2MMOA

Solution structure of the oxidised thioredoxin from plasmodium falciparum
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Solution Structure of Plasmodium falciparum Thioredoxin
rcsb
source organism Plasmodium falciparum
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mmoA00
1MTCA 3HJMA 3FKFA 1ERWA 3MSZA 1EP7A 1GNEA 1SJIA 2VCXA 4KSOA 1EWXA 1R4WA 3CBUA 4KUNA 4F0CA 2F9SA 5D9TA 5IMAA 1OVNA 2BMXA 2H1AA 3L4NA 1I9DA 1TU8A 4QL9A 1X9WB 4KAEA 3CXGA 1IYIA 5IMZA 2C80A 2CAQA 5ECMB 3HCZA 2YZUA 1EEMA 3DWVA 2YPMA 4POBA 2H1BA 1NSWA 2DC5A 2IMDA 3N9JA 2HZFA 1ERTA 4IP6A 2XHFA 3UBKA 2VO4A 4JRRA 3EE2A 1PN9A 3IOSA 3DVWA 3APOA 5B8AA 1LJRA 2JL4A 20GSA 4OO5A 2C3QA 2X8GA 1JHBA 4OCEA 2VOCA 2C8UA 2WULA 1K0MA 3M9KA 4FIWA 1PSQA 1SD8A 3K8NA 3KEBA 4OFMA 1SKWB 1PRXA 4L5OA 4KB3A 3H8QA 1PL1A 2PPTA 3ZVJA 1XOAA 4ECJA 4EL1A 5GAPD 1F37A 1ACVA 10GSA 3MNGA 3GIXA 2VLVA 3IXRA 1ST9A 4FH8A 3WT1A 4XIHA 2CZ3A 4IS0A 3QD9A 1XWKA 3HVSA 2HNLA 5IM9A 4F03A 5E4WA 1VF4A 2PU9C 3G7IA 3FW2A 3UVTA 3CTGA 3AY8A 2RUFA 2H01A 3GSSA 5F06A 3TJGA 1TI1A 1VF2A 3GTUA 1AUCA 3TJFA 4BVXA 1X5DA 4G19A 5B6MA 5IIZA 2PBJA 2YOIA 3CSIA 1T7PB 2H8LA 3FZ9A 4HDEA 3F4TA 4DSQA 1NM3A 3IPZA 2XBQA 2R4VA 1Z9HA 5ELGA 4OMVA 2DLXA 4HJMA 3P2AA 1TJDA 2DMLA 4ILFA 1B4QA 2DMMA 2FA8A 4ZB6A 2O7KA 3HKRA 2H75A 2M80A 1O85A 3CYNA 1MDIA 1GSSA 1EV4A 5ELAA 5KN1A 4PUFC 3HJOA 3CMIA 4KW6A 1T1VA 2FGXA 2L6DA 4NMUA 1DE1A 4AJ8A 1MDJA 1URMA 3DXBA 2VL3A 2GSTA 2L59A 5ECIB 1EP8A 3P90A 3S9FA 4I2TA 2B5EA 1YDKA 4GTUA 12GSA 1E2YA 1HNAA 1NW2A 4TKYA 2HLSA 2KUCA 1G7EA 2A4VA 4EXJA 3TDGA 4XS6A 3DRNA 1G6YA 2HT9A 3HD5A 5AN1A 1Q4JA 1RK4A 3V1WA 2LRCA 1X9MB 3LYKA 1U87A 3PINA 3VWUA 5IMDA 1G6WA 2R6KA 1GH2A 3M0FA 1O6JA 4AJ6A 5DDLA 1EZKA 4Q5QA 4HQZA 5F05A 4HI7A 1GP1A 2VM1A 1H4OA 1A2JA 1GSUA 5ID2B 3HVVA 6GSYA 2O87A 1B9XC 2LQQA 1ERUA 4IN0A 3BD2A 3EYTA 3L0HA 1GNWA 1QGVA 4CW9A 3N5OA 2DIYA 1XWGA 4X0XA 1BQ7A 1MD4A 2IMFA 4FO5A 1AQWA 4KGIA 1GTIA 4ZXGA 1GUHA 2YV9A 4EDYA 5IO0A 4FYUA 2AHEA 2LJRA 6GSSA 3BJ5A 4LA1A 2YANA 4HOJA 1A2LA 2I9HA 2ZCTA 2CVBA 2PN8A 5DAKB 1NHOA 2A2RA 1KTEA 2H73A 1XVQA 2H0HA 4HS1A 3D4TA 3GNJA 1FVJA 1QXHA 4J56E 1IYHA 2L4CA 1I5GA 4F9ZA 2FA4A 5E59A 1XBSA 4BA7A 3WD6A 3F63A 1M2BA 2DJ2A 3JCML 4RI6A 1EGRA 2B6MA 3VK9A 2H0IA 3A2VA 4LL1B 2F8AA 2WGRA 3HZ8A 3VWXA 1XFLA 2EIOA 3C1SA 3W8JA 5H5RA 1FAAA 4RQXA 5EPFA 5C04A 3TJJA 1KEBA 4Z7XA 5KN0A 1K0NA 1X0RA 2GSRA 2B7KA 3NZNA 3C7MA 2IFQA 1YF0A 3C71A 4V2LA 5D9WA 1EOGA 3VLNA 4BWSA 5JCWA 4IW9A 3F4SA 1K0DA 3KTLA 3VPTA 1THXA 3TOTA 3PR8A 1WE0A 4YQMA 3A3TA 3DGQA 3I6AA 2WJUA 1OC3A 4AGSA 2VL2C 3GKKA 3ZLPA 4WBRD 3Q18A 1A24A 3KJYA 3VPQA 4XRDA 1G0TA 3IHQA 3GFKA 2BJXA 2LRNA 1UVZA 4I97A 1RW1A 3TRQA 3ZVJD 4O32A 4J2FA 5G31A 4Q5NA 1PL2A 2YCDA 1YEPA 4L8EA 2B1KA 3M3MA 2R37A 4K0GA 4K7NA 1XPVA 1F6MC 1ILOA 1TOFA 1HNBA 3KMOA 4WBJA 4E8EA 2MZCA 1K0OA 1SL0B 3H4KA 1TDIA 3RDWA 4L0WA 2HI7A 4TXOB 14GSA 2LNSA 3I69A 1R5PA 2WCIA 2C3NA 4N30A 2K18A 1WPIA 5G30A 2HSHA 3CTFA 3M9JA 4ULXA 5LCZA 4Q5FA 5CNWA 2YWIA 1E6BA 2RLIA 5ABRA 2B5YA 2H71A 2LJKA 4K1FA 4TOPA 1SK2A 4MDCA 5CYYA 18GSA 2LNTA 2FD3A 5G5FA 4NXIA 5DALA 5D93A 2FWHA 2CV4A 1M9BA 4HEA2 2L57A 2GQLA 5DAKA 2X64A 4HUAA 5INYA 1F9MA 3BOAA 4MJEA 2VCQA 3LEFA 4EVMA 2MBSA 2DIZA 2WFCA 1XVWA 1B48A 3F3RA 4IGJA 1KNGA 1BJXA 2B3SA 1Z6NA 3TKQA 1OE8A 1DUGA 2GDRA 2GLRA 4IKHA 3NOFA 4GSTA 1SKSB 1WOUA 4RI7A 3HVXA 1ZMAA 2K6VA 2YWOA 1XZOA 5J9BA 1ZYEA 1XW6A 5IMCA 3Q19A 4LLRA 2V1MA 4K9ZA 4YQUA 2PVQA 4K8MA 2GS3A 4MA9A 4ISDA 5C00A 1R7HA 2EIQA 1JZDA 1PD21 5B7CA 3ZTLA 3O3TA 5H5SA 1UC7A 2KP2A 3F6FA 3GRXA 6GSVA 3DEXA 3IAM2 4DEJA 4PUAA 2AV4A 4OWYA 3GKMA 3IK7A 3F4RA 3GH6A 4KX4A 5JWRB 4I2UA 2VD0A 3ZREA 6GSUA 2LJAA 2GZZA 4G10A 2GTUA 1ZZYA 2QSIA 5ECSA 3HHVA 2MMZA 1V2AA 3G7JA 4EE0A 1V98A 5KEJA 3L9UA 1DE2A 4GQCA 3D5JA 3LXZA 3ERGA 1SJZA 1VRSD 2PGTA 1Y6EA 5CAXA 3ZRDA 4ZIJA 2Z9SA 3VURA 3FK8A 2C4JA 2KLXA 2B1LA 4FYCA 4TN8A 2DJJA 2N5AA 2K8VA 1T00A 2E0QA 1DBYA 4PNGA 5DQYA 4ZB8A 4PQHA 5IPHA 4MABA 3IDVA 1R26A 4MF6A 1LBKA 2LS5A 2E7PA 1WMJA 1ZYQB 2VM2A 2RUEA 4XCSA 2R3XA 1MD3A 1VGLA 4LMVA 2WDUA 5KN2A 1QUWA 3LSZA 2H70A 2XPEA 1JLVA 3IBHA 2YWMA 1TTZA 4O92A 2ES7A 2GGTA 5ECLB 1SKRB 3KP8A 3GL3A 1K0CA 1LU4A 3DMLA 4ML6A 5A4VA 1WRYA 3KCMA 2DBCA 2VCZA 3DYRA 2CT6A 2IN3A 3FZAA 1PKZA 5B6NA 1W89A 1PA3A 2O8VB 5AGYA 3M8NA 1EV9A 4PXOA 2J9HA 2CQ9A 2VCWA 1GTUA 22GSA 3RHBA 4GQFA 1XW5A 1SU9A 2LSTA 4XRAA 2H6ZA 2D2ZA 1YZXA 3M1GA 5D9VA 5HFGA 2HYXA 2LRTA 4D73B 3F0IA 3VWWA 4HZ4A 3W8SA 4QL7A 3TRPA 2MYGA 4JE1A 1T4ZA 5EVOA 5JWOB 1ERVA 1BX9A 2MMNA 4KDYA 4MF7A 3C1RA 2YP6A 2JZSA 1AXDA 2HSYA 4H86A 1AQVA 4XS4B 3TKPA 3RBTA 1PQNA 3ISOA 1BYEA 4CHSA 4ECIA 4GRFA 4PGTA 4LMWA 1XW9A 2YJ7A 4OFTA 1C72A 1GSYA 2PUKC 3RHCA 2VUPA 2HRFA 3KH9A 3TJKA 3HJPA 2F51A 1M2AA 4TVEA 5J3RA 4NHWA 5L71A 3APSA 2LV3A 2EC4A 1A2MA 3UBLA 1XXUA 1T3BA 1J0FA 2H1DA 3RPPA 2DJKA 3QFBC 5IMFA 4ACSA 1O8WA 4TRXA 4POMA 4IHUA 4NWYA 5LD0A 2PERA 4ZL9A 2QGVA 3DD3A 1YKCA 2CAIA 2I4AA 2WS2A 4WXTA 1K0AA 4V1Ap 4IJ3A 4PQIA 1YJ6A 1FW1A 2PMTA 3IA1A 4KDXA 2O85A 2X8HA 3CSHA 5GSTA 1EGOA 4DVCA 2L5LA 1SYRA 3EVIA 4AJ7A 1AQXA 1SL1B 4JZQA 1T4YA 2CVKA 3QFAC 1JFUA 3MWHA 5HR0A 2K8SA 1HYUA 4RUVA 5EL8A 4MLYA 3HY2A 2OBKA 1GSQA 2X99A 3IC4A 2GZPA 1TRUA 4QQ7A 4J57E 4K0NA 2WRTA 2QC7A 1TU7A 3LWAA 4EO3A 5A4WA 4MP4A 3ZMLA 2C0FA 3GMFA 2GQMA 1U3AA 1W4VA 1JZWA 3E3EA 3QOUA 3FYGA 4KE3A 2H6XA 5DJMA 2JSZA 2KOKA 5HFKA 3CSJA 4POKA 1JZOA 3ZIVA 4ZBBA 2GSSA 2HFDA 4F0BA 4POLA 2V6KA 3F8UA 4X1UA 1S3DA 5CRHA 4JBBA 1X5EA 4L5LA 1OC8A 4DSRA 1X9SB 5AISA 3U5RE 1OAZA 3KGKA 1MDKA 1YF1A 4BVYA 3WT2A 4PURA 2G0FA 3H79A 1GSEA 2I3YA 17GSA 5GZZB 4HJ2A 4YH2A 5EY6A 4MJBA 3ZFLA 3HYPA 1JLWA 4OFNA 4D73A 1SJ6A 3C73A 5ECKB 5ECNB 2OE0A 1CQGA 4ZB9A 4L0UA 4GCIA 2C0GA 4MF5A 1AC1A 5COHA 4MK3A 4TXVA 1O8XA 1Y25A 1YQ1A 3NIVA 1TK0B 1TXXA 1A0FA 3TKSE 4EKZA 3ZYWA 3FRCA 4NV2A 4XS4A 3KXOA 3F6DA 1ZL9A 3UEMA 5HR1A 3SWLA 3WGEA 1M0UA 3QCPA 2MBTA 2LEGA 2NTOA 2CZ2A 3EWLA 5D8IA 1U88A 2XBIA 3ERWA 1GSDA 1H75A 2TIRA 2B7JA 2L6CA 5JWQB 2RIIA 3QAVA 2H74A 2N5FA 5H5QA 1TI3A 1R5AA 3UIWA 1V58A 3L78A 3GKNA 2H30A 2NBSA 2E2GA 4P3YB 4IJIA 1Z7RA 4IQ1A 2HRNA 1GSFA 3LG6A 3QAWA 3UAPA 2IIYA 3DIEA 3D0ZA 3KH7A 2HZEB 1OYJA 2LKUA 2OKAA 1Z3EA 6GSWA 2REMA 4F2IA 4MZBA 3TJBA 3MAKA 5IO2A 1K3OA 5ID2A 3TKRA 3HDCA 2O89A 2L4QA 4EF0A 2HE3A 3US3A 3D6IA 3UL3A 2JACA 3TKSA 3GURA 4YQVA 3GHAA 5IMVA 4GXZA 3EU4A 2JZTA 2JU5A 1XWAA 2C0DA 4IVFA 1CQHA 5CO3A 1GUKA 4DSSB 4TR1B 5CRGA 3GYKA 5G1LA 2JZRA 4NV5A 2R2JA 1QQ2A 3GX8A 4WF4A 3IAS2 1Z5YE 2P5RA 4HZ2A 1HD2A 2AB6A 4IELA 4OO4A 1EOHA 2H1GA 5HR3A 3F3QA 4ID0A 3LQ7A 5IOXA 2ALBA 3UVHA 5CRDA 5A4UA 4MH2A 2OE3A 2V32A 2B5XA 2EIRA 2JSYA 2NVLA 1USBA 1J08A 5ECRB 3PGTA 1SK0A 1FG4A 2E2MA 3IE3A 1QMVA 4MJCA 4V2NA 1FB0A 4FYBA 4KNDA 4XTSA 1GUMA 2GT5A 3O76A 3OR5A 2X8CA 1SL2B 4EUYA 5JCGA 5F8BA 5F07A 2QKEA 2P0GA 2IWTA 3Q6OA 3QDNA 4K6XA 5D96A 4O5RA 2F3MA 2XPDA 1M7TA 4ECCA 1KBNA 4WF5A 2A2SA 1GTAA 3E9JB 3A2XA 2TRCP 3GH9A 4ML1A 3LJRA 3MDKA 3PH9A 3HA9A 3ZMKA 1EEJA 3H93A 1XWBA 1GLPA 2FWGA 2IMEA 2VCVA 1M9AA 4MZCA 4AF2A 2GZYA 3BCKA 4G2EA 3VI5A 1N2AA 1F3AA 3FR3A 4GWRA 3BBYA 4GSNA 4HU9A 3SBCA 2M46A 3WYWA 5HQPA 5ENUA 1TK5B 2YV7A 1V57A 2VLUA 3EMPA 2OADA 3IR4A 13GSA 1A8LA 1XOBA 5IOWA 4GSSA 3CRTA 3IV4A 3ZITA 2VL9A 4I8BA 3D22A 5F0GA 3FR9A 5G2ZA 5DVBA 1MEKA 3TOUA 3D4MA 4YAVA 4X43A 1TW9A 2HZEA 2RM5A 4TXOA 1F2EA 3Q74A 1Q98A 4KDUA 3R2QA 5FWGA 1GULA 2FWFA 3TKSC 5AIVA 2C0EA 4I5QA 4NAXA 3VI7A 3EU3A 6GSTA 1U3IA 3UOMA 2OACA 1AAZA 2FHEA 2AYTA 2IL3A 3KD0A 1JZRA 1K0BA 2HXKA 3QAGA 2C3TA 3FEUA 3KZQA 2VLTA 1V40A 4DSSA 1ZCPA 1F3BA 4TR1A 2LTKA 1NHYA 1U6TA 2AUVA 5HFIA 4ZBDA 1SD9A 1M2DA 4E8HA 5J5NA 2K9FA 2RM6A 3ZIJA 2DSAA 4NHZA 5CRWA 3VFIA 1ZGNA 4K7OA 1GLQA 2WB9A 5G1KA 4OCFA 1GL8A 1FB6A 3GN3A 3FZ4A 11GSA 1BEDA 5DCGA 2JADA 4MCUA 3RPNA 4PQ1A 1M99A 8GSSA 4O7HA 5LNKe 3I9V2 4TW5A 2IFQB 1ON4A 4BL7A 2C1YA 1VF3A 2J23A 3I43A 4HU7A 4TR4A 4WEYA 5ECHB 5KN3A 4K2DA 3TGZA 3UJ1A 2NDOA 4PNFA 5IPGA 1DSBA 2VIMA 2VCTA 2KHPA 2M72A 4GLTA 4ZL8A 2VL2A 4JEDA 4MPGA 4KCEA 2WZ9A 1WP0A 3DVXA 1HNCA 1AIUA 5DCHA 2LQOA 4MPFA 1XWCA 4WR4A 3ED3A 1XIYA 5J4UA 5FHIA 3G7YA 4IP1A 1B8XA 1YY7A 1OC9B 2P5QA 1OE7A 3FZ5A 3J7Yb 3FR6A 2IMIA 2BTOT 2FWEA 1YKAA 19GSA 4N10A 2PWJA 3LGCA 3FHKA 4N11A 2CVDA 4OD7A 3ZZXA 5D73A 3L9SA 3TB2A 1N8JA 4YAPA 5JCUA 2MMAA 4KH7A 4CDOA 1RQMA 1FO5A 2F8FA 1ZOFA 1PX7A 3A2WA 4MH3A 4JR6A 3GX0A 3J7Yk 1K3YA 3HZ4A 1PMTA 1TRWA 2YZHA 5J9CA 4TR3A 3EINA 1OKTA 1SENA 2GQKA 1OKDA 3EC3A 3KP9A 4EDZA 2IPAA 4RQRA 2R5GA 3DKSA 3GV1A 1FVKA 1SYXA 4F82A 4XHMA 1UN2A 4KCAA 3WGDA 4NPBA 3ERFA 1T8EB 2FY6A 3QPMA 4N0VA 2FLSA 4BPYA 7GSSA 2I1UA 2YNXA 4Q5RA 3QMXA 2DJ3A 5DALB 2L5OA 2CA8A 4MJAA 5DJLA 3H1NA 4MZWA 4KA0A 5GAND 3CRUA 1B9YC 5J41A 2KP1A 2G2QA 2FCHA 1WWJA 1J9BA 3KMNA 3P7XA 2ON5A 1YEXA 3P8WA 5DBQA 2N5BA 3ME8A 2V6OA 4TR0A 3IK9A 1A23A 1O81A 2CX3A 1B4PA 3O6TA 3G9BA 3TCOA 2V2GA 1TRSA 2VAFA 2OJLA 3UARA 1FHEA 1PX6A 3GKXA 4IBPA 2I81A 3RAZA 2DJ0A 3A5WA 5D9XA 2H6YA 1WIKA 4PX1A 3D21A 2H72A 1X5CA 1O73A 3LYPA 3VWVA 5ECOB 1FOVA 3TRXA 1TK8B 1UA5A 1TP9A 4G9HA 1O7UA 1Z6MA 4K7IA 2IJYA 9GSSA 2CX4A 4ECBA 4WETA 3L9VA 3IRAA 2GSQA 1WJKA 3F9UA 1TRVA 5B8BA 3GA4A 4LL4B 3KIJA 1BG5A 2LUSA 1THOA 5A5KA 5AIXA 2P31A 4ZBAA 3TUEA 4JR4A 2ZUPA 2OE1A 1VF1A 3HXSA 2AJQB 4WKWA 3GSTA 3W6GA 5FT3A 6GSXA 2FUG2 3FY7A 3UMAA 2ZNMA 1GTBA 4HQSA 1OC9A 2YWNA 4IQAA 2H0GA 2IMKA 2GT6A 4MMMA 3KTBA 5DQSA 3EMXA 4V2MA 4EC0A 5CP1A 3LFLA 1BAYA 3ZFBA 1V9WA 3LXTA 2GVPA 2ON7A 3QR6A 1ABAA 1S3CA 1K3LA 2H19A 1HQOA 3APQA 5ECPB 4JU5A 2FNOA 2H66A 16GSA 3U6VA 5GSSA 3E0UA 1AW9A 2XC2A 1A8YA 3EURA 3LORA 2YJHA 3ME7A 3GTUB 4KSMA 4N0ZA 2VD1A 2TRXA 3BCIA 3C8EA 1TKDB 5G5EA 4ZL7A 4BWQA 1SK1A 2DJ1A 1S3AA 1XCCA 2V41A 1PGTA 4GF0A 4ZILA 1QK8A 4V1Ag 2PVOC 1Z7PA 1G7OA 4XS1A 2YN1A 1GWCA 5ECQB 1GRXA 5CREA 4WR5A 5HR2A 3GL5A 1ML6A 2OBIA 3KM6A 1QFNA 5IQYA 3WGXA 3ZL5A 1PKWA 3GUSA 2OA7A 4I6XA 2H76A 1A0RP 2NPBA 2MMOA 2AAWA
