2HSYA

Solution structure of thioredoxin 2 from saccharomyces cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
b'MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin II
publication title NMR solution structure of the reduced form of thioredoxin 2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hsyA00
2PVOC 1IYHA 3LORA 2G2QA 2HRNA 1XWKA 1A2JA 1XOBA 4K2DA 2OBIA 1U3AA 3HZ8A 5G5EA 2PN8A 1GSQA 4L5LA 3GYKA 2GSTA 2PWJA 5D9WA 2JADA 3GN3A 3CSIA 3FZ4A 1KEBA 2GDRA 4LL1B 4AGSA 1PD21 4JR4A 4KW6A 3LQ7A 1K0BA 2OA7A 1WMJA 2DLXA 4Q5NA 5HFIA 3F4RA 3LFLA 6GSTA 4IELA 3IE3A 1K3YA 4NV5A 3O3TA 4HJ2A 5ID2B 2VCWA 3DXBA 2I3YA 1ML6A 3IDVA 3RPPA 3KH9A 3C71A 1U3IA 3APQA 5IPHA 1PRXA 3KXOA 4KDXA 4NWYA 2CZ3A 1T00A 2DJ3A 3TKRA 1B8XA 1MDIA 2K8VA 1OE7A 1FAAA 4JBBA 1VGLA 4F82A 3HCZA 12GSA 4RUVA 3LWAA 3CSHA 5DCHA 2GQKA 4OCEA 2V6OA 5F0GA 3G7IA 3D4TA 3KP9A 2NVLA 2R5GA 3FHKA 1EWXA 1OKTA 1PSQA 4XIHA 1PN9A 3Q18A 3L9VA 1GSEA 4LMVA 2JSYA 2TIRA 1XBSA 16GSA 3FZ5A 13GSA 4JRRA 1ZGNA 3TRPA 2K18A 3F63A 4QL7A 2KLXA 4IBPA 4TR0A 2JZTA 3W6GA 1X9SB 2BMXA 2YV7A 3F4TA 3WT2A 5E59A 2VL2A 1RW1A 3FZ9A 4BVYA 1GLPA 1K0MA 1MTCA 2C0EA 2C4JA 3VURA 1YKAA 3ZFLA 4BWSA 4MF7A 3M1GA 2H19A 3DIEA 3TKSA 3VWUA 1HQOA 2V1MA 5J5NA 2WJUA 3KGKA 4KNDA 3LGCA 4PQ1A 5F8BA 3RHBA 1GUMA 5EY6A 5HR1A 3HXSA 4ILFA 1SL1B 2YJ7A 3D4MA 4WF4A 2C3TA 1A24A 3LYKA 4F9ZA 1JZRA 20GSA 1M2AA 3EURA 3HYPA 5J9BA 5E4WA 2P5QA 4IW9A 3MWHA 4JE1A 1GRXA 4TR3A 2P0GA 4V2NA 1X5CA 6GSXA 4IGJA 5KEJA 4K7OA 2H0IA 1JFUA 2GT6A 1W89A 3I6AA 1GTBA 3LXTA 3UVHA 3LXZA 2VCQA 1PGTA 3BCKA 5G2ZA 1GSUA 4MZCA 1NHOA 5ENUA 2YV9A 1ST9A 5ECRB 5A4WA 1T8EB 4MF5A 4X1UA 2RUEA 3KTLA 4N30A 1FVKA 5F07A 1PL1A 1SK1A 2HLSA 2TRXA 3HZ4A 3HDCA 1SYXA 1F6MC 2L5LA 1QK8A 1UC7A 2LQQA 3FW2A 2RM6A 1EEJA 1O7UA 3ZMKA 3O76A 1WP0A 2O8VB 2H8LA 3D5JA 2DC5A 3APOA 5G1KA 5FT3A 2VM2A 5CYYA 2CA8A 2D2ZA 1MDKA 2ALBA 4JEDA 4HQSA 2A2SA 4N10A 4Q5QA 5G1LA 4IS0A 4EF0A 2MMZA 2PPTA 2WDUA 2CVDA 3ZRDA 1O8WA 3CRTA 1GSDA 3F0IA 2IMKA 1V58A 5DDLA 3FY7A 4WF5A 3F6FA 4FH8A 4RQRA 5IPGA 1XVWA 5EVOA 4DVCA 2VUPA 3J7Yb 1O85A 1FOVA 3L9UA 2CVBA 3FR3A 2H0GA 1SK2A 4OD7A 5J41A 2FLSA 2REMA 2LJKA 3UBKA 1PA3A 2QC7A 2P31A 3A5WA 2L4CA 1A2LA 3F3QA 1KTEA 2YWIA 5IQYA 1Z5YE 3D0ZA 4MCUA 1QFNA 3N5OA 5IOXA 4AJ6A 5CP1A 4FYCA 2WZ9A 4XRDA 3ZMLA 5IMFA 2LS5A 3QD9A 4K7NA 1T7PB 2FUG2 3E3EA 4V1Ap 2PU9C 4K0GA 3EMXA 2M72A 1TRUA 3DMLA 2YOIA 2M80A 3H8QA 3ZITA 3BCIA 5C04A 4ECJA 3DVWA 1K0OA 4ZL8A 1ILOA 2AJQB 2PBJA 1Z6NA 4ML6A 2C0DA 3HJOA 1Y25A 2QSIA 1M2BA 4XRAA 3FR9A 1Y6EA 1UN2A 2O85A 4I6XA 1R7HA 2CZ2A 1M2DA 2B5XA 5ECSA 1NW2A 3J7Yk 2H30A 5ELGA 3FYGA 2RUFA 2OE3A 4ZIJA 3RAZA 5J9CA 2I4AA 2IFQA 3GKKA 2L59A 5DAKA 2WS2A 1YEXA 3IHQA 4XS4A 1R26A 1WOUA 3PINA 22GSA 3H79A 1VF2A 3ZYWA 4HS1A 4OFNA 2OACA 1T1VA 4BL7A 1YF0A 3P90A 5CRWA 18GSA 2F3MA 3HHVA 1E6BA 5DQSA 1RK4A 4ZXGA 1B4PA 2LV3A 2KOKA 4KDYA 5D93A 4ZILA 5J3RA 5CO3A 2IMEA 5GZZB 1V98A 2YWNA 4ACSA 5HR2A 2A4VA 2WFCA 3CRUA 2H66A 1B9XC 2R2JA 2VIMA 2HNLA 1MDJA 4I5QA 4TVEA 2V32A 1AQWA 3F9UA 3QMXA 4DSSA 4AJ8A 5B6MA 5JCWA 1WIKA 3GIXA 2IL3A 3HVXA 3KMOA 1M9AA 4G19A 2VD1A 4DSQA 14GSA 2DJKA 1SD9A 3GX8A 3JCML 2C1YA 5D96A 3RBTA 2RIIA 1SD8A 5HFKA 4BWQA 5JCUA 2CVKA 3ZIVA 4MPGA 1TXXA 4G2EA 5CNWA 3ERWA 1GL8A 3DRNA 1OAZA 3VK9A 4I2UA 1BEDA 4QQ7A 2YCDA 2H0HA 2AV4A 1AIUA 2MZCA 5IMZA 3E0UA 3M0FA 2AB6A 5LCZA 3WGEA 3FR6A 5C00A 2HZFA 1SKWB 3PR8A 2B5YA 3D21A 3DYRA 2FCHA 1PQNA 3VLNA 3I43A 1TTZA 3QDNA 3L0HA 1ZYQB 5HR3A 2C0FA 5JWOB 1R5AA 2X99A 4O92A 4GSNA 1PX7A 2X8GA 3GA4A 3F3RA 4EKZA 2E2GA 1AC1A 3IAM2 5CREA 4XCSA 2CAQA 3HKRA 1AQVA 4OMVA 5GAPD 1F3AA 3GKNA 3TJJA 3ISOA 4YQMA 1S3DA 4OWYA 3UJ1A 10GSA 2H6ZA 2HXKA 2LRNA 1OC3A 1NSWA 1JLWA 4IP6A 4TW5A 4G10A 4KGIA 3Q6OA 4MPFA 1X9MB 1PL2A 4YQUA 2X8CA 3CBUA 4GQFA 2RM5A 4MF6A 1OVNA 1THXA 2H73A 2MBSA 4F0CA 5ECLB 2IMDA 1XXUA 1HNAA 2GSRA 2N5FA 1NM3A 4YAVA 1M7TA 3TKQA 3DEXA 5COHA 1EP7A 2IFQB 3HA9A 1Z3EA 2GVPA 1J08A 4PNGA 5DAKB 2ON5A 4XS4B 4F2IA 2MMNA 2F9SA 3BD2A 1QUWA 2ZNMA 4GLTA 2HE3A 4DSRA 3KEBA 2NTOA 2VCZA 4MMMA 1URMA 2LUSA 1TU8A 2H01A 19GSA 2EC4A 4L8EA 3MSZA 3WGDA 4IQAA 1O81A 2V2GA 1XWGA 2GQMA 2HT9A 4MJAA 3UARA 2H1DA 2B3SA 2DIYA 4CDOA 1MD4A 2B6MA 4KE3A 4MZBA 2DIZA 3TJFA 1T4ZA 2QKEA 1YKCA 1EV4A 1YF1A 5F06A 3BBYA 4K1FA 4ZB6A 1ERWA 4EDZA 2C0GA 4DSSB 4D73A 2YJHA 2PERA 3Q74A 2OKAA 2YNXA 4HOJA 2DJJA 2ZUPA 2B5EA 1JZDA 2AYTA 4RI6A 4RI7A 2C8UA 2VLVA 4LA1A 1V2AA 1GWCA 2K6VA 5B8BA 2H1BA 3WD6A 3EINA 1X0RA 2R3XA 1XW9A 1T3BA 2EIQA 2L6DA 4HZ4A 3UIWA 1TDIA 2K9FA 5ELAA 2H70A 5DVBA 1HNCA 4POBA 2JSZA 5B7CA 5IO2A 5GAND 1Z9HA 3FRCA 4JR6A 4O32A 3IRAA 1A8LA 1F9MA 3HD5A 1K3LA 2X64A 4MZWA 3HVSA 2JL4A 3G7YA 1A2MA 4ZBBA 1XIYA 2L6CA 4GF0A 1USBA 4MH2A 1O6JA 2L5OA 4BVXA 1Z7PA 2HYXA 4OO4A 5J4UA 5IMCA 3KIJA 2YZHA 6GSSA 1GLQA 2DMMA 4IJ3A 4PNFA 2H1GA 3W8SA 1OC9A 3I69A 17GSA 4IP1A 1DUGA 2YWOA 3CSJA 1Q98A 1FB0A 2PVQA 3GL3A 2X8HA 5D9VA 4TRXA 4MP4A 1X9WB 2XC2A 1TRWA 1DE1A 4PX1A 3UBLA 4FYUA 4ZL7A 1A0FA 4POMA 2PMTA 2AHEA 1F3BA 3GSTA 5ECHB 4TR4A 1QGVA 1SJ6A 1CQHA 1U88A 3CYNA 4GXZA 3MDKA 4ML1A 2GGTA 2YWMA 4DEJA 5INYA 2DJ0A 3VI5A 3ME7A 3TDGA 2H6YA 5DQYA 3QAWA 3S9FA 3KH7A 4KH7A 4PUFC 2GT5A 2H6XA 1K0DA 1V9WA 2QGVA 2FNOA 4ZB9A 4MK3A 3ZL5A 2J23A 3UEMA 2VO4A 5ABRA 3M8NA 3ZVJA 1TW9A 4ZBAA 1MD3A 2ZCTA 3GRXA 1EGOA 3EU3A 5FHIA 3GKMA 1G7OA 4HJMA 5G30A 4XS6A 1HD2A 3GKXA 3EWLA 4ZL9A 3EC3A 1PKWA 4YAPA 2VLTA 3V1WA 5ECNB 3EMPA 1U87A 4NXIA 3IC4A 3L78A 3QR6A 2CV4A 2MYGA 3DGQA 3KM6A 4D73B 2GQLA 2HI7A 4F0BA 3G9BA 4HZ2A 4PGTA 1G6YA 1V40A 1RQMA 1PX6A 1OC8A 2FWHA 4MABA 2LJRA 4HUAA 5DCGA 2R37A 3QFBC 2FY6A 4K0NA 1H4OA 3ERFA 3UVTA 4KB3A 4KA0A 1K3OA 1DE2A 4HEA2 3LEFA 3GV1A 4KAEA 4TR1A 1M99A 3TOTA 2M46A 4PUAA 2BTOT 3GSSA 5H5RA 1B9YC 2C80A 4MA9A 1XWCA 4IJIA 4JZQA 3IOSA 3ZFBA 2LKUA 3KMNA 1TRVA 3C73A 3NOFA 4NHWA 4NV2A 2VM1A 3QFAC 1LU4A 1GH2A 1R5PA 3E9JB 1GULA 1N8JA 3EVIA 1AQXA 2IJYA 1SENA 3QPMA 3TCOA 1TP9A 1GNWA 1GSSA 1BQ7A 5AN1A 3BJ5A 4ECIA 4K7IA 3GMFA 1XVQA 5D73A 1ACVA 4Z7XA 1OC9B 7GSSA 4LLRA 4WR4A 3IXRA 3SWLA 2FA8A 1GSFA 2WGRA 1BJXA 4N11A 3VWVA 3BOAA 3F8UA 3I9V2 4OO5A 1EGRA 2NBSA 2WCIA 1FB6A 1SL0B 3ED3A 2OE1A 1O73A 3C1SA 9GSSA 3MAKA 1B4QA 1TOFA 5ECOB 1ON4A 1QQ2A 3NZNA 4QL9A 3R2QA 5F05A 3TGZA 2HZEA 1DSBA 4CW9A 4TOPA 3GUSA 4H86A 3TB2A 6GSYA 2CQ9A 6GSWA 1WJKA 3F4SA 2YANA 5DALA 2KHPA 2A2RA 5D9TA 1WPIA 4POKA 2WRTA 4OFMA 5HQPA 5CRHA 3RHCA 1X5DA 1Q4JA 4KUNA 4GRFA 1EP8A 2LSTA 4P3YB 4XS1A 1SKSB 1I5GA 1XWBA 1BG5A 2I9HA 1AUCA 4PQIA 1WRYA 2AUVA 2IN3A 4GWRA 2CAIA 2IWTA 1YQ1A 5JCGA 2F51A 4IN0A 3C7MA 1SJZA 4J57E 4EVMA 1SU9A 2B1KA 4HU9A 2DBCA 2HSYA 3A2WA 5ECPB 4I2TA 3IR4A 2J9HA 5D9XA 1FVJA 2YN1A 1WWJA 2LNSA 1LBKA 1TI3A 3GTUB 1FG4A 5IMAA 2LTKA 1HYUA 4XTSA 6GSUA 3HJMA 3LYPA 1XWAA 3IPZA 1YZXA 4ISDA 2G0FA 4IVFA 4EDYA 3PH9A 2MBTA 3EU4A 2DMLA 3FK8A 1S3AA 2I1UA 3W8JA 4K6XA 4K8MA 2H75A 1VF1A 4KDUA 8GSSA 3VWWA 3PGTA 1FW1A 1O8XA 1V57A 2VLUA 3MNGA 2FA4A 2VL2C 1ABAA 4I8BA 4TR1B 4V2LA 2LJAA 2H71A 2ON7A 3HJPA 3QOUA 2LQOA 5HFGA 4EE0A 4L0UA 1M9BA 3O6TA 1GUKA 5IOWA 1J9BA 2F8AA 3TKSC 5KN3A 2EIOA 4FIWA 4MDCA 2IMIA 1I9DA 4GSSA 2ES7A 1C72A 3M9KA 1GUHA 3ZLPA 2R6KA 5ECQB 4WBJA 4ZBDA 1TK0B 1X5EA 3VFIA 4ECBA 4IQ1A 4GSTA 3DWVA 1YJ6A 4Q5RA 3M3MA 1PMTA 2NPBA 4MJEA 5AIXA 4BA7A 2IIYA 5DJLA 3IV4A 2LRCA 1TK8B 1R4WA 3U5RE 3TOUA 1OYJA 4BPYA 5DJMA 4FO5A 1TK5B 2TRCP 1AXDA 5LD0A 1G7EA 1XFLA 1UA5A 3P7XA 4MJBA 4MLYA 3WT1A 3P8WA 1G6WA 2YZUA 4HQZA 1A23A 5GSTA 4TXVA 2FWGA 1BX9A 4ZB8A 4HU7A 3GNJA 3ZVJD 2KP2A 3A2VA 4GCIA 2HRFA 2B7JA 2GSSA 3US3A 5LNKe 4N0ZA 3RPNA 1EOHA 2CT6A 2LRTA 1YDKA 2I81A 3FKFA 2HZEB 1ZYEA 1IYIA 3M9JA 5KN2A 2IPAA 2CX4A 3C1RA 5IO0A 1N2AA 1SK0A 4WKWA 4FYBA 3GX0A 3ZTLA 3TRQA 4AJ7A 3KD0A 5DALB 4KCEA 5IMDA 2BJXA 4CHSA 2OBKA 5G5FA 2VCVA 4POLA 2MMOA 1B48A 1XZOA 4XHMA 5G31A 3TKSE 4GTUA 2RLIA 3CTGA 5CRDA 4KSOA 2VOCA 4TXOB 2LNTA 5AGYA 1TRSA 2PGTA 3FEUA 4KX4A 2DJ2A 4WXTA 3QAVA 2VCTA 3UOMA 2C3QA 3HVVA 2OE0A 1GTUA 2GZYA 2L4QA 3DKSA 1A8YA 3ERGA 2H74A 1AAZA 1EEMA 2LEGA 3KTBA 4E8HA 4HI7A 1ZCPA 1YY7A 2FWEA 2DSAA 4L0WA 5AIVA 5KN1A 5B6NA 4PQHA 4RQXA 5KN0A 1G0TA 4WR5A 3K8NA 2VD0A 1Z7RA 1U6TA 1JZOA 2E2MA 3L4NA 4AF2A 4TN8A 2GTUA 1VF3A 4K9ZA 4EC0A 5FWGA 5ECKB 2B7KA 5D8IA 1GSYA 5CAXA 2H72A 2KP1A 3UMAA 1XCCA 1OE8A 3A2XA 2P5RA 2DJ1A 4J56E 3QCPA 2V41A 3FZAA 3DD3A 4MH3A 1ERUA 1EZKA 2GZPA 4V1Ag 4G9HA 1GTAA 1S3CA 5H5QA 3VI7A 3EYTA 4X43A 1K0AA 2K8SA 6GSVA 3L9SA 2IMFA 4PXOA 4L5OA 4YQVA 3ME8A 5DBQA 3TJBA 4V2MA 3H4KA 2FHEA 3C8EA 1ERTA 11GSA 2FGXA 1PKZA 4EL1A 4NPBA 5A4VA 1SJIA 3KCMA 2JZSA 1TKDB 1NHYA 1K0NA 3CTFA 5B8AA 2GSQA 2FWFA 2WULA 4NMUA 2E7PA 1UVZA 3WYWA 3EE2A 3CMIA 2O89A 1GP1A 5HR0A 3GH9A 2XBIA 2VAFA 2XBQA 1EOGA 2KUCA 1CQGA 4MJCA 4EUYA 3LG6A 2XPDA 4LL4B 2JACA 2N5AA 2Z9SA 1TI1A 2CX3A 2H76A 3GTUA 3Q19A 1ERVA 4EO3A 5JWRB 4KSMA 2VL9A 3A3TA 3RDWA 4IHUA 4EXJA 3IK9A 5IMVA 4X0XA 2XHFA 1OKDA 3TKPA 1TU7A 1GNEA 3GL5A 1QXHA 1Z6MA 2HSHA 1VF4A 1JHBA 1H75A 4TKYA 1JZWA 4ULXA 3KP8A 3ZREA 5H5SA 2FD3A 1J0FA 1F2EA 5ID2A 5ECIB 3SBCA 3WGXA 4KCAA 1XW5A 5ECMB 2V6KA 4N0VA 4F03A 4NAXA 2GZZA 4GQCA 2YP6A 4E8EA 3GURA 2EIRA 1THOA 2YPMA 1EV9A 5AISA 1KBNA 3LSZA 2H1AA 1ZOFA 2O7KA 4I97A 1SYRA 3GHAA 3N9JA 4HDEA 1M0UA 4PURA 5JWQB 1XW6A 3ZIJA 3TJKA 1ZL9A 3G7JA 3P2AA 1E2YA 1W4VA 4O7HA 2N5BA 1YEPA 2B1LA 5A5KA 4LMWA 2F8FA 4OCFA 2JZRA 1DBYA 3LJRA 1VRSD 2GLRA 1XPVA 3OR5A 5EL8A 3UL3A 2PUKC 1A0RP 5L71A 3VPTA 1BAYA 1JLVA 2OJLA 3VWXA 3IA1A 1TJDA 1QMVA 2L57A 4YH2A 2R4VA 2NDOA 3F6DA 5IIZA 1KNGA 3H93A 2E0QA 1WE0A 2GS3A 3KJYA 1SKRB 5EPFA 1T4YA 2AAWA 1SL2B 4Q5FA 5IM9A 3D22A 3GH6A 3QAGA 4OFTA 1FHEA 1AW9A 3U6VA 1BYEA 3TJGA 3VPQA 3D6IA 4O5RA 3IBHA 4WETA 1HNBA 2HFDA 2XPEA 1ZMAA 3NIVA 2JU5A 4ECCA 3GFKA 2MMAA 1F37A 1GTIA 4WEYA 5GSSA 2C3NA 1FO5A 2O87A 2OADA 3DVXA 3H1NA 3KZQA 1ZZYA 5A4UA 4JU5A 3HY2A 3IK7A 2VL3A 1LJRA 1XOAA 3AY8A 3IAS2 2VCXA 4J2FA 3UAPA 3APSA 5CRGA 3ZZXA 1K0CA 4ID0A 4TXOA 3TRXA 2WB9A 4NHZA 3CXGA 1MEKA 4IKHA 3TUEA 4WBRD
