA 5HR0A 5IMDA 5G5FA 2HRNA 3BOAA 2L6DA 1A23A 1EZKA 1VF4A 3VI5A 2B1LA 2R6KA 4HDEA 5CO3A 2GVPA 5AGYA 20GSA 3BCKA 3LQ7A 2B5YA 2PVQA 3FZAA 1GSFA 1GTAA 4HUAA 4MZWA 3G9BA 2VL2A 3S9FA 2XC2A 2CT6A 4WEYA 1K3LA 1BJXA 1YKCA 4HU9A 1T4YA 4PQHA 1GSQA 4WF5A 4MH2A 3RPPA 4MF6A 3ZITA 1S3CA 2BTOT 1EWXA 2GTUA 2X49A 3GRXA 5IOWA 1R5AA 1OKDA 4J57E 5A5KA 3RDWA 1LJRA 3P8WA 3IV4A 4ECCA 5BRTA 2F9SA 3KIJA 1GWCA 1JZRA 1TRUA 3LGCA 4IP1A 3P90A 5B6NA 5FT3A 1XWAA 2LJAA 1SL2B 3CYNA 3KTBA 4F2IA 3F8UA 3UVTA 2I3YA 17GSA 1ZYQB 5JWRB 1SK1A 5AISA 1Z3EA 1IYHA 2YWIA 3UAPA 2L4QA 1GL8A 2GQMA 2MBSA 1PN0A 3FHKA 2H01A 1ERTA 3UL3A 2IN3A 4EUYA 5HR2A 2LS5A 3E3EA 4MDCA 1A2JA 4JZQA 5G5EA 1OE8A 2QSIA 3ZZXA 2DMMA 4PURA 1EV9A 5CREA 1A8YA 4BVXA 3RPNA 3QDNA 3IAS2 4CW9A 4XS4A 1G0TA 18GSA 2L5OA 3WD6A 5DALB 4EKZA 5DJLA 4JR6A 1M0UA 1XOBA 5LD0A 4AF2A 2C8UA 2F8FA 1PL1A 3HXSA 3ZYWA 1ZCPA 3G7IA 4IQ1A 2QKEA 2P5RA 2KP1A 3KXOA 4GLTA 1SK2A 2LEGA 4KNDA 2V32A 2NTOA 4XTSA 4HSCX 2PU9C 2K6VA 3H79A 1V57A 5ID2B 2I4AA 4BWSA 4ECJA 3FYGA 3TJFA 1KBNA 1ACVA 2R5GA 2GZZA 5J3RA 1PRXA 2ZUPA 2HXKA 1ZZYA 2XPDA 1QK8A 4D73B 1MEKA 1OE7A 2B1KA 3TJJA 1GSEA 2OJLA 3CTGA 5INYA 4XRAA 5D9XA 3QFBC 4CDOA 1SENA 3NZNA 1AIUA 4PUAA 2HSYA 4TR1A 1KEBA 3QMXA 1TXXA 1EGRA 4FH8A 1SJIA 1K0MA 3CRUA 2C80A 2LRCA 2H0IA 3KEBA 5J9CA 3IE3A 1GSUA 2B7JA 4E8EA 3F4RA 3ZFLA 1H4OA 3HZ4A 3L9UA 6GSSA 2AV4A 2CVDA 3HJMA 3LSZA 3KH7A 6GSTA 4IJIA 2L4CA 1HQOA 1TOFA 4WKWA 4G0IA 4POKA 4V1Ag 2YOIA 1PKWA 1G7OA 3QR6A 3NOFA 3E9JB 5G30A 4HZ4A 2H74A 1UC7A 3OR5A 1F9MA 3FZ4A 2CVBA 4Z7XA 5EL8A 1GTIA 5IQYA 2AAWA 3D6IA 3ZFBA 2HRKA 3IHQA 1YY7A 2IMEA 1A2MA 3GURA 5JWQB 4EVMA 4BVYA 2DJ0A 2NVLA 4TN8A 3MSZA 5GZZB 5HFIA 3O6TA 2J9HA 2WB9A 1NHOA 1GSDA 2O89A 5J9BA 3FKFA 3F6DA 1SK0A 5CP1A 3IHGA 2C3NA 1A2LA 1SJ6A 1ILOA 3G7JA 3GX8A 4WR4A 4NV5A 4WR5A 2HLSA 2HT9A 4LL1B 1TI1A 1LU4A 1J9BA 5AN1A 3R3EA 1K0NA 4NHZA 3KMNA 1F3AA 4LMWA 3ZIJA 2EIOA 1VF2A 4GSSA 2AYTA 1TK0B 3TCOA 2HSHA 4OWYA 2IFQA 1K0AA 4MABA 4IKHA 3GSTA 2KOKA 1FOHA 3GTUA 2GZPA 3QAWA 3LFLA 1N2AA 4I6XA 2KHPA 1Y25A 5H5RA 1TU8A 2VM2A 2E0QA 3ZMLA 1F2EA 3IC8A 2GGTA 3W8SA 2Z9SA 2N5AA 1T1VA 5IMAA 3VPQA 2PUKC 1GNEA 3K8NA 3GV1A 1MD4A 4AJ6A 3ZLPA 2P0GA 3UIWA 5CRWA 4HOJA 4KDXA 4CY8A 3APSA 2FUG2 2B3SA 3Q19A 2H30A 2R0PA 3KM6A 4ZBAA 5H5SA 2C0DA 1K0DA 1V9WA 1XW5A 4TXOA 3TKSA 1ABAA 1B48A 4NXIA 3TJKA 1JFUA 3VPTA 6GSUA 1KTEA 3VWVA 1PD21 2ES7A 4POMA 4GQCA 2DKHA 1EEJA 3DYRA 1XXUA 4WXTA 2WJUA 4KUNA 2AJQB 4JRRA 1UN2A 2B5XA 4FYCA 4K7OA 1Q4JA 4ZILA 3M9KA 1X0RA 4L8EA 2CA8A 3TJBA 3KJYA 3QPMA 3F3RA 5IPHA 3W8JA 2FWHA 3ZL5A 1AXDA 2I9HA 3UARA 2H0HA 2X8GA 3GSSA 1XW9A 3ZMKA 4F0BA 2YZUA 4KAEA 2CVKA 1U3AA 2RLIA 1UVZA 2VCVA 3US3A 1I9DA 2GT6A 3CTFA 1TRVA 2DBCA 3LG6A 3I43A 1VF1A 4NAXA 4DSSB 4ZIJA 2EIQA 2VUPA 3UMAA 5LNKe 2L6CA 4K2XA 1GULA 1ZYNA 1VRSD 2FWGA 3TKRA 2GLRA 5DAKB 4YQUA 4IBPA 2VCTA 4DEJA 1GUKA 3CSIA 3ED3A 1V98A 5JCGA 4BWQA 1SD9A 3HCZA 2BJXA 2E7PA 4BIKA 4IELA 1EEMA 3NIVA 2MMOA 4MZCA 5HR3A 1Y6EA 3F63A 2O85A 1BEDA 1OC9B 2H66A 2YCDA 2IMFA 1FVKA 3TJGA 4YQMA 1XPVA 4MA9A 2VLVA 5ECOB 3RBTA 3HHVA 3KP9A 1M3JA 4MNNA 1T8EB 2R37A 1V2AA 1VF3A 2KUCA 2H1BA 3GH6A 1EV4A 2JADA 4N11A 3C73A 4XCSA 1B4QA 1XWKA 1PX7A 2HE3A 3C1SA 2NPBA 4IW9A 1Z7RA 1AC1A 2FWEA 4PQ1A 3MWHA 4L0UA 4JE1A 3D4TA 3ZVJA 1FVJA 1Z6MA 2DMLA 1TW9A 3TGZA 1FO5A 2DSAA 1A24A 5JCWA 1ZGNA 4E8HA 3Q18A 5KN3A 3L4NA 1MDIA 3A3TA 1QGVA 4OFMA 1ON4A 2K8SA 3DEXA 2MMAA 1EGOA 5F8BA 4TR4A 5F0GA 1I5GA 3FMWA 3QOUA 3IC4A 5DCGA 5HR1A 3W6GA 5AIXA 3CSHA 3SWLA 1DBYA 2FHEA 4HEA2 1EOGA 4F9ZA 5J4UA 2YWMA 4F03A 1WPIA 3RHCA 2MZCA 4Z2TA 2WFCA 2HI7A 2EIRA 2LV3A 1SYRA 1Z7PA 1YKAA 2YWOA 4EF0A 3MDKA 3MNGA 3IK7A 4GF0A 3M0FA 4MF7A 2IPAA 3LW9A 3Q74A 2L5LA 3O3TA 5ECIB 1A8LA 5IO2A 14GSA 1GH2A 2PERA 2J23A 4LMVA 4FO5A 4K5SA 3DVWA 3DVXA 4HQZA 1BAYA 3GYKA 3ME7A 3F6FA 4LL4B 4HQSA 4AJ8A 5ECMB 2B6MA 1W4VA 1THOA 4KSMA 1FAAA 1Z6NA 2ZCTA 3L0HA 1S3AA 4OFNA 2VCXA 2A4HA 2OACA 1PQNA 3J7Yk 1SKRB 3APQA 1NHYA 2TIRA 5ECPB 2CAQA 4V1Ap 1J08A 4IS0A 4ZXGA 2V6KA 3DXBA 3DGQA 2X8CA 4FYUA 1YF0A 3FK8A 2VO4A 3KMOA 3C71A 2LTKA 4POLA 1ZL9A 2GSQA 2NDOA 1USBA 2YANA 3FR9A 2R0GA 1XZOA 2VAFA 5A4UA 5C04A 1RQMA 1TDIA 1O8WA 1GSYA 5EVOA 2QA1A 1YJ6A 1O73A 1RK4A 2CV4A 1J0FA 4N0ZA 2I81A 1B9YC 3DRNA 4N0VA 2PBJA 1OAZA 4YH2A 1NSWA 1G7EA 4G2EA 5AIVA 4F82A 3WT2A 1GRXA 1KNGA 2RUEA 5EPFA 3A2VA 5G31A 3C1RA 4O7HA 1XWCA 3WGDA 4ZBDA 3DMLA 2B5EA 4H86A 2O87A 1JLVA 3LWAA 1RW1A 1M99A 3IK9A 5CRHA 4MZBA 2LJKA 5JWOB 4BPYA 5LCZA 2VCZA 3VLNA 1E2YA 1A0FA 3LORA 2F8AA 4ID0A 2GQLA 2VOCA 4KDYA 4OMVA 4TR3A 9GSSA 1O81A 2C4JA 3SBCA 4V2LA 4CY6A 2DJKA 2VD1A 2DJ1A 1QFNA 1K0OA 1T7PB 3GKMA 2H72A 2CZ2A 4ZB6A 3FZ9A 4QL9A 4GWRA 4PNGA 2G0FA 5A4WA 5IIZA 1PL2A 4K7IA 1ZYEA 5DVBA 5HQPA 1G6YA 4ECIA 2H73A 2H19A 2XBIA 3DD3A 2HFDA 1K0CA 5GAND 2HSMA 4TOPA 4X1UA 2IMIA 1TJDA 5D93A 5L71A 4FYBA 2L57A 5D9TA 2C1YA 4MF5A 3TKPA 1ERUA 5D9WA 3HDCA 1YZXA 13GSA 1THXA 2WGRA 2AUVA 1XOAA 2ON5A 5FWGA 5KN2A 3I6AA 1VGLA 1PN9A 5E59A 1Z5YE 4IQAA 5F05A 2RIIA 2DJJA 3KZQA 3APOA 3V1WA 4Q5QA 5DALA 3C7MA 5IOXA 2TRXA 1PKZA 1K3OA 2FD3A 2A4VA 2OBKA 4BL7B 2CAIA 2YN1A 2R2JA 1SD8A 1WP0A 1ZYPA 1TI3A 4MH3A 1YF1A 1HNBA 1FG4A 3DWVA 2R3XA 1F6MC 2WDUA 4P3YB 4BA7A 3ZIVA 2P31A 2YV7A 3MYDA 5ELGA 5ID2A 1WRYA 1GUMA 1OC8A 2PWJA 2FA4A 4PTSA 3KTLA 1PFOA 2MMZA 2OE3A 3EINA 1PMTA 1TKDB 2K9FA 2LRTA 3LJRA 4D73A 3IPZA 4K0GA 5H5QA 4K6XA 4HZ2A 1X5CA 1FW1A 2YPMA 2HRAA 5COHA 1B8XA 3CBUA 3EPTA 2EC4A 4OCEA 3EU4A 1NM3A 1X5DA 2VD0A 1O6JA 4V2MA 1O8XA 3D4MA 2YZHA 5KN0A 3E0UA 1SYXA 2UZ8A 3A2WA 1M9AA 4CHSA 12GSA 3BCIA 3VK9A 2WCIA 1WMJA 3AY8A 1GUHA 2WS2A 3RAZA 1M3IA 1ZMAA 4YAVA 2OE1A 5GSTA 3FEUA 5KEJA 3M9JA 1R26A 5G1LA 2BMXA 3TKSE 2I1UA 3HVSA 22GSA 2DJ2A 3VI7A 4ZB8A 5EY6A 3IR4A 4PNFA 1V58A 2XPEA 4Z2UA 4RQRA 3IA1A 4I8BA 4ICYA 3EE2A 3UOMA 4O5RA 5ECSA 2VL9A 4EE0A 3HVVA 4HJMA 4USSA 2MMNA 3N5OA 4EIPA 1R5PA 3KCMA 5GSSA 3JCML 2H75A 1TK8B 1LBKA 2OA7A 4TKYA 4K7NA 8GSSA 4GQFA 2ON7A 3PGTA 3A5IA 1YDKA 2JZSA 2CX3A 1GSSA 1M7TA 1XCCA 2A2PA 1H75A 1TU7A 2GDRA 1F3BA 3BD2A 4JBBA 1SKWB 4YKGA 3IXRA 3FY7A 3CQFA 3A2XA 1YEXA 2WULA 4OD7A 2LSTA 1GLPA 3HVNA 3HJPA 4Q5RA 2K8VA 3EURA 4WF4A 1XIYA 3H93A 3IOSA 3U5RE 5J5NA 3LYPA 3CXGA 1QXHA 2LNTA 4MLYA 5B7CA 1M2AA 1OKTA 4IVFA 4PXOA 4K8MA 3FRCA 1QUWA 4XRDA 3F3QA 4ML6A 3ERWA 1X9WB 3TB2A 5A4VA 1SKSB 1K3YA 2H71A 3FR3A 1EP8A 4PUFC 4DSQA 4F0CA 2JZRA 5KOXA 4HI7A 3VFIA 1U88A 4N10A 2JU5A 2GSRA 1MDJA 3MAKA 3UEMA 1GP1A 4BVXB 1C72A 3J7Yb 3I9V2 3ZREA 2C0EA 4K9ZA 5DJMA 4EIQA 2V41A 4XS4B 5CNWA 2AHEA 1XVWA 2CQ9A 1JHBA 1PSQA 3GMFA 3LEFA 2E2MA 5CRGA 4KH7A 2P5QA 4IHUA 1WJKA 5E4WA 4G9HA 5HFKA 1TP9A 4NPBA 1WIKA 3LXZA 4A5PA 3F4TA 4G0KA 2WZ9A 2YJ7A 3GKKA 1S3RA 4OO5A 4ZBBA 1OYJA 5ECRB 4NV2A 3VWUA 2ALBA 1FOVA 3P2AA 1QMVA 1JLWA 3A5WA 5KN1A 2DC5A 4I2TA 2HZEA 4OCFA 1GTBA 2C3QA 4RI7A 4I97A 5IMFA 3I69A 5G1KA 4ZL8A 3FZ5A 4RUVA 4XS6A 2YNXA 4PQIA 2LRNA 3F9UA 5F07A 3IDVA 1M2DA 3WGXA 1TTZA 4Q5FA 4JR4A 3M1GA 1S3DA 2OE0A 3TRQA 3CSJA 3D0ZA 1WWJA 3F0IA 3FR6A 1HNAA 2JSZA 4KGIA 4TR1B 3HYPA 3IAM2 4N30A 1OVNA 2C0GA 2RM6A 1BX9A 1CQGA 2PN8A 4HS1A 2YJHA 4XHMA 2IMKA 4JEDA 4RI6A 1ZOFA 4L0WA 3GN3A 5FHIA 3WT1A 2CZ3A 3GKXA 4DSSA 2JL4A 1SU9A 1E6BA 2FLSA 2CX4A 3EWLA 4J2FA 4K5RA 1IYIA 2IL3A 3ISOA 2QC7A 1XWGA 3QAGA 5DAKA 4NWYA 1EOHA 3PINA 2IMDA 3KP8A 3D5JA 3L9SA 3VURA 3ZTLA 4KSOA 2PMTA 2QA2A 1BQ7A 3F4SA 19GSA 2M46A 2LQOA 3MIXA 3H4KA 2A2RA 3GHAA 4EDZA 5D96A 4X43A 1OC9A 3LYKA 4X0XA 3HVXA 2DKIA 3TOUA 5ENUA 4GTUA 5CAXA 1R4WA 4BVYB 3ERFA 5CRDA 1XFLA 2PVOC 5IM9A 3PH9A 2V1MA 1WOUA 4LLRA 4G0LA 4GSNA 4ZL7A 4O92A 2PPTA 3Q6OA 2MYGA 3HY2A 7GSSA 2XHFA 4ECBA 5IMVA 3TKQA 5ELAA 2H1GA 4EL1A 3HKRA 1AQWA 1G6WA 3TDGA 2YP6A 3HZ8A 4ZB9A 1M9BA 3EMPA 1TK5B 4TR0A 3CRTA 2DIZA 1MD3A 2VM1A 4KB3A 4EO3A 4MJAA 2L59A 1N8JA 2N5BA 3GUSA 2X99A 1X9SB 2IFQB 5ECNB 3GTUB 4QL7A 1BYEA 4FIWA 3L9VA 1FHEA 1O85A 1ML6A 3LXTA 1AAZA 5B8AA 1WE0A 3BJ5A 2E2GA 2IJYA 4TW5A 2XBQA 4KE3A 2M80A 1HNCA 4IJ3A 4IGJA 2REMA 1ST9A 2DIYA 3EVIA 1FB0A 2OBIA 4ML1A 3C8EA 5ECKB 2H76A 4WETA 2V2GA 1ERWA 1X5EA 3O76A 4EXJA 2HZFA 3UVHA 2R0CA 5BMUA 3TUEA 1FB6A 3PR8A 4TXOB 2DJ3A 1U3IA 4NHWA 2VLUA 16GSA 4XS1A 2KLXA 5D9VA 3HJOA 4YKFA 1W89A 3GFKA 4EDYA 4OO4A 1DSBA 4K1FA 1V40A 2AB6A 1JZOA 4MMMA 2LQQA 1AW9A 3EYTA 1PX6A 3U6VA 5B6MA 4AJ7A 1XW6A 1PA3A 1U6TA 3TKSC 4TRXA 2JSYA 2GT5A 2NBSA 4K2DA 4MP4A 3M3MA 4DSRA 3TOTA 4KCEA 4IN0A 2H70A 4GCIA 3KD0A 3VWWA 3ZRDA 3EMXA 1T3BA 2JZTA 2GZYA 3UJ1A 4POBA 1AQXA 5ECQB 2KP2A 2ZNMA 3IRAA 5IMZA 4NMUA 1K0BA 3GNJA 2HRFA 1JZWA 2K18A 1XVQA 5IO0A 4TXVA 3GL5A 1B9XC 3UBKA 3WGEA 3TRXA 5DCHA 2LKUA 2PGTA 1MDKA 4X4JA 4JU5A 1QQ2A 4I2UA 5HFGA 5JCUA 1GNWA 5C00A 4MJEA 3KH9A 6GSYA 3KGKA 4KCAA 2IIYA 3ME8A 4PX1A 1YQ1A 3VWXA 4G19A 4J56E 1BG5A 4K0NA 2X64A 2H6XA 3P7XA 2OADA 2D2ZA 3GL3A 5DBQA 6GSWA 2H6ZA 2FY6A 1DE2A 3QFAC 4ILFA