chains in the Genus database with same CATH superfamily
1MTCA 4KF9A 3HJMA 3FKFA 1ERWA 3MSZA 1EP7A 1GNEA 1SJIA 2VCXA 4KSOA 1EWXA 3A5IA 1R4WA 3CBUA 4KUNA 4F0CA 2F9SA 5D9TA 5IMAA 1OVNA 2BMXA 2H1AA 3L4NA 1I9DA 1TU8A 4QL9A 1X9WB 4KAEA 3CXGA 1IYIA 5IMZA 2C80A 2CAQA 5ECMB 3HCZA 2YZUA 4HSCX 1EEMA 3DWVA 2YPMA 4POBA 2H1BA 1NSWA 2DC5A 2IMDA 3N9JA 2HZFA 1ERTA 4IP6A 2XHFA 3UBKA 2VO4A 4JRRA 3EE2A 1PN9A 3IOSA 3DVWA 3APOA 5B8AA 1LJRA 2JL4A 20GSA 4OO5A 1XG8A 2X49A 2C3QA 2X8GA 1JHBA 4OCEA 2VOCA 2C8UA 2WULA 1K0MA 3M9KA 4FIWA 1PSQA 1SD8A 3K8NA 3KEBA 4OFMA 1SKWB 4CY8A 1PRXA 4L5OA 4KB3A 3H8QA 1PL1A 2PPTA 3ZVJA 1XOAA 4ECJA 4EL1A 5GAPD 1F37A 1ACVA 10GSA 3MNGA 3GIXA 2VLVA 3IXRA 1ST9A 4FH8A 3WT1A 4XIHA 2CZ3A 4IS0A 3QD9A 1XWKA 3HVSA 2HNLA 5IM9A 4F03A 5E4WA 1VF4A 2PU9C 3G7IA 3FW2A 3UVTA 3CTGA 3AY8A 2RUFA 2H01A 3GSSA 5F06A 3TJGA 1TI1A 1VF2A 1ZYNA 3GTUA 1AUCA 3TJFA 4BVXA 1X5DA 4G19A 5B6MA 5IIZA 2PBJA 2YOIA 3CSIA 1T7PB 2H8LA 3FZ9A 4HDEA 3F4TA 4DSQA 1NM3A 3IPZA 2XBQA 2R4VA 1Z9HA 5ELGA 4OMVA 2DLXA 4HJMA 3P2AA 1TJDA 2DMLA 4ILFA 1B4QA 4K2XA 2DMMA 2FA8A 4ZB6A 2O7KA 3HKRA 2H75A 2M80A 1O85A 1PFOA 3CYNA 1MDIA 1GSSA 1EV4A 5ELAA 5KN1A 4PUFC 3HJOA 3CMIA 4KW6A 1T1VA 2FGXA 2L6DA 4NMUA 1DE1A 3MIXA 4AJ8A 1MDJA 1URMA 3DXBA 2VL3A 2GSTA 2L59A 5ECIB 1EP8A 3P90A 3S9FA 4I2TA 2B5EA 1YDKA 4GTUA 12GSA 1E2YA 1HNAA 1NW2A 4TKYA 2HLSA 2KUCA 1G7EA 2A4VA 4EXJA 3TDGA 4XS6A 4Z2TA 3DRNA 1G6YA 2HT9A 3HD5A 5AN1A 1Q4JA 1RK4A 3V1WA 2LRCA 1X9MB 3LYKA 1U87A 3PINA 3VWUA 5IMDA 1G6WA 2R6KA 1GH2A 3M0FA 1O6JA 4AJ6A 5DDLA 1EZKA 4Q5QA 4HQZA 5F05A 4HI7A 1GP1A 2VM1A 1H4OA 1A2JA 1GSUA 5ID2B 3HVVA 6GSYA 2O87A 1B9XC 2LQQA 1ERUA 4IN0A 3BD2A 3EYTA 3L0HA 1GNWA 1QGVA 4CW9A 3N5OA 2DIYA 2HRKA 1XWGA 4X0XA 3CQFA 1BQ7A 1MD4A 2IMFA 1FOHA 4FO5A 1AQWA 4KGIA 4EIQA 1GTIA 4ZXGA 1GUHA 2YV9A 4EDYA 5IO0A 4FYUA 2AHEA 2LJRA 6GSSA 3BJ5A 4LA1A 2YANA 4HOJA 1A2LA 2I9HA 2ZCTA 2CVBA 2PN8A 5DAKB 1NHOA 2A2RA 1KTEA 2H73A 1XVQA 2H0HA 4HS1A 3D4TA 3GNJA 1FVJA 1QXHA 4J56E 2DKHA 1IYHA 2L4CA 1I5GA 4F9ZA 2FA4A 5E59A 1XBSA 4BA7A 3WD6A 3F63A 1M2BA 2DJ2A 3JCML 4RI6A 1EGRA 2B6MA 3VK9A 2H0IA 3A2VA 4LL1B 2A4HA 2F8AA 2WGRA 3HZ8A 3VWXA 1XFLA 2EIOA 3C1SA 3W8JA 5H5RA 1FAAA 4RQXA 5EPFA 5C04A 3TJJA 1KEBA 4Z7XA 5KN0A 1K0NA 1X0RA 2GSRA 2B7KA 3NZNA 3C7MA 2IFQA 1YF0A 3C71A 4V2LA 5D9WA 1EOGA 3VLNA 4MNNA 4BWSA 5JCWA 4IW9A 3F4SA 1K0DA 3KTLA 3VPTA 1THXA 3TOTA 3PR8A 1WE0A 4YQMA 3A3TA 3DGQA 3I6AA 2WJUA 1OC3A 4AGSA 2VL2C 4EIPA 3GKKA 3ZLPA 4WBRD 3Q18A 1A24A 3KJYA 3VPQA 4XRDA 1G0TA 3IHQA 3GFKA 2BJXA 2LRNA 1UVZA 4I97A 1RW1A 3TRQA 3ZVJD 4O32A 4J2FA 5G31A 3IHGA 4Q5NA 1PL2A 2YCDA 1YEPA 4L8EA 2B1KA 3M3MA 2R37A 4K0GA 4K7NA 1XPVA 1F6MC 1ILOA 1TOFA 1HNBA 3KMOA 4WBJA 4E8EA 2MZCA 1K0OA 1SL0B 3H4KA 1TDIA 3RDWA 4L0WA 2HI7A 4TXOB 14GSA 2LNSA 3I69A 1R5PA 2WCIA 2C3NA 4N30A 2K18A 2HSMA 1WPIA 5G30A 2HSHA 3CTFA 3M9JA 4ULXA 5LCZA 4Q5FA 5CNWA 4ICYA 2YWIA 1E6BA 5KOXA 2RLIA 5ABRA 2B5YA 2H71A 2LJKA 4K1FA 4TOPA 1S3RA 1SK2A 4MDCA 5CYYA 18GSA 2LNTA 2FD3A 5G5FA 4NXIA 5DALA 5D93A 2FWHA 2CV4A 1M9BA 4HEA2 2L57A 2GQLA 5DAKA 2X64A 4HUAA 5INYA 1F9MA 3BOAA 4MJEA 2VCQA 3LEFA 4EVMA 4Z2UA 2MBSA 2DIZA 2WFCA 1XVWA 1B48A 2R0PA 3F3RA 4IGJA 1KNGA 1BJXA 2B3SA 1Z6NA 3TKQA 1OE8A 1DUGA 2GDRA 2GLRA 4IKHA 3NOFA 4GSTA 1SKSB 1WOUA 4RI7A 3HVXA 1ZMAA 2K6VA 2YWOA 1XZOA 5J9BA 1ZYEA 1XW6A 5IMCA 3Q19A 4LLRA 2V1MA 4K9ZA 4YQUA 2PVQA 4K8MA 2GS3A 4MA9A 4ISDA 5C00A 1R7HA 2EIQA 1JZDA 1PD21 5B7CA 3ZTLA 3O3TA 5H5SA 1UC7A 2KP2A 3F6FA 3GRXA 6GSVA 3DEXA 3IAM2 5BRTA 4DEJA 4PUAA 2AV4A 4OWYA 3GKMA 3IK7A 3F4RA 3GH6A 4KX4A 5JWRB 4I2UA 2VD0A 3ZREA 6GSUA 2LJAA 2GZZA 4G10A 2GTUA 1ZZYA 2QSIA 5ECSA 3HHVA 2MMZA 1V2AA 3G7JA 4EE0A 1V98A 5KEJA 3L9UA 1DE2A 4GQCA 3D5JA 3LXZA 3ERGA 1SJZA 1VRSD 2PGTA 1Y6EA 5CAXA 3ZRDA 4ZIJA 2Z9SA 3VURA 3FK8A 2C4JA 2KLXA 2B1LA 4FYCA 4TN8A 2DJJA 2N5AA 2K8VA 1T00A 2E0QA 1DBYA 4PNGA 5DQYA 4ZB8A 4PQHA 5IPHA 4MABA 3IDVA 1R26A 4MF6A 1LBKA 2LS5A 2E7PA 4USSA 1WMJA 1ZYQB 2VM2A 2RUEA 4XCSA 2R3XA 1MD3A 1VGLA 4LMVA 2WDUA 5KN2A 1QUWA 3LSZA 2H70A 2XPEA 1JLVA 3IBHA 2YWMA 1TTZA 4O92A 2ES7A 2GGTA 5ECLB 1SKRB 3KP8A 3GL3A 1K0CA 1LU4A 3DMLA 4ML6A 5A4VA 1WRYA 3R3EA 3KCMA 2DBCA 2VCZA 3DYRA 2CT6A 2IN3A 3FZAA 1PKZA 5B6NA 1W89A 1PA3A 2O8VB 5AGYA 3M8NA 4BVYB 1EV9A 4PXOA 2J9HA 2CQ9A 4A5PA 2VCWA 1GTUA 22GSA 3RHBA 4GQFA 4O5UA 1XW5A 1SU9A 2LSTA 4XRAA 2H6ZA 2D2ZA 1YZXA 3M1GA 5D9VA 5HFGA 2HYXA 2LRTA 4D73B 3F0IA 3VWWA 4HZ4A 3W8SA 4QL7A 3TRPA 2MYGA 4JE1A 1T4ZA 5EVOA 5JWOB 4Z2RA 1ERVA 1BX9A 2MMNA 4KDYA 4MF7A 3C1RA 2YP6A 2JZSA 1AXDA 2HSYA 4H86A 1AQVA 4XS4B 3TKPA 3RBTA 1PQNA 3ISOA 1BYEA 4CHSA 4ECIA 4GRFA 4PGTA 4LMWA 1XW9A 2YJ7A 4OFTA 1C72A 1GSYA 2PUKC 3RHCA 2VUPA 2HRFA 3KH9A 3TJKA 3HJPA 2F51A 1M2AA 4TVEA 5J3RA 4NHWA 5L71A 3APSA 2LV3A 1M3IA 2EC4A 1A2MA 3UBLA 1XXUA 1T3BA 1J0FA 2H1DA 3RPPA 2DJKA 4O5QA 3QFBC 5KOWA 5IMFA 4ACSA 1O8WA 4TRXA 4POMA 4IHUA 4NWYA 5LD0A 2PERA 4ZL9A 2QGVA 3DD3A 1YKCA 2CAIA 2I4AA 2WS2A 4WXTA 1K0AA 4V1Ap 4IJ3A 4PQIA 1YJ6A 1FW1A 2PMTA 3IA1A 4KDXA 2O85A 2X8HA 3CSHA 5GSTA 1EGOA 4DVCA 4K5SA 2L5LA 2X4AA 1SYRA 3EVIA 4AJ7A 1AQXA 1SL1B 4JZQA 1T4YA 2CVKA 3QFAC 1JFUA 3MWHA 5HR0A 2K8SA 1HYUA 4RUVA 5EL8A 4MLYA 3HY2A 3IC8A 2OBKA 1GSQA 2X99A 3IC4A 2GZPA 1TRUA 4QQ7A 4J57E 4K0NA 2WRTA 2QC7A 1TU7A 3LWAA 4EO3A 5A4WA 4MP4A 3ZMLA 2C0FA 3GMFA 2GQMA 1U3AA 1W4VA 1JZWA 3E3EA 3QOUA 3FYGA 4KE3A 2H6XA 5DJMA 2JSZA 2KOKA 5HFKA 3CSJA 4POKA 1JZOA 3ZIVA 4ZBBA 2GSSA 2HFDA 4F0BA 4POLA 2V6KA 3F8UA 4X1UA 1S3DA 5CRHA 4JBBA 1X5EA 2QA2A 4L5LA 1OC8A 4DSRA 1X9SB 5AISA 3U5RE 1OAZA 3KGKA 1MDKA 1YF1A 4BVYA 3WT2A 4PURA 2G0FA 3H79A 1GSEA 2I3YA 17GSA 5GZZB 4HJ2A 3PPUA 4YH2A 5EY6A 4G0IA 4MJBA 3ZFLA 3HYPA 1JLWA 4OFNA 4D73A 1SJ6A 3C73A 5ECKB 5ECNB 2OE0A 2R0GA 1CQGA 4ZB9A 4L0UA 4GCIA 2C0GA 4MF5A 1AC1A 5COHA 4MK3A 4TXVA 1ZYPA 1O8XA 1Y25A 1YQ1A 3NIVA 1TK0B 1TXXA 1A0FA 3TKSE 4EKZA 3ZYWA 3FRCA 4NV2A 4XS4A 3KXOA 3F6DA 1ZL9A 3UEMA 5HR1A 3SWLA 3WGEA 1M0UA 3QCPA 2MBTA 2LEGA 2NTOA 2CZ2A 3EWLA 5D8IA 1U88A 2XBIA 3ERWA 1GSDA 1H75A 2TIRA 2B7JA 2L6CA 5JWQB 2RIIA 3QAVA 2H74A 2N5FA 5H5QA 1TI3A 1R5AA 3UIWA 1V58A 3HVNA 3L78A 3GKNA 2H30A 2NBSA 2E2GA 4K5RA 4P3YB 4IJIA 1Z7RA 4IQ1A 2HRNA 1GSFA 3LG6A 3QAWA 3UAPA 2IIYA 3DIEA 3D0ZA 3KH7A 2HZEB 1OYJA 2LKUA 2OKAA 1Z3EA 6GSWA 2REMA 4F2IA 4MZBA 3TJBA 3MAKA 5IO2A 1K3OA 5ID2A 3TKRA 3HDCA 2O89A 2L4QA 4EF0A 2HE3A 3US3A 3D6IA 3UL3A 2JACA 3TKSA 3GURA 4YQVA 3GHAA 5IMVA 4GXZA 3EU4A 2JZTA 2JU5A 1XWAA 2C0DA 4IVFA 1CQHA 5CO3A 1GUKA 4DSSB 4TR1B 5CRGA 3GYKA 5G1LA 2JZRA 4NV5A 2R2JA 1QQ2A 3GX8A 4WF4A 3IAS2 1Z5YE 2P5RA 4HZ2A 1HD2A 2AB6A 4IELA 4OO4A 1EOHA 2H1GA 5HR3A 3F3QA 4ID0A 4G0KA 3LQ7A 5IOXA 2ALBA 3UVHA 5CRDA 5A4UA 4MH2A 2OE3A 2V32A 2B5XA 2EIRA 2JSYA 4BL7B 2NVLA 1USBA 1J08A 5ECRB 3PGTA 1SK0A 1FG4A 2E2MA 3IE3A 1QMVA 3EPTA 4MJCA 4V2NA 1FB0A 4FYBA 4KNDA 4XTSA 1GUMA 2GT5A 3O76A 3OR5A 2X8CA 1SL2B 4EUYA 5JCGA 5F8BA 5F07A 2QKEA 2P0GA 2IWTA 3Q6OA 3QDNA 4K6XA 5D96A 4O5RA 2F3MA 2XPDA 1M7TA 4ECCA 1KBNA 4WF5A 2A2SA 1GTAA 3E9JB 4YKFA 3A2XA 2TRCP 3GH9A 4ML1A 3LJRA 4FQUA 3MDKA 3PH9A 3HA9A 3ZMKA 1EEJA 3H93A 1XWBA 1GLPA 2FWGA 2IMEA 2VCVA 1M9AA 4MZCA 4AF2A 2GZYA 3BCKA 4G2EA 3VI5A 1N2AA 1F3AA 3FR3A 4GWRA 3BBYA 4GSNA 4HU9A 3SBCA 2M46A 3WYWA 5HQPA 5ENUA 1TK5B 2YV7A 1V57A 3LW9A 2VLUA 3EMPA 2OADA 3IR4A 13GSA 1A8LA 1XOBA 5IOWA 4GSSA 3CRTA 3IV4A 3ZITA 4BIKA 2VL9A 4I8BA 3D22A 5F0GA 3FR9A 5G2ZA 5DVBA 1MEKA 3TOUA 3D4MA 4YAVA 4X43A 1TW9A 2HZEA 2RM5A 4TXOA 1F2EA 3Q74A 1Q98A 4KDUA 3R2QA 5FWGA 1GULA 2FWFA 3TKSC 5AIVA 2C0EA 4I5QA 4NAXA 2DKIA 3VI7A 3EU3A 6GSTA 1U3IA 3UOMA 2OACA 1AAZA 1PN0A 2FHEA 2AYTA 2IL3A 3KD0A 1JZRA 1K0BA 2HXKA 3QAGA 2A2PA 2C3TA 3FEUA 3KZQA 2VLTA 1V40A 4DSSA 1ZCPA 1F3BA 4TR1A 2LTKA 1NHYA 1U6TA 2AUVA 5HFIA 4ZBDA 1SD9A 1M2DA 4E8HA 5J5NA 2K9FA 2RM6A 3ZIJA 2DSAA 4NHZA 5CRWA 3VFIA 1ZGNA 4K7OA 1GLQA 2WB9A 5G1KA 4OCFA 1GL8A 1FB6A 3GN3A 3FZ4A 11GSA 1BEDA 5DCGA 2JADA 4PTSA 4MCUA 2HRAA 3RPNA 4PQ1A 1M99A 8GSSA 4O7HA 5LNKe 3I9V2 4TW5A 2IFQB 1ON4A 4BL7A 2C1YA 1VF3A 2J23A 3I43A 4HU7A 4TR4A 4WEYA 5ECHB 5KN3A 4K2DA 3TGZA 3UJ1A 2NDOA 4PNFA 5IPGA 1DSBA 2VIMA 2VCTA 2KHPA 2M72A 4GLTA 4ZL8A 2VL2A 4JEDA 4MPGA 4KCEA 2WZ9A 1WP0A 3DVXA 1HNCA 1AIUA 5DCHA 2LQOA 4MPFA 1XWCA 4WR4A 3ED3A 1XIYA 5J4UA 5FHIA 3G7YA 4IP1A 1B8XA 1YY7A 1OC9B 2P5QA 1OE7A 3FZ5A 3J7Yb 3FR6A 2IMIA 2BTOT 2FWEA 3FMWA 1YKAA 19GSA 4N10A 2PWJA 3LGCA 3FHKA 4N11A 2QA1A 2CVDA 4OD7A 3ZZXA 5D73A 3L9SA 3TB2A 1N8JA 4YAPA 5JCUA 2MMAA 4KH7A 4CDOA 1RQMA 1FO5A 2F8FA 1ZOFA 1PX7A 3A2WA 4CY6A 4MH3A 4JR6A 3GX0A 3J7Yk 4G0LA 1K3YA 3HZ4A 1PMTA 1TRWA 2YZHA 5J9CA 4TR3A 3EINA 1OKTA 1SENA 2GQKA 1OKDA 3EC3A 3KP9A 4EDZA 2IPAA 4RQRA 2R5GA 3DKSA 3GV1A 1FVKA 1SYXA 4F82A 4XHMA 1UN2A 4KCAA 3WGDA 4NPBA 3ERFA 1T8EB 2FY6A 3QPMA 4N0VA 2FLSA 4BPYA 7GSSA 2I1UA 2YNXA 4Q5RA 3QMXA 2DJ3A 5DALB 2L5OA 2CA8A 4MJAA 5DJLA 3H1NA 4MZWA 4KA0A 5BMUA 5GAND 3CRUA 1B9YC 5J41A 2KP1A 2G2QA 2FCHA 1WWJA 1J9BA 3KMNA 3P7XA 2ON5A 1YEXA 3P8WA 5DBQA 2N5BA 3ME8A 2V6OA 4TR0A 3IK9A 1A23A 1O81A 2CX3A 1B4PA 3O6TA 3G9BA 3TCOA 2V2GA 1TRSA 2VAFA 2OJLA 3UARA 1FHEA 1PX6A 3GKXA 4IBPA 2I81A 3RAZA 2DJ0A 3A5WA 5D9XA 2H6YA 1WIKA 4PX1A 3D21A 2H72A 1X5CA 1O73A 3LYPA 3VWVA 5ECOB 1FOVA 3TRXA 1TK8B 1UA5A 1TP9A 4G9HA 1O7UA 1Z6MA 4K7IA 2IJYA 9GSSA 2CX4A 4ECBA 4WETA 3L9VA 3IRAA 2GSQA 1WJKA 3F9UA 1TRVA 5B8BA 3GA4A 4LL4B 3KIJA 1BG5A 2LUSA 1THOA 5A5KA 5AIXA 2P31A 4ZBAA 3TUEA 4JR4A 2ZUPA 2OE1A 1VF1A 3HXSA 2AJQB 4WKWA 3GSTA 3W6GA 5FT3A 6GSXA 2FUG2 3FY7A 3UMAA 2ZNMA 1GTBA 4HQSA 1OC9A 2YWNA 4IQAA 2H0GA 2IMKA 2R0CA 2GT6A 4MMMA 3KTBA 5DQSA 3EMXA 4V2MA 4EC0A 5CP1A 3LFLA 1BAYA 3ZFBA 1V9WA 3LXTA 2GVPA 2ON7A 3QR6A 1ABAA 1S3CA 1K3LA 2H19A 1HQOA 3APQA 5ECPB 4JU5A 2FNOA 2H66A 16GSA 3U6VA 5GSSA 3E0UA 1AW9A 2XC2A 1A8YA 3EURA 3LORA 2UZ8A 4YKGA 2YJHA 3ME7A 3GTUB 4KSMA 4BVXB 4N0ZA 2VD1A 2TRXA 3BCIA 3C8EA 1TKDB 5G5EA 4ZL7A 4BWQA 1SK1A 2DJ1A 1S3AA 1XCCA 2V41A 1PGTA 4GF0A 4ZILA 1QK8A 4V1Ag 2PVOC 1Z7PA 1G7OA 4XS1A 2YN1A 1GWCA 5ECQB 1GRXA 5CREA 4WR5A 5HR2A 3GL5A 1ML6A 2OBIA 1M3JA 3KM6A 1QFNA 5IQYA 3WGXA 3ZL5A 1PKWA 3GUSA 2OA7A 4I6XA 2H76A 1A0RP 4X4JA 2NPBA 2MMOA 3MYDA 2AAWA