chains in the Genus database with same CATH superfamily
2PVOC 1IYHA 3LORA 2G2QA 2HRNA 1XWKA 1A2JA 5BRTA 1XOBA 2HRKA 4K2DA 2OBIA 1U3AA 3HZ8A 5G5EA 2PN8A 1GSQA 4L5LA 3GYKA 2GSTA 2PWJA 5D9WA 2JADA 3GN3A 3CSIA 3FZ4A 1KEBA 2GDRA 4LL1B 4AGSA 1PD21 4JR4A 4KW6A 3LQ7A 1K0BA 2OA7A 1WMJA 4CY6A 2DLXA 4Q5NA 5HFIA 3F4RA 3LFLA 6GSTA 4IELA 3IE3A 1K3YA 1ZYPA 4NV5A 3O3TA 4HJ2A 5ID2B 2VCWA 3DXBA 2I3YA 1ML6A 3IDVA 3RPPA 3KH9A 3C71A 1U3IA 3APQA 5IPHA 1PRXA 3KXOA 4KDXA 4NWYA 2CZ3A 1T00A 2DJ3A 3TKRA 3PPUA 1B8XA 1MDIA 2K8VA 1OE7A 1FAAA 4JBBA 1VGLA 4F82A 3HCZA 12GSA 3HVNA 4RUVA 3LWAA 3CSHA 5DCHA 2GQKA 4OCEA 2V6OA 5F0GA 3G7IA 3D4TA 3KP9A 2NVLA 2R5GA 3FHKA 1EWXA 1OKTA 1PSQA 4XIHA 1PN9A 3Q18A 3L9VA 1GSEA 4LMVA 2JSYA 2TIRA 1XBSA 4BL7B 16GSA 3FZ5A 13GSA 4JRRA 1ZGNA 3TRPA 2K18A 3F63A 4QL7A 2KLXA 4IBPA 4TR0A 2JZTA 3W6GA 1X9SB 2BMXA 2YV7A 3F4TA 3WT2A 5E59A 2VL2A 1RW1A 3FZ9A 4BVYA 1GLPA 1K0MA 1MTCA 2C0EA 2C4JA 3VURA 1YKAA 3ZFLA 4BWSA 4MF7A 3M1GA 2H19A 3DIEA 3TKSA 3VWUA 1HQOA 2V1MA 5J5NA 2WJUA 3KGKA 4KF9A 4KNDA 3LGCA 4PQ1A 5F8BA 3RHBA 1GUMA 5EY6A 5HR1A 3HXSA 4ILFA 1SL1B 2YJ7A 3D4MA 4WF4A 2C3TA 1A24A 3LYKA 4F9ZA 1JZRA 20GSA 1M2AA 1FOHA 3EURA 3HYPA 5J9BA 5E4WA 2P5QA 4IW9A 3MWHA 4FQUA 4JE1A 1GRXA 4TR3A 2P0GA 4V2NA 1X5CA 6GSXA 4IGJA 5KEJA 4K7OA 2H0IA 3CQFA 1JFUA 2GT6A 1W89A 3I6AA 1GTBA 3LXTA 3UVHA 3LXZA 2VCQA 1PGTA 3BCKA 5G2ZA 1GSUA 4MZCA 1NHOA 5ENUA 2YV9A 1ST9A 5ECRB 5A4WA 1T8EB 4MF5A 4X1UA 2RUEA 3KTLA 4N30A 1FVKA 5F07A 1PL1A 1SK1A 2HLSA 2TRXA 3HZ4A 3HDCA 1SYXA 1F6MC 2L5LA 1QK8A 1UC7A 2LQQA 3FW2A 2RM6A 1EEJA 1O7UA 3ZMKA 3O76A 1WP0A 2O8VB 2H8LA 3D5JA 2DC5A 3APOA 5G1KA 1M3IA 5FT3A 2VM2A 5CYYA 2CA8A 2D2ZA 1MDKA 2ALBA 4JEDA 4HQSA 2A2SA 4N10A 4Q5QA 5G1LA 4IS0A 4EF0A 2MMZA 2PPTA 2WDUA 2CVDA 3ZRDA 1O8WA 3CRTA 1GSDA 3F0IA 2IMKA 1V58A 5DDLA 3FY7A 4WF5A 3F6FA 4FH8A 4RQRA 5IPGA 1XVWA 5EVOA 4DVCA 2VUPA 3J7Yb 1O85A 1FOVA 3L9UA 2CVBA 3FR3A 2H0GA 1SK2A 4OD7A 5J41A 2FLSA 2REMA 2LJKA 4PTSA 3UBKA 1PA3A 2QC7A 2P31A 3A5WA 2L4CA 1A2LA 3F3QA 1KTEA 2YWIA 5IQYA 1Z5YE 3D0ZA 4MCUA 1QFNA 3N5OA 4BVYB 5IOXA 4AJ6A 5CP1A 4FYCA 2WZ9A 4XRDA 3ZMLA 5IMFA 2LS5A 3QD9A 4K7NA 1T7PB 2FUG2 3E3EA 4V1Ap 2PU9C 4K0GA 3EMXA 2M72A 1TRUA 3DMLA 2YOIA 2M80A 3H8QA 1XG8A 3ZITA 3BCIA 5C04A 4ECJA 3DVWA 1K0OA 4ZL8A 1ILOA 2AJQB 2PBJA 1Z6NA 4ML6A 2C0DA 3HJOA 1Y25A 2QSIA 1M2BA 4XRAA 3FR9A 1Y6EA 1UN2A 2O85A 4I6XA 1R7HA 2CZ2A 1M2DA 2B5XA 5ECSA 1NW2A 3J7Yk 2H30A 5ELGA 2A4HA 3FYGA 2RUFA 2OE3A 4ZIJA 3RAZA 5J9CA 2I4AA 2IFQA 3GKKA 4Z2UA 2L59A 5DAKA 2WS2A 1YEXA 3IHQA 4XS4A 1R26A 1WOUA 3PINA 22GSA 3H79A 1VF2A 3ZYWA 4HS1A 4OFNA 2OACA 1T1VA 4BL7A 1YF0A 3P90A 5CRWA 18GSA 2F3MA 3HHVA 1E6BA 5DQSA 1RK4A 4ZXGA 1B4PA 2LV3A 2KOKA 4KDYA 5D93A 4ZILA 5J3RA 5CO3A 2IMEA 5GZZB 1V98A 2YWNA 4ACSA 5HR2A 2A4VA 2WFCA 3CRUA 2H66A 1B9XC 2R2JA 2VIMA 2HNLA 1MDJA 4I5QA 4TVEA 2V32A 1AQWA 4Z2RA 3F9UA 3QMXA 4DSSA 4ICYA 4AJ8A 5B6MA 5JCWA 1WIKA 3GIXA 2IL3A 3HVXA 3KMOA 1M9AA 4G19A 2VD1A 4DSQA 14GSA 2DJKA 1SD9A 3GX8A 3JCML 2C1YA 5D96A 3RBTA 2RIIA 1SD8A 5HFKA 4BWQA 5JCUA 2CVKA 3ZIVA 4MPGA 1TXXA 4G2EA 5CNWA 3ERWA 1GL8A 3DRNA 1OAZA 3VK9A 4I2UA 1BEDA 4QQ7A 2YCDA 2H0HA 2AV4A 1AIUA 2MZCA 5IMZA 3E0UA 3M0FA 2AB6A 5LCZA 3WGEA 3FR6A 5C00A 2HZFA 1SKWB 3PR8A 2B5YA 3D21A 3DYRA 2FCHA 1PQNA 3VLNA 3I43A 1TTZA 3QDNA 3L0HA 1ZYQB 4EIPA 5HR3A 2C0FA 5JWOB 1R5AA 2X99A 4O92A 4GSNA 1PX7A 2X8GA 3GA4A 2R0PA 3F3RA 4EKZA 2E2GA 1AC1A 3IAM2 5CREA 4XCSA 2CAQA 3HKRA 1AQVA 4OMVA 5GAPD 1F3AA 3GKNA 3IC8A 3TJJA 3ISOA 4YQMA 1S3DA 4OWYA 3UJ1A 10GSA 2H6ZA 2HXKA 2LRNA 1OC3A 1NSWA 1JLWA 4IP6A 4TW5A 4G10A 4KGIA 3Q6OA 4MPFA 1X9MB 1PL2A 4YQUA 2X8CA 3CBUA 4GQFA 2RM5A 4MF6A 1OVNA 1PFOA 1THXA 2H73A 2MBSA 4F0CA 5ECLB 2IMDA 1XXUA 1HNAA 2GSRA 2N5FA 1NM3A 4YAVA 1M7TA 3TKQA 3DEXA 5COHA 1EP7A 2IFQB 3HA9A 1Z3EA 2GVPA 1J08A 4PNGA 5DAKB 2ON5A 4XS4B 4F2IA 2MMNA 2F9SA 3BD2A 1QUWA 2ZNMA 4GLTA 2HE3A 4DSRA 1S3RA 3KEBA 2NTOA 2VCZA 4MMMA 1URMA 2LUSA 1TU8A 2H01A 19GSA 2EC4A 4L8EA 3MSZA 3WGDA 4IQAA 1O81A 3R3EA 2V2GA 1XWGA 3MIXA 2GQMA 2HT9A 4MJAA 3UARA 2H1DA 2B3SA 2DIYA 4CDOA 1MD4A 2B6MA 4KE3A 4MZBA 2DIZA 3TJFA 1T4ZA 2QKEA 1YKCA 1EV4A 1YF1A 5F06A 3BBYA 4K1FA 4ZB6A 1ERWA 4EDZA 2C0GA 4DSSB 4D73A 2YJHA 2PERA 3Q74A 2OKAA 2YNXA 4HOJA 2DJJA 2ZUPA 2B5EA 1JZDA 2AYTA 4RI6A 4RI7A 2C8UA 2VLVA 4LA1A 1V2AA 1GWCA 2K6VA 5B8BA 2H1BA 3WD6A 3EINA 1X0RA 2R3XA 1XW9A 1T3BA 2EIQA 2L6DA 4HZ4A 4O5QA 3UIWA 1TDIA 2K9FA 4BIKA 5ELAA 2H70A 5DVBA 1HNCA 4POBA 2JSZA 5B7CA 5IO2A 5GAND 1Z9HA 3FRCA 4JR6A 4O32A 3IRAA 1A8LA 1F9MA 3HD5A 1K3LA 2X64A 4MZWA 3HVSA 2JL4A 3G7YA 1A2MA 4ZBBA 1XIYA 2L6CA 4GF0A 1USBA 4MH2A 1O6JA 2L5OA 4BVXA 2R0CA 1Z7PA 2HYXA 4OO4A 5J4UA 5IMCA 3KIJA 2YZHA 6GSSA 1GLQA 2DMMA 4IJ3A 4PNFA 2H1GA 3W8SA 1OC9A 3I69A 17GSA 4IP1A 1DUGA 2YWOA 3CSJA 1Q98A 1FB0A 2PVQA 3GL3A 2X8HA 5D9VA 4TRXA 4MP4A 1X9WB 2XC2A 1TRWA 1DE1A 4PX1A 3UBLA 4FYUA 4ZL7A 1A0FA 4K2XA 4POMA 2PMTA 2AHEA 1F3BA 3GSTA 5ECHB 4TR4A 1QGVA 1SJ6A 1CQHA 1U88A 3CYNA 4GXZA 3MDKA 4ML1A 2GGTA 2YWMA 4DEJA 5INYA 2DJ0A 3VI5A 3ME7A 3TDGA 2H6YA 5DQYA 3QAWA 3S9FA 3KH7A 4KH7A 4PUFC 4X4JA 2GT5A 2H6XA 1K0DA 1V9WA 2QGVA 2FNOA 2A2PA 4ZB9A 4MK3A 3ZL5A 2J23A 3UEMA 2VO4A 5ABRA 3M8NA 3ZVJA 1TW9A 4ZBAA 1MD3A 2ZCTA 3GRXA 4G0KA 1EGOA 3EU3A 5FHIA 3GKMA 1G7OA 4HJMA 2QA2A 5G30A 4XS6A 1HD2A 3GKXA 3EWLA 4ZL9A 3EC3A 1PKWA 4YAPA 2VLTA 3V1WA 5ECNB 3EMPA 1U87A 4NXIA 3IC4A 3L78A 3QR6A 2CV4A 2MYGA 3DGQA 3KM6A 4D73B 2GQLA 2HI7A 4F0BA 3G9BA 4HZ2A 4PGTA 1G6YA 1V40A 1RQMA 1PX6A 4CY8A 1OC8A 2FWHA 4MABA 2LJRA 3FMWA 4HUAA 5DCGA 2R37A 3QFBC 2FY6A 4K0NA 1H4OA 3ERFA 3UVTA 4KB3A 4KA0A 1K3OA 1DE2A 4HEA2 3LEFA 3GV1A 4KAEA 4TR1A 1M99A 3TOTA 2M46A 4PUAA 2BTOT 3GSSA 5H5RA 1B9YC 2C80A 4MA9A 1XWCA 4IJIA 4JZQA 3IOSA 4O5UA 3ZFBA 2LKUA 3KMNA 1TRVA 3C73A 3NOFA 4NHWA 1PN0A 4NV2A 2VM1A 3QFAC 1LU4A 2R0GA 4K5SA 1GH2A 1R5PA 3E9JB 1GULA 1N8JA 3EVIA 1AQXA 2IJYA 1SENA 3QPMA 3TCOA 1TP9A 1GNWA 1GSSA 1M3JA 4BVXB 1BQ7A 5AN1A 3BJ5A 4ECIA 4K7IA 3GMFA 1XVQA 5D73A 1ACVA 4Z7XA 1OC9B 7GSSA 4LLRA 4WR4A 3IXRA 3SWLA 2FA8A 1GSFA 2WGRA 1BJXA 4N11A 3VWVA 3BOAA 3F8UA 3I9V2 4OO5A 4USSA 1EGRA 2NBSA 2WCIA 1FB6A 1SL0B 3ED3A 2OE1A 1O73A 3C1SA 9GSSA 3MAKA 1B4QA 1TOFA 5ECOB 1ON4A 1QQ2A 3NZNA 4QL9A 3A5IA 3R2QA 5F05A 3TGZA 2HZEA 1DSBA 4CW9A 4TOPA 3GUSA 4H86A 3TB2A 6GSYA 2CQ9A 6GSWA 1WJKA 3F4SA 2YANA 5DALA 2KHPA 2A2RA 2QA1A 5D9TA 1WPIA 4POKA 2WRTA 4OFMA 5HQPA 5CRHA 3RHCA 1X5DA 1Q4JA 4KUNA 4GRFA 1EP8A 2LSTA 4P3YB 4XS1A 1SKSB 1I5GA 4HSCX 1XWBA 1BG5A 2I9HA 1AUCA 4PQIA 1WRYA 2AUVA 2IN3A 4GWRA 2CAIA 2IWTA 1YQ1A 5BMUA 5JCGA 2F51A 4IN0A 3C7MA 1SJZA 4J57E 4EVMA 1SU9A 2B1KA 4HU9A 2DBCA 2HSYA 3A2WA 5ECPB 4I2TA 3IR4A 2J9HA 5D9XA 1FVJA 2YN1A 1WWJA 2LNSA 1LBKA 1TI3A 3GTUB 1FG4A 5IMAA 3LW9A 2LTKA 1HYUA 4G0LA 4XTSA 6GSUA 3HJMA 3LYPA 1XWAA 3IPZA 1YZXA 4ISDA 2G0FA 4IVFA 4EDYA 3PH9A 2MBTA 3EU4A 2DMLA 3FK8A 1S3AA 2I1UA 3W8JA 4K6XA 2X4AA 4K8MA 2H75A 4YKGA 1VF1A 4KDUA 8GSSA 3VWWA 3PGTA 1FW1A 1O8XA 1V57A 2VLUA 3MNGA 2FA4A 2VL2C 1ABAA 3MYDA 4I8BA 4TR1B 4V2LA 2LJAA 2H71A 2ON7A 3HJPA 3QOUA 2LQOA 5HFGA 4EE0A 4L0UA 1M9BA 3O6TA 1GUKA 5IOWA 1J9BA 2F8AA 3TKSC 5KN3A 2EIOA 4FIWA 4MDCA 2IMIA 1I9DA 4GSSA 2ES7A 1C72A 3M9KA 1GUHA 3ZLPA 2R6KA 5ECQB 4WBJA 4ZBDA 1TK0B 1X5EA 3VFIA 4Z2TA 4ECBA 4IQ1A 4GSTA 3DWVA 1YJ6A 4Q5RA 3M3MA 1PMTA 2NPBA 4MJEA 5AIXA 4BA7A 2IIYA 5DJLA 3IV4A 2LRCA 1TK8B 1R4WA 3U5RE 3TOUA 1OYJA 4BPYA 5DJMA 4FO5A 1TK5B 2TRCP 1AXDA 5LD0A 1G7EA 1XFLA 1UA5A 3P7XA 4MJBA 4MLYA 3WT1A 3P8WA 1G6WA 2YZUA 4HQZA 1A23A 5GSTA 4TXVA 2FWGA 1BX9A 4ZB8A 4HU7A 4MNNA 3GNJA 3ZVJD 2KP2A 3A2VA 4GCIA 2HRFA 2B7JA 2GSSA 3US3A 5LNKe 4N0ZA 3RPNA 1EOHA 2CT6A 2LRTA 1YDKA 2I81A 3FKFA 2HZEB 1ZYEA 1IYIA 3M9JA 5KN2A 2IPAA 2CX4A 3C1RA 5IO0A 1N2AA 1SK0A 4WKWA 4FYBA 3GX0A 3ZTLA 3TRQA 4AJ7A 3KD0A 5DALB 4KCEA 5IMDA 2BJXA 4CHSA 2OBKA 5G5FA 2VCVA 4POLA 2MMOA 1B48A 1XZOA 3EPTA 4XHMA 5G31A 3TKSE 4GTUA 2RLIA 3CTGA 5CRDA 4KSOA 2VOCA 4TXOB 2LNTA 5AGYA 1TRSA 2PGTA 3FEUA 4KX4A 2DJ2A 4WXTA 3QAVA 2VCTA 3UOMA 2C3QA 3HVVA 2OE0A 1GTUA 2GZYA 2L4QA 3DKSA 1A8YA 3ERGA 2H74A 1AAZA 1EEMA 2LEGA 3KTBA 4E8HA 4HI7A 1ZCPA 1YY7A 2FWEA 2DSAA 4L0WA 5AIVA 5KN1A 5B6NA 4PQHA 4RQXA 4G0IA 5KN0A 1G0TA 4WR5A 5KOWA 3K8NA 2VD0A 1Z7RA 1U6TA 1JZOA 2E2MA 3L4NA 4AF2A 4K5RA 4TN8A 2GTUA 1VF3A 4K9ZA 4EC0A 5FWGA 5ECKB 2B7KA 5D8IA 1GSYA 5CAXA 2H72A 2KP1A 3UMAA 1XCCA 1OE8A 2DKHA 3A2XA 2P5RA 2DJ1A 4J56E 3QCPA 2V41A 3FZAA 3DD3A 4MH3A 1ERUA 1EZKA 2GZPA 4V1Ag 4G9HA 1GTAA 1S3CA 5H5QA 3VI7A 3EYTA 4X43A 1K0AA 2K8SA 6GSVA 3L9SA 2IMFA 4PXOA 4L5OA 4YQVA 3ME8A 5DBQA 3TJBA 4V2MA 3H4KA 2FHEA 3C8EA 1ERTA 11GSA 2FGXA 1PKZA 4EL1A 4NPBA 5A4VA 1SJIA 3KCMA 2JZSA 1TKDB 1NHYA 1K0NA 3CTFA 5B8AA 2GSQA 2FWFA 2WULA 4NMUA 2E7PA 1UVZA 3WYWA 3EE2A 3CMIA 2O89A 1GP1A 5HR0A 3GH9A 2XBIA 2VAFA 3IHGA 2XBQA 1EOGA 2KUCA 1CQGA 4MJCA 4EUYA 3LG6A 2XPDA 4LL4B 2JACA 2N5AA 2Z9SA 1TI1A 2CX3A 2H76A 3GTUA 3Q19A 1ERVA 4EO3A 5JWRB 4KSMA 2VL9A 3A3TA 3RDWA 4IHUA 4EXJA 3IK9A 5IMVA 4X0XA 2XHFA 1OKDA 3TKPA 1TU7A 1GNEA 3GL5A 1QXHA 1Z6MA 2HSHA 1VF4A 1JHBA 2HSMA 1H75A 4TKYA 1JZWA 4ULXA 3KP8A 3ZREA 5H5SA 2FD3A 1J0FA 1F2EA 5ID2A 5ECIB 3SBCA 3WGXA 4KCAA 1XW5A 5ECMB 2V6KA 4N0VA 4F03A 4NAXA 2GZZA 4GQCA 2YP6A 4E8EA 3GURA 2EIRA 1THOA 2YPMA 1EV9A 5AISA 1KBNA 3LSZA 2H1AA 1ZOFA 2O7KA 4I97A 1SYRA 3GHAA 3N9JA 4HDEA 4A5PA 1M0UA 4PURA 5JWQB 1XW6A 2UZ8A 3ZIJA 3TJKA 1ZL9A 3G7JA 3P2AA 1E2YA 1W4VA 4O7HA 2N5BA 1YEPA 2B1LA 5A5KA 4LMWA 2F8FA 4OCFA 2JZRA 1DBYA 3LJRA 1VRSD 2GLRA 1XPVA 3OR5A 5EL8A 3UL3A 2PUKC 1A0RP 5L71A 2HRAA 3VPTA 1BAYA 1JLVA 2OJLA 3VWXA 3IA1A 1TJDA 1QMVA 2L57A 4YH2A 2R4VA 2NDOA 3F6DA 5IIZA 1KNGA 3H93A 2E0QA 1WE0A 2GS3A 3KJYA 1SKRB 5EPFA 1T4YA 2AAWA 1SL2B 4EIQA 4Q5FA 5IM9A 3D22A 3GH6A 3QAGA 4OFTA 1FHEA 1AW9A 3U6VA 1BYEA 3TJGA 3VPQA 3D6IA 4O5RA 3IBHA 4WETA 1HNBA 2HFDA 2XPEA 2DKIA 1ZYNA 1ZMAA 3NIVA 2JU5A 4ECCA 3GFKA 2MMAA 1F37A 1GTIA 4WEYA 5GSSA 2C3NA 1FO5A 2O87A 2OADA 3DVXA 3H1NA 3KZQA 1ZZYA 5A4UA 4JU5A 3HY2A 3IK7A 5KOXA 2VL3A 1LJRA 1XOAA 3AY8A 3IAS2 2VCXA 4J2FA 3UAPA 3APSA 5CRGA 3ZZXA 1K0CA 4ID0A 4TXOA 2X49A 3TRXA 2WB9A 4NHZA 3CXGA 1MEKA 4IKHA 3TUEA 4WBRD 4YKFA