chains in the Genus database with same CATH topology
2JACA 5G2ZA 3D22A 2C3TA 2LUSA 2OKAA 5DQYA 5ABRA 3H1NA 2R4VA 5IPGA 4RQXA 4O5QA 5ECLB 1B4PA 4L5LA 2HYXA 4ZL9A 3FW2A 4Q5NA 3RHBA 4ISDA 1F37A 3GX0A 3N9JA 1EP7A 1SL0B 1JZDA 4KA0A 1URMA 2GS3A 1AUCA 2QGVA 2TRCP 4WBJA 1YEPA 3HD5A 1PGTA 1T4ZA 2RM5A 1O7UA 3GA4A 1Z9HA 1A0RP 1XBSA 2HNLA 4DVCA 3UBLA 2F51A 3CMIA 2A2SA 5ECHB 4O32A 2H8LA 4HJ2A 4KDUA 1HD2A 2V6OA 3QCPA 2HZEB 4MCUA 2GSTA 2VL3A 4XIHA 2F3MA 3WYWA 10GSA 4L5OA 5DDLA 1CQHA 2WRTA 1T00A 4GRFA 4PGTA 3GH9A 2LJRA 4FQUA 4GSTA 3ERGA 1U87A 2M72A 1ERVA 3ZVJD 4WBRD 5B8BA 1X9MB 3HA9A 2FWFA 2VL2C 3DIEA 1GLQA 2DLXA 4MPFA 3R2QA 3PPUA 2YWNA 1NW2A 3QAVA 2VCQA 4YQVA 4MJBA 3L78A 6GSXA 1OC3A 2X4AA 2G2QA 1AQVA 4Z2RA 1GTUA 5CYYA 3EU3A 5IMCA 1M2BA 4MJCA 4QQ7A 1SJZA 4ACSA 2O8VB 5GAPD 4BL7A 4IP6A 3BBYA 4MPGA 2B7KA 2GQKA 4MK3A 4I5QA 1HYUA 2X8HA 4TVEA 4GXZA 5KOWA 3M8NA 2IWTA 2GSSA 4G10A 3DKSA 1DUGA 2H1AA 6GSVA 1Q98A 4OFTA 1TRSA 3G7YA 3GIXA 4KW6A 2FNOA 2VCWA 3TRPA 4KX4A 4ULXA 3IBHA 3D21A 4KF9A 2FA8A 1TRWA 2YV9A 3H8QA 5D8IA 2H6YA 1DE1A 2O7KA 11GSA 4YAPA 2RUFA 4LA1A 2VIMA 1SL1B 2VLTA 2LNSA 1R7HA 4AGSA 5DQSA 2FGXA 2FCHA 1XWBA 4HU7A 5J41A 2N5FA 2H0GA 5D73A 5F06A 4O5UA 4EC0A 2MBTA 3GKNA 2H1DA 3EC3A 1UA5A 3QD9A 4V2NA 1MTCA 2C0FA 5HR0A 5IMDA 5G5FA 2HRNA 3BOAA 2L6DA 1A23A 1EZKA 1VF4A 3VI5A 2B1LA 2R6KA 4HDEA 5CO3A 2GVPA 5AGYA 20GSA 3BCKA 3LQ7A 2B5YA 2PVQA 3FZAA 1GSFA 1GTAA 4HUAA 4MZWA 3G9BA 2VL2A 3S9FA 2XC2A 2CT6A 4WEYA 1K3LA 1BJXA 1YKCA 4HU9A 1T4YA 4PQHA 1GSQA 4WF5A 4MH2A 3RPPA 4MF6A 3ZITA 1S3CA 2BTOT 1EWXA 2GTUA 2X49A 3GRXA 5IOWA 1R5AA 1OKDA 4J57E 5A5KA 3RDWA 1LJRA 3P8WA 3IV4A 4ECCA 5BRTA 2F9SA 3KIJA 1GWCA 1JZRA 1TRUA 3LGCA 4IP1A 3P90A 5B6NA 5FT3A 1XWAA 2LJAA 1SL2B 3CYNA 3KTBA 4F2IA 3F8UA 3UVTA 2I3YA 17GSA 1ZYQB 5JWRB 1SK1A 5AISA 1Z3EA 1IYHA 2YWIA 3UAPA 2L4QA 1GL8A 2GQMA 2MBSA 1PN0A 3FHKA 2H01A 1ERTA 3UL3A 2IN3A 4EUYA 5HR2A 2LS5A 3E3EA 4MDCA 1A2JA 4JZQA 5G5EA 1OE8A 2QSIA 3ZZXA 2DMMA 4PURA 1EV9A 5CREA 1A8YA 4BVXA 3RPNA 3QDNA 3IAS2 4CW9A 4XS4A 1G0TA 18GSA 2L5OA 3WD6A 5DALB 4EKZA 5DJLA 4JR6A 1M0UA 1XOBA 5LD0A 4AF2A 2C8UA 2F8FA 1PL1A 3HXSA 3ZYWA 1ZCPA 3G7IA 4IQ1A 2QKEA 2P5RA 2KP1A 3KXOA 4GLTA 1SK2A 2LEGA 4KNDA 2V32A 2NTOA 4XTSA 2PU9C 2K6VA 3H79A 1V57A 5ID2B 2I4AA 4BWSA 4ECJA 3FYGA 3TJFA 1KBNA 1ACVA 2R5GA 2GZZA 5J3RA 1PRXA 2ZUPA 2HXKA 1ZZYA 2XPDA 1QK8A 4D73B 1MEKA 1OE7A 2B1KA 3TJJA 1GSEA 2OJLA 3CTGA 5INYA 4XRAA 5D9XA 3QFBC 4CDOA 1SENA 3NZNA 1AIUA 4PUAA 2HSYA 4TR1A 1KEBA 3QMXA 1TXXA 1EGRA 4FH8A 1SJIA 1K0MA 3CRUA 2C80A 2LRCA 2H0IA 3KEBA 5J9CA 3IE3A 1GSUA 2B7JA 4E8EA 3F4RA 3ZFLA 1H4OA 3HZ4A 3L9UA 6GSSA 2AV4A 2CVDA 3HJMA 3LSZA 3KH7A 6GSTA 4IJIA 2L4CA 1HQOA 1TOFA 4WKWA 4G0IA 4POKA 4V1Ag 2YOIA 1PKWA 1G7OA 3QR6A 3NOFA 3E9JB 5G30A 4HZ4A 2H74A 1UC7A 3OR5A 1F9MA 3FZ4A 2CVBA 4Z7XA 5EL8A 1GTIA 5IQYA 2AAWA 3D6IA 3ZFBA 2HRKA 3IHQA 1YY7A 2IMEA 1A2MA 3GURA 5JWQB 4EVMA 4BVYA 2DJ0A 2NVLA 4TN8A 3MSZA 5GZZB 5HFIA 3O6TA 2J9HA 2WB9A 1NHOA 1GSDA 2O89A 5J9BA 3FKFA 3F6DA 1SK0A 5CP1A 3IHGA 2C3NA 1A2LA 1SJ6A 1ILOA 3G7JA 3GX8A 4WR4A 4NV5A 4WR5A 2HLSA 2HT9A 4LL1B 1TI1A 1LU4A 1J9BA 5AN1A 3R3EA 1K0NA 4NHZA 3KMNA 1F3AA 4LMWA 3ZIJA 2EIOA 1VF2A 4GSSA 2AYTA 1TK0B 3TCOA 2HSHA 4OWYA 2IFQA 1K0AA 4MABA 4IKHA 3GSTA 2KOKA 1FOHA 3GTUA 2GZPA 3QAWA 3LFLA 1N2AA 4I6XA 2KHPA 1Y25A 5H5RA 1TU8A 2VM2A 2E0QA 3ZMLA 1F2EA 3IC8A 2GGTA 3W8SA 2Z9SA 2N5AA 1T1VA 5IMAA 3VPQA 2PUKC 1GNEA 3K8NA 3GV1A 1MD4A 4AJ6A 3ZLPA 2P0GA 3UIWA 5CRWA 4HOJA 4KDXA 4CY8A 3APSA 2FUG2 2B3SA 3Q19A 2H30A 2R0PA 3KM6A 4ZBAA 5H5SA 2C0DA 1K0DA 1V9WA 1XW5A 4TXOA 3TKSA 1ABAA 1B48A 4NXIA 3TJKA 1JFUA 3VPTA 6GSUA 1KTEA 3VWVA 1PD21 2ES7A 4POMA 4GQCA 2DKHA 1EEJA 3DYRA 1XXUA 4WXTA 2WJUA 4KUNA 2AJQB 4JRRA 1UN2A 2B5XA 4FYCA 4K7OA 1Q4JA 4ZILA 3M9KA 1X0RA 4L8EA 2CA8A 3TJBA 3KJYA 3QPMA 3F3RA 5IPHA 3W8JA 2FWHA 3ZL5A 1AXDA 2I9HA 3UARA 2H0HA 2X8GA 3GSSA 1XW9A 3ZMKA 4F0BA 2YZUA 4KAEA 2CVKA 1U3AA 2RLIA 1UVZA 2VCVA 3US3A 1I9DA 2GT6A 3CTFA 1TRVA 2DBCA 3LG6A 3I43A 1VF1A 4NAXA 4DSSB 4ZIJA 2EIQA 2VUPA 3UMAA 5LNKe 2L6CA 4K2XA 1GULA 1ZYNA 1VRSD 2FWGA 3TKRA 2GLRA 5DAKB 4YQUA 4IBPA 2VCTA 4DEJA 1GUKA 3CSIA 3ED3A 1V98A 5JCGA 4BWQA 1SD9A 3HCZA 2BJXA 2E7PA 4IELA 1EEMA 3NIVA 2MMOA 4MZCA 5HR3A 1Y6EA 3F63A 2O85A 1BEDA 1OC9B 2H66A 2YCDA 2IMFA 1FVKA 3TJGA 4YQMA 1XPVA 4MA9A 2VLVA 5ECOB 3RBTA 3HHVA 3KP9A 4MNNA 1T8EB 2R37A 1V2AA 1VF3A 2KUCA 2H1BA 3GH6A 1EV4A 2JADA 4N11A 3C73A 4XCSA 1B4QA 1XWKA 1PX7A 2HE3A 3C1SA 2NPBA 4IW9A 1Z7RA 1AC1A 2FWEA 4PQ1A 3MWHA 4L0UA 4JE1A 3D4TA 3ZVJA 1FVJA 1Z6MA 2DMLA 1TW9A 3TGZA 1FO5A 2DSAA 1A24A 5JCWA 1ZGNA 4E8HA 3Q18A 5KN3A 3L4NA 1MDIA 3A3TA 1QGVA 4OFMA 1ON4A 2K8SA 3DEXA 2MMAA 1EGOA 5F8BA 4TR4A 5F0GA 1I5GA 3FMWA 3QOUA 3IC4A 5DCGA 5HR1A 3W6GA 5AIXA 3CSHA 3SWLA 1DBYA 2FHEA 4HEA2 1EOGA 4F9ZA 5J4UA 2YWMA 4F03A 1WPIA 3RHCA 2MZCA 4Z2TA 2WFCA 2HI7A 2EIRA 2LV3A 1SYRA 1Z7PA 1YKAA 2YWOA 4EF0A 3MDKA 3MNGA 3IK7A 4GF0A 3M0FA 4MF7A 2IPAA 3LW9A 3Q74A 2L5LA 3O3TA 5ECIB 1A8LA 5IO2A 14GSA 1GH2A 2PERA 2J23A 4LMVA 4FO5A 4K5SA 3DVWA 3DVXA 4HQZA 1BAYA 3GYKA 3ME7A 3F6FA 4LL4B 4HQSA 4AJ8A 5ECMB 2B6MA 1W4VA 1THOA 4KSMA 1FAAA 1Z6NA 2ZCTA 3L0HA 1S3AA 4OFNA 2VCXA 2A4HA 2OACA 1PQNA 3J7Yk 1SKRB 3APQA 1NHYA 2TIRA 5ECPB 2CAQA 4V1Ap 1J08A 4IS0A 4ZXGA 2V6KA 3DXBA 3DGQA 2X8CA 4FYUA 1YF0A 3FK8A 2VO4A 3KMOA 3C71A 2LTKA 4POLA 1ZL9A 2GSQA 2NDOA 1USBA 2YANA 3FR9A 2R0GA 1XZOA 2VAFA 5A4UA 5C04A 1RQMA 1TDIA 1O8WA 1GSYA 5EVOA 2QA1A 1YJ6A 1O73A 1RK4A 2CV4A 1J0FA 4N0ZA 2I81A 1B9YC 3DRNA 4N0VA 2PBJA 1OAZA 4YH2A 1NSWA 1G7EA 4G2EA 5AIVA 4F82A 3WT2A 1GRXA 1KNGA 2RUEA 5EPFA 3A2VA 5G31A 3C1RA 4O7HA 1XWCA 3WGDA 4ZBDA 3DMLA 2B5EA 4H86A 2O87A 1JLVA 3LWAA 1RW1A 1M99A 3IK9A 5CRHA 4MZBA 2LJKA 5JWOB 4BPYA 5LCZA 2VCZA 3VLNA 1E2YA 1A0FA 3LORA 2F8AA 4ID0A 2GQLA 2VOCA 4KDYA 4OMVA 4TR3A 9GSSA 1O81A 2C4JA 3SBCA 4V2LA 4CY6A 2DJKA 2VD1A 2DJ1A 1QFNA 1K0OA 1T7PB 3GKMA 2H72A 2CZ2A 4ZB6A 3FZ9A 4QL9A 4GWRA 4PNGA 2G0FA 5A4WA 5IIZA 1PL2A 4K7IA 1ZYEA 5DVBA 5HQPA 1G6YA 4ECIA 2H73A 2H19A 2XBIA 3DD3A 2HFDA 1K0CA 5GAND 2HSMA 4TOPA 4X1UA 2IMIA 1TJDA 5D93A 5L71A 4FYBA 2L57A 5D9TA 2C1YA 4MF5A 3TKPA 1ERUA 5D9WA 3HDCA 1YZXA 13GSA 1THXA 2WGRA 2AUVA 1XOAA 2ON5A 5FWGA 5KN2A 3I6AA 1VGLA 1PN9A 5E59A 1Z5YE 4IQAA 5F05A 2RIIA 2DJJA 3KZQA 3APOA 3V1WA 4Q5QA 5DALA 3C7MA 5IOXA 2TRXA 1PKZA 1K3OA 2FD3A 2A4VA 2OBKA 4BL7B 2CAIA 2YN1A 2R2JA 1SD8A 1WP0A 1ZYPA 1TI3A 4MH3A 1YF1A 1HNBA 1FG4A 3DWVA 2R3XA 1F6MC 2WDUA 4P3YB 4BA7A 3ZIVA 2P31A 2YV7A 3MYDA 5ELGA 5ID2A 1WRYA 1GUMA 1OC8A 2PWJA 2FA4A 4PTSA 3KTLA 2MMZA 2OE3A 3EINA 1PMTA 1TKDB 2K9FA 2LRTA 3LJRA 4D73A 3IPZA 4K0GA 5H5QA 4K6XA 4HZ2A 1X5CA 1FW1A 2YPMA 2HRAA 5COHA 1B8XA 3CBUA 3EPTA 2EC4A 4OCEA 3EU4A 1NM3A 1X5DA 2VD0A 1O6JA 4V2MA 1O8XA 3D4MA 2YZHA 5KN0A 3E0UA 1SYXA 2UZ8A 3A2WA 1M9AA 4CHSA 12GSA 3BCIA 3VK9A 2WCIA 1WMJA 3AY8A 1GUHA 2WS2A 3RAZA 1ZMAA 4YAVA 2OE1A 5GSTA 3FEUA 5KEJA 3M9JA 1R26A 5G1LA 2BMXA 3TKSE 2I1UA 3HVSA 22GSA 2DJ2A 3VI7A 4ZB8A 5EY6A 3IR4A 4PNFA 1V58A 2XPEA 4Z2UA 4RQRA 3IA1A 4I8BA 4ICYA 3EE2A 3UOMA 4O5RA 5ECSA 2VL9A 