chains in the Genus database with same CATH topology
1MTCA 4KF9A 3HJMA 3FKFA 1ERWA 3MSZA 1EP7A 1GNEA 1SJIA 2VCXA 4KSOA 1EWXA 3A5IA 1R4WA 3CBUA 4KUNA 4F0CA 2F9SA 5D9TA 5IMAA 1OVNA 2BMXA 2H1AA 3L4NA 1I9DA 1TU8A 4QL9A 1X9WB 4KAEA 3CXGA 1IYIA 5IMZA 2C80A 2CAQA 5ECMB 3HCZA 2YZUA 1EEMA 3DWVA 2YPMA 4POBA 2H1BA 1NSWA 2DC5A 2IMDA 3N9JA 2HZFA 1ERTA 4IP6A 2XHFA 3UBKA 2VO4A 4JRRA 3EE2A 1PN9A 3IOSA 3DVWA 3APOA 5B8AA 1LJRA 2JL4A 20GSA 4OO5A 2X49A 2C3QA 2X8GA 1JHBA 4OCEA 2VOCA 2C8UA 2WULA 1K0MA 3M9KA 4FIWA 1PSQA 1SD8A 3K8NA 3KEBA 4OFMA 1SKWB 4CY8A 1PRXA 4L5OA 4KB3A 3H8QA 1PL1A 2PPTA 3ZVJA 1XOAA 4ECJA 4EL1A 5GAPD 1F37A 1ACVA 10GSA 3MNGA 3GIXA 2VLVA 3IXRA 1ST9A 4FH8A 3WT1A 4XIHA 2CZ3A 4IS0A 3QD9A 1XWKA 3HVSA 2HNLA 5IM9A 4F03A 5E4WA 1VF4A 2PU9C 3G7IA 3FW2A 3UVTA 3CTGA 3AY8A 2RUFA 2H01A 3GSSA 5F06A 3TJGA 1TI1A 1VF2A 1ZYNA 3GTUA 1AUCA 3TJFA 4BVXA 1X5DA 4G19A 5B6MA 5IIZA 2PBJA 2YOIA 3CSIA 1T7PB 2H8LA 3FZ9A 4HDEA 3F4TA 4DSQA 1NM3A 3IPZA 2XBQA 2R4VA 1Z9HA 5ELGA 4OMVA 2DLXA 4HJMA 3P2AA 1TJDA 2DMLA 4ILFA 1B4QA 4K2XA 2DMMA 2FA8A 4ZB6A 2O7KA 3HKRA 2H75A 2M80A 1O85A 3CYNA 1MDIA 1GSSA 1EV4A 5ELAA 5KN1A 4PUFC 3HJOA 3CMIA 4KW6A 1T1VA 2FGXA 2L6DA 4NMUA 1DE1A 3MIXA 4AJ8A 1MDJA 1URMA 3DXBA 2VL3A 2GSTA 2L59A 5ECIB 1EP8A 3P90A 3S9FA 4I2TA 2B5EA 1YDKA 4GTUA 12GSA 1E2YA 1HNAA 1NW2A 4TKYA 2HLSA 2KUCA 1G7EA 2A4VA 4EXJA 3TDGA 4XS6A 4Z2TA 3DRNA 1G6YA 2HT9A 3HD5A 5AN1A 1Q4JA 1RK4A 3V1WA 2LRCA 1X9MB 3LYKA 1U87A 3PINA 3VWUA 5IMDA 1G6WA 2R6KA 1GH2A 3M0FA 1O6JA 4AJ6A 5DDLA 1EZKA 4Q5QA 4HQZA 5F05A 4HI7A 1GP1A 2VM1A 1H4OA 1A2JA 1GSUA 5ID2B 3HVVA 6GSYA 2O87A 1B9XC 2LQQA 1ERUA 4IN0A 3BD2A 3EYTA 3L0HA 1GNWA 1QGVA 4CW9A 3N5OA 2DIYA 2HRKA 1XWGA 4X0XA 1BQ7A 1MD4A 2IMFA 1FOHA 4FO5A 1AQWA 4KGIA 4EIQA 1GTIA 4ZXGA 1GUHA 2YV9A 4EDYA 5IO0A 4FYUA 2AHEA 2LJRA 6GSSA 3BJ5A 4LA1A 2YANA 4HOJA 1A2LA 2I9HA 2ZCTA 2CVBA 2PN8A 5DAKB 1NHOA 2A2RA 1KTEA 2H73A 1XVQA 2H0HA 4HS1A 3D4TA 3GNJA 1FVJA 1QXHA 4J56E 2DKHA 1IYHA 2L4CA 1I5GA 4F9ZA 2FA4A 5E59A 1XBSA 4BA7A 3WD6A 3F63A 1M2BA 2DJ2A 3JCML 4RI6A 1EGRA 2B6MA 3VK9A 2H0IA 3A2VA 4LL1B 2A4HA 2F8AA 2WGRA 3HZ8A 3VWXA 1XFLA 2EIOA 3C1SA 3W8JA 5H5RA 1FAAA 4RQXA 5EPFA 5C04A 3TJJA 1KEBA 4Z7XA 5KN0A 1K0NA 1X0RA 2GSRA 2B7KA 3NZNA 3C7MA 2IFQA 1YF0A 3C71A 4V2LA 5D9WA 1EOGA 3VLNA 4MNNA 4BWSA 5JCWA 4IW9A 3F4SA 1K0DA 3KTLA 3VPTA 1THXA 3TOTA 3PR8A 1WE0A 4YQMA 3A3TA 3DGQA 3I6AA 2WJUA 1OC3A 4AGSA 2VL2C 4EIPA 3GKKA 3ZLPA 4WBRD 3Q18A 1A24A 3KJYA 3VPQA 4XRDA 1G0TA 3IHQA 3GFKA 2BJXA 2LRNA 1UVZA 4I97A 1RW1A 3TRQA 3ZVJD 4O32A 4J2FA 5G31A 3IHGA 4Q5NA 1PL2A 2YCDA 1YEPA 4L8EA 2B1KA 3M3MA 2R37A 4K0GA 4K7NA 1XPVA 1F6MC 1ILOA 1TOFA 1HNBA 3KMOA 4WBJA 4E8EA 2MZCA 1K0OA 1SL0B 3H4KA 1TDIA 3RDWA 4L0WA 2HI7A 4TXOB 14GSA 2LNSA 3I69A 1R5PA 2WCIA 2C3NA 4N30A 2K18A 2HSMA 1WPIA 5G30A 2HSHA 3CTFA 3M9JA 4ULXA 5LCZA 4Q5FA 5CNWA 4ICYA 2YWIA 1E6BA 5KOXA 2RLIA 5ABRA 2B5YA 2H71A 2LJKA 4K1FA 4TOPA 1SK2A 4MDCA 5CYYA 18GSA 2LNTA 2FD3A 5G5FA 4NXIA 5DALA 5D93A 2FWHA 2CV4A 1M9BA 4HEA2 2L57A 2GQLA 5DAKA 2X64A 4HUAA 5INYA 1F9MA 3BOAA 4MJEA 2VCQA 3LEFA 4EVMA 4Z2UA 2MBSA 2DIZA 2WFCA 1XVWA 1B48A 2R0PA 3F3RA 4IGJA 1KNGA 1BJXA 2B3SA 1Z6NA 3TKQA 1OE8A 1DUGA 2GDRA 2GLRA 4IKHA 3NOFA 4GSTA 1SKSB 1WOUA 4RI7A 3HVXA 1ZMAA 2K6VA 2YWOA 1XZOA 5J9BA 1ZYEA 1XW6A 5IMCA 3Q19A 4LLRA 2V1MA 4K9ZA 4YQUA 2PVQA 4K8MA 2GS3A 4MA9A 4ISDA 5C00A 1R7HA 2EIQA 1JZDA 1PD21 5B7CA 3ZTLA 3O3TA 5H5SA 1UC7A 2KP2A 3F6FA 3GRXA 6GSVA 3DEXA 3IAM2 5BRTA 4DEJA 4PUAA 2AV4A 4OWYA 3GKMA 3IK7A 3F4RA 3GH6A 4KX4A 5JWRB 4I2UA 2VD0A 3ZREA 6GSUA 2LJAA 2GZZA 4G10A 2GTUA 1ZZYA 2QSIA 5ECSA 3HHVA 2MMZA 1V2AA 3G7JA 4EE0A 1V98A 5KEJA 3L9UA 1DE2A 4GQCA 3D5JA 3LXZA 3ERGA 1SJZA 1VRSD 2PGTA 1Y6EA 5CAXA 3ZRDA 4ZIJA 2Z9SA 3VURA 3FK8A 2C4JA 2KLXA 2B1LA 4FYCA 4TN8A 2DJJA 2N5AA 2K8VA 1T00A 2E0QA 1DBYA 4PNGA 5DQYA 4ZB8A 4PQHA 5IPHA 4MABA 3IDVA 1R26A 4MF6A 1LBKA 2LS5A 2E7PA 4USSA 1WMJA 1ZYQB 2VM2A 2RUEA 4XCSA 2R3XA 1MD3A 1VGLA 4LMVA 2WDUA 5KN2A 1QUWA 3LSZA 2H70A 2XPEA 1JLVA 3IBHA 2YWMA 1TTZA 4O92A 2ES7A 2GGTA 5ECLB 1SKRB 3KP8A 3GL3A 1K0CA 1LU4A 3DMLA 4ML6A 5A4VA 1WRYA 3R3EA 3KCMA 2DBCA 2VCZA 3DYRA 2CT6A 2IN3A 3FZAA 1PKZA 5B6NA 1W89A 1PA3A 2O8VB 5AGYA 3M8NA 4BVYB 1EV9A 4PXOA 2J9HA 2CQ9A 4A5PA 2VCWA 1GTUA 22GSA 3RHBA 4GQFA 4O5UA 1XW5A 1SU9A 2LSTA 4XRAA 2H6ZA 2D2ZA 1YZXA 3M1GA 5D9VA 5HFGA 2HYXA 2LRTA 4D73B 3F0IA 3VWWA 4HZ4A 3W8SA 4QL7A 3TRPA 2MYGA 4JE1A 1T4ZA 5EVOA 5JWOB 4Z2RA 1ERVA 1BX9A 2MMNA 4KDYA 4MF7A 3C1RA 2YP6A 2JZSA 1AXDA 2HSYA 4H86A 1AQVA 4XS4B 3TKPA 3RBTA 1PQNA 3ISOA 1BYEA 4CHSA 4ECIA 4GRFA 4PGTA 4LMWA 1XW9A 2YJ7A 4OFTA 1C72A 1GSYA 2PUKC 3RHCA 2VUPA 2HRFA 3KH9A 3TJKA 3HJPA 2F51A 1M2AA 4TVEA 5J3RA 4NHWA 5L71A 3APSA 2LV3A 2EC4A 1A2MA 3UBLA 1XXUA 1T3BA 1J0FA 2H1DA 3RPPA 2DJKA 4O5QA 3QFBC 5KOWA 5IMFA 4ACSA 1O8WA 4TRXA 4POMA 4IHUA 4NWYA 5LD0A 2PERA 4ZL9A 2QGVA 3DD3A 1YKCA 2CAIA 2I4AA 2WS2A 4WXTA 1K0AA 4V1Ap 4IJ3A 4PQIA 1YJ6A 1FW1A 2PMTA 3IA1A 4KDXA 2O85A 2X8HA 3CSHA 5GSTA 1EGOA 4DVCA 4K5SA 2L5LA 2X4AA 1SYRA 3EVIA 4AJ7A 1AQXA 1SL1B 4JZQA 1T4YA 2CVKA 3QFAC 1JFUA 3MWHA 5HR0A 2K8SA 1HYUA 4RUVA 5EL8A 4MLYA 3HY2A 3IC8A 2OBKA 1GSQA 2X99A 3IC4A 2GZPA 1TRUA 4QQ7A 4J57E 4K0NA 2WRTA 2QC7A 1TU7A 3LWAA 4EO3A 5A4WA 4MP4A 3ZMLA 2C0FA 3GMFA 2GQMA 1U3AA 1W4VA 1JZWA 3E3EA 3QOUA 3FYGA 4KE3A 2H6XA 5DJMA 2JSZA 2KOKA 5HFKA 3CSJA 4POKA 1JZOA 3ZIVA 4ZBBA 2GSSA 2HFDA 4F0BA 4POLA 2V6KA 3F8UA 4X1UA 1S3DA 5CRHA 4JBBA 1X5EA 2QA2A 4L5LA 1OC8A 4DSRA 1X9SB 5AISA 3U5RE 1OAZA 3KGKA 1MDKA 1YF1A 4BVYA 3WT2A 4PURA 2G0FA 3H79A 1GSEA 2I3YA 17GSA 5GZZB 4HJ2A 3PPUA 4YH2A 5EY6A 4G0IA 4MJBA 3ZFLA 3HYPA 1JLWA 4OFNA 4D73A 1SJ6A 3C73A 5ECKB 5ECNB 2OE0A 2R0GA 1CQGA 4ZB9A 4L0UA 4GCIA 2C0GA 4MF5A 1AC1A 5COHA 4MK3A 4TXVA 1ZYPA 1O8XA 1Y25A 1YQ1A 3NIVA 1TK0B 1TXXA 1A0FA 3TKSE 4EKZA 3ZYWA 3FRCA 4NV2A 4XS4A 3KXOA 3F6DA 1ZL9A 3UEMA 5HR1A 3SWLA 3WGEA 1M0UA 3QCPA 2MBTA 2LEGA 2NTOA 2CZ2A 3EWLA 5D8IA 1U88A 2XBIA 3ERWA 1GSDA 1H75A 2TIRA 2B7JA 2L6CA 5JWQB 2RIIA 3QAVA 2H74A 2N5FA 5H5QA 1TI3A 1R5AA 3UIWA 1V58A 3L78A 3GKNA 2H30A 2NBSA 2E2GA 4K5RA 4P3YB 4IJIA 1Z7RA 4IQ1A 2HRNA 1GSFA 3LG6A 3QAWA 3UAPA 2IIYA 3DIEA 3D0ZA 3KH7A 2HZEB 1OYJA 2LKUA 2OKAA 1Z3EA 6GSWA 2REMA 4F2IA 4MZBA 3TJBA 3MAKA 5IO2A 1K3OA 5ID2A 3TKRA 3HDCA 2O89A 2L4QA 4EF0A 2HE3A 3US3A 3D6IA 3UL3A 2JACA 3TKSA 3GURA 4YQVA 3GHAA 5IMVA 4GXZA 3EU4A 2JZTA 2JU5A 1XWAA 2C0DA 4IVFA 1CQHA 5CO3A 1GUKA 4DSSB 4TR1B 5CRGA 3GYKA 5G1LA 2JZRA 4NV5A 2R2JA 1QQ2A 3GX8A 4WF4A 3IAS2 1Z5YE 2P5RA 4HZ2A 1HD2A 2AB6A 4IELA 4OO4A 1EOHA 2H1GA 5HR3A 3F3QA 4ID0A 4G0KA 3LQ7A 5IOXA 2ALBA 3UVHA 5CRDA 5A4UA 4MH2A 2OE3A 2V32A 2B5XA 2EIRA 2JSYA 4BL7B 2NVLA 1USBA 1J08A 5ECRB 3PGTA 1SK0A 1FG4A 2E2MA 3IE3A 1QMVA 3EPTA 4MJCA 4V2NA 1FB0A 4FYBA 4KNDA 4XTSA 1GUMA 2GT5A 3O76A 3OR5A 2X8CA 1SL2B 4EUYA 5JCGA 5F8BA 5F07A 2QKEA 2P0GA 2IWTA 3Q6OA 3QDNA 4K6XA 5D96A 4O5RA 2F3MA 2XPDA 1M7TA 4ECCA 1KBNA 4WF5A 2A2SA 1GTAA 3E9JB 4YKFA 3A2XA 2TRCP 3GH9A 4ML1A 3LJRA 4FQUA 3MDKA 3PH9A 3HA9A 3ZMKA 1EEJA 3H93A 1XWBA 1GLPA 2FWGA 2IMEA 2VCVA 1M9AA 4MZCA 4AF2A 2GZYA 3BCKA 4G2EA 3VI5A 1N2AA 1F3AA 3FR3A 4GWRA 3BBYA 4GSNA 4HU9A 3SBCA 2M46A 3WYWA 5HQPA 5ENUA 1TK5B 2YV7A 1V57A 3LW9A 2VLUA 3EMPA 2OADA 3IR4A 13GSA 1A8LA 1XOBA 5IOWA 4GSSA 3CRTA 3IV4A 3ZITA 2VL9A 4I8BA 3D22A 5F0GA 3FR9A 5G2ZA 5DVBA 1MEKA 3TOUA 3D4MA 4YAVA 4X43A 1TW9A 2HZEA 2RM5A 4TXOA 1F2EA 3Q74A 1Q98A 4KDUA 3R2QA 5FWGA 1GULA 2FWFA 3TKSC 5AIVA 2C0EA 4I5QA 4NAXA 2DKIA 3VI7A 3EU3A 6GSTA 1U3IA 3UOMA 2OACA 1AAZA 1PN0A 2FHEA 2AYTA 2IL3A 3KD0A 1JZRA 1K0BA 2HXKA 3QAGA 2A2PA 2C3TA 3FEUA 3KZQA 2VLTA 1V40A 4DSSA 1ZCPA 1F3BA 4TR1A 2LTKA 1NHYA 1U6TA 2AUVA 5HFIA 4ZBDA 1SD9A 1M2DA 4E8HA 5J5NA 2K9FA 2RM6A 3ZIJA 2DSAA 4NHZA 5CRWA 3VFIA 1ZGNA 4K7OA 1GLQA 2WB9A 5G1KA 4OCFA 1GL8A 1FB6A 3GN3A 3FZ4A 11GSA 1BEDA 5DCGA 2JADA 4PTSA 4MCUA 2HRAA 3RPNA 4PQ1A 1M99A 8GSSA 4O7HA 5LNKe 3I9V2 4TW5A 2IFQB 1ON4A 4BL7A 2C1YA 1VF3A 2J23A 3I43A 4HU7A 4TR4A 4WEYA 5ECHB 5KN3A 4K2DA 3TGZA 3UJ1A 2NDOA 