chains in the Genus database with same CATH topology
2PVOC 1IYHA 3LORA 2G2QA 2HRNA 1XWKA 1A2JA 5BRTA 1XOBA 2HRKA 4K2DA 2OBIA 1U3AA 3HZ8A 5G5EA 2PN8A 1GSQA 4L5LA 3GYKA 2GSTA 2PWJA 5D9WA 2JADA 3GN3A 3CSIA 3FZ4A 1KEBA 2GDRA 4LL1B 4AGSA 1PD21 4JR4A 4KW6A 3LQ7A 1K0BA 2OA7A 1WMJA 4CY6A 2DLXA 4Q5NA 5HFIA 3F4RA 3LFLA 6GSTA 4IELA 3IE3A 1K3YA 1ZYPA 4NV5A 3O3TA 4HJ2A 5ID2B 2VCWA 3DXBA 2I3YA 1ML6A 3IDVA 3RPPA 3KH9A 3C71A 1U3IA 3APQA 5IPHA 1PRXA 3KXOA 4KDXA 4NWYA 2CZ3A 1T00A 2DJ3A 3TKRA 3PPUA 1B8XA 1MDIA 2K8VA 1OE7A 1FAAA 4JBBA 1VGLA 4F82A 3HCZA 12GSA 4RUVA 3LWAA 3CSHA 5DCHA 2GQKA 4OCEA 2V6OA 5F0GA 3G7IA 3D4TA 3KP9A 2NVLA 2R5GA 3FHKA 1EWXA 1OKTA 1PSQA 4XIHA 1PN9A 3Q18A 3L9VA 1GSEA 4LMVA 2JSYA 2TIRA 1XBSA 4BL7B 16GSA 3FZ5A 13GSA 4JRRA 1ZGNA 3TRPA 2K18A 3F63A 4QL7A 2KLXA 4IBPA 4TR0A 2JZTA 3W6GA 1X9SB 2BMXA 2YV7A 3F4TA 3WT2A 5E59A 2VL2A 1RW1A 3FZ9A 4BVYA 1GLPA 1K0MA 1MTCA 2C0EA 2C4JA 3VURA 1YKAA 3ZFLA 4BWSA 4MF7A 3M1GA 2H19A 3DIEA 3TKSA 3VWUA 1HQOA 2V1MA 5J5NA 2WJUA 3KGKA 4KF9A 4KNDA 3LGCA 4PQ1A 5F8BA 3RHBA 1GUMA 5EY6A 5HR1A 3HXSA 4ILFA 1SL1B 2YJ7A 3D4MA 4WF4A 2C3TA 1A24A 3LYKA 4F9ZA 1JZRA 20GSA 1M2AA 1FOHA 3EURA 3HYPA 5J9BA 5E4WA 2P5QA 4IW9A 3MWHA 4FQUA 4JE1A 1GRXA 4TR3A 2P0GA 4V2NA 1X5CA 6GSXA 4IGJA 5KEJA 4K7OA 2H0IA 1JFUA 2GT6A 1W89A 3I6AA 1GTBA 3LXTA 3UVHA 3LXZA 2VCQA 1PGTA 3BCKA 5G2ZA 1GSUA 4MZCA 1NHOA 5ENUA 2YV9A 1ST9A 5ECRB 5A4WA 1T8EB 4MF5A 4X1UA 2RUEA 3KTLA 4N30A 1FVKA 5F07A 1PL1A 1SK1A 2HLSA 2TRXA 3HZ4A 3HDCA 1SYXA 1F6MC 2L5LA 1QK8A 1UC7A 2LQQA 3FW2A 2RM6A 1EEJA 1O7UA 3ZMKA 3O76A 1WP0A 2O8VB 2H8LA 3D5JA 2DC5A 3APOA 5G1KA 5FT3A 2VM2A 5CYYA 2CA8A 2D2ZA 1MDKA 2ALBA 4JEDA 4HQSA 2A2SA 4N10A 4Q5QA 5G1LA 4IS0A 4EF0A 2MMZA 2PPTA 2WDUA 2CVDA 3ZRDA 1O8WA 3CRTA 1GSDA 3F0IA 2IMKA 1V58A 5DDLA 3FY7A 4WF5A 3F6FA 4FH8A 4RQRA 5IPGA 1XVWA 5EVOA 4DVCA 2VUPA 3J7Yb 1O85A 1FOVA 3L9UA 2CVBA 3FR3A 2H0GA 1SK2A 4OD7A 5J41A 2FLSA 2REMA 2LJKA 4PTSA 3UBKA 1PA3A 2QC7A 2P31A 3A5WA 2L4CA 1A2LA 3F3QA 1KTEA 2YWIA 5IQYA 1Z5YE 3D0ZA 4MCUA 1QFNA 3N5OA 4BVYB 5IOXA 4AJ6A 5CP1A 4FYCA 2WZ9A 4XRDA 3ZMLA 5IMFA 2LS5A 3QD9A 4K7NA 1T7PB 2FUG2 3E3EA 4V1Ap 2PU9C 4K0GA 3EMXA 2M72A 1TRUA 3DMLA 2YOIA 2M80A 3H8QA 3ZITA 3BCIA 5C04A 4ECJA 3DVWA 1K0OA 4ZL8A 1ILOA 2AJQB 2PBJA 1Z6NA 4ML6A 2C0DA 3HJOA 1Y25A 2QSIA 1M2BA 4XRAA 3FR9A 1Y6EA 1UN2A 2O85A 4I6XA 1R7HA 2CZ2A 1M2DA 2B5XA 5ECSA 1NW2A 3J7Yk 2H30A 5ELGA 2A4HA 3FYGA 2RUFA 2OE3A 4ZIJA 3RAZA 5J9CA 2I4AA 2IFQA 3GKKA 4Z2UA 2L59A 5DAKA 2WS2A 1YEXA 3IHQA 4XS4A 1R26A 1WOUA 3PINA 22GSA 3H79A 1VF2A 3ZYWA 4HS1A 4OFNA 2OACA 1T1VA 4BL7A 1YF0A 3P90A 5CRWA 18GSA 2F3MA 3HHVA 1E6BA 5DQSA 1RK4A 4ZXGA 1B4PA 2LV3A 2KOKA 4KDYA 5D93A 4ZILA 5J3RA 5CO3A 2IMEA 5GZZB 1V98A 2YWNA 4ACSA 5HR2A 2A4VA 2WFCA 3CRUA 2H66A 1B9XC 2R2JA 2VIMA 2HNLA 1MDJA 4I5QA 4TVEA 2V32A 1AQWA 4Z2RA 3F9UA 3QMXA 4DSSA 4ICYA 4AJ8A 5B6MA 5JCWA 1WIKA 3GIXA 2IL3A 3HVXA 3KMOA 1M9AA 4G19A 2VD1A 4DSQA 14GSA 2DJKA 1SD9A 3GX8A 3JCML 2C1YA 5D96A 3RBTA 2RIIA 1SD8A 5HFKA 4BWQA 5JCUA 2CVKA 3ZIVA 4MPGA 1TXXA 4G2EA 5CNWA 3ERWA 1GL8A 3DRNA 1OAZA 3VK9A 4I2UA 1BEDA 4QQ7A 2YCDA 2H0HA 2AV4A 1AIUA 2MZCA 5IMZA 3E0UA 3M0FA 2AB6A 5LCZA 3WGEA 3FR6A 5C00A 2HZFA 1SKWB 3PR8A 2B5YA 3D21A 3DYRA 2FCHA 1PQNA 3VLNA 3I43A 1TTZA 3QDNA 3L0HA 1ZYQB 4EIPA 5HR3A 2C0FA 5JWOB 1R5AA 2X99A 4O92A 4GSNA 1PX7A 2X8GA 3GA4A 2R0PA 3F3RA 4EKZA 2E2GA 1AC1A 3IAM2 5CREA 4XCSA 2CAQA 3HKRA 1AQVA 4OMVA 5GAPD 1F3AA 3GKNA 3IC8A 3TJJA 3ISOA 4YQMA 1S3DA 4OWYA 3UJ1A 10GSA 2H6ZA 2HXKA 2LRNA 1OC3A 1NSWA 1JLWA 4IP6A 4TW5A 4G10A 4KGIA 3Q6OA 4MPFA 1X9MB 1PL2A 4YQUA 2X8CA 3CBUA 4GQFA 2RM5A 4MF6A 1OVNA 1THXA 2H73A 2MBSA 4F0CA 5ECLB 2IMDA 1XXUA 1HNAA 2GSRA 2N5FA 1NM3A 4YAVA 1M7TA 3TKQA 3DEXA 5COHA 1EP7A 2IFQB 3HA9A 1Z3EA 2GVPA 1J08A 4PNGA 5DAKB 2ON5A 4XS4B 4F2IA 2MMNA 2F9SA 3BD2A 1QUWA 2ZNMA 4GLTA 2HE3A 4DSRA 3KEBA 2NTOA 2VCZA 4MMMA 1URMA 2LUSA 1TU8A 2H01A 19GSA 2EC4A 4L8EA 3MSZA 3WGDA 4IQAA 1O81A 3R3EA 2V2GA 1XWGA 3MIXA 2GQMA 2HT9A 4MJAA 3UARA 2H1DA 2B3SA 2DIYA 4CDOA 1MD4A 2B6MA 4KE3A 4MZBA 2DIZA 3TJFA 1T4ZA 2QKEA 1YKCA 1EV4A 1YF1A 5F06A 3BBYA 4K1FA 4ZB6A 1ERWA 4EDZA 2C0GA 4DSSB 4D73A 2YJHA 2PERA 3Q74A 2OKAA 2YNXA 4HOJA 2DJJA 2ZUPA 2B5EA 1JZDA 2AYTA 4RI6A 4RI7A 2C8UA 2VLVA 4LA1A 1V2AA 1GWCA 2K6VA 5B8BA 2H1BA 3WD6A 3EINA 1X0RA 2R3XA 1XW9A 1T3BA 2EIQA 2L6DA 4HZ4A 4O5QA 3UIWA 1TDIA 2K9FA 5ELAA 2H70A 5DVBA 1HNCA 4POBA 2JSZA 5B7CA 5IO2A 5GAND 1Z9HA 3FRCA 4JR6A 4O32A 3IRAA 1A8LA 1F9MA 3HD5A 1K3LA 2X64A 4MZWA 3HVSA 2JL4A 3G7YA 1A2MA 4ZBBA 1XIYA 2L6CA 4GF0A 1USBA 4MH2A 1O6JA 2L5OA 4BVXA 2R0CA 1Z7PA 2HYXA 4OO4A 5J4UA 5IMCA 3KIJA 2YZHA 6GSSA 1GLQA 2DMMA 4IJ3A 4PNFA 2H1GA 3W8SA 1OC9A 3I69A 17GSA 4IP1A 1DUGA 2YWOA 3CSJA 1Q98A 1FB0A 2PVQA 3GL3A 2X8HA 5D9VA 4TRXA 4MP4A 1X9WB 2XC2A 1TRWA 1DE1A 4PX1A 3UBLA 4FYUA 4ZL7A 1A0FA 4K2XA 4POMA 2PMTA 2AHEA 1F3BA 3GSTA 5ECHB 4TR4A 1QGVA 1SJ6A 1CQHA 1U88A 3CYNA 4GXZA 3MDKA 4ML1A 2GGTA 2YWMA 4DEJA 5INYA 2DJ0A 3VI5A 3ME7A 3TDGA 2H6YA 5DQYA 3QAWA 3S9FA 3KH7A 4KH7A 4PUFC 4X4JA 2GT5A 2H6XA 1K0DA 1V9WA 2QGVA 2FNOA 2A2PA 4ZB9A 4MK3A 3ZL5A 2J23A 3UEMA 2VO4A 5ABRA 3M8NA 3ZVJA 1TW9A 4ZBAA 1MD3A 2ZCTA 3GRXA 4G0KA 1EGOA 3EU3A 5FHIA 3GKMA 1G7OA 4HJMA 2QA2A 5G30A 4XS6A 1HD2A 3GKXA 3EWLA 4ZL9A 3EC3A 1PKWA 4YAPA 2VLTA 3V1WA 5ECNB 3EMPA 1U87A 4NXIA 3IC4A 3L78A 3QR6A 2CV4A 2MYGA 3DGQA 3KM6A 4D73B 2GQLA 2HI7A 4F0BA 3G9BA 4HZ2A 4PGTA 1G6YA 1V40A 1RQMA 1PX6A 4CY8A 1OC8A 2FWHA 4MABA 2LJRA 3FMWA 4HUAA 5DCGA 2R37A 3QFBC 2FY6A 4K0NA 1H4OA 3ERFA 3UVTA 4KB3A 4KA0A 1K3OA 1DE2A 4HEA2 3LEFA 3GV1A 4KAEA 4TR1A 1M99A 3TOTA 2M46A 4PUAA 2BTOT 3GSSA 5H5RA 1B9YC 2C80A 4MA9A 1XWCA 4IJIA 4JZQA 3IOSA 4O5UA 3ZFBA 2LKUA 3KMNA 1TRVA 3C73A 3NOFA 4NHWA 1PN0A 4NV2A 2VM1A 3QFAC 1LU4A 2R0GA 4K5SA 1GH2A 1R5PA 3E9JB 1GULA 1N8JA 3EVIA 1AQXA 2IJYA 1SENA 3QPMA 3TCOA 1TP9A 1GNWA 1GSSA 4BVXB 1BQ7A 5AN1A 3BJ5A 4ECIA 4K7IA 3GMFA 1XVQA 5D73A 1ACVA 4Z7XA 1OC9B 7GSSA 4LLRA 4WR4A 3IXRA 3SWLA 2FA8A 1GSFA 2WGRA 1BJXA 4N11A 3VWVA 3BOAA 3F8UA 3I9V2 4OO5A 4USSA 1EGRA 2NBSA 2WCIA 1FB6A 1SL0B 3ED3A 2OE1A 1O73A 3C1SA 9GSSA 3MAKA 1B4QA 1TOFA 5ECOB 1ON4A 1QQ2A 3NZNA 4QL9A 3A5IA 3R2QA 5F05A 3TGZA 2HZEA 1DSBA 4CW9A 4TOPA 3GUSA 4H86A 3TB2A 6GSYA 2CQ9A 6GSWA 1WJKA 3F4SA 2YANA 5DALA 2KHPA 2A2RA 2QA1A 5D9TA 1WPIA 4POKA 2WRTA 4OFMA 5HQPA 5CRHA 3RHCA 1X5DA 1Q4JA 4KUNA 4GRFA 1EP8A 2LSTA 4P3YB 4XS1A 1SKSB 1I5GA 1XWBA 1BG5A 2I9HA 1AUCA 4PQIA 1WRYA 2AUVA 2IN3A 4GWRA 2CAIA 2IWTA 1YQ1A 5BMUA 5JCGA 2F51A 4IN0A 3C7MA 1SJZA 4J57E 4EVMA 1SU9A 2B1KA 4HU9A 2DBCA 2HSYA 3A2WA 5ECPB 4I2TA 3IR4A 2J9HA 5D9XA 1FVJA 2YN1A 1WWJA 2LNSA 1LBKA 1TI3A 3GTUB 1FG4A 5IMAA 3LW9A 2LTKA 1HYUA 4G0LA 4XTSA 6GSUA 3HJMA 3LYPA 1XWAA 3IPZA 1YZXA 4ISDA 2G0FA 4IVFA 4EDYA 3PH9A 2MBTA 3EU4A 2DMLA 3FK8A 1S3AA 2I1UA 3W8JA 4K6XA 2X4AA 4K8MA 2H75A 4YKGA 1VF1A 4KDUA 8GSSA 3VWWA 3PGTA 1FW1A 1O8XA 1V57A 2VLUA 3MNGA 2FA4A 2VL2C 1ABAA 3MYDA 4I8BA 4TR1B 4V2LA 2LJAA 2H71A 2ON7A 3HJPA 3QOUA 2LQOA 5HFGA 4EE0A 4L0UA 1M9BA 3O6TA 1GUKA 5IOWA 1J9BA 2F8AA 3TKSC 5KN3A 2EIOA 4FIWA 4MDCA 2IMIA 1I9DA 4GSSA 2ES7A 1C72A 3M9KA 1GUHA 3ZLPA 2R6KA 5ECQB 4WBJA 4ZBDA 1TK0B 1X5EA 3VFIA 4Z2TA 4ECBA 4IQ1A 4GSTA 3DWVA 1YJ6A 4Q5RA 3M3MA 1PMTA 2NPBA 4MJEA 5AIXA 4BA7A 2IIYA 5DJLA 3IV4A 2LRCA 1TK8B 1R4WA 3U5RE 3TOUA 1OYJA 4BPYA 5DJMA 4FO5A 1TK5B 2TRCP 1AXDA 5LD0A 1G7EA 1XFLA 1UA5A 3P7XA 4MJBA 4MLYA 3WT1A 3P8WA 1G6WA 2YZUA 4HQZA 1A23A 5GSTA 4TXVA 2FWGA 1BX9A 4ZB8A 4HU7A 4MNNA 3GNJA 3ZVJD 2KP2A 3A2VA 4GCIA 2HRFA 2B7JA 2GSSA 3US3A 5LNKe 4N0ZA 3RPNA 1EOHA 2CT6A 2LRTA 1YDKA 2I81A 3FKFA 2HZEB 1ZYEA 1IYIA 3M9JA 5KN2A 2IPAA 2CX4A 3C1RA 5IO0A 1N2AA 1SK0A 4WKWA 4FYBA 3GX0A 3ZTLA 3TRQA 4AJ7A 3KD0A 5DALB 4KCEA 5IMDA 2BJXA 4CHSA 2OBKA 5G5FA 2VCVA 4POLA 2MMOA 1B48A 1XZOA 3EPTA 4XHMA 5G31A 3TKSE 4GTUA 2RLIA 3CTGA 5CRDA 4KSOA 2VOCA 4TXOB 2LNTA 5AGYA 1TRSA 2PGTA 3FEUA 4KX4A 2DJ2A 4WXTA 3QAVA 2VCTA 3UOMA 2C3QA 3HVVA 2OE0A 1GTUA 2GZYA 2L4QA 3DKSA 1A8YA 3ERGA 2H74A 1AAZA 