4EE0A 3HVVA 4HJMA 4USSA 2MMNA 3N5OA 4EIPA 1R5PA 3KCMA 5GSSA 3JCML 2H75A 1TK8B 1LBKA 2OA7A 4TKYA 4K7NA 8GSSA 4GQFA 2ON7A 3PGTA 3A5IA 1YDKA 2JZSA 2CX3A 1GSSA 1M7TA 1XCCA 2A2PA 1H75A 1TU7A 2GDRA 1F3BA 3BD2A 4JBBA 1SKWB 4YKGA 3IXRA 3FY7A 3A2XA 1YEXA 2WULA 4OD7A 2LSTA 1GLPA 3HJPA 4Q5RA 2K8VA 3EURA 4WF4A 1XIYA 3H93A 3IOSA 3U5RE 5J5NA 3LYPA 3CXGA 1QXHA 2LNTA 4MLYA 5B7CA 1M2AA 1OKTA 4IVFA 4PXOA 4K8MA 3FRCA 1QUWA 4XRDA 3F3QA 4ML6A 3ERWA 1X9WB 3TB2A 5A4VA 1SKSB 1K3YA 2H71A 3FR3A 1EP8A 4PUFC 4DSQA 4F0CA 2JZRA 5KOXA 4HI7A 3VFIA 1U88A 4N10A 2JU5A 2GSRA 1MDJA 3MAKA 3UEMA 1GP1A 4BVXB 1C72A 3J7Yb 3I9V2 3ZREA 2C0EA 4K9ZA 5DJMA 4EIQA 2V41A 4XS4B 5CNWA 2AHEA 1XVWA 2CQ9A 1JHBA 1PSQA 3GMFA 3LEFA 2E2MA 5CRGA 4KH7A 2P5QA 4IHUA 1WJKA 5E4WA 4G9HA 5HFKA 1TP9A 4NPBA 1WIKA 3LXZA 4A5PA 3F4TA 4G0KA 2WZ9A 2YJ7A 3GKKA 4OO5A 4ZBBA 1OYJA 5ECRB 4NV2A 3VWUA 2ALBA 1FOVA 3P2AA 1QMVA 1JLWA 3A5WA 5KN1A 2DC5A 4I2TA 2HZEA 4OCFA 1GTBA 2C3QA 4RI7A 4I97A 5IMFA 3I69A 5G1KA 4ZL8A 3FZ5A 4RUVA 4XS6A 2YNXA 4PQIA 2LRNA 3F9UA 5F07A 3IDVA 1M2DA 3WGXA 1TTZA 4Q5FA 4JR4A 3M1GA 1S3DA 2OE0A 3TRQA 3CSJA 3D0ZA 1WWJA 3F0IA 3FR6A 1HNAA 2JSZA 4KGIA 4TR1B 3HYPA 3IAM2 4N30A 1OVNA 2C0GA 2RM6A 1BX9A 1CQGA 2PN8A 4HS1A 2YJHA 4XHMA 2IMKA 4JEDA 4RI6A 1ZOFA 4L0WA 3GN3A 5FHIA 3WT1A 2CZ3A 3GKXA 4DSSA 2JL4A 1SU9A 1E6BA 2FLSA 2CX4A 3EWLA 4J2FA 4K5RA 1IYIA 2IL3A 3ISOA 2QC7A 1XWGA 3QAGA 5DAKA 4NWYA 1EOHA 3PINA 2IMDA 3KP8A 3D5JA 3L9SA 3VURA 3ZTLA 4KSOA 2PMTA 2QA2A 1BQ7A 3F4SA 19GSA 2M46A 2LQOA 3MIXA 3H4KA 2A2RA 3GHAA 4EDZA 5D96A 4X43A 1OC9A 3LYKA 4X0XA 3HVXA 2DKIA 3TOUA 5ENUA 4GTUA 5CAXA 1R4WA 4BVYB 3ERFA 5CRDA 1XFLA 2PVOC 5IM9A 3PH9A 2V1MA 1WOUA 4LLRA 4G0LA 4GSNA 4ZL7A 4O92A 2PPTA 3Q6OA 2MYGA 3HY2A 7GSSA 2XHFA 4ECBA 5IMVA 3TKQA 5ELAA 2H1GA 4EL1A 3HKRA 1AQWA 1G6WA 3TDGA 2YP6A 3HZ8A 4ZB9A 1M9BA 3EMPA 1TK5B 4TR0A 3CRTA 2DIZA 1MD3A 2VM1A 4KB3A 4EO3A 4MJAA 2L59A 1N8JA 2N5BA 3GUSA 2X99A 1X9SB 2IFQB 5ECNB 3GTUB 4QL7A 1BYEA 4FIWA 3L9VA 1FHEA 1O85A 1ML6A 3LXTA 1AAZA 5B8AA 1WE0A 3BJ5A 2E2GA 2IJYA 4TW5A 2XBQA 4KE3A 2M80A 1HNCA 4IJ3A 4IGJA 2REMA 1ST9A 2DIYA 3EVIA 1FB0A 2OBIA 4ML1A 3C8EA 5ECKB 2H76A 4WETA 2V2GA 1ERWA 1X5EA 3O76A 4EXJA 2HZFA 3UVHA 2R0CA 5BMUA 3TUEA 1FB6A 3PR8A 4TXOB 2DJ3A 1U3IA 4NHWA 2VLUA 16GSA 4XS1A 2KLXA 5D9VA 3HJOA 4YKFA 1W89A 3GFKA 4EDYA 4OO4A 1DSBA 4K1FA 1V40A 2AB6A 1JZOA 4MMMA 2LQQA 1AW9A 3EYTA 1PX6A 3U6VA 5B6MA 4AJ7A 1XW6A 1PA3A 1U6TA 3TKSC 4TRXA 2JSYA 2GT5A 2NBSA 4K2DA 4MP4A 3M3MA 4DSRA 3TOTA 4KCEA 4IN0A 2H70A 4GCIA 3KD0A 3VWWA 3ZRDA 3EMXA 1T3BA 2JZTA 2GZYA 3UJ1A 4POBA 1AQXA 5ECQB 2KP2A 2ZNMA 3IRAA 5IMZA 4NMUA 1K0BA 3GNJA 2HRFA 1JZWA 2K18A 1XVQA 5IO0A 4TXVA 3GL5A 1B9XC 3UBKA 3WGEA 3TRXA 5DCHA 2LKUA 2PGTA 1MDKA 4X4JA 4JU5A 1QQ2A 4I2UA 5HFGA 5JCUA 1GNWA 5C00A 4MJEA 3KH9A 6GSYA 3KGKA 4KCAA 2IIYA 3ME8A 4PX1A 1YQ1A 3VWXA 4G19A 4J56E 1BG5A 4K0NA 2X64A 2H6XA 3P7XA 2OADA 2D2ZA 3GL3A 5DBQA 6GSWA 2H6ZA 2FY6A 1DE2A 3QFAC 4ILFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAC A;  5G2Z A;  3D22 A;  2C3T A;  2LUS A;  2OKA A;  5DQY A;  5ABR A;  3H1N A;  2R4V A;  5IPG A;  4RQX A;  5ECL B;  1B4P A;  4L5L A;  2HYX A;  4ZL9 A;  3FW2 A;  4Q5N A;  3RHB A;  4ISD A;  1F37 A;  3GX0 A;  3N9J A;  1EP7 A;  1SL0 B;  1JZD A;  4KA0 A;  1URM A;  2GS3 A;  1AUC A;  2QGV A;  2TRC P;  4WBJ A;  1YEP A;  3HD5 A;  1PGT A;  1T4Z A;  2RM5 A;  1O7U A;  3GA4 A;  1Z9H A;  1A0R P;  1XBS A;  2HNL A;  4DVC A;  3UBL A;  2F51 A;  3CMI A;  2A2S A;  5ECH B;  4O32 A;  2H8L A;  4HJ2 A;  4KDU A;  1HD2 A;  2V6O A;  3QCP A;  2HZE B;  4MCU A;  2GST A;  2VL3 A;  4XIH A;  2F3M A;  3WYW A;  10GS A;  4L5O A;  5DDL A;  1CQH A;  2WRT A;  1T00 A;  4GRF A;  4PGT A;  3GH9 A;  2LJR A;  4GST A;  3ERG A;  1U87 A;  2M72 A;  1ERV A;  3ZVJ D;  4WBR D;  5B8B A;  1X9M B;  3HA9 A;  2FWF A;  2VL2 C;  3DIE A;  1GLQ A;  2DLX A;  4MPF A;  3R2Q A;  2YWN A;  1NW2 A;  3QAV A;  2VCQ A;  4YQV A;  4MJB A;  3L78 A;  6GSX A;  1OC3 A;  2G2Q A;  1AQV A;  1GTU A;  5CYY A;  3EU3 A;  5IMC A;  1M2B A;  4MJC A;  4QQ7 A;  1SJZ A;  4ACS A;  2O8V B;  5GAP D;  4BL7 A;  4IP6 A;  3BBY A;  4MPG A;  2B7K A;  2GQK A;  4MK3 A;  4I5Q A;  1HYU A;  2X8H A;  4TVE A;  4GXZ A;  3M8N A;  2IWT A;  2GSS A;  4G10 A;  3DKS A;  1DUG A;  2H1A A;  6GSV A;  1Q98 A;  4OFT A;  1TRS A;  3G7Y A;  3GIX A;  4KW6 A;  2FNO A;  2VCW A;  3TRP A;  4KX4 A;  4ULX A;  3IBH A;  3D21 A;  2FA8 A;  1TRW A;  2YV9 A;  3H8Q A;  5D8I A;  2H6Y A;  1DE1 A;  2O7K A;  11GS A;  4YAP A;  2RUF A;  4LA1 A;  2VIM A;  1SL1 B;  2VLT A;  2LNS A;  1R7H A;  4AGS A;  5DQS A;  2FGX A;  2FCH A;  1XWB A;  4HU7 A;  5J41 A;  2N5F A;  2H0G A;  5D73 A;  5F06 A;  4EC0 A;  2MBT A;  3GKN A;  2H1D A;  3EC3 A;  1UA5 A;  3QD9 A;  4V2N A;  1MTC A;  2C0F A;  5HR0 A;  5IMD A;  5G5F A;  2HRN A;  3BOA A;  2L6D A;  1A23 A;  1EZK A;  1VF4 A;  3VI5 A;  2B1L A;  2R6K A;  4HDE A;  5CO3 A;  2GVP A;  5AGY A;  20GS A;  3BCK A;  3LQ7 A;  2B5Y A;  2PVQ A;  3FZA A;  1GSF A;  1GTA A;  4HUA A;  4MZW A;  3G9B A;  2VL2 A;  3S9F A;  2XC2 A;  2CT6 A;  4WEY A;  1K3L A;  1BJX A;  1YKC A;  4HU9 A;  1T4Y A;  4PQH A;  1GSQ A;  4WF5 A;  4MH2 A;  3RPP A;  4MF6 A;  3ZIT A;  1S3C A;  2BTO T;  1EWX A;  2GTU A;  3GRX A;  5IOW A;  1R5A A;  1OKD A;  4J57 E;  5A5K A;  3RDW A;  1LJR A;  3P8W A;  3IV4 A;  4ECC A;  2F9S A;  3KIJ A;  1GWC A;  1JZR A;  1TRU A;  3LGC A;  4IP1 A;  3P90 A;  5B6N A;  5FT3 A;  1XWA A;  2LJA A;  1SL2 B;  3CYN A;  3KTB A;  4F2I A;  3F8U A;  3UVT A;  2I3Y A;  17GS A;  1ZYQ B;  5JWR B;  1SK1 A;  5AIS A;  1Z3E A;  1IYH A;  2YWI A;  3UAP A;  2L4Q A;  1GL8 A;  2GQM A;  2MBS A;  3FHK A;  2H01 A;  1ERT A;  3UL3 A;  2IN3 A;  4EUY A;  5HR2 A;  2LS5 A;  3E3E A;  4MDC A;  1A2J A;  4JZQ A;  5G5E A;  1OE8 A;  2QSI A;  3ZZX A;  2DMM A;  4PUR A;  1EV9 A;  5CRE A;  1A8Y A;  4BVX A;  3RPN A;  3QDN A;  3IAS 2;  4CW9 A;  4XS4 A;  1G0T A;  18GS A;  2L5O A;  3WD6 A;  5DAL B;  4EKZ A;  5DJL A;  4JR6 A;  1M0U A;  1XOB A;  5LD0 A;  4AF2 A;  2C8U A;  2F8F A;  1PL1 A;  3HXS A;  3ZYW A;  1ZCP A;  3G7I A;  4IQ1 A;  2QKE A;  2P5R A;  2KP1 A;  3KXO A;  4GLT A;  1SK2 A;  2LEG A;  4KND A;  2V32 A;  2NTO A;  4XTS A;  2PU9 C;  2K6V A;  3H79 A;  1V57 A;  5ID2 B;  2I4A A;  4BWS A;  4ECJ A;  3FYG A;  3TJF A;  1KBN A;  1ACV A;  2R5G A;  2GZZ A;  5J3R A;  1PRX A;  2ZUP A;  2HXK A;  1ZZY A;  2XPD A;  1QK8 A;  4D73 B;  1MEK A;  1OE7 A;  2B1K A;  3TJJ A;  1GSE A;  2OJL A;  3CTG A;  5INY A;  4XRA A;  5D9X A;  3QFB C;  4CDO A;  1SEN A;  3NZN A;  1AIU A;  4PUA A;  2HSY A;  4TR1 A;  1KEB A;  3QMX A;  1TXX A;  1EGR A;  4FH8 A;  1SJI A;  1K0M A;  3CRU A;  2C80 A;  2LRC A;  2H0I A;  3KEB A;  5J9C A;  3IE3 A;  1GSU A;  2B7J A;  4E8E A;  3F4R A;  3ZFL A;  1H4O A;  3HZ4 A;  3L9U A;  6GSS A;  2AV4 A;  2CVD A;  3HJM A;  3LSZ A;  3KH7 A;  6GST A;  4IJI A;  2L4C A;  1HQO A;  1TOF A;  4WKW A;  4POK A;  4V1A g;  2YOI A;  1PKW A;  1G7O A;  3QR6 A;  3NOF A;  3E9J B;  5G30 A;  4HZ4 A;  2H74 A;  1UC7 A;  3OR5 A;  1F9M A;  3FZ4 A;  2CVB A;  4Z7X A;  5EL8 A;  1GTI A;  5IQY A;  2AAW A;  3D6I A;  3ZFB A;  3IHQ A;  1YY7 A;  2IME A;  1A2M A;  3GUR A;  5JWQ B;  4EVM A;  4BVY A;  2DJ0 A;  2NVL A;  4TN8 A;  3MSZ A;  5GZZ B;  5HFI A;  3O6T A;  2J9H A;  2WB9 A;  1NHO A;  1GSD A;  2O89 A;  5J9B A;  3FKF A;  3F6D A;  1SK0 A;  5CP1 A;  2C3N A;  1A2L A;  1SJ6 A;  1ILO A;  3G7J A;  3GX8 A;  4WR4 A;  4NV5 A;  4WR5 A;  2HLS A;  2HT9 A;  4LL1 B;  1TI1 A;  1LU4 A;  1J9B A;  5AN1 A;  1K0N A;  4NHZ A;  3KMN A;  1F3A A;  4LMW A;  3ZIJ A;  2EIO A;  1VF2 A;  4GSS A;  2AYT A;  1TK0 B;  3TCO A;  2HSH A;  4OWY A;  2IFQ A;  1K0A A;  4MAB A;  4IKH A;  3GST A;  2KOK A;  3GTU A;  2GZP A;  3QAW A;  3LFL A;  1N2A A;  4I6X A;  2KHP A;  1Y25 A;  5H5R A;  1TU8 A;  2VM2 A;  2E0Q A;  3ZML A;  1F2E A;  2GGT A;  3W8S A;  2Z9S A;  2N5A A;  1T1V A;  5IMA A;  3VPQ A;  2PUK C;  1GNE