4PNFA 5IPGA 1DSBA 2VIMA 2VCTA 2KHPA 2M72A 4GLTA 4ZL8A 2VL2A 4JEDA 4MPGA 4KCEA 2WZ9A 1WP0A 3DVXA 1HNCA 1AIUA 5DCHA 2LQOA 4MPFA 1XWCA 4WR4A 3ED3A 1XIYA 5J4UA 5FHIA 3G7YA 4IP1A 1B8XA 1YY7A 1OC9B 2P5QA 1OE7A 3FZ5A 3J7Yb 3FR6A 2IMIA 2BTOT 2FWEA 3FMWA 1YKAA 19GSA 4N10A 2PWJA 3LGCA 3FHKA 4N11A 2QA1A 2CVDA 4OD7A 3ZZXA 5D73A 3L9SA 3TB2A 1N8JA 4YAPA 5JCUA 2MMAA 4KH7A 4CDOA 1RQMA 1FO5A 2F8FA 1ZOFA 1PX7A 3A2WA 4CY6A 4MH3A 4JR6A 3GX0A 3J7Yk 4G0LA 1K3YA 3HZ4A 1PMTA 1TRWA 2YZHA 5J9CA 4TR3A 3EINA 1OKTA 1SENA 2GQKA 1OKDA 3EC3A 3KP9A 4EDZA 2IPAA 4RQRA 2R5GA 3DKSA 3GV1A 1FVKA 1SYXA 4F82A 4XHMA 1UN2A 4KCAA 3WGDA 4NPBA 3ERFA 1T8EB 2FY6A 3QPMA 4N0VA 2FLSA 4BPYA 7GSSA 2I1UA 2YNXA 4Q5RA 3QMXA 2DJ3A 5DALB 2L5OA 2CA8A 4MJAA 5DJLA 3H1NA 4MZWA 4KA0A 5BMUA 5GAND 3CRUA 1B9YC 5J41A 2KP1A 2G2QA 2FCHA 1WWJA 1J9BA 3KMNA 3P7XA 2ON5A 1YEXA 3P8WA 5DBQA 2N5BA 3ME8A 2V6OA 4TR0A 3IK9A 1A23A 1O81A 2CX3A 1B4PA 3O6TA 3G9BA 3TCOA 2V2GA 1TRSA 2VAFA 2OJLA 3UARA 1FHEA 1PX6A 3GKXA 4IBPA 2I81A 3RAZA 2DJ0A 3A5WA 5D9XA 2H6YA 1WIKA 4PX1A 3D21A 2H72A 1X5CA 1O73A 3LYPA 3VWVA 5ECOB 1FOVA 3TRXA 1TK8B 1UA5A 1TP9A 4G9HA 1O7UA 1Z6MA 4K7IA 2IJYA 9GSSA 2CX4A 4ECBA 4WETA 3L9VA 3IRAA 2GSQA 1WJKA 3F9UA 1TRVA 5B8BA 3GA4A 4LL4B 3KIJA 1BG5A 2LUSA 1THOA 5A5KA 5AIXA 2P31A 4ZBAA 3TUEA 4JR4A 2ZUPA 2OE1A 1VF1A 3HXSA 2AJQB 4WKWA 3GSTA 3W6GA 5FT3A 6GSXA 2FUG2 3FY7A 3UMAA 2ZNMA 1GTBA 4HQSA 1OC9A 2YWNA 4IQAA 2H0GA 2IMKA 2R0CA 2GT6A 4MMMA 3KTBA 5DQSA 3EMXA 4V2MA 4EC0A 5CP1A 3LFLA 1BAYA 3ZFBA 1V9WA 3LXTA 2GVPA 2ON7A 3QR6A 1ABAA 1S3CA 1K3LA 2H19A 1HQOA 3APQA 5ECPB 4JU5A 2FNOA 2H66A 16GSA 3U6VA 5GSSA 3E0UA 1AW9A 2XC2A 1A8YA 3EURA 3LORA 2UZ8A 4YKGA 2YJHA 3ME7A 3GTUB 4KSMA 4BVXB 4N0ZA 2VD1A 2TRXA 3BCIA 3C8EA 1TKDB 5G5EA 4ZL7A 4BWQA 1SK1A 2DJ1A 1S3AA 1XCCA 2V41A 1PGTA 4GF0A 4ZILA 1QK8A 4V1Ag 2PVOC 1Z7PA 1G7OA 4XS1A 2YN1A 1GWCA 5ECQB 1GRXA 5CREA 4WR5A 5HR2A 3GL5A 1ML6A 2OBIA 3KM6A 1QFNA 5IQYA 3WGXA 3ZL5A 1PKWA 3GUSA 2OA7A 4I6XA 2H76A 1A0RP 4X4JA 2NPBA 2MMOA 3MYDA 2AAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MTC A;  3HJM A;  3FKF A;  1ERW A;  3MSZ A;  1EP7 A;  1GNE A;  1SJI A;  2VCX A;  4KSO A;  1EWX A;  1R4W A;  3CBU A;  4KUN A;  4F0C A;  2F9S A;  5D9T A;  5IMA A;  1OVN A;  2BMX A;  2H1A A;  3L4N A;  1I9D A;  1TU8 A;  4QL9 A;  1X9W B;  4KAE A;  3CXG A;  1IYI A;  5IMZ A;  2C80 A;  2CAQ A;  5ECM B;  3HCZ A;  2YZU A;  1EEM A;  3DWV A;  2YPM A;  4POB A;  2H1B A;  1NSW A;  2DC5 A;  2IMD A;  3N9J A;  2HZF A;  1ERT A;  4IP6 A;  2XHF A;  3UBK A;  2VO4 A;  4JRR A;  3EE2 A;  1PN9 A;  3IOS A;  3DVW A;  3APO A;  5B8A A;  1LJR A;  2JL4 A;  20GS A;  4OO5 A;  2C3Q A;  2X8G A;  1JHB A;  4OCE A;  2VOC A;  2C8U A;  2WUL A;  1K0M A;  3M9K A;  4FIW A;  1PSQ A;  1SD8 A;  3K8N A;  3KEB A;  4OFM A;  1SKW B;  1PRX A;  4L5O A;  4KB3 A;  3H8Q A;  1PL1 A;  2PPT A;  3ZVJ A;  1XOA A;  4ECJ A;  4EL1 A;  5GAP D;  1F37 A;  1ACV A;  10GS A;  3MNG A;  3GIX A;  2VLV A;  3IXR A;  1ST9 A;  4FH8 A;  3WT1 A;  4XIH A;  2CZ3 A;  4IS0 A;  3QD9 A;  1XWK A;  3HVS A;  2HNL A;  5IM9 A;  4F03 A;  5E4W A;  1VF4 A;  2PU9 C;  3G7I A;  3FW2 A;  3UVT A;  3CTG A;  3AY8 A;  2RUF A;  2H01 A;  3GSS A;  5F06 A;  3TJG A;  1TI1 A;  1VF2 A;  3GTU A;  1AUC A;  3TJF A;  4BVX A;  1X5D A;  4G19 A;  5B6M A;  5IIZ A;  2PBJ A;  2YOI A;  3CSI A;  1T7P B;  2H8L A;  3FZ9 A;  4HDE A;  3F4T A;  4DSQ A;  1NM3 A;  3IPZ A;  2XBQ A;  2R4V A;  1Z9H A;  5ELG A;  4OMV A;  2DLX A;  4HJM A;  3P2A A;  1TJD A;  2DML A;  4ILF A;  1B4Q A;  2DMM A;  2FA8 A;  4ZB6 A;  2O7K A;  3HKR A;  2H75 A;  2M80 A;  1O85 A;  3CYN A;  1MDI A;  1GSS A;  1EV4 A;  5ELA A;  5KN1 A;  4PUF C;  3HJO A;  3CMI A;  4KW6 A;  1T1V A;  2FGX A;  2L6D A;  4NMU A;  1DE1 A;  4AJ8 A;  1MDJ A;  1URM A;  3DXB A;  2VL3 A;  2GST A;  2L59 A;  5ECI B;  1EP8 A;  3P90 A;  3S9F A;  4I2T A;  2B5E A;  1YDK A;  4GTU A;  12GS A;  1E2Y A;  1HNA A;  1NW2 A;  4TKY A;  2HLS A;  2KUC A;  1G7E A;  2A4V A;  4EXJ A;  3TDG A;  4XS6 A;  3DRN A;  1G6Y A;  2HT9 A;  3HD5 A;  5AN1 A;  1Q4J A;  1RK4 A;  3V1W A;  2LRC A;  1X9M B;  3LYK A;  1U87 A;  3PIN A;  3VWU A;  5IMD A;  1G6W A;  2R6K A;  1GH2 A;  3M0F A;  1O6J A;  4AJ6 A;  5DDL A;  1EZK A;  4Q5Q A;  4HQZ A;  5F05 A;  4HI7 A;  1GP1 A;  2VM1 A;  1H4O A;  1A2J A;  1GSU A;  5ID2 B;  3HVV A;  6GSY A;  2O87 A;  1B9X C;  2LQQ A;  1ERU A;  4IN0 A;  3BD2 A;  3EYT A;  3L0H A;  1GNW A;  1QGV A;  4CW9 A;  3N5O A;  2DIY A;  1XWG A;  4X0X A;  1BQ7 A;  1MD4 A;  2IMF A;  4FO5 A;  1AQW A;  4KGI A;  1GTI A;  4ZXG A;  1GUH A;  2YV9 A;  4EDY A;  5IO0 A;  4FYU A;  2AHE A;  2LJR A;  6GSS A;  3BJ5 A;  4LA1 A;  2YAN A;  4HOJ A;  1A2L A;  2I9H A;  2ZCT A;  2CVB A;  2PN8 A;  5DAK B;  1NHO A;  2A2R A;  1KTE A;  2H73 A;  1XVQ A;  2H0H A;  4HS1 A;  3D4T A;  3GNJ A;  1FVJ A;  1QXH A;  4J56 E;  1IYH A;  2L4C A;  1I5G A;  4F9Z A;  2FA4 A;  5E59 A;  1XBS A;  4BA7 A;  3WD6 A;  3F63 A;  1M2B A;  2DJ2 A;  3JCM L;  4RI6 A;  1EGR A;  2B6M A;  3VK9 A;  2H0I A;  3A2V A;  4LL1 B;  2F8A A;  2WGR A;  3HZ8 A;  3VWX A;  1XFL A;  2EIO A;  3C1S A;  3W8J A;  5H5R A;  1FAA A;  4RQX A;  5EPF A;  5C04 A;  3TJJ A;  1KEB A;  4Z7X A;  5KN0 A;  1K0N A;  1X0R A;  2GSR A;  2B7K A;  3NZN A;  3C7M A;  2IFQ A;  1YF0 A;  3C71 A;  4V2L A;  5D9W A;  1EOG A;  3VLN A;  4BWS A;  5JCW A;  4IW9 A;  3F4S A;  1K0D A;  3KTL A;  3VPT A;  1THX A;  3TOT A;  3PR8 A;  1WE0 A;  4YQM A;  3A3T A;  3DGQ A;  3I6A A;  2WJU A;  1OC3 A;  4AGS A;  2VL2 C;  3GKK A;  3ZLP A;  4WBR D;  3Q18 A;  1A24 A;  3KJY A;  3VPQ A;  4XRD A;  1G0T A;  3IHQ A;  3GFK A;  2BJX A;  2LRN A;  1UVZ A;  4I97 A;  1RW1 A;  3TRQ A;  3ZVJ D;  4O32 A;  4J2F A;  5G31 A;  4Q5N A;  1PL2 A;  2YCD A;  1YEP A;  4L8E A;  2B1K A;  3M3M A;  2R37 A;  4K0G A;  4K7N A;  1XPV A;  1F6M C;  1ILO A;  1TOF A;  1HNB A;  3KMO A;  4WBJ A;  4E8E A;  2MZC A;  1K0O A;  1SL0 B;  3H4K A;  1TDI A;  3RDW A;  4L0W A;  2HI7 A;  4TXO B;  14GS A;  2LNS A;  3I69 A;  1R5P A;  2WCI A;  2C3N A;  4N30 A;  2K18 A;  1WPI A;  5G30 A;  2HSH A;  3CTF A;  3M9J A;  4ULX A;  5LCZ A;  4Q5F A;  5CNW A;  2YWI A;  1E6B A;  2RLI A;  5ABR A;  2B5Y A;  2H71 A;  2LJK A;  4K1F A;  4TOP A;  1SK2 A;  4MDC A;  5CYY A;  18GS A;  2LNT A;  2FD3 A;  5G5F A;  4NXI A;  5DAL A;  5D93 A;  2FWH A;  2CV4 A;  1M9B A;  4HEA 2;  2L57 A;  2GQL A;  5DAK A;  2X64 A;  4HUA A;  5INY A;  1F9M A;  3BOA A;  4MJE A;  2VCQ A;  3LEF A;  4EVM A;  2MBS A;  2DIZ A;  2WFC A;  1XVW A;  1B48 A;  3F3R A;  4IGJ A;  1KNG A;  1BJX A;  2B3S A;  1Z6N A;  3TKQ A;  1OE8 A;  1DUG A;  2GDR A;  2GLR A;  4IKH A;  3NOF A;  4GST A;  1SKS B;  1WOU A;  4RI7 A;  3HVX A;  1ZMA A;  2K6V A;  2YWO A;  1XZO A;  5J9B A;  1ZYE A;  1XW6 A;  5IMC A;  3Q19 A;  4LLR A;  2V1M A;  4K9Z A;  4YQU A;  2PVQ A;  4K8M A;  2GS3 A;  4MA9 A;  4ISD A;  5C00 A;  1R7H A;  2EIQ A;  1JZD A;  1PD2 1;  5B7C A;  3ZTL A;  3O3T A;  5H5S A;  1UC7 A;  2KP2 A;  3F6F A;  3GRX A;  6GSV A;  3DEX A;  3IAM 2;  4DEJ A;  4PUA A;  2AV4 A;  4OWY A;  3GKM A;  3IK7 A;  3F4R A;  3GH6 A;  4KX4 A;  5JWR B;  4I2U A;  2VD0 A;  3ZRE A;  6GSU A;  2LJA A;  2GZZ A;  4G10 A;  2GTU A;  1ZZY A;  2QSI A;  5ECS A;  3HHV A;  2MMZ A;  1V2A A;  3G7J A;  4EE0 A;  1V98 A;  5KEJ A;  3L9U A;  1DE2 A;  4GQC A;  3D5J A;  3LXZ A;  3ERG A;  1SJZ A;  1VRS D;  2PGT A;  1Y6E A;  5CAX A;  3ZRD A;  4ZIJ A;  2Z9S A;  3VUR A;  3FK8 A;  2C4J A;  2KLX A;  2B1L A;  4FYC A;  4TN8 A;  2DJJ A;  2N5A A;  2K8V A;  1T00 A;  2E0Q A;  1DBY A;  4PNG A;  5DQY A;  4ZB8 A;  4PQH A;  5IPH A;  4MAB A;  3IDV A;  1R26 A;  4MF6 A;  1LBK A;  2LS5 A;  2E7P A;  1WMJ A;  1ZYQ B;  2VM2 A;  2RUE A;  4XCS A;  2R3X A;  1MD3 A;  1VGL A;  4LMV A;  2WDU A;  5KN2 A;  1QUW A;  3LSZ A;  2H70 A;  2XPE A;  1JLV A;  3IBH A;  2YWM A;  1TTZ A;  4O92 A;  2ES7 A;  2GGT A;  5ECL B;  1SKR B;  3KP8 A;  3GL3 A;  1K0C A;  1LU4 A;  3DML A;  4ML6 A;  5A4V A;  1WRY A;  3KCM A;  2DBC A;  2VCZ A;  3DYR A;  2CT6 A;  2IN3 A;  3FZA A;  1PKZ A;  5B6N A;  1W89 A;  1PA3 A;  2O8V B;  5AGY A;  3M8N A;  1EV9 A;  4PXO A;  2J9H A;  2CQ9 A;  2VCW A;  1GTU A;  22GS A;  3RHB A;  4GQF A;  1XW5 A;  1SU9 A;  2LST A;  4XRA A;  2H6Z A;  2D2Z A;  1YZX A;  3M1G A;  5D9V A;  5HFG A;  2HYX A;  2LRT A;  4D73 B;  3F0I A;  3VWW A;  4HZ4 A;  3W8S A;  4QL7 A;  3TRP A;  2MYG A;  4JE1 A;  1T4Z A;  5EVO A;  5JWO B;  1ERV A;  1BX9 A;  2MMN A;  4KDY A;  4MF7 A;  3C1R A;  2YP6 A;  2JZS A;  1AXD A;  2HSY A;  4H86 A;  1AQV A;  4XS4 B;  3TKP A;  3RBT A;  1PQN A;  3ISO A;  1BYE A;  4CHS A;  4ECI A;  4GRF A;  4PGT A;  4LMW A;  1XW9 A;  2YJ7 A;  4OFT A;  1C72 A;  1GSY A;  2PUK C;  3RHC A;  2VUP A;  2HRF A;  3KH9 A;  3TJK A;  3HJP A;  2F51 A;  1M2A A;  4TVE A;  5J3R A;  4NHW A;  5L71 A;  3APS A;  2LV3 A;  2EC4 A;  1A2M A;  3UBL A;  1XXU A;  1T3B A;  1J0F A;  2H1D A;  3RPP A;  2DJK A;  3QFB C;  5IMF A;  4ACS A;  1O8W A;  4TRX A;  4POM A;  4IHU A;  4NWY A;  5LD0 A;  2PER A;  4ZL9 A;  2QGV A;  3DD3 A;  1YKC A;  2CAI A;  2I4A A;  2WS2 A;  4WXT A;  1K0A A;  4V1A p;  4IJ3 A;  4PQI A;  1YJ6 A;  1FW1 A;  2PMT A;  3IA1 A;  4KDX A;  2O85 A;  2X8H A;  3CSH A;  5GST A;  1EGO A;  4DVC A;  2L5L A;  1SYR A;  3EVI A;  4AJ7 A;  1AQX A;  1SL1 B;  4JZQ A;  1T4Y A;  2CVK A;  3QFA C;  1JFU A;  3MWH