1EEMA 2LEGA 3KTBA 4E8HA 4HI7A 1ZCPA 1YY7A 2FWEA 2DSAA 4L0WA 5AIVA 5KN1A 5B6NA 4PQHA 4RQXA 4G0IA 5KN0A 1G0TA 4WR5A 5KOWA 3K8NA 2VD0A 1Z7RA 1U6TA 1JZOA 2E2MA 3L4NA 4AF2A 4K5RA 4TN8A 2GTUA 1VF3A 4K9ZA 4EC0A 5FWGA 5ECKB 2B7KA 5D8IA 1GSYA 5CAXA 2H72A 2KP1A 3UMAA 1XCCA 1OE8A 2DKHA 3A2XA 2P5RA 2DJ1A 4J56E 3QCPA 2V41A 3FZAA 3DD3A 4MH3A 1ERUA 1EZKA 2GZPA 4V1Ag 4G9HA 1GTAA 1S3CA 5H5QA 3VI7A 3EYTA 4X43A 1K0AA 2K8SA 6GSVA 3L9SA 2IMFA 4PXOA 4L5OA 4YQVA 3ME8A 5DBQA 3TJBA 4V2MA 3H4KA 2FHEA 3C8EA 1ERTA 11GSA 2FGXA 1PKZA 4EL1A 4NPBA 5A4VA 1SJIA 3KCMA 2JZSA 1TKDB 1NHYA 1K0NA 3CTFA 5B8AA 2GSQA 2FWFA 2WULA 4NMUA 2E7PA 1UVZA 3WYWA 3EE2A 3CMIA 2O89A 1GP1A 5HR0A 3GH9A 2XBIA 2VAFA 3IHGA 2XBQA 1EOGA 2KUCA 1CQGA 4MJCA 4EUYA 3LG6A 2XPDA 4LL4B 2JACA 2N5AA 2Z9SA 1TI1A 2CX3A 2H76A 3GTUA 3Q19A 1ERVA 4EO3A 5JWRB 4KSMA 2VL9A 3A3TA 3RDWA 4IHUA 4EXJA 3IK9A 5IMVA 4X0XA 2XHFA 1OKDA 3TKPA 1TU7A 1GNEA 3GL5A 1QXHA 1Z6MA 2HSHA 1VF4A 1JHBA 2HSMA 1H75A 4TKYA 1JZWA 4ULXA 3KP8A 3ZREA 5H5SA 2FD3A 1J0FA 1F2EA 5ID2A 5ECIB 3SBCA 3WGXA 4KCAA 1XW5A 5ECMB 2V6KA 4N0VA 4F03A 4NAXA 2GZZA 4GQCA 2YP6A 4E8EA 3GURA 2EIRA 1THOA 2YPMA 1EV9A 5AISA 1KBNA 3LSZA 2H1AA 1ZOFA 2O7KA 4I97A 1SYRA 3GHAA 3N9JA 4HDEA 4A5PA 1M0UA 4PURA 5JWQB 1XW6A 2UZ8A 3ZIJA 3TJKA 1ZL9A 3G7JA 3P2AA 1E2YA 1W4VA 4O7HA 2N5BA 1YEPA 2B1LA 5A5KA 4LMWA 2F8FA 4OCFA 2JZRA 1DBYA 3LJRA 1VRSD 2GLRA 1XPVA 3OR5A 5EL8A 3UL3A 2PUKC 1A0RP 5L71A 2HRAA 3VPTA 1BAYA 1JLVA 2OJLA 3VWXA 3IA1A 1TJDA 1QMVA 2L57A 4YH2A 2R4VA 2NDOA 3F6DA 5IIZA 1KNGA 3H93A 2E0QA 1WE0A 2GS3A 3KJYA 1SKRB 5EPFA 1T4YA 2AAWA 1SL2B 4EIQA 4Q5FA 5IM9A 3D22A 3GH6A 3QAGA 4OFTA 1FHEA 1AW9A 3U6VA 1BYEA 3TJGA 3VPQA 3D6IA 4O5RA 3IBHA 4WETA 1HNBA 2HFDA 2XPEA 2DKIA 1ZYNA 1ZMAA 3NIVA 2JU5A 4ECCA 3GFKA 2MMAA 1F37A 1GTIA 4WEYA 5GSSA 2C3NA 1FO5A 2O87A 2OADA 3DVXA 3H1NA 3KZQA 1ZZYA 5A4UA 4JU5A 3HY2A 3IK7A 5KOXA 2VL3A 1LJRA 1XOAA 3AY8A 3IAS2 2VCXA 4J2FA 3UAPA 3APSA 5CRGA 3ZZXA 1K0CA 4ID0A 4TXOA 2X49A 3TRXA 2WB9A 4NHZA 3CXGA 1MEKA 4IKHA 3TUEA 4WBRD 4YKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVO C;  1IYH A;  3LOR A;  2G2Q A;  2HRN A;  1XWK A;  1A2J A;  1XOB A;  4K2D A;  2OBI A;  1U3A A;  3HZ8 A;  5G5E A;  2PN8 A;  1GSQ A;  4L5L A;  3GYK A;  2GST A;  2PWJ A;  5D9W A;  2JAD A;  3GN3 A;  3CSI A;  3FZ4 A;  1KEB A;  2GDR A;  4LL1 B;  4AGS A;  1PD2 1;  4JR4 A;  4KW6 A;  3LQ7 A;  1K0B A;  2OA7 A;  1WMJ A;  2DLX A;  4Q5N A;  5HFI A;  3F4R A;  3LFL A;  6GST A;  4IEL A;  3IE3 A;  1K3Y A;  4NV5 A;  3O3T A;  4HJ2 A;  5ID2 B;  2VCW A;  3DXB A;  2I3Y A;  1ML6 A;  3IDV A;  3RPP A;  3KH9 A;  3C71 A;  1U3I A;  3APQ A;  5IPH A;  1PRX A;  3KXO A;  4KDX A;  4NWY A;  2CZ3 A;  1T00 A;  2DJ3 A;  3TKR A;  1B8X A;  1MDI A;  2K8V A;  1OE7 A;  1FAA A;  4JBB A;  1VGL A;  4F82 A;  3HCZ A;  12GS A;  4RUV A;  3LWA A;  3CSH A;  5DCH A;  2GQK A;  4OCE A;  2V6O A;  5F0G A;  3G7I A;  3D4T A;  3KP9 A;  2NVL A;  2R5G A;  3FHK A;  1EWX A;  1OKT A;  1PSQ A;  4XIH A;  1PN9 A;  3Q18 A;  3L9V A;  1GSE A;  4LMV A;  2JSY A;  2TIR A;  1XBS A;  16GS A;  3FZ5 A;  13GS A;  4JRR A;  1ZGN A;  3TRP A;  2K18 A;  3F63 A;  4QL7 A;  2KLX A;  4IBP A;  4TR0 A;  2JZT A;  3W6G A;  1X9S B;  2BMX A;  2YV7 A;  3F4T A;  3WT2 A;  5E59 A;  2VL2 A;  1RW1 A;  3FZ9 A;  4BVY A;  1GLP A;  1K0M A;  1MTC A;  2C0E A;  2C4J A;  3VUR A;  1YKA A;  3ZFL A;  4BWS A;  4MF7 A;  3M1G A;  2H19 A;  3DIE A;  3TKS A;  3VWU A;  1HQO A;  2V1M A;  5J5N A;  2WJU A;  3KGK A;  4KND A;  3LGC A;  4PQ1 A;  5F8B A;  3RHB A;  1GUM A;  5EY6 A;  5HR1 A;  3HXS A;  4ILF A;  1SL1 B;  2YJ7 A;  3D4M A;  4WF4 A;  2C3T A;  1A24 A;  3LYK A;  4F9Z A;  1JZR A;  20GS A;  1M2A A;  3EUR A;  3HYP A;  5J9B A;  5E4W A;  2P5Q A;  4IW9 A;  3MWH A;  4JE1 A;  1GRX A;  4TR3 A;  2P0G A;  4V2N A;  1X5C A;  6GSX A;  4IGJ A;  5KEJ A;  4K7O A;  2H0I A;  1JFU A;  2GT6 A;  1W89 A;  3I6A A;  1GTB A;  3LXT A;  3UVH A;  3LXZ A;  2VCQ A;  1PGT A;  3BCK A;  5G2Z A;  1GSU A;  4MZC A;  1NHO A;  5ENU A;  2YV9 A;  1ST9 A;  5ECR B;  5A4W A;  1T8E B;  4MF5 A;  4X1U A;  2RUE A;  3KTL A;  4N30 A;  1FVK A;  5F07 A;  1PL1 A;  1SK1 A;  2HLS A;  2TRX A;  3HZ4 A;  3HDC A;  1SYX A;  1F6M C;  2L5L A;  1QK8 A;  1UC7 A;  2LQQ A;  3FW2 A;  2RM6 A;  1EEJ A;  1O7U A;  3ZMK A;  3O76 A;  1WP0 A;  2O8V B;  2H8L A;  3D5J A;  2DC5 A;  3APO A;  5G1K A;  5FT3 A;  2VM2 A;  5CYY A;  2CA8 A;  2D2Z A;  1MDK A;  2ALB A;  4JED A;  4HQS A;  2A2S A;  4N10 A;  4Q5Q A;  5G1L A;  4IS0 A;  4EF0 A;  2MMZ A;  2PPT A;  2WDU A;  2CVD A;  3ZRD A;  1O8W A;  3CRT A;  1GSD A;  3F0I A;  2IMK A;  1V58 A;  5DDL A;  3FY7 A;  4WF5 A;  3F6F A;  4FH8 A;  4RQR A;  5IPG A;  1XVW A;  5EVO A;  4DVC A;  2VUP A;  3J7Y b;  1O85 A;  1FOV A;  3L9U A;  2CVB A;  3FR3 A;  2H0G A;  1SK2 A;  4OD7 A;  5J41 A;  2FLS A;  2REM A;  2LJK A;  3UBK A;  1PA3 A;  2QC7 A;  2P31 A;  3A5W A;  2L4C A;  1A2L A;  3F3Q A;  1KTE A;  2YWI A;  5IQY A;  1Z5Y E;  3D0Z A;  4MCU A;  1QFN A;  3N5O A;  5IOX A;  4AJ6 A;  5CP1 A;  4FYC A;  2WZ9 A;  4XRD A;  3ZML A;  5IMF A;  2LS5 A;  3QD9 A;  4K7N A;  1T7P B;  2FUG 2;  3E3E A;  4V1A p;  2PU9 C;  4K0G A;  3EMX A;  2M72 A;  1TRU A;  3DML A;  2YOI A;  2M80 A;  3H8Q A;  3ZIT A;  3BCI A;  5C04 A;  4ECJ A;  3DVW A;  1K0O A;  4ZL8 A;  1ILO A;  2AJQ B;  2PBJ A;  1Z6N A;  4ML6 A;  2C0D A;  3HJO A;  1Y25 A;  2QSI A;  1M2B A;  4XRA A;  3FR9 A;  1Y6E A;  1UN2 A;  2O85 A;  4I6X A;  1R7H A;  2CZ2 A;  1M2D A;  2B5X A;  5ECS A;  1NW2 A;  3J7Y k;  2H30 A;  5ELG A;  3FYG A;  2RUF A;  2OE3 A;  4ZIJ A;  3RAZ A;  5J9C A;  2I4A A;  2IFQ A;  3GKK A;  2L59 A;  5DAK A;  2WS2 A;  1YEX A;  3IHQ A;  4XS4 A;  1R26 A;  1WOU A;  3PIN A;  22GS A;  3H79 A;  1VF2 A;  3ZYW A;  4HS1 A;  4OFN A;  2OAC A;  1T1V A;  4BL7 A;  1YF0 A;  3P90 A;  5CRW A;  18GS A;  2F3M A;  3HHV A;  1E6B A;  5DQS A;  1RK4 A;  4ZXG A;  1B4P A;  2LV3 A;  2KOK A;  4KDY A;  5D93 A;  4ZIL A;  5J3R A;  5CO3 A;  2IME A;  5GZZ B;  1V98 A;  2YWN A;  4ACS A;  5HR2 A;  2A4V A;  2WFC A;  3CRU A;  2H66 A;  1B9X C;  2R2J A;  2VIM A;  2HNL A;  1MDJ A;  4I5Q A;  4TVE A;  2V32 A;  1AQW A;  3F9U A;  3QMX A;  4DSS A;  4AJ8 A;  5B6M A;  5JCW A;  1WIK A;  3GIX A;  2IL3 A;  3HVX A;  3KMO A;  1M9A A;  4G19 A;  2VD1 A;  4DSQ A;  14GS A;  2DJK A;  1SD9 A;  3GX8 A;  3JCM L;  2C1Y A;  5D96 A;  3RBT A;  2RII A;  1SD8 A;  5HFK A;  4BWQ A;  5JCU A;  2CVK A;  3ZIV A;  4MPG A;  1TXX A;  4G2E A;  5CNW A;  3ERW A;  1GL8 A;  3DRN A;  1OAZ A;  3VK9 A;  4I2U A;  1BED A;  4QQ7 A;  2YCD A;  2H0H A;  2AV4 A;  1AIU A;  2MZC A;  5IMZ A;  3E0U A;  3M0F A;  2AB6 A;  5LCZ A;  3WGE A;  3FR6 A;  5C00 A;  2HZF A;  1SKW B;  3PR8 A;  2B5Y A;  3D21 A;  3DYR A;  2FCH A;  1PQN A;  3VLN A;  3I43 A;  1TTZ A;  3QDN A;  3L0H A;  1ZYQ B;  5HR3 A;  2C0F A;  5JWO B;  1R5A A;  2X99 A;  4O92 A;  4GSN A;  1PX7 A;  2X8G A;  3GA4 A;  3F3R A;  4EKZ A;  2E2G A;  1AC1 A;  3IAM 2;  5CRE A;  4XCS A;  2CAQ A;  3HKR A;  1AQV A;  4OMV A;  5GAP D;  1F3A A;  3GKN A;  3TJJ A;  3ISO A;  4YQM A;  1S3D A;  4OWY A;  3UJ1 A;  10GS A;  2H6Z A;  2HXK A;  2LRN A;  1OC3 A;  1NSW A;  1JLW A;  4IP6 A;  4TW5 A;  4G10 A;  4KGI A;  3Q6O A;  4MPF A;  1X9M B;  1PL2 A;  4YQU A;  2X8C A;  3CBU A;  4GQF A;  2RM5 A;  4MF6 A;  1OVN A;  1THX A;  2H73 A;  2MBS A;  4F0C A;  5ECL B;  2IMD A;  1XXU A;  1HNA A;  2GSR A;  2N5F A;  1NM3 A;  4YAV A;  1M7T A;  3TKQ A;  3DEX A;  5COH A;  1EP7 A;  2IFQ B;  3HA9 A;  1Z3E A;  2GVP A;  1J08 A;  4PNG A;  5DAK B;  2ON5 A;  4XS4 B;  4F2I A;  2MMN A;  2F9S A;  3BD2 A;  1QUW A;  2ZNM A;  4GLT A;  2HE3 A;  4DSR A;  3KEB A;  2NTO A;  2VCZ A;  4MMM A;  1URM A;  2LUS A;  1TU8 A;  2H01 A;  19GS A;  2EC4 A;  4L8E A;  3MSZ A;  3WGD A;  4IQA A;  1O81 A;  2V2G A;  1XWG A;  2GQM A;  2HT9 A;  4MJA A;  3UAR A;  2H1D A;  2B3S A;  2DIY A;  4CDO A;  1MD4 A;  2B6M A;  4KE3 A;  4MZB A;  2DIZ A;  3TJF A;  1T4Z A;  2QKE A;  1YKC A;  1EV4 A;  1YF1 A;  5F06 A;  3BBY A;  4K1F A;  4ZB6 A;  1ERW A;  4EDZ A;  2C0G A;  4DSS B;  4D73 A;  2YJH A;  2PER A;  3Q74 A;  2OKA A;  2YNX A;  4HOJ A;  2DJJ A;  2ZUP A;  2B5E A;  1JZD A;  2AYT A;  4RI6 A;  4RI7 A;  2C8U A;  2VLV A;  4LA1 A;  1V2A A;  1GWC A;  2K6V A;  5B8B A;  2H1B A;  3WD6 A;  3EIN A;  1X0R A;  2R3X A;  1XW9 A;  1T3B A;  2EIQ A;  2L6D A;  4HZ4 A;  3UIW A;  1TDI A;  2K9F A;  5ELA A;  2H70 A;  5DVB A;  1HNC A;  4POB A;  2JSZ A;  5B7C A;  5IO2 A;  5GAN D;  1Z9H A;  3FRC A;  4JR6 A;  4O32 A;  3IRA A;  1A8L A;  1F9M A;  3HD5 A;  1K3L A;  2X64 A;  4MZW A;  3HVS A;  2JL4 A;  3G7Y A;  1A2M A;  4ZBB A;  1XIY A;  2L6C A;  4GF0 A;  1USB A;  4MH2 A;  1O6J A;  2L5O A;  4BVX A;  1Z7P A;  2HYX A;  4OO4 A;  5J4U A;  5IMC A;  3KIJ A;  2YZH A;  6GSS A;  1GLQ A;  2DMM A;  4IJ3 A;  4PNF A;  2H1G A;  3W8S A;  1OC9 A;  3I69 A;  17GS A;  4IP1 A;  1DUG A;  2YWO A;  3CSJ A;  1Q98 A;  1FB0 A;  2PVQ A;  3GL3 A;  2X8H A;  5D9V A;  4TRX A;  4MP4 A;  1X9W B;  2XC2 A;  1TRW A;  1DE1 A;  4PX1 A;  3UBL A;  4FYU A;  4ZL7 A;  1A0F A;  4POM A;  2PMT A;  2AHE A;  1F3B A;  3GST A;  5ECH B;  4TR4 A;  1QGV A;  1SJ6 A;  1CQH A;  1U88 A;  3CYN A;  4GXZ A;  3MDK A;  4ML1 A;  2GGT A;  2YWM A;  4DEJ A;  5INY A;  2DJ0 A;  3VI5 A;  3ME7 A;  3TDG A;  2H6Y A;  5DQY A;  3QAW A;  3S9F A;  3KH7 A;  4KH7 