A;  3K8N A;  3GV1 A;  1MD4 A;  4AJ6 A;  3ZLP A;  2P0G A;  3UIW A;  5CRW A;  4HOJ A;  4KDX A;  3APS A;  2FUG 2;  2B3S A;  3Q19 A;  2H30 A;  3KM6 A;  4ZBA A;  5H5S A;  2C0D A;  1K0D A;  1V9W A;  1XW5 A;  4TXO A;  3TKS A;  1ABA A;  1B48 A;  4NXI A;  3TJK A;  1JFU A;  3VPT A;  6GSU A;  1KTE A;  3VWV A;  1PD2 1;  2ES7 A;  4POM A;  4GQC A;  1EEJ A;  3DYR A;  1XXU A;  4WXT A;  2WJU A;  4KUN A;  2AJQ B;  4JRR A;  1UN2 A;  2B5X A;  4FYC A;  4K7O A;  1Q4J A;  4ZIL A;  3M9K A;  1X0R A;  4L8E A;  2CA8 A;  3TJB A;  3KJY A;  3QPM A;  3F3R A;  5IPH A;  3W8J A;  2FWH A;  3ZL5 A;  1AXD A;  2I9H A;  3UAR A;  2H0H A;  2X8G A;  3GSS A;  1XW9 A;  3ZMK A;  4F0B A;  2YZU A;  4KAE A;  2CVK A;  1U3A A;  2RLI A;  1UVZ A;  2VCV A;  3US3 A;  1I9D A;  2GT6 A;  3CTF A;  1TRV A;  2DBC A;  3LG6 A;  3I43 A;  1VF1 A;  4NAX A;  4DSS B;  4ZIJ A;  2EIQ A;  2VUP A;  3UMA A;  5LNK e;  2L6C A;  1GUL A;  1VRS D;  2FWG A;  3TKR A;  2GLR A;  5DAK B;  4YQU A;  4IBP A;  2VCT A;  4DEJ A;  1GUK A;  3CSI A;  3ED3 A;  1V98 A;  5JCG A;  4BWQ A;  1SD9 A;  3HCZ A;  2BJX A;  2E7P A;  4IEL A;  1EEM A;  3NIV A;  2MMO A;  4MZC A;  5HR3 A;  1Y6E A;  3F63 A;  2O85 A;  1BED A;  1OC9 B;  2H66 A;  2YCD A;  2IMF A;  1FVK A;  3TJG A;  4YQM A;  1XPV A;  4MA9 A;  2VLV A;  5ECO B;  3RBT A;  3HHV A;  3KP9 A;  1T8E B;  2R37 A;  1V2A A;  1VF3 A;  2KUC A;  2H1B A;  3GH6 A;  1EV4 A;  2JAD A;  4N11 A;  3C73 A;  4XCS A;  1B4Q A;  1XWK A;  1PX7 A;  2HE3 A;  3C1S A;  2NPB A;  4IW9 A;  1Z7R A;  1AC1 A;  2FWE A;  4PQ1 A;  3MWH A;  4L0U A;  4JE1 A;  3D4T A;  3ZVJ A;  1FVJ A;  1Z6M A;  2DML A;  1TW9 A;  3TGZ A;  1FO5 A;  2DSA A;  1A24 A;  5JCW A;  1ZGN A;  4E8H A;  3Q18 A;  5KN3 A;  3L4N A;  1MDI A;  3A3T A;  1QGV A;  4OFM A;  1ON4 A;  2K8S A;  3DEX A;  2MMA A;  1EGO A;  5F8B A;  4TR4 A;  5F0G A;  1I5G A;  3QOU A;  3IC4 A;  5DCG A;  5HR1 A;  3W6G A;  5AIX A;  3CSH A;  3SWL A;  1DBY A;  2FHE A;  4HEA 2;  1EOG A;  4F9Z A;  5J4U A;  2YWM A;  4F03 A;  1WPI A;  3RHC A;  2MZC A;  2WFC A;  2HI7 A;  2EIR A;  2LV3 A;  1SYR A;  1Z7P A;  1YKA A;  2YWO A;  4EF0 A;  3MDK A;  3MNG A;  3IK7 A;  4GF0 A;  3M0F A;  4MF7 A;  2IPA A;  3Q74 A;  2L5L A;  3O3T A;  5ECI B;  1A8L A;  5IO2 A;  14GS A;  1GH2 A;  2PER A;  2J23 A;  4LMV A;  4FO5 A;  3DVW A;  3DVX A;  4HQZ A;  1BAY A;  3GYK A;  3ME7 A;  3F6F A;  4LL4 B;  4HQS A;  4AJ8 A;  5ECM B;  2B6M A;  1W4V A;  1THO A;  4KSM A;  1FAA A;  1Z6N A;  2ZCT A;  3L0H A;  1S3A A;  4OFN A;  2VCX A;  2OAC A;  1PQN A;  3J7Y k;  1SKR B;  3APQ A;  1NHY A;  2TIR A;  5ECP B;  2CAQ A;  4V1A p;  1J08 A;  4IS0 A;  4ZXG A;  2V6K A;  3DXB A;  3DGQ A;  2X8C A;  4FYU A;  1YF0 A;  3FK8 A;  2VO4 A;  3KMO A;  3C71 A;  2LTK A;  4POL A;  1ZL9 A;  2GSQ A;  2NDO A;  1USB A;  2YAN A;  3FR9 A;  1XZO A;  2VAF A;  5A4U A;  5C04 A;  1RQM A;  1TDI A;  1O8W A;  1GSY A;  5EVO A;  1YJ6 A;  1O73 A;  1RK4 A;  2CV4 A;  1J0F A;  4N0Z A;  2I81 A;  1B9Y C;  3DRN A;  4N0V A;  2PBJ A;  1OAZ A;  4YH2 A;  1NSW A;  1G7E A;  4G2E A;  5AIV A;  4F82 A;  3WT2 A;  1GRX A;  1KNG A;  2RUE A;  5EPF A;  3A2V A;  5G31 A;  3C1R A;  4O7H A;  1XWC A;  3WGD A;  4ZBD A;  3DML A;  2B5E A;  4H86 A;  2O87 A;  1JLV A;  3LWA A;  1RW1 A;  1M99 A;  3IK9 A;  5CRH A;  4MZB A;  2LJK A;  5JWO B;  4BPY A;  5LCZ A;  2VCZ A;  3VLN A;  1E2Y A;  1A0F A;  3LOR A;  2F8A A;  4ID0 A;  2GQL A;  2VOC A;  4KDY A;  4OMV A;  4TR3 A;  9GSS A;  1O81 A;  2C4J A;  3SBC A;  4V2L A;  2DJK A;  2VD1 A;  2DJ1 A;  1QFN A;  1K0O A;  1T7P B;  3GKM A;  2H72 A;  2CZ2 A;  4ZB6 A;  3FZ9 A;  4QL9 A;  4GWR A;  4PNG A;  2G0F A;  5A4W A;  5IIZ A;  1PL2 A;  4K7I A;  1ZYE A;  5DVB A;  5HQP A;  1G6Y A;  4ECI A;  2H73 A;  2H19 A;  2XBI A;  3DD3 A;  2HFD A;  1K0C A;  5GAN D;  4TOP A;  4X1U A;  2IMI A;  1TJD A;  5D93 A;  5L71 A;  4FYB A;  2L57 A;  5D9T A;  2C1Y A;  4MF5 A;  3TKP A;  1ERU A;  5D9W A;  3HDC A;  1YZX A;  13GS A;  1THX A;  2WGR A;  2AUV A;  1XOA A;  2ON5 A;  5FWG A;  5KN2 A;  3I6A A;  1VGL A;  1PN9 A;  5E59 A;  1Z5Y E;  4IQA A;  5F05 A;  2RII A;  2DJJ A;  3KZQ A;  3APO A;  3V1W A;  4Q5Q A;  5DAL A;  3C7M A;  5IOX A;  2TRX A;  1PKZ A;  1K3O A;  2FD3 A;  2A4V A;  2OBK A;  2CAI A;  2YN1 A;  2R2J A;  1SD8 A;  1WP0 A;  1TI3 A;  4MH3 A;  1YF1 A;  1HNB A;  1FG4 A;  3DWV A;  2R3X A;  1F6M C;  2WDU A;  4P3Y B;  4BA7 A;  3ZIV A;  2P31 A;  2YV7 A;  5ELG A;  5ID2 A;  1WRY A;  1GUM A;  1OC8 A;  2PWJ A;  2FA4 A;  3KTL A;  2MMZ A;  2OE3 A;  3EIN A;  1PMT A;  1TKD B;  2K9F A;  2LRT A;  3LJR A;  4D73 A;  3IPZ A;  4K0G A;  5H5Q A;  4K6X A;  4HZ2 A;  1X5C A;  1FW1 A;  2YPM A;  5COH A;  1B8X A;  3CBU A;  2EC4 A;  4OCE A;  3EU4 A;  1NM3 A;  1X5D A;  2VD0 A;  1O6J A;  4V2M A;  1O8X A;  3D4M A;  2YZH A;  5KN0 A;  3E0U A;  1SYX A;  3A2W A;  1M9A A;  4CHS A;  12GS A;  3BCI A;  3VK9 A;  2WCI A;  1WMJ A;  3AY8 A;  1GUH A;  2WS2 A;  3RAZ A;  1ZMA A;  4YAV A;  2OE1 A;  5GST A;  3FEU A;  5KEJ A;  3M9J A;  1R26 A;  5G1L A;  2BMX A;  3TKS E;  2I1U A;  3HVS A;  22GS A;  2DJ2 A;  3VI7 A;  4ZB8 A;  5EY6 A;  3IR4 A;  4PNF A;  1V58 A;  2XPE A;  4RQR A;  3IA1 A;  4I8B A;  3EE2 A;  3UOM A;  4O5R A;  5ECS A;  2VL9 A;  4EE0 A;  3HVV A;  4HJM A;  2MMN A;  3N5O A;  1R5P A;  3KCM A;  5GSS A;  3JCM L;  2H75 A;  1TK8 B;  1LBK A;  2OA7 A;  4TKY A;  4K7N A;  8GSS A;  4GQF A;  2ON7 A;  3PGT A;  1YDK A;  2JZS A;  2CX3 A;  1GSS A;  1M7T A;  1XCC A;  1H75 A;  1TU7 A;  2GDR A;  1F3B A;  3BD2 A;  4JBB A;  1SKW B;  3IXR A;  3FY7 A;  3A2X A;  1YEX A;  2WUL A;  4OD7 A;  2LST A;  1GLP A;  3HJP A;  4Q5R A;  2K8V A;  3EUR A;  4WF4 A;  1XIY A;  3H93 A;  3IOS A;  3U5R E;  5J5N A;  3LYP A;  3CXG A;  1QXH A;  2LNT A;  4MLY A;  5B7C A;  1M2A A;  1OKT A;  4IVF A;  4PXO A;  4K8M A;  3FRC A;  1QUW A;  4XRD A;  3F3Q A;  4ML6 A;  3ERW A;  1X9W B;  3TB2 A;  5A4V A;  1SKS B;  1K3Y A;  2H71 A;  3FR3 A;  1EP8 A;  4PUF C;  4DSQ A;  4F0C A;  2JZR A;  4HI7 A;  3VFI A;  1U88 A;  4N10 A;  2JU5 A;  2GSR A;  1MDJ A;  3MAK A;  3UEM A;  1GP1 A;  1C72 A;  3J7Y b;  3I9V 2;  3ZRE A;  2C0E A;  4K9Z A;  5DJM A;  2V41 A;  4XS4 B;  5CNW A;  2AHE A;  1XVW A;  2CQ9 A;  1JHB A;  1PSQ A;  3GMF A;  3LEF A;  2E2M A;  5CRG A;  4KH7 A;  2P5Q A;  4IHU A;  1WJK A;  5E4W A;  4G9H A;  5HFK A;  1TP9 A;  4NPB A;  1WIK A;  3LXZ A;  3F4T A;  2WZ9 A;  2YJ7 A;  3GKK A;  4OO5 A;  4ZBB A;  1OYJ A;  5ECR B;  4NV2 A;  3VWU A;  2ALB A;  1FOV A;  3P2A A;  1QMV A;  1JLW A;  3A5W A;  5KN1 A;  2DC5 A;  4I2T A;  2HZE A;  4OCF A;  1GTB A;  2C3Q A;  4RI7 A;  4I97 A;  5IMF A;  3I69 A;  5G1K A;  4ZL8 A;  3FZ5 A;  4RUV A;  4XS6 A;  2YNX A;  4PQI A;  2LRN A;  3F9U A;  5F07 A;  3IDV A;  1M2D A;  3WGX A;  1TTZ A;  4Q5F A;  4JR4 A;  3M1G A;  1S3D A;  2OE0 A;  3TRQ A;  3CSJ A;  3D0Z A;  1WWJ A;  3F0I A;  3FR6 A;  1HNA A;  2JSZ A;  4KGI A;  4TR1 B;  3HYP A;  3IAM 2;  4N30 A;  1OVN A;  2C0G A;  2RM6 A;  1BX9 A;  1CQG A;  2PN8 A;  4HS1 A;  2YJH A;  4XHM A;  2IMK A;  4JED A;  4RI6 A;  1ZOF A;  4L0W A;  3GN3 A;  5FHI A;  3WT1 A;  2CZ3 A;  3GKX A;  4DSS A;  2JL4 A;  1SU9 A;  1E6B A;  2FLS A;  2CX4 A;  3EWL A;  4J2F A;  1IYI A;  2IL3 A;  3ISO A;  2QC7 A;  1XWG A;  3QAG A;  5DAK A;  4NWY A;  1EOH A;  3PIN A;  2IMD A;  3KP8 A;  3D5J A;  3L9S A;  3VUR A;  3ZTL A;  4KSO A;  2PMT A;  1BQ7 A;  3F4S A;  19GS A;  2M46 A;  2LQO A;  3H4K A;  2A2R A;  3GHA A;  4EDZ A;  5D96 A;  4X43 A;  1OC9 A;  3LYK A;  4X0X A;  3HVX A;  3TOU A;  5ENU A;  4GTU A;  5CAX A;  1R4W A;  3ERF A;  5CRD A;  1XFL A;  2PVO C;  5IM9 A;  3PH9 A;  2V1M A;  1WOU A;  4LLR A;  4GSN A;  4ZL7 A;  4O92 A;  2PPT A;  3Q6O A;  2MYG A;  3HY2 A;  7GSS A;  2XHF A;  4ECB A;  5IMV A;  3TKQ A;  5ELA A;  2H1G A;  4EL1 A;  3HKR A;  1AQW A;  1G6W A;  3TDG A;  2YP6 A;  3HZ8 A;  4ZB9 A;  1M9B A;  3EMP A;  1TK5 B;  4TR0 A;  3CRT A;  2DIZ A;  1MD3 A;  2VM1 A;  4KB3 A;  4EO3 A;  4MJA A;  2L59 