A;  5HR0 A;  2K8S A;  1HYU A;  4RUV A;  5EL8 A;  4MLY A;  3HY2 A;  2OBK A;  1GSQ A;  2X99 A;  3IC4 A;  2GZP A;  1TRU A;  4QQ7 A;  4J57 E;  4K0N A;  2WRT A;  2QC7 A;  1TU7 A;  3LWA A;  4EO3 A;  5A4W A;  4MP4 A;  3ZML A;  2C0F A;  3GMF A;  2GQM A;  1U3A A;  1W4V A;  1JZW A;  3E3E A;  3QOU A;  3FYG A;  4KE3 A;  2H6X A;  5DJM A;  2JSZ A;  2KOK A;  5HFK A;  3CSJ A;  4POK A;  1JZO A;  3ZIV A;  4ZBB A;  2GSS A;  2HFD A;  4F0B A;  4POL A;  2V6K A;  3F8U A;  4X1U A;  1S3D A;  5CRH A;  4JBB A;  1X5E A;  4L5L A;  1OC8 A;  4DSR A;  1X9S B;  5AIS A;  3U5R E;  1OAZ A;  3KGK A;  1MDK A;  1YF1 A;  4BVY A;  3WT2 A;  4PUR A;  2G0F A;  3H79 A;  1GSE A;  2I3Y A;  17GS A;  5GZZ B;  4HJ2 A;  4YH2 A;  5EY6 A;  4MJB A;  3ZFL A;  3HYP A;  1JLW A;  4OFN A;  4D73 A;  1SJ6 A;  3C73 A;  5ECK B;  5ECN B;  2OE0 A;  1CQG A;  4ZB9 A;  4L0U A;  4GCI A;  2C0G A;  4MF5 A;  1AC1 A;  5COH A;  4MK3 A;  4TXV A;  1O8X A;  1Y25 A;  1YQ1 A;  3NIV A;  1TK0 B;  1TXX A;  1A0F A;  3TKS E;  4EKZ A;  3ZYW A;  3FRC A;  4NV2 A;  4XS4 A;  3KXO A;  3F6D A;  1ZL9 A;  3UEM A;  5HR1 A;  3SWL A;  3WGE A;  1M0U A;  3QCP A;  2MBT A;  2LEG A;  2NTO A;  2CZ2 A;  3EWL A;  5D8I A;  1U88 A;  2XBI A;  3ERW A;  1GSD A;  1H75 A;  2TIR A;  2B7J A;  2L6C A;  5JWQ B;  2RII A;  3QAV A;  2H74 A;  2N5F A;  5H5Q A;  1TI3 A;  1R5A A;  3UIW A;  1V58 A;  3L78 A;  3GKN A;  2H30 A;  2NBS A;  2E2G A;  4P3Y B;  4IJI A;  1Z7R A;  4IQ1 A;  2HRN A;  1GSF A;  3LG6 A;  3QAW A;  3UAP A;  2IIY A;  3DIE A;  3D0Z A;  3KH7 A;  2HZE B;  1OYJ A;  2LKU A;  2OKA A;  1Z3E A;  6GSW A;  2REM A;  4F2I A;  4MZB A;  3TJB A;  3MAK A;  5IO2 A;  1K3O A;  5ID2 A;  3TKR A;  3HDC A;  2O89 A;  2L4Q A;  4EF0 A;  2HE3 A;  3US3 A;  3D6I A;  3UL3 A;  2JAC A;  3TKS A;  3GUR A;  4YQV A;  3GHA A;  5IMV A;  4GXZ A;  3EU4 A;  2JZT A;  2JU5 A;  1XWA A;  2C0D A;  4IVF A;  1CQH A;  5CO3 A;  1GUK A;  4DSS B;  4TR1 B;  5CRG A;  3GYK A;  5G1L A;  2JZR A;  4NV5 A;  2R2J A;  1QQ2 A;  3GX8 A;  4WF4 A;  3IAS 2;  1Z5Y E;  2P5R A;  4HZ2 A;  1HD2 A;  2AB6 A;  4IEL A;  4OO4 A;  1EOH A;  2H1G A;  5HR3 A;  3F3Q A;  4ID0 A;  3LQ7 A;  5IOX A;  2ALB A;  3UVH A;  5CRD A;  5A4U A;  4MH2 A;  2OE3 A;  2V32 A;  2B5X A;  2EIR A;  2JSY A;  2NVL A;  1USB A;  1J08 A;  5ECR B;  3PGT A;  1SK0 A;  1FG4 A;  2E2M A;  3IE3 A;  1QMV A;  4MJC A;  4V2N A;  1FB0 A;  4FYB A;  4KND A;  4XTS A;  1GUM A;  2GT5 A;  3O76 A;  3OR5 A;  2X8C A;  1SL2 B;  4EUY A;  5JCG A;  5F8B A;  5F07 A;  2QKE A;  2P0G A;  2IWT A;  3Q6O A;  3QDN A;  4K6X A;  5D96 A;  4O5R A;  2F3M A;  2XPD A;  1M7T A;  4ECC A;  1KBN A;  4WF5 A;  2A2S A;  1GTA A;  3E9J B;  3A2X A;  2TRC P;  3GH9 A;  4ML1 A;  3LJR A;  3MDK A;  3PH9 A;  3HA9 A;  3ZMK A;  1EEJ A;  3H93 A;  1XWB A;  1GLP A;  2FWG A;  2IME A;  2VCV A;  1M9A A;  4MZC A;  4AF2 A;  2GZY A;  3BCK A;  4G2E A;  3VI5 A;  1N2A A;  1F3A A;  3FR3 A;  4GWR A;  3BBY A;  4GSN A;  4HU9 A;  3SBC A;  2M46 A;  3WYW A;  5HQP A;  5ENU A;  1TK5 B;  2YV7 A;  1V57 A;  2VLU A;  3EMP A;  2OAD A;  3IR4 A;  13GS A;  1A8L A;  1XOB A;  5IOW A;  4GSS A;  3CRT A;  3IV4 A;  3ZIT A;  2VL9 A;  4I8B A;  3D22 A;  5F0G A;  3FR9 A;  5G2Z A;  5DVB A;  1MEK A;  3TOU A;  3D4M A;  4YAV A;  4X43 A;  1TW9 A;  2HZE A;  2RM5 A;  4TXO A;  1F2E A;  3Q74 A;  1Q98 A;  4KDU A;  3R2Q A;  5FWG A;  1GUL A;  2FWF A;  3TKS C;  5AIV A;  2C0E A;  4I5Q A;  4NAX A;  3VI7 A;  3EU3 A;  6GST A;  1U3I A;  3UOM A;  2OAC A;  1AAZ A;  2FHE A;  2AYT A;  2IL3 A;  3KD0 A;  1JZR A;  1K0B A;  2HXK A;  3QAG A;  2C3T A;  3FEU A;  3KZQ A;  2VLT A;  1V40 A;  4DSS A;  1ZCP A;  1F3B A;  4TR1 A;  2LTK A;  1NHY A;  1U6T A;  2AUV A;  5HFI A;  4ZBD A;  1SD9 A;  1M2D A;  4E8H A;  5J5N A;  2K9F A;  2RM6 A;  3ZIJ A;  2DSA A;  4NHZ A;  5CRW A;  3VFI A;  1ZGN A;  4K7O A;  1GLQ A;  2WB9 A;  5G1K A;  4OCF A;  1GL8 A;  1FB6 A;  3GN3 A;  3FZ4 A;  11GS A;  1BED A;  5DCG A;  2JAD A;  4MCU A;  3RPN A;  4PQ1 A;  1M99 A;  8GSS A;  4O7H A;  5LNK e;  3I9V 2;  4TW5 A;  2IFQ B;  1ON4 A;  4BL7 A;  2C1Y A;  1VF3 A;  2J23 A;  3I43 A;  4HU7 A;  4TR4 A;  4WEY A;  5ECH B;  5KN3 A;  4K2D A;  3TGZ A;  3UJ1 A;  2NDO A;  4PNF A;  5IPG A;  1DSB A;  2VIM A;  2VCT A;  2KHP A;  2M72 A;  4GLT A;  4ZL8 A;  2VL2 A;  4JED A;  4MPG A;  4KCE A;  2WZ9 A;  1WP0 A;  3DVX A;  1HNC A;  1AIU A;  5DCH A;  2LQO A;  4MPF A;  1XWC A;  4WR4 A;  3ED3 A;  1XIY A;  5J4U A;  5FHI A;  3G7Y A;  4IP1 A;  1B8X A;  1YY7 A;  1OC9 B;  2P5Q A;  1OE7 A;  3FZ5 A;  3J7Y b;  3FR6 A;  2IMI A;  2BTO T;  2FWE A;  1YKA A;  19GS A;  4N10 A;  2PWJ A;  3LGC A;  3FHK A;  4N11 A;  2CVD A;  4OD7 A;  3ZZX A;  5D73 A;  3L9S A;  3TB2 A;  1N8J A;  4YAP A;  5JCU A;  2MMA A;  4KH7 A;  4CDO A;  1RQM A;  1FO5 A;  2F8F A;  1ZOF A;  1PX7 A;  3A2W A;  4MH3 A;  4JR6 A;  3GX0 A;  3J7Y k;  1K3Y A;  3HZ4 A;  1PMT A;  1TRW A;  2YZH A;  5J9C A;  4TR3 A;  3EIN A;  1OKT A;  1SEN A;  2GQK A;  1OKD A;  3EC3 A;  3KP9 A;  4EDZ A;  2IPA A;  4RQR A;  2R5G A;  3DKS A;  3GV1 A;  1FVK A;  1SYX A;  4F82 A;  4XHM A;  1UN2 A;  4KCA A;  3WGD A;  4NPB A;  3ERF A;  1T8E B;  2FY6 A;  3QPM A;  4N0V A;  2FLS A;  4BPY A;  7GSS A;  2I1U A;  2YNX A;  4Q5R A;  3QMX A;  2DJ3 A;  5DAL B;  2L5O A;  2CA8 A;  4MJA A;  5DJL A;  3H1N A;  4MZW A;  4KA0 A;  5GAN D;  3CRU A;  1B9Y C;  5J41 A;  2KP1 A;  2G2Q A;  2FCH A;  1WWJ A;  1J9B A;  3KMN A;  3P7X A;  2ON5 A;  1YEX A;  3P8W A;  5DBQ A;  2N5B A;  3ME8 A;  2V6O A;  4TR0 A;  3IK9 A;  1A23 A;  1O81 A;  2CX3 A;  1B4P A;  3O6T A;  3G9B A;  3TCO A;  2V2G A;  1TRS A;  2VAF A;  2OJL A;  3UAR A;  1FHE A;  1PX6 A;  3GKX A;  4IBP A;  2I81 A;  3RAZ A;  2DJ0 A;  3A5W A;  5D9X A;  2H6Y A;  1WIK A;  4PX1 A;  3D21 A;  2H72 A;  1X5C A;  1O73 A;  3LYP A;  3VWV A;  5ECO B;  1FOV A;  3TRX A;  1TK8 B;  1UA5 A;  1TP9 A;  4G9H A;  1O7U A;  1Z6M A;  4K7I A;  2IJY A;  9GSS A;  2CX4 A;  4ECB A;  4WET A;  3L9V A;  3IRA A;  2GSQ A;  1WJK A;  3F9U A;  1TRV A;  5B8B A;  3GA4 A;  4LL4 B;  3KIJ A;  1BG5 A;  2LUS A;  1THO A;  5A5K A;  5AIX A;  2P31 A;  4ZBA A;  3TUE A;  4JR4 A;  2ZUP A;  2OE1 A;  1VF1 A;  3HXS A;  2AJQ B;  4WKW A;  3GST A;  3W6G A;  5FT3 A;  6GSX A;  2FUG 2;  3FY7 A;  3UMA A;  2ZNM A;  1GTB A;  4HQS A;  1OC9 A;  2YWN A;  4IQA A;  2H0G A;  2IMK A;  2GT6 A;  4MMM A;  3KTB A;  5DQS A;  3EMX A;  4V2M A;  4EC0 A;  5CP1 A;  3LFL A;  1BAY A;  3ZFB A;  1V9W A;  3LXT A;  2GVP A;  2ON7 A;  3QR6 A;  1ABA A;  1S3C A;  1K3L A;  2H19 A;  1HQO A;  3APQ A;  5ECP B;  4JU5 A;  2FNO A;  2H66 A;  16GS A;  3U6V A;  5GSS A;  3E0U A;  1AW9 A;  2XC2 A;  1A8Y A;  3EUR A;  3LOR A;  2YJH A;  3ME7 A;  3GTU B;  4KSM A;  4N0Z A;  2VD1 A;  2TRX A;  3BCI A;  3C8E A;  1TKD B;  5G5E A;  4ZL7 A;  4BWQ A;  1SK1 A;  2DJ1 A;  1S3A A;  1XCC A;  2V41 A;  1PGT A;  4GF0 A;  4ZIL A;  1QK8 A;  4V1A g;  2PVO C;  1Z7P A;  1G7O A;  4XS1 A;  2YN1 A;  1GWC A;  5ECQ B;  1GRX A;  5CRE A;  4WR5 A;  5HR2 A;  3GL5 A;  1ML6 A;  2OBI A;  3KM6 A;  1QFN A;  5IQY A;  3WGX A;  3ZL5 A;  1PKW A;  3GUS A;  2OA7 A;  4I6X A;  2H76 A;  1A0R P;  2NPB A;  2MMO A;  2AAW A; 
#chains in the Genus database with same CATH topology
 1MTC A;  4KF9 A;  3HJM A;  3FKF A;  1ERW A;  3MSZ A;  1EP7 A;  1GNE A;  1SJI A;  2VCX A;  4KSO A;  1EWX A;  3A5I A;  1R4W A;  3CBU A;  4KUN A;  4F0C A;  2F9S A;  5D9T A;  5IMA A;  1OVN A;  2BMX A;  2H1A A;  3L4N A;  1I9D A;  1TU8 A;  4QL9 A;  1X9W B;  4KAE A;  3CXG A;  1IYI A;  5IMZ A;  2C80 A;  2CAQ A;  5ECM B;  3HCZ A;  2YZU A;  4HSC X;  1EEM A;  3DWV A;  2YPM A;  4POB A;  2H1B A;  1NSW A;  2DC5 A;  2IMD A;  3N9J A;  2HZF A;  1ERT A;  4IP6 A;  2XHF A;  3UBK A;  2VO4 A;  4JRR A;  3EE2 A;  1PN9 A;  3IOS A;  3DVW A;  3APO A;  5B8A A;  1LJR A;  2JL4 A;  20GS A;  4OO5 A;  1XG8 A;  2X49 A;  2C3Q A;  2X8G A;  1JHB A;  4OCE A;  2VOC A;  2C8U A;  2WUL A;  1K0M A;  3M9K A;  4FIW A;  1PSQ A;  1SD8 A;  3K8N A;  3KEB A;  4OFM A;  1SKW B;  4CY8 A;  1PRX A;  4L5O A;  4KB3 A;  3H8Q A;  1PL1 A;  2PPT A;  3ZVJ A;  1XOA A;  4ECJ A;  4EL1 A;  5GAP D;  1F37 A;  1ACV A;  10GS A;  3MNG A;  3GIX A;  2VLV A;  3IXR A;  1ST9 A;  4FH8 A;  3WT1 A;  4XIH A;  2CZ3 A;  4IS0 A;  3QD9 A;  1XWK A;  3HVS A;  2HNL A;  5IM9 A;  4F03 A;  5E4W A;  1VF4 A;  2PU9 C;  3G7I A;  3FW2 A;  3UVT A;  3CTG A;  3AY8 A;  2RUF A;  2H01 A;  3GSS A;  5F06 A;  3TJG A;  1TI1 A;  1VF2 A;  1ZYN A;  3GTU A;  1AUC A;  3TJF A;  4BVX A;  1X5D A;  4G19 A;  5B6M A;  5IIZ A;  2PBJ A;  2YOI A;  3CSI A;  1T7P B;  2H8L A;  3FZ9 A;  4HDE A;  3F4T A;  4DSQ A;  1NM3 A;  3IPZ A;  2XBQ A;  2R4V A;  1Z9H A;  5ELG A;  4OMV A;  2DLX A;  4HJM A;  3P2A A;  1TJD A;  2DML A;  4ILF A;  1B4Q A;  4K2X A;  2DMM A;  2FA8 A;  4ZB6 A;  2O7K A;  3HKR A;  2H75 A;  2M80 A;  1O85 A;  1PFO A;  3CYN A;  1MDI A;  1GSS A;  1EV4 A;  5ELA A;  5KN1 A;  4PUF C;  3HJO A;  3CMI A;  4KW6 A;  1T1V A;  2FGX A;  2L6D A;  4NMU A;  1DE1 A;  3MIX A;  4AJ8 A;  1MDJ A;  1URM A;  3DXB A;  2VL3 A;  2GST A;  2L59 A;  5ECI B;  1EP8 A;  3P90 A;  3S9F A;  4I2T A;  2B5E A;  1YDK A;  4GTU A;  12GS A;  1E2Y A;  1HNA A;  1NW2 A;  4TKY A;  2HLS A;  2KUC A;  1G7E A;  2A4V A;  4EXJ A;  3TDG A;  4XS6 A;  4Z2T A;  3DRN A;  1G6Y A;  2HT9 A;  3HD5 A;  5AN1 A;  1Q4J A;  1RK4 A;  3V1W A;  2LRC A;  1X9M B;  