A;  4PUF C;  2GT5 A;  2H6X A;  1K0D A;  1V9W A;  2QGV A;  2FNO A;  4ZB9 A;  4MK3 A;  3ZL5 A;  2J23 A;  3UEM A;  2VO4 A;  5ABR A;  3M8N A;  3ZVJ A;  1TW9 A;  4ZBA A;  1MD3 A;  2ZCT A;  3GRX A;  1EGO A;  3EU3 A;  5FHI A;  3GKM A;  1G7O A;  4HJM A;  5G30 A;  4XS6 A;  1HD2 A;  3GKX A;  3EWL A;  4ZL9 A;  3EC3 A;  1PKW A;  4YAP A;  2VLT A;  3V1W A;  5ECN B;  3EMP A;  1U87 A;  4NXI A;  3IC4 A;  3L78 A;  3QR6 A;  2CV4 A;  2MYG A;  3DGQ A;  3KM6 A;  4D73 B;  2GQL A;  2HI7 A;  4F0B A;  3G9B A;  4HZ2 A;  4PGT A;  1G6Y A;  1V40 A;  1RQM A;  1PX6 A;  1OC8 A;  2FWH A;  4MAB A;  2LJR A;  4HUA A;  5DCG A;  2R37 A;  3QFB C;  2FY6 A;  4K0N A;  1H4O A;  3ERF A;  3UVT A;  4KB3 A;  4KA0 A;  1K3O A;  1DE2 A;  4HEA 2;  3LEF A;  3GV1 A;  4KAE A;  4TR1 A;  1M99 A;  3TOT A;  2M46 A;  4PUA A;  2BTO T;  3GSS A;  5H5R A;  1B9Y C;  2C80 A;  4MA9 A;  1XWC A;  4IJI A;  4JZQ A;  3IOS A;  3ZFB A;  2LKU A;  3KMN A;  1TRV A;  3C73 A;  3NOF A;  4NHW A;  4NV2 A;  2VM1 A;  3QFA C;  1LU4 A;  1GH2 A;  1R5P A;  3E9J B;  1GUL A;  1N8J A;  3EVI A;  1AQX A;  2IJY A;  1SEN A;  3QPM A;  3TCO A;  1TP9 A;  1GNW A;  1GSS A;  1BQ7 A;  5AN1 A;  3BJ5 A;  4ECI A;  4K7I A;  3GMF A;  1XVQ A;  5D73 A;  1ACV A;  4Z7X A;  1OC9 B;  7GSS A;  4LLR A;  4WR4 A;  3IXR A;  3SWL A;  2FA8 A;  1GSF A;  2WGR A;  1BJX A;  4N11 A;  3VWV A;  3BOA A;  3F8U A;  3I9V 2;  4OO5 A;  1EGR A;  2NBS A;  2WCI A;  1FB6 A;  1SL0 B;  3ED3 A;  2OE1 A;  1O73 A;  3C1S A;  9GSS A;  3MAK A;  1B4Q A;  1TOF A;  5ECO B;  1ON4 A;  1QQ2 A;  3NZN A;  4QL9 A;  3R2Q A;  5F05 A;  3TGZ A;  2HZE A;  1DSB A;  4CW9 A;  4TOP A;  3GUS A;  4H86 A;  3TB2 A;  6GSY A;  2CQ9 A;  6GSW A;  1WJK A;  3F4S A;  2YAN A;  5DAL A;  2KHP A;  2A2R A;  5D9T A;  1WPI A;  4POK A;  2WRT A;  4OFM A;  5HQP A;  5CRH A;  3RHC A;  1X5D A;  1Q4J A;  4KUN A;  4GRF A;  1EP8 A;  2LST A;  4P3Y B;  4XS1 A;  1SKS B;  1I5G A;  1XWB A;  1BG5 A;  2I9H A;  1AUC A;  4PQI A;  1WRY A;  2AUV A;  2IN3 A;  4GWR A;  2CAI A;  2IWT A;  1YQ1 A;  5JCG A;  2F51 A;  4IN0 A;  3C7M A;  1SJZ A;  4J57 E;  4EVM A;  1SU9 A;  2B1K A;  4HU9 A;  2DBC A;  2HSY A;  3A2W A;  5ECP B;  4I2T A;  3IR4 A;  2J9H A;  5D9X A;  1FVJ A;  2YN1 A;  1WWJ A;  2LNS A;  1LBK A;  1TI3 A;  3GTU B;  1FG4 A;  5IMA A;  2LTK A;  1HYU A;  4XTS A;  6GSU A;  3HJM A;  3LYP A;  1XWA A;  3IPZ A;  1YZX A;  4ISD A;  2G0F A;  4IVF A;  4EDY A;  3PH9 A;  2MBT A;  3EU4 A;  2DML A;  3FK8 A;  1S3A A;  2I1U A;  3W8J A;  4K6X A;  4K8M A;  2H75 A;  1VF1 A;  4KDU A;  8GSS A;  3VWW A;  3PGT A;  1FW1 A;  1O8X A;  1V57 A;  2VLU A;  3MNG A;  2FA4 A;  2VL2 C;  1ABA A;  4I8B A;  4TR1 B;  4V2L A;  2LJA A;  2H71 A;  2ON7 A;  3HJP A;  3QOU A;  2LQO A;  5HFG A;  4EE0 A;  4L0U A;  1M9B A;  3O6T A;  1GUK A;  5IOW A;  1J9B A;  2F8A A;  3TKS C;  5KN3 A;  2EIO A;  4FIW A;  4MDC A;  2IMI A;  1I9D A;  4GSS A;  2ES7 A;  1C72 A;  3M9K A;  1GUH A;  3ZLP A;  2R6K A;  5ECQ B;  4WBJ A;  4ZBD A;  1TK0 B;  1X5E A;  3VFI A;  4ECB A;  4IQ1 A;  4GST A;  3DWV A;  1YJ6 A;  4Q5R A;  3M3M A;  1PMT A;  2NPB A;  4MJE A;  5AIX A;  4BA7 A;  2IIY A;  5DJL A;  3IV4 A;  2LRC A;  1TK8 B;  1R4W A;  3U5R E;  3TOU A;  1OYJ A;  4BPY A;  5DJM A;  4FO5 A;  1TK5 B;  2TRC P;  1AXD A;  5LD0 A;  1G7E A;  1XFL A;  1UA5 A;  3P7X A;  4MJB A;  4MLY A;  3WT1 A;  3P8W A;  1G6W A;  2YZU A;  4HQZ A;  1A23 A;  5GST A;  4TXV A;  2FWG A;  1BX9 A;  4ZB8 A;  4HU7 A;  3GNJ A;  3ZVJ D;  2KP2 A;  3A2V A;  4GCI A;  2HRF A;  2B7J A;  2GSS A;  3US3 A;  5LNK e;  4N0Z A;  3RPN A;  1EOH A;  2CT6 A;  2LRT A;  1YDK A;  2I81 A;  3FKF A;  2HZE B;  1ZYE A;  1IYI A;  3M9J A;  5KN2 A;  2IPA A;  2CX4 A;  3C1R A;  5IO0 A;  1N2A A;  1SK0 A;  4WKW A;  4FYB A;  3GX0 A;  3ZTL A;  3TRQ A;  4AJ7 A;  3KD0 A;  5DAL B;  4KCE A;  5IMD A;  2BJX A;  4CHS A;  2OBK A;  5G5F A;  2VCV A;  4POL A;  2MMO A;  1B48 A;  1XZO A;  4XHM A;  5G31 A;  3TKS E;  4GTU A;  2RLI A;  3CTG A;  5CRD A;  4KSO A;  2VOC A;  4TXO B;  2LNT A;  5AGY A;  1TRS A;  2PGT A;  3FEU A;  4KX4 A;  2DJ2 A;  4WXT A;  3QAV A;  2VCT A;  3UOM A;  2C3Q A;  3HVV A;  2OE0 A;  1GTU A;  2GZY A;  2L4Q A;  3DKS A;  1A8Y A;  3ERG A;  2H74 A;  1AAZ A;  1EEM A;  2LEG A;  3KTB A;  4E8H A;  4HI7 A;  1ZCP A;  1YY7 A;  2FWE A;  2DSA A;  4L0W A;  5AIV A;  5KN1 A;  5B6N A;  4PQH A;  4RQX A;  5KN0 A;  1G0T A;  4WR5 A;  3K8N A;  2VD0 A;  1Z7R A;  1U6T A;  1JZO A;  2E2M A;  3L4N A;  4AF2 A;  4TN8 A;  2GTU A;  1VF3 A;  4K9Z A;  4EC0 A;  5FWG A;  5ECK B;  2B7K A;  5D8I A;  1GSY A;  5CAX A;  2H72 A;  2KP1 A;  3UMA A;  1XCC A;  1OE8 A;  3A2X A;  2P5R A;  2DJ1 A;  4J56 E;  3QCP A;  2V41 A;  3FZA A;  3DD3 A;  4MH3 A;  1ERU A;  1EZK A;  2GZP A;  4V1A g;  4G9H A;  1GTA A;  1S3C A;  5H5Q A;  3VI7 A;  3EYT A;  4X43 A;  1K0A A;  2K8S A;  6GSV A;  3L9S A;  2IMF A;  4PXO A;  4L5O A;  4YQV A;  3ME8 A;  5DBQ A;  3TJB A;  4V2M A;  3H4K A;  2FHE A;  3C8E A;  1ERT A;  11GS A;  2FGX A;  1PKZ A;  4EL1 A;  4NPB A;  5A4V A;  1SJI A;  3KCM A;  2JZS A;  1TKD B;  1NHY A;  1K0N A;  3CTF A;  5B8A A;  2GSQ A;  2FWF A;  2WUL A;  4NMU A;  2E7P A;  1UVZ A;  3WYW A;  3EE2 A;  3CMI A;  2O89 A;  1GP1 A;  5HR0 A;  3GH9 A;  2XBI A;  2VAF A;  2XBQ A;  1EOG A;  2KUC A;  1CQG A;  4MJC A;  4EUY A;  3LG6 A;  2XPD A;  4LL4 B;  2JAC A;  2N5A A;  2Z9S A;  1TI1 A;  2CX3 A;  2H76 A;  3GTU A;  3Q19 A;  1ERV A;  4EO3 A;  5JWR B;  4KSM A;  2VL9 A;  3A3T A;  3RDW A;  4IHU A;  4EXJ A;  3IK9 A;  5IMV A;  4X0X A;  2XHF A;  1OKD A;  3TKP A;  1TU7 A;  1GNE A;  3GL5 A;  1QXH A;  1Z6M A;  2HSH A;  1VF4 A;  1JHB A;  1H75 A;  4TKY A;  1JZW A;  4ULX A;  3KP8 A;  3ZRE A;  5H5S A;  2FD3 A;  1J0F A;  1F2E A;  5ID2 A;  5ECI B;  3SBC A;  3WGX A;  4KCA A;  1XW5 A;  5ECM B;  2V6K A;  4N0V A;  4F03 A;  4NAX A;  2GZZ A;  4GQC A;  2YP6 A;  4E8E A;  3GUR A;  2EIR A;  1THO A;  2YPM A;  1EV9 A;  5AIS A;  1KBN A;  3LSZ A;  2H1A A;  1ZOF A;  2O7K A;  4I97 A;  1SYR A;  3GHA A;  3N9J A;  4HDE A;  1M0U A;  4PUR A;  5JWQ B;  1XW6 A;  3ZIJ A;  3TJK A;  1ZL9 A;  3G7J A;  3P2A A;  1E2Y A;  1W4V A;  4O7H A;  2N5B A;  1YEP A;  2B1L A;  5A5K A;  4LMW A;  2F8F A;  4OCF A;  2JZR A;  1DBY A;  3LJR A;  1VRS D;  2GLR A;  1XPV A;  3OR5 A;  5EL8 A;  3UL3 A;  2PUK C;  1A0R P;  5L71 A;  3VPT A;  1BAY A;  1JLV A;  2OJL A;  3VWX A;  3IA1 A;  1TJD A;  1QMV A;  2L57 A;  4YH2 A;  2R4V A;  2NDO A;  3F6D A;  5IIZ A;  1KNG A;  3H93 A;  2E0Q A;  1WE0 A;  2GS3 A;  3KJY A;  1SKR B;  5EPF A;  1T4Y A;  2AAW A;  1SL2 B;  4Q5F A;  5IM9 A;  3D22 A;  3GH6 A;  3QAG A;  4OFT A;  1FHE A;  1AW9 A;  3U6V A;  1BYE A;  3TJG A;  3VPQ A;  3D6I A;  4O5R A;  3IBH A;  4WET A;  1HNB A;  2HFD A;  2XPE A;  1ZMA A;  3NIV A;  2JU5 A;  4ECC A;  3GFK A;  2MMA A;  1F37 A;  1GTI A;  4WEY A;  5GSS A;  2C3N A;  1FO5 A;  2O87 A;  2OAD A;  3DVX A;  3H1N A;  3KZQ A;  1ZZY A;  5A4U A;  4JU5 A;  3HY2 A;  3IK7 A;  2VL3 A;  1LJR A;  1XOA A;  3AY8 A;  3IAS 2;  2VCX A;  4J2F A;  3UAP A;  3APS A;  5CRG A;  3ZZX A;  1K0C A;  4ID0 A;  4TXO A;  3TRX A;  2WB9 A;  4NHZ A;  3CXG A;  1MEK A;  4IKH A;  3TUE A;  4WBR D; 
#chains in the Genus database with same CATH topology
 2PVO C;  1IYH A;  3LOR A;  2G2Q A;  2HRN A;  1XWK A;  1A2J A;  5BRT A;  1XOB A;  2HRK A;  4K2D A;  2OBI A;  1U3A A;  3HZ8 A;  5G5E A;  2PN8 A;  1GSQ A;  4L5L A;  3GYK A;  2GST A;  2PWJ A;  5D9W A;  2JAD A;  3GN3 A;  3CSI A;  3FZ4 A;  1KEB A;  2GDR A;  4LL1 B;  4AGS A;  1PD2 1;  4JR4 A;  4KW6 A;  3LQ7 A;  1K0B A;  2OA7 A;  1WMJ A;  4CY6 A;  2DLX A;  4Q5N A;  5HFI A;  3F4R A;  3LFL A;  6GST A;  4IEL A;  3IE3 A;  1K3Y A;  1ZYP A;  4NV5 A;  3O3T A;  4HJ2 A;  5ID2 B;  2VCW A;  3DXB A;  2I3Y A;  1ML6 A;  3IDV A;  3RPP A;  3KH9 A;  3C71 A;  1U3I A;  3APQ A;  5IPH A;  1PRX A;  3KXO A;  4KDX A;  4NWY A;  2CZ3 A;  1T00 A;  2DJ3 A;  3TKR A;  3PPU A;  1B8X A;  1MDI A;  2K8V A;  1OE7 A;  1FAA A;  4JBB A;  1VGL A;  4F82 A;  3HCZ A;  12GS A;  3HVN A;  4RUV A;  3LWA A;  3CSH A;  5DCH A;  2GQK A;  4OCE A;  2V6O A;  5F0G A;  3G7I A;  3D4T A;  3KP9 A;  2NVL A;  2R5G A;  3FHK A;  1EWX A;  1OKT A;  1PSQ A;  4XIH A;  1PN9 A;  3Q18 A;  3L9V A;  1GSE A;  4LMV A;  2JSY A;  2TIR A;  1XBS A;  4BL7 B;  16GS A;  3FZ5 A;  13GS A;  4JRR A;  1ZGN A;  3TRP A;  2K18 A;  3F63 A;  4QL7 A;  2KLX A;  4IBP A;  4TR0 A;  2JZT A;  3W6G A;  1X9S B;  2BMX A;  2YV7 A;  3F4T A;  3WT2 A;  5E59 A;  2VL2 A;  1RW1 A;  3FZ9 A;  4BVY A;  1GLP A;  1K0M A;  1MTC A;  2C0E A;  2C4J A;  3VUR A;  1YKA A;  3ZFL A;  4BWS A;  4MF7 A;  3M1G A;  2H19 A;  3DIE A;  3TKS A;  3VWU A;  1HQO A;  2V1M A;  5J5N A;  2WJU A;  3KGK A;  4KF9 A;  4KND A;  3LGC A;  4PQ1 A;  5F8B A;  3RHB A;  1GUM A;  5EY6 A;  5HR1 A;  3HXS A;  4ILF A;  1SL1 B;  2YJ7 A;  3D4M A;  4WF4 A;  2C3T A;  1A24 A;  3LYK A;  4F9Z A;  1JZR A;  20GS A;  1M2A A;  1FOH A;  3EUR A;  3HYP A;  5J9B A;  5E4W A;  2P5Q A;  4IW9 A;  3MWH A;  4FQU A;  4JE1 A;  1GRX A;  4TR3 A;  2P0G A;  4V2N A;  1X5C A;  6GSX A;  4IGJ A;  5KEJ A;  4K7O A;  2H0I A;  3CQF A;  1JFU A;  2GT6 A;  1W89 A;  3I6A A;  1GTB A;  3LXT A;  3UVH A;  3LXZ A;  2VCQ A;  1PGT A;  3BCK A;  5G2Z A;  1GSU A;  4MZC A;  1NHO A;  5ENU A;  2YV9 A;  1ST9 A;  5ECR B;  5A4W A;  1T8E B;  4MF5 A;  4X1U A;  2RUE A;  3KTL A;  4N30 A;  