A;  1N8J A;  2N5B A;  3GUS A;  2X99 A;  1X9S B;  2IFQ B;  5ECN B;  3GTU B;  4QL7 A;  1BYE A;  4FIW A;  3L9V A;  1FHE A;  1O85 A;  1ML6 A;  3LXT A;  1AAZ A;  5B8A A;  1WE0 A;  3BJ5 A;  2E2G A;  2IJY A;  4TW5 A;  2XBQ A;  4KE3 A;  2M80 A;  1HNC A;  4IJ3 A;  4IGJ A;  2REM A;  1ST9 A;  2DIY A;  3EVI A;  1FB0 A;  2OBI A;  4ML1 A;  3C8E A;  5ECK B;  2H76 A;  4WET A;  2V2G A;  1ERW A;  1X5E A;  3O76 A;  4EXJ A;  2HZF A;  3UVH A;  3TUE A;  1FB6 A;  3PR8 A;  4TXO B;  2DJ3 A;  1U3I A;  4NHW A;  2VLU A;  16GS A;  4XS1 A;  2KLX A;  5D9V A;  3HJO A;  1W89 A;  3GFK A;  4EDY A;  4OO4 A;  1DSB A;  4K1F A;  1V40 A;  2AB6 A;  1JZO A;  4MMM A;  2LQQ A;  1AW9 A;  3EYT A;  1PX6 A;  3U6V A;  5B6M A;  4AJ7 A;  1XW6 A;  1PA3 A;  1U6T A;  3TKS C;  4TRX A;  2JSY A;  2GT5 A;  2NBS A;  4K2D A;  4MP4 A;  3M3M A;  4DSR A;  3TOT A;  4KCE A;  4IN0 A;  2H70 A;  4GCI A;  3KD0 A;  3VWW A;  3ZRD A;  3EMX A;  1T3B A;  2JZT A;  2GZY A;  3UJ1 A;  4POB A;  1AQX A;  5ECQ B;  2KP2 A;  2ZNM A;  3IRA A;  5IMZ A;  4NMU A;  1K0B A;  3GNJ A;  2HRF A;  1JZW A;  2K18 A;  1XVQ A;  5IO0 A;  4TXV A;  3GL5 A;  1B9X C;  3UBK A;  3WGE A;  3TRX A;  5DCH A;  2LKU A;  2PGT A;  1MDK A;  4JU5 A;  1QQ2 A;  4I2U A;  5HFG A;  5JCU A;  1GNW A;  5C00 A;  4MJE A;  3KH9 A;  6GSY A;  3KGK A;  4KCA A;  2IIY A;  3ME8 A;  4PX1 A;  1YQ1 A;  3VWX A;  4G19 A;  4J56 E;  1BG5 A;  4K0N A;  2X64 A;  2H6X A;  3P7X A;  2OAD A;  2D2Z A;  3GL3 A;  5DBQ A;  6GSW A;  2H6Z A;  2FY6 A;  1DE2 A;  3QFA C;  4ILF A; 
#chains in the Genus database with same CATH topology
 2JAC A;  5G2Z A;  3D22 A;  2C3T A;  2LUS A;  2OKA A;  5DQY A;  5ABR A;  3H1N A;  2R4V A;  5IPG A;  4RQX A;  4O5Q A;  5ECL B;  1B4P A;  4L5L A;  2HYX A;  4ZL9 A;  3FW2 A;  4Q5N A;  3RHB A;  4ISD A;  1F37 A;  3GX0 A;  3N9J A;  1EP7 A;  1SL0 B;  1JZD A;  4KA0 A;  1URM A;  2GS3 A;  1AUC A;  2QGV A;  2TRC P;  4WBJ A;  1YEP A;  3HD5 A;  1PGT A;  1T4Z A;  2RM5 A;  1O7U A;  3GA4 A;  1Z9H A;  1A0R P;  1XBS A;  2HNL A;  4DVC A;  3UBL A;  2F51 A;  3CMI A;  2A2S A;  5ECH B;  4O32 A;  2H8L A;  4HJ2 A;  4KDU A;  1HD2 A;  2V6O A;  3QCP A;  2HZE B;  4MCU A;  2GST A;  2VL3 A;  4XIH A;  2F3M A;  3WYW A;  10GS A;  4L5O A;  5DDL A;  1CQH A;  2WRT A;  1T00 A;  4GRF A;  4PGT A;  3GH9 A;  2LJR A;  4FQU A;  4GST A;  3ERG A;  1U87 A;  2M72 A;  1ERV A;  3ZVJ D;  4WBR D;  5B8B A;  1X9M B;  3HA9 A;  2FWF A;  2VL2 C;  3DIE A;  1GLQ A;  2DLX A;  4MPF A;  3R2Q A;  3PPU A;  2YWN A;  1NW2 A;  3QAV A;  2VCQ A;  4YQV A;  4MJB A;  3L78 A;  6GSX A;  1OC3 A;  2X4A A;  2G2Q A;  1AQV A;  4Z2R A;  1GTU A;  5CYY A;  3EU3 A;  5IMC A;  1M2B A;  4MJC A;  4QQ7 A;  1SJZ A;  4ACS A;  2O8V B;  5GAP D;  4BL7 A;  4IP6 A;  3BBY A;  4MPG A;  2B7K A;  2GQK A;  4MK3 A;  1XG8 A;  4I5Q A;  1HYU A;  2X8H A;  4TVE A;  4GXZ A;  5KOW A;  3M8N A;  2IWT A;  2GSS A;  4G10 A;  3DKS A;  1DUG A;  2H1A A;  6GSV A;  1Q98 A;  4OFT A;  1TRS A;  3G7Y A;  3GIX A;  4KW6 A;  2FNO A;  2VCW A;  3TRP A;  4KX4 A;  4ULX A;  3IBH A;  3D21 A;  4KF9 A;  2FA8 A;  1TRW A;  2YV9 A;  3H8Q A;  5D8I A;  2H6Y A;  1DE1 A;  2O7K A;  11GS A;  4YAP A;  2RUF A;  4LA1 A;  2VIM A;  1SL1 B;  2VLT A;  2LNS A;  1R7H A;  4AGS A;  5DQS A;  2FGX A;  2FCH A;  1XWB A;  4HU7 A;  5J41 A;  2N5F A;  2H0G A;  5D73 A;  5F06 A;  4O5U A;  4EC0 A;  2MBT A;  3GKN A;  2H1D A;  3EC3 A;  1UA5 A;  3QD9 A;  4V2N A;  1MTC A;  2C0F A;  5HR0 A;  5IMD A;  5G5F A;  2HRN A;  3BOA A;  2L6D A;  1A23 A;  1EZK A;  1VF4 A;  3VI5 A;  2B1L A;  2R6K A;  4HDE A;  5CO3 A;  2GVP A;  5AGY A;  20GS A;  3BCK A;  3LQ7 A;  2B5Y A;  2PVQ A;  3FZA A;  1GSF A;  1GTA A;  4HUA A;  4MZW A;  3G9B A;  2VL2 A;  3S9F A;  2XC2 A;  2CT6 A;  4WEY A;  1K3L A;  1BJX A;  1YKC A;  4HU9 A;  1T4Y A;  4PQH A;  1GSQ A;  4WF5 A;  4MH2 A;  3RPP A;  4MF6 A;  3ZIT A;  1S3C A;  2BTO T;  1EWX A;  2GTU A;  2X49 A;  3GRX A;  5IOW A;  1R5A A;  1OKD A;  4J57 E;  5A5K A;  3RDW A;  1LJR A;  3P8W A;  3IV4 A;  4ECC A;  5BRT A;  2F9S A;  3KIJ A;  1GWC A;  1JZR A;  1TRU A;  3LGC A;  4IP1 A;  3P90 A;  5B6N A;  5FT3 A;  1XWA A;  2LJA A;  1SL2 B;  3CYN A;  3KTB A;  4F2I A;  3F8U A;  3UVT A;  2I3Y A;  17GS A;  1ZYQ B;  5JWR B;  1SK1 A;  5AIS A;  1Z3E A;  1IYH A;  2YWI A;  3UAP A;  2L4Q A;  1GL8 A;  2GQM A;  2MBS A;  1PN0 A;  3FHK A;  2H01 A;  1ERT A;  3UL3 A;  2IN3 A;  4EUY A;  5HR2 A;  2LS5 A;  3E3E A;  4MDC A;  1A2J A;  4JZQ A;  5G5E A;  1OE8 A;  2QSI A;  3ZZX A;  2DMM A;  4PUR A;  1EV9 A;  5CRE A;  1A8Y A;  4BVX A;  3RPN A;  3QDN A;  3IAS 2;  4CW9 A;  4XS4 A;  1G0T A;  18GS A;  2L5O A;  3WD6 A;  5DAL B;  4EKZ A;  5DJL A;  4JR6 A;  1M0U A;  1XOB A;  5LD0 A;  4AF2 A;  2C8U A;  2F8F A;  1PL1 A;  3HXS A;  3ZYW A;  1ZCP A;  3G7I A;  4IQ1 A;  2QKE A;  2P5R A;  2KP1 A;  3KXO A;  4GLT A;  1SK2 A;  2LEG A;  4KND A;  2V32 A;  2NTO A;  4XTS A;  4HSC X;  2PU9 C;  2K6V A;  3H79 A;  1V57 A;  5ID2 B;  2I4A A;  4BWS A;  4ECJ A;  3FYG A;  3TJF A;  1KBN A;  1ACV A;  2R5G A;  2GZZ A;  5J3R A;  1PRX A;  2ZUP A;  2HXK A;  1ZZY A;  2XPD A;  1QK8 A;  4D73 B;  1MEK A;  1OE7 A;  2B1K A;  3TJJ A;  1GSE A;  2OJL A;  3CTG A;  5INY A;  4XRA A;  5D9X A;  3QFB C;  4CDO A;  1SEN A;  3NZN A;  1AIU A;  4PUA A;  2HSY A;  4TR1 A;  1KEB A;  3QMX A;  1TXX A;  1EGR A;  4FH8 A;  1SJI A;  1K0M A;  3CRU A;  2C80 A;  2LRC A;  2H0I A;  3KEB A;  5J9C A;  3IE3 A;  1GSU A;  2B7J A;  4E8E A;  3F4R A;  3ZFL A;  1H4O A;  3HZ4 A;  3L9U A;  6GSS A;  2AV4 A;  2CVD A;  3HJM A;  3LSZ A;  3KH7 A;  6GST A;  4IJI A;  2L4C A;  1HQO A;  1TOF A;  4WKW A;  4G0I A;  4POK A;  4V1A g;  2YOI A;  1PKW A;  1G7O A;  3QR6 A;  3NOF A;  3E9J B;  5G30 A;  4HZ4 A;  2H74 A;  1UC7 A;  3OR5 A;  1F9M A;  3FZ4 A;  2CVB A;  4Z7X A;  5EL8 A;  1GTI A;  5IQY A;  2AAW A;  3D6I A;  3ZFB A;  2HRK A;  3IHQ A;  1YY7 A;  2IME A;  1A2M A;  3GUR A;  5JWQ B;  4EVM A;  4BVY A;  2DJ0 A;  2NVL A;  4TN8 A;  3MSZ A;  5GZZ B;  5HFI A;  3O6T A;  2J9H A;  2WB9 A;  1NHO A;  1GSD A;  2O89 A;  5J9B A;  3FKF A;  3F6D A;  1SK0 A;  5CP1 A;  3IHG A;  2C3N A;  1A2L A;  1SJ6 A;  1ILO A;  3G7J A;  3GX8 A;  4WR4 A;  4NV5 A;  4WR5 A;  2HLS A;  2HT9 A;  4LL1 B;  1TI1 A;  1LU4 A;  1J9B A;  5AN1 A;  3R3E A;  1K0N A;  4NHZ A;  3KMN A;  1F3A A;  4LMW A;  3ZIJ A;  2EIO A;  1VF2 A;  4GSS A;  2AYT A;  1TK0 B;  3TCO A;  2HSH A;  4OWY A;  2IFQ A;  1K0A A;  4MAB A;  4IKH A;  3GST A;  2KOK A;  1FOH A;  3GTU A;  2GZP A;  3QAW A;  3LFL A;  1N2A A;  4I6X A;  2KHP A;  1Y25 A;  5H5R A;  1TU8 A;  2VM2 A;  2E0Q A;  3ZML A;  1F2E A;  3IC8 A;  2GGT A;  3W8S A;  2Z9S A;  2N5A A;  1T1V A;  5IMA A;  3VPQ A;  2PUK C;  1GNE A;  3K8N A;  3GV1 A;  1MD4 A;  4AJ6 A;  3ZLP A;  2P0G A;  3UIW A;  5CRW A;  4HOJ A;  4KDX A;  4CY8 A;  3APS A;  2FUG 2;  2B3S A;  3Q19 A;  2H30 A;  2R0P A;  3KM6 A;  4ZBA A;  5H5S A;  2C0D A;  1K0D A;  1V9W A;  1XW5 A;  4TXO A;  3TKS A;  1ABA A;  1B48 A;  4NXI A;  3TJK A;  1JFU A;  3VPT A;  6GSU A;  1KTE A;  3VWV A;  1PD2 1;  2ES7 A;  4POM A;  4GQC A;  2DKH A;  1EEJ A;  3DYR A;  1XXU A;  4WXT A;  2WJU A;  4KUN A;  2AJQ B;  4JRR A;  1UN2 A;  2B5X A;  4FYC A;  4K7O A;  1Q4J A;  4ZIL A;  3M9K A;  1X0R A;  4L8E A;  2CA8 A;  3TJB A;  3KJY A;  3QPM A;  3F3R A;  5IPH A;  3W8J A;  2FWH A;  3ZL5 A;  1AXD A;  2I9H A;  3UAR A;  2H0H A;  2X8G A;  3GSS A;  1XW9 A;  3ZMK A;  4F0B A;  2YZU A;  4KAE A;  2CVK A;  1U3A A;  2RLI A;  1UVZ A;  2VCV A;  3US3 A;  1I9D A;  2GT6 A;  3CTF A;  1TRV A;  2DBC A;  3LG6 A;  3I43 A;  1VF1 A;  4NAX A;  4DSS B;  4ZIJ A;  2EIQ A;  2VUP A;  3UMA A;  5LNK e;  2L6C A;  4K2X A;  1GUL A;  1ZYN A;  1VRS D;  2FWG A;  3TKR A;  2GLR A;  5DAK B;  4YQU A;  4IBP A;  2VCT A;  4DEJ A;  1GUK A;  3CSI A;  3ED3 A;  1V98 A;  5JCG A;  4BWQ A;  1SD9 A;  3HCZ A;  2BJX A;  2E7P A;  4BIK A;  4IEL A;  1EEM A;  3NIV A;  2MMO A;  4MZC A;  5HR3 A;  1Y6E A;  3F63 A;  