3LYK A;  1U87 A;  3PIN A;  3VWU A;  5IMD A;  1G6W A;  2R6K A;  1GH2 A;  3M0F A;  1O6J A;  4AJ6 A;  5DDL A;  1EZK A;  4Q5Q A;  4HQZ A;  5F05 A;  4HI7 A;  1GP1 A;  2VM1 A;  1H4O A;  1A2J A;  1GSU A;  5ID2 B;  3HVV A;  6GSY A;  2O87 A;  1B9X C;  2LQQ A;  1ERU A;  4IN0 A;  3BD2 A;  3EYT A;  3L0H A;  1GNW A;  1QGV A;  4CW9 A;  3N5O A;  2DIY A;  2HRK A;  1XWG A;  4X0X A;  3CQF A;  1BQ7 A;  1MD4 A;  2IMF A;  1FOH A;  4FO5 A;  1AQW A;  4KGI A;  4EIQ A;  1GTI A;  4ZXG A;  1GUH A;  2YV9 A;  4EDY A;  5IO0 A;  4FYU A;  2AHE A;  2LJR A;  6GSS A;  3BJ5 A;  4LA1 A;  2YAN A;  4HOJ A;  1A2L A;  2I9H A;  2ZCT A;  2CVB A;  2PN8 A;  5DAK B;  1NHO A;  2A2R A;  1KTE A;  2H73 A;  1XVQ A;  2H0H A;  4HS1 A;  3D4T A;  3GNJ A;  1FVJ A;  1QXH A;  4J56 E;  2DKH A;  1IYH A;  2L4C A;  1I5G A;  4F9Z A;  2FA4 A;  5E59 A;  1XBS A;  4BA7 A;  3WD6 A;  3F63 A;  1M2B A;  2DJ2 A;  3JCM L;  4RI6 A;  1EGR A;  2B6M A;  3VK9 A;  2H0I A;  3A2V A;  4LL1 B;  2A4H A;  2F8A A;  2WGR A;  3HZ8 A;  3VWX A;  1XFL A;  2EIO A;  3C1S A;  3W8J A;  5H5R A;  1FAA A;  4RQX A;  5EPF A;  5C04 A;  3TJJ A;  1KEB A;  4Z7X A;  5KN0 A;  1K0N A;  1X0R A;  2GSR A;  2B7K A;  3NZN A;  3C7M A;  2IFQ A;  1YF0 A;  3C71 A;  4V2L A;  5D9W A;  1EOG A;  3VLN A;  4MNN A;  4BWS A;  5JCW A;  4IW9 A;  3F4S A;  1K0D A;  3KTL A;  3VPT A;  1THX A;  3TOT A;  3PR8 A;  1WE0 A;  4YQM A;  3A3T A;  3DGQ A;  3I6A A;  2WJU A;  1OC3 A;  4AGS A;  2VL2 C;  4EIP A;  3GKK A;  3ZLP A;  4WBR D;  3Q18 A;  1A24 A;  3KJY A;  3VPQ A;  4XRD A;  1G0T A;  3IHQ A;  3GFK A;  2BJX A;  2LRN A;  1UVZ A;  4I97 A;  1RW1 A;  3TRQ A;  3ZVJ D;  4O32 A;  4J2F A;  5G31 A;  3IHG A;  4Q5N A;  1PL2 A;  2YCD A;  1YEP A;  4L8E A;  2B1K A;  3M3M A;  2R37 A;  4K0G A;  4K7N A;  1XPV A;  1F6M C;  1ILO A;  1TOF A;  1HNB A;  3KMO A;  4WBJ A;  4E8E A;  2MZC A;  1K0O A;  1SL0 B;  3H4K A;  1TDI A;  3RDW A;  4L0W A;  2HI7 A;  4TXO B;  14GS A;  2LNS A;  3I69 A;  1R5P A;  2WCI A;  2C3N A;  4N30 A;  2K18 A;  2HSM A;  1WPI A;  5G30 A;  2HSH A;  3CTF A;  3M9J A;  4ULX A;  5LCZ A;  4Q5F A;  5CNW A;  4ICY A;  2YWI A;  1E6B A;  5KOX A;  2RLI A;  5ABR A;  2B5Y A;  2H71 A;  2LJK A;  4K1F A;  4TOP A;  1S3R A;  1SK2 A;  4MDC A;  5CYY A;  18GS A;  2LNT A;  2FD3 A;  5G5F A;  4NXI A;  5DAL A;  5D93 A;  2FWH A;  2CV4 A;  1M9B A;  4HEA 2;  2L57 A;  2GQL A;  5DAK A;  2X64 A;  4HUA A;  5INY A;  1F9M A;  3BOA A;  4MJE A;  2VCQ A;  3LEF A;  4EVM A;  4Z2U A;  2MBS A;  2DIZ A;  2WFC A;  1XVW A;  1B48 A;  2R0P A;  3F3R A;  4IGJ A;  1KNG A;  1BJX A;  2B3S A;  1Z6N A;  3TKQ A;  1OE8 A;  1DUG A;  2GDR A;  2GLR A;  4IKH A;  3NOF A;  4GST A;  1SKS B;  1WOU A;  4RI7 A;  3HVX A;  1ZMA A;  2K6V A;  2YWO A;  1XZO A;  5J9B A;  1ZYE A;  1XW6 A;  5IMC A;  3Q19 A;  4LLR A;  2V1M A;  4K9Z A;  4YQU A;  2PVQ A;  4K8M A;  2GS3 A;  4MA9 A;  4ISD A;  5C00 A;  1R7H A;  2EIQ A;  1JZD A;  1PD2 1;  5B7C A;  3ZTL A;  3O3T A;  5H5S A;  1UC7 A;  2KP2 A;  3F6F A;  3GRX A;  6GSV A;  3DEX A;  3IAM 2;  5BRT A;  4DEJ A;  4PUA A;  2AV4 A;  4OWY A;  3GKM A;  3IK7 A;  3F4R A;  3GH6 A;  4KX4 A;  5JWR B;  4I2U A;  2VD0 A;  3ZRE A;  6GSU A;  2LJA A;  2GZZ A;  4G10 A;  2GTU A;  1ZZY A;  2QSI A;  5ECS A;  3HHV A;  2MMZ A;  1V2A A;  3G7J A;  4EE0 A;  1V98 A;  5KEJ A;  3L9U A;  1DE2 A;  4GQC A;  3D5J A;  3LXZ A;  3ERG A;  1SJZ A;  1VRS D;  2PGT A;  1Y6E A;  5CAX A;  3ZRD A;  4ZIJ A;  2Z9S A;  3VUR A;  3FK8 A;  2C4J A;  2KLX A;  2B1L A;  4FYC A;  4TN8 A;  2DJJ A;  2N5A A;  2K8V A;  1T00 A;  2E0Q A;  1DBY A;  4PNG A;  5DQY A;  4ZB8 A;  4PQH A;  5IPH A;  4MAB A;  3IDV A;  1R26 A;  4MF6 A;  1LBK A;  2LS5 A;  2E7P A;  4USS A;  1WMJ A;  1ZYQ B;  2VM2 A;  2RUE A;  4XCS A;  2R3X A;  1MD3 A;  1VGL A;  4LMV A;  2WDU A;  5KN2 A;  1QUW A;  3LSZ A;  2H70 A;  2XPE A;  1JLV A;  3IBH A;  2YWM A;  1TTZ A;  4O92 A;  2ES7 A;  2GGT A;  5ECL B;  1SKR B;  3KP8 A;  3GL3 A;  1K0C A;  1LU4 A;  3DML A;  4ML6 A;  5A4V A;  1WRY A;  3R3E A;  3KCM A;  2DBC A;  2VCZ A;  3DYR A;  2CT6 A;  2IN3 A;  3FZA A;  1PKZ A;  5B6N A;  1W89 A;  1PA3 A;  2O8V B;  5AGY A;  3M8N A;  4BVY B;  1EV9 A;  4PXO A;  2J9H A;  2CQ9 A;  4A5P A;  2VCW A;  1GTU A;  22GS A;  3RHB A;  4GQF A;  4O5U A;  1XW5 A;  1SU9 A;  2LST A;  4XRA A;  2H6Z A;  2D2Z A;  1YZX A;  3M1G A;  5D9V A;  5HFG A;  2HYX A;  2LRT A;  4D73 B;  3F0I A;  3VWW A;  4HZ4 A;  3W8S A;  4QL7 A;  3TRP A;  2MYG A;  4JE1 A;  1T4Z A;  5EVO A;  5JWO B;  4Z2R A;  1ERV A;  1BX9 A;  2MMN A;  4KDY A;  4MF7 A;  3C1R A;  2YP6 A;  2JZS A;  1AXD A;  2HSY A;  4H86 A;  1AQV A;  4XS4 B;  3TKP A;  3RBT A;  1PQN A;  3ISO A;  1BYE A;  4CHS A;  4ECI A;  4GRF A;  4PGT A;  4LMW A;  1XW9 A;  2YJ7 A;  4OFT A;  1C72 A;  1GSY A;  2PUK C;  3RHC A;  2VUP A;  2HRF A;  3KH9 A;  3TJK A;  3HJP A;  2F51 A;  1M2A A;  4TVE A;  5J3R A;  4NHW A;  5L71 A;  3APS A;  2LV3 A;  1M3I A;  2EC4 A;  1A2M A;  3UBL A;  1XXU A;  1T3B A;  1J0F A;  2H1D A;  3RPP A;  2DJK A;  4O5Q A;  3QFB C;  5KOW A;  5IMF A;  4ACS A;  1O8W A;  4TRX A;  4POM A;  4IHU A;  4NWY A;  5LD0 A;  2PER A;  4ZL9 A;  2QGV A;  3DD3 A;  1YKC A;  2CAI A;  2I4A A;  2WS2 A;  4WXT A;  1K0A A;  4V1A p;  4IJ3 A;  4PQI A;  1YJ6 A;  1FW1 A;  2PMT A;  3IA1 A;  4KDX A;  2O85 A;  2X8H A;  3CSH A;  5GST A;  1EGO A;  4DVC A;  4K5S A;  2L5L A;  2X4A A;  1SYR A;  3EVI A;  4AJ7 A;  1AQX A;  1SL1 B;  4JZQ A;  1T4Y A;  2CVK A;  3QFA C;  1JFU A;  3MWH A;  5HR0 A;  2K8S A;  1HYU A;  4RUV A;  5EL8 A;  4MLY A;  3HY2 A;  3IC8 A;  2OBK A;  1GSQ A;  2X99 A;  3IC4 A;  2GZP A;  1TRU A;  4QQ7 A;  4J57 E;  4K0N A;  2WRT A;  2QC7 A;  1TU7 A;  3LWA A;  4EO3 A;  5A4W A;  4MP4 A;  3ZML A;  2C0F A;  3GMF A;  2GQM A;  1U3A A;  1W4V A;  1JZW A;  3E3E A;  3QOU A;  3FYG A;  4KE3 A;  2H6X A;  5DJM A;  2JSZ A;  2KOK A;  5HFK A;  3CSJ A;  4POK A;  1JZO A;  3ZIV A;  4ZBB A;  2GSS A;  2HFD A;  4F0B A;  4POL A;  2V6K A;  3F8U A;  4X1U A;  1S3D A;  5CRH A;  4JBB A;  1X5E A;  2QA2 A;  4L5L A;  1OC8 A;  4DSR A;  1X9S B;  5AIS A;  3U5R E;  1OAZ A;  3KGK A;  1MDK A;  1YF1 A;  4BVY A;  3WT2 A;  4PUR A;  2G0F A;  3H79 A;  1GSE A;  2I3Y A;  17GS A;  5GZZ B;  4HJ2 A;  3PPU A;  4YH2 A;  5EY6 A;  4G0I A;  4MJB A;  3ZFL A;  3HYP A;  1JLW A;  4OFN A;  4D73 A;  1SJ6 A;  3C73 A;  5ECK B;  5ECN B;  2OE0 A;  2R0G A;  1CQG A;  4ZB9 A;  4L0U A;  4GCI A;  2C0G A;  4MF5 A;  1AC1 A;  5COH A;  4MK3 A;  4TXV A;  1ZYP A;  1O8X A;  1Y25 A;  1YQ1 A;  3NIV A;  1TK0 B;  1TXX A;  1A0F A;  3TKS E;  4EKZ A;  3ZYW A;  3FRC A;  4NV2 A;  4XS4 A;  3KXO A;  3F6D A;  1ZL9 A;  3UEM A;  5HR1 A;  3SWL A;  3WGE A;  1M0U A;  3QCP A;  2MBT A;  2LEG A;  2NTO A;  2CZ2 A;  3EWL A;  5D8I A;  1U88 A;  2XBI A;  3ERW A;  1GSD A;  1H75 A;  2TIR A;  2B7J A;  2L6C A;  5JWQ B;  2RII A;  3QAV A;  2H74 A;  2N5F A;  5H5Q A;  1TI3 A;  1R5A A;  3UIW A;  1V58 A;  3HVN A;  3L78 A;  3GKN A;  2H30 A;  2NBS A;  2E2G A;  4K5R A;  4P3Y B;  4IJI A;  1Z7R A;  4IQ1 A;  2HRN A;  1GSF A;  3LG6 A;  3QAW A;  3UAP A;  2IIY A;  3DIE A;  3D0Z A;  3KH7 A;  2HZE B;  1OYJ A;  2LKU A;  2OKA A;  1Z3E A;  6GSW A;  2REM A;  4F2I A;  4MZB A;  3TJB A;  3MAK A;  5IO2 A;  1K3O A;  5ID2 A;  3TKR A;  3HDC A;  2O89 A;  2L4Q A;  4EF0 A;  2HE3 A;  3US3 A;  3D6I A;  3UL3 A;  2JAC A;  3TKS A;  3GUR A;  4YQV A;  3GHA A;  5IMV A;  4GXZ A;  3EU4 A;  2JZT A;  2JU5 A;  1XWA A;  2C0D A;  4IVF A;  1CQH A;  5CO3 A;  1GUK A;  4DSS B;  4TR1 B;  5CRG A;  3GYK A;  5G1L A;  2JZR A;  4NV5 A;  2R2J A;  1QQ2 A;  3GX8 A;  4WF4 A;  3IAS 2;  1Z5Y E;  2P5R A;  4HZ2 A;  1HD2 A;  2AB6 A;  4IEL A;  4OO4 A;  1EOH A;  2H1G A;  5HR3 A;  3F3Q A;  4ID0 A;  4G0K A;  3LQ7 A;  5IOX A;  2ALB A;  3UVH A;  5CRD A;  5A4U A;  4MH2 A;  2OE3 A;  2V32 A;  2B5X A;  2EIR A;  2JSY A;  4BL7 B;  2NVL A;  1USB A;  1J08 A;  5ECR B;  3PGT A;  1SK0 A;  1FG4 A;  2E2M A;  3IE3 A;  1QMV A;  3EPT A;  4MJC A;  4V2N A;  1FB0 A;  4FYB A;  4KND A;  4XTS A;  1GUM A;  2GT5 A;  3O76 A;  3OR5 A;  2X8C A;  1SL2 B;  4EUY A;  5JCG A;  5F8B A;  5F07 A;  2QKE A;  2P0G A;  2IWT A;  3Q6O A;  3QDN A;  4K6X A;  5D96 A;  4O5R A;  2F3M A;  2XPD A;  1M7T A;  4ECC A;  1KBN A;  4WF5 A;  2A2S A;  1GTA A;  3E9J B;  4YKF A;  3A2X A;  2TRC P;  3GH9 A;  4ML1 A;  3LJR A;  4FQU A;  3MDK A;  3PH9 A;  3HA9 A;  3ZMK A;  1EEJ A;  3H93 A;  1XWB A;  1GLP A;  2FWG A;  2IME A;  2VCV A;  1M9A A;  4MZC A;  4AF2 A;  2GZY A;  3BCK A;  4G2E A;  3VI5 A;  1N2A A;  1F3A A;  3FR3 A;  4GWR A;  3BBY A;  4GSN A;  4HU9 A;  3SBC A;  2M46 A;  3WYW A;  5HQP A;  5ENU A;  1TK5 B;  2YV7 A;  1V57 A;  3LW9 A;  2VLU A;  3EMP A;  2OAD A;  3IR4 A;  13GS A;  1A8L A;  1XOB A;  5IOW A;  4GSS A;  3CRT A;  3IV4 A;  3ZIT A;  4BIK A;  2VL9 A;  4I8B A;  3D22 A;  5F0G A;  3FR9 A;  5G2Z A;  5DVB A;  1MEK A;  3TOU A;  3D4M A;  4YAV A;  4X43 A;  1TW9 A;  2HZE A;  2RM5 A;  4TXO A;  1F2E A;  3Q74 A;  1Q98 A;  4KDU A;  3R2Q A;  5FWG A;  1GUL A;  2FWF A;  3TKS C;  5AIV A;  2C0E A;  4I5Q A;  4NAX A;  2DKI A;  3VI7 A;  3EU3 A;  6GST A;  1U3I A;  3UOM A;  2OAC A;  1AAZ A;  1PN0 A;  2FHE A;  2AYT A;  2IL3 A;  3KD0 A;  1JZR A;  1K0B A;  2HXK A;  3QAG A;  2A2P A;  2C3T A;  3FEU A;  3KZQ A;  2VLT A;  1V40 A;  4DSS A;  1ZCP A;  1F3B A;  4TR1 A;  2LTK A;  1NHY A;  1U6T A;  