1FVK A;  5F07 A;  1PL1 A;  1SK1 A;  2HLS A;  2TRX A;  3HZ4 A;  3HDC A;  1SYX A;  1F6M C;  2L5L A;  1QK8 A;  1UC7 A;  2LQQ A;  3FW2 A;  2RM6 A;  1EEJ A;  1O7U A;  3ZMK A;  3O76 A;  1WP0 A;  2O8V B;  2H8L A;  3D5J A;  2DC5 A;  3APO A;  5G1K A;  1M3I A;  5FT3 A;  2VM2 A;  5CYY A;  2CA8 A;  2D2Z A;  1MDK A;  2ALB A;  4JED A;  4HQS A;  2A2S A;  4N10 A;  4Q5Q A;  5G1L A;  4IS0 A;  4EF0 A;  2MMZ A;  2PPT A;  2WDU A;  2CVD A;  3ZRD A;  1O8W A;  3CRT A;  1GSD A;  3F0I A;  2IMK A;  1V58 A;  5DDL A;  3FY7 A;  4WF5 A;  3F6F A;  4FH8 A;  4RQR A;  5IPG A;  1XVW A;  5EVO A;  4DVC A;  2VUP A;  3J7Y b;  1O85 A;  1FOV A;  3L9U A;  2CVB A;  3FR3 A;  2H0G A;  1SK2 A;  4OD7 A;  5J41 A;  2FLS A;  2REM A;  2LJK A;  4PTS A;  3UBK A;  1PA3 A;  2QC7 A;  2P31 A;  3A5W A;  2L4C A;  1A2L A;  3F3Q A;  1KTE A;  2YWI A;  5IQY A;  1Z5Y E;  3D0Z A;  4MCU A;  1QFN A;  3N5O A;  4BVY B;  5IOX A;  4AJ6 A;  5CP1 A;  4FYC A;  2WZ9 A;  4XRD A;  3ZML A;  5IMF A;  2LS5 A;  3QD9 A;  4K7N A;  1T7P B;  2FUG 2;  3E3E A;  4V1A p;  2PU9 C;  4K0G A;  3EMX A;  2M72 A;  1TRU A;  3DML A;  2YOI A;  2M80 A;  3H8Q A;  1XG8 A;  3ZIT A;  3BCI A;  5C04 A;  4ECJ A;  3DVW A;  1K0O A;  4ZL8 A;  1ILO A;  2AJQ B;  2PBJ A;  1Z6N A;  4ML6 A;  2C0D A;  3HJO A;  1Y25 A;  2QSI A;  1M2B A;  4XRA A;  3FR9 A;  1Y6E A;  1UN2 A;  2O85 A;  4I6X A;  1R7H A;  2CZ2 A;  1M2D A;  2B5X A;  5ECS A;  1NW2 A;  3J7Y k;  2H30 A;  5ELG A;  2A4H A;  3FYG A;  2RUF A;  2OE3 A;  4ZIJ A;  3RAZ A;  5J9C A;  2I4A A;  2IFQ A;  3GKK A;  4Z2U A;  2L59 A;  5DAK A;  2WS2 A;  1YEX A;  3IHQ A;  4XS4 A;  1R26 A;  1WOU A;  3PIN A;  22GS A;  3H79 A;  1VF2 A;  3ZYW A;  4HS1 A;  4OFN A;  2OAC A;  1T1V A;  4BL7 A;  1YF0 A;  3P90 A;  5CRW A;  18GS A;  2F3M A;  3HHV A;  1E6B A;  5DQS A;  1RK4 A;  4ZXG A;  1B4P A;  2LV3 A;  2KOK A;  4KDY A;  5D93 A;  4ZIL A;  5J3R A;  5CO3 A;  2IME A;  5GZZ B;  1V98 A;  2YWN A;  4ACS A;  5HR2 A;  2A4V A;  2WFC A;  3CRU A;  2H66 A;  1B9X C;  2R2J A;  2VIM A;  2HNL A;  1MDJ A;  4I5Q A;  4TVE A;  2V32 A;  1AQW A;  4Z2R A;  3F9U A;  3QMX A;  4DSS A;  4ICY A;  4AJ8 A;  5B6M A;  5JCW A;  1WIK A;  3GIX A;  2IL3 A;  3HVX A;  3KMO A;  1M9A A;  4G19 A;  2VD1 A;  4DSQ A;  14GS A;  2DJK A;  1SD9 A;  3GX8 A;  3JCM L;  2C1Y A;  5D96 A;  3RBT A;  2RII A;  1SD8 A;  5HFK A;  4BWQ A;  5JCU A;  2CVK A;  3ZIV A;  4MPG A;  1TXX A;  4G2E A;  5CNW A;  3ERW A;  1GL8 A;  3DRN A;  1OAZ A;  3VK9 A;  4I2U A;  1BED A;  4QQ7 A;  2YCD A;  2H0H A;  2AV4 A;  1AIU A;  2MZC A;  5IMZ A;  3E0U A;  3M0F A;  2AB6 A;  5LCZ A;  3WGE A;  3FR6 A;  5C00 A;  2HZF A;  1SKW B;  3PR8 A;  2B5Y A;  3D21 A;  3DYR A;  2FCH A;  1PQN A;  3VLN A;  3I43 A;  1TTZ A;  3QDN A;  3L0H A;  1ZYQ B;  4EIP A;  5HR3 A;  2C0F A;  5JWO B;  1R5A A;  2X99 A;  4O92 A;  4GSN A;  1PX7 A;  2X8G A;  3GA4 A;  2R0P A;  3F3R A;  4EKZ A;  2E2G A;  1AC1 A;  3IAM 2;  5CRE A;  4XCS A;  2CAQ A;  3HKR A;  1AQV A;  4OMV A;  5GAP D;  1F3A A;  3GKN A;  3IC8 A;  3TJJ A;  3ISO A;  4YQM A;  1S3D A;  4OWY A;  3UJ1 A;  10GS A;  2H6Z A;  2HXK A;  2LRN A;  1OC3 A;  1NSW A;  1JLW A;  4IP6 A;  4TW5 A;  4G10 A;  4KGI A;  3Q6O A;  4MPF A;  1X9M B;  1PL2 A;  4YQU A;  2X8C A;  3CBU A;  4GQF A;  2RM5 A;  4MF6 A;  1OVN A;  1PFO A;  1THX A;  2H73 A;  2MBS A;  4F0C A;  5ECL B;  2IMD A;  1XXU A;  1HNA A;  2GSR A;  2N5F A;  1NM3 A;  4YAV A;  1M7T A;  3TKQ A;  3DEX A;  5COH A;  1EP7 A;  2IFQ B;  3HA9 A;  1Z3E A;  2GVP A;  1J08 A;  4PNG A;  5DAK B;  2ON5 A;  4XS4 B;  4F2I A;  2MMN A;  2F9S A;  3BD2 A;  1QUW A;  2ZNM A;  4GLT A;  2HE3 A;  4DSR A;  1S3R A;  3KEB A;  2NTO A;  2VCZ A;  4MMM A;  1URM A;  2LUS A;  1TU8 A;  2H01 A;  19GS A;  2EC4 A;  4L8E A;  3MSZ A;  3WGD A;  4IQA A;  1O81 A;  3R3E A;  2V2G A;  1XWG A;  3MIX A;  2GQM A;  2HT9 A;  4MJA A;  3UAR A;  2H1D A;  2B3S A;  2DIY A;  4CDO A;  1MD4 A;  2B6M A;  4KE3 A;  4MZB A;  2DIZ A;  3TJF A;  1T4Z A;  2QKE A;  1YKC A;  1EV4 A;  1YF1 A;  5F06 A;  3BBY A;  4K1F A;  4ZB6 A;  1ERW A;  4EDZ A;  2C0G A;  4DSS B;  4D73 A;  2YJH A;  2PER A;  3Q74 A;  2OKA A;  2YNX A;  4HOJ A;  2DJJ A;  2ZUP A;  2B5E A;  1JZD A;  2AYT A;  4RI6 A;  4RI7 A;  2C8U A;  2VLV A;  4LA1 A;  1V2A A;  1GWC A;  2K6V A;  5B8B A;  2H1B A;  3WD6 A;  3EIN A;  1X0R A;  2R3X A;  1XW9 A;  1T3B A;  2EIQ A;  2L6D A;  4HZ4 A;  4O5Q A;  3UIW A;  1TDI A;  2K9F A;  4BIK A;  5ELA A;  2H70 A;  5DVB A;  1HNC A;  4POB A;  2JSZ A;  5B7C A;  5IO2 A;  5GAN D;  1Z9H A;  3FRC A;  4JR6 A;  4O32 A;  3IRA A;  1A8L A;  1F9M A;  3HD5 A;  1K3L A;  2X64 A;  4MZW A;  3HVS A;  2JL4 A;  3G7Y A;  1A2M A;  4ZBB A;  1XIY A;  2L6C A;  4GF0 A;  1USB A;  4MH2 A;  1O6J A;  2L5O A;  4BVX A;  2R0C A;  1Z7P A;  2HYX A;  4OO4 A;  5J4U A;  5IMC A;  3KIJ A;  2YZH A;  6GSS A;  1GLQ A;  2DMM A;  4IJ3 A;  4PNF A;  2H1G A;  3W8S A;  1OC9 A;  3I69 A;  17GS A;  4IP1 A;  1DUG A;  2YWO A;  3CSJ A;  1Q98 A;  1FB0 A;  2PVQ A;  3GL3 A;  2X8H A;  5D9V A;  4TRX A;  4MP4 A;  1X9W B;  2XC2 A;  1TRW A;  1DE1 A;  4PX1 A;  3UBL A;  4FYU A;  4ZL7 A;  1A0F A;  4K2X A;  4POM A;  2PMT A;  2AHE A;  1F3B A;  3GST A;  5ECH B;  4TR4 A;  1QGV A;  1SJ6 A;  1CQH A;  1U88 A;  3CYN A;  4GXZ A;  3MDK A;  4ML1 A;  2GGT A;  2YWM A;  4DEJ A;  5INY A;  2DJ0 A;  3VI5 A;  3ME7 A;  3TDG A;  2H6Y A;  5DQY A;  3QAW A;  3S9F A;  3KH7 A;  4KH7 A;  4PUF C;  4X4J A;  2GT5 A;  2H6X A;  1K0D A;  1V9W A;  2QGV A;  2FNO A;  2A2P A;  4ZB9 A;  4MK3 A;  3ZL5 A;  2J23 A;  3UEM A;  2VO4 A;  5ABR A;  3M8N A;  3ZVJ A;  1TW9 A;  4ZBA A;  1MD3 A;  2ZCT A;  3GRX A;  4G0K A;  1EGO A;  3EU3 A;  5FHI A;  3GKM A;  1G7O A;  4HJM A;  2QA2 A;  5G30 A;  4XS6 A;  1HD2 A;  3GKX A;  3EWL A;  4ZL9 A;  3EC3 A;  1PKW A;  4YAP A;  2VLT A;  3V1W A;  5ECN B;  3EMP A;  1U87 A;  4NXI A;  3IC4 A;  3L78 A;  3QR6 A;  2CV4 A;  2MYG A;  3DGQ A;  3KM6 A;  4D73 B;  2GQL A;  2HI7 A;  4F0B A;  3G9B A;  4HZ2 A;  4PGT A;  1G6Y A;  1V40 A;  1RQM A;  1PX6 A;  4CY8 A;  1OC8 A;  2FWH A;  4MAB A;  2LJR A;  3FMW A;  4HUA A;  5DCG A;  2R37 A;  3QFB C;  2FY6 A;  4K0N A;  1H4O A;  3ERF A;  3UVT A;  4KB3 A;  4KA0 A;  1K3O A;  1DE2 A;  4HEA 2;  3LEF A;  3GV1 A;  4KAE A;  4TR1 A;  1M99 A;  3TOT A;  2M46 A;  4PUA A;  2BTO T;  3GSS A;  5H5R A;  1B9Y C;  2C80 A;  4MA9 A;  1XWC A;  4IJI A;  4JZQ A;  3IOS A;  4O5U A;  3ZFB A;  2LKU A;  3KMN A;  1TRV A;  3C73 A;  3NOF A;  4NHW A;  1PN0 A;  4NV2 A;  2VM1 A;  3QFA C;  1LU4 A;  2R0G A;  4K5S A;  1GH2 A;  1R5P A;  3E9J B;  1GUL A;  1N8J A;  3EVI A;  1AQX A;  2IJY A;  1SEN A;  3QPM A;  3TCO A;  1TP9 A;  1GNW A;  1GSS A;  1M3J A;  4BVX B;  1BQ7 A;  5AN1 A;  3BJ5 A;  4ECI A;  4K7I A;  3GMF A;  1XVQ A;  5D73 A;  1ACV A;  4Z7X A;  1OC9 B;  7GSS A;  4LLR A;  4WR4 A;  3IXR A;  3SWL A;  2FA8 A;  1GSF A;  2WGR A;  1BJX A;  4N11 A;  3VWV A;  3BOA A;  3F8U A;  3I9V 2;  4OO5 A;  4USS A;  1EGR A;  2NBS A;  2WCI A;  1FB6 A;  1SL0 B;  3ED3 A;  2OE1 A;  1O73 A;  3C1S A;  9GSS A;  3MAK A;  1B4Q A;  1TOF A;  5ECO B;  1ON4 A;  1QQ2 A;  3NZN A;  4QL9 A;  3A5I A;  3R2Q A;  5F05 A;  3TGZ A;  2HZE A;  1DSB A;  4CW9 A;  4TOP A;  3GUS A;  4H86 A;  3TB2 A;  6GSY A;  2CQ9 A;  6GSW A;  1WJK A;  3F4S A;  2YAN A;  5DAL A;  2KHP A;  2A2R A;  2QA1 A;  5D9T A;  1WPI A;  4POK A;  2WRT A;  4OFM A;  5HQP A;  5CRH A;  3RHC A;  1X5D A;  1Q4J A;  4KUN A;  4GRF A;  1EP8 A;  2LST A;  4P3Y B;  4XS1 A;  1SKS B;  1I5G A;  4HSC X;  1XWB A;  1BG5 A;  2I9H A;  1AUC A;  4PQI A;  1WRY A;  2AUV A;  2IN3 A;  4GWR A;  2CAI A;  2IWT A;  1YQ1 A;  5BMU A;  5JCG A;  2F51 A;  4IN0 A;  3C7M A;  1SJZ A;  4J57 E;  4EVM A;  1SU9 A;  2B1K A;  4HU9 A;  2DBC A;  2HSY A;  3A2W A;  5ECP B;  4I2T A;  3IR4 A;  2J9H A;  5D9X A;  1FVJ A;  2YN1 A;  1WWJ A;  2LNS A;  1LBK A;  1TI3 A;  3GTU B;  1FG4 A;  5IMA A;  3LW9 A;  2LTK A;  1HYU A;  4G0L A;  4XTS A;  6GSU A;  3HJM A;  3LYP A;  1XWA A;  3IPZ A;  1YZX A;  4ISD A;  2G0F A;  4IVF A;  4EDY A;  3PH9 A;  2MBT A;  3EU4 A;  2DML A;  3FK8 A;  1S3A A;  2I1U A;  3W8J A;  4K6X A;  2X4A A;  4K8M A;  2H75 A;  4YKG A;  1VF1 A;  4KDU A;  8GSS A;  3VWW A;  3PGT A;  1FW1 A;  1O8X A;  1V57 A;  2VLU A;  3MNG A;  2FA4 A;  2VL2 C;  1ABA A;  3MYD A;  4I8B A;  4TR1 B;  4V2L A;  2LJA A;  2H71 A;  2ON7 A;  3HJP A;  3QOU A;  2LQO A;  5HFG A;  4EE0 A;  4L0U A;  1M9B A;  3O6T A;  1GUK A;  5IOW A;  1J9B A;  2F8A A;  3TKS C;  5KN3 A;  2EIO A;  4FIW A;  4MDC A;  2IMI A;  1I9D A;  4GSS A;  2ES7 A;  1C72 A;  3M9K A;  1GUH A;  3ZLP A;  2R6K A;  5ECQ B;  4WBJ A;  4ZBD A;  1TK0 B;  1X5E A;  3VFI A;  4Z2T A;  4ECB A;  4IQ1 A;  4GST A;  3DWV A;  1YJ6 A;  4Q5R A;  3M3M A;  1PMT A;  2NPB A;  4MJE A;  5AIX A;  4BA7 A;  2IIY A;  5DJL A;  3IV4 A;  2LRC A;  1TK8 B;  1R4W A;  3U5R E;  3TOU A;  1OYJ A;  4BPY A;  5DJM A;  4FO5 A;  1TK5 B;  2TRC P;  1AXD A;  5LD0 A;  1G7E A;  1XFL A;  1UA5 A;  3P7X A;  4MJB A;  4MLY A;  3WT1 A;  3P8W A;  1G6W A;  2YZU A;  4HQZ A;  1A23 A;  5GST A;  4TXV A;  2FWG A;  1BX9 A;  4ZB8 A;  4HU7 A;  4MNN A;  3GNJ A;  3ZVJ D;  2KP2 A;  3A2V A;  4GCI A;  2HRF A;  2B7J A;  2GSS A;  3US3 A;  5LNK e;  4N0Z A;  3RPN A;  1EOH A;  2CT6 A;  2LRT A;  1YDK A;  2I81 A;  3FKF A;  2HZE B;  1ZYE A;  1IYI A;  3M9J A;  5KN2 A;  2IPA A;  2CX4 A;  3C1R A;  5IO0 