2O85 A;  1BED A;  1OC9 B;  2H66 A;  2YCD A;  2IMF A;  1FVK A;  3TJG A;  4YQM A;  1XPV A;  4MA9 A;  2VLV A;  5ECO B;  3RBT A;  3HHV A;  3KP9 A;  1M3J A;  4MNN A;  1T8E B;  2R37 A;  1V2A A;  1VF3 A;  2KUC A;  2H1B A;  3GH6 A;  1EV4 A;  2JAD A;  4N11 A;  3C73 A;  4XCS A;  1B4Q A;  1XWK A;  1PX7 A;  2HE3 A;  3C1S A;  2NPB A;  4IW9 A;  1Z7R A;  1AC1 A;  2FWE A;  4PQ1 A;  3MWH A;  4L0U A;  4JE1 A;  3D4T A;  3ZVJ A;  1FVJ A;  1Z6M A;  2DML A;  1TW9 A;  3TGZ A;  1FO5 A;  2DSA A;  1A24 A;  5JCW A;  1ZGN A;  4E8H A;  3Q18 A;  5KN3 A;  3L4N A;  1MDI A;  3A3T A;  1QGV A;  4OFM A;  1ON4 A;  2K8S A;  3DEX A;  2MMA A;  1EGO A;  5F8B A;  4TR4 A;  5F0G A;  1I5G A;  3FMW A;  3QOU A;  3IC4 A;  5DCG A;  5HR1 A;  3W6G A;  5AIX A;  3CSH A;  3SWL A;  1DBY A;  2FHE A;  4HEA 2;  1EOG A;  4F9Z A;  5J4U A;  2YWM A;  4F03 A;  1WPI A;  3RHC A;  2MZC A;  4Z2T A;  2WFC A;  2HI7 A;  2EIR A;  2LV3 A;  1SYR A;  1Z7P A;  1YKA A;  2YWO A;  4EF0 A;  3MDK A;  3MNG A;  3IK7 A;  4GF0 A;  3M0F A;  4MF7 A;  2IPA A;  3LW9 A;  3Q74 A;  2L5L A;  3O3T A;  5ECI B;  1A8L A;  5IO2 A;  14GS A;  1GH2 A;  2PER A;  2J23 A;  4LMV A;  4FO5 A;  4K5S A;  3DVW A;  3DVX A;  4HQZ A;  1BAY A;  3GYK A;  3ME7 A;  3F6F A;  4LL4 B;  4HQS A;  4AJ8 A;  5ECM B;  2B6M A;  1W4V A;  1THO A;  4KSM A;  1FAA A;  1Z6N A;  2ZCT A;  3L0H A;  1S3A A;  4OFN A;  2VCX A;  2A4H A;  2OAC A;  1PQN A;  3J7Y k;  1SKR B;  3APQ A;  1NHY A;  2TIR A;  5ECP B;  2CAQ A;  4V1A p;  1J08 A;  4IS0 A;  4ZXG A;  2V6K A;  3DXB A;  3DGQ A;  2X8C A;  4FYU A;  1YF0 A;  3FK8 A;  2VO4 A;  3KMO A;  3C71 A;  2LTK A;  4POL A;  1ZL9 A;  2GSQ A;  2NDO A;  1USB A;  2YAN A;  3FR9 A;  2R0G A;  1XZO A;  2VAF A;  5A4U A;  5C04 A;  1RQM A;  1TDI A;  1O8W A;  1GSY A;  5EVO A;  2QA1 A;  1YJ6 A;  1O73 A;  1RK4 A;  2CV4 A;  1J0F A;  4N0Z A;  2I81 A;  1B9Y C;  3DRN A;  4N0V A;  2PBJ A;  1OAZ A;  4YH2 A;  1NSW A;  1G7E A;  4G2E A;  5AIV A;  4F82 A;  3WT2 A;  1GRX A;  1KNG A;  2RUE A;  5EPF A;  3A2V A;  5G31 A;  3C1R A;  4O7H A;  1XWC A;  3WGD A;  4ZBD A;  3DML A;  2B5E A;  4H86 A;  2O87 A;  1JLV A;  3LWA A;  1RW1 A;  1M99 A;  3IK9 A;  5CRH A;  4MZB A;  2LJK A;  5JWO B;  4BPY A;  5LCZ A;  2VCZ A;  3VLN A;  1E2Y A;  1A0F A;  3LOR A;  2F8A A;  4ID0 A;  2GQL A;  2VOC A;  4KDY A;  4OMV A;  4TR3 A;  9GSS A;  1O81 A;  2C4J A;  3SBC A;  4V2L A;  4CY6 A;  2DJK A;  2VD1 A;  2DJ1 A;  1QFN A;  1K0O A;  1T7P B;  3GKM A;  2H72 A;  2CZ2 A;  4ZB6 A;  3FZ9 A;  4QL9 A;  4GWR A;  4PNG A;  2G0F A;  5A4W A;  5IIZ A;  1PL2 A;  4K7I A;  1ZYE A;  5DVB A;  5HQP A;  1G6Y A;  4ECI A;  2H73 A;  2H19 A;  2XBI A;  3DD3 A;  2HFD A;  1K0C A;  5GAN D;  2HSM A;  4TOP A;  4X1U A;  2IMI A;  1TJD A;  5D93 A;  5L71 A;  4FYB A;  2L57 A;  5D9T A;  2C1Y A;  4MF5 A;  3TKP A;  1ERU A;  5D9W A;  3HDC A;  1YZX A;  13GS A;  1THX A;  2WGR A;  2AUV A;  1XOA A;  2ON5 A;  5FWG A;  5KN2 A;  3I6A A;  1VGL A;  1PN9 A;  5E59 A;  1Z5Y E;  4IQA A;  5F05 A;  2RII A;  2DJJ A;  3KZQ A;  3APO A;  3V1W A;  4Q5Q A;  5DAL A;  3C7M A;  5IOX A;  2TRX A;  1PKZ A;  1K3O A;  2FD3 A;  2A4V A;  2OBK A;  4BL7 B;  2CAI A;  2YN1 A;  2R2J A;  1SD8 A;  1WP0 A;  1ZYP A;  1TI3 A;  4MH3 A;  1YF1 A;  1HNB A;  1FG4 A;  3DWV A;  2R3X A;  1F6M C;  2WDU A;  4P3Y B;  4BA7 A;  3ZIV A;  2P31 A;  2YV7 A;  3MYD A;  5ELG A;  5ID2 A;  1WRY A;  1GUM A;  1OC8 A;  2PWJ A;  2FA4 A;  4PTS A;  3KTL A;  1PFO A;  2MMZ A;  2OE3 A;  3EIN A;  1PMT A;  1TKD B;  2K9F A;  2LRT A;  3LJR A;  4D73 A;  3IPZ A;  4K0G A;  5H5Q A;  4K6X A;  4HZ2 A;  1X5C A;  1FW1 A;  2YPM A;  2HRA A;  5COH A;  1B8X A;  3CBU A;  3EPT A;  2EC4 A;  4OCE A;  3EU4 A;  1NM3 A;  1X5D A;  2VD0 A;  1O6J A;  4V2M A;  1O8X A;  3D4M A;  2YZH A;  5KN0 A;  3E0U A;  1SYX A;  2UZ8 A;  3A2W A;  1M9A A;  4CHS A;  12GS A;  3BCI A;  3VK9 A;  2WCI A;  1WMJ A;  3AY8 A;  1GUH A;  2WS2 A;  3RAZ A;  1M3I A;  1ZMA A;  4YAV A;  2OE1 A;  5GST A;  3FEU A;  5KEJ A;  3M9J A;  1R26 A;  5G1L A;  2BMX A;  3TKS E;  2I1U A;  3HVS A;  22GS A;  2DJ2 A;  3VI7 A;  4ZB8 A;  5EY6 A;  3IR4 A;  4PNF A;  1V58 A;  2XPE A;  4Z2U A;  4RQR A;  3IA1 A;  4I8B A;  4ICY A;  3EE2 A;  3UOM A;  4O5R A;  5ECS A;  2VL9 A;  4EE0 A;  3HVV A;  4HJM A;  4USS A;  2MMN A;  3N5O A;  4EIP A;  1R5P A;  3KCM A;  5GSS A;  3JCM L;  2H75 A;  1TK8 B;  1LBK A;  2OA7 A;  4TKY A;  4K7N A;  8GSS A;  4GQF A;  2ON7 A;  3PGT A;  3A5I A;  1YDK A;  2JZS A;  2CX3 A;  1GSS A;  1M7T A;  1XCC A;  2A2P A;  1H75 A;  1TU7 A;  2GDR A;  1F3B A;  3BD2 A;  4JBB A;  1SKW B;  4YKG A;  3IXR A;  3FY7 A;  3CQF A;  3A2X A;  1YEX A;  2WUL A;  4OD7 A;  2LST A;  1GLP A;  3HVN A;  3HJP A;  4Q5R A;  2K8V A;  3EUR A;  4WF4 A;  1XIY A;  3H93 A;  3IOS A;  3U5R E;  5J5N A;  3LYP A;  3CXG A;  1QXH A;  2LNT A;  4MLY A;  5B7C A;  1M2A A;  1OKT A;  4IVF A;  4PXO A;  4K8M A;  3FRC A;  1QUW A;  4XRD A;  3F3Q A;  4ML6 A;  3ERW A;  1X9W B;  3TB2 A;  5A4V A;  1SKS B;  1K3Y A;  2H71 A;  3FR3 A;  1EP8 A;  4PUF C;  4DSQ A;  4F0C A;  2JZR A;  5KOX A;  4HI7 A;  3VFI A;  1U88 A;  4N10 A;  2JU5 A;  2GSR A;  1MDJ A;  3MAK A;  3UEM A;  1GP1 A;  4BVX B;  1C72 A;  3J7Y b;  3I9V 2;  3ZRE A;  2C0E A;  4K9Z A;  5DJM A;  4EIQ A;  2V41 A;  4XS4 B;  5CNW A;  2AHE A;  1XVW A;  2CQ9 A;  1JHB A;  1PSQ A;  3GMF A;  3LEF A;  2E2M A;  5CRG A;  4KH7 A;  2P5Q A;  4IHU A;  1WJK A;  5E4W A;  4G9H A;  5HFK A;  1TP9 A;  4NPB A;  1WIK A;  3LXZ A;  4A5P A;  3F4T A;  4G0K A;  2WZ9 A;  2YJ7 A;  3GKK A;  1S3R A;  4OO5 A;  4ZBB A;  1OYJ A;  5ECR B;  4NV2 A;  3VWU A;  2ALB A;  1FOV A;  3P2A A;  1QMV A;  1JLW A;  3A5W A;  5KN1 A;  2DC5 A;  4I2T A;  2HZE A;  4OCF A;  1GTB A;  2C3Q A;  4RI7 A;  4I97 A;  5IMF A;  3I69 A;  5G1K A;  4ZL8 A;  3FZ5 A;  4RUV A;  4XS6 A;  2YNX A;  4PQI A;  2LRN A;  3F9U A;  5F07 A;  3IDV A;  1M2D A;  3WGX A;  1TTZ A;  4Q5F A;  4JR4 A;  3M1G A;  1S3D A;  2OE0 A;  3TRQ A;  3CSJ A;  3D0Z A;  1WWJ A;  3F0I A;  3FR6 A;  1HNA A;  2JSZ A;  4KGI A;  4TR1 B;  3HYP A;  3IAM 2;  4N30 A;  1OVN A;  2C0G A;  2RM6 A;  1BX9 A;  1CQG A;  2PN8 A;  4HS1 A;  2YJH A;  4XHM A;  2IMK A;  4JED A;  4RI6 A;  1ZOF A;  4L0W A;  3GN3 A;  5FHI A;  3WT1 A;  2CZ3 A;  3GKX A;  4DSS A;  2JL4 A;  1SU9 A;  1E6B A;  2FLS A;  2CX4 A;  3EWL A;  4J2F A;  4K5R A;  1IYI A;  2IL3 A;  3ISO A;  2QC7 A;  1XWG A;  3QAG A;  5DAK A;  4NWY A;  1EOH A;  3PIN A;  2IMD A;  3KP8 A;  3D5J A;  3L9S A;  3VUR A;  3ZTL A;  4KSO A;  2PMT A;  2QA2 A;  1BQ7 A;  3F4S A;  19GS A;  2M46 A;  2LQO A;  3MIX A;  3H4K A;  2A2R A;  3GHA A;  4EDZ A;  5D96 A;  4X43 A;  1OC9 A;  3LYK A;  4X0X A;  3HVX A;  2DKI A;  3TOU A;  5ENU A;  4GTU A;  5CAX A;  1R4W A;  4BVY B;  3ERF A;  5CRD A;  1XFL A;  2PVO C;  5IM9 A;  3PH9 A;  2V1M A;  1WOU A;  4LLR A;  4G0L A;  4GSN A;  4ZL7 A;  4O92 A;  2PPT A;  3Q6O A;  2MYG A;  3HY2 A;  7GSS A;  2XHF A;  4ECB A;  5IMV A;  3TKQ A;  5ELA A;  2H1G A;  4EL1 A;  3HKR A;  1AQW A;  1G6W A;  3TDG A;  2YP6 A;  3HZ8 A;  4ZB9 A;  1M9B A;  3EMP A;  1TK5 B;  4TR0 A;  3CRT A;  2DIZ A;  1MD3 A;  2VM1 A;  4KB3 A;  4EO3 A;  4MJA A;  2L59 A;  1N8J A;  2N5B A;  3GUS A;  2X99 A;  1X9S B;  2IFQ B;  5ECN B;  3GTU B;  4QL7 A;  1BYE A;  4FIW A;  3L9V A;  1FHE A;  1O85 A;  1ML6 A;  3LXT A;  1AAZ A;  5B8A A;  1WE0 A;  3BJ5 A;  2E2G A;  2IJY A;  4TW5 A;  2XBQ A;  4KE3 A;  2M80 A;  1HNC A;  4IJ3 A;  4IGJ A;  2REM A;  1ST9 A;  2DIY A;  3EVI A;  1FB0 A;  2OBI A;  4ML1 A;  3C8E A;  5ECK B;  2H76 A;  4WET A;  2V2G A;  1ERW A;  1X5E A;  3O76 A;  4EXJ A;  2HZF A;  3UVH A;  2R0C A;  5BMU A;  3TUE A;  1FB6 A;  3PR8 A;  4TXO B;  2DJ3 A;  1U3I A;  4NHW A;  2VLU A;  16GS A;  4XS1 A;  2KLX A;  5D9V A;  3HJO A;  4YKF A;  1W89 A;  3GFK A;  4EDY A;  4OO4 A;  1DSB A;  4K1F A;  1V40 A;  2AB6 A;  1JZO A;  4MMM A;  2LQQ A;  1AW9 A;  3EYT A;  1PX6 A;  3U6V A;  5B6M A;  4AJ7 A;  1XW6 A;  1PA3 A;  1U6T A;  3TKS C;  4TRX A;  2JSY A;  2GT5 A;  2NBS A;  4K2D A;  4MP4 A;  3M3M A;  4DSR A;  3TOT A;  4KCE A;  4IN0 A;  2H70 A;  4GCI A;  3KD0 A;  3VWW A;  3ZRD A;  3EMX A;  1T3B A;  2JZT A;  2GZY A;  3UJ1 A;  4POB A;  1AQX A;  5ECQ B;  2KP2 A;  2ZNM A;  3IRA A;  5IMZ A;  4NMU A;  1K0B A;  3GNJ A;  2HRF A;  1JZW A;  2K18 A;  1XVQ A;  5IO0 A;  4TXV A;  3GL5 A;  1B9X C;  3UBK A;  3WGE A;  3TRX A;  5DCH A;  2LKU A;  2PGT A;  1MDK A;  4X4J A;  4JU5 A;  1QQ2 A;  4I2U A;  5HFG A;  5JCU A;  1GNW A;  5C00 A;  4MJE A;  3KH9 A;  6GSY A;  3KGK A;  4KCA A;  2IIY A;  3ME8 A;  4PX1 A;  1YQ1 A;  3VWX A;  4G19 A;  4J56 E;  1BG5 A;  4K0N A;  2X64 A;  2H6X A;  3P7X A;  2OAD A;  2D2Z A;  3GL3 A;  5DBQ A;  6GSW A;  2H6Z A;  2FY6 A;  1DE2 A;  3QFA C;  4ILF A; 