2AUV A;  5HFI A;  4ZBD A;  1SD9 A;  1M2D A;  4E8H A;  5J5N A;  2K9F A;  2RM6 A;  3ZIJ A;  2DSA A;  4NHZ A;  5CRW A;  3VFI A;  1ZGN A;  4K7O A;  1GLQ A;  2WB9 A;  5G1K A;  4OCF A;  1GL8 A;  1FB6 A;  3GN3 A;  3FZ4 A;  11GS A;  1BED A;  5DCG A;  2JAD A;  4PTS A;  4MCU A;  2HRA A;  3RPN A;  4PQ1 A;  1M99 A;  8GSS A;  4O7H A;  5LNK e;  3I9V 2;  4TW5 A;  2IFQ B;  1ON4 A;  4BL7 A;  2C1Y A;  1VF3 A;  2J23 A;  3I43 A;  4HU7 A;  4TR4 A;  4WEY A;  5ECH B;  5KN3 A;  4K2D A;  3TGZ A;  3UJ1 A;  2NDO A;  4PNF A;  5IPG A;  1DSB A;  2VIM A;  2VCT A;  2KHP A;  2M72 A;  4GLT A;  4ZL8 A;  2VL2 A;  4JED A;  4MPG A;  4KCE A;  2WZ9 A;  1WP0 A;  3DVX A;  1HNC A;  1AIU A;  5DCH A;  2LQO A;  4MPF A;  1XWC A;  4WR4 A;  3ED3 A;  1XIY A;  5J4U A;  5FHI A;  3G7Y A;  4IP1 A;  1B8X A;  1YY7 A;  1OC9 B;  2P5Q A;  1OE7 A;  3FZ5 A;  3J7Y b;  3FR6 A;  2IMI A;  2BTO T;  2FWE A;  3FMW A;  1YKA A;  19GS A;  4N10 A;  2PWJ A;  3LGC A;  3FHK A;  4N11 A;  2QA1 A;  2CVD A;  4OD7 A;  3ZZX A;  5D73 A;  3L9S A;  3TB2 A;  1N8J A;  4YAP A;  5JCU A;  2MMA A;  4KH7 A;  4CDO A;  1RQM A;  1FO5 A;  2F8F A;  1ZOF A;  1PX7 A;  3A2W A;  4CY6 A;  4MH3 A;  4JR6 A;  3GX0 A;  3J7Y k;  4G0L A;  1K3Y A;  3HZ4 A;  1PMT A;  1TRW A;  2YZH A;  5J9C A;  4TR3 A;  3EIN A;  1OKT A;  1SEN A;  2GQK A;  1OKD A;  3EC3 A;  3KP9 A;  4EDZ A;  2IPA A;  4RQR A;  2R5G A;  3DKS A;  3GV1 A;  1FVK A;  1SYX A;  4F82 A;  4XHM A;  1UN2 A;  4KCA A;  3WGD A;  4NPB A;  3ERF A;  1T8E B;  2FY6 A;  3QPM A;  4N0V A;  2FLS A;  4BPY A;  7GSS A;  2I1U A;  2YNX A;  4Q5R A;  3QMX A;  2DJ3 A;  5DAL B;  2L5O A;  2CA8 A;  4MJA A;  5DJL A;  3H1N A;  4MZW A;  4KA0 A;  5BMU A;  5GAN D;  3CRU A;  1B9Y C;  5J41 A;  2KP1 A;  2G2Q A;  2FCH A;  1WWJ A;  1J9B A;  3KMN A;  3P7X A;  2ON5 A;  1YEX A;  3P8W A;  5DBQ A;  2N5B A;  3ME8 A;  2V6O A;  4TR0 A;  3IK9 A;  1A23 A;  1O81 A;  2CX3 A;  1B4P A;  3O6T A;  3G9B A;  3TCO A;  2V2G A;  1TRS A;  2VAF A;  2OJL A;  3UAR A;  1FHE A;  1PX6 A;  3GKX A;  4IBP A;  2I81 A;  3RAZ A;  2DJ0 A;  3A5W A;  5D9X A;  2H6Y A;  1WIK A;  4PX1 A;  3D21 A;  2H72 A;  1X5C A;  1O73 A;  3LYP A;  3VWV A;  5ECO B;  1FOV A;  3TRX A;  1TK8 B;  1UA5 A;  1TP9 A;  4G9H A;  1O7U A;  1Z6M A;  4K7I A;  2IJY A;  9GSS A;  2CX4 A;  4ECB A;  4WET A;  3L9V A;  3IRA A;  2GSQ A;  1WJK A;  3F9U A;  1TRV A;  5B8B A;  3GA4 A;  4LL4 B;  3KIJ A;  1BG5 A;  2LUS A;  1THO A;  5A5K A;  5AIX A;  2P31 A;  4ZBA A;  3TUE A;  4JR4 A;  2ZUP A;  2OE1 A;  1VF1 A;  3HXS A;  2AJQ B;  4WKW A;  3GST A;  3W6G A;  5FT3 A;  6GSX A;  2FUG 2;  3FY7 A;  3UMA A;  2ZNM A;  1GTB A;  4HQS A;  1OC9 A;  2YWN A;  4IQA A;  2H0G A;  2IMK A;  2R0C A;  2GT6 A;  4MMM A;  3KTB A;  5DQS A;  3EMX A;  4V2M A;  4EC0 A;  5CP1 A;  3LFL A;  1BAY A;  3ZFB A;  1V9W A;  3LXT A;  2GVP A;  2ON7 A;  3QR6 A;  1ABA A;  1S3C A;  1K3L A;  2H19 A;  1HQO A;  3APQ A;  5ECP B;  4JU5 A;  2FNO A;  2H66 A;  16GS A;  3U6V A;  5GSS A;  3E0U A;  1AW9 A;  2XC2 A;  1A8Y A;  3EUR A;  3LOR A;  2UZ8 A;  4YKG A;  2YJH A;  3ME7 A;  3GTU B;  4KSM A;  4BVX B;  4N0Z A;  2VD1 A;  2TRX A;  3BCI A;  3C8E A;  1TKD B;  5G5E A;  4ZL7 A;  4BWQ A;  1SK1 A;  2DJ1 A;  1S3A A;  1XCC A;  2V41 A;  1PGT A;  4GF0 A;  4ZIL A;  1QK8 A;  4V1A g;  2PVO C;  1Z7P A;  1G7O A;  4XS1 A;  2YN1 A;  1GWC A;  5ECQ B;  1GRX A;  5CRE A;  4WR5 A;  5HR2 A;  3GL5 A;  1ML6 A;  2OBI A;  1M3J A;  3KM6 A;  1QFN A;  5IQY A;  3WGX A;  3ZL5 A;  1PKW A;  3GUS A;  2OA7 A;  4I6X A;  2H76 A;  1A0R P;  4X4J A;  2NPB A;  2MMO A;  3MYD A;  2AAW A; 
#chains in the Genus database with same CATH homology
 1MTC A;  4KF9 A;  3HJM A;  3FKF A;  1ERW A;  3MSZ A;  1EP7 A;  1GNE A;  1SJI A;  2VCX A;  4KSO A;  1EWX A;  3A5I A;  1R4W A;  3CBU A;  4KUN A;  4F0C A;  2F9S A;  5D9T A;  5IMA A;  1OVN A;  2BMX A;  2H1A A;  3L4N A;  1I9D A;  1TU8 A;  4QL9 A;  1X9W B;  4KAE A;  3CXG A;  1IYI A;  5IMZ A;  2C80 A;  2CAQ A;  5ECM B;  3HCZ A;  2YZU A;  1EEM A;  3DWV A;  2YPM A;  4POB A;  2H1B A;  1NSW A;  2DC5 A;  2IMD A;  3N9J A;  2HZF A;  1ERT A;  4IP6 A;  2XHF A;  3UBK A;  2VO4 A;  4JRR A;  3EE2 A;  1PN9 A;  3IOS A;  3DVW A;  3APO A;  5B8A A;  1LJR A;  2JL4 A;  20GS A;  4OO5 A;  2X49 A;  2C3Q A;  2X8G A;  1JHB A;  4OCE A;  2VOC A;  2C8U A;  2WUL A;  1K0M A;  3M9K A;  4FIW A;  1PSQ A;  1SD8 A;  3K8N A;  3KEB A;  4OFM A;  1SKW B;  4CY8 A;  1PRX A;  4L5O A;  4KB3 A;  3H8Q A;  1PL1 A;  2PPT A;  3ZVJ A;  1XOA A;  4ECJ A;  4EL1 A;  5GAP D;  1F37 A;  1ACV A;  10GS A;  3MNG A;  3GIX A;  2VLV A;  3IXR A;  1ST9 A;  4FH8 A;  3WT1 A;  4XIH A;  2CZ3 A;  4IS0 A;  3QD9 A;  1XWK A;  3HVS A;  2HNL A;  5IM9 A;  4F03 A;  5E4W A;  1VF4 A;  2PU9 C;  3G7I A;  3FW2 A;  3UVT A;  3CTG A;  3AY8 A;  2RUF A;  2H01 A;  3GSS A;  5F06 A;  3TJG A;  1TI1 A;  1VF2 A;  1ZYN A;  3GTU A;  1AUC A;  3TJF A;  4BVX A;  1X5D A;  4G19 A;  5B6M A;  5IIZ A;  2PBJ A;  2YOI A;  3CSI A;  1T7P B;  2H8L A;  3FZ9 A;  4HDE A;  3F4T A;  4DSQ A;  1NM3 A;  3IPZ A;  2XBQ A;  2R4V A;  1Z9H A;  5ELG A;  4OMV A;  2DLX A;  4HJM A;  3P2A A;  1TJD A;  2DML A;  4ILF A;  1B4Q A;  4K2X A;  2DMM A;  2FA8 A;  4ZB6 A;  2O7K A;  3HKR A;  2H75 A;  2M80 A;  1O85 A;  3CYN A;  1MDI A;  1GSS A;  1EV4 A;  5ELA A;  5KN1 A;  4PUF C;  3HJO A;  3CMI A;  4KW6 A;  1T1V A;  2FGX A;  2L6D A;  4NMU A;  1DE1 A;  3MIX A;  4AJ8 A;  1MDJ A;  1URM A;  3DXB A;  2VL3 A;  2GST A;  2L59 A;  5ECI B;  1EP8 A;  3P90 A;  3S9F A;  4I2T A;  2B5E A;  1YDK A;  4GTU A;  12GS A;  1E2Y A;  1HNA A;  1NW2 A;  4TKY A;  2HLS A;  2KUC A;  1G7E A;  2A4V A;  4EXJ A;  3TDG A;  4XS6 A;  4Z2T A;  3DRN A;  1G6Y A;  2HT9 A;  3HD5 A;  5AN1 A;  1Q4J A;  1RK4 A;  3V1W A;  2LRC A;  1X9M B;  3LYK A;  1U87 A;  3PIN A;  3VWU A;  5IMD A;  1G6W A;  2R6K A;  1GH2 A;  3M0F A;  1O6J A;  4AJ6 A;  5DDL A;  1EZK A;  4Q5Q A;  4HQZ A;  5F05 A;  4HI7 A;  1GP1 A;  2VM1 A;  1H4O A;  1A2J A;  1GSU A;  5ID2 B;  3HVV A;  6GSY A;  2O87 A;  1B9X C;  2LQQ A;  1ERU A;  4IN0 A;  3BD2 A;  3EYT A;  3L0H A;  1GNW A;  1QGV A;  4CW9 A;  3N5O A;  2DIY A;  2HRK A;  1XWG A;  4X0X A;  1BQ7 A;  1MD4 A;  2IMF A;  1FOH A;  4FO5 A;  1AQW A;  4KGI A;  4EIQ A;  1GTI A;  4ZXG A;  1GUH A;  2YV9 A;  4EDY A;  5IO0 A;  4FYU A;  2AHE A;  2LJR A;  6GSS A;  3BJ5 A;  4LA1 A;  2YAN A;  4HOJ A;  1A2L A;  2I9H A;  2ZCT A;  2CVB A;  2PN8 A;  5DAK B;  1NHO A;  2A2R A;  1KTE A;  2H73 A;  1XVQ A;  2H0H A;  4HS1 A;  3D4T A;  3GNJ A;  1FVJ A;  1QXH A;  4J56 E;  2DKH A;  1IYH A;  2L4C A;  1I5G A;  4F9Z A;  2FA4 A;  5E59 A;  1XBS A;  4BA7 A;  3WD6 A;  3F63 A;  1M2B A;  2DJ2 A;  3JCM L;  4RI6 A;  1EGR A;  2B6M A;  3VK9 A;  2H0I A;  3A2V A;  4LL1 B;  2A4H A;  2F8A A;  2WGR A;  3HZ8 A;  3VWX A;  1XFL A;  2EIO A;  3C1S A;  3W8J A;  5H5R A;  1FAA A;  4RQX A;  5EPF A;  5C04 A;  3TJJ A;  1KEB A;  4Z7X A;  5KN0 A;  1K0N A;  1X0R A;  2GSR A;  2B7K A;  3NZN A;  3C7M A;  2IFQ A;  1YF0 A;  3C71 A;  4V2L A;  5D9W A;  1EOG A;  3VLN A;  4MNN A;  4BWS A;  5JCW A;  4IW9 A;  3F4S A;  1K0D A;  3KTL A;  3VPT A;  1THX A;  3TOT A;  3PR8 A;  1WE0 A;  4YQM A;  3A3T A;  3DGQ A;  3I6A A;  2WJU A;  1OC3 A;  4AGS A;  2VL2 C;  4EIP A;  3GKK A;  3ZLP A;  4WBR D;  3Q18 A;  1A24 A;  3KJY A;  3VPQ A;  4XRD A;  1G0T A;  3IHQ A;  3GFK A;  2BJX A;  2LRN A;  1UVZ A;  4I97 A;  1RW1 A;  3TRQ A;  3ZVJ D;  4O32 A;  4J2F A;  5G31 A;  3IHG A;  4Q5N A;  1PL2 A;  2YCD A;  1YEP A;  4L8E A;  2B1K A;  3M3M A;  2R37 A;  4K0G A;  4K7N A;  1XPV A;  1F6M C;  1ILO A;  1TOF A;  1HNB A;  3KMO A;  4WBJ A;  4E8E A;  2MZC A;  1K0O A;  1SL0 B;  3H4K A;  1TDI A;  3RDW A;  4L0W A;  2HI7 A;  4TXO B;  14GS A;  2LNS A;  3I69 A;  1R5P A;  2WCI A;  2C3N A;  4N30 A;  2K18 A;  2HSM A;  1WPI A;  5G30 A;  2HSH A;  3CTF A;  3M9J A;  4ULX A;  5LCZ A;  4Q5F A;  5CNW A;  4ICY A;  2YWI A;  1E6B A;  5KOX A;  2RLI A;  5ABR A;  2B5Y A;  2H71 A;  2LJK A;  4K1F A;  4TOP A;  1SK2 A;  4MDC A;  5CYY A;  18GS A;  2LNT A;  2FD3 A;  5G5F A;  4NXI A;  5DAL A;  5D93 A;  2FWH A;  2CV4 A;  1M9B A;  4HEA 2;  2L57 A;  2GQL A;  5DAK A;  2X64 A;  4HUA A;  5INY A;  1F9M A;  3BOA A;  4MJE A;  2VCQ A;  3LEF A;  4EVM A;  4Z2U A;  2MBS A;  2DIZ A;  2WFC A;  1XVW A;  1B48 A;  2R0P A;  3F3R A;  4IGJ A;  1KNG A;  1BJX A;  2B3S A;  1Z6N A;  3TKQ A;  1OE8 A;  1DUG A;  2GDR A;  2GLR A;  4IKH A;  3NOF A;  4GST A;  1SKS B;  1WOU A;  4RI7 A;  3HVX A;  1ZMA A;  2K6V A;  2YWO A;  1XZO A;  5J9B A;  1ZYE A;  1XW6 A;  5IMC A;  3Q19 A;  4LLR A;  2V1M A;  4K9Z A;  4YQU A;  2PVQ A;  4K8M A;  2GS3 A;  4MA9 A;  4ISD A;  5C00 A;  1R7H A;  2EIQ A;  1JZD A;  1PD2 1;  5B7C A;  3ZTL A;  3O3T A;  5H5S A;  1UC7 A;  2KP2 A;  3F6F A;  3GRX A;  6GSV A;  3DEX A;  3IAM 2;  5BRT A;  4DEJ A;  4PUA A;  2AV4 A;  4OWY A;  3GKM A;  3IK7 A;  3F4R A;  3GH6 A;  4KX4 A;  5JWR B;  4I2U A;  2VD0 A;  3ZRE A;  6GSU A;  2LJA A;  2GZZ A;  4G10 A;  2GTU A;  1ZZY A;  2QSI A;  5ECS A;  3HHV A;  2MMZ A;  1V2A A;  3G7J A;  4EE0 A;  1V98 A;  5KEJ A;  3L9U A;  1DE2 A;  4GQC A;  3D5J A;  3LXZ A;  3ERG A;  1SJZ A;  1VRS D;  2PGT A;  1Y6E A;  5CAX A;  3ZRD A;  4ZIJ A;  2Z9S A;  3VUR A;  3FK8 A;  2C4J A;  2KLX A;  2B1L A;  4FYC A;  4TN8 A;  2DJJ A;  2N5A A;  2K8V A;  1T00 A;  2E0Q A;  1DBY A;  4PNG A;  5DQY A;  