A;  1N2A A;  1SK0 A;  4WKW A;  4FYB A;  3GX0 A;  3ZTL A;  3TRQ A;  4AJ7 A;  3KD0 A;  5DAL B;  4KCE A;  5IMD A;  2BJX A;  4CHS A;  2OBK A;  5G5F A;  2VCV A;  4POL A;  2MMO A;  1B48 A;  1XZO A;  3EPT A;  4XHM A;  5G31 A;  3TKS E;  4GTU A;  2RLI A;  3CTG A;  5CRD A;  4KSO A;  2VOC A;  4TXO B;  2LNT A;  5AGY A;  1TRS A;  2PGT A;  3FEU A;  4KX4 A;  2DJ2 A;  4WXT A;  3QAV A;  2VCT A;  3UOM A;  2C3Q A;  3HVV A;  2OE0 A;  1GTU A;  2GZY A;  2L4Q A;  3DKS A;  1A8Y A;  3ERG A;  2H74 A;  1AAZ A;  1EEM A;  2LEG A;  3KTB A;  4E8H A;  4HI7 A;  1ZCP A;  1YY7 A;  2FWE A;  2DSA A;  4L0W A;  5AIV A;  5KN1 A;  5B6N A;  4PQH A;  4RQX A;  4G0I A;  5KN0 A;  1G0T A;  4WR5 A;  5KOW A;  3K8N A;  2VD0 A;  1Z7R A;  1U6T A;  1JZO A;  2E2M A;  3L4N A;  4AF2 A;  4K5R A;  4TN8 A;  2GTU A;  1VF3 A;  4K9Z A;  4EC0 A;  5FWG A;  5ECK B;  2B7K A;  5D8I A;  1GSY A;  5CAX A;  2H72 A;  2KP1 A;  3UMA A;  1XCC A;  1OE8 A;  2DKH A;  3A2X A;  2P5R A;  2DJ1 A;  4J56 E;  3QCP A;  2V41 A;  3FZA A;  3DD3 A;  4MH3 A;  1ERU A;  1EZK A;  2GZP A;  4V1A g;  4G9H A;  1GTA A;  1S3C A;  5H5Q A;  3VI7 A;  3EYT A;  4X43 A;  1K0A A;  2K8S A;  6GSV A;  3L9S A;  2IMF A;  4PXO A;  4L5O A;  4YQV A;  3ME8 A;  5DBQ A;  3TJB A;  4V2M A;  3H4K A;  2FHE A;  3C8E A;  1ERT A;  11GS A;  2FGX A;  1PKZ A;  4EL1 A;  4NPB A;  5A4V A;  1SJI A;  3KCM A;  2JZS A;  1TKD B;  1NHY A;  1K0N A;  3CTF A;  5B8A A;  2GSQ A;  2FWF A;  2WUL A;  4NMU A;  2E7P A;  1UVZ A;  3WYW A;  3EE2 A;  3CMI A;  2O89 A;  1GP1 A;  5HR0 A;  3GH9 A;  2XBI A;  2VAF A;  3IHG A;  2XBQ A;  1EOG A;  2KUC A;  1CQG A;  4MJC A;  4EUY A;  3LG6 A;  2XPD A;  4LL4 B;  2JAC A;  2N5A A;  2Z9S A;  1TI1 A;  2CX3 A;  2H76 A;  3GTU A;  3Q19 A;  1ERV A;  4EO3 A;  5JWR B;  4KSM A;  2VL9 A;  3A3T A;  3RDW A;  4IHU A;  4EXJ A;  3IK9 A;  5IMV A;  4X0X A;  2XHF A;  1OKD A;  3TKP A;  1TU7 A;  1GNE A;  3GL5 A;  1QXH A;  1Z6M A;  2HSH A;  1VF4 A;  1JHB A;  2HSM A;  1H75 A;  4TKY A;  1JZW A;  4ULX A;  3KP8 A;  3ZRE A;  5H5S A;  2FD3 A;  1J0F A;  1F2E A;  5ID2 A;  5ECI B;  3SBC A;  3WGX A;  4KCA A;  1XW5 A;  5ECM B;  2V6K A;  4N0V A;  4F03 A;  4NAX A;  2GZZ A;  4GQC A;  2YP6 A;  4E8E A;  3GUR A;  2EIR A;  1THO A;  2YPM A;  1EV9 A;  5AIS A;  1KBN A;  3LSZ A;  2H1A A;  1ZOF A;  2O7K A;  4I97 A;  1SYR A;  3GHA A;  3N9J A;  4HDE A;  4A5P A;  1M0U A;  4PUR A;  5JWQ B;  1XW6 A;  2UZ8 A;  3ZIJ A;  3TJK A;  1ZL9 A;  3G7J A;  3P2A A;  1E2Y A;  1W4V A;  4O7H A;  2N5B A;  1YEP A;  2B1L A;  5A5K A;  4LMW A;  2F8F A;  4OCF A;  2JZR A;  1DBY A;  3LJR A;  1VRS D;  2GLR A;  1XPV A;  3OR5 A;  5EL8 A;  3UL3 A;  2PUK C;  1A0R P;  5L71 A;  2HRA A;  3VPT A;  1BAY A;  1JLV A;  2OJL A;  3VWX A;  3IA1 A;  1TJD A;  1QMV A;  2L57 A;  4YH2 A;  2R4V A;  2NDO A;  3F6D A;  5IIZ A;  1KNG A;  3H93 A;  2E0Q A;  1WE0 A;  2GS3 A;  3KJY A;  1SKR B;  5EPF A;  1T4Y A;  2AAW A;  1SL2 B;  4EIQ A;  4Q5F A;  5IM9 A;  3D22 A;  3GH6 A;  3QAG A;  4OFT A;  1FHE A;  1AW9 A;  3U6V A;  1BYE A;  3TJG A;  3VPQ A;  3D6I A;  4O5R A;  3IBH A;  4WET A;  1HNB A;  2HFD A;  2XPE A;  2DKI A;  1ZYN A;  1ZMA A;  3NIV A;  2JU5 A;  4ECC A;  3GFK A;  2MMA A;  1F37 A;  1GTI A;  4WEY A;  5GSS A;  2C3N A;  1FO5 A;  2O87 A;  2OAD A;  3DVX A;  3H1N A;  3KZQ A;  1ZZY A;  5A4U A;  4JU5 A;  3HY2 A;  3IK7 A;  5KOX A;  2VL3 A;  1LJR A;  1XOA A;  3AY8 A;  3IAS 2;  2VCX A;  4J2F A;  3UAP A;  3APS A;  5CRG A;  3ZZX A;  1K0C A;  4ID0 A;  4TXO A;  2X49 A;  3TRX A;  2WB9 A;  4NHZ A;  3CXG A;  1MEK A;  4IKH A;  3TUE A;  4WBR D;  4YKF A; 
#chains in the Genus database with same CATH homology
 2PVO C;  1IYH A;  3LOR A;  2G2Q A;  2HRN A;  1XWK A;  1A2J A;  5BRT A;  1XOB A;  2HRK A;  4K2D A;  2OBI A;  1U3A A;  3HZ8 A;  5G5E A;  2PN8 A;  1GSQ A;  4L5L A;  3GYK A;  2GST A;  2PWJ A;  5D9W A;  2JAD A;  3GN3 A;  3CSI A;  3FZ4 A;  1KEB A;  2GDR A;  4LL1 B;  4AGS A;  1PD2 1;  4JR4 A;  4KW6 A;  3LQ7 A;  1K0B A;  2OA7 A;  1WMJ A;  4CY6 A;  2DLX A;  4Q5N A;  5HFI A;  3F4R A;  3LFL A;  6GST A;  4IEL A;  3IE3 A;  1K3Y A;  1ZYP A;  4NV5 A;  3O3T A;  4HJ2 A;  5ID2 B;  2VCW A;  3DXB A;  2I3Y A;  1ML6 A;  3IDV A;  3RPP A;  3KH9 A;  3C71 A;  1U3I A;  3APQ A;  5IPH A;  1PRX A;  3KXO A;  4KDX A;  4NWY A;  2CZ3 A;  1T00 A;  2DJ3 A;  3TKR A;  3PPU A;  1B8X A;  1MDI A;  2K8V A;  1OE7 A;  1FAA A;  4JBB A;  1VGL A;  4F82 A;  3HCZ A;  12GS A;  4RUV A;  3LWA A;  3CSH A;  5DCH A;  2GQK A;  4OCE A;  2V6O A;  5F0G A;  3G7I A;  3D4T A;  3KP9 A;  2NVL A;  2R5G A;  3FHK A;  1EWX A;  1OKT A;  1PSQ A;  4XIH A;  1PN9 A;  3Q18 A;  3L9V A;  1GSE A;  4LMV A;  2JSY A;  2TIR A;  1XBS A;  4BL7 B;  16GS A;  3FZ5 A;  13GS A;  4JRR A;  1ZGN A;  3TRP A;  2K18 A;  3F63 A;  4QL7 A;  2KLX A;  4IBP A;  4TR0 A;  2JZT A;  3W6G A;  1X9S B;  2BMX A;  2YV7 A;  3F4T A;  3WT2 A;  5E59 A;  2VL2 A;  1RW1 A;  3FZ9 A;  4BVY A;  1GLP A;  1K0M A;  1MTC A;  2C0E A;  2C4J A;  3VUR A;  1YKA A;  3ZFL A;  4BWS A;  4MF7 A;  3M1G A;  2H19 A;  3DIE A;  3TKS A;  3VWU A;  1HQO A;  2V1M A;  5J5N A;  2WJU A;  3KGK A;  4KF9 A;  4KND A;  3LGC A;  4PQ1 A;  5F8B A;  3RHB A;  1GUM A;  5EY6 A;  5HR1 A;  3HXS A;  4ILF A;  1SL1 B;  2YJ7 A;  3D4M A;  4WF4 A;  2C3T A;  1A24 A;  3LYK A;  4F9Z A;  1JZR A;  20GS A;  1M2A A;  1FOH A;  3EUR A;  3HYP A;  5J9B A;  5E4W A;  2P5Q A;  4IW9 A;  3MWH A;  4FQU A;  4JE1 A;  1GRX A;  4TR3 A;  2P0G A;  4V2N A;  1X5C A;  6GSX A;  4IGJ A;  5KEJ A;  4K7O A;  2H0I A;  1JFU A;  2GT6 A;  1W89 A;  3I6A A;  1GTB A;  3LXT A;  3UVH A;  3LXZ A;  2VCQ A;  1PGT A;  3BCK A;  5G2Z A;  1GSU A;  4MZC A;  1NHO A;  5ENU A;  2YV9 A;  1ST9 A;  5ECR B;  5A4W A;  1T8E B;  4MF5 A;  4X1U A;  2RUE A;  3KTL A;  4N30 A;  1FVK A;  5F07 A;  1PL1 A;  1SK1 A;  2HLS A;  2TRX A;  3HZ4 A;  3HDC A;  1SYX A;  1F6M C;  2L5L A;  1QK8 A;  1UC7 A;  2LQQ A;  3FW2 A;  2RM6 A;  1EEJ A;  1O7U A;  3ZMK A;  3O76 A;  1WP0 A;  2O8V B;  2H8L A;  3D5J A;  2DC5 A;  3APO A;  5G1K A;  5FT3 A;  2VM2 A;  5CYY A;  2CA8 A;  2D2Z A;  1MDK A;  2ALB A;  4JED A;  4HQS A;  2A2S A;  4N10 A;  4Q5Q A;  5G1L A;  4IS0 A;  4EF0 A;  2MMZ A;  2PPT A;  2WDU A;  2CVD A;  3ZRD A;  1O8W A;  3CRT A;  1GSD A;  3F0I A;  2IMK A;  1V58 A;  5DDL A;  3FY7 A;  4WF5 A;  3F6F A;  4FH8 A;  4RQR A;  5IPG A;  1XVW A;  5EVO A;  4DVC A;  2VUP A;  3J7Y b;  1O85 A;  1FOV A;  3L9U A;  2CVB A;  3FR3 A;  2H0G A;  1SK2 A;  4OD7 A;  5J41 A;  2FLS A;  2REM A;  2LJK A;  4PTS A;  3UBK A;  1PA3 A;  2QC7 A;  2P31 A;  3A5W A;  2L4C A;  1A2L A;  3F3Q A;  1KTE A;  2YWI A;  5IQY A;  1Z5Y E;  3D0Z A;  4MCU A;  1QFN A;  3N5O A;  4BVY B;  5IOX A;  4AJ6 A;  5CP1 A;  4FYC A;  2WZ9 A;  4XRD A;  3ZML A;  5IMF A;  2LS5 A;  3QD9 A;  4K7N A;  1T7P B;  2FUG 2;  3E3E A;  4V1A p;  2PU9 C;  4K0G A;  3EMX A;  2M72 A;  1TRU A;  3DML A;  2YOI A;  2M80 A;  3H8Q A;  3ZIT A;  3BCI A;  5C04 A;  4ECJ A;  3DVW A;  1K0O A;  4ZL8 A;  1ILO A;  2AJQ B;  2PBJ A;  1Z6N A;  4ML6 A;  2C0D A;  3HJO A;  1Y25 A;  2QSI A;  1M2B A;  4XRA A;  3FR9 A;  1Y6E A;  1UN2 A;  2O85 A;  4I6X A;  1R7H A;  2CZ2 A;  1M2D A;  2B5X A;  5ECS A;  1NW2 A;  3J7Y k;  2H30 A;  5ELG A;  2A4H A;  3FYG A;  2RUF A;  2OE3 A;  4ZIJ A;  3RAZ A;  5J9C A;  2I4A A;  2IFQ A;  3GKK A;  4Z2U A;  2L59 A;  5DAK A;  2WS2 A;  1YEX A;  3IHQ A;  4XS4 A;  1R26 A;  1WOU A;  3PIN A;  22GS A;  3H79 A;  1VF2 A;  3ZYW A;  4HS1 A;  4OFN A;  2OAC A;  1T1V A;  4BL7 A;  1YF0 A;  3P90 A;  5CRW A;  18GS A;  2F3M A;  3HHV A;  1E6B A;  5DQS A;  1RK4 A;  4ZXG A;  1B4P A;  2LV3 A;  2KOK A;  4KDY A;  5D93 A;  4ZIL A;  5J3R A;  5CO3 A;  2IME A;  5GZZ B;  1V98 A;  2YWN A;  4ACS A;  5HR2 A;  2A4V A;  2WFC A;  3CRU A;  2H66 A;  1B9X C;  2R2J A;  2VIM A;  2HNL A;  1MDJ A;  4I5Q A;  4TVE A;  2V32 A;  1AQW A;  4Z2R A;  3F9U A;  3QMX A;  4DSS A;  4ICY A;  4AJ8 A;  5B6M A;  5JCW A;  1WIK A;  3GIX A;  2IL3 A;  3HVX A;  3KMO A;  1M9A A;  4G19 A;  2VD1 A;  4DSQ A;  14GS A;  2DJK A;  1SD9 A;  3GX8 A;  3JCM L;  2C1Y A;  5D96 A;  3RBT A;  2RII A;  1SD8 A;  5HFK A;  4BWQ A;  5JCU A;  2CVK A;  3ZIV A;  4MPG A;  1TXX A;  4G2E A;  5CNW A;  3ERW A;  1GL8 A;  3DRN A;  1OAZ A;  3VK9 A;  4I2U A;  1BED A;  4QQ7 A;  2YCD A;  2H0H A;  2AV4 A;  1AIU A;  2MZC A;  5IMZ A;  3E0U A;  3M0F A;  2AB6 A;  5LCZ A;  3WGE A;  3FR6 A;  5C00 A;  2HZF A;  1SKW B;  3PR8 A;  2B5Y A;  3D21 A;  3DYR A;  2FCH A;  1PQN A;  3VLN A;  3I43 A;  1TTZ A;  3QDN A;  3L0H A;  1ZYQ B;  4EIP A;  5HR3 A;  2C0F A;  5JWO B;  1R5A A;  2X99 A;  4O92 A;  4GSN A;  1PX7 A;  2X8G A;  3GA4 A;  2R0P A;  3F3R A;  4EKZ A;  2E2G A;  1AC1 A;  3IAM 2;  5CRE A;  4XCS A;  2CAQ A;  3HKR A;  1AQV A;  4OMV A;  5GAP D;  1F3A A;  3GKN A;  3IC8 A;  3TJJ A;  3ISO A;  4YQM A;  1S3D A;  4OWY A;  3UJ1 A;  10GS A;  2H6Z A;  2HXK A;  2LRN A;  1OC3 A;  1NSW A;  1JLW A;  4IP6 A;  4TW5 A;  4G10 A;  4KGI A;  3Q6O A;  4MPF A;  1X9M B;  1PL2 A;  4YQU A;  2X8C A;  3CBU A;  4GQF A;  2RM5 A;  4MF6 A;  1OVN A;  1THX A;  2H73 A;  2MBS A;  4F0C A;  5ECL B;  2IMD A;  1XXU A;  1HNA A;  2GSR A;  2N5F A;  1NM3 A;  4YAV A;  1M7T A;  3TKQ A;  3DEX A;  5COH A;  1EP7 A;  2IFQ B;  3HA9 A;  1Z3E A;  2GVP A;  1J08 A;  4PNG A;  5DAK B;  2ON5 A;  4XS4 B;  4F2I A;  2MMN A;  2F9S A;  3BD2 A;  1QUW A;  2ZNM A;  