#chains in the Genus database with same CATH homology
 2JAC A;  5G2Z A;  3D22 A;  2C3T A;  2LUS A;  2OKA A;  5DQY A;  5ABR A;  3H1N A;  2R4V A;  5IPG A;  4RQX A;  4O5Q A;  5ECL B;  1B4P A;  4L5L A;  2HYX A;  4ZL9 A;  3FW2 A;  4Q5N A;  3RHB A;  4ISD A;  1F37 A;  3GX0 A;  3N9J A;  1EP7 A;  1SL0 B;  1JZD A;  4KA0 A;  1URM A;  2GS3 A;  1AUC A;  2QGV A;  2TRC P;  4WBJ A;  1YEP A;  3HD5 A;  1PGT A;  1T4Z A;  2RM5 A;  1O7U A;  3GA4 A;  1Z9H A;  1A0R P;  1XBS A;  2HNL A;  4DVC A;  3UBL A;  2F51 A;  3CMI A;  2A2S A;  5ECH B;  4O32 A;  2H8L A;  4HJ2 A;  4KDU A;  1HD2 A;  2V6O A;  3QCP A;  2HZE B;  4MCU A;  2GST A;  2VL3 A;  4XIH A;  2F3M A;  3WYW A;  10GS A;  4L5O A;  5DDL A;  1CQH A;  2WRT A;  1T00 A;  4GRF A;  4PGT A;  3GH9 A;  2LJR A;  4FQU A;  4GST A;  3ERG A;  1U87 A;  2M72 A;  1ERV A;  3ZVJ D;  4WBR D;  5B8B A;  1X9M B;  3HA9 A;  2FWF A;  2VL2 C;  3DIE A;  1GLQ A;  2DLX A;  4MPF A;  3R2Q A;  3PPU A;  2YWN A;  1NW2 A;  3QAV A;  2VCQ A;  4YQV A;  4MJB A;  3L78 A;  6GSX A;  1OC3 A;  2X4A A;  2G2Q A;  1AQV A;  4Z2R A;  1GTU A;  5CYY A;  3EU3 A;  5IMC A;  1M2B A;  4MJC A;  4QQ7 A;  1SJZ A;  4ACS A;  2O8V B;  5GAP D;  4BL7 A;  4IP6 A;  3BBY A;  4MPG A;  2B7K A;  2GQK A;  4MK3 A;  4I5Q A;  1HYU A;  2X8H A;  4TVE A;  4GXZ A;  5KOW A;  3M8N A;  2IWT A;  2GSS A;  4G10 A;  3DKS A;  1DUG A;  2H1A A;  6GSV A;  1Q98 A;  4OFT A;  1TRS A;  3G7Y A;  3GIX A;  4KW6 A;  2FNO A;  2VCW A;  3TRP A;  4KX4 A;  4ULX A;  3IBH A;  3D21 A;  4KF9 A;  2FA8 A;  1TRW A;  2YV9 A;  3H8Q A;  5D8I A;  2H6Y A;  1DE1 A;  2O7K A;  11GS A;  4YAP A;  2RUF A;  4LA1 A;  2VIM A;  1SL1 B;  2VLT A;  2LNS A;  1R7H A;  4AGS A;  5DQS A;  2FGX A;  2FCH A;  1XWB A;  4HU7 A;  5J41 A;  2N5F A;  2H0G A;  5D73 A;  5F06 A;  4O5U A;  4EC0 A;  2MBT A;  3GKN A;  2H1D A;  3EC3 A;  1UA5 A;  3QD9 A;  4V2N A;  1MTC A;  2C0F A;  5HR0 A;  5IMD A;  5G5F A;  2HRN A;  3BOA A;  2L6D A;  1A23 A;  1EZK A;  1VF4 A;  3VI5 A;  2B1L A;  2R6K A;  4HDE A;  5CO3 A;  2GVP A;  5AGY A;  20GS A;  3BCK A;  3LQ7 A;  2B5Y A;  2PVQ A;  3FZA A;  1GSF A;  1GTA A;  4HUA A;  4MZW A;  3G9B A;  2VL2 A;  3S9F A;  2XC2 A;  2CT6 A;  4WEY A;  1K3L A;  1BJX A;  1YKC A;  4HU9 A;  1T4Y A;  4PQH A;  1GSQ A;  4WF5 A;  4MH2 A;  3RPP A;  4MF6 A;  3ZIT A;  1S3C A;  2BTO T;  1EWX A;  2GTU A;  2X49 A;  3GRX A;  5IOW A;  1R5A A;  1OKD A;  4J57 E;  5A5K A;  3RDW A;  1LJR A;  3P8W A;  3IV4 A;  4ECC A;  5BRT A;  2F9S A;  3KIJ A;  1GWC A;  1JZR A;  1TRU A;  3LGC A;  4IP1 A;  3P90 A;  5B6N A;  5FT3 A;  1XWA A;  2LJA A;  1SL2 B;  3CYN A;  3KTB A;  4F2I A;  3F8U A;  3UVT A;  2I3Y A;  17GS A;  1ZYQ B;  5JWR B;  1SK1 A;  5AIS A;  1Z3E A;  1IYH A;  2YWI A;  3UAP A;  2L4Q A;  1GL8 A;  2GQM A;  2MBS A;  1PN0 A;  3FHK A;  2H01 A;  1ERT A;  3UL3 A;  2IN3 A;  4EUY A;  5HR2 A;  2LS5 A;  3E3E A;  4MDC A;  1A2J A;  4JZQ A;  5G5E A;  1OE8 A;  2QSI A;  3ZZX A;  2DMM A;  4PUR A;  1EV9 A;  5CRE A;  1A8Y A;  4BVX A;  3RPN A;  3QDN A;  3IAS 2;  4CW9 A;  4XS4 A;  1G0T A;  18GS A;  2L5O A;  3WD6 A;  5DAL B;  4EKZ A;  5DJL A;  4JR6 A;  1M0U A;  1XOB A;  5LD0 A;  4AF2 A;  2C8U A;  2F8F A;  1PL1 A;  3HXS A;  3ZYW A;  1ZCP A;  3G7I A;  4IQ1 A;  2QKE A;  2P5R A;  2KP1 A;  3KXO A;  4GLT A;  1SK2 A;  2LEG A;  4KND A;  2V32 A;  2NTO A;  4XTS A;  2PU9 C;  2K6V A;  3H79 A;  1V57 A;  5ID2 B;  2I4A A;  4BWS A;  4ECJ A;  3FYG A;  3TJF A;  1KBN A;  1ACV A;  2R5G A;  2GZZ A;  5J3R A;  1PRX A;  2ZUP A;  2HXK A;  1ZZY A;  2XPD A;  1QK8 A;  4D73 B;  1MEK A;  1OE7 A;  2B1K A;  3TJJ A;  1GSE A;  2OJL A;  3CTG A;  5INY A;  4XRA A;  5D9X A;  3QFB C;  4CDO A;  1SEN A;  3NZN A;  1AIU A;  4PUA A;  2HSY A;  4TR1 A;  1KEB A;  3QMX A;  1TXX A;  1EGR A;  4FH8 A;  1SJI A;  1K0M A;  3CRU A;  2C80 A;  2LRC A;  2H0I A;  3KEB A;  5J9C A;  3IE3 A;  1GSU A;  2B7J A;  4E8E A;  3F4R A;  3ZFL A;  1H4O A;  3HZ4 A;  3L9U A;  6GSS A;  2AV4 A;  2CVD A;  3HJM A;  3LSZ A;  3KH7 A;  6GST A;  4IJI A;  2L4C A;  1HQO A;  1TOF A;  4WKW A;  4G0I A;  4POK A;  4V1A g;  2YOI A;  1PKW A;  1G7O A;  3QR6 A;  3NOF A;  3E9J B;  5G30 A;  4HZ4 A;  2H74 A;  1UC7 A;  3OR5 A;  1F9M A;  3FZ4 A;  2CVB A;  4Z7X A;  5EL8 A;  1GTI A;  5IQY A;  2AAW A;  3D6I A;  3ZFB A;  2HRK A;  3IHQ A;  1YY7 A;  2IME A;  1A2M A;  3GUR A;  5JWQ B;  4EVM A;  4BVY A;  2DJ0 A;  2NVL A;  4TN8 A;  3MSZ A;  5GZZ B;  5HFI A;  3O6T A;  2J9H A;  2WB9 A;  1NHO A;  1GSD A;  2O89 A;  5J9B A;  3FKF A;  3F6D A;  1SK0 A;  5CP1 A;  3IHG A;  2C3N A;  1A2L A;  1SJ6 A;  1ILO A;  3G7J A;  3GX8 A;  4WR4 A;  4NV5 A;  4WR5 A;  2HLS A;  2HT9 A;  4LL1 B;  1TI1 A;  1LU4 A;  1J9B A;  5AN1 A;  3R3E A;  1K0N A;  4NHZ A;  3KMN A;  1F3A A;  4LMW A;  3ZIJ A;  2EIO A;  1VF2 A;  4GSS A;  2AYT A;  1TK0 B;  3TCO A;  2HSH A;  4OWY A;  2IFQ A;  1K0A A;  4MAB A;  4IKH A;  3GST A;  2KOK A;  1FOH A;  3GTU A;  2GZP A;  3QAW A;  3LFL A;  1N2A A;  4I6X A;  2KHP A;  1Y25 A;  5H5R A;  1TU8 A;  2VM2 A;  2E0Q A;  3ZML A;  1F2E A;  3IC8 A;  2GGT A;  3W8S A;  2Z9S A;  2N5A A;  1T1V A;  5IMA A;  3VPQ A;  2PUK C;  1GNE A;  3K8N A;  3GV1 A;  1MD4 A;  4AJ6 A;  3ZLP A;  2P0G A;  3UIW A;  5CRW A;  4HOJ A;  4KDX A;  4CY8 A;  3APS A;  2FUG 2;  2B3S A;  3Q19 A;  2H30 A;  2R0P A;  3KM6 A;  4ZBA A;  5H5S A;  2C0D A;  1K0D A;  1V9W A;  1XW5 A;  4TXO A;  3TKS A;  1ABA A;  1B48 A;  4NXI A;  3TJK A;  1JFU A;  3VPT A;  6GSU A;  1KTE A;  3VWV A;  1PD2 1;  2ES7 A;  4POM A;  4GQC A;  2DKH A;  1EEJ A;  3DYR A;  1XXU A;  4WXT A;  2WJU A;  4KUN A;  2AJQ B;  4JRR A;  1UN2 A;  2B5X A;  4FYC A;  4K7O A;  1Q4J A;  4ZIL A;  3M9K A;  1X0R A;  4L8E A;  2CA8 A;  3TJB A;  3KJY A;  3QPM A;  3F3R A;  5IPH A;  3W8J A;  2FWH A;  3ZL5 A;  1AXD A;  2I9H A;  3UAR A;  2H0H A;  2X8G A;  3GSS A;  1XW9 A;  3ZMK A;  4F0B A;  2YZU A;  4KAE A;  2CVK A;  1U3A A;  2RLI A;  1UVZ A;  2VCV A;  3US3 A;  1I9D A;  2GT6 A;  3CTF A;  1TRV A;  2DBC A;  3LG6 A;  3I43 A;  1VF1 A;  4NAX A;  4DSS B;  4ZIJ A;  2EIQ A;  2VUP A;  3UMA A;  5LNK e;  2L6C A;  4K2X A;  1GUL A;  1ZYN A;  1VRS D;  2FWG A;  3TKR A;  2GLR A;  5DAK B;  4YQU A;  4IBP A;  2VCT A;  4DEJ A;  1GUK A;  3CSI A;  3ED3 A;  1V98 A;  5JCG A;  4BWQ A;  1SD9 A;  3HCZ A;  2BJX A;  2E7P A;  4IEL A;  1EEM A;  3NIV A;  2MMO A;  4MZC A;  5HR3 A;  1Y6E A;  3F63 A;  2O85 A;  1BED A;  1OC9 B;  2H66 A;  2YCD A;  2IMF A;  1FVK A;  3TJG A;  4YQM A;  1XPV A;  4MA9 A;  2VLV A;  5ECO B;  3RBT A;  3HHV A;  3KP9 A;  4MNN A;  1T8E B;  2R37 A;  1V2A A;  1VF3 A;  2KUC A;  2H1B A;  3GH6 A;  1EV4 A;  2JAD A;  4N11 A;  3C73 A;  4XCS A;  1B4Q A;  1XWK A;  1PX7 A;  2HE3 A;  3C1S A;  2NPB A;  4IW9 A;  1Z7R A;  1AC1 A;  2FWE A;  4PQ1 A;  3MWH A;  4L0U A;  4JE1 A;  3D4T A;  3ZVJ A;  1FVJ A;  1Z6M A;  2DML A;  1TW9 A;  3TGZ A;  1FO5 A;  2DSA A;  1A24 A;  5JCW A;  1ZGN A;  4E8H A;  3Q18 A;  5KN3 A;  3L4N A;  1MDI A;  3A3T A;  1QGV A;  4OFM A;  1ON4 A;  2K8S A;  3DEX A;  2MMA A;  1EGO A;  5F8B A;  4TR4 A;  5F0G A;  1I5G A;  3FMW A;  3QOU A;  3IC4 A;  5DCG A;  5HR1 A;  3W6G A;  5AIX A;  3CSH A;  3SWL A;  1DBY A;  