4ZB8 A;  4PQH A;  5IPH A;  4MAB A;  3IDV A;  1R26 A;  4MF6 A;  1LBK A;  2LS5 A;  2E7P A;  4USS A;  1WMJ A;  1ZYQ B;  2VM2 A;  2RUE A;  4XCS A;  2R3X A;  1MD3 A;  1VGL A;  4LMV A;  2WDU A;  5KN2 A;  1QUW A;  3LSZ A;  2H70 A;  2XPE A;  1JLV A;  3IBH A;  2YWM A;  1TTZ A;  4O92 A;  2ES7 A;  2GGT A;  5ECL B;  1SKR B;  3KP8 A;  3GL3 A;  1K0C A;  1LU4 A;  3DML A;  4ML6 A;  5A4V A;  1WRY A;  3R3E A;  3KCM A;  2DBC A;  2VCZ A;  3DYR A;  2CT6 A;  2IN3 A;  3FZA A;  1PKZ A;  5B6N A;  1W89 A;  1PA3 A;  2O8V B;  5AGY A;  3M8N A;  4BVY B;  1EV9 A;  4PXO A;  2J9H A;  2CQ9 A;  4A5P A;  2VCW A;  1GTU A;  22GS A;  3RHB A;  4GQF A;  4O5U A;  1XW5 A;  1SU9 A;  2LST A;  4XRA A;  2H6Z A;  2D2Z A;  1YZX A;  3M1G A;  5D9V A;  5HFG A;  2HYX A;  2LRT A;  4D73 B;  3F0I A;  3VWW A;  4HZ4 A;  3W8S A;  4QL7 A;  3TRP A;  2MYG A;  4JE1 A;  1T4Z A;  5EVO A;  5JWO B;  4Z2R A;  1ERV A;  1BX9 A;  2MMN A;  4KDY A;  4MF7 A;  3C1R A;  2YP6 A;  2JZS A;  1AXD A;  2HSY A;  4H86 A;  1AQV A;  4XS4 B;  3TKP A;  3RBT A;  1PQN A;  3ISO A;  1BYE A;  4CHS A;  4ECI A;  4GRF A;  4PGT A;  4LMW A;  1XW9 A;  2YJ7 A;  4OFT A;  1C72 A;  1GSY A;  2PUK C;  3RHC A;  2VUP A;  2HRF A;  3KH9 A;  3TJK A;  3HJP A;  2F51 A;  1M2A A;  4TVE A;  5J3R A;  4NHW A;  5L71 A;  3APS A;  2LV3 A;  2EC4 A;  1A2M A;  3UBL A;  1XXU A;  1T3B A;  1J0F A;  2H1D A;  3RPP A;  2DJK A;  4O5Q A;  3QFB C;  5KOW A;  5IMF A;  4ACS A;  1O8W A;  4TRX A;  4POM A;  4IHU A;  4NWY A;  5LD0 A;  2PER A;  4ZL9 A;  2QGV A;  3DD3 A;  1YKC A;  2CAI A;  2I4A A;  2WS2 A;  4WXT A;  1K0A A;  4V1A p;  4IJ3 A;  4PQI A;  1YJ6 A;  1FW1 A;  2PMT A;  3IA1 A;  4KDX A;  2O85 A;  2X8H A;  3CSH A;  5GST A;  1EGO A;  4DVC A;  4K5S A;  2L5L A;  2X4A A;  1SYR A;  3EVI A;  4AJ7 A;  1AQX A;  1SL1 B;  4JZQ A;  1T4Y A;  2CVK A;  3QFA C;  1JFU A;  3MWH A;  5HR0 A;  2K8S A;  1HYU A;  4RUV A;  5EL8 A;  4MLY A;  3HY2 A;  3IC8 A;  2OBK A;  1GSQ A;  2X99 A;  3IC4 A;  2GZP A;  1TRU A;  4QQ7 A;  4J57 E;  4K0N A;  2WRT A;  2QC7 A;  1TU7 A;  3LWA A;  4EO3 A;  5A4W A;  4MP4 A;  3ZML A;  2C0F A;  3GMF A;  2GQM A;  1U3A A;  1W4V A;  1JZW A;  3E3E A;  3QOU A;  3FYG A;  4KE3 A;  2H6X A;  5DJM A;  2JSZ A;  2KOK A;  5HFK A;  3CSJ A;  4POK A;  1JZO A;  3ZIV A;  4ZBB A;  2GSS A;  2HFD A;  4F0B A;  4POL A;  2V6K A;  3F8U A;  4X1U A;  1S3D A;  5CRH A;  4JBB A;  1X5E A;  2QA2 A;  4L5L A;  1OC8 A;  4DSR A;  1X9S B;  5AIS A;  3U5R E;  1OAZ A;  3KGK A;  1MDK A;  1YF1 A;  4BVY A;  3WT2 A;  4PUR A;  2G0F A;  3H79 A;  1GSE A;  2I3Y A;  17GS A;  5GZZ B;  4HJ2 A;  3PPU A;  4YH2 A;  5EY6 A;  4G0I A;  4MJB A;  3ZFL A;  3HYP A;  1JLW A;  4OFN A;  4D73 A;  1SJ6 A;  3C73 A;  5ECK B;  5ECN B;  2OE0 A;  2R0G A;  1CQG A;  4ZB9 A;  4L0U A;  4GCI A;  2C0G A;  4MF5 A;  1AC1 A;  5COH A;  4MK3 A;  4TXV A;  1ZYP A;  1O8X A;  1Y25 A;  1YQ1 A;  3NIV A;  1TK0 B;  1TXX A;  1A0F A;  3TKS E;  4EKZ A;  3ZYW A;  3FRC A;  4NV2 A;  4XS4 A;  3KXO A;  3F6D A;  1ZL9 A;  3UEM A;  5HR1 A;  3SWL A;  3WGE A;  1M0U A;  3QCP A;  2MBT A;  2LEG A;  2NTO A;  2CZ2 A;  3EWL A;  5D8I A;  1U88 A;  2XBI A;  3ERW A;  1GSD A;  1H75 A;  2TIR A;  2B7J A;  2L6C A;  5JWQ B;  2RII A;  3QAV A;  2H74 A;  2N5F A;  5H5Q A;  1TI3 A;  1R5A A;  3UIW A;  1V58 A;  3L78 A;  3GKN A;  2H30 A;  2NBS A;  2E2G A;  4K5R A;  4P3Y B;  4IJI A;  1Z7R A;  4IQ1 A;  2HRN A;  1GSF A;  3LG6 A;  3QAW A;  3UAP A;  2IIY A;  3DIE A;  3D0Z A;  3KH7 A;  2HZE B;  1OYJ A;  2LKU A;  2OKA A;  1Z3E A;  6GSW A;  2REM A;  4F2I A;  4MZB A;  3TJB A;  3MAK A;  5IO2 A;  1K3O A;  5ID2 A;  3TKR A;  3HDC A;  2O89 A;  2L4Q A;  4EF0 A;  2HE3 A;  3US3 A;  3D6I A;  3UL3 A;  2JAC A;  3TKS A;  3GUR A;  4YQV A;  3GHA A;  5IMV A;  4GXZ A;  3EU4 A;  2JZT A;  2JU5 A;  1XWA A;  2C0D A;  4IVF A;  1CQH A;  5CO3 A;  1GUK A;  4DSS B;  4TR1 B;  5CRG A;  3GYK A;  5G1L A;  2JZR A;  4NV5 A;  2R2J A;  1QQ2 A;  3GX8 A;  4WF4 A;  3IAS 2;  1Z5Y E;  2P5R A;  4HZ2 A;  1HD2 A;  2AB6 A;  4IEL A;  4OO4 A;  1EOH A;  2H1G A;  5HR3 A;  3F3Q A;  4ID0 A;  4G0K A;  3LQ7 A;  5IOX A;  2ALB A;  3UVH A;  5CRD A;  5A4U A;  4MH2 A;  2OE3 A;  2V32 A;  2B5X A;  2EIR A;  2JSY A;  4BL7 B;  2NVL A;  1USB A;  1J08 A;  5ECR B;  3PGT A;  1SK0 A;  1FG4 A;  2E2M A;  3IE3 A;  1QMV A;  3EPT A;  4MJC A;  4V2N A;  1FB0 A;  4FYB A;  4KND A;  4XTS A;  1GUM A;  2GT5 A;  3O76 A;  3OR5 A;  2X8C A;  1SL2 B;  4EUY A;  5JCG A;  5F8B A;  5F07 A;  2QKE A;  2P0G A;  2IWT A;  3Q6O A;  3QDN A;  4K6X A;  5D96 A;  4O5R A;  2F3M A;  2XPD A;  1M7T A;  4ECC A;  1KBN A;  4WF5 A;  2A2S A;  1GTA A;  3E9J B;  4YKF A;  3A2X A;  2TRC P;  3GH9 A;  4ML1 A;  3LJR A;  4FQU A;  3MDK A;  3PH9 A;  3HA9 A;  3ZMK A;  1EEJ A;  3H93 A;  1XWB A;  1GLP A;  2FWG A;  2IME A;  2VCV A;  1M9A A;  4MZC A;  4AF2 A;  2GZY A;  3BCK A;  4G2E A;  3VI5 A;  1N2A A;  1F3A A;  3FR3 A;  4GWR A;  3BBY A;  4GSN A;  4HU9 A;  3SBC A;  2M46 A;  3WYW A;  5HQP A;  5ENU A;  1TK5 B;  2YV7 A;  1V57 A;  3LW9 A;  2VLU A;  3EMP A;  2OAD A;  3IR4 A;  13GS A;  1A8L A;  1XOB A;  5IOW A;  4GSS A;  3CRT A;  3IV4 A;  3ZIT A;  2VL9 A;  4I8B A;  3D22 A;  5F0G A;  3FR9 A;  5G2Z A;  5DVB A;  1MEK A;  3TOU A;  3D4M A;  4YAV A;  4X43 A;  1TW9 A;  2HZE A;  2RM5 A;  4TXO A;  1F2E A;  3Q74 A;  1Q98 A;  4KDU A;  3R2Q A;  5FWG A;  1GUL A;  2FWF A;  3TKS C;  5AIV A;  2C0E A;  4I5Q A;  4NAX A;  2DKI A;  3VI7 A;  3EU3 A;  6GST A;  1U3I A;  3UOM A;  2OAC A;  1AAZ A;  1PN0 A;  2FHE A;  2AYT A;  2IL3 A;  3KD0 A;  1JZR A;  1K0B A;  2HXK A;  3QAG A;  2A2P A;  2C3T A;  3FEU A;  3KZQ A;  2VLT A;  1V40 A;  4DSS A;  1ZCP A;  1F3B A;  4TR1 A;  2LTK A;  1NHY A;  1U6T A;  2AUV A;  5HFI A;  4ZBD A;  1SD9 A;  1M2D A;  4E8H A;  5J5N A;  2K9F A;  2RM6 A;  3ZIJ A;  2DSA A;  4NHZ A;  5CRW A;  3VFI A;  1ZGN A;  4K7O A;  1GLQ A;  2WB9 A;  5G1K A;  4OCF A;  1GL8 A;  1FB6 A;  3GN3 A;  3FZ4 A;  11GS A;  1BED A;  5DCG A;  2JAD A;  4PTS A;  4MCU A;  2HRA A;  3RPN A;  4PQ1 A;  1M99 A;  8GSS A;  4O7H A;  5LNK e;  3I9V 2;  4TW5 A;  2IFQ B;  1ON4 A;  4BL7 A;  2C1Y A;  1VF3 A;  2J23 A;  3I43 A;  4HU7 A;  4TR4 A;  4WEY A;  5ECH B;  5KN3 A;  4K2D A;  3TGZ A;  3UJ1 A;  2NDO A;  4PNF A;  5IPG A;  1DSB A;  2VIM A;  2VCT A;  2KHP A;  2M72 A;  4GLT A;  4ZL8 A;  2VL2 A;  4JED A;  4MPG A;  4KCE A;  2WZ9 A;  1WP0 A;  3DVX A;  1HNC A;  1AIU A;  5DCH A;  2LQO A;  4MPF A;  1XWC A;  4WR4 A;  3ED3 A;  1XIY A;  5J4U A;  5FHI A;  3G7Y A;  4IP1 A;  1B8X A;  1YY7 A;  1OC9 B;  2P5Q A;  1OE7 A;  3FZ5 A;  3J7Y b;  3FR6 A;  2IMI A;  2BTO T;  2FWE A;  3FMW A;  1YKA A;  19GS A;  4N10 A;  2PWJ A;  3LGC A;  3FHK A;  4N11 A;  2QA1 A;  2CVD A;  4OD7 A;  3ZZX A;  5D73 A;  3L9S A;  3TB2 A;  1N8J A;  4YAP A;  5JCU A;  2MMA A;  4KH7 A;  4CDO A;  1RQM A;  1FO5 A;  2F8F A;  1ZOF A;  1PX7 A;  3A2W A;  4CY6 A;  4MH3 A;  4JR6 A;  3GX0 A;  3J7Y k;  4G0L A;  1K3Y A;  3HZ4 A;  1PMT A;  1TRW A;  2YZH A;  5J9C A;  4TR3 A;  3EIN A;  1OKT A;  1SEN A;  2GQK A;  1OKD A;  3EC3 A;  3KP9 A;  4EDZ A;  2IPA A;  4RQR A;  2R5G A;  3DKS A;  3GV1 A;  1FVK A;  1SYX A;  4F82 A;  4XHM A;  1UN2 A;  4KCA A;  3WGD A;  4NPB A;  3ERF A;  1T8E B;  2FY6 A;  3QPM A;  4N0V A;  2FLS A;  4BPY A;  7GSS A;  2I1U A;  2YNX A;  4Q5R A;  3QMX A;  2DJ3 A;  5DAL B;  2L5O A;  2CA8 A;  4MJA A;  5DJL A;  3H1N A;  4MZW A;  4KA0 A;  5BMU A;  5GAN D;  3CRU A;  1B9Y C;  5J41 A;  2KP1 A;  2G2Q A;  2FCH A;  1WWJ A;  1J9B A;  3KMN A;  3P7X A;  2ON5 A;  1YEX A;  3P8W A;  5DBQ A;  2N5B A;  3ME8 A;  2V6O A;  4TR0 A;  3IK9 A;  1A23 A;  1O81 A;  2CX3 A;  1B4P A;  3O6T A;  3G9B A;  3TCO A;  2V2G A;  1TRS A;  2VAF A;  2OJL A;  3UAR A;  1FHE A;  1PX6 A;  3GKX A;  4IBP A;  2I81 A;  3RAZ A;  2DJ0 A;  3A5W A;  5D9X A;  2H6Y A;  1WIK A;  4PX1 A;  3D21 A;  2H72 A;  1X5C A;  1O73 A;  3LYP A;  3VWV A;  5ECO B;  1FOV A;  3TRX A;  1TK8 B;  1UA5 A;  1TP9 A;  4G9H A;  1O7U A;  1Z6M A;  4K7I A;  2IJY A;  9GSS A;  2CX4 A;  4ECB A;  4WET A;  3L9V A;  3IRA A;  2GSQ A;  1WJK A;  3F9U A;  1TRV A;  5B8B A;  3GA4 A;  4LL4 B;  3KIJ A;  1BG5 A;  2LUS A;  1THO A;  5A5K A;  5AIX A;  2P31 A;  4ZBA A;  3TUE A;  4JR4 A;  2ZUP A;  2OE1 A;  1VF1 A;  3HXS A;  2AJQ B;  4WKW A;  3GST A;  3W6G A;  5FT3 A;  6GSX A;  2FUG 2;  3FY7 A;  3UMA A;  2ZNM A;  1GTB A;  4HQS A;  1OC9 A;  2YWN A;  4IQA A;  2H0G A;  2IMK A;  2R0C A;  2GT6 A;  4MMM A;  3KTB A;  5DQS A;  3EMX A;  4V2M A;  4EC0 A;  5CP1 A;  3LFL A;  1BAY A;  3ZFB A;  1V9W A;  3LXT A;  2GVP A;  2ON7 A;  3QR6 A;  1ABA A;  1S3C A;  1K3L A;  2H19 A;  1HQO A;  3APQ A;  5ECP B;  4JU5 A;  2FNO A;  2H66 A;  16GS A;  3U6V A;  5GSS A;  3E0U A;  1AW9 A;  2XC2 A;  1A8Y A;  3EUR A;  3LOR A;  2UZ8 A;  4YKG A;  2YJH A;  3ME7 A;  3GTU B;  4KSM A;  4BVX B;  4N0Z A;  2VD1 A;  2TRX A;  3BCI A;  3C8E A;  1TKD B;  5G5E A;  4ZL7 A;  4BWQ A;  1SK1 A;  2DJ1 A;  1S3A A;  1XCC A;  2V41 A;  1PGT A;  4GF0 A;  4ZIL A;  1QK8 A;  4V1A g;  2PVO C;  1Z7P A;  1G7O A;  4XS1 A;  2YN1 A;  1GWC A;  5ECQ B;  1GRX A;  5CRE A;  4WR5 A;  5HR2 A;  3GL5 A;  1ML6 A;  2OBI A;  3KM6 A;  1QFN A;  5IQY A;  3WGX A;  3ZL5 A;  1PKW A;  3GUS A;  2OA7 A;  4I6X A;  2H76 A;  1A0R P;  4X4J A;  2NPB A;  2MMO A;  3MYD A;  2AAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...