4GLT A;  2HE3 A;  4DSR A;  3KEB A;  2NTO A;  2VCZ A;  4MMM A;  1URM A;  2LUS A;  1TU8 A;  2H01 A;  19GS A;  2EC4 A;  4L8E A;  3MSZ A;  3WGD A;  4IQA A;  1O81 A;  3R3E A;  2V2G A;  1XWG A;  3MIX A;  2GQM A;  2HT9 A;  4MJA A;  3UAR A;  2H1D A;  2B3S A;  2DIY A;  4CDO A;  1MD4 A;  2B6M A;  4KE3 A;  4MZB A;  2DIZ A;  3TJF A;  1T4Z A;  2QKE A;  1YKC A;  1EV4 A;  1YF1 A;  5F06 A;  3BBY A;  4K1F A;  4ZB6 A;  1ERW A;  4EDZ A;  2C0G A;  4DSS B;  4D73 A;  2YJH A;  2PER A;  3Q74 A;  2OKA A;  2YNX A;  4HOJ A;  2DJJ A;  2ZUP A;  2B5E A;  1JZD A;  2AYT A;  4RI6 A;  4RI7 A;  2C8U A;  2VLV A;  4LA1 A;  1V2A A;  1GWC A;  2K6V A;  5B8B A;  2H1B A;  3WD6 A;  3EIN A;  1X0R A;  2R3X A;  1XW9 A;  1T3B A;  2EIQ A;  2L6D A;  4HZ4 A;  4O5Q A;  3UIW A;  1TDI A;  2K9F A;  5ELA A;  2H70 A;  5DVB A;  1HNC A;  4POB A;  2JSZ A;  5B7C A;  5IO2 A;  5GAN D;  1Z9H A;  3FRC A;  4JR6 A;  4O32 A;  3IRA A;  1A8L A;  1F9M A;  3HD5 A;  1K3L A;  2X64 A;  4MZW A;  3HVS A;  2JL4 A;  3G7Y A;  1A2M A;  4ZBB A;  1XIY A;  2L6C A;  4GF0 A;  1USB A;  4MH2 A;  1O6J A;  2L5O A;  4BVX A;  2R0C A;  1Z7P A;  2HYX A;  4OO4 A;  5J4U A;  5IMC A;  3KIJ A;  2YZH A;  6GSS A;  1GLQ A;  2DMM A;  4IJ3 A;  4PNF A;  2H1G A;  3W8S A;  1OC9 A;  3I69 A;  17GS A;  4IP1 A;  1DUG A;  2YWO A;  3CSJ A;  1Q98 A;  1FB0 A;  2PVQ A;  3GL3 A;  2X8H A;  5D9V A;  4TRX A;  4MP4 A;  1X9W B;  2XC2 A;  1TRW A;  1DE1 A;  4PX1 A;  3UBL A;  4FYU A;  4ZL7 A;  1A0F A;  4K2X A;  4POM A;  2PMT A;  2AHE A;  1F3B A;  3GST A;  5ECH B;  4TR4 A;  1QGV A;  1SJ6 A;  1CQH A;  1U88 A;  3CYN A;  4GXZ A;  3MDK A;  4ML1 A;  2GGT A;  2YWM A;  4DEJ A;  5INY A;  2DJ0 A;  3VI5 A;  3ME7 A;  3TDG A;  2H6Y A;  5DQY A;  3QAW A;  3S9F A;  3KH7 A;  4KH7 A;  4PUF C;  4X4J A;  2GT5 A;  2H6X A;  1K0D A;  1V9W A;  2QGV A;  2FNO A;  2A2P A;  4ZB9 A;  4MK3 A;  3ZL5 A;  2J23 A;  3UEM A;  2VO4 A;  5ABR A;  3M8N A;  3ZVJ A;  1TW9 A;  4ZBA A;  1MD3 A;  2ZCT A;  3GRX A;  4G0K A;  1EGO A;  3EU3 A;  5FHI A;  3GKM A;  1G7O A;  4HJM A;  2QA2 A;  5G30 A;  4XS6 A;  1HD2 A;  3GKX A;  3EWL A;  4ZL9 A;  3EC3 A;  1PKW A;  4YAP A;  2VLT A;  3V1W A;  5ECN B;  3EMP A;  1U87 A;  4NXI A;  3IC4 A;  3L78 A;  3QR6 A;  2CV4 A;  2MYG A;  3DGQ A;  3KM6 A;  4D73 B;  2GQL A;  2HI7 A;  4F0B A;  3G9B A;  4HZ2 A;  4PGT A;  1G6Y A;  1V40 A;  1RQM A;  1PX6 A;  4CY8 A;  1OC8 A;  2FWH A;  4MAB A;  2LJR A;  3FMW A;  4HUA A;  5DCG A;  2R37 A;  3QFB C;  2FY6 A;  4K0N A;  1H4O A;  3ERF A;  3UVT A;  4KB3 A;  4KA0 A;  1K3O A;  1DE2 A;  4HEA 2;  3LEF A;  3GV1 A;  4KAE A;  4TR1 A;  1M99 A;  3TOT A;  2M46 A;  4PUA A;  2BTO T;  3GSS A;  5H5R A;  1B9Y C;  2C80 A;  4MA9 A;  1XWC A;  4IJI A;  4JZQ A;  3IOS A;  4O5U A;  3ZFB A;  2LKU A;  3KMN A;  1TRV A;  3C73 A;  3NOF A;  4NHW A;  1PN0 A;  4NV2 A;  2VM1 A;  3QFA C;  1LU4 A;  2R0G A;  4K5S A;  1GH2 A;  1R5P A;  3E9J B;  1GUL A;  1N8J A;  3EVI A;  1AQX A;  2IJY A;  1SEN A;  3QPM A;  3TCO A;  1TP9 A;  1GNW A;  1GSS A;  4BVX B;  1BQ7 A;  5AN1 A;  3BJ5 A;  4ECI A;  4K7I A;  3GMF A;  1XVQ A;  5D73 A;  1ACV A;  4Z7X A;  1OC9 B;  7GSS A;  4LLR A;  4WR4 A;  3IXR A;  3SWL A;  2FA8 A;  1GSF A;  2WGR A;  1BJX A;  4N11 A;  3VWV A;  3BOA A;  3F8U A;  3I9V 2;  4OO5 A;  4USS A;  1EGR A;  2NBS A;  2WCI A;  1FB6 A;  1SL0 B;  3ED3 A;  2OE1 A;  1O73 A;  3C1S A;  9GSS A;  3MAK A;  1B4Q A;  1TOF A;  5ECO B;  1ON4 A;  1QQ2 A;  3NZN A;  4QL9 A;  3A5I A;  3R2Q A;  5F05 A;  3TGZ A;  2HZE A;  1DSB A;  4CW9 A;  4TOP A;  3GUS A;  4H86 A;  3TB2 A;  6GSY A;  2CQ9 A;  6GSW A;  1WJK A;  3F4S A;  2YAN A;  5DAL A;  2KHP A;  2A2R A;  2QA1 A;  5D9T A;  1WPI A;  4POK A;  2WRT A;  4OFM A;  5HQP A;  5CRH A;  3RHC A;  1X5D A;  1Q4J A;  4KUN A;  4GRF A;  1EP8 A;  2LST A;  4P3Y B;  4XS1 A;  1SKS B;  1I5G A;  1XWB A;  1BG5 A;  2I9H A;  1AUC A;  4PQI A;  1WRY A;  2AUV A;  2IN3 A;  4GWR A;  2CAI A;  2IWT A;  1YQ1 A;  5BMU A;  5JCG A;  2F51 A;  4IN0 A;  3C7M A;  1SJZ A;  4J57 E;  4EVM A;  1SU9 A;  2B1K A;  4HU9 A;  2DBC A;  2HSY A;  3A2W A;  5ECP B;  4I2T A;  3IR4 A;  2J9H A;  5D9X A;  1FVJ A;  2YN1 A;  1WWJ A;  2LNS A;  1LBK A;  1TI3 A;  3GTU B;  1FG4 A;  5IMA A;  3LW9 A;  2LTK A;  1HYU A;  4G0L A;  4XTS A;  6GSU A;  3HJM A;  3LYP A;  1XWA A;  3IPZ A;  1YZX A;  4ISD A;  2G0F A;  4IVF A;  4EDY A;  3PH9 A;  2MBT A;  3EU4 A;  2DML A;  3FK8 A;  1S3A A;  2I1U A;  3W8J A;  4K6X A;  2X4A A;  4K8M A;  2H75 A;  4YKG A;  1VF1 A;  4KDU A;  8GSS A;  3VWW A;  3PGT A;  1FW1 A;  1O8X A;  1V57 A;  2VLU A;  3MNG A;  2FA4 A;  2VL2 C;  1ABA A;  3MYD A;  4I8B A;  4TR1 B;  4V2L A;  2LJA A;  2H71 A;  2ON7 A;  3HJP A;  3QOU A;  2LQO A;  5HFG A;  4EE0 A;  4L0U A;  1M9B A;  3O6T A;  1GUK A;  5IOW A;  1J9B A;  2F8A A;  3TKS C;  5KN3 A;  2EIO A;  4FIW A;  4MDC A;  2IMI A;  1I9D A;  4GSS A;  2ES7 A;  1C72 A;  3M9K A;  1GUH A;  3ZLP A;  2R6K A;  5ECQ B;  4WBJ A;  4ZBD A;  1TK0 B;  1X5E A;  3VFI A;  4Z2T A;  4ECB A;  4IQ1 A;  4GST A;  3DWV A;  1YJ6 A;  4Q5R A;  3M3M A;  1PMT A;  2NPB A;  4MJE A;  5AIX A;  4BA7 A;  2IIY A;  5DJL A;  3IV4 A;  2LRC A;  1TK8 B;  1R4W A;  3U5R E;  3TOU A;  1OYJ A;  4BPY A;  5DJM A;  4FO5 A;  1TK5 B;  2TRC P;  1AXD A;  5LD0 A;  1G7E A;  1XFL A;  1UA5 A;  3P7X A;  4MJB A;  4MLY A;  3WT1 A;  3P8W A;  1G6W A;  2YZU A;  4HQZ A;  1A23 A;  5GST A;  4TXV A;  2FWG A;  1BX9 A;  4ZB8 A;  4HU7 A;  4MNN A;  3GNJ A;  3ZVJ D;  2KP2 A;  3A2V A;  4GCI A;  2HRF A;  2B7J A;  2GSS A;  3US3 A;  5LNK e;  4N0Z A;  3RPN A;  1EOH A;  2CT6 A;  2LRT A;  1YDK A;  2I81 A;  3FKF A;  2HZE B;  1ZYE A;  1IYI A;  3M9J A;  5KN2 A;  2IPA A;  2CX4 A;  3C1R A;  5IO0 A;  1N2A A;  1SK0 A;  4WKW A;  4FYB A;  3GX0 A;  3ZTL A;  3TRQ A;  4AJ7 A;  3KD0 A;  5DAL B;  4KCE A;  5IMD A;  2BJX A;  4CHS A;  2OBK A;  5G5F A;  2VCV A;  4POL A;  2MMO A;  1B48 A;  1XZO A;  3EPT A;  4XHM A;  5G31 A;  3TKS E;  4GTU A;  2RLI A;  3CTG A;  5CRD A;  4KSO A;  2VOC A;  4TXO B;  2LNT A;  5AGY A;  1TRS A;  2PGT A;  3FEU A;  4KX4 A;  2DJ2 A;  4WXT A;  3QAV A;  2VCT A;  3UOM A;  2C3Q A;  3HVV A;  2OE0 A;  1GTU A;  2GZY A;  2L4Q A;  3DKS A;  1A8Y A;  3ERG A;  2H74 A;  1AAZ A;  1EEM A;  2LEG A;  3KTB A;  4E8H A;  4HI7 A;  1ZCP A;  1YY7 A;  2FWE A;  2DSA A;  4L0W A;  5AIV A;  5KN1 A;  5B6N A;  4PQH A;  4RQX A;  4G0I A;  5KN0 A;  1G0T A;  4WR5 A;  5KOW A;  3K8N A;  2VD0 A;  1Z7R A;  1U6T A;  1JZO A;  2E2M A;  3L4N A;  4AF2 A;  4K5R A;  4TN8 A;  2GTU A;  1VF3 A;  4K9Z A;  4EC0 A;  5FWG A;  5ECK B;  2B7K A;  5D8I A;  1GSY A;  5CAX A;  2H72 A;  2KP1 A;  3UMA A;  1XCC A;  1OE8 A;  2DKH A;  3A2X A;  2P5R A;  2DJ1 A;  4J56 E;  3QCP A;  2V41 A;  3FZA A;  3DD3 A;  4MH3 A;  1ERU A;  1EZK A;  2GZP A;  4V1A g;  4G9H A;  1GTA A;  1S3C A;  5H5Q A;  3VI7 A;  3EYT A;  4X43 A;  1K0A A;  2K8S A;  6GSV A;  3L9S A;  2IMF A;  4PXO A;  4L5O A;  4YQV A;  3ME8 A;  5DBQ A;  3TJB A;  4V2M A;  3H4K A;  2FHE A;  3C8E A;  1ERT A;  11GS A;  2FGX A;  1PKZ A;  4EL1 A;  4NPB A;  5A4V A;  1SJI A;  3KCM A;  2JZS A;  1TKD B;  1NHY A;  1K0N A;  3CTF A;  5B8A A;  2GSQ A;  2FWF A;  2WUL A;  4NMU A;  2E7P A;  1UVZ A;  3WYW A;  3EE2 A;  3CMI A;  2O89 A;  1GP1 A;  5HR0 A;  3GH9 A;  2XBI A;  2VAF A;  3IHG A;  2XBQ A;  1EOG A;  2KUC A;  1CQG A;  4MJC A;  4EUY A;  3LG6 A;  2XPD A;  4LL4 B;  2JAC A;  2N5A A;  2Z9S A;  1TI1 A;  2CX3 A;  2H76 A;  3GTU A;  3Q19 A;  1ERV A;  4EO3 A;  5JWR B;  4KSM A;  2VL9 A;  3A3T A;  3RDW A;  4IHU A;  4EXJ A;  3IK9 A;  5IMV A;  4X0X A;  2XHF A;  1OKD A;  3TKP A;  1TU7 A;  1GNE A;  3GL5 A;  1QXH A;  1Z6M A;  2HSH A;  1VF4 A;  1JHB A;  2HSM A;  1H75 A;  4TKY A;  1JZW A;  4ULX A;  3KP8 A;  3ZRE A;  5H5S A;  2FD3 A;  1J0F A;  1F2E A;  5ID2 A;  5ECI B;  3SBC A;  3WGX A;  4KCA A;  1XW5 A;  5ECM B;  2V6K A;  4N0V A;  4F03 A;  4NAX A;  2GZZ A;  4GQC A;  2YP6 A;  4E8E A;  3GUR A;  2EIR A;  1THO A;  2YPM A;  1EV9 A;  5AIS A;  1KBN A;  3LSZ A;  2H1A A;  1ZOF A;  2O7K A;  4I97 A;  1SYR A;  3GHA A;  3N9J A;  4HDE A;  4A5P A;  1M0U A;  4PUR A;  5JWQ B;  1XW6 A;  2UZ8 A;  3ZIJ A;  3TJK A;  1ZL9 A;  3G7J A;  3P2A A;  1E2Y A;  1W4V A;  4O7H A;  2N5B A;  1YEP A;  2B1L A;  5A5K A;  4LMW A;  2F8F A;  4OCF A;  2JZR A;  1DBY A;  3LJR A;  1VRS D;  2GLR A;  1XPV A;  3OR5 A;  5EL8 A;  3UL3 A;  2PUK C;  1A0R P;  5L71 A;  2HRA A;  3VPT A;  1BAY A;  1JLV A;  2OJL A;  3VWX A;  3IA1 A;  1TJD A;  1QMV A;  2L57 A;  4YH2 A;  2R4V A;  2NDO A;  3F6D A;  5IIZ A;  1KNG A;  3H93 A;  2E0Q A;  1WE0 A;  2GS3 A;  3KJY A;  1SKR B;  5EPF A;  1T4Y A;  2AAW A;  1SL2 B;  4EIQ A;  4Q5F A;  5IM9 A;  3D22 A;  3GH6 A;  3QAG A;  4OFT A;  1FHE A;  1AW9 A;  3U6V A;  1BYE A;  3TJG A;  3VPQ A;  3D6I A;  4O5R A;  3IBH A;  4WET A;  1HNB A;  2HFD A;  2XPE A;  2DKI A;  1ZYN A;  1ZMA A;  3NIV A;  2JU5 A;  4ECC A;  3GFK A;  2MMA A;  1F37 A;  1GTI A;  4WEY A;  5GSS A;  2C3N A;  1FO5 A;  2O87 A;  2OAD A;  3DVX A;  3H1N A;  3KZQ A;  1ZZY A;  5A4U A;  4JU5 A;  3HY2 A;  3IK7 A;  5KOX A;  2VL3 A;  1LJR A;  1XOA A;  3AY8 A;  3IAS 2;  2VCX A;  4J2F A;  3UAP A;  3APS A;  5CRG A;  3ZZX A;  1K0C A;  4ID0 A;  4TXO A;  2X49 A;  3TRX A;  2WB9 A;  4NHZ A;  3CXG A;  1MEK A;  4IKH A;  3TUE A;  4WBR D;  4YKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...