2FHE A;  4HEA 2;  1EOG A;  4F9Z A;  5J4U A;  2YWM A;  4F03 A;  1WPI A;  3RHC A;  2MZC A;  4Z2T A;  2WFC A;  2HI7 A;  2EIR A;  2LV3 A;  1SYR A;  1Z7P A;  1YKA A;  2YWO A;  4EF0 A;  3MDK A;  3MNG A;  3IK7 A;  4GF0 A;  3M0F A;  4MF7 A;  2IPA A;  3LW9 A;  3Q74 A;  2L5L A;  3O3T A;  5ECI B;  1A8L A;  5IO2 A;  14GS A;  1GH2 A;  2PER A;  2J23 A;  4LMV A;  4FO5 A;  4K5S A;  3DVW A;  3DVX A;  4HQZ A;  1BAY A;  3GYK A;  3ME7 A;  3F6F A;  4LL4 B;  4HQS A;  4AJ8 A;  5ECM B;  2B6M A;  1W4V A;  1THO A;  4KSM A;  1FAA A;  1Z6N A;  2ZCT A;  3L0H A;  1S3A A;  4OFN A;  2VCX A;  2A4H A;  2OAC A;  1PQN A;  3J7Y k;  1SKR B;  3APQ A;  1NHY A;  2TIR A;  5ECP B;  2CAQ A;  4V1A p;  1J08 A;  4IS0 A;  4ZXG A;  2V6K A;  3DXB A;  3DGQ A;  2X8C A;  4FYU A;  1YF0 A;  3FK8 A;  2VO4 A;  3KMO A;  3C71 A;  2LTK A;  4POL A;  1ZL9 A;  2GSQ A;  2NDO A;  1USB A;  2YAN A;  3FR9 A;  2R0G A;  1XZO A;  2VAF A;  5A4U A;  5C04 A;  1RQM A;  1TDI A;  1O8W A;  1GSY A;  5EVO A;  2QA1 A;  1YJ6 A;  1O73 A;  1RK4 A;  2CV4 A;  1J0F A;  4N0Z A;  2I81 A;  1B9Y C;  3DRN A;  4N0V A;  2PBJ A;  1OAZ A;  4YH2 A;  1NSW A;  1G7E A;  4G2E A;  5AIV A;  4F82 A;  3WT2 A;  1GRX A;  1KNG A;  2RUE A;  5EPF A;  3A2V A;  5G31 A;  3C1R A;  4O7H A;  1XWC A;  3WGD A;  4ZBD A;  3DML A;  2B5E A;  4H86 A;  2O87 A;  1JLV A;  3LWA A;  1RW1 A;  1M99 A;  3IK9 A;  5CRH A;  4MZB A;  2LJK A;  5JWO B;  4BPY A;  5LCZ A;  2VCZ A;  3VLN A;  1E2Y A;  1A0F A;  3LOR A;  2F8A A;  4ID0 A;  2GQL A;  2VOC A;  4KDY A;  4OMV A;  4TR3 A;  9GSS A;  1O81 A;  2C4J A;  3SBC A;  4V2L A;  4CY6 A;  2DJK A;  2VD1 A;  2DJ1 A;  1QFN A;  1K0O A;  1T7P B;  3GKM A;  2H72 A;  2CZ2 A;  4ZB6 A;  3FZ9 A;  4QL9 A;  4GWR A;  4PNG A;  2G0F A;  5A4W A;  5IIZ A;  1PL2 A;  4K7I A;  1ZYE A;  5DVB A;  5HQP A;  1G6Y A;  4ECI A;  2H73 A;  2H19 A;  2XBI A;  3DD3 A;  2HFD A;  1K0C A;  5GAN D;  2HSM A;  4TOP A;  4X1U A;  2IMI A;  1TJD A;  5D93 A;  5L71 A;  4FYB A;  2L57 A;  5D9T A;  2C1Y A;  4MF5 A;  3TKP A;  1ERU A;  5D9W A;  3HDC A;  1YZX A;  13GS A;  1THX A;  2WGR A;  2AUV A;  1XOA A;  2ON5 A;  5FWG A;  5KN2 A;  3I6A A;  1VGL A;  1PN9 A;  5E59 A;  1Z5Y E;  4IQA A;  5F05 A;  2RII A;  2DJJ A;  3KZQ A;  3APO A;  3V1W A;  4Q5Q A;  5DAL A;  3C7M A;  5IOX A;  2TRX A;  1PKZ A;  1K3O A;  2FD3 A;  2A4V A;  2OBK A;  4BL7 B;  2CAI A;  2YN1 A;  2R2J A;  1SD8 A;  1WP0 A;  1ZYP A;  1TI3 A;  4MH3 A;  1YF1 A;  1HNB A;  1FG4 A;  3DWV A;  2R3X A;  1F6M C;  2WDU A;  4P3Y B;  4BA7 A;  3ZIV A;  2P31 A;  2YV7 A;  3MYD A;  5ELG A;  5ID2 A;  1WRY A;  1GUM A;  1OC8 A;  2PWJ A;  2FA4 A;  4PTS A;  3KTL A;  2MMZ A;  2OE3 A;  3EIN A;  1PMT A;  1TKD B;  2K9F A;  2LRT A;  3LJR A;  4D73 A;  3IPZ A;  4K0G A;  5H5Q A;  4K6X A;  4HZ2 A;  1X5C A;  1FW1 A;  2YPM A;  2HRA A;  5COH A;  1B8X A;  3CBU A;  3EPT A;  2EC4 A;  4OCE A;  3EU4 A;  1NM3 A;  1X5D A;  2VD0 A;  1O6J A;  4V2M A;  1O8X A;  3D4M A;  2YZH A;  5KN0 A;  3E0U A;  1SYX A;  2UZ8 A;  3A2W A;  1M9A A;  4CHS A;  12GS A;  3BCI A;  3VK9 A;  2WCI A;  1WMJ A;  3AY8 A;  1GUH A;  2WS2 A;  3RAZ A;  1ZMA A;  4YAV A;  2OE1 A;  5GST A;  3FEU A;  5KEJ A;  3M9J A;  1R26 A;  5G1L A;  2BMX A;  3TKS E;  2I1U A;  3HVS A;  22GS A;  2DJ2 A;  3VI7 A;  4ZB8 A;  5EY6 A;  3IR4 A;  4PNF A;  1V58 A;  2XPE A;  4Z2U A;  4RQR A;  3IA1 A;  4I8B A;  4ICY A;  3EE2 A;  3UOM A;  4O5R A;  5ECS A;  2VL9 A;  4EE0 A;  3HVV A;  4HJM A;  4USS A;  2MMN A;  3N5O A;  4EIP A;  1R5P A;  3KCM A;  5GSS A;  3JCM L;  2H75 A;  1TK8 B;  1LBK A;  2OA7 A;  4TKY A;  4K7N A;  8GSS A;  4GQF A;  2ON7 A;  3PGT A;  3A5I A;  1YDK A;  2JZS A;  2CX3 A;  1GSS A;  1M7T A;  1XCC A;  2A2P A;  1H75 A;  1TU7 A;  2GDR A;  1F3B A;  3BD2 A;  4JBB A;  1SKW B;  4YKG A;  3IXR A;  3FY7 A;  3A2X A;  1YEX A;  2WUL A;  4OD7 A;  2LST A;  1GLP A;  3HJP A;  4Q5R A;  2K8V A;  3EUR A;  4WF4 A;  1XIY A;  3H93 A;  3IOS A;  3U5R E;  5J5N A;  3LYP A;  3CXG A;  1QXH A;  2LNT A;  4MLY A;  5B7C A;  1M2A A;  1OKT A;  4IVF A;  4PXO A;  4K8M A;  3FRC A;  1QUW A;  4XRD A;  3F3Q A;  4ML6 A;  3ERW A;  1X9W B;  3TB2 A;  5A4V A;  1SKS B;  1K3Y A;  2H71 A;  3FR3 A;  1EP8 A;  4PUF C;  4DSQ A;  4F0C A;  2JZR A;  5KOX A;  4HI7 A;  3VFI A;  1U88 A;  4N10 A;  2JU5 A;  2GSR A;  1MDJ A;  3MAK A;  3UEM A;  1GP1 A;  4BVX B;  1C72 A;  3J7Y b;  3I9V 2;  3ZRE A;  2C0E A;  4K9Z A;  5DJM A;  4EIQ A;  2V41 A;  4XS4 B;  5CNW A;  2AHE A;  1XVW A;  2CQ9 A;  1JHB A;  1PSQ A;  3GMF A;  3LEF A;  2E2M A;  5CRG A;  4KH7 A;  2P5Q A;  4IHU A;  1WJK A;  5E4W A;  4G9H A;  5HFK A;  1TP9 A;  4NPB A;  1WIK A;  3LXZ A;  4A5P A;  3F4T A;  4G0K A;  2WZ9 A;  2YJ7 A;  3GKK A;  4OO5 A;  4ZBB A;  1OYJ A;  5ECR B;  4NV2 A;  3VWU A;  2ALB A;  1FOV A;  3P2A A;  1QMV A;  1JLW A;  3A5W A;  5KN1 A;  2DC5 A;  4I2T A;  2HZE A;  4OCF A;  1GTB A;  2C3Q A;  4RI7 A;  4I97 A;  5IMF A;  3I69 A;  5G1K A;  4ZL8 A;  3FZ5 A;  4RUV A;  4XS6 A;  2YNX A;  4PQI A;  2LRN A;  3F9U A;  5F07 A;  3IDV A;  1M2D A;  3WGX A;  1TTZ A;  4Q5F A;  4JR4 A;  3M1G A;  1S3D A;  2OE0 A;  3TRQ A;  3CSJ A;  3D0Z A;  1WWJ A;  3F0I A;  3FR6 A;  1HNA A;  2JSZ A;  4KGI A;  4TR1 B;  3HYP A;  3IAM 2;  4N30 A;  1OVN A;  2C0G A;  2RM6 A;  1BX9 A;  1CQG A;  2PN8 A;  4HS1 A;  2YJH A;  4XHM A;  2IMK A;  4JED A;  4RI6 A;  1ZOF A;  4L0W A;  3GN3 A;  5FHI A;  3WT1 A;  2CZ3 A;  3GKX A;  4DSS A;  2JL4 A;  1SU9 A;  1E6B A;  2FLS A;  2CX4 A;  3EWL A;  4J2F A;  4K5R A;  1IYI A;  2IL3 A;  3ISO A;  2QC7 A;  1XWG A;  3QAG A;  5DAK A;  4NWY A;  1EOH A;  3PIN A;  2IMD A;  3KP8 A;  3D5J A;  3L9S A;  3VUR A;  3ZTL A;  4KSO A;  2PMT A;  2QA2 A;  1BQ7 A;  3F4S A;  19GS A;  2M46 A;  2LQO A;  3MIX A;  3H4K A;  2A2R A;  3GHA A;  4EDZ A;  5D96 A;  4X43 A;  1OC9 A;  3LYK A;  4X0X A;  3HVX A;  2DKI A;  3TOU A;  5ENU A;  4GTU A;  5CAX A;  1R4W A;  4BVY B;  3ERF A;  5CRD A;  1XFL A;  2PVO C;  5IM9 A;  3PH9 A;  2V1M A;  1WOU A;  4LLR A;  4G0L A;  4GSN A;  4ZL7 A;  4O92 A;  2PPT A;  3Q6O A;  2MYG A;  3HY2 A;  7GSS A;  2XHF A;  4ECB A;  5IMV A;  3TKQ A;  5ELA A;  2H1G A;  4EL1 A;  3HKR A;  1AQW A;  1G6W A;  3TDG A;  2YP6 A;  3HZ8 A;  4ZB9 A;  1M9B A;  3EMP A;  1TK5 B;  4TR0 A;  3CRT A;  2DIZ A;  1MD3 A;  2VM1 A;  4KB3 A;  4EO3 A;  4MJA A;  2L59 A;  1N8J A;  2N5B A;  3GUS A;  2X99 A;  1X9S B;  2IFQ B;  5ECN B;  3GTU B;  4QL7 A;  1BYE A;  4FIW A;  3L9V A;  1FHE A;  1O85 A;  1ML6 A;  3LXT A;  1AAZ A;  5B8A A;  1WE0 A;  3BJ5 A;  2E2G A;  2IJY A;  4TW5 A;  2XBQ A;  4KE3 A;  2M80 A;  1HNC A;  4IJ3 A;  4IGJ A;  2REM A;  1ST9 A;  2DIY A;  3EVI A;  1FB0 A;  2OBI A;  4ML1 A;  3C8E A;  5ECK B;  2H76 A;  4WET A;  2V2G A;  1ERW A;  1X5E A;  3O76 A;  4EXJ A;  2HZF A;  3UVH A;  2R0C A;  5BMU A;  3TUE A;  1FB6 A;  3PR8 A;  4TXO B;  2DJ3 A;  1U3I A;  4NHW A;  2VLU A;  16GS A;  4XS1 A;  2KLX A;  5D9V A;  3HJO A;  4YKF A;  1W89 A;  3GFK A;  4EDY A;  4OO4 A;  1DSB A;  4K1F A;  1V40 A;  2AB6 A;  1JZO A;  4MMM A;  2LQQ A;  1AW9 A;  3EYT A;  1PX6 A;  3U6V A;  5B6M A;  4AJ7 A;  1XW6 A;  1PA3 A;  1U6T A;  3TKS C;  4TRX A;  2JSY A;  2GT5 A;  2NBS A;  4K2D A;  4MP4 A;  3M3M A;  4DSR A;  3TOT A;  4KCE A;  4IN0 A;  2H70 A;  4GCI A;  3KD0 A;  3VWW A;  3ZRD A;  3EMX A;  1T3B A;  2JZT A;  2GZY A;  3UJ1 A;  4POB A;  1AQX A;  5ECQ B;  2KP2 A;  2ZNM A;  3IRA A;  5IMZ A;  4NMU A;  1K0B A;  3GNJ A;  2HRF A;  1JZW A;  2K18 A;  1XVQ A;  5IO0 A;  4TXV A;  3GL5 A;  1B9X C;  3UBK A;  3WGE A;  3TRX A;  5DCH A;  2LKU A;  2PGT A;  1MDK A;  4X4J A;  4JU5 A;  1QQ2 A;  4I2U A;  5HFG A;  5JCU A;  1GNW A;  5C00 A;  4MJE A;  3KH9 A;  6GSY A;  3KGK A;  4KCA A;  2IIY A;  3ME8 A;  4PX1 A;  1YQ1 A;  3VWX A;  4G19 A;  4J56 E;  1BG5 A;  4K0N A;  2X64 A;  2H6X A;  3P7X A;  2OAD A;  2D2Z A;  3GL3 A;  5DBQ A;  6GSW A;  2H6Z A;  2FY6 A;  1DE2 A;  3QFA C;  4ILF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...